data_2J4F
# 
_entry.id   2J4F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2J4F         
PDBE  EBI-29863    
WWPDB D_1290029863 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2J4F 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kreimer, D.I.'   1 
'Dolginova, E.A.' 2 
'Raves, M.'       3 
'Sussman, J.L.'   4 
'Silman, I.'      5 
'Weiner, L.'      6 
# 
_citation.id                        primary 
_citation.title                     
'A Metastable State of Torpedo Californica Acetylcholinesterase Generated by Modification with Organomercurials' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            33 
_citation.page_first                14407 
_citation.page_last                 ? 
_citation.year                      1994 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7981200 
_citation.pdbx_database_id_DOI      10.1021/BI00252A006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kreimer, D.I.'   1 ? 
primary 'Dolginova, E.A.' 2 ? 
primary 'Raves, M.'       3 ? 
primary 'Sussman, J.L.'   4 ? 
primary 'Silman, I.'      5 ? 
primary 'Weiner, L.'      6 ? 
# 
_cell.entry_id           2J4F 
_cell.length_a           110.700 
_cell.length_b           110.700 
_cell.length_c           135.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2J4F 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE 61325.090 1  3.1.1.7 ? 'RESIDUES 22-564' ? 
2 non-polymer syn 'MERCURY (II) ION'   200.590   2  ?       ? ?                 ? 
3 water       nat water                18.015    94 ?       ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2J4F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HG  non-polymer         . 'MERCURY (II) ION' ? 'Hg 2'           200.590 
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2J4F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.05 
_exptl_crystal.density_percent_sol   69.39 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS MULTIWIRE' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2J4F 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   23445 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            0.11000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        44.9 
_reflns.pdbx_redundancy              3.700 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2J4F 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19872 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               3966972 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    86.5 
_refine.ls_R_factor_obs                          0.204 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.7 
_refine.ls_number_reflns_R_free                  1935 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               29.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2J4F 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.44 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.55 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4115 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             94 
_refine_hist.number_atoms_total               4211 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.6  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.28  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.62  1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.57  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.5   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            3.65  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.8 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.292 
_refine_ls_shell.percent_reflns_obs               64.8 
_refine_ls_shell.R_factor_R_free                  0.391 
_refine_ls_shell.R_factor_R_free_error            0.025 
_refine_ls_shell.percent_reflns_R_free            9.7 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARAM19X.PRO 
_pdbx_xplor_file.topol_file       TOPH19X.PRO 
# 
_struct.entry_id                  2J4F 
_struct.title                     'Torpedo acetylcholinesterase - Hg heavy-atom derivative' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2J4F 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, NEUROTRANSMITTER DEGRADATION, NEUROTRANSMITTER CLEAVAGE, ALTERNATIVE SPLICING, ALPHA-BETA HYDROLASE, SERINE ESTERASE, SERINE HYDROLASE, CATALYTIC TRIAD, LIPOPROTEIN, GLYCOPROTEIN, CHOLINESTERASE, SYNAPSE, MEMBRANE, GPI-ANCHOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P5  5  GLY A 151 ? LEU A 156 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  CYS A 231 ? SER A 235 ? CYS A 231 SER A 235 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P14 14 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P15 15 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P16 16 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P17 17 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P18 18 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P19 19 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P20 20 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P21 21 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P22 22 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P23 23 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 24 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 25 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67   A CYS 94   1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf2 disulf ? ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254  A CYS 265  1_555 ? ? ? ? ? ? ? 2.018 ? ? 
disulf3 disulf ? ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402  A CYS 521  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc1 metalc ? ? A GLU 139 OE1 ? ? ? 1_555 B HG  .   HG ? ? A GLU 139  A HG  1536 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc2 metalc ? ? A GLU 139 OE2 ? ? ? 1_555 B HG  .   HG ? ? A GLU 139  A HG  1536 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc3 metalc ? ? A SER 228 OG  ? ? ? 1_555 C HG  .   HG ? ? A SER 228  A HG  1537 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc4 metalc ? ? A SER 228 N   ? ? ? 1_555 C HG  .   HG ? ? A SER 228  A HG  1537 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc5 metalc ? ? A SER 228 O   ? ? ? 1_555 C HG  .   HG ? ? A SER 228  A HG  1537 1_555 ? ? ? ? ? ? ? 2.349 ? ? 
metalc6 metalc ? ? A CYS 231 SG  ? ? ? 1_555 C HG  .   HG ? ? A CYS 231  A HG  1537 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc7 metalc ? ? A HIS 471 ND1 ? ? ? 1_555 B HG  .   HG ? ? A HIS 471  A HG  1536 1_555 ? ? ? ? ? ? ? 1.694 ? ? 
metalc8 metalc ? ? B HG  .   HG  ? ? ? 1_555 D HOH .   O  ? ? A HG  1536 A HOH 2088 1_555 ? ? ? ? ? ? ? 3.282 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? ASN A 9   ? LEU A 7   ASN A 9   
AA 2  LYS A 14  ? MET A 16  ? LYS A 14  MET A 16  
AA 3  TRP A 58  ? ASN A 59  ? TRP A 58  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? ASP A 504 ? LYS A 501 ASP A 504 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE HG A1536' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE HG A1537' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 GLU A 139 ? GLU A 139 . ? 1_555 ? 
2 AC1 2 HIS A 471 ? HIS A 471 . ? 1_555 ? 
3 AC2 3 GLY A 227 ? GLY A 227 . ? 1_555 ? 
4 AC2 3 SER A 228 ? SER A 228 . ? 1_555 ? 
5 AC2 3 CYS A 231 ? CYS A 231 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2J4F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2J4F 
_atom_sites.fract_transf_matrix[1][1]   0.009033 
_atom_sites.fract_transf_matrix[1][2]   0.005215 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010431 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007407 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
HG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -11.534 83.942 33.720 1.00 43.31 ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -11.335 85.403 33.994 1.00 41.56 ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -10.491 85.662 35.266 1.00 39.03 ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -10.974 86.232 36.248 1.00 37.14 ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -12.707 86.091 34.084 1.00 43.12 ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -13.573 85.616 33.054 1.00 42.73 ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? -9.227  85.239 35.224 1.00 37.44 ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? -8.292  85.394 36.340 1.00 34.87 ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? -8.750  84.615 37.580 1.00 33.93 ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? -8.235  83.526 37.858 1.00 34.81 ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? -8.070  86.879 36.652 1.00 35.22 ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? -6.989  87.180 37.701 1.00 37.06 ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? -5.584  86.774 37.272 1.00 37.40 ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? -4.677  87.649 37.242 1.00 37.39 ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? -5.381  85.574 36.988 1.00 38.74 ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? -9.747  85.136 38.290 1.00 32.80 ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? -10.260 84.470 39.491 1.00 29.31 ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? -11.254 83.360 39.185 1.00 28.29 ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? -11.328 82.374 39.909 1.00 28.90 ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? -10.895 85.482 40.437 1.00 27.13 ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? -10.136 85.731 41.734 1.00 25.17 ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? -8.651  85.840 41.464 1.00 26.09 ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? -10.666 86.991 42.396 1.00 26.90 ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? -12.080 83.547 38.168 1.00 26.67 ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? -13.029 82.500 37.828 1.00 26.25 ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? -12.371 81.596 36.815 1.00 25.93 ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? -11.880 82.060 35.777 1.00 27.26 ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? -14.339 83.075 37.279 1.00 24.75 ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? -15.370 82.133 36.646 1.00 22.88 ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? -15.161 82.100 35.155 1.00 25.52 ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? -15.324 80.728 37.239 1.00 20.68 ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? -12.333 80.314 37.144 1.00 23.75 ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? -11.746 79.318 36.283 1.00 22.25 ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? -12.752 78.224 36.019 1.00 24.66 ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? -13.596 77.932 36.852 1.00 26.61 ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? -10.496 78.727 36.899 1.00 19.87 ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? -10.128 77.427 36.197 1.00 21.71 ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? -9.363  79.722 36.772 1.00 20.62 ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? -12.707 77.668 34.818 1.00 27.66 ? 9    ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? -13.616 76.605 34.452 1.00 26.99 ? 9    ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? -12.737 75.383 34.379 1.00 27.16 ? 9    ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? -11.588 75.464 33.932 1.00 27.40 ? 9    ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? -14.247 76.889 33.102 1.00 29.00 ? 9    ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? -15.571 76.190 32.937 1.00 31.92 ? 9    ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? -15.822 75.160 33.578 1.00 34.51 ? 9    ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? -16.452 76.760 32.112 1.00 31.97 ? 9    ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? -13.226 74.272 34.896 1.00 25.44 ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? -12.437 73.059 34.895 1.00 23.73 ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? -13.353 71.956 34.426 1.00 24.51 ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? -14.564 72.147 34.327 1.00 26.34 ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? -11.939 72.692 36.320 1.00 22.62 ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? -13.045 72.244 37.114 1.00 20.29 ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? -11.286 73.893 37.009 1.00 20.81 ? 10   THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? -12.781 70.783 34.208 1.00 22.74 ? 11   LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? -13.549 69.643 33.771 1.00 20.81 ? 11   LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? -14.563 69.280 34.847 1.00 21.67 ? 11   LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? -15.637 68.764 34.550 1.00 23.00 ? 11   LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? -12.596 68.489 33.486 1.00 18.79 ? 11   LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? -11.591 68.850 32.417 1.00 17.60 ? 11   LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? -10.454 67.881 32.353 1.00 19.90 ? 11   LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? -9.542  68.207 31.198 1.00 20.00 ? 11   LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? -8.317  67.368 31.208 1.00 21.39 ? 11   LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? -14.238 69.606 36.092 1.00 22.23 ? 12   SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? -15.116 69.312 37.218 1.00 24.15 ? 12   SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? -16.233 70.344 37.335 1.00 23.69 ? 12   SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? -17.309 70.043 37.848 1.00 23.23 ? 12   SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? -14.304 69.287 38.515 1.00 27.44 ? 12   SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? -14.705 68.227 39.373 1.00 30.71 ? 12   SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? -15.960 71.568 36.896 1.00 24.40 ? 13   GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? -16.959 72.621 36.959 1.00 25.25 ? 13   GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? -16.272 73.963 37.056 1.00 27.12 ? 13   GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? -15.041 74.016 37.108 1.00 26.58 ? 13   GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? -17.039 75.049 37.027 1.00 29.14 ? 14   LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? -16.448 76.384 37.144 1.00 29.27 ? 14   LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? -16.188 76.596 38.625 1.00 29.29 ? 14   LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? -17.055 76.285 39.453 1.00 29.29 ? 14   LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? -17.412 77.472 36.659 1.00 29.83 ? 14   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? -17.601 77.550 35.171 1.00 31.27 ? 14   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? -18.545 78.688 34.824 1.00 33.70 ? 14   LYS A CD  1 
ATOM   80   N  N   . VAL A 1 15  ? -15.029 77.160 38.951 1.00 27.56 ? 15   VAL A N   1 
ATOM   81   C  CA  . VAL A 1 15  ? -14.645 77.408 40.326 1.00 26.77 ? 15   VAL A CA  1 
ATOM   82   C  C   . VAL A 1 15  ? -14.257 78.880 40.530 1.00 27.29 ? 15   VAL A C   1 
ATOM   83   O  O   . VAL A 1 15  ? -13.338 79.392 39.891 1.00 26.60 ? 15   VAL A O   1 
ATOM   84   C  CB  . VAL A 1 15  ? -13.504 76.434 40.730 1.00 25.95 ? 15   VAL A CB  1 
ATOM   85   C  CG1 . VAL A 1 15  ? -12.202 76.806 40.080 1.00 24.55 ? 15   VAL A CG1 1 
ATOM   86   C  CG2 . VAL A 1 15  ? -13.369 76.359 42.215 1.00 27.89 ? 15   VAL A CG2 1 
ATOM   87   N  N   . MET A 1 16  ? -15.015 79.576 41.374 1.00 29.13 ? 16   MET A N   1 
ATOM   88   C  CA  . MET A 1 16  ? -14.768 80.995 41.670 1.00 29.62 ? 16   MET A CA  1 
ATOM   89   C  C   . MET A 1 16  ? -13.734 81.114 42.787 1.00 28.13 ? 16   MET A C   1 
ATOM   90   O  O   . MET A 1 16  ? -14.039 80.858 43.951 1.00 28.99 ? 16   MET A O   1 
ATOM   91   C  CB  . MET A 1 16  ? -16.080 81.686 42.094 1.00 32.78 ? 16   MET A CB  1 
ATOM   92   C  CG  . MET A 1 16  ? -15.954 83.160 42.518 1.00 37.17 ? 16   MET A CG  1 
ATOM   93   S  SD  . MET A 1 16  ? -15.450 84.282 41.165 1.00 43.03 ? 16   MET A SD  1 
ATOM   94   C  CE  . MET A 1 16  ? -17.086 84.786 40.480 1.00 45.47 ? 16   MET A CE  1 
ATOM   95   N  N   . GLY A 1 17  ? -12.511 81.484 42.437 1.00 26.31 ? 17   GLY A N   1 
ATOM   96   C  CA  . GLY A 1 17  ? -11.478 81.613 43.447 1.00 25.37 ? 17   GLY A CA  1 
ATOM   97   C  C   . GLY A 1 17  ? -11.517 82.945 44.153 1.00 24.32 ? 17   GLY A C   1 
ATOM   98   O  O   . GLY A 1 17  ? -12.521 83.659 44.101 1.00 26.31 ? 17   GLY A O   1 
ATOM   99   N  N   . THR A 1 18  ? -10.419 83.277 44.816 1.00 22.82 ? 18   THR A N   1 
ATOM   100  C  CA  . THR A 1 18  ? -10.301 84.534 45.526 1.00 23.94 ? 18   THR A CA  1 
ATOM   101  C  C   . THR A 1 18  ? -8.903  85.073 45.301 1.00 25.20 ? 18   THR A C   1 
ATOM   102  O  O   . THR A 1 18  ? -7.979  84.323 44.973 1.00 26.51 ? 18   THR A O   1 
ATOM   103  C  CB  . THR A 1 18  ? -10.538 84.375 47.032 1.00 24.51 ? 18   THR A CB  1 
ATOM   104  O  OG1 . THR A 1 18  ? -10.263 85.618 47.686 1.00 27.81 ? 18   THR A OG1 1 
ATOM   105  C  CG2 . THR A 1 18  ? -9.627  83.316 47.620 1.00 27.42 ? 18   THR A CG2 1 
ATOM   106  N  N   . ARG A 1 19  ? -8.748  86.378 45.450 1.00 25.42 ? 19   ARG A N   1 
ATOM   107  C  CA  . ARG A 1 19  ? -7.453  86.989 45.251 1.00 28.76 ? 19   ARG A CA  1 
ATOM   108  C  C   . ARG A 1 19  ? -6.863  87.296 46.626 1.00 30.22 ? 19   ARG A C   1 
ATOM   109  O  O   . ARG A 1 19  ? -7.345  88.185 47.345 1.00 31.63 ? 19   ARG A O   1 
ATOM   110  C  CB  . ARG A 1 19  ? -7.618  88.254 44.414 1.00 32.81 ? 19   ARG A CB  1 
ATOM   111  C  CG  . ARG A 1 19  ? -6.326  89.004 44.119 1.00 36.42 ? 19   ARG A CG  1 
ATOM   112  C  CD  . ARG A 1 19  ? -6.587  90.141 43.141 1.00 38.61 ? 19   ARG A CD  1 
ATOM   113  N  NE  . ARG A 1 19  ? -5.480  91.092 43.094 1.00 40.44 ? 19   ARG A NE  1 
ATOM   114  N  N   . VAL A 1 20  ? -5.862  86.523 47.027 1.00 28.69 ? 20   VAL A N   1 
ATOM   115  C  CA  . VAL A 1 20  ? -5.248  86.744 48.329 1.00 26.34 ? 20   VAL A CA  1 
ATOM   116  C  C   . VAL A 1 20  ? -3.997  87.593 48.226 1.00 25.42 ? 20   VAL A C   1 
ATOM   117  O  O   . VAL A 1 20  ? -3.232  87.484 47.273 1.00 25.31 ? 20   VAL A O   1 
ATOM   118  C  CB  . VAL A 1 20  ? -4.900  85.419 49.033 1.00 24.86 ? 20   VAL A CB  1 
ATOM   119  C  CG1 . VAL A 1 20  ? -6.155  84.590 49.223 1.00 23.05 ? 20   VAL A CG1 1 
ATOM   120  C  CG2 . VAL A 1 20  ? -3.841  84.658 48.245 1.00 24.00 ? 20   VAL A CG2 1 
ATOM   121  N  N   . PRO A 1 21  ? -3.784  88.475 49.201 1.00 24.22 ? 21   PRO A N   1 
ATOM   122  C  CA  . PRO A 1 21  ? -2.604  89.338 49.193 1.00 23.55 ? 21   PRO A CA  1 
ATOM   123  C  C   . PRO A 1 21  ? -1.411  88.504 49.589 1.00 23.40 ? 21   PRO A C   1 
ATOM   124  O  O   . PRO A 1 21  ? -1.514  87.647 50.464 1.00 22.26 ? 21   PRO A O   1 
ATOM   125  C  CB  . PRO A 1 21  ? -2.926  90.348 50.281 1.00 24.29 ? 21   PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 21  ? -3.667  89.502 51.281 1.00 26.25 ? 21   PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 21  ? -4.600  88.698 50.405 1.00 24.58 ? 21   PRO A CD  1 
ATOM   128  N  N   . VAL A 1 22  ? -0.284  88.741 48.938 1.00 24.68 ? 22   VAL A N   1 
ATOM   129  C  CA  . VAL A 1 22  ? 0.927   88.004 49.245 1.00 25.39 ? 22   VAL A CA  1 
ATOM   130  C  C   . VAL A 1 22  ? 2.099   88.945 49.085 1.00 26.78 ? 22   VAL A C   1 
ATOM   131  O  O   . VAL A 1 22  ? 2.233   89.605 48.054 1.00 27.73 ? 22   VAL A O   1 
ATOM   132  C  CB  . VAL A 1 22  ? 1.100   86.793 48.319 1.00 23.45 ? 22   VAL A CB  1 
ATOM   133  C  CG1 . VAL A 1 22  ? 1.009   87.226 46.873 1.00 25.05 ? 22   VAL A CG1 1 
ATOM   134  C  CG2 . VAL A 1 22  ? 2.429   86.127 48.582 1.00 23.17 ? 22   VAL A CG2 1 
ATOM   135  N  N   . LEU A 1 23  ? 2.935   89.013 50.117 1.00 29.67 ? 23   LEU A N   1 
ATOM   136  C  CA  . LEU A 1 23  ? 4.105   89.880 50.112 1.00 30.23 ? 23   LEU A CA  1 
ATOM   137  C  C   . LEU A 1 23  ? 3.666   91.289 49.727 1.00 32.28 ? 23   LEU A C   1 
ATOM   138  O  O   . LEU A 1 23  ? 2.779   91.864 50.359 1.00 33.12 ? 23   LEU A O   1 
ATOM   139  C  CB  . LEU A 1 23  ? 5.160   89.360 49.127 1.00 31.14 ? 23   LEU A CB  1 
ATOM   140  C  CG  . LEU A 1 23  ? 6.273   88.395 49.548 1.00 31.77 ? 23   LEU A CG  1 
ATOM   141  C  CD1 . LEU A 1 23  ? 7.008   88.987 50.729 1.00 34.50 ? 23   LEU A CD1 1 
ATOM   142  C  CD2 . LEU A 1 23  ? 5.740   87.013 49.881 1.00 32.81 ? 23   LEU A CD2 1 
ATOM   143  N  N   . SER A 1 24  ? 4.228   91.803 48.641 1.00 34.54 ? 24   SER A N   1 
ATOM   144  C  CA  . SER A 1 24  ? 3.920   93.142 48.166 1.00 35.79 ? 24   SER A CA  1 
ATOM   145  C  C   . SER A 1 24  ? 2.769   93.139 47.174 1.00 36.65 ? 24   SER A C   1 
ATOM   146  O  O   . SER A 1 24  ? 2.342   94.204 46.724 1.00 38.00 ? 24   SER A O   1 
ATOM   147  C  CB  . SER A 1 24  ? 5.144   93.695 47.442 1.00 36.13 ? 24   SER A CB  1 
ATOM   148  O  OG  . SER A 1 24  ? 5.513   92.816 46.380 1.00 36.30 ? 24   SER A OG  1 
ATOM   149  N  N   . SER A 1 25  ? 2.275   91.958 46.824 1.00 35.89 ? 25   SER A N   1 
ATOM   150  C  CA  . SER A 1 25  ? 1.234   91.872 45.812 1.00 35.76 ? 25   SER A CA  1 
ATOM   151  C  C   . SER A 1 25  ? -0.004  91.102 46.221 1.00 34.66 ? 25   SER A C   1 
ATOM   152  O  O   . SER A 1 25  ? -0.386  91.087 47.391 1.00 36.82 ? 25   SER A O   1 
ATOM   153  C  CB  . SER A 1 25  ? 1.838   91.233 44.559 1.00 37.47 ? 25   SER A CB  1 
ATOM   154  O  OG  . SER A 1 25  ? 3.212   91.583 44.425 1.00 41.89 ? 25   SER A OG  1 
ATOM   155  N  N   . HIS A 1 26  ? -0.660  90.509 45.230 1.00 33.60 ? 26   HIS A N   1 
ATOM   156  C  CA  . HIS A 1 26  ? -1.855  89.706 45.449 1.00 33.23 ? 26   HIS A CA  1 
ATOM   157  C  C   . HIS A 1 26  ? -1.657  88.410 44.635 1.00 31.54 ? 26   HIS A C   1 
ATOM   158  O  O   . HIS A 1 26  ? -0.719  88.313 43.837 1.00 31.09 ? 26   HIS A O   1 
ATOM   159  C  CB  . HIS A 1 26  ? -3.100  90.477 44.999 1.00 32.50 ? 26   HIS A CB  1 
ATOM   160  N  N   . ILE A 1 27  ? -2.517  87.421 44.826 1.00 28.01 ? 27   ILE A N   1 
ATOM   161  C  CA  . ILE A 1 27  ? -2.356  86.174 44.120 1.00 26.24 ? 27   ILE A CA  1 
ATOM   162  C  C   . ILE A 1 27  ? -3.704  85.486 44.055 1.00 26.57 ? 27   ILE A C   1 
ATOM   163  O  O   . ILE A 1 27  ? -4.576  85.722 44.906 1.00 26.50 ? 27   ILE A O   1 
ATOM   164  C  CB  . ILE A 1 27  ? -1.294  85.289 44.839 1.00 27.13 ? 27   ILE A CB  1 
ATOM   165  C  CG1 . ILE A 1 27  ? -0.279  84.762 43.836 1.00 29.69 ? 27   ILE A CG1 1 
ATOM   166  C  CG2 . ILE A 1 27  ? -1.922  84.118 45.572 1.00 27.95 ? 27   ILE A CG2 1 
ATOM   167  C  CD1 . ILE A 1 27  ? 0.660   85.835 43.316 1.00 32.19 ? 27   ILE A CD1 1 
ATOM   168  N  N   . SER A 1 28  ? -3.906  84.690 43.013 1.00 25.61 ? 28   SER A N   1 
ATOM   169  C  CA  . SER A 1 28  ? -5.164  83.979 42.866 1.00 26.25 ? 28   SER A CA  1 
ATOM   170  C  C   . SER A 1 28  ? -5.054  82.846 43.870 1.00 25.58 ? 28   SER A C   1 
ATOM   171  O  O   . SER A 1 28  ? -3.969  82.291 44.063 1.00 26.75 ? 28   SER A O   1 
ATOM   172  C  CB  . SER A 1 28  ? -5.318  83.393 41.450 1.00 29.26 ? 28   SER A CB  1 
ATOM   173  O  OG  . SER A 1 28  ? -4.897  84.283 40.416 1.00 32.14 ? 28   SER A OG  1 
ATOM   174  N  N   . ALA A 1 29  ? -6.159  82.511 44.515 1.00 23.90 ? 29   ALA A N   1 
ATOM   175  C  CA  . ALA A 1 29  ? -6.177  81.431 45.483 1.00 23.57 ? 29   ALA A CA  1 
ATOM   176  C  C   . ALA A 1 29  ? -7.513  80.759 45.334 1.00 23.89 ? 29   ALA A C   1 
ATOM   177  O  O   . ALA A 1 29  ? -8.556  81.399 45.455 1.00 24.99 ? 29   ALA A O   1 
ATOM   178  C  CB  . ALA A 1 29  ? -6.025  81.968 46.897 1.00 23.11 ? 29   ALA A CB  1 
ATOM   179  N  N   . PHE A 1 30  ? -7.491  79.482 45.001 1.00 22.55 ? 30   PHE A N   1 
ATOM   180  C  CA  . PHE A 1 30  ? -8.724  78.737 44.839 1.00 22.84 ? 30   PHE A CA  1 
ATOM   181  C  C   . PHE A 1 30  ? -8.682  77.730 45.961 1.00 22.18 ? 30   PHE A C   1 
ATOM   182  O  O   . PHE A 1 30  ? -7.986  76.718 45.860 1.00 23.93 ? 30   PHE A O   1 
ATOM   183  C  CB  . PHE A 1 30  ? -8.746  78.063 43.463 1.00 22.55 ? 30   PHE A CB  1 
ATOM   184  C  CG  . PHE A 1 30  ? -8.679  79.036 42.327 1.00 20.12 ? 30   PHE A CG  1 
ATOM   185  C  CD1 . PHE A 1 30  ? -9.836  79.428 41.669 1.00 18.92 ? 30   PHE A CD1 1 
ATOM   186  C  CD2 . PHE A 1 30  ? -7.473  79.623 41.970 1.00 18.57 ? 30   PHE A CD2 1 
ATOM   187  C  CE1 . PHE A 1 30  ? -9.801  80.384 40.687 1.00 15.98 ? 30   PHE A CE1 1 
ATOM   188  C  CE2 . PHE A 1 30  ? -7.426  80.591 40.981 1.00 18.83 ? 30   PHE A CE2 1 
ATOM   189  C  CZ  . PHE A 1 30  ? -8.597  80.976 40.338 1.00 19.52 ? 30   PHE A CZ  1 
ATOM   190  N  N   . LEU A 1 31  ? -9.342  78.057 47.067 1.00 18.27 ? 31   LEU A N   1 
ATOM   191  C  CA  . LEU A 1 31  ? -9.336  77.182 48.219 1.00 17.45 ? 31   LEU A CA  1 
ATOM   192  C  C   . LEU A 1 31  ? -10.568 76.329 48.334 1.00 19.84 ? 31   LEU A C   1 
ATOM   193  O  O   . LEU A 1 31  ? -11.676 76.801 48.115 1.00 22.29 ? 31   LEU A O   1 
ATOM   194  C  CB  . LEU A 1 31  ? -9.194  77.986 49.504 1.00 14.94 ? 31   LEU A CB  1 
ATOM   195  C  CG  . LEU A 1 31  ? -7.908  78.758 49.761 1.00 14.49 ? 31   LEU A CG  1 
ATOM   196  C  CD1 . LEU A 1 31  ? -6.766  78.022 49.114 1.00 15.10 ? 31   LEU A CD1 1 
ATOM   197  C  CD2 . LEU A 1 31  ? -8.004  80.161 49.219 1.00 16.11 ? 31   LEU A CD2 1 
ATOM   198  N  N   . GLY A 1 32  ? -10.365 75.064 48.680 1.00 19.81 ? 32   GLY A N   1 
ATOM   199  C  CA  . GLY A 1 32  ? -11.482 74.164 48.893 1.00 19.96 ? 32   GLY A CA  1 
ATOM   200  C  C   . GLY A 1 32  ? -12.192 73.548 47.715 1.00 20.00 ? 32   GLY A C   1 
ATOM   201  O  O   . GLY A 1 32  ? -13.374 73.227 47.818 1.00 21.78 ? 32   GLY A O   1 
ATOM   202  N  N   . ILE A 1 33  ? -11.481 73.338 46.615 1.00 19.62 ? 33   ILE A N   1 
ATOM   203  C  CA  . ILE A 1 33  ? -12.082 72.729 45.438 1.00 16.62 ? 33   ILE A CA  1 
ATOM   204  C  C   . ILE A 1 33  ? -12.237 71.251 45.758 1.00 17.41 ? 33   ILE A C   1 
ATOM   205  O  O   . ILE A 1 33  ? -11.272 70.605 46.156 1.00 21.69 ? 33   ILE A O   1 
ATOM   206  C  CB  . ILE A 1 33  ? -11.166 72.868 44.221 1.00 14.00 ? 33   ILE A CB  1 
ATOM   207  C  CG1 . ILE A 1 33  ? -10.804 74.332 44.017 1.00 11.48 ? 33   ILE A CG1 1 
ATOM   208  C  CG2 . ILE A 1 33  ? -11.857 72.333 42.990 1.00 13.80 ? 33   ILE A CG2 1 
ATOM   209  C  CD1 . ILE A 1 33  ? -9.800  74.551 42.956 1.00 12.00 ? 33   ILE A CD1 1 
ATOM   210  N  N   . PRO A 1 34  ? -13.452 70.702 45.644 1.00 16.31 ? 34   PRO A N   1 
ATOM   211  C  CA  . PRO A 1 34  ? -13.596 69.278 45.951 1.00 15.98 ? 34   PRO A CA  1 
ATOM   212  C  C   . PRO A 1 34  ? -12.903 68.469 44.869 1.00 16.24 ? 34   PRO A C   1 
ATOM   213  O  O   . PRO A 1 34  ? -12.835 68.913 43.721 1.00 17.79 ? 34   PRO A O   1 
ATOM   214  C  CB  . PRO A 1 34  ? -15.105 69.049 45.859 1.00 15.85 ? 34   PRO A CB  1 
ATOM   215  C  CG  . PRO A 1 34  ? -15.710 70.412 45.804 1.00 15.29 ? 34   PRO A CG  1 
ATOM   216  C  CD  . PRO A 1 34  ? -14.706 71.256 45.121 1.00 16.51 ? 34   PRO A CD  1 
ATOM   217  N  N   . PHE A 1 35  ? -12.364 67.308 45.229 1.00 16.24 ? 35   PHE A N   1 
ATOM   218  C  CA  . PHE A 1 35  ? -11.724 66.448 44.242 1.00 15.57 ? 35   PHE A CA  1 
ATOM   219  C  C   . PHE A 1 35  ? -12.245 65.031 44.346 1.00 17.08 ? 35   PHE A C   1 
ATOM   220  O  O   . PHE A 1 35  ? -11.945 64.183 43.511 1.00 19.61 ? 35   PHE A O   1 
ATOM   221  C  CB  . PHE A 1 35  ? -10.200 66.489 44.340 1.00 15.89 ? 35   PHE A CB  1 
ATOM   222  C  CG  . PHE A 1 35  ? -9.635  65.888 45.593 1.00 18.01 ? 35   PHE A CG  1 
ATOM   223  C  CD1 . PHE A 1 35  ? -9.724  64.529 45.837 1.00 18.09 ? 35   PHE A CD1 1 
ATOM   224  C  CD2 . PHE A 1 35  ? -8.940  66.680 46.495 1.00 19.45 ? 35   PHE A CD2 1 
ATOM   225  C  CE1 . PHE A 1 35  ? -9.131  63.966 46.949 1.00 17.76 ? 35   PHE A CE1 1 
ATOM   226  C  CE2 . PHE A 1 35  ? -8.343  66.126 47.608 1.00 18.61 ? 35   PHE A CE2 1 
ATOM   227  C  CZ  . PHE A 1 35  ? -8.439  64.762 47.835 1.00 17.85 ? 35   PHE A CZ  1 
ATOM   228  N  N   . ALA A 1 36  ? -13.064 64.794 45.362 1.00 17.71 ? 36   ALA A N   1 
ATOM   229  C  CA  . ALA A 1 36  ? -13.664 63.491 45.605 1.00 17.49 ? 36   ALA A CA  1 
ATOM   230  C  C   . ALA A 1 36  ? -14.986 63.724 46.322 1.00 19.07 ? 36   ALA A C   1 
ATOM   231  O  O   . ALA A 1 36  ? -15.178 64.747 46.979 1.00 22.81 ? 36   ALA A O   1 
ATOM   232  C  CB  . ALA A 1 36  ? -12.749 62.648 46.463 1.00 17.37 ? 36   ALA A CB  1 
ATOM   233  N  N   . GLU A 1 37  ? -15.930 62.820 46.141 1.00 19.39 ? 37   GLU A N   1 
ATOM   234  C  CA  . GLU A 1 37  ? -17.214 62.956 46.802 1.00 20.75 ? 37   GLU A CA  1 
ATOM   235  C  C   . GLU A 1 37  ? -16.950 62.833 48.290 1.00 21.92 ? 37   GLU A C   1 
ATOM   236  O  O   . GLU A 1 37  ? -16.147 62.001 48.702 1.00 25.38 ? 37   GLU A O   1 
ATOM   237  C  CB  . GLU A 1 37  ? -18.138 61.823 46.359 1.00 21.54 ? 37   GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 37  ? -18.586 61.929 44.933 1.00 20.97 ? 37   GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 37  ? -19.695 62.915 44.793 1.00 21.88 ? 37   GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 37  ? -20.841 62.511 45.064 1.00 25.43 ? 37   GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 37  ? -19.431 64.092 44.451 1.00 21.90 ? 37   GLU A OE2 1 
ATOM   242  N  N   . PRO A 1 38  ? -17.597 63.672 49.114 1.00 22.00 ? 38   PRO A N   1 
ATOM   243  C  CA  . PRO A 1 38  ? -17.440 63.659 50.568 1.00 21.01 ? 38   PRO A CA  1 
ATOM   244  C  C   . PRO A 1 38  ? -17.497 62.230 51.076 1.00 21.72 ? 38   PRO A C   1 
ATOM   245  O  O   . PRO A 1 38  ? -18.521 61.566 50.960 1.00 24.99 ? 38   PRO A O   1 
ATOM   246  C  CB  . PRO A 1 38  ? -18.663 64.430 51.035 1.00 20.57 ? 38   PRO A CB  1 
ATOM   247  C  CG  . PRO A 1 38  ? -18.799 65.462 49.994 1.00 23.72 ? 38   PRO A CG  1 
ATOM   248  C  CD  . PRO A 1 38  ? -18.590 64.682 48.712 1.00 24.51 ? 38   PRO A CD  1 
ATOM   249  N  N   . PRO A 1 39  ? -16.405 61.744 51.664 1.00 20.23 ? 39   PRO A N   1 
ATOM   250  C  CA  . PRO A 1 39  ? -16.324 60.388 52.192 1.00 20.01 ? 39   PRO A CA  1 
ATOM   251  C  C   . PRO A 1 39  ? -17.126 60.209 53.471 1.00 21.03 ? 39   PRO A C   1 
ATOM   252  O  O   . PRO A 1 39  ? -16.701 59.501 54.390 1.00 23.90 ? 39   PRO A O   1 
ATOM   253  C  CB  . PRO A 1 39  ? -14.835 60.236 52.456 1.00 21.05 ? 39   PRO A CB  1 
ATOM   254  C  CG  . PRO A 1 39  ? -14.469 61.596 52.906 1.00 20.52 ? 39   PRO A CG  1 
ATOM   255  C  CD  . PRO A 1 39  ? -15.141 62.460 51.882 1.00 20.28 ? 39   PRO A CD  1 
ATOM   256  N  N   . VAL A 1 40  ? -18.270 60.872 53.547 1.00 18.99 ? 40   VAL A N   1 
ATOM   257  C  CA  . VAL A 1 40  ? -19.120 60.767 54.712 1.00 17.92 ? 40   VAL A CA  1 
ATOM   258  C  C   . VAL A 1 40  ? -20.020 59.562 54.503 1.00 19.17 ? 40   VAL A C   1 
ATOM   259  O  O   . VAL A 1 40  ? -19.737 58.716 53.664 1.00 22.59 ? 40   VAL A O   1 
ATOM   260  C  CB  . VAL A 1 40  ? -19.965 62.013 54.863 1.00 16.23 ? 40   VAL A CB  1 
ATOM   261  C  CG1 . VAL A 1 40  ? -19.068 63.226 54.960 1.00 14.24 ? 40   VAL A CG1 1 
ATOM   262  C  CG2 . VAL A 1 40  ? -20.925 62.129 53.692 1.00 17.58 ? 40   VAL A CG2 1 
ATOM   263  N  N   . GLY A 1 41  ? -21.086 59.469 55.288 1.00 20.48 ? 41   GLY A N   1 
ATOM   264  C  CA  . GLY A 1 41  ? -22.030 58.372 55.170 1.00 19.58 ? 41   GLY A CA  1 
ATOM   265  C  C   . GLY A 1 41  ? -21.432 56.981 55.122 1.00 18.82 ? 41   GLY A C   1 
ATOM   266  O  O   . GLY A 1 41  ? -20.420 56.697 55.752 1.00 18.21 ? 41   GLY A O   1 
ATOM   267  N  N   . ASN A 1 42  ? -22.064 56.121 54.332 1.00 20.86 ? 42   ASN A N   1 
ATOM   268  C  CA  . ASN A 1 42  ? -21.631 54.743 54.165 1.00 22.14 ? 42   ASN A CA  1 
ATOM   269  C  C   . ASN A 1 42  ? -20.379 54.617 53.285 1.00 22.70 ? 42   ASN A C   1 
ATOM   270  O  O   . ASN A 1 42  ? -20.073 53.540 52.783 1.00 22.76 ? 42   ASN A O   1 
ATOM   271  C  CB  . ASN A 1 42  ? -22.781 53.901 53.598 1.00 19.55 ? 42   ASN A CB  1 
ATOM   272  N  N   . MET A 1 43  ? -19.678 55.722 53.066 1.00 24.25 ? 43   MET A N   1 
ATOM   273  C  CA  . MET A 1 43  ? -18.459 55.690 52.271 1.00 26.51 ? 43   MET A CA  1 
ATOM   274  C  C   . MET A 1 43  ? -17.254 55.773 53.202 1.00 26.50 ? 43   MET A C   1 
ATOM   275  O  O   . MET A 1 43  ? -16.106 55.735 52.753 1.00 28.16 ? 43   MET A O   1 
ATOM   276  C  CB  . MET A 1 43  ? -18.422 56.831 51.246 1.00 30.67 ? 43   MET A CB  1 
ATOM   277  C  CG  . MET A 1 43  ? -19.449 56.705 50.118 1.00 35.13 ? 43   MET A CG  1 
ATOM   278  S  SD  . MET A 1 43  ? -19.091 57.772 48.669 1.00 40.60 ? 43   MET A SD  1 
ATOM   279  C  CE  . MET A 1 43  ? -19.751 59.402 49.252 1.00 39.70 ? 43   MET A CE  1 
ATOM   280  N  N   . ARG A 1 44  ? -17.522 55.916 54.498 1.00 24.84 ? 44   ARG A N   1 
ATOM   281  C  CA  . ARG A 1 44  ? -16.474 55.972 55.515 1.00 22.70 ? 44   ARG A CA  1 
ATOM   282  C  C   . ARG A 1 44  ? -15.600 54.741 55.279 1.00 21.93 ? 44   ARG A C   1 
ATOM   283  O  O   . ARG A 1 44  ? -16.111 53.632 55.148 1.00 21.12 ? 44   ARG A O   1 
ATOM   284  C  CB  . ARG A 1 44  ? -17.123 55.929 56.911 1.00 22.32 ? 44   ARG A CB  1 
ATOM   285  C  CG  . ARG A 1 44  ? -16.185 55.664 58.082 1.00 22.47 ? 44   ARG A CG  1 
ATOM   286  C  CD  . ARG A 1 44  ? -15.821 56.920 58.840 1.00 20.01 ? 44   ARG A CD  1 
ATOM   287  N  NE  . ARG A 1 44  ? -16.994 57.571 59.409 1.00 21.49 ? 44   ARG A NE  1 
ATOM   288  C  CZ  . ARG A 1 44  ? -17.616 57.171 60.516 1.00 24.36 ? 44   ARG A CZ  1 
ATOM   289  N  NH1 . ARG A 1 44  ? -17.185 56.109 61.190 1.00 23.55 ? 44   ARG A NH1 1 
ATOM   290  N  NH2 . ARG A 1 44  ? -18.672 57.841 60.958 1.00 24.18 ? 44   ARG A NH2 1 
ATOM   291  N  N   . PHE A 1 45  ? -14.295 54.953 55.165 1.00 21.70 ? 45   PHE A N   1 
ATOM   292  C  CA  . PHE A 1 45  ? -13.315 53.883 54.911 1.00 22.67 ? 45   PHE A CA  1 
ATOM   293  C  C   . PHE A 1 45  ? -13.294 53.473 53.447 1.00 23.08 ? 45   PHE A C   1 
ATOM   294  O  O   . PHE A 1 45  ? -12.267 53.012 52.954 1.00 24.05 ? 45   PHE A O   1 
ATOM   295  C  CB  . PHE A 1 45  ? -13.565 52.626 55.755 1.00 21.94 ? 45   PHE A CB  1 
ATOM   296  C  CG  . PHE A 1 45  ? -13.685 52.888 57.222 1.00 24.77 ? 45   PHE A CG  1 
ATOM   297  C  CD1 . PHE A 1 45  ? -12.693 53.581 57.906 1.00 26.04 ? 45   PHE A CD1 1 
ATOM   298  C  CD2 . PHE A 1 45  ? -14.804 52.460 57.921 1.00 23.71 ? 45   PHE A CD2 1 
ATOM   299  C  CE1 . PHE A 1 45  ? -12.817 53.847 59.263 1.00 24.94 ? 45   PHE A CE1 1 
ATOM   300  C  CE2 . PHE A 1 45  ? -14.934 52.719 59.275 1.00 25.45 ? 45   PHE A CE2 1 
ATOM   301  C  CZ  . PHE A 1 45  ? -13.940 53.415 59.949 1.00 25.42 ? 45   PHE A CZ  1 
ATOM   302  N  N   . ARG A 1 46  ? -14.428 53.593 52.765 1.00 23.50 ? 46   ARG A N   1 
ATOM   303  C  CA  . ARG A 1 46  ? -14.503 53.226 51.353 1.00 25.83 ? 46   ARG A CA  1 
ATOM   304  C  C   . ARG A 1 46  ? -13.661 54.179 50.516 1.00 24.56 ? 46   ARG A C   1 
ATOM   305  O  O   . ARG A 1 46  ? -13.509 55.347 50.865 1.00 24.07 ? 46   ARG A O   1 
ATOM   306  C  CB  . ARG A 1 46  ? -15.953 53.235 50.849 1.00 27.13 ? 46   ARG A CB  1 
ATOM   307  C  CG  . ARG A 1 46  ? -16.774 52.037 51.281 1.00 31.91 ? 46   ARG A CG  1 
ATOM   308  C  CD  . ARG A 1 46  ? -18.190 52.090 50.711 1.00 38.87 ? 46   ARG A CD  1 
ATOM   309  N  NE  . ARG A 1 46  ? -18.487 50.909 49.898 1.00 45.42 ? 46   ARG A NE  1 
ATOM   310  C  CZ  . ARG A 1 46  ? -17.986 50.685 48.678 1.00 49.18 ? 46   ARG A CZ  1 
ATOM   311  N  NH1 . ARG A 1 46  ? -17.166 51.577 48.109 1.00 52.19 ? 46   ARG A NH1 1 
ATOM   312  N  NH2 . ARG A 1 46  ? -18.254 49.542 48.042 1.00 49.10 ? 46   ARG A NH2 1 
ATOM   313  N  N   . ARG A 1 47  ? -13.095 53.662 49.428 1.00 22.76 ? 47   ARG A N   1 
ATOM   314  C  CA  . ARG A 1 47  ? -12.273 54.457 48.527 1.00 21.41 ? 47   ARG A CA  1 
ATOM   315  C  C   . ARG A 1 47  ? -13.008 55.712 48.104 1.00 20.67 ? 47   ARG A C   1 
ATOM   316  O  O   . ARG A 1 47  ? -14.237 55.745 48.070 1.00 23.87 ? 47   ARG A O   1 
ATOM   317  C  CB  . ARG A 1 47  ? -11.939 53.665 47.275 1.00 23.67 ? 47   ARG A CB  1 
ATOM   318  C  CG  . ARG A 1 47  ? -11.169 52.409 47.513 1.00 27.34 ? 47   ARG A CG  1 
ATOM   319  C  CD  . ARG A 1 47  ? -10.687 51.831 46.192 1.00 30.14 ? 47   ARG A CD  1 
ATOM   320  N  NE  . ARG A 1 47  ? -9.746  50.743 46.424 1.00 32.41 ? 47   ARG A NE  1 
ATOM   321  C  CZ  . ARG A 1 47  ? -10.104 49.493 46.703 1.00 34.01 ? 47   ARG A CZ  1 
ATOM   322  N  NH1 . ARG A 1 47  ? -11.392 49.152 46.775 1.00 33.05 ? 47   ARG A NH1 1 
ATOM   323  N  NH2 . ARG A 1 47  ? -9.164  48.595 46.964 1.00 35.51 ? 47   ARG A NH2 1 
ATOM   324  N  N   . PRO A 1 48  ? -12.266 56.750 47.720 1.00 18.90 ? 48   PRO A N   1 
ATOM   325  C  CA  . PRO A 1 48  ? -12.950 57.971 47.309 1.00 21.21 ? 48   PRO A CA  1 
ATOM   326  C  C   . PRO A 1 48  ? -13.509 57.894 45.890 1.00 23.26 ? 48   PRO A C   1 
ATOM   327  O  O   . PRO A 1 48  ? -12.885 57.324 44.983 1.00 25.34 ? 48   PRO A O   1 
ATOM   328  C  CB  . PRO A 1 48  ? -11.850 59.022 47.431 1.00 18.24 ? 48   PRO A CB  1 
ATOM   329  C  CG  . PRO A 1 48  ? -10.636 58.265 47.069 1.00 16.39 ? 48   PRO A CG  1 
ATOM   330  C  CD  . PRO A 1 48  ? -10.807 56.939 47.750 1.00 17.73 ? 48   PRO A CD  1 
ATOM   331  N  N   . GLU A 1 49  ? -14.726 58.395 45.725 1.00 23.21 ? 49   GLU A N   1 
ATOM   332  C  CA  . GLU A 1 49  ? -15.358 58.446 44.419 1.00 22.71 ? 49   GLU A CA  1 
ATOM   333  C  C   . GLU A 1 49  ? -14.965 59.813 43.908 1.00 21.06 ? 49   GLU A C   1 
ATOM   334  O  O   . GLU A 1 49  ? -14.838 60.747 44.694 1.00 22.02 ? 49   GLU A O   1 
ATOM   335  C  CB  . GLU A 1 49  ? -16.874 58.415 44.548 1.00 27.06 ? 49   GLU A CB  1 
ATOM   336  C  CG  . GLU A 1 49  ? -17.496 57.050 44.792 1.00 31.92 ? 49   GLU A CG  1 
ATOM   337  C  CD  . GLU A 1 49  ? -19.011 57.147 44.946 1.00 37.83 ? 49   GLU A CD  1 
ATOM   338  O  OE1 . GLU A 1 49  ? -19.642 56.116 45.316 1.00 42.18 ? 49   GLU A OE1 1 
ATOM   339  O  OE2 . GLU A 1 49  ? -19.571 58.254 44.707 1.00 37.06 ? 49   GLU A OE2 1 
ATOM   340  N  N   . PRO A 1 50  ? -14.755 59.958 42.596 1.00 20.16 ? 50   PRO A N   1 
ATOM   341  C  CA  . PRO A 1 50  ? -14.376 61.270 42.077 1.00 19.59 ? 50   PRO A CA  1 
ATOM   342  C  C   . PRO A 1 50  ? -15.496 62.259 42.352 1.00 21.43 ? 50   PRO A C   1 
ATOM   343  O  O   . PRO A 1 50  ? -16.616 61.855 42.676 1.00 22.74 ? 50   PRO A O   1 
ATOM   344  C  CB  . PRO A 1 50  ? -14.230 61.006 40.589 1.00 18.94 ? 50   PRO A CB  1 
ATOM   345  C  CG  . PRO A 1 50  ? -13.801 59.573 40.542 1.00 19.52 ? 50   PRO A CG  1 
ATOM   346  C  CD  . PRO A 1 50  ? -14.742 58.951 41.526 1.00 20.61 ? 50   PRO A CD  1 
ATOM   347  N  N   . LYS A 1 51  ? -15.199 63.549 42.257 1.00 22.55 ? 51   LYS A N   1 
ATOM   348  C  CA  . LYS A 1 51  ? -16.217 64.561 42.503 1.00 26.07 ? 51   LYS A CA  1 
ATOM   349  C  C   . LYS A 1 51  ? -17.126 64.759 41.294 1.00 27.96 ? 51   LYS A C   1 
ATOM   350  O  O   . LYS A 1 51  ? -16.664 65.190 40.228 1.00 28.71 ? 51   LYS A O   1 
ATOM   351  C  CB  . LYS A 1 51  ? -15.577 65.900 42.873 1.00 27.48 ? 51   LYS A CB  1 
ATOM   352  C  CG  . LYS A 1 51  ? -16.589 67.027 43.060 1.00 27.34 ? 51   LYS A CG  1 
ATOM   353  C  CD  . LYS A 1 51  ? -17.512 66.744 44.229 1.00 26.75 ? 51   LYS A CD  1 
ATOM   354  C  CE  . LYS A 1 51  ? -18.446 67.915 44.487 1.00 31.54 ? 51   LYS A CE  1 
ATOM   355  N  NZ  . LYS A 1 51  ? -19.226 67.741 45.760 1.00 33.85 ? 51   LYS A NZ  1 
ATOM   356  N  N   . LYS A 1 52  ? -18.409 64.446 41.466 1.00 28.43 ? 52   LYS A N   1 
ATOM   357  C  CA  . LYS A 1 52  ? -19.396 64.613 40.406 1.00 28.56 ? 52   LYS A CA  1 
ATOM   358  C  C   . LYS A 1 52  ? -19.355 66.070 39.988 1.00 28.77 ? 52   LYS A C   1 
ATOM   359  O  O   . LYS A 1 52  ? -19.483 66.957 40.825 1.00 28.78 ? 52   LYS A O   1 
ATOM   360  C  CB  . LYS A 1 52  ? -20.791 64.272 40.920 1.00 31.34 ? 52   LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 52  ? -20.961 62.821 41.334 1.00 34.01 ? 52   LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 52  ? -22.408 62.525 41.690 1.00 36.41 ? 52   LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 52  ? -22.588 61.061 42.045 1.00 38.63 ? 52   LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 52  ? -21.721 60.667 43.190 1.00 40.79 ? 52   LYS A NZ  1 
ATOM   365  N  N   . PRO A 1 53  ? -19.220 66.334 38.680 1.00 29.66 ? 53   PRO A N   1 
ATOM   366  C  CA  . PRO A 1 53  ? -19.157 67.699 38.159 1.00 29.36 ? 53   PRO A CA  1 
ATOM   367  C  C   . PRO A 1 53  ? -20.266 68.553 38.716 1.00 30.04 ? 53   PRO A C   1 
ATOM   368  O  O   . PRO A 1 53  ? -21.428 68.140 38.748 1.00 30.73 ? 53   PRO A O   1 
ATOM   369  C  CB  . PRO A 1 53  ? -19.337 67.505 36.658 1.00 29.47 ? 53   PRO A CB  1 
ATOM   370  C  CG  . PRO A 1 53  ? -18.769 66.141 36.420 1.00 30.83 ? 53   PRO A CG  1 
ATOM   371  C  CD  . PRO A 1 53  ? -19.361 65.372 37.575 1.00 30.50 ? 53   PRO A CD  1 
ATOM   372  N  N   . TRP A 1 54  ? -19.890 69.708 39.240 1.00 30.30 ? 54   TRP A N   1 
ATOM   373  C  CA  . TRP A 1 54  ? -20.873 70.618 39.775 1.00 30.44 ? 54   TRP A CA  1 
ATOM   374  C  C   . TRP A 1 54  ? -21.288 71.555 38.643 1.00 34.25 ? 54   TRP A C   1 
ATOM   375  O  O   . TRP A 1 54  ? -20.822 71.412 37.491 1.00 36.38 ? 54   TRP A O   1 
ATOM   376  C  CB  . TRP A 1 54  ? -20.326 71.385 40.991 1.00 25.16 ? 54   TRP A CB  1 
ATOM   377  C  CG  . TRP A 1 54  ? -19.038 72.117 40.798 1.00 18.69 ? 54   TRP A CG  1 
ATOM   378  C  CD1 . TRP A 1 54  ? -18.889 73.428 40.446 1.00 18.69 ? 54   TRP A CD1 1 
ATOM   379  C  CD2 . TRP A 1 54  ? -17.718 71.612 41.026 1.00 16.41 ? 54   TRP A CD2 1 
ATOM   380  N  NE1 . TRP A 1 54  ? -17.559 73.774 40.449 1.00 17.65 ? 54   TRP A NE1 1 
ATOM   381  C  CE2 . TRP A 1 54  ? -16.816 72.679 40.801 1.00 15.99 ? 54   TRP A CE2 1 
ATOM   382  C  CE3 . TRP A 1 54  ? -17.208 70.367 41.402 1.00 13.17 ? 54   TRP A CE3 1 
ATOM   383  C  CZ2 . TRP A 1 54  ? -15.436 72.537 40.943 1.00 12.26 ? 54   TRP A CZ2 1 
ATOM   384  C  CZ3 . TRP A 1 54  ? -15.833 70.227 41.542 1.00 13.63 ? 54   TRP A CZ3 1 
ATOM   385  C  CH2 . TRP A 1 54  ? -14.965 71.307 41.313 1.00 12.87 ? 54   TRP A CH2 1 
ATOM   386  N  N   . SER A 1 55  ? -22.204 72.467 38.956 1.00 36.32 ? 55   SER A N   1 
ATOM   387  C  CA  . SER A 1 55  ? -22.701 73.442 37.996 1.00 35.67 ? 55   SER A CA  1 
ATOM   388  C  C   . SER A 1 55  ? -22.735 74.765 38.733 1.00 35.22 ? 55   SER A C   1 
ATOM   389  O  O   . SER A 1 55  ? -23.081 74.813 39.920 1.00 36.26 ? 55   SER A O   1 
ATOM   390  C  CB  . SER A 1 55  ? -24.106 73.073 37.533 1.00 35.09 ? 55   SER A CB  1 
ATOM   391  O  OG  . SER A 1 55  ? -24.678 74.148 36.809 1.00 37.93 ? 55   SER A OG  1 
ATOM   392  N  N   . GLY A 1 56  ? -22.442 75.845 38.023 1.00 33.25 ? 56   GLY A N   1 
ATOM   393  C  CA  . GLY A 1 56  ? -22.420 77.133 38.677 1.00 31.08 ? 56   GLY A CA  1 
ATOM   394  C  C   . GLY A 1 56  ? -21.062 77.220 39.329 1.00 28.71 ? 56   GLY A C   1 
ATOM   395  O  O   . GLY A 1 56  ? -20.464 76.202 39.644 1.00 29.82 ? 56   GLY A O   1 
ATOM   396  N  N   . VAL A 1 57  ? -20.544 78.424 39.489 1.00 26.35 ? 57   VAL A N   1 
ATOM   397  C  CA  . VAL A 1 57  ? -19.239 78.577 40.080 1.00 25.18 ? 57   VAL A CA  1 
ATOM   398  C  C   . VAL A 1 57  ? -19.156 77.986 41.484 1.00 25.84 ? 57   VAL A C   1 
ATOM   399  O  O   . VAL A 1 57  ? -20.069 78.121 42.304 1.00 26.12 ? 57   VAL A O   1 
ATOM   400  C  CB  . VAL A 1 57  ? -18.814 80.052 40.115 1.00 24.32 ? 57   VAL A CB  1 
ATOM   401  C  CG1 . VAL A 1 57  ? -18.744 80.610 38.711 1.00 24.38 ? 57   VAL A CG1 1 
ATOM   402  C  CG2 . VAL A 1 57  ? -19.785 80.857 40.945 1.00 28.57 ? 57   VAL A CG2 1 
ATOM   403  N  N   . TRP A 1 58  ? -18.081 77.256 41.729 1.00 26.32 ? 58   TRP A N   1 
ATOM   404  C  CA  . TRP A 1 58  ? -17.852 76.688 43.036 1.00 26.45 ? 58   TRP A CA  1 
ATOM   405  C  C   . TRP A 1 58  ? -17.052 77.758 43.772 1.00 28.37 ? 58   TRP A C   1 
ATOM   406  O  O   . TRP A 1 58  ? -15.932 78.097 43.364 1.00 26.51 ? 58   TRP A O   1 
ATOM   407  C  CB  . TRP A 1 58  ? -17.018 75.429 42.937 1.00 25.41 ? 58   TRP A CB  1 
ATOM   408  C  CG  . TRP A 1 58  ? -16.711 74.902 44.269 1.00 27.04 ? 58   TRP A CG  1 
ATOM   409  C  CD1 . TRP A 1 58  ? -15.728 75.333 45.118 1.00 25.51 ? 58   TRP A CD1 1 
ATOM   410  C  CD2 . TRP A 1 58  ? -17.441 73.900 44.970 1.00 27.41 ? 58   TRP A CD2 1 
ATOM   411  N  NE1 . TRP A 1 58  ? -15.816 74.665 46.311 1.00 27.70 ? 58   TRP A NE1 1 
ATOM   412  C  CE2 . TRP A 1 58  ? -16.858 73.776 46.248 1.00 27.49 ? 58   TRP A CE2 1 
ATOM   413  C  CE3 . TRP A 1 58  ? -18.536 73.095 44.645 1.00 29.18 ? 58   TRP A CE3 1 
ATOM   414  C  CZ2 . TRP A 1 58  ? -17.333 72.876 47.204 1.00 28.77 ? 58   TRP A CZ2 1 
ATOM   415  C  CZ3 . TRP A 1 58  ? -19.012 72.197 45.597 1.00 32.24 ? 58   TRP A CZ3 1 
ATOM   416  C  CH2 . TRP A 1 58  ? -18.408 72.096 46.862 1.00 31.06 ? 58   TRP A CH2 1 
ATOM   417  N  N   . ASN A 1 59  ? -17.626 78.308 44.836 1.00 30.46 ? 59   ASN A N   1 
ATOM   418  C  CA  . ASN A 1 59  ? -16.933 79.343 45.584 1.00 30.51 ? 59   ASN A CA  1 
ATOM   419  C  C   . ASN A 1 59  ? -15.723 78.740 46.267 1.00 30.38 ? 59   ASN A C   1 
ATOM   420  O  O   . ASN A 1 59  ? -15.861 77.959 47.204 1.00 32.80 ? 59   ASN A O   1 
ATOM   421  C  CB  . ASN A 1 59  ? -17.846 79.995 46.618 1.00 31.73 ? 59   ASN A CB  1 
ATOM   422  C  CG  . ASN A 1 59  ? -17.303 81.336 47.105 1.00 35.83 ? 59   ASN A CG  1 
ATOM   423  O  OD1 . ASN A 1 59  ? -17.923 82.016 47.945 1.00 37.88 ? 59   ASN A OD1 1 
ATOM   424  N  ND2 . ASN A 1 59  ? -16.158 81.748 46.553 1.00 36.72 ? 59   ASN A ND2 1 
ATOM   425  N  N   . ALA A 1 60  ? -14.549 79.040 45.725 1.00 27.93 ? 60   ALA A N   1 
ATOM   426  C  CA  . ALA A 1 60  ? -13.289 78.559 46.254 1.00 26.03 ? 60   ALA A CA  1 
ATOM   427  C  C   . ALA A 1 60  ? -12.537 79.699 46.915 1.00 27.39 ? 60   ALA A C   1 
ATOM   428  O  O   . ALA A 1 60  ? -11.351 79.910 46.652 1.00 28.60 ? 60   ALA A O   1 
ATOM   429  C  CB  . ALA A 1 60  ? -12.455 77.962 45.142 1.00 23.51 ? 60   ALA A CB  1 
ATOM   430  N  N   . SER A 1 61  ? -13.212 80.430 47.791 1.00 28.57 ? 61   SER A N   1 
ATOM   431  C  CA  . SER A 1 61  ? -12.570 81.550 48.470 1.00 29.84 ? 61   SER A CA  1 
ATOM   432  C  C   . SER A 1 61  ? -12.281 81.319 49.950 1.00 30.27 ? 61   SER A C   1 
ATOM   433  O  O   . SER A 1 61  ? -11.682 82.182 50.601 1.00 33.82 ? 61   SER A O   1 
ATOM   434  C  CB  . SER A 1 61  ? -13.416 82.816 48.322 1.00 30.03 ? 61   SER A CB  1 
ATOM   435  O  OG  . SER A 1 61  ? -14.698 82.637 48.905 1.00 30.09 ? 61   SER A OG  1 
ATOM   436  N  N   . THR A 1 62  ? -12.714 80.188 50.498 1.00 28.81 ? 62   THR A N   1 
ATOM   437  C  CA  . THR A 1 62  ? -12.480 79.920 51.911 1.00 27.46 ? 62   THR A CA  1 
ATOM   438  C  C   . THR A 1 62  ? -12.007 78.506 52.153 1.00 25.92 ? 62   THR A C   1 
ATOM   439  O  O   . THR A 1 62  ? -12.607 77.553 51.664 1.00 25.72 ? 62   THR A O   1 
ATOM   440  C  CB  . THR A 1 62  ? -13.738 80.161 52.732 1.00 28.06 ? 62   THR A CB  1 
ATOM   441  O  OG1 . THR A 1 62  ? -14.834 79.457 52.136 1.00 30.56 ? 62   THR A OG1 1 
ATOM   442  C  CG2 . THR A 1 62  ? -14.056 81.649 52.784 1.00 29.78 ? 62   THR A CG2 1 
ATOM   443  N  N   . TYR A 1 63  ? -10.932 78.386 52.922 1.00 24.16 ? 63   TYR A N   1 
ATOM   444  C  CA  . TYR A 1 63  ? -10.330 77.103 53.241 1.00 21.94 ? 63   TYR A CA  1 
ATOM   445  C  C   . TYR A 1 63  ? -11.331 76.012 53.547 1.00 21.61 ? 63   TYR A C   1 
ATOM   446  O  O   . TYR A 1 63  ? -12.353 76.250 54.179 1.00 22.55 ? 63   TYR A O   1 
ATOM   447  C  CB  . TYR A 1 63  ? -9.390  77.253 54.418 1.00 22.31 ? 63   TYR A CB  1 
ATOM   448  C  CG  . TYR A 1 63  ? -8.009  77.719 54.054 1.00 23.73 ? 63   TYR A CG  1 
ATOM   449  C  CD1 . TYR A 1 63  ? -7.425  78.789 54.715 1.00 26.92 ? 63   TYR A CD1 1 
ATOM   450  C  CD2 . TYR A 1 63  ? -7.249  77.037 53.114 1.00 25.35 ? 63   TYR A CD2 1 
ATOM   451  C  CE1 . TYR A 1 63  ? -6.112  79.163 54.462 1.00 28.24 ? 63   TYR A CE1 1 
ATOM   452  C  CE2 . TYR A 1 63  ? -5.932  77.404 52.853 1.00 27.56 ? 63   TYR A CE2 1 
ATOM   453  C  CZ  . TYR A 1 63  ? -5.370  78.464 53.536 1.00 27.00 ? 63   TYR A CZ  1 
ATOM   454  O  OH  . TYR A 1 63  ? -4.052  78.805 53.331 1.00 28.90 ? 63   TYR A OH  1 
ATOM   455  N  N   . PRO A 1 64  ? -11.065 74.797 53.062 1.00 21.45 ? 64   PRO A N   1 
ATOM   456  C  CA  . PRO A 1 64  ? -11.960 73.666 53.298 1.00 22.64 ? 64   PRO A CA  1 
ATOM   457  C  C   . PRO A 1 64  ? -11.854 73.167 54.733 1.00 23.14 ? 64   PRO A C   1 
ATOM   458  O  O   . PRO A 1 64  ? -10.991 73.609 55.488 1.00 25.02 ? 64   PRO A O   1 
ATOM   459  C  CB  . PRO A 1 64  ? -11.437 72.621 52.317 1.00 22.24 ? 64   PRO A CB  1 
ATOM   460  C  CG  . PRO A 1 64  ? -9.969  72.919 52.247 1.00 21.01 ? 64   PRO A CG  1 
ATOM   461  C  CD  . PRO A 1 64  ? -9.950  74.419 52.174 1.00 20.70 ? 64   PRO A CD  1 
ATOM   462  N  N   . ASN A 1 65  ? -12.747 72.264 55.115 1.00 23.34 ? 65   ASN A N   1 
ATOM   463  C  CA  . ASN A 1 65  ? -12.709 71.704 56.454 1.00 22.19 ? 65   ASN A CA  1 
ATOM   464  C  C   . ASN A 1 65  ? -11.504 70.785 56.508 1.00 21.25 ? 65   ASN A C   1 
ATOM   465  O  O   . ASN A 1 65  ? -10.892 70.477 55.479 1.00 16.97 ? 65   ASN A O   1 
ATOM   466  C  CB  . ASN A 1 65  ? -13.964 70.881 56.753 1.00 25.38 ? 65   ASN A CB  1 
ATOM   467  C  CG  . ASN A 1 65  ? -15.198 71.738 56.999 1.00 28.71 ? 65   ASN A CG  1 
ATOM   468  O  OD1 . ASN A 1 65  ? -16.317 71.306 56.715 1.00 31.79 ? 65   ASN A OD1 1 
ATOM   469  N  ND2 . ASN A 1 65  ? -15.009 72.943 57.548 1.00 29.93 ? 65   ASN A ND2 1 
ATOM   470  N  N   . ASN A 1 66  ? -11.158 70.359 57.714 1.00 20.16 ? 66   ASN A N   1 
ATOM   471  C  CA  . ASN A 1 66  ? -10.035 69.466 57.900 1.00 19.82 ? 66   ASN A CA  1 
ATOM   472  C  C   . ASN A 1 66  ? -10.588 68.118 58.283 1.00 20.24 ? 66   ASN A C   1 
ATOM   473  O  O   . ASN A 1 66  ? -11.589 68.032 58.994 1.00 20.75 ? 66   ASN A O   1 
ATOM   474  C  CB  . ASN A 1 66  ? -9.120  69.984 58.997 1.00 19.15 ? 66   ASN A CB  1 
ATOM   475  C  CG  . ASN A 1 66  ? -8.415  71.258 58.607 1.00 20.69 ? 66   ASN A CG  1 
ATOM   476  O  OD1 . ASN A 1 66  ? -7.683  71.836 59.406 1.00 20.91 ? 66   ASN A OD1 1 
ATOM   477  N  ND2 . ASN A 1 66  ? -8.602  71.695 57.367 1.00 24.64 ? 66   ASN A ND2 1 
ATOM   478  N  N   . CYS A 1 67  ? -9.985  67.064 57.751 1.00 19.69 ? 67   CYS A N   1 
ATOM   479  C  CA  . CYS A 1 67  ? -10.435 65.724 58.065 1.00 19.55 ? 67   CYS A CA  1 
ATOM   480  C  C   . CYS A 1 67  ? -10.370 65.516 59.565 1.00 19.99 ? 67   CYS A C   1 
ATOM   481  O  O   . CYS A 1 67  ? -9.591  66.174 60.259 1.00 20.46 ? 67   CYS A O   1 
ATOM   482  C  CB  . CYS A 1 67  ? -9.552  64.695 57.376 1.00 19.80 ? 67   CYS A CB  1 
ATOM   483  S  SG  . CYS A 1 67  ? -9.523  64.876 55.575 1.00 17.95 ? 67   CYS A SG  1 
ATOM   484  N  N   . GLN A 1 68  ? -11.208 64.610 60.055 1.00 19.47 ? 68   GLN A N   1 
ATOM   485  C  CA  . GLN A 1 68  ? -11.249 64.277 61.460 1.00 17.16 ? 68   GLN A CA  1 
ATOM   486  C  C   . GLN A 1 68  ? -9.893  63.747 61.832 1.00 18.04 ? 68   GLN A C   1 
ATOM   487  O  O   . GLN A 1 68  ? -9.372  62.840 61.181 1.00 17.25 ? 68   GLN A O   1 
ATOM   488  C  CB  . GLN A 1 68  ? -12.277 63.193 61.702 1.00 14.80 ? 68   GLN A CB  1 
ATOM   489  C  CG  . GLN A 1 68  ? -13.668 63.660 61.504 1.00 14.75 ? 68   GLN A CG  1 
ATOM   490  C  CD  . GLN A 1 68  ? -14.093 64.690 62.516 1.00 14.80 ? 68   GLN A CD  1 
ATOM   491  O  OE1 . GLN A 1 68  ? -15.171 65.240 62.404 1.00 20.41 ? 68   GLN A OE1 1 
ATOM   492  N  NE2 . GLN A 1 68  ? -13.281 64.921 63.537 1.00 17.23 ? 68   GLN A NE2 1 
ATOM   493  N  N   . GLN A 1 69  ? -9.319  64.303 62.885 1.00 19.16 ? 69   GLN A N   1 
ATOM   494  C  CA  . GLN A 1 69  ? -8.006  63.868 63.317 1.00 22.29 ? 69   GLN A CA  1 
ATOM   495  C  C   . GLN A 1 69  ? -7.838  64.111 64.798 1.00 24.73 ? 69   GLN A C   1 
ATOM   496  O  O   . GLN A 1 69  ? -8.596  64.865 65.409 1.00 26.96 ? 69   GLN A O   1 
ATOM   497  C  CB  . GLN A 1 69  ? -6.916  64.626 62.550 1.00 18.54 ? 69   GLN A CB  1 
ATOM   498  C  CG  . GLN A 1 69  ? -7.023  66.138 62.659 1.00 17.65 ? 69   GLN A CG  1 
ATOM   499  C  CD  . GLN A 1 69  ? -5.838  66.854 62.064 1.00 15.15 ? 69   GLN A CD  1 
ATOM   500  O  OE1 . GLN A 1 69  ? -4.742  66.832 62.607 1.00 17.15 ? 69   GLN A OE1 1 
ATOM   501  N  NE2 . GLN A 1 69  ? -6.055  67.503 60.952 1.00 19.17 ? 69   GLN A NE2 1 
ATOM   502  N  N   . TYR A 1 70  ? -6.853  63.438 65.370 1.00 25.77 ? 70   TYR A N   1 
ATOM   503  C  CA  . TYR A 1 70  ? -6.528  63.581 66.769 1.00 25.20 ? 70   TYR A CA  1 
ATOM   504  C  C   . TYR A 1 70  ? -5.933  64.976 66.991 1.00 24.70 ? 70   TYR A C   1 
ATOM   505  O  O   . TYR A 1 70  ? -4.832  65.260 66.532 1.00 25.38 ? 70   TYR A O   1 
ATOM   506  C  CB  . TYR A 1 70  ? -5.505  62.509 67.138 1.00 27.89 ? 70   TYR A CB  1 
ATOM   507  C  CG  . TYR A 1 70  ? -4.879  62.681 68.503 1.00 31.63 ? 70   TYR A CG  1 
ATOM   508  C  CD1 . TYR A 1 70  ? -5.603  62.407 69.659 1.00 32.86 ? 70   TYR A CD1 1 
ATOM   509  C  CD2 . TYR A 1 70  ? -3.558  63.110 68.637 1.00 32.92 ? 70   TYR A CD2 1 
ATOM   510  C  CE1 . TYR A 1 70  ? -5.031  62.554 70.914 1.00 33.93 ? 70   TYR A CE1 1 
ATOM   511  C  CE2 . TYR A 1 70  ? -2.974  63.262 69.890 1.00 33.64 ? 70   TYR A CE2 1 
ATOM   512  C  CZ  . TYR A 1 70  ? -3.719  62.980 71.025 1.00 34.72 ? 70   TYR A CZ  1 
ATOM   513  O  OH  . TYR A 1 70  ? -3.154  63.106 72.276 1.00 37.90 ? 70   TYR A OH  1 
ATOM   514  N  N   . VAL A 1 71  ? -6.674  65.869 67.637 1.00 25.30 ? 71   VAL A N   1 
ATOM   515  C  CA  . VAL A 1 71  ? -6.135  67.200 67.915 1.00 24.74 ? 71   VAL A CA  1 
ATOM   516  C  C   . VAL A 1 71  ? -5.020  66.944 68.924 1.00 24.81 ? 71   VAL A C   1 
ATOM   517  O  O   . VAL A 1 71  ? -4.971  65.870 69.541 1.00 27.49 ? 71   VAL A O   1 
ATOM   518  C  CB  . VAL A 1 71  ? -7.166  68.126 68.581 1.00 23.22 ? 71   VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 71  ? -6.755  69.574 68.416 1.00 22.67 ? 71   VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 71  ? -8.534  67.903 68.005 1.00 25.61 ? 71   VAL A CG2 1 
ATOM   521  N  N   . ASP A 1 72  ? -4.159  67.923 69.143 1.00 22.65 ? 72   ASP A N   1 
ATOM   522  C  CA  . ASP A 1 72  ? -3.063  67.735 70.072 1.00 21.01 ? 72   ASP A CA  1 
ATOM   523  C  C   . ASP A 1 72  ? -3.135  68.738 71.196 1.00 22.71 ? 72   ASP A C   1 
ATOM   524  O  O   . ASP A 1 72  ? -2.641  69.861 71.079 1.00 23.88 ? 72   ASP A O   1 
ATOM   525  C  CB  . ASP A 1 72  ? -1.729  67.840 69.346 1.00 19.73 ? 72   ASP A CB  1 
ATOM   526  C  CG  . ASP A 1 72  ? -0.569  67.945 70.293 1.00 18.71 ? 72   ASP A CG  1 
ATOM   527  O  OD1 . ASP A 1 72  ? 0.213   68.914 70.188 1.00 18.12 ? 72   ASP A OD1 1 
ATOM   528  O  OD2 . ASP A 1 72  ? -0.460  67.066 71.164 1.00 21.67 ? 72   ASP A OD2 1 
ATOM   529  N  N   . GLU A 1 73  ? -3.714  68.302 72.309 1.00 24.94 ? 73   GLU A N   1 
ATOM   530  C  CA  . GLU A 1 73  ? -3.881  69.150 73.483 1.00 24.36 ? 73   GLU A CA  1 
ATOM   531  C  C   . GLU A 1 73  ? -2.686  69.091 74.419 1.00 26.08 ? 73   GLU A C   1 
ATOM   532  O  O   . GLU A 1 73  ? -2.692  69.729 75.465 1.00 29.04 ? 73   GLU A O   1 
ATOM   533  C  CB  . GLU A 1 73  ? -5.148  68.763 74.244 1.00 21.11 ? 73   GLU A CB  1 
ATOM   534  C  CG  . GLU A 1 73  ? -6.348  68.558 73.353 1.00 24.03 ? 73   GLU A CG  1 
ATOM   535  C  CD  . GLU A 1 73  ? -7.597  69.191 73.897 1.00 24.74 ? 73   GLU A CD  1 
ATOM   536  O  OE1 . GLU A 1 73  ? -8.390  68.480 74.547 1.00 26.50 ? 73   GLU A OE1 1 
ATOM   537  O  OE2 . GLU A 1 73  ? -7.788  70.406 73.670 1.00 29.23 ? 73   GLU A OE2 1 
ATOM   538  N  N   . GLN A 1 74  ? -1.642  68.368 74.030 1.00 25.26 ? 74   GLN A N   1 
ATOM   539  C  CA  . GLN A 1 74  ? -0.457  68.251 74.872 1.00 25.81 ? 74   GLN A CA  1 
ATOM   540  C  C   . GLN A 1 74  ? 0.157   69.567 75.342 1.00 25.90 ? 74   GLN A C   1 
ATOM   541  O  O   . GLN A 1 74  ? 0.924   69.568 76.292 1.00 29.69 ? 74   GLN A O   1 
ATOM   542  C  CB  . GLN A 1 74  ? 0.599   67.410 74.179 1.00 27.03 ? 74   GLN A CB  1 
ATOM   543  C  CG  . GLN A 1 74  ? 0.774   66.034 74.787 1.00 29.05 ? 74   GLN A CG  1 
ATOM   544  C  CD  . GLN A 1 74  ? 1.738   66.027 75.953 1.00 28.72 ? 74   GLN A CD  1 
ATOM   545  O  OE1 . GLN A 1 74  ? 2.225   67.072 76.367 1.00 29.39 ? 74   GLN A OE1 1 
ATOM   546  N  NE2 . GLN A 1 74  ? 2.063   64.835 76.452 1.00 28.09 ? 74   GLN A NE2 1 
ATOM   547  N  N   . PHE A 1 75  ? -0.131  70.672 74.662 1.00 24.82 ? 75   PHE A N   1 
ATOM   548  C  CA  . PHE A 1 75  ? 0.393   71.983 75.056 1.00 24.39 ? 75   PHE A CA  1 
ATOM   549  C  C   . PHE A 1 75  ? -0.580  73.036 74.527 1.00 26.28 ? 75   PHE A C   1 
ATOM   550  O  O   . PHE A 1 75  ? -0.239  73.825 73.652 1.00 26.53 ? 75   PHE A O   1 
ATOM   551  C  CB  . PHE A 1 75  ? 1.795   72.226 74.476 1.00 23.48 ? 75   PHE A CB  1 
ATOM   552  C  CG  . PHE A 1 75  ? 2.823   71.212 74.905 1.00 22.46 ? 75   PHE A CG  1 
ATOM   553  C  CD1 . PHE A 1 75  ? 3.184   70.168 74.064 1.00 22.47 ? 75   PHE A CD1 1 
ATOM   554  C  CD2 . PHE A 1 75  ? 3.413   71.287 76.150 1.00 21.08 ? 75   PHE A CD2 1 
ATOM   555  C  CE1 . PHE A 1 75  ? 4.114   69.213 74.458 1.00 20.07 ? 75   PHE A CE1 1 
ATOM   556  C  CE2 . PHE A 1 75  ? 4.344   70.337 76.549 1.00 21.94 ? 75   PHE A CE2 1 
ATOM   557  C  CZ  . PHE A 1 75  ? 4.692   69.296 75.699 1.00 20.68 ? 75   PHE A CZ  1 
ATOM   558  N  N   . PRO A 1 76  ? -1.795  73.093 75.100 1.00 27.31 ? 76   PRO A N   1 
ATOM   559  C  CA  . PRO A 1 76  ? -2.866  74.019 74.729 1.00 26.61 ? 76   PRO A CA  1 
ATOM   560  C  C   . PRO A 1 76  ? -2.409  75.440 74.481 1.00 27.31 ? 76   PRO A C   1 
ATOM   561  O  O   . PRO A 1 76  ? -1.742  76.040 75.320 1.00 29.01 ? 76   PRO A O   1 
ATOM   562  C  CB  . PRO A 1 76  ? -3.793  73.958 75.935 1.00 24.90 ? 76   PRO A CB  1 
ATOM   563  C  CG  . PRO A 1 76  ? -3.654  72.570 76.375 1.00 25.77 ? 76   PRO A CG  1 
ATOM   564  C  CD  . PRO A 1 76  ? -2.155  72.395 76.345 1.00 27.93 ? 76   PRO A CD  1 
ATOM   565  N  N   . GLY A 1 77  ? -2.750  75.970 73.312 1.00 27.80 ? 77   GLY A N   1 
ATOM   566  C  CA  . GLY A 1 77  ? -2.383  77.339 73.003 1.00 26.00 ? 77   GLY A CA  1 
ATOM   567  C  C   . GLY A 1 77  ? -0.919  77.557 72.694 1.00 23.78 ? 77   GLY A C   1 
ATOM   568  O  O   . GLY A 1 77  ? -0.532  78.655 72.266 1.00 24.38 ? 77   GLY A O   1 
ATOM   569  N  N   . PHE A 1 78  ? -0.102  76.539 72.931 1.00 19.68 ? 78   PHE A N   1 
ATOM   570  C  CA  . PHE A 1 78  ? 1.309   76.640 72.639 1.00 16.83 ? 78   PHE A CA  1 
ATOM   571  C  C   . PHE A 1 78  ? 1.441   76.507 71.129 1.00 18.10 ? 78   PHE A C   1 
ATOM   572  O  O   . PHE A 1 78  ? 1.086   75.474 70.564 1.00 18.11 ? 78   PHE A O   1 
ATOM   573  C  CB  . PHE A 1 78  ? 2.067   75.522 73.334 1.00 14.43 ? 78   PHE A CB  1 
ATOM   574  C  CG  . PHE A 1 78  ? 3.520   75.467 72.984 1.00 11.88 ? 78   PHE A CG  1 
ATOM   575  C  CD1 . PHE A 1 78  ? 4.300   76.610 73.023 1.00 8.74  ? 78   PHE A CD1 1 
ATOM   576  C  CD2 . PHE A 1 78  ? 4.111   74.271 72.626 1.00 11.25 ? 78   PHE A CD2 1 
ATOM   577  C  CE1 . PHE A 1 78  ? 5.643   76.559 72.711 1.00 7.53  ? 78   PHE A CE1 1 
ATOM   578  C  CE2 . PHE A 1 78  ? 5.452   74.218 72.315 1.00 9.28  ? 78   PHE A CE2 1 
ATOM   579  C  CZ  . PHE A 1 78  ? 6.218   75.366 72.358 1.00 8.15  ? 78   PHE A CZ  1 
ATOM   580  N  N   . SER A 1 79  ? 1.912   77.565 70.472 1.00 20.10 ? 79   SER A N   1 
ATOM   581  C  CA  . SER A 1 79  ? 2.085   77.560 69.023 1.00 21.65 ? 79   SER A CA  1 
ATOM   582  C  C   . SER A 1 79  ? 2.752   76.274 68.559 1.00 20.97 ? 79   SER A C   1 
ATOM   583  O  O   . SER A 1 79  ? 2.151   75.480 67.844 1.00 21.09 ? 79   SER A O   1 
ATOM   584  C  CB  . SER A 1 79  ? 2.955   78.733 68.586 1.00 24.39 ? 79   SER A CB  1 
ATOM   585  O  OG  . SER A 1 79  ? 2.510   79.943 69.162 1.00 33.69 ? 79   SER A OG  1 
ATOM   586  N  N   . GLY A 1 80  ? 3.974   76.053 69.025 1.00 18.61 ? 80   GLY A N   1 
ATOM   587  C  CA  . GLY A 1 80  ? 4.718   74.876 68.641 1.00 15.68 ? 80   GLY A CA  1 
ATOM   588  C  C   . GLY A 1 80  ? 3.891   73.630 68.432 1.00 16.25 ? 80   GLY A C   1 
ATOM   589  O  O   . GLY A 1 80  ? 4.241   72.813 67.595 1.00 18.81 ? 80   GLY A O   1 
ATOM   590  N  N   . SER A 1 81  ? 2.812   73.466 69.190 1.00 16.74 ? 81   SER A N   1 
ATOM   591  C  CA  . SER A 1 81  ? 1.971   72.290 69.042 1.00 18.62 ? 81   SER A CA  1 
ATOM   592  C  C   . SER A 1 81  ? 0.713   72.630 68.244 1.00 20.96 ? 81   SER A C   1 
ATOM   593  O  O   . SER A 1 81  ? 0.316   71.898 67.325 1.00 20.42 ? 81   SER A O   1 
ATOM   594  C  CB  . SER A 1 81  ? 1.595   71.725 70.417 1.00 17.21 ? 81   SER A CB  1 
ATOM   595  O  OG  . SER A 1 81  ? 0.470   72.379 70.984 1.00 13.65 ? 81   SER A OG  1 
ATOM   596  N  N   . GLU A 1 82  ? 0.091   73.749 68.605 1.00 23.43 ? 82   GLU A N   1 
ATOM   597  C  CA  . GLU A 1 82  ? -1.133  74.215 67.960 1.00 25.03 ? 82   GLU A CA  1 
ATOM   598  C  C   . GLU A 1 82  ? -0.980  74.510 66.469 1.00 22.52 ? 82   GLU A C   1 
ATOM   599  O  O   . GLU A 1 82  ? -1.877  74.236 65.678 1.00 24.15 ? 82   GLU A O   1 
ATOM   600  C  CB  . GLU A 1 82  ? -1.692  75.446 68.690 1.00 28.65 ? 82   GLU A CB  1 
ATOM   601  C  CG  . GLU A 1 82  ? -2.326  75.141 70.056 1.00 33.16 ? 82   GLU A CG  1 
ATOM   602  C  CD  . GLU A 1 82  ? -3.507  74.154 69.973 1.00 39.14 ? 82   GLU A CD  1 
ATOM   603  O  OE1 . GLU A 1 82  ? -4.347  74.281 69.033 1.00 41.47 ? 82   GLU A OE1 1 
ATOM   604  O  OE2 . GLU A 1 82  ? -3.594  73.250 70.850 1.00 39.92 ? 82   GLU A OE2 1 
ATOM   605  N  N   . MET A 1 83  ? 0.182   75.000 66.076 1.00 20.49 ? 83   MET A N   1 
ATOM   606  C  CA  . MET A 1 83  ? 0.431   75.329 64.684 1.00 21.08 ? 83   MET A CA  1 
ATOM   607  C  C   . MET A 1 83  ? 0.153   74.144 63.775 1.00 21.13 ? 83   MET A C   1 
ATOM   608  O  O   . MET A 1 83  ? -0.021  74.326 62.566 1.00 24.30 ? 83   MET A O   1 
ATOM   609  C  CB  . MET A 1 83  ? 1.878   75.792 64.496 1.00 20.23 ? 83   MET A CB  1 
ATOM   610  C  CG  . MET A 1 83  ? 2.884   74.672 64.510 1.00 19.56 ? 83   MET A CG  1 
ATOM   611  S  SD  . MET A 1 83  ? 4.581   75.236 64.540 1.00 24.64 ? 83   MET A SD  1 
ATOM   612  C  CE  . MET A 1 83  ? 4.652   76.305 63.087 1.00 22.52 ? 83   MET A CE  1 
ATOM   613  N  N   . TRP A 1 84  ? 0.130   72.943 64.356 1.00 19.17 ? 84   TRP A N   1 
ATOM   614  C  CA  . TRP A 1 84  ? -0.114  71.709 63.611 1.00 18.24 ? 84   TRP A CA  1 
ATOM   615  C  C   . TRP A 1 84  ? -1.521  71.125 63.757 1.00 18.97 ? 84   TRP A C   1 
ATOM   616  O  O   . TRP A 1 84  ? -1.853  70.136 63.096 1.00 19.42 ? 84   TRP A O   1 
ATOM   617  C  CB  . TRP A 1 84  ? 0.884   70.638 64.035 1.00 15.92 ? 84   TRP A CB  1 
ATOM   618  C  CG  . TRP A 1 84  ? 2.280   71.085 63.976 1.00 17.37 ? 84   TRP A CG  1 
ATOM   619  C  CD1 . TRP A 1 84  ? 3.082   71.381 65.030 1.00 17.36 ? 84   TRP A CD1 1 
ATOM   620  C  CD2 . TRP A 1 84  ? 3.060   71.304 62.799 1.00 17.59 ? 84   TRP A CD2 1 
ATOM   621  N  NE1 . TRP A 1 84  ? 4.317   71.775 64.587 1.00 18.25 ? 84   TRP A NE1 1 
ATOM   622  C  CE2 . TRP A 1 84  ? 4.331   71.736 63.218 1.00 18.24 ? 84   TRP A CE2 1 
ATOM   623  C  CE3 . TRP A 1 84  ? 2.807   71.182 61.428 1.00 18.02 ? 84   TRP A CE3 1 
ATOM   624  C  CZ2 . TRP A 1 84  ? 5.347   72.049 62.318 1.00 17.69 ? 84   TRP A CZ2 1 
ATOM   625  C  CZ3 . TRP A 1 84  ? 3.810   71.491 60.537 1.00 16.98 ? 84   TRP A CZ3 1 
ATOM   626  C  CH2 . TRP A 1 84  ? 5.066   71.920 60.985 1.00 19.54 ? 84   TRP A CH2 1 
ATOM   627  N  N   . ASN A 1 85  ? -2.322  71.692 64.650 1.00 18.70 ? 85   ASN A N   1 
ATOM   628  C  CA  . ASN A 1 85  ? -3.673  71.196 64.881 1.00 18.19 ? 85   ASN A CA  1 
ATOM   629  C  C   . ASN A 1 85  ? -4.637  71.746 63.851 1.00 18.34 ? 85   ASN A C   1 
ATOM   630  O  O   . ASN A 1 85  ? -4.509  72.901 63.433 1.00 17.47 ? 85   ASN A O   1 
ATOM   631  C  CB  . ASN A 1 85  ? -4.172  71.606 66.269 1.00 20.92 ? 85   ASN A CB  1 
ATOM   632  C  CG  . ASN A 1 85  ? -3.528  70.821 67.377 1.00 21.00 ? 85   ASN A CG  1 
ATOM   633  O  OD1 . ASN A 1 85  ? -3.531  69.598 67.360 1.00 20.97 ? 85   ASN A OD1 1 
ATOM   634  N  ND2 . ASN A 1 85  ? -2.991  71.522 68.364 1.00 21.97 ? 85   ASN A ND2 1 
ATOM   635  N  N   . PRO A 1 86  ? -5.636  70.942 63.455 1.00 16.78 ? 86   PRO A N   1 
ATOM   636  C  CA  . PRO A 1 86  ? -6.613  71.388 62.473 1.00 18.07 ? 86   PRO A CA  1 
ATOM   637  C  C   . PRO A 1 86  ? -7.146  72.728 62.918 1.00 19.64 ? 86   PRO A C   1 
ATOM   638  O  O   . PRO A 1 86  ? -7.596  72.873 64.052 1.00 22.90 ? 86   PRO A O   1 
ATOM   639  C  CB  . PRO A 1 86  ? -7.682  70.292 62.518 1.00 17.94 ? 86   PRO A CB  1 
ATOM   640  C  CG  . PRO A 1 86  ? -7.480  69.634 63.835 1.00 18.26 ? 86   PRO A CG  1 
ATOM   641  C  CD  . PRO A 1 86  ? -5.994  69.614 63.968 1.00 18.44 ? 86   PRO A CD  1 
ATOM   642  N  N   . ASN A 1 87  ? -6.991  73.719 62.046 1.00 19.78 ? 87   ASN A N   1 
ATOM   643  C  CA  . ASN A 1 87  ? -7.419  75.082 62.312 1.00 18.43 ? 87   ASN A CA  1 
ATOM   644  C  C   . ASN A 1 87  ? -8.744  75.493 61.674 1.00 18.82 ? 87   ASN A C   1 
ATOM   645  O  O   . ASN A 1 87  ? -9.026  76.685 61.541 1.00 20.75 ? 87   ASN A O   1 
ATOM   646  C  CB  . ASN A 1 87  ? -6.327  76.042 61.862 1.00 18.79 ? 87   ASN A CB  1 
ATOM   647  C  CG  . ASN A 1 87  ? -6.137  76.047 60.368 1.00 18.72 ? 87   ASN A CG  1 
ATOM   648  O  OD1 . ASN A 1 87  ? -5.529  76.959 59.828 1.00 22.29 ? 87   ASN A OD1 1 
ATOM   649  N  ND2 . ASN A 1 87  ? -6.635  75.021 59.688 1.00 19.78 ? 87   ASN A ND2 1 
ATOM   650  N  N   . ARG A 1 88  ? -9.518  74.516 61.220 1.00 16.67 ? 88   ARG A N   1 
ATOM   651  C  CA  . ARG A 1 88  ? -10.827 74.761 60.616 1.00 15.61 ? 88   ARG A CA  1 
ATOM   652  C  C   . ARG A 1 88  ? -11.714 73.683 61.242 1.00 16.53 ? 88   ARG A C   1 
ATOM   653  O  O   . ARG A 1 88  ? -11.199 72.747 61.856 1.00 18.55 ? 88   ARG A O   1 
ATOM   654  C  CB  . ARG A 1 88  ? -10.804 74.575 59.080 1.00 16.68 ? 88   ARG A CB  1 
ATOM   655  C  CG  . ARG A 1 88  ? -9.878  75.481 58.280 1.00 13.18 ? 88   ARG A CG  1 
ATOM   656  C  CD  . ARG A 1 88  ? -10.014 76.941 58.688 1.00 20.05 ? 88   ARG A CD  1 
ATOM   657  N  NE  . ARG A 1 88  ? -10.728 77.805 57.749 1.00 19.33 ? 88   ARG A NE  1 
ATOM   658  C  CZ  . ARG A 1 88  ? -12.007 77.668 57.407 1.00 23.34 ? 88   ARG A CZ  1 
ATOM   659  N  NH1 . ARG A 1 88  ? -12.749 76.684 57.907 1.00 24.17 ? 88   ARG A NH1 1 
ATOM   660  N  NH2 . ARG A 1 88  ? -12.570 78.567 56.612 1.00 25.20 ? 88   ARG A NH2 1 
ATOM   661  N  N   . GLU A 1 89  ? -13.032 73.793 61.090 1.00 16.32 ? 89   GLU A N   1 
ATOM   662  C  CA  . GLU A 1 89  ? -13.943 72.800 61.660 1.00 14.66 ? 89   GLU A CA  1 
ATOM   663  C  C   . GLU A 1 89  ? -13.672 71.443 61.047 1.00 12.19 ? 89   GLU A C   1 
ATOM   664  O  O   . GLU A 1 89  ? -13.744 71.286 59.838 1.00 16.48 ? 89   GLU A O   1 
ATOM   665  C  CB  . GLU A 1 89  ? -15.403 73.194 61.416 1.00 15.24 ? 89   GLU A CB  1 
ATOM   666  C  CG  . GLU A 1 89  ? -16.416 72.170 61.898 1.00 15.36 ? 89   GLU A CG  1 
ATOM   667  N  N   . MET A 1 90  ? -13.281 70.484 61.865 1.00 10.76 ? 90   MET A N   1 
ATOM   668  C  CA  . MET A 1 90  ? -13.028 69.159 61.352 1.00 12.23 ? 90   MET A CA  1 
ATOM   669  C  C   . MET A 1 90  ? -14.345 68.607 60.867 1.00 13.62 ? 90   MET A C   1 
ATOM   670  O  O   . MET A 1 90  ? -15.395 68.938 61.409 1.00 14.37 ? 90   MET A O   1 
ATOM   671  C  CB  . MET A 1 90  ? -12.464 68.246 62.427 1.00 13.55 ? 90   MET A CB  1 
ATOM   672  C  CG  . MET A 1 90  ? -11.039 68.533 62.781 1.00 16.22 ? 90   MET A CG  1 
ATOM   673  S  SD  . MET A 1 90  ? -10.445 67.322 63.961 1.00 24.43 ? 90   MET A SD  1 
ATOM   674  C  CE  . MET A 1 90  ? -10.767 68.213 65.481 1.00 24.91 ? 90   MET A CE  1 
ATOM   675  N  N   . SER A 1 91  ? -14.279 67.798 59.819 1.00 15.25 ? 91   SER A N   1 
ATOM   676  C  CA  . SER A 1 91  ? -15.449 67.174 59.215 1.00 15.34 ? 91   SER A CA  1 
ATOM   677  C  C   . SER A 1 91  ? -14.897 66.023 58.404 1.00 14.15 ? 91   SER A C   1 
ATOM   678  O  O   . SER A 1 91  ? -13.715 66.022 58.072 1.00 13.90 ? 91   SER A O   1 
ATOM   679  C  CB  . SER A 1 91  ? -16.164 68.166 58.290 1.00 16.05 ? 91   SER A CB  1 
ATOM   680  O  OG  . SER A 1 91  ? -17.417 67.663 57.848 1.00 21.03 ? 91   SER A OG  1 
ATOM   681  N  N   . GLU A 1 92  ? -15.713 65.005 58.162 1.00 15.08 ? 92   GLU A N   1 
ATOM   682  C  CA  . GLU A 1 92  ? -15.269 63.861 57.363 1.00 16.31 ? 92   GLU A CA  1 
ATOM   683  C  C   . GLU A 1 92  ? -15.252 64.318 55.906 1.00 16.38 ? 92   GLU A C   1 
ATOM   684  O  O   . GLU A 1 92  ? -14.527 63.777 55.069 1.00 13.48 ? 92   GLU A O   1 
ATOM   685  C  CB  . GLU A 1 92  ? -16.220 62.685 57.529 1.00 18.63 ? 92   GLU A CB  1 
ATOM   686  C  CG  . GLU A 1 92  ? -16.318 62.160 58.936 1.00 17.92 ? 92   GLU A CG  1 
ATOM   687  C  CD  . GLU A 1 92  ? -16.701 60.711 58.950 1.00 18.52 ? 92   GLU A CD  1 
ATOM   688  O  OE1 . GLU A 1 92  ? -17.907 60.413 58.941 1.00 18.95 ? 92   GLU A OE1 1 
ATOM   689  O  OE2 . GLU A 1 92  ? -15.788 59.868 58.937 1.00 20.56 ? 92   GLU A OE2 1 
ATOM   690  N  N   . ASP A 1 93  ? -16.087 65.319 55.637 1.00 15.64 ? 93   ASP A N   1 
ATOM   691  C  CA  . ASP A 1 93  ? -16.213 65.962 54.345 1.00 15.52 ? 93   ASP A CA  1 
ATOM   692  C  C   . ASP A 1 93  ? -15.034 66.921 54.316 1.00 16.86 ? 93   ASP A C   1 
ATOM   693  O  O   . ASP A 1 93  ? -15.186 68.125 54.509 1.00 17.79 ? 93   ASP A O   1 
ATOM   694  C  CB  . ASP A 1 93  ? -17.520 66.746 54.305 1.00 16.17 ? 93   ASP A CB  1 
ATOM   695  C  CG  . ASP A 1 93  ? -17.655 67.598 53.068 1.00 20.48 ? 93   ASP A CG  1 
ATOM   696  O  OD1 . ASP A 1 93  ? -18.537 68.486 53.058 1.00 25.65 ? 93   ASP A OD1 1 
ATOM   697  O  OD2 . ASP A 1 93  ? -16.892 67.387 52.099 1.00 23.22 ? 93   ASP A OD2 1 
ATOM   698  N  N   . CYS A 1 94  ? -13.860 66.384 54.037 1.00 16.58 ? 94   CYS A N   1 
ATOM   699  C  CA  . CYS A 1 94  ? -12.664 67.191 54.042 1.00 15.68 ? 94   CYS A CA  1 
ATOM   700  C  C   . CYS A 1 94  ? -11.821 67.034 52.814 1.00 16.13 ? 94   CYS A C   1 
ATOM   701  O  O   . CYS A 1 94  ? -10.778 67.672 52.709 1.00 18.15 ? 94   CYS A O   1 
ATOM   702  C  CB  . CYS A 1 94  ? -11.822 66.758 55.214 1.00 18.47 ? 94   CYS A CB  1 
ATOM   703  S  SG  . CYS A 1 94  ? -11.493 64.974 55.130 1.00 17.48 ? 94   CYS A SG  1 
ATOM   704  N  N   . LEU A 1 95  ? -12.223 66.153 51.911 1.00 15.16 ? 95   LEU A N   1 
ATOM   705  C  CA  . LEU A 1 95  ? -11.447 65.920 50.707 1.00 12.47 ? 95   LEU A CA  1 
ATOM   706  C  C   . LEU A 1 95  ? -11.543 67.065 49.721 1.00 14.00 ? 95   LEU A C   1 
ATOM   707  O  O   . LEU A 1 95  ? -12.322 67.008 48.778 1.00 15.86 ? 95   LEU A O   1 
ATOM   708  C  CB  . LEU A 1 95  ? -11.879 64.618 50.066 1.00 9.51  ? 95   LEU A CB  1 
ATOM   709  C  CG  . LEU A 1 95  ? -11.425 63.427 50.881 1.00 6.16  ? 95   LEU A CG  1 
ATOM   710  C  CD1 . LEU A 1 95  ? -11.865 62.153 50.213 1.00 9.97  ? 95   LEU A CD1 1 
ATOM   711  C  CD2 . LEU A 1 95  ? -9.933  63.482 50.992 1.00 4.14  ? 95   LEU A CD2 1 
ATOM   712  N  N   . TYR A 1 96  ? -10.764 68.115 49.961 1.00 13.70 ? 96   TYR A N   1 
ATOM   713  C  CA  . TYR A 1 96  ? -10.742 69.299 49.109 1.00 14.47 ? 96   TYR A CA  1 
ATOM   714  C  C   . TYR A 1 96  ? -9.306  69.770 48.923 1.00 14.49 ? 96   TYR A C   1 
ATOM   715  O  O   . TYR A 1 96  ? -8.518  69.752 49.865 1.00 18.31 ? 96   TYR A O   1 
ATOM   716  C  CB  . TYR A 1 96  ? -11.519 70.444 49.757 1.00 13.76 ? 96   TYR A CB  1 
ATOM   717  C  CG  . TYR A 1 96  ? -12.987 70.200 49.982 1.00 13.99 ? 96   TYR A CG  1 
ATOM   718  C  CD1 . TYR A 1 96  ? -13.428 69.339 50.974 1.00 14.96 ? 96   TYR A CD1 1 
ATOM   719  C  CD2 . TYR A 1 96  ? -13.932 70.862 49.222 1.00 15.97 ? 96   TYR A CD2 1 
ATOM   720  C  CE1 . TYR A 1 96  ? -14.772 69.142 51.200 1.00 17.73 ? 96   TYR A CE1 1 
ATOM   721  C  CE2 . TYR A 1 96  ? -15.277 70.680 49.438 1.00 19.94 ? 96   TYR A CE2 1 
ATOM   722  C  CZ  . TYR A 1 96  ? -15.698 69.819 50.426 1.00 20.48 ? 96   TYR A CZ  1 
ATOM   723  O  OH  . TYR A 1 96  ? -17.053 69.639 50.626 1.00 24.19 ? 96   TYR A OH  1 
ATOM   724  N  N   . LEU A 1 97  ? -8.976  70.235 47.727 1.00 12.75 ? 97   LEU A N   1 
ATOM   725  C  CA  . LEU A 1 97  ? -7.641  70.721 47.473 1.00 12.95 ? 97   LEU A CA  1 
ATOM   726  C  C   . LEU A 1 97  ? -7.628  72.238 47.391 1.00 13.72 ? 97   LEU A C   1 
ATOM   727  O  O   . LEU A 1 97  ? -8.673  72.865 47.241 1.00 14.21 ? 97   LEU A O   1 
ATOM   728  C  CB  . LEU A 1 97  ? -7.064  70.071 46.217 1.00 15.65 ? 97   LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 97  ? -7.820  70.105 44.892 1.00 14.83 ? 97   LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 97  ? -7.496  71.371 44.134 1.00 14.08 ? 97   LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 97  ? -7.401  68.903 44.072 1.00 14.58 ? 97   LEU A CD2 1 
ATOM   732  N  N   . ASN A 1 98  ? -6.441  72.819 47.517 1.00 15.10 ? 98   ASN A N   1 
ATOM   733  C  CA  . ASN A 1 98  ? -6.260  74.262 47.486 1.00 17.10 ? 98   ASN A CA  1 
ATOM   734  C  C   . ASN A 1 98  ? -5.241  74.591 46.408 1.00 19.53 ? 98   ASN A C   1 
ATOM   735  O  O   . ASN A 1 98  ? -4.222  73.915 46.310 1.00 22.80 ? 98   ASN A O   1 
ATOM   736  C  CB  . ASN A 1 98  ? -5.725  74.742 48.836 1.00 18.37 ? 98   ASN A CB  1 
ATOM   737  C  CG  . ASN A 1 98  ? -6.596  74.315 49.996 1.00 18.90 ? 98   ASN A CG  1 
ATOM   738  O  OD1 . ASN A 1 98  ? -7.813  74.506 49.971 1.00 20.19 ? 98   ASN A OD1 1 
ATOM   739  N  ND2 . ASN A 1 98  ? -5.981  73.742 51.023 1.00 14.83 ? 98   ASN A ND2 1 
ATOM   740  N  N   . ILE A 1 99  ? -5.466  75.668 45.657 1.00 19.65 ? 99   ILE A N   1 
ATOM   741  C  CA  . ILE A 1 99  ? -4.563  76.055 44.573 1.00 18.29 ? 99   ILE A CA  1 
ATOM   742  C  C   . ILE A 1 99  ? -4.165  77.533 44.609 1.00 17.90 ? 99   ILE A C   1 
ATOM   743  O  O   . ILE A 1 99  ? -5.010  78.414 44.468 1.00 19.70 ? 99   ILE A O   1 
ATOM   744  C  CB  . ILE A 1 99  ? -5.233  75.795 43.196 1.00 19.85 ? 99   ILE A CB  1 
ATOM   745  C  CG1 . ILE A 1 99  ? -5.841  74.387 43.154 1.00 17.99 ? 99   ILE A CG1 1 
ATOM   746  C  CG2 . ILE A 1 99  ? -4.229  76.006 42.067 1.00 18.90 ? 99   ILE A CG2 1 
ATOM   747  C  CD1 . ILE A 1 99  ? -6.549  74.061 41.863 1.00 17.67 ? 99   ILE A CD1 1 
ATOM   748  N  N   . TRP A 1 100 ? -2.892  77.815 44.818 1.00 16.19 ? 100  TRP A N   1 
ATOM   749  C  CA  . TRP A 1 100 ? -2.444  79.189 44.818 1.00 18.58 ? 100  TRP A CA  1 
ATOM   750  C  C   . TRP A 1 100 ? -1.810  79.378 43.455 1.00 21.42 ? 100  TRP A C   1 
ATOM   751  O  O   . TRP A 1 100 ? -0.802  78.734 43.142 1.00 24.09 ? 100  TRP A O   1 
ATOM   752  C  CB  . TRP A 1 100 ? -1.445  79.431 45.941 1.00 20.41 ? 100  TRP A CB  1 
ATOM   753  C  CG  . TRP A 1 100 ? -2.105  79.514 47.276 1.00 20.78 ? 100  TRP A CG  1 
ATOM   754  C  CD1 . TRP A 1 100 ? -2.672  80.617 47.837 1.00 20.30 ? 100  TRP A CD1 1 
ATOM   755  C  CD2 . TRP A 1 100 ? -2.312  78.443 48.200 1.00 21.24 ? 100  TRP A CD2 1 
ATOM   756  N  NE1 . TRP A 1 100 ? -3.227  80.298 49.050 1.00 23.78 ? 100  TRP A NE1 1 
ATOM   757  C  CE2 . TRP A 1 100 ? -3.019  78.969 49.296 1.00 22.08 ? 100  TRP A CE2 1 
ATOM   758  C  CE3 . TRP A 1 100 ? -1.969  77.090 48.207 1.00 23.55 ? 100  TRP A CE3 1 
ATOM   759  C  CZ2 . TRP A 1 100 ? -3.390  78.193 50.387 1.00 23.80 ? 100  TRP A CZ2 1 
ATOM   760  C  CZ3 . TRP A 1 100 ? -2.338  76.314 49.296 1.00 24.49 ? 100  TRP A CZ3 1 
ATOM   761  C  CH2 . TRP A 1 100 ? -3.042  76.869 50.371 1.00 24.94 ? 100  TRP A CH2 1 
ATOM   762  N  N   . VAL A 1 101 ? -2.432  80.217 42.629 1.00 22.42 ? 101  VAL A N   1 
ATOM   763  C  CA  . VAL A 1 101 ? -1.976  80.469 41.258 1.00 21.93 ? 101  VAL A CA  1 
ATOM   764  C  C   . VAL A 1 101 ? -1.408  81.868 41.060 1.00 22.17 ? 101  VAL A C   1 
ATOM   765  O  O   . VAL A 1 101 ? -2.100  82.857 41.310 1.00 26.22 ? 101  VAL A O   1 
ATOM   766  C  CB  . VAL A 1 101 ? -3.149  80.316 40.275 1.00 21.94 ? 101  VAL A CB  1 
ATOM   767  C  CG1 . VAL A 1 101 ? -2.709  80.664 38.875 1.00 25.48 ? 101  VAL A CG1 1 
ATOM   768  C  CG2 . VAL A 1 101 ? -3.713  78.910 40.328 1.00 22.74 ? 101  VAL A CG2 1 
ATOM   769  N  N   . PRO A 1 102 ? -0.167  81.978 40.552 1.00 21.07 ? 102  PRO A N   1 
ATOM   770  C  CA  . PRO A 1 102 ? 0.434   83.294 40.338 1.00 20.42 ? 102  PRO A CA  1 
ATOM   771  C  C   . PRO A 1 102 ? -0.485  84.279 39.627 1.00 22.08 ? 102  PRO A C   1 
ATOM   772  O  O   . PRO A 1 102 ? -1.508  83.903 39.044 1.00 20.72 ? 102  PRO A O   1 
ATOM   773  C  CB  . PRO A 1 102 ? 1.667   82.966 39.505 1.00 18.55 ? 102  PRO A CB  1 
ATOM   774  C  CG  . PRO A 1 102 ? 2.112   81.682 40.107 1.00 20.08 ? 102  PRO A CG  1 
ATOM   775  C  CD  . PRO A 1 102 ? 0.800   80.912 40.231 1.00 21.54 ? 102  PRO A CD  1 
ATOM   776  N  N   . SER A 1 103 ? -0.151  85.555 39.753 1.00 25.14 ? 103  SER A N   1 
ATOM   777  C  CA  . SER A 1 103 ? -0.917  86.609 39.118 1.00 29.45 ? 103  SER A CA  1 
ATOM   778  C  C   . SER A 1 103 ? 0.112   87.499 38.458 1.00 31.40 ? 103  SER A C   1 
ATOM   779  O  O   . SER A 1 103 ? 1.013   87.997 39.126 1.00 34.92 ? 103  SER A O   1 
ATOM   780  C  CB  . SER A 1 103 ? -1.702  87.416 40.146 1.00 30.05 ? 103  SER A CB  1 
ATOM   781  O  OG  . SER A 1 103 ? -2.447  88.444 39.511 1.00 33.12 ? 103  SER A OG  1 
ATOM   782  N  N   . PRO A 1 104 ? -0.010  87.723 37.140 1.00 31.90 ? 104  PRO A N   1 
ATOM   783  C  CA  . PRO A 1 104 ? -1.057  87.185 36.265 1.00 30.57 ? 104  PRO A CA  1 
ATOM   784  C  C   . PRO A 1 104 ? -0.944  85.671 36.137 1.00 29.40 ? 104  PRO A C   1 
ATOM   785  O  O   . PRO A 1 104 ? 0.157   85.125 36.161 1.00 28.30 ? 104  PRO A O   1 
ATOM   786  C  CB  . PRO A 1 104 ? -0.763  87.875 34.938 1.00 32.12 ? 104  PRO A CB  1 
ATOM   787  C  CG  . PRO A 1 104 ? 0.743   87.933 34.938 1.00 32.69 ? 104  PRO A CG  1 
ATOM   788  C  CD  . PRO A 1 104 ? 1.032   88.407 36.350 1.00 32.91 ? 104  PRO A CD  1 
ATOM   789  N  N   . ARG A 1 105 ? -2.089  85.003 36.047 1.00 29.56 ? 105  ARG A N   1 
ATOM   790  C  CA  . ARG A 1 105 ? -2.129  83.550 35.925 1.00 29.41 ? 105  ARG A CA  1 
ATOM   791  C  C   . ARG A 1 105 ? -1.223  83.109 34.805 1.00 29.62 ? 105  ARG A C   1 
ATOM   792  O  O   . ARG A 1 105 ? -1.297  83.640 33.685 1.00 32.16 ? 105  ARG A O   1 
ATOM   793  C  CB  . ARG A 1 105 ? -3.538  83.075 35.598 1.00 30.17 ? 105  ARG A CB  1 
ATOM   794  C  CG  . ARG A 1 105 ? -3.632  81.574 35.399 1.00 29.72 ? 105  ARG A CG  1 
ATOM   795  C  CD  . ARG A 1 105 ? -4.810  81.218 34.516 1.00 29.46 ? 105  ARG A CD  1 
ATOM   796  N  NE  . ARG A 1 105 ? -6.059  81.828 34.963 1.00 28.49 ? 105  ARG A NE  1 
ATOM   797  C  CZ  . ARG A 1 105 ? -7.236  81.576 34.403 1.00 30.47 ? 105  ARG A CZ  1 
ATOM   798  N  NH1 . ARG A 1 105 ? -7.312  80.719 33.382 1.00 31.25 ? 105  ARG A NH1 1 
ATOM   799  N  NH2 . ARG A 1 105 ? -8.329  82.208 34.829 1.00 29.75 ? 105  ARG A NH2 1 
ATOM   800  N  N   . PRO A 1 106 ? -0.345  82.143 35.086 1.00 27.89 ? 106  PRO A N   1 
ATOM   801  C  CA  . PRO A 1 106 ? 0.581   81.639 34.071 1.00 27.53 ? 106  PRO A CA  1 
ATOM   802  C  C   . PRO A 1 106 ? -0.244  80.959 32.980 1.00 27.39 ? 106  PRO A C   1 
ATOM   803  O  O   . PRO A 1 106 ? -1.461  80.813 33.124 1.00 28.38 ? 106  PRO A O   1 
ATOM   804  C  CB  . PRO A 1 106 ? 1.401   80.605 34.850 1.00 27.48 ? 106  PRO A CB  1 
ATOM   805  C  CG  . PRO A 1 106 ? 1.304   81.070 36.268 1.00 26.53 ? 106  PRO A CG  1 
ATOM   806  C  CD  . PRO A 1 106 ? -0.138  81.464 36.372 1.00 26.12 ? 106  PRO A CD  1 
ATOM   807  N  N   . LYS A 1 107 ? 0.390   80.587 31.875 1.00 26.40 ? 107  LYS A N   1 
ATOM   808  C  CA  . LYS A 1 107 ? -0.339  79.893 30.818 1.00 27.46 ? 107  LYS A CA  1 
ATOM   809  C  C   . LYS A 1 107 ? -0.099  78.414 31.050 1.00 27.62 ? 107  LYS A C   1 
ATOM   810  O  O   . LYS A 1 107 ? -0.951  77.564 30.774 1.00 29.00 ? 107  LYS A O   1 
ATOM   811  C  CB  . LYS A 1 107 ? 0.143   80.329 29.437 1.00 29.84 ? 107  LYS A CB  1 
ATOM   812  C  CG  . LYS A 1 107 ? -0.169  81.788 29.132 1.00 30.89 ? 107  LYS A CG  1 
ATOM   813  C  CD  . LYS A 1 107 ? -1.609  82.128 29.534 1.00 32.06 ? 107  LYS A CD  1 
ATOM   814  C  CE  . LYS A 1 107 ? -1.907  83.605 29.339 1.00 33.52 ? 107  LYS A CE  1 
ATOM   815  N  NZ  . LYS A 1 107 ? -3.204  83.970 29.967 1.00 34.13 ? 107  LYS A NZ  1 
ATOM   816  N  N   . SER A 1 108 ? 1.078   78.128 31.581 1.00 27.02 ? 108  SER A N   1 
ATOM   817  C  CA  . SER A 1 108 ? 1.491   76.782 31.924 1.00 28.04 ? 108  SER A CA  1 
ATOM   818  C  C   . SER A 1 108 ? 2.834   76.900 32.586 1.00 28.13 ? 108  SER A C   1 
ATOM   819  O  O   . SER A 1 108 ? 3.823   77.263 31.942 1.00 29.13 ? 108  SER A O   1 
ATOM   820  C  CB  . SER A 1 108 ? 1.571   75.878 30.706 1.00 27.27 ? 108  SER A CB  1 
ATOM   821  O  OG  . SER A 1 108 ? 0.376   75.119 30.599 1.00 33.30 ? 108  SER A OG  1 
ATOM   822  N  N   . THR A 1 109 ? 2.827   76.723 33.903 1.00 27.26 ? 109  THR A N   1 
ATOM   823  C  CA  . THR A 1 109 ? 4.032   76.802 34.694 1.00 24.66 ? 109  THR A CA  1 
ATOM   824  C  C   . THR A 1 109 ? 4.115   75.547 35.536 1.00 24.27 ? 109  THR A C   1 
ATOM   825  O  O   . THR A 1 109 ? 3.242   74.682 35.468 1.00 24.21 ? 109  THR A O   1 
ATOM   826  C  CB  . THR A 1 109 ? 4.014   78.021 35.608 1.00 24.43 ? 109  THR A CB  1 
ATOM   827  O  OG1 . THR A 1 109 ? 5.295   78.157 36.245 1.00 26.26 ? 109  THR A OG1 1 
ATOM   828  C  CG2 . THR A 1 109 ? 2.911   77.889 36.651 1.00 22.36 ? 109  THR A CG2 1 
ATOM   829  N  N   . THR A 1 110 ? 5.176   75.443 36.319 1.00 23.96 ? 110  THR A N   1 
ATOM   830  C  CA  . THR A 1 110 ? 5.375   74.291 37.170 1.00 22.16 ? 110  THR A CA  1 
ATOM   831  C  C   . THR A 1 110 ? 4.252   74.197 38.173 1.00 20.39 ? 110  THR A C   1 
ATOM   832  O  O   . THR A 1 110 ? 3.703   75.205 38.597 1.00 19.84 ? 110  THR A O   1 
ATOM   833  C  CB  . THR A 1 110 ? 6.685   74.404 37.905 1.00 23.49 ? 110  THR A CB  1 
ATOM   834  O  OG1 . THR A 1 110 ? 7.735   74.597 36.951 1.00 23.90 ? 110  THR A OG1 1 
ATOM   835  C  CG2 . THR A 1 110 ? 6.946   73.143 38.684 1.00 25.08 ? 110  THR A CG2 1 
ATOM   836  N  N   . VAL A 1 111 ? 3.883   72.975 38.509 1.00 20.60 ? 111  VAL A N   1 
ATOM   837  C  CA  . VAL A 1 111 ? 2.828   72.726 39.469 1.00 18.39 ? 111  VAL A CA  1 
ATOM   838  C  C   . VAL A 1 111 ? 3.514   72.030 40.619 1.00 17.55 ? 111  VAL A C   1 
ATOM   839  O  O   . VAL A 1 111 ? 4.433   71.235 40.406 1.00 17.23 ? 111  VAL A O   1 
ATOM   840  C  CB  . VAL A 1 111 ? 1.760   71.791 38.883 1.00 19.67 ? 111  VAL A CB  1 
ATOM   841  C  CG1 . VAL A 1 111 ? 0.730   71.424 39.934 1.00 20.47 ? 111  VAL A CG1 1 
ATOM   842  C  CG2 . VAL A 1 111 ? 1.088   72.452 37.699 1.00 19.78 ? 111  VAL A CG2 1 
ATOM   843  N  N   . MET A 1 112 ? 3.126   72.381 41.837 1.00 16.66 ? 112  MET A N   1 
ATOM   844  C  CA  . MET A 1 112 ? 3.697   71.764 43.019 1.00 15.58 ? 112  MET A CA  1 
ATOM   845  C  C   . MET A 1 112 ? 2.564   71.375 43.932 1.00 15.60 ? 112  MET A C   1 
ATOM   846  O  O   . MET A 1 112 ? 1.810   72.228 44.390 1.00 16.82 ? 112  MET A O   1 
ATOM   847  C  CB  . MET A 1 112 ? 4.658   72.713 43.724 1.00 14.01 ? 112  MET A CB  1 
ATOM   848  C  CG  . MET A 1 112 ? 5.988   72.859 43.014 1.00 9.24  ? 112  MET A CG  1 
ATOM   849  S  SD  . MET A 1 112 ? 7.143   73.816 43.966 1.00 10.05 ? 112  MET A SD  1 
ATOM   850  C  CE  . MET A 1 112 ? 8.029   72.548 44.732 1.00 8.73  ? 112  MET A CE  1 
ATOM   851  N  N   . VAL A 1 113 ? 2.388   70.072 44.100 1.00 14.29 ? 113  VAL A N   1 
ATOM   852  C  CA  . VAL A 1 113 ? 1.342   69.534 44.945 1.00 13.71 ? 113  VAL A CA  1 
ATOM   853  C  C   . VAL A 1 113 ? 1.972   69.201 46.279 1.00 14.99 ? 113  VAL A C   1 
ATOM   854  O  O   . VAL A 1 113 ? 3.002   68.543 46.321 1.00 17.29 ? 113  VAL A O   1 
ATOM   855  C  CB  . VAL A 1 113 ? 0.761   68.254 44.346 1.00 12.59 ? 113  VAL A CB  1 
ATOM   856  C  CG1 . VAL A 1 113 ? -0.318  67.708 45.238 1.00 14.55 ? 113  VAL A CG1 1 
ATOM   857  C  CG2 . VAL A 1 113 ? 0.209   68.528 42.981 1.00 9.85  ? 113  VAL A CG2 1 
ATOM   858  N  N   . TRP A 1 114 ? 1.364   69.649 47.369 1.00 16.50 ? 114  TRP A N   1 
ATOM   859  C  CA  . TRP A 1 114 ? 1.888   69.391 48.705 1.00 15.93 ? 114  TRP A CA  1 
ATOM   860  C  C   . TRP A 1 114 ? 1.020   68.388 49.433 1.00 16.67 ? 114  TRP A C   1 
ATOM   861  O  O   . TRP A 1 114 ? -0.202  68.511 49.432 1.00 21.08 ? 114  TRP A O   1 
ATOM   862  C  CB  . TRP A 1 114 ? 1.953   70.703 49.489 1.00 16.04 ? 114  TRP A CB  1 
ATOM   863  C  CG  . TRP A 1 114 ? 2.172   70.561 50.958 1.00 19.20 ? 114  TRP A CG  1 
ATOM   864  C  CD1 . TRP A 1 114 ? 1.242   70.737 51.946 1.00 19.97 ? 114  TRP A CD1 1 
ATOM   865  C  CD2 . TRP A 1 114 ? 3.411   70.282 51.622 1.00 19.08 ? 114  TRP A CD2 1 
ATOM   866  N  NE1 . TRP A 1 114 ? 1.830   70.596 53.178 1.00 18.52 ? 114  TRP A NE1 1 
ATOM   867  C  CE2 . TRP A 1 114 ? 3.158   70.314 53.008 1.00 17.87 ? 114  TRP A CE2 1 
ATOM   868  C  CE3 . TRP A 1 114 ? 4.709   70.012 51.179 1.00 19.81 ? 114  TRP A CE3 1 
ATOM   869  C  CZ2 . TRP A 1 114 ? 4.150   70.090 53.949 1.00 19.30 ? 114  TRP A CZ2 1 
ATOM   870  C  CZ3 . TRP A 1 114 ? 5.694   69.789 52.112 1.00 21.24 ? 114  TRP A CZ3 1 
ATOM   871  C  CH2 . TRP A 1 114 ? 5.412   69.830 53.484 1.00 22.13 ? 114  TRP A CH2 1 
ATOM   872  N  N   . ILE A 1 115 ? 1.646   67.378 50.022 1.00 17.31 ? 115  ILE A N   1 
ATOM   873  C  CA  . ILE A 1 115 ? 0.938   66.356 50.787 1.00 17.34 ? 115  ILE A CA  1 
ATOM   874  C  C   . ILE A 1 115 ? 1.421   66.541 52.235 1.00 18.97 ? 115  ILE A C   1 
ATOM   875  O  O   . ILE A 1 115 ? 2.610   66.381 52.513 1.00 20.56 ? 115  ILE A O   1 
ATOM   876  C  CB  . ILE A 1 115 ? 1.312   64.954 50.290 1.00 16.50 ? 115  ILE A CB  1 
ATOM   877  C  CG1 . ILE A 1 115 ? 1.180   64.891 48.762 1.00 16.13 ? 115  ILE A CG1 1 
ATOM   878  C  CG2 . ILE A 1 115 ? 0.412   63.918 50.936 1.00 16.22 ? 115  ILE A CG2 1 
ATOM   879  C  CD1 . ILE A 1 115 ? 1.601   63.572 48.130 1.00 9.45  ? 115  ILE A CD1 1 
ATOM   880  N  N   . TYR A 1 116 ? 0.527   66.934 53.139 1.00 16.34 ? 116  TYR A N   1 
ATOM   881  C  CA  . TYR A 1 116 ? 0.907   67.167 54.530 1.00 13.72 ? 116  TYR A CA  1 
ATOM   882  C  C   . TYR A 1 116 ? 1.368   65.958 55.319 1.00 16.48 ? 116  TYR A C   1 
ATOM   883  O  O   . TYR A 1 116 ? 1.044   64.816 54.985 1.00 16.94 ? 116  TYR A O   1 
ATOM   884  C  CB  . TYR A 1 116 ? -0.202  67.887 55.293 1.00 9.13  ? 116  TYR A CB  1 
ATOM   885  C  CG  . TYR A 1 116 ? -1.549  67.221 55.272 1.00 7.28  ? 116  TYR A CG  1 
ATOM   886  C  CD1 . TYR A 1 116 ? -1.727  65.929 55.757 1.00 8.18  ? 116  TYR A CD1 1 
ATOM   887  C  CD2 . TYR A 1 116 ? -2.662  67.902 54.809 1.00 7.19  ? 116  TYR A CD2 1 
ATOM   888  C  CE1 . TYR A 1 116 ? -2.985  65.340 55.784 1.00 6.24  ? 116  TYR A CE1 1 
ATOM   889  C  CE2 . TYR A 1 116 ? -3.922  67.322 54.830 1.00 6.86  ? 116  TYR A CE2 1 
ATOM   890  C  CZ  . TYR A 1 116 ? -4.075  66.045 55.318 1.00 6.27  ? 116  TYR A CZ  1 
ATOM   891  O  OH  . TYR A 1 116 ? -5.323  65.488 55.344 1.00 5.31  ? 116  TYR A OH  1 
ATOM   892  N  N   . GLY A 1 117 ? 2.093   66.230 56.399 1.00 17.81 ? 117  GLY A N   1 
ATOM   893  C  CA  . GLY A 1 117 ? 2.606   65.171 57.247 1.00 18.77 ? 117  GLY A CA  1 
ATOM   894  C  C   . GLY A 1 117 ? 1.691   64.824 58.398 1.00 18.35 ? 117  GLY A C   1 
ATOM   895  O  O   . GLY A 1 117 ? 0.476   64.951 58.292 1.00 19.05 ? 117  GLY A O   1 
ATOM   896  N  N   . GLY A 1 118 ? 2.276   64.397 59.512 1.00 18.86 ? 118  GLY A N   1 
ATOM   897  C  CA  . GLY A 1 118 ? 1.473   64.044 60.668 1.00 15.37 ? 118  GLY A CA  1 
ATOM   898  C  C   . GLY A 1 118 ? 1.241   62.560 60.815 1.00 12.06 ? 118  GLY A C   1 
ATOM   899  O  O   . GLY A 1 118 ? 0.130   62.122 61.069 1.00 10.51 ? 118  GLY A O   1 
ATOM   900  N  N   . GLY A 1 119 ? 2.297   61.787 60.626 1.00 12.48 ? 119  GLY A N   1 
ATOM   901  C  CA  . GLY A 1 119 ? 2.217   60.347 60.760 1.00 13.34 ? 119  GLY A CA  1 
ATOM   902  C  C   . GLY A 1 119 ? 0.923   59.662 60.385 1.00 14.28 ? 119  GLY A C   1 
ATOM   903  O  O   . GLY A 1 119 ? 0.523   58.702 61.034 1.00 16.71 ? 119  GLY A O   1 
ATOM   904  N  N   . PHE A 1 120 ? 0.244   60.169 59.366 1.00 14.69 ? 120  PHE A N   1 
ATOM   905  C  CA  . PHE A 1 120 ? -1.003  59.576 58.885 1.00 14.25 ? 120  PHE A CA  1 
ATOM   906  C  C   . PHE A 1 120 ? -2.197  59.641 59.826 1.00 14.42 ? 120  PHE A C   1 
ATOM   907  O  O   . PHE A 1 120 ? -3.273  59.197 59.453 1.00 15.08 ? 120  PHE A O   1 
ATOM   908  C  CB  . PHE A 1 120 ? -0.784  58.123 58.436 1.00 12.61 ? 120  PHE A CB  1 
ATOM   909  C  CG  . PHE A 1 120 ? 0.188   57.978 57.304 1.00 10.50 ? 120  PHE A CG  1 
ATOM   910  C  CD1 . PHE A 1 120 ? -0.233  58.111 55.993 1.00 13.12 ? 120  PHE A CD1 1 
ATOM   911  C  CD2 . PHE A 1 120 ? 1.523   57.751 57.550 1.00 10.45 ? 120  PHE A CD2 1 
ATOM   912  C  CE1 . PHE A 1 120 ? 0.662   58.024 54.947 1.00 11.48 ? 120  PHE A CE1 1 
ATOM   913  C  CE2 . PHE A 1 120 ? 2.422   57.664 56.510 1.00 14.31 ? 120  PHE A CE2 1 
ATOM   914  C  CZ  . PHE A 1 120 ? 1.990   57.802 55.209 1.00 13.81 ? 120  PHE A CZ  1 
ATOM   915  N  N   . TYR A 1 121 ? -2.020  60.163 61.040 1.00 14.75 ? 121  TYR A N   1 
ATOM   916  C  CA  . TYR A 1 121 ? -3.133  60.277 61.995 1.00 13.31 ? 121  TYR A CA  1 
ATOM   917  C  C   . TYR A 1 121 ? -3.655  61.712 62.092 1.00 11.86 ? 121  TYR A C   1 
ATOM   918  O  O   . TYR A 1 121 ? -4.711  61.954 62.671 1.00 14.93 ? 121  TYR A O   1 
ATOM   919  C  CB  . TYR A 1 121 ? -2.726  59.790 63.398 1.00 12.10 ? 121  TYR A CB  1 
ATOM   920  C  CG  . TYR A 1 121 ? -1.802  60.734 64.135 1.00 9.42  ? 121  TYR A CG  1 
ATOM   921  C  CD1 . TYR A 1 121 ? -2.303  61.815 64.849 1.00 9.88  ? 121  TYR A CD1 1 
ATOM   922  C  CD2 . TYR A 1 121 ? -0.431  60.563 64.088 1.00 8.93  ? 121  TYR A CD2 1 
ATOM   923  C  CE1 . TYR A 1 121 ? -1.465  62.702 65.489 1.00 11.95 ? 121  TYR A CE1 1 
ATOM   924  C  CE2 . TYR A 1 121 ? 0.420   61.443 64.725 1.00 11.60 ? 121  TYR A CE2 1 
ATOM   925  C  CZ  . TYR A 1 121 ? -0.103  62.512 65.423 1.00 13.41 ? 121  TYR A CZ  1 
ATOM   926  O  OH  . TYR A 1 121 ? 0.747   63.392 66.054 1.00 19.66 ? 121  TYR A OH  1 
ATOM   927  N  N   . SER A 1 122 ? -2.895  62.659 61.560 1.00 10.58 ? 122  SER A N   1 
ATOM   928  C  CA  . SER A 1 122 ? -3.259  64.063 61.598 1.00 10.40 ? 122  SER A CA  1 
ATOM   929  C  C   . SER A 1 122 ? -2.813  64.739 60.312 1.00 11.59 ? 122  SER A C   1 
ATOM   930  O  O   . SER A 1 122 ? -2.071  64.157 59.523 1.00 11.71 ? 122  SER A O   1 
ATOM   931  C  CB  . SER A 1 122 ? -2.560  64.735 62.777 1.00 12.23 ? 122  SER A CB  1 
ATOM   932  O  OG  . SER A 1 122 ? -1.151  64.571 62.685 1.00 12.59 ? 122  SER A OG  1 
ATOM   933  N  N   . GLY A 1 123 ? -3.240  65.979 60.119 1.00 11.79 ? 123  GLY A N   1 
ATOM   934  C  CA  . GLY A 1 123 ? -2.850  66.706 58.936 1.00 12.41 ? 123  GLY A CA  1 
ATOM   935  C  C   . GLY A 1 123 ? -3.943  67.619 58.429 1.00 14.32 ? 123  GLY A C   1 
ATOM   936  O  O   . GLY A 1 123 ? -5.116  67.251 58.411 1.00 15.83 ? 123  GLY A O   1 
ATOM   937  N  N   . SER A 1 124 ? -3.556  68.814 58.013 1.00 14.41 ? 124  SER A N   1 
ATOM   938  C  CA  . SER A 1 124 ? -4.490  69.788 57.480 1.00 14.98 ? 124  SER A CA  1 
ATOM   939  C  C   . SER A 1 124 ? -3.755  70.476 56.329 1.00 17.20 ? 124  SER A C   1 
ATOM   940  O  O   . SER A 1 124 ? -2.551  70.707 56.409 1.00 16.42 ? 124  SER A O   1 
ATOM   941  C  CB  . SER A 1 124 ? -4.853  70.812 58.553 1.00 14.41 ? 124  SER A CB  1 
ATOM   942  O  OG  . SER A 1 124 ? -5.253  70.177 59.750 1.00 14.61 ? 124  SER A OG  1 
ATOM   943  N  N   . SER A 1 125 ? -4.448  70.717 55.225 1.00 19.05 ? 125  SER A N   1 
ATOM   944  C  CA  . SER A 1 125 ? -3.828  71.383 54.091 1.00 18.84 ? 125  SER A CA  1 
ATOM   945  C  C   . SER A 1 125 ? -4.006  72.877 54.271 1.00 19.39 ? 125  SER A C   1 
ATOM   946  O  O   . SER A 1 125 ? -3.476  73.673 53.505 1.00 21.25 ? 125  SER A O   1 
ATOM   947  C  CB  . SER A 1 125 ? -4.508  70.947 52.797 1.00 19.67 ? 125  SER A CB  1 
ATOM   948  O  OG  . SER A 1 125 ? -5.907  71.173 52.853 1.00 23.86 ? 125  SER A OG  1 
ATOM   949  N  N   . THR A 1 126 ? -4.753  73.243 55.305 1.00 18.90 ? 126  THR A N   1 
ATOM   950  C  CA  . THR A 1 126 ? -5.065  74.624 55.592 1.00 17.78 ? 126  THR A CA  1 
ATOM   951  C  C   . THR A 1 126 ? -4.163  75.289 56.624 1.00 19.34 ? 126  THR A C   1 
ATOM   952  O  O   . THR A 1 126 ? -4.344  76.463 56.931 1.00 22.61 ? 126  THR A O   1 
ATOM   953  C  CB  . THR A 1 126 ? -6.501  74.703 56.101 1.00 17.15 ? 126  THR A CB  1 
ATOM   954  O  OG1 . THR A 1 126 ? -6.631  73.852 57.240 1.00 18.50 ? 126  THR A OG1 1 
ATOM   955  C  CG2 . THR A 1 126 ? -7.468  74.195 55.055 1.00 18.15 ? 126  THR A CG2 1 
ATOM   956  N  N   . LEU A 1 127 ? -3.211  74.552 57.183 1.00 19.90 ? 127  LEU A N   1 
ATOM   957  C  CA  . LEU A 1 127 ? -2.337  75.117 58.210 1.00 19.49 ? 127  LEU A CA  1 
ATOM   958  C  C   . LEU A 1 127 ? -1.626  76.362 57.724 1.00 20.30 ? 127  LEU A C   1 
ATOM   959  O  O   . LEU A 1 127 ? -1.371  76.525 56.535 1.00 20.38 ? 127  LEU A O   1 
ATOM   960  C  CB  . LEU A 1 127 ? -1.308  74.095 58.703 1.00 19.50 ? 127  LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 127 ? -1.813  72.775 59.291 1.00 19.14 ? 127  LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 127 ? -0.648  71.962 59.825 1.00 19.70 ? 127  LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 127 ? -2.812  73.050 60.385 1.00 20.11 ? 127  LEU A CD2 1 
ATOM   964  N  N   . ASP A 1 128 ? -1.268  77.225 58.658 1.00 22.13 ? 128  ASP A N   1 
ATOM   965  C  CA  . ASP A 1 128 ? -0.598  78.460 58.309 1.00 23.54 ? 128  ASP A CA  1 
ATOM   966  C  C   . ASP A 1 128 ? 0.736   78.255 57.618 1.00 22.77 ? 128  ASP A C   1 
ATOM   967  O  O   . ASP A 1 128 ? 1.023   78.943 56.646 1.00 26.41 ? 128  ASP A O   1 
ATOM   968  C  CB  . ASP A 1 128 ? -0.437  79.359 59.534 1.00 27.75 ? 128  ASP A CB  1 
ATOM   969  C  CG  . ASP A 1 128 ? -1.772  79.838 60.087 1.00 31.50 ? 128  ASP A CG  1 
ATOM   970  O  OD1 . ASP A 1 128 ? -2.773  79.818 59.330 1.00 32.93 ? 128  ASP A OD1 1 
ATOM   971  O  OD2 . ASP A 1 128 ? -1.822  80.237 61.280 1.00 36.07 ? 128  ASP A OD2 1 
ATOM   972  N  N   . VAL A 1 129 ? 1.545   77.310 58.084 1.00 20.87 ? 129  VAL A N   1 
ATOM   973  C  CA  . VAL A 1 129 ? 2.840   77.093 57.454 1.00 19.39 ? 129  VAL A CA  1 
ATOM   974  C  C   . VAL A 1 129 ? 2.712   76.365 56.138 1.00 20.75 ? 129  VAL A C   1 
ATOM   975  O  O   . VAL A 1 129 ? 3.718   76.112 55.483 1.00 23.05 ? 129  VAL A O   1 
ATOM   976  C  CB  . VAL A 1 129 ? 3.802   76.291 58.328 1.00 18.48 ? 129  VAL A CB  1 
ATOM   977  C  CG1 . VAL A 1 129 ? 4.233   77.111 59.519 1.00 18.27 ? 129  VAL A CG1 1 
ATOM   978  C  CG2 . VAL A 1 129 ? 3.157   74.984 58.749 1.00 16.75 ? 129  VAL A CG2 1 
ATOM   979  N  N   . TYR A 1 130 ? 1.493   75.961 55.787 1.00 19.59 ? 130  TYR A N   1 
ATOM   980  C  CA  . TYR A 1 130 ? 1.269   75.253 54.536 1.00 17.18 ? 130  TYR A CA  1 
ATOM   981  C  C   . TYR A 1 130 ? 0.678   76.186 53.500 1.00 20.47 ? 130  TYR A C   1 
ATOM   982  O  O   . TYR A 1 130 ? 0.434   75.777 52.367 1.00 24.05 ? 130  TYR A O   1 
ATOM   983  C  CB  . TYR A 1 130 ? 0.345   74.054 54.734 1.00 12.38 ? 130  TYR A CB  1 
ATOM   984  C  CG  . TYR A 1 130 ? 0.925   72.904 55.534 1.00 9.59  ? 130  TYR A CG  1 
ATOM   985  C  CD1 . TYR A 1 130 ? 2.271   72.868 55.898 1.00 10.33 ? 130  TYR A CD1 1 
ATOM   986  C  CD2 . TYR A 1 130 ? 0.120   71.849 55.924 1.00 8.94  ? 130  TYR A CD2 1 
ATOM   987  C  CE1 . TYR A 1 130 ? 2.787   71.802 56.628 1.00 9.11  ? 130  TYR A CE1 1 
ATOM   988  C  CE2 . TYR A 1 130 ? 0.621   70.792 56.648 1.00 7.25  ? 130  TYR A CE2 1 
ATOM   989  C  CZ  . TYR A 1 130 ? 1.949   70.767 56.998 1.00 9.03  ? 130  TYR A CZ  1 
ATOM   990  O  OH  . TYR A 1 130 ? 2.419   69.693 57.714 1.00 8.36  ? 130  TYR A OH  1 
ATOM   991  N  N   . ASN A 1 131 ? 0.455   77.440 53.889 1.00 22.52 ? 131  ASN A N   1 
ATOM   992  C  CA  . ASN A 1 131 ? -0.107  78.455 52.995 1.00 24.04 ? 131  ASN A CA  1 
ATOM   993  C  C   . ASN A 1 131 ? 0.891   78.724 51.879 1.00 25.08 ? 131  ASN A C   1 
ATOM   994  O  O   . ASN A 1 131 ? 1.821   79.520 52.031 1.00 26.20 ? 131  ASN A O   1 
ATOM   995  C  CB  . ASN A 1 131 ? -0.380  79.750 53.767 1.00 24.11 ? 131  ASN A CB  1 
ATOM   996  C  CG  . ASN A 1 131 ? -1.215  80.731 52.977 1.00 25.46 ? 131  ASN A CG  1 
ATOM   997  O  OD1 . ASN A 1 131 ? -1.159  80.761 51.747 1.00 28.82 ? 131  ASN A OD1 1 
ATOM   998  N  ND2 . ASN A 1 131 ? -2.011  81.529 53.676 1.00 28.96 ? 131  ASN A ND2 1 
ATOM   999  N  N   . GLY A 1 132 ? 0.680   78.069 50.745 1.00 26.09 ? 132  GLY A N   1 
ATOM   1000 C  CA  . GLY A 1 132 ? 1.585   78.212 49.614 1.00 26.73 ? 132  GLY A CA  1 
ATOM   1001 C  C   . GLY A 1 132 ? 1.595   79.542 48.890 1.00 26.82 ? 132  GLY A C   1 
ATOM   1002 O  O   . GLY A 1 132 ? 2.270   79.670 47.872 1.00 26.67 ? 132  GLY A O   1 
ATOM   1003 N  N   . LYS A 1 133 ? 0.886   80.538 49.415 1.00 26.71 ? 133  LYS A N   1 
ATOM   1004 C  CA  . LYS A 1 133 ? 0.830   81.854 48.783 1.00 25.77 ? 133  LYS A CA  1 
ATOM   1005 C  C   . LYS A 1 133 ? 2.212   82.461 48.546 1.00 24.47 ? 133  LYS A C   1 
ATOM   1006 O  O   . LYS A 1 133 ? 2.430   83.153 47.560 1.00 26.22 ? 133  LYS A O   1 
ATOM   1007 C  CB  . LYS A 1 133 ? -0.012  82.838 49.612 1.00 25.32 ? 133  LYS A CB  1 
ATOM   1008 C  CG  . LYS A 1 133 ? 0.682   83.337 50.877 1.00 27.99 ? 133  LYS A CG  1 
ATOM   1009 C  CD  . LYS A 1 133 ? 0.172   84.697 51.348 1.00 27.14 ? 133  LYS A CD  1 
ATOM   1010 C  CE  . LYS A 1 133 ? -1.220  84.592 51.926 1.00 29.32 ? 133  LYS A CE  1 
ATOM   1011 N  NZ  . LYS A 1 133 ? -1.631  85.870 52.561 1.00 29.21 ? 133  LYS A NZ  1 
ATOM   1012 N  N   . TYR A 1 134 ? 3.143   82.211 49.452 1.00 22.73 ? 134  TYR A N   1 
ATOM   1013 C  CA  . TYR A 1 134 ? 4.466   82.783 49.312 1.00 22.53 ? 134  TYR A CA  1 
ATOM   1014 C  C   . TYR A 1 134 ? 5.293   81.968 48.343 1.00 21.33 ? 134  TYR A C   1 
ATOM   1015 O  O   . TYR A 1 134 ? 6.108   82.516 47.610 1.00 21.70 ? 134  TYR A O   1 
ATOM   1016 C  CB  . TYR A 1 134 ? 5.172   82.867 50.668 1.00 25.96 ? 134  TYR A CB  1 
ATOM   1017 C  CG  . TYR A 1 134 ? 4.307   83.393 51.801 1.00 24.59 ? 134  TYR A CG  1 
ATOM   1018 C  CD1 . TYR A 1 134 ? 4.174   84.759 52.040 1.00 23.86 ? 134  TYR A CD1 1 
ATOM   1019 C  CD2 . TYR A 1 134 ? 3.644   82.514 52.642 1.00 24.89 ? 134  TYR A CD2 1 
ATOM   1020 C  CE1 . TYR A 1 134 ? 3.400   85.230 53.095 1.00 25.54 ? 134  TYR A CE1 1 
ATOM   1021 C  CE2 . TYR A 1 134 ? 2.872   82.966 53.688 1.00 27.17 ? 134  TYR A CE2 1 
ATOM   1022 C  CZ  . TYR A 1 134 ? 2.749   84.321 53.920 1.00 26.76 ? 134  TYR A CZ  1 
ATOM   1023 O  OH  . TYR A 1 134 ? 1.978   84.738 54.991 1.00 27.69 ? 134  TYR A OH  1 
ATOM   1024 N  N   . LEU A 1 135 ? 5.083   80.660 48.327 1.00 20.93 ? 135  LEU A N   1 
ATOM   1025 C  CA  . LEU A 1 135 ? 5.843   79.804 47.420 1.00 21.82 ? 135  LEU A CA  1 
ATOM   1026 C  C   . LEU A 1 135 ? 5.400   80.052 45.970 1.00 23.19 ? 135  LEU A C   1 
ATOM   1027 O  O   . LEU A 1 135 ? 6.226   80.333 45.099 1.00 23.68 ? 135  LEU A O   1 
ATOM   1028 C  CB  . LEU A 1 135 ? 5.692   78.326 47.813 1.00 17.03 ? 135  LEU A CB  1 
ATOM   1029 C  CG  . LEU A 1 135 ? 6.662   77.327 47.177 1.00 13.73 ? 135  LEU A CG  1 
ATOM   1030 C  CD1 . LEU A 1 135 ? 8.069   77.882 47.188 1.00 14.50 ? 135  LEU A CD1 1 
ATOM   1031 C  CD2 . LEU A 1 135 ? 6.619   76.009 47.912 1.00 10.65 ? 135  LEU A CD2 1 
ATOM   1032 N  N   . ALA A 1 136 ? 4.090   79.999 45.734 1.00 24.14 ? 136  ALA A N   1 
ATOM   1033 C  CA  . ALA A 1 136 ? 3.524   80.220 44.407 1.00 23.78 ? 136  ALA A CA  1 
ATOM   1034 C  C   . ALA A 1 136 ? 3.939   81.588 43.899 1.00 25.89 ? 136  ALA A C   1 
ATOM   1035 O  O   . ALA A 1 136 ? 4.320   81.746 42.736 1.00 30.44 ? 136  ALA A O   1 
ATOM   1036 C  CB  . ALA A 1 136 ? 2.008   80.122 44.453 1.00 20.49 ? 136  ALA A CB  1 
ATOM   1037 N  N   . TYR A 1 137 ? 3.875   82.580 44.775 1.00 25.34 ? 137  TYR A N   1 
ATOM   1038 C  CA  . TYR A 1 137 ? 4.243   83.936 44.409 1.00 24.09 ? 137  TYR A CA  1 
ATOM   1039 C  C   . TYR A 1 137 ? 5.740   84.062 44.127 1.00 23.59 ? 137  TYR A C   1 
ATOM   1040 O  O   . TYR A 1 137 ? 6.145   84.204 42.984 1.00 25.45 ? 137  TYR A O   1 
ATOM   1041 C  CB  . TYR A 1 137 ? 3.813   84.903 45.505 1.00 22.86 ? 137  TYR A CB  1 
ATOM   1042 C  CG  . TYR A 1 137 ? 4.264   86.311 45.281 1.00 26.48 ? 137  TYR A CG  1 
ATOM   1043 C  CD1 . TYR A 1 137 ? 5.483   86.760 45.788 1.00 29.79 ? 137  TYR A CD1 1 
ATOM   1044 C  CD2 . TYR A 1 137 ? 3.470   87.208 44.578 1.00 28.12 ? 137  TYR A CD2 1 
ATOM   1045 C  CE1 . TYR A 1 137 ? 5.897   88.071 45.602 1.00 31.73 ? 137  TYR A CE1 1 
ATOM   1046 C  CE2 . TYR A 1 137 ? 3.869   88.524 44.382 1.00 30.15 ? 137  TYR A CE2 1 
ATOM   1047 C  CZ  . TYR A 1 137 ? 5.081   88.950 44.898 1.00 32.16 ? 137  TYR A CZ  1 
ATOM   1048 O  OH  . TYR A 1 137 ? 5.472   90.259 44.727 1.00 35.24 ? 137  TYR A OH  1 
ATOM   1049 N  N   . THR A 1 138 ? 6.558   83.979 45.167 1.00 23.64 ? 138  THR A N   1 
ATOM   1050 C  CA  . THR A 1 138 ? 8.006   84.100 45.030 1.00 21.93 ? 138  THR A CA  1 
ATOM   1051 C  C   . THR A 1 138 ? 8.596   83.218 43.929 1.00 21.77 ? 138  THR A C   1 
ATOM   1052 O  O   . THR A 1 138 ? 9.517   83.639 43.228 1.00 23.44 ? 138  THR A O   1 
ATOM   1053 C  CB  . THR A 1 138 ? 8.702   83.802 46.380 1.00 20.89 ? 138  THR A CB  1 
ATOM   1054 O  OG1 . THR A 1 138 ? 8.144   84.653 47.387 1.00 20.29 ? 138  THR A OG1 1 
ATOM   1055 C  CG2 . THR A 1 138 ? 10.198  84.053 46.300 1.00 19.84 ? 138  THR A CG2 1 
ATOM   1056 N  N   . GLU A 1 139 ? 8.066   82.011 43.759 1.00 21.24 ? 139  GLU A N   1 
ATOM   1057 C  CA  . GLU A 1 139 ? 8.587   81.119 42.733 1.00 22.67 ? 139  GLU A CA  1 
ATOM   1058 C  C   . GLU A 1 139 ? 7.758   80.934 41.454 1.00 25.71 ? 139  GLU A C   1 
ATOM   1059 O  O   . GLU A 1 139 ? 7.970   79.975 40.709 1.00 28.07 ? 139  GLU A O   1 
ATOM   1060 C  CB  . GLU A 1 139 ? 8.960   79.768 43.331 1.00 20.13 ? 139  GLU A CB  1 
ATOM   1061 C  CG  . GLU A 1 139 ? 10.226  79.806 44.151 1.00 23.05 ? 139  GLU A CG  1 
ATOM   1062 C  CD  . GLU A 1 139 ? 11.382  80.452 43.406 1.00 25.91 ? 139  GLU A CD  1 
ATOM   1063 O  OE1 . GLU A 1 139 ? 11.914  79.851 42.443 1.00 25.71 ? 139  GLU A OE1 1 
ATOM   1064 O  OE2 . GLU A 1 139 ? 11.749  81.583 43.777 1.00 29.19 ? 139  GLU A OE2 1 
ATOM   1065 N  N   . GLU A 1 140 ? 6.792   81.812 41.206 1.00 26.78 ? 140  GLU A N   1 
ATOM   1066 C  CA  . GLU A 1 140 ? 6.006   81.718 39.983 1.00 27.12 ? 140  GLU A CA  1 
ATOM   1067 C  C   . GLU A 1 140 ? 5.463   80.316 39.730 1.00 25.94 ? 140  GLU A C   1 
ATOM   1068 O  O   . GLU A 1 140 ? 5.209   79.941 38.582 1.00 28.83 ? 140  GLU A O   1 
ATOM   1069 C  CB  . GLU A 1 140 ? 6.899   82.098 38.797 1.00 33.66 ? 140  GLU A CB  1 
ATOM   1070 C  CG  . GLU A 1 140 ? 7.032   83.587 38.520 1.00 39.03 ? 140  GLU A CG  1 
ATOM   1071 C  CD  . GLU A 1 140 ? 5.754   84.170 37.958 1.00 43.42 ? 140  GLU A CD  1 
ATOM   1072 O  OE1 . GLU A 1 140 ? 5.557   85.394 38.118 1.00 47.68 ? 140  GLU A OE1 1 
ATOM   1073 O  OE2 . GLU A 1 140 ? 4.942   83.409 37.363 1.00 45.66 ? 140  GLU A OE2 1 
ATOM   1074 N  N   . VAL A 1 141 ? 5.292   79.533 40.777 1.00 22.20 ? 141  VAL A N   1 
ATOM   1075 C  CA  . VAL A 1 141 ? 4.811   78.185 40.595 1.00 20.13 ? 141  VAL A CA  1 
ATOM   1076 C  C   . VAL A 1 141 ? 3.374   78.054 41.070 1.00 20.09 ? 141  VAL A C   1 
ATOM   1077 O  O   . VAL A 1 141 ? 2.943   78.786 41.954 1.00 20.67 ? 141  VAL A O   1 
ATOM   1078 C  CB  . VAL A 1 141 ? 5.710   77.197 41.342 1.00 19.74 ? 141  VAL A CB  1 
ATOM   1079 C  CG1 . VAL A 1 141 ? 5.614   77.403 42.840 1.00 19.20 ? 141  VAL A CG1 1 
ATOM   1080 C  CG2 . VAL A 1 141 ? 5.336   75.809 40.993 1.00 23.58 ? 141  VAL A CG2 1 
ATOM   1081 N  N   . VAL A 1 142 ? 2.604   77.205 40.402 1.00 20.34 ? 142  VAL A N   1 
ATOM   1082 C  CA  . VAL A 1 142 ? 1.222   76.962 40.792 1.00 21.25 ? 142  VAL A CA  1 
ATOM   1083 C  C   . VAL A 1 142 ? 1.327   75.883 41.867 1.00 24.02 ? 142  VAL A C   1 
ATOM   1084 O  O   . VAL A 1 142 ? 1.714   74.740 41.587 1.00 26.50 ? 142  VAL A O   1 
ATOM   1085 C  CB  . VAL A 1 142 ? 0.366   76.450 39.604 1.00 19.28 ? 142  VAL A CB  1 
ATOM   1086 C  CG1 . VAL A 1 142 ? -0.908  75.788 40.098 1.00 15.54 ? 142  VAL A CG1 1 
ATOM   1087 C  CG2 . VAL A 1 142 ? 0.014   77.600 38.696 1.00 19.83 ? 142  VAL A CG2 1 
ATOM   1088 N  N   . LEU A 1 143 ? 1.037   76.254 43.105 1.00 23.58 ? 143  LEU A N   1 
ATOM   1089 C  CA  . LEU A 1 143 ? 1.138   75.315 44.200 1.00 20.92 ? 143  LEU A CA  1 
ATOM   1090 C  C   . LEU A 1 143 ? -0.239  74.904 44.656 1.00 19.58 ? 143  LEU A C   1 
ATOM   1091 O  O   . LEU A 1 143 ? -1.101  75.744 44.905 1.00 18.72 ? 143  LEU A O   1 
ATOM   1092 C  CB  . LEU A 1 143 ? 1.924   75.945 45.349 1.00 21.94 ? 143  LEU A CB  1 
ATOM   1093 C  CG  . LEU A 1 143 ? 2.236   75.107 46.589 1.00 25.15 ? 143  LEU A CG  1 
ATOM   1094 C  CD1 . LEU A 1 143 ? 3.467   75.659 47.251 1.00 25.42 ? 143  LEU A CD1 1 
ATOM   1095 C  CD2 . LEU A 1 143 ? 1.062   75.082 47.571 1.00 26.49 ? 143  LEU A CD2 1 
ATOM   1096 N  N   . VAL A 1 144 ? -0.460  73.601 44.702 1.00 18.52 ? 144  VAL A N   1 
ATOM   1097 C  CA  . VAL A 1 144 ? -1.728  73.057 45.143 1.00 18.46 ? 144  VAL A CA  1 
ATOM   1098 C  C   . VAL A 1 144 ? -1.412  72.124 46.289 1.00 18.39 ? 144  VAL A C   1 
ATOM   1099 O  O   . VAL A 1 144 ? -0.475  71.335 46.207 1.00 19.69 ? 144  VAL A O   1 
ATOM   1100 C  CB  . VAL A 1 144 ? -2.491  72.298 43.996 1.00 18.31 ? 144  VAL A CB  1 
ATOM   1101 C  CG1 . VAL A 1 144 ? -1.532  71.790 42.943 1.00 20.44 ? 144  VAL A CG1 1 
ATOM   1102 C  CG2 . VAL A 1 144 ? -3.297  71.135 44.554 1.00 16.22 ? 144  VAL A CG2 1 
ATOM   1103 N  N   . SER A 1 145 ? -2.097  72.314 47.406 1.00 18.33 ? 145  SER A N   1 
ATOM   1104 C  CA  . SER A 1 145 ? -1.899  71.457 48.554 1.00 17.75 ? 145  SER A CA  1 
ATOM   1105 C  C   . SER A 1 145 ? -3.213  70.716 48.691 1.00 18.70 ? 145  SER A C   1 
ATOM   1106 O  O   . SER A 1 145 ? -4.282  71.325 48.742 1.00 19.75 ? 145  SER A O   1 
ATOM   1107 C  CB  . SER A 1 145 ? -1.557  72.263 49.815 1.00 17.28 ? 145  SER A CB  1 
ATOM   1108 O  OG  . SER A 1 145 ? -2.553  73.214 50.141 1.00 18.44 ? 145  SER A OG  1 
ATOM   1109 N  N   . LEU A 1 146 ? -3.126  69.396 48.613 1.00 18.44 ? 146  LEU A N   1 
ATOM   1110 C  CA  . LEU A 1 146 ? -4.281  68.530 48.713 1.00 15.31 ? 146  LEU A CA  1 
ATOM   1111 C  C   . LEU A 1 146 ? -4.501  68.159 50.177 1.00 16.98 ? 146  LEU A C   1 
ATOM   1112 O  O   . LEU A 1 146 ? -3.733  68.551 51.061 1.00 16.66 ? 146  LEU A O   1 
ATOM   1113 C  CB  . LEU A 1 146 ? -4.036  67.274 47.871 1.00 11.50 ? 146  LEU A CB  1 
ATOM   1114 C  CG  . LEU A 1 146 ? -2.786  66.443 48.186 1.00 10.33 ? 146  LEU A CG  1 
ATOM   1115 C  CD1 . LEU A 1 146 ? -3.061  65.497 49.340 1.00 12.13 ? 146  LEU A CD1 1 
ATOM   1116 C  CD2 . LEU A 1 146 ? -2.372  65.634 46.979 1.00 8.30  ? 146  LEU A CD2 1 
ATOM   1117 N  N   . SER A 1 147 ? -5.550  67.393 50.426 1.00 17.22 ? 147  SER A N   1 
ATOM   1118 C  CA  . SER A 1 147 ? -5.851  66.942 51.763 1.00 16.23 ? 147  SER A CA  1 
ATOM   1119 C  C   . SER A 1 147 ? -6.252  65.492 51.569 1.00 16.64 ? 147  SER A C   1 
ATOM   1120 O  O   . SER A 1 147 ? -6.590  65.084 50.455 1.00 16.36 ? 147  SER A O   1 
ATOM   1121 C  CB  . SER A 1 147 ? -7.005  67.732 52.339 1.00 15.59 ? 147  SER A CB  1 
ATOM   1122 O  OG  . SER A 1 147 ? -8.223  67.234 51.843 1.00 16.67 ? 147  SER A OG  1 
ATOM   1123 N  N   . TYR A 1 148 ? -6.186  64.707 52.633 1.00 15.04 ? 148  TYR A N   1 
ATOM   1124 C  CA  . TYR A 1 148 ? -6.535  63.305 52.543 1.00 13.59 ? 148  TYR A CA  1 
ATOM   1125 C  C   . TYR A 1 148 ? -6.969  62.769 53.888 1.00 13.28 ? 148  TYR A C   1 
ATOM   1126 O  O   . TYR A 1 148 ? -6.603  63.296 54.933 1.00 13.55 ? 148  TYR A O   1 
ATOM   1127 C  CB  . TYR A 1 148 ? -5.358  62.489 51.995 1.00 13.67 ? 148  TYR A CB  1 
ATOM   1128 C  CG  . TYR A 1 148 ? -4.109  62.522 52.835 1.00 12.45 ? 148  TYR A CG  1 
ATOM   1129 C  CD1 . TYR A 1 148 ? -3.886  61.564 53.819 1.00 16.10 ? 148  TYR A CD1 1 
ATOM   1130 C  CD2 . TYR A 1 148 ? -3.150  63.504 52.652 1.00 11.62 ? 148  TYR A CD2 1 
ATOM   1131 C  CE1 . TYR A 1 148 ? -2.739  61.588 54.605 1.00 14.30 ? 148  TYR A CE1 1 
ATOM   1132 C  CE2 . TYR A 1 148 ? -1.999  63.533 53.433 1.00 13.86 ? 148  TYR A CE2 1 
ATOM   1133 C  CZ  . TYR A 1 148 ? -1.807  62.574 54.408 1.00 12.57 ? 148  TYR A CZ  1 
ATOM   1134 O  OH  . TYR A 1 148 ? -0.701  62.622 55.209 1.00 12.10 ? 148  TYR A OH  1 
ATOM   1135 N  N   . ARG A 1 149 ? -7.792  61.740 53.856 1.00 11.03 ? 149  ARG A N   1 
ATOM   1136 C  CA  . ARG A 1 149 ? -8.261  61.151 55.074 1.00 10.57 ? 149  ARG A CA  1 
ATOM   1137 C  C   . ARG A 1 149 ? -7.097  60.593 55.861 1.00 12.90 ? 149  ARG A C   1 
ATOM   1138 O  O   . ARG A 1 149 ? -6.260  59.863 55.333 1.00 15.84 ? 149  ARG A O   1 
ATOM   1139 C  CB  . ARG A 1 149 ? -9.284  60.076 54.766 1.00 10.62 ? 149  ARG A CB  1 
ATOM   1140 C  CG  . ARG A 1 149 ? -10.634 60.650 54.440 1.00 12.89 ? 149  ARG A CG  1 
ATOM   1141 C  CD  . ARG A 1 149 ? -11.594 59.568 54.027 1.00 17.18 ? 149  ARG A CD  1 
ATOM   1142 N  NE  . ARG A 1 149 ? -11.242 58.988 52.735 1.00 16.25 ? 149  ARG A NE  1 
ATOM   1143 C  CZ  . ARG A 1 149 ? -11.873 57.960 52.186 1.00 16.31 ? 149  ARG A CZ  1 
ATOM   1144 N  NH1 . ARG A 1 149 ? -11.481 57.506 51.008 1.00 16.91 ? 149  ARG A NH1 1 
ATOM   1145 N  NH2 . ARG A 1 149 ? -12.857 57.352 52.836 1.00 15.85 ? 149  ARG A NH2 1 
ATOM   1146 N  N   . VAL A 1 150 ? -7.016  61.004 57.115 1.00 12.28 ? 150  VAL A N   1 
ATOM   1147 C  CA  . VAL A 1 150 ? -5.972  60.560 58.011 1.00 10.07 ? 150  VAL A CA  1 
ATOM   1148 C  C   . VAL A 1 150 ? -6.637  59.682 59.057 1.00 12.64 ? 150  VAL A C   1 
ATOM   1149 O  O   . VAL A 1 150 ? -7.860  59.701 59.211 1.00 14.03 ? 150  VAL A O   1 
ATOM   1150 C  CB  . VAL A 1 150 ? -5.335  61.758 58.714 1.00 9.28  ? 150  VAL A CB  1 
ATOM   1151 C  CG1 . VAL A 1 150 ? -4.626  62.630 57.717 1.00 10.22 ? 150  VAL A CG1 1 
ATOM   1152 C  CG2 . VAL A 1 150 ? -6.396  62.563 59.412 1.00 6.82  ? 150  VAL A CG2 1 
ATOM   1153 N  N   . GLY A 1 151 ? -5.841  58.889 59.753 1.00 12.47 ? 151  GLY A N   1 
ATOM   1154 C  CA  . GLY A 1 151 ? -6.364  58.033 60.798 1.00 11.80 ? 151  GLY A CA  1 
ATOM   1155 C  C   . GLY A 1 151 ? -7.284  56.984 60.245 1.00 12.70 ? 151  GLY A C   1 
ATOM   1156 O  O   . GLY A 1 151 ? -7.421  56.859 59.038 1.00 16.99 ? 151  GLY A O   1 
ATOM   1157 N  N   . ALA A 1 152 ? -7.935  56.251 61.135 1.00 15.55 ? 152  ALA A N   1 
ATOM   1158 C  CA  . ALA A 1 152 ? -8.873  55.188 60.784 1.00 15.62 ? 152  ALA A CA  1 
ATOM   1159 C  C   . ALA A 1 152 ? -9.718  55.519 59.566 1.00 14.98 ? 152  ALA A C   1 
ATOM   1160 O  O   . ALA A 1 152 ? -9.872  54.703 58.664 1.00 15.16 ? 152  ALA A O   1 
ATOM   1161 C  CB  . ALA A 1 152 ? -9.790  54.911 61.977 1.00 17.71 ? 152  ALA A CB  1 
ATOM   1162 N  N   . PHE A 1 153 ? -10.234 56.741 59.552 1.00 14.10 ? 153  PHE A N   1 
ATOM   1163 C  CA  . PHE A 1 153 ? -11.088 57.243 58.491 1.00 14.96 ? 153  PHE A CA  1 
ATOM   1164 C  C   . PHE A 1 153 ? -10.531 57.034 57.090 1.00 15.73 ? 153  PHE A C   1 
ATOM   1165 O  O   . PHE A 1 153 ? -11.296 56.875 56.126 1.00 15.02 ? 153  PHE A O   1 
ATOM   1166 C  CB  . PHE A 1 153 ? -11.350 58.726 58.719 1.00 14.46 ? 153  PHE A CB  1 
ATOM   1167 C  CG  . PHE A 1 153 ? -11.890 59.027 60.070 1.00 14.22 ? 153  PHE A CG  1 
ATOM   1168 C  CD1 . PHE A 1 153 ? -11.120 59.713 60.998 1.00 15.30 ? 153  PHE A CD1 1 
ATOM   1169 C  CD2 . PHE A 1 153 ? -13.155 58.596 60.434 1.00 12.77 ? 153  PHE A CD2 1 
ATOM   1170 C  CE1 . PHE A 1 153 ? -11.599 59.959 62.262 1.00 13.37 ? 153  PHE A CE1 1 
ATOM   1171 C  CE2 . PHE A 1 153 ? -13.642 58.839 61.698 1.00 12.75 ? 153  PHE A CE2 1 
ATOM   1172 C  CZ  . PHE A 1 153 ? -12.865 59.520 62.614 1.00 15.06 ? 153  PHE A CZ  1 
ATOM   1173 N  N   . GLY A 1 154 ? -9.210  57.089 56.970 1.00 12.92 ? 154  GLY A N   1 
ATOM   1174 C  CA  . GLY A 1 154 ? -8.597  56.898 55.677 1.00 15.45 ? 154  GLY A CA  1 
ATOM   1175 C  C   . GLY A 1 154 ? -7.668  55.707 55.587 1.00 16.36 ? 154  GLY A C   1 
ATOM   1176 O  O   . GLY A 1 154 ? -7.299  55.299 54.489 1.00 18.34 ? 154  GLY A O   1 
ATOM   1177 N  N   . PHE A 1 155 ? -7.310  55.112 56.716 1.00 14.56 ? 155  PHE A N   1 
ATOM   1178 C  CA  . PHE A 1 155 ? -6.387  54.000 56.673 1.00 12.16 ? 155  PHE A CA  1 
ATOM   1179 C  C   . PHE A 1 155 ? -6.796  52.690 57.328 1.00 12.88 ? 155  PHE A C   1 
ATOM   1180 O  O   . PHE A 1 155 ? -5.970  51.783 57.438 1.00 13.30 ? 155  PHE A O   1 
ATOM   1181 C  CB  . PHE A 1 155 ? -5.018  54.456 57.175 1.00 13.11 ? 155  PHE A CB  1 
ATOM   1182 C  CG  . PHE A 1 155 ? -4.343  55.458 56.271 1.00 12.90 ? 155  PHE A CG  1 
ATOM   1183 C  CD1 . PHE A 1 155 ? -3.607  55.038 55.172 1.00 13.36 ? 155  PHE A CD1 1 
ATOM   1184 C  CD2 . PHE A 1 155 ? -4.446  56.813 56.516 1.00 13.33 ? 155  PHE A CD2 1 
ATOM   1185 C  CE1 . PHE A 1 155 ? -2.991  55.952 54.341 1.00 12.26 ? 155  PHE A CE1 1 
ATOM   1186 C  CE2 . PHE A 1 155 ? -3.831  57.732 55.686 1.00 13.28 ? 155  PHE A CE2 1 
ATOM   1187 C  CZ  . PHE A 1 155 ? -3.103  57.300 54.598 1.00 11.21 ? 155  PHE A CZ  1 
ATOM   1188 N  N   . LEU A 1 156 ? -8.061  52.556 57.719 1.00 13.14 ? 156  LEU A N   1 
ATOM   1189 C  CA  . LEU A 1 156 ? -8.520  51.312 58.338 1.00 14.88 ? 156  LEU A CA  1 
ATOM   1190 C  C   . LEU A 1 156 ? -8.363  50.226 57.270 1.00 16.63 ? 156  LEU A C   1 
ATOM   1191 O  O   . LEU A 1 156 ? -9.007  50.280 56.223 1.00 18.21 ? 156  LEU A O   1 
ATOM   1192 C  CB  . LEU A 1 156 ? -9.984  51.421 58.772 1.00 13.40 ? 156  LEU A CB  1 
ATOM   1193 C  CG  . LEU A 1 156 ? -10.418 50.409 59.833 1.00 11.98 ? 156  LEU A CG  1 
ATOM   1194 C  CD1 . LEU A 1 156 ? -10.302 51.030 61.204 1.00 12.31 ? 156  LEU A CD1 1 
ATOM   1195 C  CD2 . LEU A 1 156 ? -11.846 50.003 59.595 1.00 15.18 ? 156  LEU A CD2 1 
ATOM   1196 N  N   . ALA A 1 157 ? -7.521  49.234 57.535 1.00 16.30 ? 157  ALA A N   1 
ATOM   1197 C  CA  . ALA A 1 157 ? -7.267  48.201 56.550 1.00 14.25 ? 157  ALA A CA  1 
ATOM   1198 C  C   . ALA A 1 157 ? -7.746  46.774 56.797 1.00 16.76 ? 157  ALA A C   1 
ATOM   1199 O  O   . ALA A 1 157 ? -6.943  45.865 57.054 1.00 17.63 ? 157  ALA A O   1 
ATOM   1200 C  CB  . ALA A 1 157 ? -5.794  48.204 56.190 1.00 14.08 ? 157  ALA A CB  1 
ATOM   1201 N  N   . LEU A 1 158 ? -9.049  46.559 56.668 1.00 17.17 ? 158  LEU A N   1 
ATOM   1202 C  CA  . LEU A 1 158 ? -9.602  45.224 56.807 1.00 16.70 ? 158  LEU A CA  1 
ATOM   1203 C  C   . LEU A 1 158 ? -9.421  44.694 55.401 1.00 17.58 ? 158  LEU A C   1 
ATOM   1204 O  O   . LEU A 1 158 ? -10.338 44.750 54.598 1.00 18.37 ? 158  LEU A O   1 
ATOM   1205 C  CB  . LEU A 1 158 ? -11.085 45.288 57.147 1.00 16.38 ? 158  LEU A CB  1 
ATOM   1206 C  CG  . LEU A 1 158 ? -11.462 45.650 58.579 1.00 17.10 ? 158  LEU A CG  1 
ATOM   1207 C  CD1 . LEU A 1 158 ? -12.964 45.727 58.696 1.00 14.11 ? 158  LEU A CD1 1 
ATOM   1208 C  CD2 . LEU A 1 158 ? -10.918 44.602 59.533 1.00 15.11 ? 158  LEU A CD2 1 
ATOM   1209 N  N   . HIS A 1 159 ? -8.217  44.221 55.100 1.00 20.92 ? 159  HIS A N   1 
ATOM   1210 C  CA  . HIS A 1 159 ? -7.871  43.727 53.767 1.00 25.00 ? 159  HIS A CA  1 
ATOM   1211 C  C   . HIS A 1 159 ? -8.933  42.974 52.984 1.00 28.78 ? 159  HIS A C   1 
ATOM   1212 O  O   . HIS A 1 159 ? -9.224  43.321 51.835 1.00 29.84 ? 159  HIS A O   1 
ATOM   1213 C  CB  . HIS A 1 159 ? -6.616  42.873 53.800 1.00 26.25 ? 159  HIS A CB  1 
ATOM   1214 C  CG  . HIS A 1 159 ? -6.015  42.649 52.449 1.00 28.90 ? 159  HIS A CG  1 
ATOM   1215 N  ND1 . HIS A 1 159 ? -6.090  43.588 51.440 1.00 29.37 ? 159  HIS A ND1 1 
ATOM   1216 C  CD2 . HIS A 1 159 ? -5.300  41.613 51.946 1.00 29.80 ? 159  HIS A CD2 1 
ATOM   1217 C  CE1 . HIS A 1 159 ? -5.440  43.142 50.378 1.00 30.47 ? 159  HIS A CE1 1 
ATOM   1218 N  NE2 . HIS A 1 159 ? -4.952  41.946 50.659 1.00 29.22 ? 159  HIS A NE2 1 
ATOM   1219 N  N   . GLY A 1 160 ? -9.450  41.898 53.568 1.00 31.62 ? 160  GLY A N   1 
ATOM   1220 C  CA  . GLY A 1 160 ? -10.466 41.118 52.876 1.00 34.42 ? 160  GLY A CA  1 
ATOM   1221 C  C   . GLY A 1 160 ? -11.552 41.970 52.231 1.00 34.18 ? 160  GLY A C   1 
ATOM   1222 O  O   . GLY A 1 160 ? -11.747 41.938 51.020 1.00 34.78 ? 160  GLY A O   1 
ATOM   1223 N  N   . SER A 1 161 ? -12.224 42.766 53.054 1.00 34.37 ? 161  SER A N   1 
ATOM   1224 C  CA  . SER A 1 161 ? -13.309 43.623 52.611 1.00 32.80 ? 161  SER A CA  1 
ATOM   1225 C  C   . SER A 1 161 ? -12.885 44.626 51.561 1.00 31.78 ? 161  SER A C   1 
ATOM   1226 O  O   . SER A 1 161 ? -11.699 44.830 51.320 1.00 32.95 ? 161  SER A O   1 
ATOM   1227 C  CB  . SER A 1 161 ? -13.882 44.377 53.812 1.00 32.20 ? 161  SER A CB  1 
ATOM   1228 O  OG  . SER A 1 161 ? -14.896 45.292 53.421 1.00 33.36 ? 161  SER A OG  1 
ATOM   1229 N  N   . GLN A 1 162 ? -13.884 45.222 50.923 1.00 31.42 ? 162  GLN A N   1 
ATOM   1230 C  CA  . GLN A 1 162 ? -13.691 46.257 49.910 1.00 31.19 ? 162  GLN A CA  1 
ATOM   1231 C  C   . GLN A 1 162 ? -14.358 47.489 50.507 1.00 30.44 ? 162  GLN A C   1 
ATOM   1232 O  O   . GLN A 1 162 ? -14.112 48.621 50.091 1.00 29.76 ? 162  GLN A O   1 
ATOM   1233 C  CB  . GLN A 1 162 ? -14.391 45.877 48.601 1.00 32.28 ? 162  GLN A CB  1 
ATOM   1234 N  N   . GLU A 1 163 ? -15.225 47.231 51.484 1.00 30.69 ? 163  GLU A N   1 
ATOM   1235 C  CA  . GLU A 1 163 ? -15.958 48.257 52.207 1.00 29.47 ? 163  GLU A CA  1 
ATOM   1236 C  C   . GLU A 1 163 ? -14.986 49.065 53.055 1.00 27.20 ? 163  GLU A C   1 
ATOM   1237 O  O   . GLU A 1 163 ? -15.297 50.164 53.478 1.00 28.84 ? 163  GLU A O   1 
ATOM   1238 C  CB  . GLU A 1 163 ? -17.005 47.602 53.105 1.00 31.36 ? 163  GLU A CB  1 
ATOM   1239 C  CG  . GLU A 1 163 ? -18.117 46.905 52.352 1.00 35.51 ? 163  GLU A CG  1 
ATOM   1240 C  CD  . GLU A 1 163 ? -18.923 47.864 51.487 1.00 38.65 ? 163  GLU A CD  1 
ATOM   1241 O  OE1 . GLU A 1 163 ? -19.027 49.053 51.868 1.00 39.82 ? 163  GLU A OE1 1 
ATOM   1242 O  OE2 . GLU A 1 163 ? -19.452 47.429 50.428 1.00 40.55 ? 163  GLU A OE2 1 
ATOM   1243 N  N   . ALA A 1 164 ? -13.832 48.488 53.355 1.00 24.17 ? 164  ALA A N   1 
ATOM   1244 C  CA  . ALA A 1 164 ? -12.813 49.192 54.117 1.00 22.80 ? 164  ALA A CA  1 
ATOM   1245 C  C   . ALA A 1 164 ? -11.433 48.591 53.861 1.00 22.03 ? 164  ALA A C   1 
ATOM   1246 O  O   . ALA A 1 164 ? -10.872 47.924 54.734 1.00 23.75 ? 164  ALA A O   1 
ATOM   1247 C  CB  . ALA A 1 164 ? -13.132 49.176 55.595 1.00 22.28 ? 164  ALA A CB  1 
ATOM   1248 N  N   . PRO A 1 165 ? -10.936 48.698 52.614 1.00 19.79 ? 165  PRO A N   1 
ATOM   1249 C  CA  . PRO A 1 165 ? -9.620  48.174 52.253 1.00 18.07 ? 165  PRO A CA  1 
ATOM   1250 C  C   . PRO A 1 165 ? -8.657  49.260 52.704 1.00 18.63 ? 165  PRO A C   1 
ATOM   1251 O  O   . PRO A 1 165 ? -9.060  50.415 52.874 1.00 21.89 ? 165  PRO A O   1 
ATOM   1252 C  CB  . PRO A 1 165 ? -9.701  48.113 50.737 1.00 20.43 ? 165  PRO A CB  1 
ATOM   1253 C  CG  . PRO A 1 165 ? -10.489 49.341 50.405 1.00 18.59 ? 165  PRO A CG  1 
ATOM   1254 C  CD  . PRO A 1 165 ? -11.600 49.285 51.436 1.00 19.56 ? 165  PRO A CD  1 
ATOM   1255 N  N   . GLY A 1 166 ? -7.393  48.940 52.890 1.00 14.83 ? 166  GLY A N   1 
ATOM   1256 C  CA  . GLY A 1 166 ? -6.501  49.987 53.355 1.00 15.85 ? 166  GLY A CA  1 
ATOM   1257 C  C   . GLY A 1 166 ? -6.173  51.074 52.350 1.00 14.45 ? 166  GLY A C   1 
ATOM   1258 O  O   . GLY A 1 166 ? -6.884  51.282 51.375 1.00 14.06 ? 166  GLY A O   1 
ATOM   1259 N  N   . ASN A 1 167 ? -5.143  51.842 52.669 1.00 13.01 ? 167  ASN A N   1 
ATOM   1260 C  CA  . ASN A 1 167 ? -4.631  52.883 51.802 1.00 12.25 ? 167  ASN A CA  1 
ATOM   1261 C  C   . ASN A 1 167 ? -5.647  53.780 51.137 1.00 12.67 ? 167  ASN A C   1 
ATOM   1262 O  O   . ASN A 1 167 ? -5.318  54.529 50.219 1.00 13.24 ? 167  ASN A O   1 
ATOM   1263 C  CB  . ASN A 1 167 ? -3.761  52.234 50.746 1.00 12.35 ? 167  ASN A CB  1 
ATOM   1264 C  CG  . ASN A 1 167 ? -2.898  51.141 51.318 1.00 15.72 ? 167  ASN A CG  1 
ATOM   1265 O  OD1 . ASN A 1 167 ? -2.576  51.159 52.501 1.00 16.54 ? 167  ASN A OD1 1 
ATOM   1266 N  ND2 . ASN A 1 167 ? -2.561  50.154 50.499 1.00 17.51 ? 167  ASN A ND2 1 
ATOM   1267 N  N   . VAL A 1 168 ? -6.868  53.755 51.638 1.00 13.62 ? 168  VAL A N   1 
ATOM   1268 C  CA  . VAL A 1 168 ? -7.932  54.565 51.091 1.00 14.01 ? 168  VAL A CA  1 
ATOM   1269 C  C   . VAL A 1 168 ? -7.538  56.037 51.097 1.00 14.55 ? 168  VAL A C   1 
ATOM   1270 O  O   . VAL A 1 168 ? -7.705  56.747 50.106 1.00 16.49 ? 168  VAL A O   1 
ATOM   1271 C  CB  . VAL A 1 168 ? -9.220  54.308 51.870 1.00 13.26 ? 168  VAL A CB  1 
ATOM   1272 C  CG1 . VAL A 1 168 ? -9.872  55.577 52.295 1.00 12.58 ? 168  VAL A CG1 1 
ATOM   1273 C  CG2 . VAL A 1 168 ? -10.143 53.471 51.044 1.00 12.72 ? 168  VAL A CG2 1 
ATOM   1274 N  N   . GLY A 1 169 ? -6.922  56.467 52.183 1.00 15.36 ? 169  GLY A N   1 
ATOM   1275 C  CA  . GLY A 1 169 ? -6.506  57.853 52.288 1.00 17.13 ? 169  GLY A CA  1 
ATOM   1276 C  C   . GLY A 1 169 ? -5.351  58.132 51.357 1.00 15.60 ? 169  GLY A C   1 
ATOM   1277 O  O   . GLY A 1 169 ? -5.048  59.286 51.051 1.00 15.51 ? 169  GLY A O   1 
ATOM   1278 N  N   . LEU A 1 170 ? -4.681  57.062 50.944 1.00 14.16 ? 170  LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 170 ? -3.559  57.154 50.033 1.00 12.14 ? 170  LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 170 ? -4.197  57.319 48.657 1.00 13.43 ? 170  LEU A C   1 
ATOM   1281 O  O   . LEU A 1 170 ? -3.679  58.023 47.795 1.00 15.47 ? 170  LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 170 ? -2.705  55.892 50.145 1.00 8.07  ? 170  LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 170 ? -1.190  56.070 50.150 1.00 5.89  ? 170  LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 170 ? -0.783  57.325 50.864 1.00 7.19  ? 170  LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 170 ? -0.557  54.883 50.778 1.00 3.17  ? 170  LEU A CD2 1 
ATOM   1286 N  N   . LEU A 1 171 ? -5.375  56.736 48.488 1.00 14.17 ? 171  LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 171 ? -6.112  56.877 47.243 1.00 16.75 ? 171  LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 171 ? -6.622  58.320 47.135 1.00 18.50 ? 171  LEU A C   1 
ATOM   1289 O  O   . LEU A 1 171 ? -6.614  58.907 46.059 1.00 21.79 ? 171  LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 171 ? -7.280  55.893 47.187 1.00 14.76 ? 171  LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 171 ? -6.838  54.432 47.075 1.00 16.68 ? 171  LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 171 ? -8.023  53.528 47.166 1.00 17.92 ? 171  LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 171 ? -6.109  54.196 45.775 1.00 18.02 ? 171  LEU A CD2 1 
ATOM   1294 N  N   . ASP A 1 172 ? -7.043  58.900 48.253 1.00 18.35 ? 172  ASP A N   1 
ATOM   1295 C  CA  . ASP A 1 172 ? -7.525  60.275 48.259 1.00 15.44 ? 172  ASP A CA  1 
ATOM   1296 C  C   . ASP A 1 172 ? -6.465  61.166 47.647 1.00 14.81 ? 172  ASP A C   1 
ATOM   1297 O  O   . ASP A 1 172 ? -6.777  62.094 46.916 1.00 17.29 ? 172  ASP A O   1 
ATOM   1298 C  CB  . ASP A 1 172 ? -7.772  60.761 49.687 1.00 16.95 ? 172  ASP A CB  1 
ATOM   1299 C  CG  . ASP A 1 172 ? -8.939  60.079 50.358 1.00 18.00 ? 172  ASP A CG  1 
ATOM   1300 O  OD1 . ASP A 1 172 ? -9.405  60.614 51.373 1.00 19.85 ? 172  ASP A OD1 1 
ATOM   1301 O  OD2 . ASP A 1 172 ? -9.393  59.019 49.894 1.00 20.63 ? 172  ASP A OD2 1 
ATOM   1302 N  N   . GLN A 1 173 ? -5.206  60.884 47.959 1.00 14.69 ? 173  GLN A N   1 
ATOM   1303 C  CA  . GLN A 1 173 ? -4.095  61.677 47.447 1.00 14.62 ? 173  GLN A CA  1 
ATOM   1304 C  C   . GLN A 1 173 ? -3.987  61.472 45.955 1.00 14.68 ? 173  GLN A C   1 
ATOM   1305 O  O   . GLN A 1 173 ? -3.654  62.389 45.215 1.00 16.94 ? 173  GLN A O   1 
ATOM   1306 C  CB  . GLN A 1 173 ? -2.779  61.259 48.099 1.00 13.79 ? 173  GLN A CB  1 
ATOM   1307 C  CG  . GLN A 1 173 ? -2.757  61.352 49.601 1.00 11.35 ? 173  GLN A CG  1 
ATOM   1308 C  CD  . GLN A 1 173 ? -1.427  60.945 50.166 1.00 13.14 ? 173  GLN A CD  1 
ATOM   1309 O  OE1 . GLN A 1 173 ? -0.441  60.886 49.451 1.00 13.71 ? 173  GLN A OE1 1 
ATOM   1310 N  NE2 . GLN A 1 173 ? -1.388  60.664 51.453 1.00 16.01 ? 173  GLN A NE2 1 
ATOM   1311 N  N   . ARG A 1 174 ? -4.260  60.254 45.511 1.00 13.87 ? 174  ARG A N   1 
ATOM   1312 C  CA  . ARG A 1 174 ? -4.194  59.946 44.094 1.00 13.07 ? 174  ARG A CA  1 
ATOM   1313 C  C   . ARG A 1 174 ? -5.303  60.681 43.373 1.00 13.36 ? 174  ARG A C   1 
ATOM   1314 O  O   . ARG A 1 174 ? -5.095  61.215 42.300 1.00 17.08 ? 174  ARG A O   1 
ATOM   1315 C  CB  . ARG A 1 174 ? -4.326  58.453 43.874 1.00 12.37 ? 174  ARG A CB  1 
ATOM   1316 C  CG  . ARG A 1 174 ? -4.232  58.044 42.456 1.00 9.71  ? 174  ARG A CG  1 
ATOM   1317 C  CD  . ARG A 1 174 ? -4.396  56.567 42.359 1.00 12.21 ? 174  ARG A CD  1 
ATOM   1318 N  NE  . ARG A 1 174 ? -3.220  55.883 42.861 1.00 12.22 ? 174  ARG A NE  1 
ATOM   1319 C  CZ  . ARG A 1 174 ? -3.166  54.579 43.107 1.00 16.70 ? 174  ARG A CZ  1 
ATOM   1320 N  NH1 . ARG A 1 174 ? -2.040  54.047 43.551 1.00 17.25 ? 174  ARG A NH1 1 
ATOM   1321 N  NH2 . ARG A 1 174 ? -4.238  53.811 42.939 1.00 11.68 ? 174  ARG A NH2 1 
ATOM   1322 N  N   . MET A 1 175 ? -6.477  60.721 43.975 1.00 14.30 ? 175  MET A N   1 
ATOM   1323 C  CA  . MET A 1 175 ? -7.620  61.411 43.402 1.00 14.97 ? 175  MET A CA  1 
ATOM   1324 C  C   . MET A 1 175 ? -7.273  62.892 43.332 1.00 16.73 ? 175  MET A C   1 
ATOM   1325 O  O   . MET A 1 175 ? -7.627  63.586 42.378 1.00 18.89 ? 175  MET A O   1 
ATOM   1326 C  CB  . MET A 1 175 ? -8.824  61.225 44.311 1.00 16.88 ? 175  MET A CB  1 
ATOM   1327 C  CG  . MET A 1 175 ? -10.137 61.640 43.730 1.00 17.30 ? 175  MET A CG  1 
ATOM   1328 S  SD  . MET A 1 175 ? -11.033 60.181 43.261 1.00 18.39 ? 175  MET A SD  1 
ATOM   1329 C  CE  . MET A 1 175 ? -10.502 60.036 41.526 1.00 25.26 ? 175  MET A CE  1 
ATOM   1330 N  N   . ALA A 1 176 ? -6.589  63.380 44.360 1.00 17.61 ? 176  ALA A N   1 
ATOM   1331 C  CA  . ALA A 1 176 ? -6.187  64.781 44.417 1.00 16.87 ? 176  ALA A CA  1 
ATOM   1332 C  C   . ALA A 1 176 ? -5.208  65.045 43.301 1.00 14.82 ? 176  ALA A C   1 
ATOM   1333 O  O   . ALA A 1 176 ? -5.256  66.092 42.665 1.00 12.61 ? 176  ALA A O   1 
ATOM   1334 C  CB  . ALA A 1 176 ? -5.543  65.090 45.747 1.00 15.99 ? 176  ALA A CB  1 
ATOM   1335 N  N   . LEU A 1 177 ? -4.327  64.072 43.079 1.00 15.48 ? 177  LEU A N   1 
ATOM   1336 C  CA  . LEU A 1 177 ? -3.304  64.128 42.034 1.00 17.43 ? 177  LEU A CA  1 
ATOM   1337 C  C   . LEU A 1 177 ? -3.916  63.963 40.629 1.00 17.91 ? 177  LEU A C   1 
ATOM   1338 O  O   . LEU A 1 177 ? -3.507  64.631 39.678 1.00 18.60 ? 177  LEU A O   1 
ATOM   1339 C  CB  . LEU A 1 177 ? -2.245  63.058 42.301 1.00 14.71 ? 177  LEU A CB  1 
ATOM   1340 C  CG  . LEU A 1 177 ? -0.858  63.520 42.757 1.00 13.59 ? 177  LEU A CG  1 
ATOM   1341 C  CD1 . LEU A 1 177 ? -0.946  64.753 43.625 1.00 11.03 ? 177  LEU A CD1 1 
ATOM   1342 C  CD2 . LEU A 1 177 ? -0.154  62.377 43.475 1.00 12.42 ? 177  LEU A CD2 1 
ATOM   1343 N  N   . GLN A 1 178 ? -4.935  63.119 40.524 1.00 17.56 ? 178  GLN A N   1 
ATOM   1344 C  CA  . GLN A 1 178 ? -5.622  62.887 39.268 1.00 17.34 ? 178  GLN A CA  1 
ATOM   1345 C  C   . GLN A 1 178 ? -6.282  64.188 38.836 1.00 17.01 ? 178  GLN A C   1 
ATOM   1346 O  O   . GLN A 1 178 ? -6.095  64.626 37.705 1.00 20.08 ? 178  GLN A O   1 
ATOM   1347 C  CB  . GLN A 1 178 ? -6.677  61.790 39.430 1.00 17.81 ? 178  GLN A CB  1 
ATOM   1348 C  CG  . GLN A 1 178 ? -7.416  61.395 38.150 1.00 17.59 ? 178  GLN A CG  1 
ATOM   1349 C  CD  . GLN A 1 178 ? -6.499  60.858 37.061 1.00 18.56 ? 178  GLN A CD  1 
ATOM   1350 O  OE1 . GLN A 1 178 ? -5.820  59.840 37.231 1.00 18.14 ? 178  GLN A OE1 1 
ATOM   1351 N  NE2 . GLN A 1 178 ? -6.486  61.539 35.930 1.00 19.73 ? 178  GLN A NE2 1 
ATOM   1352 N  N   . TRP A 1 179 ? -7.032  64.815 39.735 1.00 14.72 ? 179  TRP A N   1 
ATOM   1353 C  CA  . TRP A 1 179 ? -7.705  66.072 39.428 1.00 11.41 ? 179  TRP A CA  1 
ATOM   1354 C  C   . TRP A 1 179 ? -6.669  67.116 39.041 1.00 12.76 ? 179  TRP A C   1 
ATOM   1355 O  O   . TRP A 1 179 ? -6.863  67.857 38.087 1.00 14.88 ? 179  TRP A O   1 
ATOM   1356 C  CB  . TRP A 1 179 ? -8.508  66.551 40.635 1.00 9.87  ? 179  TRP A CB  1 
ATOM   1357 C  CG  . TRP A 1 179 ? -9.516  67.647 40.356 1.00 9.55  ? 179  TRP A CG  1 
ATOM   1358 C  CD1 . TRP A 1 179 ? -10.867 67.493 40.166 1.00 8.48  ? 179  TRP A CD1 1 
ATOM   1359 C  CD2 . TRP A 1 179 ? -9.267  69.059 40.310 1.00 6.10  ? 179  TRP A CD2 1 
ATOM   1360 N  NE1 . TRP A 1 179 ? -11.461 68.717 40.015 1.00 8.58  ? 179  TRP A NE1 1 
ATOM   1361 C  CE2 . TRP A 1 179 ? -10.501 69.694 40.096 1.00 6.32  ? 179  TRP A CE2 1 
ATOM   1362 C  CE3 . TRP A 1 179 ? -8.120  69.847 40.431 1.00 5.64  ? 179  TRP A CE3 1 
ATOM   1363 C  CZ2 . TRP A 1 179 ? -10.618 71.078 40.002 1.00 6.98  ? 179  TRP A CZ2 1 
ATOM   1364 C  CZ3 . TRP A 1 179 ? -8.243  71.225 40.336 1.00 2.02  ? 179  TRP A CZ3 1 
ATOM   1365 C  CH2 . TRP A 1 179 ? -9.478  71.821 40.125 1.00 2.01  ? 179  TRP A CH2 1 
ATOM   1366 N  N   . VAL A 1 180 ? -5.561  67.175 39.766 1.00 14.06 ? 180  VAL A N   1 
ATOM   1367 C  CA  . VAL A 1 180 ? -4.508  68.137 39.445 1.00 14.79 ? 180  VAL A CA  1 
ATOM   1368 C  C   . VAL A 1 180 ? -3.993  67.883 38.022 1.00 15.50 ? 180  VAL A C   1 
ATOM   1369 O  O   . VAL A 1 180 ? -3.697  68.814 37.284 1.00 14.59 ? 180  VAL A O   1 
ATOM   1370 C  CB  . VAL A 1 180 ? -3.345  68.047 40.461 1.00 13.78 ? 180  VAL A CB  1 
ATOM   1371 C  CG1 . VAL A 1 180 ? -2.119  68.788 39.965 1.00 13.15 ? 180  VAL A CG1 1 
ATOM   1372 C  CG2 . VAL A 1 180 ? -3.782  68.628 41.778 1.00 13.62 ? 180  VAL A CG2 1 
ATOM   1373 N  N   . HIS A 1 181 ? -3.949  66.615 37.632 1.00 16.84 ? 181  HIS A N   1 
ATOM   1374 C  CA  . HIS A 1 181 ? -3.484  66.204 36.306 1.00 18.03 ? 181  HIS A CA  1 
ATOM   1375 C  C   . HIS A 1 181 ? -4.445  66.634 35.215 1.00 17.99 ? 181  HIS A C   1 
ATOM   1376 O  O   . HIS A 1 181 ? -4.029  67.051 34.141 1.00 20.14 ? 181  HIS A O   1 
ATOM   1377 C  CB  . HIS A 1 181 ? -3.336  64.679 36.260 1.00 16.15 ? 181  HIS A CB  1 
ATOM   1378 C  CG  . HIS A 1 181 ? -2.724  64.160 34.997 1.00 18.22 ? 181  HIS A CG  1 
ATOM   1379 N  ND1 . HIS A 1 181 ? -3.437  64.006 33.829 1.00 21.23 ? 181  HIS A ND1 1 
ATOM   1380 C  CD2 . HIS A 1 181 ? -1.479  63.692 34.739 1.00 21.50 ? 181  HIS A CD2 1 
ATOM   1381 C  CE1 . HIS A 1 181 ? -2.662  63.456 32.909 1.00 23.27 ? 181  HIS A CE1 1 
ATOM   1382 N  NE2 . HIS A 1 181 ? -1.469  63.255 33.437 1.00 21.43 ? 181  HIS A NE2 1 
ATOM   1383 N  N   . ASP A 1 182 ? -5.733  66.510 35.496 1.00 18.01 ? 182  ASP A N   1 
ATOM   1384 C  CA  . ASP A 1 182 ? -6.772  66.841 34.536 1.00 16.86 ? 182  ASP A CA  1 
ATOM   1385 C  C   . ASP A 1 182 ? -7.163  68.309 34.475 1.00 17.52 ? 182  ASP A C   1 
ATOM   1386 O  O   . ASP A 1 182 ? -7.577  68.789 33.424 1.00 19.25 ? 182  ASP A O   1 
ATOM   1387 C  CB  . ASP A 1 182 ? -8.042  66.030 34.831 1.00 16.78 ? 182  ASP A CB  1 
ATOM   1388 C  CG  . ASP A 1 182 ? -7.835  64.521 34.746 1.00 18.65 ? 182  ASP A CG  1 
ATOM   1389 O  OD1 . ASP A 1 182 ? -8.773  63.813 35.159 1.00 20.09 ? 182  ASP A OD1 1 
ATOM   1390 O  OD2 . ASP A 1 182 ? -6.780  64.033 34.264 1.00 17.90 ? 182  ASP A OD2 1 
ATOM   1391 N  N   . ASN A 1 183 ? -7.030  69.034 35.579 1.00 16.13 ? 183  ASN A N   1 
ATOM   1392 C  CA  . ASN A 1 183 ? -7.469  70.415 35.576 1.00 14.91 ? 183  ASN A CA  1 
ATOM   1393 C  C   . ASN A 1 183 ? -6.460  71.503 35.871 1.00 17.08 ? 183  ASN A C   1 
ATOM   1394 O  O   . ASN A 1 183 ? -6.755  72.680 35.651 1.00 19.50 ? 183  ASN A O   1 
ATOM   1395 C  CB  . ASN A 1 183 ? -8.643  70.578 36.522 1.00 13.75 ? 183  ASN A CB  1 
ATOM   1396 C  CG  . ASN A 1 183 ? -9.680  69.501 36.349 1.00 16.13 ? 183  ASN A CG  1 
ATOM   1397 O  OD1 . ASN A 1 183 ? -10.793 69.757 35.902 1.00 22.54 ? 183  ASN A OD1 1 
ATOM   1398 N  ND2 . ASN A 1 183 ? -9.334  68.292 36.726 1.00 15.46 ? 183  ASN A ND2 1 
ATOM   1399 N  N   . ILE A 1 184 ? -5.256  71.151 36.305 1.00 16.38 ? 184  ILE A N   1 
ATOM   1400 C  CA  . ILE A 1 184 ? -4.299  72.194 36.632 1.00 17.55 ? 184  ILE A CA  1 
ATOM   1401 C  C   . ILE A 1 184 ? -3.967  73.124 35.475 1.00 20.50 ? 184  ILE A C   1 
ATOM   1402 O  O   . ILE A 1 184 ? -3.532  74.257 35.688 1.00 22.43 ? 184  ILE A O   1 
ATOM   1403 C  CB  . ILE A 1 184 ? -3.018  71.642 37.264 1.00 16.78 ? 184  ILE A CB  1 
ATOM   1404 C  CG1 . ILE A 1 184 ? -2.339  72.747 38.073 1.00 18.55 ? 184  ILE A CG1 1 
ATOM   1405 C  CG2 . ILE A 1 184 ? -2.082  71.116 36.206 1.00 16.75 ? 184  ILE A CG2 1 
ATOM   1406 C  CD1 . ILE A 1 184 ? -3.244  73.367 39.132 1.00 19.32 ? 184  ILE A CD1 1 
ATOM   1407 N  N   . GLN A 1 185 ? -4.213  72.662 34.253 1.00 22.15 ? 185  GLN A N   1 
ATOM   1408 C  CA  . GLN A 1 185 ? -3.948  73.453 33.052 1.00 20.53 ? 185  GLN A CA  1 
ATOM   1409 C  C   . GLN A 1 185 ? -4.831  74.682 33.039 1.00 19.70 ? 185  GLN A C   1 
ATOM   1410 O  O   . GLN A 1 185 ? -4.401  75.766 32.653 1.00 22.56 ? 185  GLN A O   1 
ATOM   1411 C  CB  . GLN A 1 185 ? -4.205  72.619 31.797 1.00 20.78 ? 185  GLN A CB  1 
ATOM   1412 C  CG  . GLN A 1 185 ? -5.506  71.837 31.842 1.00 23.26 ? 185  GLN A CG  1 
ATOM   1413 C  CD  . GLN A 1 185 ? -5.770  71.061 30.581 1.00 22.64 ? 185  GLN A CD  1 
ATOM   1414 O  OE1 . GLN A 1 185 ? -4.928  70.293 30.124 1.00 26.90 ? 185  GLN A OE1 1 
ATOM   1415 N  NE2 . GLN A 1 185 ? -6.946  71.248 30.015 1.00 23.15 ? 185  GLN A NE2 1 
ATOM   1416 N  N   . PHE A 1 186 ? -6.052  74.519 33.528 1.00 17.77 ? 186  PHE A N   1 
ATOM   1417 C  CA  . PHE A 1 186 ? -7.009  75.609 33.570 1.00 17.05 ? 186  PHE A CA  1 
ATOM   1418 C  C   . PHE A 1 186 ? -6.591  76.660 34.569 1.00 17.48 ? 186  PHE A C   1 
ATOM   1419 O  O   . PHE A 1 186 ? -7.154  77.750 34.594 1.00 20.72 ? 186  PHE A O   1 
ATOM   1420 C  CB  . PHE A 1 186 ? -8.383  75.071 33.932 1.00 15.97 ? 186  PHE A CB  1 
ATOM   1421 C  CG  . PHE A 1 186 ? -8.836  73.967 33.041 1.00 17.39 ? 186  PHE A CG  1 
ATOM   1422 C  CD1 . PHE A 1 186 ? -9.148  72.725 33.561 1.00 17.46 ? 186  PHE A CD1 1 
ATOM   1423 C  CD2 . PHE A 1 186 ? -8.937  74.167 31.674 1.00 16.91 ? 186  PHE A CD2 1 
ATOM   1424 C  CE1 . PHE A 1 186 ? -9.555  71.697 32.740 1.00 16.58 ? 186  PHE A CE1 1 
ATOM   1425 C  CE2 . PHE A 1 186 ? -9.343  73.148 30.847 1.00 15.55 ? 186  PHE A CE2 1 
ATOM   1426 C  CZ  . PHE A 1 186 ? -9.652  71.909 31.380 1.00 17.20 ? 186  PHE A CZ  1 
ATOM   1427 N  N   . PHE A 1 187 ? -5.627  76.317 35.417 1.00 16.14 ? 187  PHE A N   1 
ATOM   1428 C  CA  . PHE A 1 187 ? -5.138  77.244 36.424 1.00 13.72 ? 187  PHE A CA  1 
ATOM   1429 C  C   . PHE A 1 187 ? -3.801  77.803 36.016 1.00 13.63 ? 187  PHE A C   1 
ATOM   1430 O  O   . PHE A 1 187 ? -3.257  78.664 36.689 1.00 17.40 ? 187  PHE A O   1 
ATOM   1431 C  CB  . PHE A 1 187 ? -5.039  76.566 37.789 1.00 11.24 ? 187  PHE A CB  1 
ATOM   1432 C  CG  . PHE A 1 187 ? -6.361  76.137 38.343 1.00 10.93 ? 187  PHE A CG  1 
ATOM   1433 C  CD1 . PHE A 1 187 ? -6.842  74.861 38.111 1.00 9.79  ? 187  PHE A CD1 1 
ATOM   1434 C  CD2 . PHE A 1 187 ? -7.135  77.018 39.083 1.00 11.29 ? 187  PHE A CD2 1 
ATOM   1435 C  CE1 . PHE A 1 187 ? -8.071  74.472 38.602 1.00 11.12 ? 187  PHE A CE1 1 
ATOM   1436 C  CE2 . PHE A 1 187 ? -8.366  76.636 39.580 1.00 10.54 ? 187  PHE A CE2 1 
ATOM   1437 C  CZ  . PHE A 1 187 ? -8.835  75.362 39.338 1.00 11.03 ? 187  PHE A CZ  1 
ATOM   1438 N  N   . GLY A 1 188 ? -3.277  77.322 34.901 1.00 12.13 ? 188  GLY A N   1 
ATOM   1439 C  CA  . GLY A 1 188 ? -2.005  77.811 34.431 1.00 9.33  ? 188  GLY A CA  1 
ATOM   1440 C  C   . GLY A 1 188 ? -0.919  76.863 34.825 1.00 10.26 ? 188  GLY A C   1 
ATOM   1441 O  O   . GLY A 1 188 ? 0.261   77.197 34.768 1.00 13.04 ? 188  GLY A O   1 
ATOM   1442 N  N   . GLY A 1 189 ? -1.311  75.659 35.198 1.00 10.54 ? 189  GLY A N   1 
ATOM   1443 C  CA  . GLY A 1 189 ? -0.331  74.677 35.598 1.00 13.17 ? 189  GLY A CA  1 
ATOM   1444 C  C   . GLY A 1 189 ? 0.009   73.682 34.513 1.00 15.11 ? 189  GLY A C   1 
ATOM   1445 O  O   . GLY A 1 189 ? -0.855  73.241 33.765 1.00 17.65 ? 189  GLY A O   1 
ATOM   1446 N  N   . ASP A 1 190 ? 1.269   73.290 34.464 1.00 15.17 ? 190  ASP A N   1 
ATOM   1447 C  CA  . ASP A 1 190 ? 1.745   72.332 33.491 1.00 15.87 ? 190  ASP A CA  1 
ATOM   1448 C  C   . ASP A 1 190 ? 1.532   70.967 34.123 1.00 16.87 ? 190  ASP A C   1 
ATOM   1449 O  O   . ASP A 1 190 ? 2.339   70.529 34.935 1.00 19.85 ? 190  ASP A O   1 
ATOM   1450 C  CB  . ASP A 1 190 ? 3.236   72.574 33.246 1.00 18.22 ? 190  ASP A CB  1 
ATOM   1451 C  CG  . ASP A 1 190 ? 3.831   71.637 32.211 1.00 21.62 ? 190  ASP A CG  1 
ATOM   1452 O  OD1 . ASP A 1 190 ? 4.935   71.947 31.711 1.00 23.03 ? 190  ASP A OD1 1 
ATOM   1453 O  OD2 . ASP A 1 190 ? 3.218   70.596 31.891 1.00 24.54 ? 190  ASP A OD2 1 
ATOM   1454 N  N   . PRO A 1 191 ? 0.491   70.240 33.706 1.00 17.41 ? 191  PRO A N   1 
ATOM   1455 C  CA  . PRO A 1 191 ? 0.214   68.920 34.270 1.00 18.47 ? 191  PRO A CA  1 
ATOM   1456 C  C   . PRO A 1 191 ? 1.327   67.909 34.092 1.00 21.23 ? 191  PRO A C   1 
ATOM   1457 O  O   . PRO A 1 191 ? 1.359   66.897 34.786 1.00 25.64 ? 191  PRO A O   1 
ATOM   1458 C  CB  . PRO A 1 191 ? -1.049  68.497 33.537 1.00 17.29 ? 191  PRO A CB  1 
ATOM   1459 C  CG  . PRO A 1 191 ? -0.897  69.150 32.225 1.00 18.93 ? 191  PRO A CG  1 
ATOM   1460 C  CD  . PRO A 1 191 ? -0.428  70.526 32.598 1.00 18.87 ? 191  PRO A CD  1 
ATOM   1461 N  N   . LYS A 1 192 ? 2.239   68.164 33.161 1.00 23.71 ? 192  LYS A N   1 
ATOM   1462 C  CA  . LYS A 1 192 ? 3.349   67.243 32.934 1.00 24.44 ? 192  LYS A CA  1 
ATOM   1463 C  C   . LYS A 1 192 ? 4.606   67.747 33.628 1.00 24.29 ? 192  LYS A C   1 
ATOM   1464 O  O   . LYS A 1 192 ? 5.730   67.397 33.251 1.00 24.37 ? 192  LYS A O   1 
ATOM   1465 C  CB  . LYS A 1 192 ? 3.614   67.048 31.441 1.00 24.30 ? 192  LYS A CB  1 
ATOM   1466 C  CG  . LYS A 1 192 ? 2.384   66.734 30.602 1.00 27.17 ? 192  LYS A CG  1 
ATOM   1467 C  CD  . LYS A 1 192 ? 1.582   65.535 31.094 1.00 27.19 ? 192  LYS A CD  1 
ATOM   1468 C  CE  . LYS A 1 192 ? 0.400   65.300 30.145 1.00 31.44 ? 192  LYS A CE  1 
ATOM   1469 N  NZ  . LYS A 1 192 ? -0.633  64.333 30.636 1.00 33.10 ? 192  LYS A NZ  1 
ATOM   1470 N  N   . THR A 1 193 ? 4.409   68.623 34.606 1.00 23.99 ? 193  THR A N   1 
ATOM   1471 C  CA  . THR A 1 193 ? 5.512   69.163 35.392 1.00 25.14 ? 193  THR A CA  1 
ATOM   1472 C  C   . THR A 1 193 ? 4.978   69.431 36.792 1.00 25.53 ? 193  THR A C   1 
ATOM   1473 O  O   . THR A 1 193 ? 5.096   70.531 37.344 1.00 25.78 ? 193  THR A O   1 
ATOM   1474 C  CB  . THR A 1 193 ? 6.082   70.421 34.776 1.00 23.76 ? 193  THR A CB  1 
ATOM   1475 O  OG1 . THR A 1 193 ? 6.442   70.149 33.417 1.00 26.11 ? 193  THR A OG1 1 
ATOM   1476 C  CG2 . THR A 1 193 ? 7.320   70.849 35.530 1.00 23.63 ? 193  THR A CG2 1 
ATOM   1477 N  N   . VAL A 1 194 ? 4.305   68.408 37.310 1.00 25.17 ? 194  VAL A N   1 
ATOM   1478 C  CA  . VAL A 1 194 ? 3.711   68.433 38.628 1.00 22.59 ? 194  VAL A CA  1 
ATOM   1479 C  C   . VAL A 1 194 ? 4.672   67.730 39.558 1.00 20.16 ? 194  VAL A C   1 
ATOM   1480 O  O   . VAL A 1 194 ? 5.010   66.575 39.339 1.00 19.88 ? 194  VAL A O   1 
ATOM   1481 C  CB  . VAL A 1 194 ? 2.357   67.685 38.632 1.00 22.31 ? 194  VAL A CB  1 
ATOM   1482 C  CG1 . VAL A 1 194 ? 1.874   67.457 40.038 1.00 23.20 ? 194  VAL A CG1 1 
ATOM   1483 C  CG2 . VAL A 1 194 ? 1.321   68.482 37.874 1.00 22.72 ? 194  VAL A CG2 1 
ATOM   1484 N  N   . THR A 1 195 ? 5.190   68.462 40.529 1.00 18.76 ? 195  THR A N   1 
ATOM   1485 C  CA  . THR A 1 195 ? 6.087   67.891 41.518 1.00 18.76 ? 195  THR A CA  1 
ATOM   1486 C  C   . THR A 1 195 ? 5.294   67.737 42.811 1.00 16.94 ? 195  THR A C   1 
ATOM   1487 O  O   . THR A 1 195 ? 4.655   68.695 43.265 1.00 15.46 ? 195  THR A O   1 
ATOM   1488 C  CB  . THR A 1 195 ? 7.285   68.804 41.767 1.00 18.80 ? 195  THR A CB  1 
ATOM   1489 O  OG1 . THR A 1 195 ? 8.160   68.741 40.638 1.00 23.67 ? 195  THR A OG1 1 
ATOM   1490 C  CG2 . THR A 1 195 ? 8.033   68.397 43.018 1.00 13.86 ? 195  THR A CG2 1 
ATOM   1491 N  N   . ILE A 1 196 ? 5.249   66.516 43.341 1.00 12.45 ? 196  ILE A N   1 
ATOM   1492 C  CA  . ILE A 1 196 ? 4.548   66.278 44.587 1.00 9.78  ? 196  ILE A CA  1 
ATOM   1493 C  C   . ILE A 1 196 ? 5.564   66.297 45.716 1.00 12.36 ? 196  ILE A C   1 
ATOM   1494 O  O   . ILE A 1 196 ? 6.584   65.594 45.667 1.00 12.51 ? 196  ILE A O   1 
ATOM   1495 C  CB  . ILE A 1 196 ? 3.776   64.943 44.608 1.00 4.56  ? 196  ILE A CB  1 
ATOM   1496 C  CG1 . ILE A 1 196 ? 4.686   63.767 44.285 1.00 3.61  ? 196  ILE A CG1 1 
ATOM   1497 C  CG2 . ILE A 1 196 ? 2.619   65.008 43.674 1.00 7.50  ? 196  ILE A CG2 1 
ATOM   1498 C  CD1 . ILE A 1 196 ? 4.007   62.443 44.387 1.00 2.04  ? 196  ILE A CD1 1 
ATOM   1499 N  N   . PHE A 1 197 ? 5.353   67.192 46.673 1.00 13.44 ? 197  PHE A N   1 
ATOM   1500 C  CA  . PHE A 1 197 ? 6.241   67.273 47.816 1.00 15.98 ? 197  PHE A CA  1 
ATOM   1501 C  C   . PHE A 1 197 ? 5.463   67.108 49.110 1.00 17.13 ? 197  PHE A C   1 
ATOM   1502 O  O   . PHE A 1 197 ? 4.270   67.395 49.155 1.00 21.06 ? 197  PHE A O   1 
ATOM   1503 C  CB  . PHE A 1 197 ? 7.138   68.532 47.784 1.00 12.75 ? 197  PHE A CB  1 
ATOM   1504 C  CG  . PHE A 1 197 ? 6.425   69.848 47.947 1.00 10.23 ? 197  PHE A CG  1 
ATOM   1505 C  CD1 . PHE A 1 197 ? 5.112   70.022 47.570 1.00 9.62  ? 197  PHE A CD1 1 
ATOM   1506 C  CD2 . PHE A 1 197 ? 7.115   70.941 48.460 1.00 9.44  ? 197  PHE A CD2 1 
ATOM   1507 C  CE1 . PHE A 1 197 ? 4.500   71.268 47.703 1.00 9.72  ? 197  PHE A CE1 1 
ATOM   1508 C  CE2 . PHE A 1 197 ? 6.512   72.175 48.594 1.00 5.68  ? 197  PHE A CE2 1 
ATOM   1509 C  CZ  . PHE A 1 197 ? 5.205   72.339 48.215 1.00 7.74  ? 197  PHE A CZ  1 
ATOM   1510 N  N   . GLY A 1 198 ? 6.094   66.521 50.116 1.00 16.81 ? 198  GLY A N   1 
ATOM   1511 C  CA  . GLY A 1 198 ? 5.418   66.324 51.382 1.00 15.36 ? 198  GLY A CA  1 
ATOM   1512 C  C   . GLY A 1 198 ? 6.440   66.064 52.450 1.00 13.98 ? 198  GLY A C   1 
ATOM   1513 O  O   . GLY A 1 198 ? 7.583   65.746 52.137 1.00 14.52 ? 198  GLY A O   1 
ATOM   1514 N  N   . GLU A 1 199 ? 6.033   66.161 53.707 1.00 15.50 ? 199  GLU A N   1 
ATOM   1515 C  CA  . GLU A 1 199 ? 6.947   65.949 54.824 1.00 16.93 ? 199  GLU A CA  1 
ATOM   1516 C  C   . GLU A 1 199 ? 6.389   64.912 55.789 1.00 18.41 ? 199  GLU A C   1 
ATOM   1517 O  O   . GLU A 1 199 ? 5.184   64.705 55.841 1.00 19.78 ? 199  GLU A O   1 
ATOM   1518 C  CB  . GLU A 1 199 ? 7.177   67.269 55.548 1.00 16.07 ? 199  GLU A CB  1 
ATOM   1519 C  CG  . GLU A 1 199 ? 8.446   67.307 56.366 1.00 16.70 ? 199  GLU A CG  1 
ATOM   1520 C  CD  . GLU A 1 199 ? 8.218   67.188 57.864 1.00 16.94 ? 199  GLU A CD  1 
ATOM   1521 O  OE1 . GLU A 1 199 ? 9.224   67.288 58.607 1.00 14.22 ? 199  GLU A OE1 1 
ATOM   1522 O  OE2 . GLU A 1 199 ? 7.053   67.010 58.292 1.00 11.72 ? 199  GLU A OE2 1 
ATOM   1523 N  N   . SER A 1 200 ? 7.261   64.245 56.537 1.00 19.18 ? 200  SER A N   1 
ATOM   1524 C  CA  . SER A 1 200 ? 6.834   63.227 57.493 1.00 19.26 ? 200  SER A CA  1 
ATOM   1525 C  C   . SER A 1 200 ? 6.016   62.208 56.696 1.00 19.78 ? 200  SER A C   1 
ATOM   1526 O  O   . SER A 1 200 ? 6.520   61.638 55.728 1.00 21.15 ? 200  SER A O   1 
ATOM   1527 C  CB  . SER A 1 200 ? 6.023   63.868 58.642 1.00 19.67 ? 200  SER A CB  1 
ATOM   1528 O  OG  . SER A 1 200 ? 5.667   62.942 59.671 1.00 20.19 ? 200  SER A OG  1 
ATOM   1529 N  N   . ALA A 1 201 ? 4.750   62.019 57.055 1.00 19.50 ? 201  ALA A N   1 
ATOM   1530 C  CA  . ALA A 1 201 ? 3.894   61.072 56.359 1.00 16.89 ? 201  ALA A CA  1 
ATOM   1531 C  C   . ALA A 1 201 ? 3.664   61.517 54.932 1.00 16.09 ? 201  ALA A C   1 
ATOM   1532 O  O   . ALA A 1 201 ? 3.382   60.705 54.069 1.00 16.27 ? 201  ALA A O   1 
ATOM   1533 C  CB  . ALA A 1 201 ? 2.587   60.946 57.075 1.00 21.04 ? 201  ALA A CB  1 
ATOM   1534 N  N   . GLY A 1 202 ? 3.743   62.821 54.703 1.00 14.85 ? 202  GLY A N   1 
ATOM   1535 C  CA  . GLY A 1 202 ? 3.566   63.361 53.372 1.00 14.88 ? 202  GLY A CA  1 
ATOM   1536 C  C   . GLY A 1 202 ? 4.770   62.968 52.552 1.00 14.67 ? 202  GLY A C   1 
ATOM   1537 O  O   . GLY A 1 202 ? 4.644   62.479 51.443 1.00 16.84 ? 202  GLY A O   1 
ATOM   1538 N  N   . GLY A 1 203 ? 5.951   63.129 53.124 1.00 15.28 ? 203  GLY A N   1 
ATOM   1539 C  CA  . GLY A 1 203 ? 7.161   62.759 52.420 1.00 14.51 ? 203  GLY A CA  1 
ATOM   1540 C  C   . GLY A 1 203 ? 7.196   61.264 52.226 1.00 13.33 ? 203  GLY A C   1 
ATOM   1541 O  O   . GLY A 1 203 ? 7.985   60.749 51.449 1.00 16.92 ? 203  GLY A O   1 
ATOM   1542 N  N   . ALA A 1 204 ? 6.361   60.555 52.968 1.00 11.91 ? 204  ALA A N   1 
ATOM   1543 C  CA  . ALA A 1 204 ? 6.296   59.113 52.858 1.00 12.25 ? 204  ALA A CA  1 
ATOM   1544 C  C   . ALA A 1 204 ? 5.217   58.746 51.854 1.00 14.22 ? 204  ALA A C   1 
ATOM   1545 O  O   . ALA A 1 204 ? 5.320   57.735 51.175 1.00 16.87 ? 204  ALA A O   1 
ATOM   1546 C  CB  . ALA A 1 204 ? 5.997   58.492 54.216 1.00 12.78 ? 204  ALA A CB  1 
ATOM   1547 N  N   . SER A 1 205 ? 4.168   59.560 51.783 1.00 14.72 ? 205  SER A N   1 
ATOM   1548 C  CA  . SER A 1 205 ? 3.074   59.327 50.857 1.00 13.03 ? 205  SER A CA  1 
ATOM   1549 C  C   . SER A 1 205 ? 3.598   59.566 49.454 1.00 13.52 ? 205  SER A C   1 
ATOM   1550 O  O   . SER A 1 205 ? 3.429   58.735 48.567 1.00 15.07 ? 205  SER A O   1 
ATOM   1551 C  CB  . SER A 1 205 ? 1.924   60.277 51.154 1.00 12.56 ? 205  SER A CB  1 
ATOM   1552 O  OG  . SER A 1 205 ? 1.379   60.024 52.432 1.00 14.59 ? 205  SER A OG  1 
ATOM   1553 N  N   . VAL A 1 206 ? 4.243   60.711 49.267 1.00 13.45 ? 206  VAL A N   1 
ATOM   1554 C  CA  . VAL A 1 206 ? 4.836   61.096 48.003 1.00 11.54 ? 206  VAL A CA  1 
ATOM   1555 C  C   . VAL A 1 206 ? 5.609   59.878 47.535 1.00 13.96 ? 206  VAL A C   1 
ATOM   1556 O  O   . VAL A 1 206 ? 5.384   59.358 46.452 1.00 18.35 ? 206  VAL A O   1 
ATOM   1557 C  CB  . VAL A 1 206 ? 5.820   62.265 48.215 1.00 10.31 ? 206  VAL A CB  1 
ATOM   1558 C  CG1 . VAL A 1 206 ? 6.667   62.481 46.999 1.00 8.96  ? 206  VAL A CG1 1 
ATOM   1559 C  CG2 . VAL A 1 206 ? 5.067   63.527 48.556 1.00 10.32 ? 206  VAL A CG2 1 
ATOM   1560 N  N   . GLY A 1 207 ? 6.426   59.350 48.427 1.00 14.98 ? 207  GLY A N   1 
ATOM   1561 C  CA  . GLY A 1 207 ? 7.227   58.194 48.097 1.00 15.21 ? 207  GLY A CA  1 
ATOM   1562 C  C   . GLY A 1 207 ? 6.422   56.956 47.813 1.00 14.28 ? 207  GLY A C   1 
ATOM   1563 O  O   . GLY A 1 207 ? 6.880   56.098 47.065 1.00 17.22 ? 207  GLY A O   1 
ATOM   1564 N  N   . MET A 1 208 ? 5.242   56.843 48.413 1.00 13.74 ? 208  MET A N   1 
ATOM   1565 C  CA  . MET A 1 208 ? 4.396   55.676 48.197 1.00 13.67 ? 208  MET A CA  1 
ATOM   1566 C  C   . MET A 1 208 ? 3.625   55.776 46.896 1.00 13.77 ? 208  MET A C   1 
ATOM   1567 O  O   . MET A 1 208 ? 2.890   54.866 46.536 1.00 15.39 ? 208  MET A O   1 
ATOM   1568 C  CB  . MET A 1 208 ? 3.478   55.436 49.393 1.00 14.01 ? 208  MET A CB  1 
ATOM   1569 C  CG  . MET A 1 208 ? 4.262   55.054 50.650 1.00 16.71 ? 208  MET A CG  1 
ATOM   1570 S  SD  . MET A 1 208 ? 3.306   54.718 52.129 1.00 16.29 ? 208  MET A SD  1 
ATOM   1571 C  CE  . MET A 1 208 ? 2.733   56.278 52.436 1.00 16.18 ? 208  MET A CE  1 
ATOM   1572 N  N   . HIS A 1 209 ? 3.821   56.894 46.195 1.00 12.93 ? 209  HIS A N   1 
ATOM   1573 C  CA  . HIS A 1 209 ? 3.220   57.167 44.887 1.00 10.08 ? 209  HIS A CA  1 
ATOM   1574 C  C   . HIS A 1 209 ? 4.282   56.889 43.830 1.00 9.47  ? 209  HIS A C   1 
ATOM   1575 O  O   . HIS A 1 209 ? 3.973   56.524 42.718 1.00 12.19 ? 209  HIS A O   1 
ATOM   1576 C  CB  . HIS A 1 209 ? 2.749   58.613 44.787 1.00 7.20  ? 209  HIS A CB  1 
ATOM   1577 C  CG  . HIS A 1 209 ? 1.498   58.890 45.555 1.00 7.80  ? 209  HIS A CG  1 
ATOM   1578 N  ND1 . HIS A 1 209 ? 1.446   59.791 46.594 1.00 6.36  ? 209  HIS A ND1 1 
ATOM   1579 C  CD2 . HIS A 1 209 ? 0.255   58.366 45.449 1.00 7.62  ? 209  HIS A CD2 1 
ATOM   1580 C  CE1 . HIS A 1 209 ? 0.227   59.809 47.097 1.00 7.23  ? 209  HIS A CE1 1 
ATOM   1581 N  NE2 . HIS A 1 209 ? -0.515  58.953 46.422 1.00 9.55  ? 209  HIS A NE2 1 
ATOM   1582 N  N   . ILE A 1 210 ? 5.538   57.111 44.185 1.00 9.04  ? 210  ILE A N   1 
ATOM   1583 C  CA  . ILE A 1 210 ? 6.667   56.826 43.315 1.00 7.19  ? 210  ILE A CA  1 
ATOM   1584 C  C   . ILE A 1 210 ? 6.734   55.314 43.160 1.00 9.67  ? 210  ILE A C   1 
ATOM   1585 O  O   . ILE A 1 210 ? 7.300   54.821 42.213 1.00 13.86 ? 210  ILE A O   1 
ATOM   1586 C  CB  . ILE A 1 210 ? 7.991   57.303 43.966 1.00 3.78  ? 210  ILE A CB  1 
ATOM   1587 C  CG1 . ILE A 1 210 ? 8.147   58.798 43.776 1.00 2.54  ? 210  ILE A CG1 1 
ATOM   1588 C  CG2 . ILE A 1 210 ? 9.189   56.544 43.432 1.00 2.03  ? 210  ILE A CG2 1 
ATOM   1589 C  CD1 . ILE A 1 210 ? 9.477   59.298 44.182 1.00 6.06  ? 210  ILE A CD1 1 
ATOM   1590 N  N   . LEU A 1 211 ? 6.214   54.586 44.140 1.00 12.92 ? 211  LEU A N   1 
ATOM   1591 C  CA  . LEU A 1 211 ? 6.217   53.129 44.126 1.00 14.09 ? 211  LEU A CA  1 
ATOM   1592 C  C   . LEU A 1 211 ? 4.954   52.572 43.492 1.00 17.29 ? 211  LEU A C   1 
ATOM   1593 O  O   . LEU A 1 211 ? 5.009   51.768 42.568 1.00 19.91 ? 211  LEU A O   1 
ATOM   1594 C  CB  . LEU A 1 211 ? 6.342   52.582 45.555 1.00 11.44 ? 211  LEU A CB  1 
ATOM   1595 C  CG  . LEU A 1 211 ? 7.722   52.367 46.189 1.00 11.87 ? 211  LEU A CG  1 
ATOM   1596 C  CD1 . LEU A 1 211 ? 8.541   53.625 46.166 1.00 13.15 ? 211  LEU A CD1 1 
ATOM   1597 C  CD2 . LEU A 1 211 ? 7.563   51.897 47.610 1.00 11.14 ? 211  LEU A CD2 1 
ATOM   1598 N  N   . SER A 1 212 ? 3.805   52.992 44.003 1.00 19.07 ? 212  SER A N   1 
ATOM   1599 C  CA  . SER A 1 212 ? 2.536   52.507 43.501 1.00 18.93 ? 212  SER A CA  1 
ATOM   1600 C  C   . SER A 1 212 ? 2.393   52.751 42.011 1.00 21.42 ? 212  SER A C   1 
ATOM   1601 O  O   . SER A 1 212 ? 2.502   53.889 41.554 1.00 26.95 ? 212  SER A O   1 
ATOM   1602 C  CB  . SER A 1 212 ? 1.402   53.188 44.238 1.00 16.98 ? 212  SER A CB  1 
ATOM   1603 O  OG  . SER A 1 212 ? 0.167   52.647 43.830 1.00 19.62 ? 212  SER A OG  1 
ATOM   1604 N  N   . PRO A 1 213 ? 2.144   51.687 41.226 1.00 21.48 ? 213  PRO A N   1 
ATOM   1605 C  CA  . PRO A 1 213 ? 1.985   51.804 39.773 1.00 17.77 ? 213  PRO A CA  1 
ATOM   1606 C  C   . PRO A 1 213 ? 0.879   52.773 39.399 1.00 15.61 ? 213  PRO A C   1 
ATOM   1607 O  O   . PRO A 1 213 ? 1.037   53.587 38.490 1.00 17.08 ? 213  PRO A O   1 
ATOM   1608 C  CB  . PRO A 1 213 ? 1.625   50.382 39.369 1.00 16.54 ? 213  PRO A CB  1 
ATOM   1609 C  CG  . PRO A 1 213 ? 2.423   49.577 40.312 1.00 20.38 ? 213  PRO A CG  1 
ATOM   1610 C  CD  . PRO A 1 213 ? 2.124   50.271 41.623 1.00 21.57 ? 213  PRO A CD  1 
ATOM   1611 N  N   . GLY A 1 214 ? -0.216  52.708 40.145 1.00 14.79 ? 214  GLY A N   1 
ATOM   1612 C  CA  . GLY A 1 214 ? -1.358  53.560 39.888 1.00 13.43 ? 214  GLY A CA  1 
ATOM   1613 C  C   . GLY A 1 214 ? -1.082  55.041 39.890 1.00 14.09 ? 214  GLY A C   1 
ATOM   1614 O  O   . GLY A 1 214 ? -1.710  55.784 39.146 1.00 17.35 ? 214  GLY A O   1 
ATOM   1615 N  N   . SER A 1 215 ? -0.132  55.473 40.707 1.00 14.90 ? 215  SER A N   1 
ATOM   1616 C  CA  . SER A 1 215 ? 0.198   56.886 40.815 1.00 14.41 ? 215  SER A CA  1 
ATOM   1617 C  C   . SER A 1 215 ? 1.388   57.373 39.992 1.00 16.19 ? 215  SER A C   1 
ATOM   1618 O  O   . SER A 1 215 ? 1.422   58.538 39.602 1.00 17.30 ? 215  SER A O   1 
ATOM   1619 C  CB  . SER A 1 215 ? 0.411   57.261 42.284 1.00 14.05 ? 215  SER A CB  1 
ATOM   1620 O  OG  . SER A 1 215 ? -0.802  57.204 43.021 1.00 15.99 ? 215  SER A OG  1 
ATOM   1621 N  N   . ARG A 1 216 ? 2.340   56.494 39.696 1.00 13.86 ? 216  ARG A N   1 
ATOM   1622 C  CA  . ARG A 1 216 ? 3.533   56.880 38.949 1.00 12.00 ? 216  ARG A CA  1 
ATOM   1623 C  C   . ARG A 1 216 ? 3.331   57.841 37.793 1.00 14.69 ? 216  ARG A C   1 
ATOM   1624 O  O   . ARG A 1 216 ? 4.224   58.613 37.465 1.00 17.14 ? 216  ARG A O   1 
ATOM   1625 C  CB  . ARG A 1 216 ? 4.258   55.650 38.417 1.00 10.63 ? 216  ARG A CB  1 
ATOM   1626 C  CG  . ARG A 1 216 ? 4.768   54.736 39.479 1.00 7.09  ? 216  ARG A CG  1 
ATOM   1627 C  CD  . ARG A 1 216 ? 5.583   53.624 38.897 1.00 6.46  ? 216  ARG A CD  1 
ATOM   1628 N  NE  . ARG A 1 216 ? 5.459   52.442 39.734 1.00 11.99 ? 216  ARG A NE  1 
ATOM   1629 C  CZ  . ARG A 1 216 ? 6.026   51.271 39.486 1.00 12.78 ? 216  ARG A CZ  1 
ATOM   1630 N  NH1 . ARG A 1 216 ? 5.828   50.264 40.318 1.00 14.26 ? 216  ARG A NH1 1 
ATOM   1631 N  NH2 . ARG A 1 216 ? 6.794   51.105 38.423 1.00 14.32 ? 216  ARG A NH2 1 
ATOM   1632 N  N   . ASP A 1 217 ? 2.157   57.817 37.181 1.00 16.12 ? 217  ASP A N   1 
ATOM   1633 C  CA  . ASP A 1 217 ? 1.910   58.660 36.022 1.00 17.16 ? 217  ASP A CA  1 
ATOM   1634 C  C   . ASP A 1 217 ? 1.289   60.011 36.302 1.00 16.69 ? 217  ASP A C   1 
ATOM   1635 O  O   . ASP A 1 217 ? 1.234   60.854 35.406 1.00 19.51 ? 217  ASP A O   1 
ATOM   1636 C  CB  . ASP A 1 217 ? 1.005   57.933 35.016 1.00 20.65 ? 217  ASP A CB  1 
ATOM   1637 C  CG  . ASP A 1 217 ? 1.569   56.592 34.543 1.00 21.57 ? 217  ASP A CG  1 
ATOM   1638 O  OD1 . ASP A 1 217 ? 0.855   55.941 33.762 1.00 23.24 ? 217  ASP A OD1 1 
ATOM   1639 O  OD2 . ASP A 1 217 ? 2.687   56.177 34.928 1.00 20.79 ? 217  ASP A OD2 1 
ATOM   1640 N  N   . LEU A 1 218 ? 0.773   60.203 37.510 1.00 15.44 ? 218  LEU A N   1 
ATOM   1641 C  CA  . LEU A 1 218 ? 0.099   61.445 37.871 1.00 10.72 ? 218  LEU A CA  1 
ATOM   1642 C  C   . LEU A 1 218 ? 0.973   62.591 38.346 1.00 11.01 ? 218  LEU A C   1 
ATOM   1643 O  O   . LEU A 1 218 ? 0.454   63.616 38.789 1.00 13.42 ? 218  LEU A O   1 
ATOM   1644 C  CB  . LEU A 1 218 ? -0.992  61.159 38.893 1.00 10.26 ? 218  LEU A CB  1 
ATOM   1645 C  CG  . LEU A 1 218 ? -2.092  60.232 38.385 1.00 9.78  ? 218  LEU A CG  1 
ATOM   1646 C  CD1 . LEU A 1 218 ? -3.044  59.892 39.496 1.00 12.15 ? 218  LEU A CD1 1 
ATOM   1647 C  CD2 . LEU A 1 218 ? -2.837  60.906 37.259 1.00 13.14 ? 218  LEU A CD2 1 
ATOM   1648 N  N   . PHE A 1 219 ? 2.288   62.427 38.238 1.00 8.57  ? 219  PHE A N   1 
ATOM   1649 C  CA  . PHE A 1 219 ? 3.236   63.455 38.649 1.00 9.49  ? 219  PHE A CA  1 
ATOM   1650 C  C   . PHE A 1 219 ? 4.584   63.232 37.963 1.00 11.94 ? 219  PHE A C   1 
ATOM   1651 O  O   . PHE A 1 219 ? 4.876   62.134 37.487 1.00 10.72 ? 219  PHE A O   1 
ATOM   1652 C  CB  . PHE A 1 219 ? 3.402   63.478 40.170 1.00 7.63  ? 219  PHE A CB  1 
ATOM   1653 C  CG  . PHE A 1 219 ? 3.931   62.202 40.733 1.00 6.28  ? 219  PHE A CG  1 
ATOM   1654 C  CD1 . PHE A 1 219 ? 3.091   61.120 40.934 1.00 4.63  ? 219  PHE A CD1 1 
ATOM   1655 C  CD2 . PHE A 1 219 ? 5.278   62.069 41.029 1.00 6.13  ? 219  PHE A CD2 1 
ATOM   1656 C  CE1 . PHE A 1 219 ? 3.585   59.933 41.412 1.00 6.64  ? 219  PHE A CE1 1 
ATOM   1657 C  CE2 . PHE A 1 219 ? 5.780   60.880 41.511 1.00 5.47  ? 219  PHE A CE2 1 
ATOM   1658 C  CZ  . PHE A 1 219 ? 4.934   59.812 41.701 1.00 8.90  ? 219  PHE A CZ  1 
ATOM   1659 N  N   . ARG A 1 220 ? 5.413   64.273 37.967 1.00 12.84 ? 220  ARG A N   1 
ATOM   1660 C  CA  . ARG A 1 220 ? 6.710   64.272 37.309 1.00 13.09 ? 220  ARG A CA  1 
ATOM   1661 C  C   . ARG A 1 220 ? 7.889   64.000 38.215 1.00 15.36 ? 220  ARG A C   1 
ATOM   1662 O  O   . ARG A 1 220 ? 8.764   63.203 37.888 1.00 16.15 ? 220  ARG A O   1 
ATOM   1663 C  CB  . ARG A 1 220 ? 6.913   65.629 36.633 1.00 13.17 ? 220  ARG A CB  1 
ATOM   1664 C  CG  . ARG A 1 220 ? 8.191   65.781 35.832 1.00 14.76 ? 220  ARG A CG  1 
ATOM   1665 C  CD  . ARG A 1 220 ? 8.113   65.050 34.509 1.00 20.82 ? 220  ARG A CD  1 
ATOM   1666 N  NE  . ARG A 1 220 ? 9.271   65.348 33.665 1.00 23.84 ? 220  ARG A NE  1 
ATOM   1667 C  CZ  . ARG A 1 220 ? 9.298   66.281 32.714 1.00 21.40 ? 220  ARG A CZ  1 
ATOM   1668 N  NH1 . ARG A 1 220 ? 8.228   67.032 32.469 1.00 16.39 ? 220  ARG A NH1 1 
ATOM   1669 N  NH2 . ARG A 1 220 ? 10.400  66.448 31.996 1.00 23.31 ? 220  ARG A NH2 1 
ATOM   1670 N  N   . ARG A 1 221 ? 7.951   64.718 39.324 1.00 18.13 ? 221  ARG A N   1 
ATOM   1671 C  CA  . ARG A 1 221 ? 9.060   64.564 40.258 1.00 18.55 ? 221  ARG A CA  1 
ATOM   1672 C  C   . ARG A 1 221 ? 8.529   64.453 41.680 1.00 18.58 ? 221  ARG A C   1 
ATOM   1673 O  O   . ARG A 1 221 ? 7.325   64.594 41.921 1.00 19.27 ? 221  ARG A O   1 
ATOM   1674 C  CB  . ARG A 1 221 ? 9.985   65.777 40.179 1.00 18.92 ? 221  ARG A CB  1 
ATOM   1675 C  CG  . ARG A 1 221 ? 10.322  66.224 38.796 1.00 16.14 ? 221  ARG A CG  1 
ATOM   1676 C  CD  . ARG A 1 221 ? 10.725  67.674 38.817 1.00 18.64 ? 221  ARG A CD  1 
ATOM   1677 N  NE  . ARG A 1 221 ? 10.682  68.232 37.477 1.00 21.41 ? 221  ARG A NE  1 
ATOM   1678 C  CZ  . ARG A 1 221 ? 11.429  67.788 36.478 1.00 23.26 ? 221  ARG A CZ  1 
ATOM   1679 N  NH1 . ARG A 1 221 ? 12.281  66.791 36.680 1.00 20.02 ? 221  ARG A NH1 1 
ATOM   1680 N  NH2 . ARG A 1 221 ? 11.300  68.313 35.267 1.00 27.23 ? 221  ARG A NH2 1 
ATOM   1681 N  N   . ALA A 1 222 ? 9.441   64.309 42.630 1.00 16.85 ? 222  ALA A N   1 
ATOM   1682 C  CA  . ALA A 1 222 ? 9.041   64.180 44.004 1.00 14.79 ? 222  ALA A CA  1 
ATOM   1683 C  C   . ALA A 1 222 ? 10.050  64.815 44.932 1.00 16.41 ? 222  ALA A C   1 
ATOM   1684 O  O   . ALA A 1 222 ? 11.258  64.718 44.710 1.00 16.09 ? 222  ALA A O   1 
ATOM   1685 C  CB  . ALA A 1 222 ? 8.879   62.715 44.339 1.00 11.24 ? 222  ALA A CB  1 
ATOM   1686 N  N   . ILE A 1 223 ? 9.542   65.529 45.929 1.00 17.25 ? 223  ILE A N   1 
ATOM   1687 C  CA  . ILE A 1 223 ? 10.383  66.139 46.949 1.00 17.74 ? 223  ILE A CA  1 
ATOM   1688 C  C   . ILE A 1 223 ? 9.887   65.469 48.224 1.00 19.29 ? 223  ILE A C   1 
ATOM   1689 O  O   . ILE A 1 223 ? 8.689   65.514 48.526 1.00 19.87 ? 223  ILE A O   1 
ATOM   1690 C  CB  . ILE A 1 223 ? 10.180  67.668 47.067 1.00 15.97 ? 223  ILE A CB  1 
ATOM   1691 C  CG1 . ILE A 1 223 ? 10.765  68.386 45.859 1.00 15.61 ? 223  ILE A CG1 1 
ATOM   1692 C  CG2 . ILE A 1 223 ? 10.861  68.197 48.313 1.00 18.86 ? 223  ILE A CG2 1 
ATOM   1693 C  CD1 . ILE A 1 223 ? 10.477  69.859 45.853 1.00 13.23 ? 223  ILE A CD1 1 
ATOM   1694 N  N   . LEU A 1 224 ? 10.775  64.762 48.915 1.00 19.57 ? 224  LEU A N   1 
ATOM   1695 C  CA  . LEU A 1 224 ? 10.393  64.084 50.155 1.00 16.17 ? 224  LEU A CA  1 
ATOM   1696 C  C   . LEU A 1 224 ? 11.183  64.690 51.300 1.00 14.44 ? 224  LEU A C   1 
ATOM   1697 O  O   . LEU A 1 224 ? 12.408  64.577 51.354 1.00 12.69 ? 224  LEU A O   1 
ATOM   1698 C  CB  . LEU A 1 224 ? 10.657  62.571 50.094 1.00 13.04 ? 224  LEU A CB  1 
ATOM   1699 C  CG  . LEU A 1 224 ? 10.119  61.726 48.945 1.00 11.00 ? 224  LEU A CG  1 
ATOM   1700 C  CD1 . LEU A 1 224 ? 10.957  61.975 47.716 1.00 10.67 ? 224  LEU A CD1 1 
ATOM   1701 C  CD2 . LEU A 1 224 ? 10.184  60.259 49.315 1.00 7.04  ? 224  LEU A CD2 1 
ATOM   1702 N  N   . GLN A 1 225 ? 10.474  65.362 52.196 1.00 14.25 ? 225  GLN A N   1 
ATOM   1703 C  CA  . GLN A 1 225 ? 11.082  65.992 53.352 1.00 11.90 ? 225  GLN A CA  1 
ATOM   1704 C  C   . GLN A 1 225 ? 10.825  65.138 54.575 1.00 11.23 ? 225  GLN A C   1 
ATOM   1705 O  O   . GLN A 1 225 ? 9.677   64.799 54.871 1.00 11.98 ? 225  GLN A O   1 
ATOM   1706 C  CB  . GLN A 1 225 ? 10.467  67.361 53.583 1.00 11.61 ? 225  GLN A CB  1 
ATOM   1707 C  CG  . GLN A 1 225 ? 10.709  68.340 52.481 1.00 12.32 ? 225  GLN A CG  1 
ATOM   1708 C  CD  . GLN A 1 225 ? 9.687   69.427 52.477 1.00 11.94 ? 225  GLN A CD  1 
ATOM   1709 O  OE1 . GLN A 1 225 ? 9.319   69.928 51.425 1.00 15.12 ? 225  GLN A OE1 1 
ATOM   1710 N  NE2 . GLN A 1 225 ? 9.199   69.790 53.650 1.00 11.11 ? 225  GLN A NE2 1 
ATOM   1711 N  N   . SER A 1 226 ? 11.900  64.777 55.264 1.00 11.05 ? 226  SER A N   1 
ATOM   1712 C  CA  . SER A 1 226 ? 11.836  63.985 56.479 1.00 10.71 ? 226  SER A CA  1 
ATOM   1713 C  C   . SER A 1 226 ? 10.871  62.822 56.352 1.00 11.04 ? 226  SER A C   1 
ATOM   1714 O  O   . SER A 1 226 ? 10.130  62.517 57.289 1.00 13.57 ? 226  SER A O   1 
ATOM   1715 C  CB  . SER A 1 226 ? 11.436  64.882 57.656 1.00 11.15 ? 226  SER A CB  1 
ATOM   1716 O  OG  . SER A 1 226 ? 12.309  65.996 57.794 1.00 9.35  ? 226  SER A OG  1 
ATOM   1717 N  N   . GLY A 1 227 ? 10.884  62.170 55.196 1.00 10.50 ? 227  GLY A N   1 
ATOM   1718 C  CA  . GLY A 1 227 ? 9.992   61.048 54.973 1.00 11.53 ? 227  GLY A CA  1 
ATOM   1719 C  C   . GLY A 1 227 ? 10.469  60.167 53.841 1.00 12.45 ? 227  GLY A C   1 
ATOM   1720 O  O   . GLY A 1 227 ? 11.325  60.560 53.066 1.00 13.65 ? 227  GLY A O   1 
ATOM   1721 N  N   . SER A 1 228 ? 9.912   58.969 53.754 1.00 12.30 ? 228  SER A N   1 
ATOM   1722 C  CA  . SER A 1 228 ? 10.255  57.987 52.725 1.00 13.99 ? 228  SER A CA  1 
ATOM   1723 C  C   . SER A 1 228 ? 9.295   56.853 53.031 1.00 15.11 ? 228  SER A C   1 
ATOM   1724 O  O   . SER A 1 228 ? 9.068   56.536 54.198 1.00 19.37 ? 228  SER A O   1 
ATOM   1725 C  CB  . SER A 1 228 ? 11.696  57.507 52.853 1.00 11.20 ? 228  SER A CB  1 
ATOM   1726 O  OG  . SER A 1 228 ? 11.892  56.907 54.109 1.00 15.32 ? 228  SER A OG  1 
ATOM   1727 N  N   . PRO A 1 229 ? 8.742   56.212 51.997 1.00 14.17 ? 229  PRO A N   1 
ATOM   1728 C  CA  . PRO A 1 229 ? 7.787   55.119 52.135 1.00 12.44 ? 229  PRO A CA  1 
ATOM   1729 C  C   . PRO A 1 229 ? 8.253   53.946 52.948 1.00 12.99 ? 229  PRO A C   1 
ATOM   1730 O  O   . PRO A 1 229 ? 7.459   53.301 53.607 1.00 14.02 ? 229  PRO A O   1 
ATOM   1731 C  CB  . PRO A 1 229 ? 7.534   54.726 50.689 1.00 14.02 ? 229  PRO A CB  1 
ATOM   1732 C  CG  . PRO A 1 229 ? 8.833   55.005 50.038 1.00 12.07 ? 229  PRO A CG  1 
ATOM   1733 C  CD  . PRO A 1 229 ? 9.181   56.337 50.598 1.00 13.73 ? 229  PRO A CD  1 
ATOM   1734 N  N   . ASN A 1 230 ? 9.554   53.704 52.941 1.00 13.81 ? 230  ASN A N   1 
ATOM   1735 C  CA  . ASN A 1 230 ? 10.132  52.572 53.646 1.00 13.37 ? 230  ASN A CA  1 
ATOM   1736 C  C   . ASN A 1 230 ? 10.342  52.786 55.146 1.00 17.40 ? 230  ASN A C   1 
ATOM   1737 O  O   . ASN A 1 230 ? 11.197  52.131 55.773 1.00 20.83 ? 230  ASN A O   1 
ATOM   1738 C  CB  . ASN A 1 230 ? 11.450  52.204 52.991 1.00 7.82  ? 230  ASN A CB  1 
ATOM   1739 C  CG  . ASN A 1 230 ? 12.525  53.212 53.268 1.00 7.93  ? 230  ASN A CG  1 
ATOM   1740 O  OD1 . ASN A 1 230 ? 12.330  54.415 53.108 1.00 5.25  ? 230  ASN A OD1 1 
ATOM   1741 N  ND2 . ASN A 1 230 ? 13.667  52.727 53.709 1.00 9.77  ? 230  ASN A ND2 1 
ATOM   1742 N  N   . CYS A 1 231 ? 9.561   53.680 55.739 1.00 17.52 ? 231  CYS A N   1 
ATOM   1743 C  CA  . CYS A 1 231 ? 9.702   53.937 57.155 1.00 17.20 ? 231  CYS A CA  1 
ATOM   1744 C  C   . CYS A 1 231 ? 8.895   53.015 58.032 1.00 16.73 ? 231  CYS A C   1 
ATOM   1745 O  O   . CYS A 1 231 ? 7.726   52.752 57.747 1.00 19.27 ? 231  CYS A O   1 
ATOM   1746 C  CB  . CYS A 1 231 ? 9.399   55.379 57.447 1.00 18.22 ? 231  CYS A CB  1 
ATOM   1747 S  SG  . CYS A 1 231 ? 10.935  56.284 57.256 1.00 24.49 ? 231  CYS A SG  1 
ATOM   1748 N  N   . PRO A 1 232 ? 9.476   52.604 59.172 1.00 15.10 ? 232  PRO A N   1 
ATOM   1749 C  CA  . PRO A 1 232 ? 8.879   51.700 60.157 1.00 13.86 ? 232  PRO A CA  1 
ATOM   1750 C  C   . PRO A 1 232 ? 7.449   52.054 60.453 1.00 13.92 ? 232  PRO A C   1 
ATOM   1751 O  O   . PRO A 1 232 ? 6.564   51.218 60.400 1.00 15.95 ? 232  PRO A O   1 
ATOM   1752 C  CB  . PRO A 1 232 ? 9.747   51.928 61.383 1.00 13.65 ? 232  PRO A CB  1 
ATOM   1753 C  CG  . PRO A 1 232 ? 11.062  52.258 60.809 1.00 13.94 ? 232  PRO A CG  1 
ATOM   1754 C  CD  . PRO A 1 232 ? 10.689  53.224 59.727 1.00 14.12 ? 232  PRO A CD  1 
ATOM   1755 N  N   . TRP A 1 233 ? 7.233   53.337 60.682 1.00 14.50 ? 233  TRP A N   1 
ATOM   1756 C  CA  . TRP A 1 233 ? 5.927   53.860 61.020 1.00 13.21 ? 233  TRP A CA  1 
ATOM   1757 C  C   . TRP A 1 233 ? 5.019   54.097 59.850 1.00 14.50 ? 233  TRP A C   1 
ATOM   1758 O  O   . TRP A 1 233 ? 3.822   54.251 60.038 1.00 18.87 ? 233  TRP A O   1 
ATOM   1759 C  CB  . TRP A 1 233 ? 6.096   55.179 61.763 1.00 13.08 ? 233  TRP A CB  1 
ATOM   1760 C  CG  . TRP A 1 233 ? 6.971   56.153 61.038 1.00 13.75 ? 233  TRP A CG  1 
ATOM   1761 C  CD1 . TRP A 1 233 ? 8.318   56.323 61.193 1.00 14.34 ? 233  TRP A CD1 1 
ATOM   1762 C  CD2 . TRP A 1 233 ? 6.559   57.097 60.048 1.00 13.92 ? 233  TRP A CD2 1 
ATOM   1763 N  NE1 . TRP A 1 233 ? 8.768   57.317 60.358 1.00 14.41 ? 233  TRP A NE1 1 
ATOM   1764 C  CE2 . TRP A 1 233 ? 7.707   57.810 59.647 1.00 12.98 ? 233  TRP A CE2 1 
ATOM   1765 C  CE3 . TRP A 1 233 ? 5.329   57.412 59.460 1.00 12.82 ? 233  TRP A CE3 1 
ATOM   1766 C  CZ2 . TRP A 1 233 ? 7.660   58.812 58.694 1.00 13.60 ? 233  TRP A CZ2 1 
ATOM   1767 C  CZ3 . TRP A 1 233 ? 5.286   58.406 58.514 1.00 13.10 ? 233  TRP A CZ3 1 
ATOM   1768 C  CH2 . TRP A 1 233 ? 6.441   59.096 58.139 1.00 12.50 ? 233  TRP A CH2 1 
ATOM   1769 N  N   . ALA A 1 234 ? 5.579   54.176 58.650 1.00 15.14 ? 234  ALA A N   1 
ATOM   1770 C  CA  . ALA A 1 234 ? 4.778   54.464 57.471 1.00 13.72 ? 234  ALA A CA  1 
ATOM   1771 C  C   . ALA A 1 234 ? 3.983   53.334 56.864 1.00 14.34 ? 234  ALA A C   1 
ATOM   1772 O  O   . ALA A 1 234 ? 3.131   53.583 56.029 1.00 16.49 ? 234  ALA A O   1 
ATOM   1773 C  CB  . ALA A 1 234 ? 5.615   55.127 56.421 1.00 13.63 ? 234  ALA A CB  1 
ATOM   1774 N  N   . SER A 1 235 ? 4.214   52.103 57.287 1.00 16.34 ? 235  SER A N   1 
ATOM   1775 C  CA  . SER A 1 235 ? 3.468   50.995 56.709 1.00 16.20 ? 235  SER A CA  1 
ATOM   1776 C  C   . SER A 1 235 ? 3.261   49.821 57.659 1.00 18.41 ? 235  SER A C   1 
ATOM   1777 O  O   . SER A 1 235 ? 4.000   49.650 58.634 1.00 18.95 ? 235  SER A O   1 
ATOM   1778 C  CB  . SER A 1 235 ? 4.172   50.507 55.439 1.00 16.95 ? 235  SER A CB  1 
ATOM   1779 O  OG  . SER A 1 235 ? 5.465   49.991 55.722 1.00 17.49 ? 235  SER A OG  1 
ATOM   1780 N  N   . VAL A 1 236 ? 2.217   49.043 57.398 1.00 18.42 ? 236  VAL A N   1 
ATOM   1781 C  CA  . VAL A 1 236 ? 1.927   47.859 58.194 1.00 20.00 ? 236  VAL A CA  1 
ATOM   1782 C  C   . VAL A 1 236 ? 1.414   46.791 57.245 1.00 20.15 ? 236  VAL A C   1 
ATOM   1783 O  O   . VAL A 1 236 ? 0.843   47.111 56.201 1.00 22.55 ? 236  VAL A O   1 
ATOM   1784 C  CB  . VAL A 1 236 ? 0.867   48.105 59.302 1.00 20.47 ? 236  VAL A CB  1 
ATOM   1785 C  CG1 . VAL A 1 236 ? 1.350   49.153 60.266 1.00 21.40 ? 236  VAL A CG1 1 
ATOM   1786 C  CG2 . VAL A 1 236 ? -0.480  48.493 58.707 1.00 20.21 ? 236  VAL A CG2 1 
ATOM   1787 N  N   . SER A 1 237 ? 1.645   45.530 57.591 1.00 19.19 ? 237  SER A N   1 
ATOM   1788 C  CA  . SER A 1 237 ? 1.197   44.422 56.771 1.00 18.99 ? 237  SER A CA  1 
ATOM   1789 C  C   . SER A 1 237 ? -0.313  44.409 56.803 1.00 18.37 ? 237  SER A C   1 
ATOM   1790 O  O   . SER A 1 237 ? -0.912  44.924 57.745 1.00 16.95 ? 237  SER A O   1 
ATOM   1791 C  CB  . SER A 1 237 ? 1.714   43.107 57.343 1.00 20.89 ? 237  SER A CB  1 
ATOM   1792 O  OG  . SER A 1 237 ? 1.101   42.811 58.593 1.00 26.22 ? 237  SER A OG  1 
ATOM   1793 N  N   . VAL A 1 238 ? -0.927  43.800 55.793 1.00 19.07 ? 238  VAL A N   1 
ATOM   1794 C  CA  . VAL A 1 238 ? -2.384  43.723 55.727 1.00 19.62 ? 238  VAL A CA  1 
ATOM   1795 C  C   . VAL A 1 238 ? -2.948  43.098 56.982 1.00 20.80 ? 238  VAL A C   1 
ATOM   1796 O  O   . VAL A 1 238 ? -4.012  43.487 57.457 1.00 21.82 ? 238  VAL A O   1 
ATOM   1797 C  CB  . VAL A 1 238 ? -2.853  42.912 54.536 1.00 16.56 ? 238  VAL A CB  1 
ATOM   1798 C  CG1 . VAL A 1 238 ? -2.695  43.718 53.284 1.00 19.48 ? 238  VAL A CG1 1 
ATOM   1799 C  CG2 . VAL A 1 238 ? -2.049  41.642 54.437 1.00 19.84 ? 238  VAL A CG2 1 
ATOM   1800 N  N   . ALA A 1 239 ? -2.215  42.134 57.520 1.00 21.73 ? 239  ALA A N   1 
ATOM   1801 C  CA  . ALA A 1 239 ? -2.629  41.451 58.730 1.00 23.09 ? 239  ALA A CA  1 
ATOM   1802 C  C   . ALA A 1 239 ? -2.617  42.408 59.910 1.00 23.98 ? 239  ALA A C   1 
ATOM   1803 O  O   . ALA A 1 239 ? -3.609  42.517 60.630 1.00 25.14 ? 239  ALA A O   1 
ATOM   1804 C  CB  . ALA A 1 239 ? -1.714  40.278 59.006 1.00 25.74 ? 239  ALA A CB  1 
ATOM   1805 N  N   . GLU A 1 240 ? -1.504  43.112 60.100 1.00 23.29 ? 240  GLU A N   1 
ATOM   1806 C  CA  . GLU A 1 240 ? -1.396  44.049 61.212 1.00 23.34 ? 240  GLU A CA  1 
ATOM   1807 C  C   . GLU A 1 240 ? -2.512  45.069 61.149 1.00 23.75 ? 240  GLU A C   1 
ATOM   1808 O  O   . GLU A 1 240 ? -3.130  45.378 62.158 1.00 27.49 ? 240  GLU A O   1 
ATOM   1809 C  CB  . GLU A 1 240 ? -0.043  44.756 61.210 1.00 23.23 ? 240  GLU A CB  1 
ATOM   1810 C  CG  . GLU A 1 240 ? 0.090   45.823 62.288 1.00 25.90 ? 240  GLU A CG  1 
ATOM   1811 C  CD  . GLU A 1 240 ? -0.140  45.291 63.690 1.00 23.75 ? 240  GLU A CD  1 
ATOM   1812 O  OE1 . GLU A 1 240 ? -1.109  45.719 64.340 1.00 25.29 ? 240  GLU A OE1 1 
ATOM   1813 O  OE2 . GLU A 1 240 ? 0.649   44.449 64.150 1.00 25.53 ? 240  GLU A OE2 1 
ATOM   1814 N  N   . GLY A 1 241 ? -2.785  45.573 59.956 1.00 24.30 ? 241  GLY A N   1 
ATOM   1815 C  CA  . GLY A 1 241 ? -3.846  46.548 59.800 1.00 23.37 ? 241  GLY A CA  1 
ATOM   1816 C  C   . GLY A 1 241 ? -5.184  45.934 60.145 1.00 21.88 ? 241  GLY A C   1 
ATOM   1817 O  O   . GLY A 1 241 ? -6.068  46.608 60.667 1.00 20.90 ? 241  GLY A O   1 
ATOM   1818 N  N   . ARG A 1 242 ? -5.347  44.656 59.834 1.00 23.00 ? 242  ARG A N   1 
ATOM   1819 C  CA  . ARG A 1 242 ? -6.593  43.983 60.141 1.00 25.38 ? 242  ARG A CA  1 
ATOM   1820 C  C   . ARG A 1 242 ? -6.708  43.931 61.649 1.00 25.91 ? 242  ARG A C   1 
ATOM   1821 O  O   . ARG A 1 242 ? -7.737  44.308 62.219 1.00 27.54 ? 242  ARG A O   1 
ATOM   1822 C  CB  . ARG A 1 242 ? -6.620  42.567 59.563 1.00 26.60 ? 242  ARG A CB  1 
ATOM   1823 C  CG  . ARG A 1 242 ? -7.612  41.661 60.278 1.00 28.70 ? 242  ARG A CG  1 
ATOM   1824 C  CD  . ARG A 1 242 ? -8.127  40.553 59.391 1.00 32.86 ? 242  ARG A CD  1 
ATOM   1825 N  NE  . ARG A 1 242 ? -9.310  40.961 58.639 1.00 33.13 ? 242  ARG A NE  1 
ATOM   1826 C  CZ  . ARG A 1 242 ? -9.294  41.286 57.354 1.00 35.40 ? 242  ARG A CZ  1 
ATOM   1827 N  NH1 . ARG A 1 242 ? -10.420 41.642 56.751 1.00 36.41 ? 242  ARG A NH1 1 
ATOM   1828 N  NH2 . ARG A 1 242 ? -8.149  41.269 56.676 1.00 36.64 ? 242  ARG A NH2 1 
ATOM   1829 N  N   . ARG A 1 243 ? -5.628  43.486 62.286 1.00 25.79 ? 243  ARG A N   1 
ATOM   1830 C  CA  . ARG A 1 243 ? -5.553  43.379 63.732 1.00 24.42 ? 243  ARG A CA  1 
ATOM   1831 C  C   . ARG A 1 243 ? -5.991  44.703 64.353 1.00 22.51 ? 243  ARG A C   1 
ATOM   1832 O  O   . ARG A 1 243 ? -6.963  44.758 65.106 1.00 22.18 ? 243  ARG A O   1 
ATOM   1833 C  CB  . ARG A 1 243 ? -4.119  43.063 64.141 1.00 28.00 ? 243  ARG A CB  1 
ATOM   1834 C  CG  . ARG A 1 243 ? -3.939  42.862 65.628 1.00 34.74 ? 243  ARG A CG  1 
ATOM   1835 C  CD  . ARG A 1 243 ? -2.853  43.763 66.212 1.00 36.31 ? 243  ARG A CD  1 
ATOM   1836 N  NE  . ARG A 1 243 ? -3.255  44.251 67.529 1.00 37.61 ? 243  ARG A NE  1 
ATOM   1837 C  CZ  . ARG A 1 243 ? -2.830  45.391 68.065 1.00 39.16 ? 243  ARG A CZ  1 
ATOM   1838 N  NH1 . ARG A 1 243 ? -3.269  45.762 69.265 1.00 41.70 ? 243  ARG A NH1 1 
ATOM   1839 N  NH2 . ARG A 1 243 ? -1.937  46.140 67.422 1.00 37.04 ? 243  ARG A NH2 1 
ATOM   1840 N  N   . ARG A 1 244 ? -5.314  45.781 63.979 1.00 18.72 ? 244  ARG A N   1 
ATOM   1841 C  CA  . ARG A 1 244 ? -5.647  47.092 64.510 1.00 17.81 ? 244  ARG A CA  1 
ATOM   1842 C  C   . ARG A 1 244 ? -7.075  47.471 64.181 1.00 18.82 ? 244  ARG A C   1 
ATOM   1843 O  O   . ARG A 1 244 ? -7.735  48.170 64.948 1.00 21.37 ? 244  ARG A O   1 
ATOM   1844 C  CB  . ARG A 1 244 ? -4.675  48.146 63.996 1.00 14.94 ? 244  ARG A CB  1 
ATOM   1845 C  CG  . ARG A 1 244 ? -3.257  47.809 64.333 1.00 10.08 ? 244  ARG A CG  1 
ATOM   1846 C  CD  . ARG A 1 244 ? -2.308  48.923 64.038 1.00 8.44  ? 244  ARG A CD  1 
ATOM   1847 N  NE  . ARG A 1 244 ? -0.950  48.450 64.238 1.00 9.81  ? 244  ARG A NE  1 
ATOM   1848 C  CZ  . ARG A 1 244 ? 0.138   49.123 63.901 1.00 11.85 ? 244  ARG A CZ  1 
ATOM   1849 N  NH1 . ARG A 1 244 ? 1.328   48.591 64.113 1.00 14.11 ? 244  ARG A NH1 1 
ATOM   1850 N  NH2 . ARG A 1 244 ? 0.043   50.344 63.412 1.00 10.96 ? 244  ARG A NH2 1 
ATOM   1851 N  N   . ALA A 1 245 ? -7.575  46.980 63.061 1.00 18.98 ? 245  ALA A N   1 
ATOM   1852 C  CA  . ALA A 1 245 ? -8.933  47.292 62.687 1.00 19.75 ? 245  ALA A CA  1 
ATOM   1853 C  C   . ALA A 1 245 ? -9.889  46.603 63.650 1.00 19.98 ? 245  ALA A C   1 
ATOM   1854 O  O   . ALA A 1 245 ? -10.841 47.222 64.116 1.00 21.81 ? 245  ALA A O   1 
ATOM   1855 C  CB  . ALA A 1 245 ? -9.194  46.868 61.279 1.00 22.36 ? 245  ALA A CB  1 
ATOM   1856 N  N   . VAL A 1 246 ? -9.634  45.343 63.988 1.00 19.37 ? 246  VAL A N   1 
ATOM   1857 C  CA  . VAL A 1 246 ? -10.532 44.672 64.919 1.00 22.84 ? 246  VAL A CA  1 
ATOM   1858 C  C   . VAL A 1 246 ? -10.320 45.184 66.337 1.00 23.86 ? 246  VAL A C   1 
ATOM   1859 O  O   . VAL A 1 246 ? -11.267 45.257 67.119 1.00 24.43 ? 246  VAL A O   1 
ATOM   1860 C  CB  . VAL A 1 246 ? -10.435 43.120 64.883 1.00 23.75 ? 246  VAL A CB  1 
ATOM   1861 C  CG1 . VAL A 1 246 ? -10.581 42.619 63.456 1.00 27.24 ? 246  VAL A CG1 1 
ATOM   1862 C  CG2 . VAL A 1 246 ? -9.156  42.622 65.514 1.00 24.87 ? 246  VAL A CG2 1 
ATOM   1863 N  N   . GLU A 1 247 ? -9.095  45.601 66.650 1.00 25.12 ? 247  GLU A N   1 
ATOM   1864 C  CA  . GLU A 1 247 ? -8.792  46.115 67.977 1.00 23.53 ? 247  GLU A CA  1 
ATOM   1865 C  C   . GLU A 1 247 ? -9.499  47.427 68.220 1.00 22.90 ? 247  GLU A C   1 
ATOM   1866 O  O   . GLU A 1 247 ? -10.026 47.661 69.305 1.00 24.51 ? 247  GLU A O   1 
ATOM   1867 C  CB  . GLU A 1 247 ? -7.306  46.314 68.163 1.00 25.12 ? 247  GLU A CB  1 
ATOM   1868 C  CG  . GLU A 1 247 ? -6.908  46.146 69.603 1.00 28.45 ? 247  GLU A CG  1 
ATOM   1869 C  CD  . GLU A 1 247 ? -7.381  44.818 70.140 1.00 29.18 ? 247  GLU A CD  1 
ATOM   1870 O  OE1 . GLU A 1 247 ? -7.959  44.810 71.249 1.00 31.50 ? 247  GLU A OE1 1 
ATOM   1871 O  OE2 . GLU A 1 247 ? -7.194  43.790 69.442 1.00 28.09 ? 247  GLU A OE2 1 
ATOM   1872 N  N   . LEU A 1 248 ? -9.474  48.310 67.231 1.00 21.87 ? 248  LEU A N   1 
ATOM   1873 C  CA  . LEU A 1 248 ? -10.165 49.589 67.353 1.00 20.40 ? 248  LEU A CA  1 
ATOM   1874 C  C   . LEU A 1 248 ? -11.608 49.186 67.576 1.00 20.56 ? 248  LEU A C   1 
ATOM   1875 O  O   . LEU A 1 248 ? -12.258 49.656 68.505 1.00 21.93 ? 248  LEU A O   1 
ATOM   1876 C  CB  . LEU A 1 248 ? -10.051 50.386 66.050 1.00 18.92 ? 248  LEU A CB  1 
ATOM   1877 C  CG  . LEU A 1 248 ? -10.860 51.672 65.868 1.00 16.64 ? 248  LEU A CG  1 
ATOM   1878 C  CD1 . LEU A 1 248 ? -10.288 52.764 66.720 1.00 20.99 ? 248  LEU A CD1 1 
ATOM   1879 C  CD2 . LEU A 1 248 ? -10.816 52.102 64.420 1.00 17.10 ? 248  LEU A CD2 1 
ATOM   1880 N  N   . GLY A 1 249 ? -12.057 48.229 66.768 1.00 20.83 ? 249  GLY A N   1 
ATOM   1881 C  CA  . GLY A 1 249 ? -13.419 47.744 66.858 1.00 22.10 ? 249  GLY A CA  1 
ATOM   1882 C  C   . GLY A 1 249 ? -13.722 47.300 68.263 1.00 22.46 ? 249  GLY A C   1 
ATOM   1883 O  O   . GLY A 1 249 ? -14.760 47.646 68.817 1.00 23.48 ? 249  GLY A O   1 
ATOM   1884 N  N   . ARG A 1 250 ? -12.778 46.586 68.859 1.00 24.63 ? 250  ARG A N   1 
ATOM   1885 C  CA  . ARG A 1 250 ? -12.934 46.089 70.218 1.00 25.68 ? 250  ARG A CA  1 
ATOM   1886 C  C   . ARG A 1 250 ? -13.053 47.250 71.182 1.00 26.84 ? 250  ARG A C   1 
ATOM   1887 O  O   . ARG A 1 250 ? -13.970 47.277 71.995 1.00 29.61 ? 250  ARG A O   1 
ATOM   1888 C  CB  . ARG A 1 250 ? -11.750 45.218 70.615 1.00 25.66 ? 250  ARG A CB  1 
ATOM   1889 C  CG  . ARG A 1 250 ? -12.159 43.953 71.317 1.00 29.79 ? 250  ARG A CG  1 
ATOM   1890 C  CD  . ARG A 1 250 ? -10.958 43.174 71.799 1.00 34.59 ? 250  ARG A CD  1 
ATOM   1891 N  NE  . ARG A 1 250 ? -10.043 42.816 70.719 1.00 39.03 ? 250  ARG A NE  1 
ATOM   1892 C  CZ  . ARG A 1 250 ? -10.170 41.739 69.944 1.00 41.70 ? 250  ARG A CZ  1 
ATOM   1893 N  NH1 . ARG A 1 250 ? -9.266  41.499 68.997 1.00 43.45 ? 250  ARG A NH1 1 
ATOM   1894 N  NH2 . ARG A 1 250 ? -11.206 40.912 70.092 1.00 42.78 ? 250  ARG A NH2 1 
ATOM   1895 N  N   . ASN A 1 251 ? -12.153 48.227 71.059 1.00 27.67 ? 251  ASN A N   1 
ATOM   1896 C  CA  . ASN A 1 251 ? -12.151 49.412 71.928 1.00 28.70 ? 251  ASN A CA  1 
ATOM   1897 C  C   . ASN A 1 251 ? -13.471 50.188 71.881 1.00 27.48 ? 251  ASN A C   1 
ATOM   1898 O  O   . ASN A 1 251 ? -13.929 50.708 72.893 1.00 28.03 ? 251  ASN A O   1 
ATOM   1899 C  CB  . ASN A 1 251 ? -10.980 50.340 71.585 1.00 30.03 ? 251  ASN A CB  1 
ATOM   1900 C  CG  . ASN A 1 251 ? -9.694  49.960 72.311 1.00 32.37 ? 251  ASN A CG  1 
ATOM   1901 O  OD1 . ASN A 1 251 ? -9.398  50.486 73.388 1.00 34.82 ? 251  ASN A OD1 1 
ATOM   1902 N  ND2 . ASN A 1 251 ? -8.921  49.050 71.726 1.00 33.89 ? 251  ASN A ND2 1 
ATOM   1903 N  N   . LEU A 1 252 ? -14.068 50.286 70.702 1.00 27.10 ? 252  LEU A N   1 
ATOM   1904 C  CA  . LEU A 1 252 ? -15.341 50.972 70.563 1.00 27.08 ? 252  LEU A CA  1 
ATOM   1905 C  C   . LEU A 1 252 ? -16.470 49.972 70.746 1.00 27.54 ? 252  LEU A C   1 
ATOM   1906 O  O   . LEU A 1 252 ? -17.617 50.229 70.402 1.00 27.83 ? 252  LEU A O   1 
ATOM   1907 C  CB  . LEU A 1 252 ? -15.442 51.652 69.206 1.00 27.58 ? 252  LEU A CB  1 
ATOM   1908 C  CG  . LEU A 1 252 ? -14.592 52.907 69.106 1.00 26.82 ? 252  LEU A CG  1 
ATOM   1909 C  CD1 . LEU A 1 252 ? -14.696 53.444 67.721 1.00 28.47 ? 252  LEU A CD1 1 
ATOM   1910 C  CD2 . LEU A 1 252 ? -15.081 53.939 70.097 1.00 28.36 ? 252  LEU A CD2 1 
ATOM   1911 N  N   . ASN A 1 253 ? -16.118 48.803 71.254 1.00 29.18 ? 253  ASN A N   1 
ATOM   1912 C  CA  . ASN A 1 253 ? -17.087 47.762 71.533 1.00 31.63 ? 253  ASN A CA  1 
ATOM   1913 C  C   . ASN A 1 253 ? -18.004 47.450 70.367 1.00 30.38 ? 253  ASN A C   1 
ATOM   1914 O  O   . ASN A 1 253 ? -19.197 47.787 70.382 1.00 29.74 ? 253  ASN A O   1 
ATOM   1915 C  CB  . ASN A 1 253 ? -17.909 48.150 72.754 1.00 37.24 ? 253  ASN A CB  1 
ATOM   1916 C  CG  . ASN A 1 253 ? -18.823 47.049 73.193 1.00 41.70 ? 253  ASN A CG  1 
ATOM   1917 O  OD1 . ASN A 1 253 ? -18.384 46.094 73.830 1.00 45.23 ? 253  ASN A OD1 1 
ATOM   1918 N  ND2 . ASN A 1 253 ? -20.101 47.150 72.829 1.00 44.74 ? 253  ASN A ND2 1 
ATOM   1919 N  N   . CYS A 1 254 ? -17.423 46.797 69.364 1.00 30.38 ? 254  CYS A N   1 
ATOM   1920 C  CA  . CYS A 1 254 ? -18.121 46.395 68.147 1.00 28.16 ? 254  CYS A CA  1 
ATOM   1921 C  C   . CYS A 1 254 ? -18.210 44.889 68.044 1.00 29.26 ? 254  CYS A C   1 
ATOM   1922 O  O   . CYS A 1 254 ? -17.415 44.155 68.651 1.00 28.67 ? 254  CYS A O   1 
ATOM   1923 C  CB  . CYS A 1 254 ? -17.365 46.868 66.917 1.00 24.17 ? 254  CYS A CB  1 
ATOM   1924 S  SG  . CYS A 1 254 ? -17.415 48.647 66.654 1.00 22.62 ? 254  CYS A SG  1 
ATOM   1925 N  N   . ASN A 1 255 ? -19.157 44.442 67.226 1.00 29.81 ? 255  ASN A N   1 
ATOM   1926 C  CA  . ASN A 1 255 ? -19.356 43.030 66.966 1.00 30.78 ? 255  ASN A CA  1 
ATOM   1927 C  C   . ASN A 1 255 ? -18.271 42.696 65.958 1.00 30.70 ? 255  ASN A C   1 
ATOM   1928 O  O   . ASN A 1 255 ? -18.424 42.979 64.780 1.00 31.50 ? 255  ASN A O   1 
ATOM   1929 C  CB  . ASN A 1 255 ? -20.731 42.816 66.340 1.00 30.67 ? 255  ASN A CB  1 
ATOM   1930 C  CG  . ASN A 1 255 ? -20.894 41.434 65.751 1.00 32.80 ? 255  ASN A CG  1 
ATOM   1931 O  OD1 . ASN A 1 255 ? -19.980 40.605 65.796 1.00 33.21 ? 255  ASN A OD1 1 
ATOM   1932 N  ND2 . ASN A 1 255 ? -22.063 41.176 65.179 1.00 36.49 ? 255  ASN A ND2 1 
ATOM   1933 N  N   . LEU A 1 256 ? -17.172 42.115 66.418 1.00 31.55 ? 256  LEU A N   1 
ATOM   1934 C  CA  . LEU A 1 256 ? -16.060 41.785 65.530 1.00 34.10 ? 256  LEU A CA  1 
ATOM   1935 C  C   . LEU A 1 256 ? -16.229 40.437 64.832 1.00 36.88 ? 256  LEU A C   1 
ATOM   1936 O  O   . LEU A 1 256 ? -15.243 39.844 64.370 1.00 38.19 ? 256  LEU A O   1 
ATOM   1937 C  CB  . LEU A 1 256 ? -14.744 41.782 66.316 1.00 32.89 ? 256  LEU A CB  1 
ATOM   1938 C  CG  . LEU A 1 256 ? -14.488 42.975 67.234 1.00 32.52 ? 256  LEU A CG  1 
ATOM   1939 C  CD1 . LEU A 1 256 ? -13.187 42.780 68.019 1.00 31.20 ? 256  LEU A CD1 1 
ATOM   1940 C  CD2 . LEU A 1 256 ? -14.448 44.247 66.398 1.00 32.71 ? 256  LEU A CD2 1 
ATOM   1941 N  N   . ASN A 1 257 ? -17.467 39.956 64.738 1.00 38.97 ? 257  ASN A N   1 
ATOM   1942 C  CA  . ASN A 1 257 ? -17.732 38.659 64.107 1.00 39.74 ? 257  ASN A CA  1 
ATOM   1943 C  C   . ASN A 1 257 ? -17.434 38.606 62.616 1.00 38.65 ? 257  ASN A C   1 
ATOM   1944 O  O   . ASN A 1 257 ? -17.357 37.524 62.045 1.00 39.34 ? 257  ASN A O   1 
ATOM   1945 C  CB  . ASN A 1 257 ? -19.184 38.223 64.342 1.00 40.27 ? 257  ASN A CB  1 
ATOM   1946 N  N   . SER A 1 258 ? -17.273 39.760 61.983 1.00 39.38 ? 258  SER A N   1 
ATOM   1947 C  CA  . SER A 1 258 ? -17.009 39.796 60.548 1.00 40.46 ? 258  SER A CA  1 
ATOM   1948 C  C   . SER A 1 258 ? -16.659 41.207 60.109 1.00 40.20 ? 258  SER A C   1 
ATOM   1949 O  O   . SER A 1 258 ? -17.154 42.183 60.695 1.00 41.55 ? 258  SER A O   1 
ATOM   1950 C  CB  . SER A 1 258 ? -18.259 39.356 59.793 1.00 41.29 ? 258  SER A CB  1 
ATOM   1951 O  OG  . SER A 1 258 ? -19.373 40.136 60.215 1.00 41.34 ? 258  SER A OG  1 
ATOM   1952 N  N   . ASP A 1 259 ? -15.854 41.316 59.052 1.00 38.53 ? 259  ASP A N   1 
ATOM   1953 C  CA  . ASP A 1 259 ? -15.449 42.617 58.532 1.00 36.93 ? 259  ASP A CA  1 
ATOM   1954 C  C   . ASP A 1 259 ? -16.669 43.510 58.327 1.00 35.82 ? 259  ASP A C   1 
ATOM   1955 O  O   . ASP A 1 259 ? -16.651 44.679 58.698 1.00 34.65 ? 259  ASP A O   1 
ATOM   1956 C  CB  . ASP A 1 259 ? -14.723 42.472 57.194 1.00 38.73 ? 259  ASP A CB  1 
ATOM   1957 C  CG  . ASP A 1 259 ? -13.471 41.604 57.279 1.00 40.79 ? 259  ASP A CG  1 
ATOM   1958 O  OD1 . ASP A 1 259 ? -13.003 41.146 56.205 1.00 43.24 ? 259  ASP A OD1 1 
ATOM   1959 O  OD2 . ASP A 1 259 ? -12.941 41.390 58.394 1.00 41.59 ? 259  ASP A OD2 1 
ATOM   1960 N  N   . GLU A 1 260 ? -17.743 42.951 57.777 1.00 34.96 ? 260  GLU A N   1 
ATOM   1961 C  CA  . GLU A 1 260 ? -18.942 43.743 57.524 1.00 34.00 ? 260  GLU A CA  1 
ATOM   1962 C  C   . GLU A 1 260 ? -19.612 44.243 58.795 1.00 33.47 ? 260  GLU A C   1 
ATOM   1963 O  O   . GLU A 1 260 ? -20.046 45.398 58.842 1.00 34.52 ? 260  GLU A O   1 
ATOM   1964 C  CB  . GLU A 1 260 ? -19.942 42.978 56.653 1.00 34.13 ? 260  GLU A CB  1 
ATOM   1965 N  N   . GLU A 1 261 ? -19.705 43.392 59.820 1.00 32.27 ? 261  GLU A N   1 
ATOM   1966 C  CA  . GLU A 1 261 ? -20.326 43.807 61.089 1.00 30.37 ? 261  GLU A CA  1 
ATOM   1967 C  C   . GLU A 1 261 ? -19.443 44.827 61.800 1.00 28.48 ? 261  GLU A C   1 
ATOM   1968 O  O   . GLU A 1 261 ? -19.931 45.833 62.348 1.00 27.22 ? 261  GLU A O   1 
ATOM   1969 C  CB  . GLU A 1 261 ? -20.582 42.607 62.001 1.00 32.18 ? 261  GLU A CB  1 
ATOM   1970 C  CG  . GLU A 1 261 ? -21.893 41.867 61.699 1.00 35.14 ? 261  GLU A CG  1 
ATOM   1971 N  N   . LEU A 1 262 ? -18.140 44.566 61.759 1.00 25.32 ? 262  LEU A N   1 
ATOM   1972 C  CA  . LEU A 1 262 ? -17.146 45.444 62.348 1.00 23.46 ? 262  LEU A CA  1 
ATOM   1973 C  C   . LEU A 1 262 ? -17.290 46.789 61.631 1.00 24.36 ? 262  LEU A C   1 
ATOM   1974 O  O   . LEU A 1 262 ? -17.601 47.804 62.249 1.00 25.02 ? 262  LEU A O   1 
ATOM   1975 C  CB  . LEU A 1 262 ? -15.752 44.873 62.088 1.00 21.36 ? 262  LEU A CB  1 
ATOM   1976 C  CG  . LEU A 1 262 ? -14.586 45.261 62.994 1.00 19.91 ? 262  LEU A CG  1 
ATOM   1977 C  CD1 . LEU A 1 262 ? -13.286 44.855 62.340 1.00 20.87 ? 262  LEU A CD1 1 
ATOM   1978 C  CD2 . LEU A 1 262 ? -14.574 46.721 63.257 1.00 20.08 ? 262  LEU A CD2 1 
ATOM   1979 N  N   . ILE A 1 263 ? -17.117 46.767 60.312 1.00 25.56 ? 263  ILE A N   1 
ATOM   1980 C  CA  . ILE A 1 263 ? -17.207 47.964 59.478 1.00 25.50 ? 263  ILE A CA  1 
ATOM   1981 C  C   . ILE A 1 263 ? -18.527 48.685 59.676 1.00 26.59 ? 263  ILE A C   1 
ATOM   1982 O  O   . ILE A 1 263 ? -18.558 49.909 59.756 1.00 27.47 ? 263  ILE A O   1 
ATOM   1983 C  CB  . ILE A 1 263 ? -17.018 47.633 57.980 1.00 22.84 ? 263  ILE A CB  1 
ATOM   1984 C  CG1 . ILE A 1 263 ? -15.572 47.237 57.720 1.00 22.72 ? 263  ILE A CG1 1 
ATOM   1985 C  CG2 . ILE A 1 263 ? -17.352 48.832 57.111 1.00 20.58 ? 263  ILE A CG2 1 
ATOM   1986 C  CD1 . ILE A 1 263 ? -15.335 46.722 56.329 1.00 23.42 ? 263  ILE A CD1 1 
ATOM   1987 N  N   . HIS A 1 264 ? -19.619 47.935 59.752 1.00 28.33 ? 264  HIS A N   1 
ATOM   1988 C  CA  . HIS A 1 264 ? -20.908 48.566 59.952 1.00 31.47 ? 264  HIS A CA  1 
ATOM   1989 C  C   . HIS A 1 264 ? -20.850 49.326 61.265 1.00 31.60 ? 264  HIS A C   1 
ATOM   1990 O  O   . HIS A 1 264 ? -21.263 50.486 61.334 1.00 33.09 ? 264  HIS A O   1 
ATOM   1991 C  CB  . HIS A 1 264 ? -22.044 47.541 60.008 1.00 37.16 ? 264  HIS A CB  1 
ATOM   1992 C  CG  . HIS A 1 264 ? -23.271 48.049 60.706 1.00 42.43 ? 264  HIS A CG  1 
ATOM   1993 N  ND1 . HIS A 1 264 ? -23.877 47.366 61.742 1.00 45.70 ? 264  HIS A ND1 1 
ATOM   1994 C  CD2 . HIS A 1 264 ? -23.968 49.205 60.561 1.00 45.26 ? 264  HIS A CD2 1 
ATOM   1995 C  CE1 . HIS A 1 264 ? -24.890 48.079 62.207 1.00 46.93 ? 264  HIS A CE1 1 
ATOM   1996 N  NE2 . HIS A 1 264 ? -24.968 49.199 61.508 1.00 46.95 ? 264  HIS A NE2 1 
ATOM   1997 N  N   . CYS A 1 265 ? -20.337 48.665 62.300 1.00 29.35 ? 265  CYS A N   1 
ATOM   1998 C  CA  . CYS A 1 265 ? -20.240 49.268 63.615 1.00 25.75 ? 265  CYS A CA  1 
ATOM   1999 C  C   . CYS A 1 265 ? -19.427 50.541 63.556 1.00 23.50 ? 265  CYS A C   1 
ATOM   2000 O  O   . CYS A 1 265 ? -19.896 51.605 63.964 1.00 24.26 ? 265  CYS A O   1 
ATOM   2001 C  CB  . CYS A 1 265 ? -19.605 48.288 64.600 1.00 26.84 ? 265  CYS A CB  1 
ATOM   2002 S  SG  . CYS A 1 265 ? -19.374 48.953 66.280 1.00 25.57 ? 265  CYS A SG  1 
ATOM   2003 N  N   . LEU A 1 266 ? -18.232 50.443 62.989 1.00 21.17 ? 266  LEU A N   1 
ATOM   2004 C  CA  . LEU A 1 266 ? -17.344 51.586 62.883 1.00 20.35 ? 266  LEU A CA  1 
ATOM   2005 C  C   . LEU A 1 266 ? -17.965 52.734 62.105 1.00 21.33 ? 266  LEU A C   1 
ATOM   2006 O  O   . LEU A 1 266 ? -17.779 53.897 62.453 1.00 21.01 ? 266  LEU A O   1 
ATOM   2007 C  CB  . LEU A 1 266 ? -16.022 51.163 62.255 1.00 19.81 ? 266  LEU A CB  1 
ATOM   2008 C  CG  . LEU A 1 266 ? -15.228 50.167 63.097 1.00 21.17 ? 266  LEU A CG  1 
ATOM   2009 C  CD1 . LEU A 1 266 ? -13.909 49.864 62.439 1.00 22.18 ? 266  LEU A CD1 1 
ATOM   2010 C  CD2 . LEU A 1 266 ? -14.981 50.744 64.471 1.00 20.96 ? 266  LEU A CD2 1 
ATOM   2011 N  N   . ARG A 1 267 ? -18.743 52.404 61.082 1.00 22.44 ? 267  ARG A N   1 
ATOM   2012 C  CA  . ARG A 1 267 ? -19.382 53.424 60.270 1.00 22.58 ? 267  ARG A CA  1 
ATOM   2013 C  C   . ARG A 1 267 ? -20.456 54.151 61.046 1.00 24.16 ? 267  ARG A C   1 
ATOM   2014 O  O   . ARG A 1 267 ? -20.915 55.210 60.615 1.00 26.19 ? 267  ARG A O   1 
ATOM   2015 C  CB  . ARG A 1 267 ? -19.992 52.834 59.002 1.00 22.24 ? 267  ARG A CB  1 
ATOM   2016 C  CG  . ARG A 1 267 ? -18.995 52.444 57.928 1.00 19.98 ? 267  ARG A CG  1 
ATOM   2017 C  CD  . ARG A 1 267 ? -19.727 52.260 56.609 1.00 25.36 ? 267  ARG A CD  1 
ATOM   2018 N  NE  . ARG A 1 267 ? -19.111 51.250 55.754 1.00 27.21 ? 267  ARG A NE  1 
ATOM   2019 C  CZ  . ARG A 1 267 ? -18.413 51.518 54.658 1.00 26.41 ? 267  ARG A CZ  1 
ATOM   2020 N  NH1 . ARG A 1 267 ? -17.892 50.527 53.954 1.00 25.15 ? 267  ARG A NH1 1 
ATOM   2021 N  NH2 . ARG A 1 267 ? -18.245 52.772 54.263 1.00 27.36 ? 267  ARG A NH2 1 
ATOM   2022 N  N   . GLU A 1 268 ? -20.891 53.568 62.160 1.00 25.30 ? 268  GLU A N   1 
ATOM   2023 C  CA  . GLU A 1 268 ? -21.918 54.190 62.993 1.00 26.71 ? 268  GLU A CA  1 
ATOM   2024 C  C   . GLU A 1 268 ? -21.335 55.101 64.063 1.00 24.58 ? 268  GLU A C   1 
ATOM   2025 O  O   . GLU A 1 268 ? -22.000 56.030 64.529 1.00 24.46 ? 268  GLU A O   1 
ATOM   2026 C  CB  . GLU A 1 268 ? -22.811 53.135 63.652 1.00 31.81 ? 268  GLU A CB  1 
ATOM   2027 C  CG  . GLU A 1 268 ? -23.853 52.537 62.713 1.00 40.53 ? 268  GLU A CG  1 
ATOM   2028 C  CD  . GLU A 1 268 ? -24.857 51.640 63.435 1.00 46.24 ? 268  GLU A CD  1 
ATOM   2029 O  OE1 . GLU A 1 268 ? -26.084 51.803 63.189 1.00 49.01 ? 268  GLU A OE1 1 
ATOM   2030 O  OE2 . GLU A 1 268 ? -24.425 50.764 64.235 1.00 48.39 ? 268  GLU A OE2 1 
ATOM   2031 N  N   . LYS A 1 269 ? -20.107 54.817 64.479 1.00 22.46 ? 269  LYS A N   1 
ATOM   2032 C  CA  . LYS A 1 269 ? -19.466 55.620 65.506 1.00 20.41 ? 269  LYS A CA  1 
ATOM   2033 C  C   . LYS A 1 269 ? -19.212 57.003 64.969 1.00 20.29 ? 269  LYS A C   1 
ATOM   2034 O  O   . LYS A 1 269 ? -18.847 57.154 63.811 1.00 22.58 ? 269  LYS A O   1 
ATOM   2035 C  CB  . LYS A 1 269 ? -18.141 55.000 65.911 1.00 18.15 ? 269  LYS A CB  1 
ATOM   2036 C  CG  . LYS A 1 269 ? -18.259 53.571 66.337 1.00 17.57 ? 269  LYS A CG  1 
ATOM   2037 C  CD  . LYS A 1 269 ? -19.227 53.448 67.471 1.00 19.00 ? 269  LYS A CD  1 
ATOM   2038 C  CE  . LYS A 1 269 ? -19.450 52.005 67.817 1.00 21.97 ? 269  LYS A CE  1 
ATOM   2039 N  NZ  . LYS A 1 269 ? -20.609 51.926 68.730 1.00 27.22 ? 269  LYS A NZ  1 
ATOM   2040 N  N   . LYS A 1 270 ? -19.441 58.021 65.789 1.00 20.74 ? 270  LYS A N   1 
ATOM   2041 C  CA  . LYS A 1 270 ? -19.189 59.389 65.353 1.00 20.27 ? 270  LYS A CA  1 
ATOM   2042 C  C   . LYS A 1 270 ? -17.685 59.481 65.115 1.00 19.69 ? 270  LYS A C   1 
ATOM   2043 O  O   . LYS A 1 270 ? -16.916 58.729 65.718 1.00 18.42 ? 270  LYS A O   1 
ATOM   2044 C  CB  . LYS A 1 270 ? -19.630 60.387 66.426 1.00 20.75 ? 270  LYS A CB  1 
ATOM   2045 C  CG  . LYS A 1 270 ? -21.141 60.466 66.618 1.00 23.54 ? 270  LYS A CG  1 
ATOM   2046 N  N   . PRO A 1 271 ? -17.239 60.450 64.302 1.00 19.12 ? 271  PRO A N   1 
ATOM   2047 C  CA  . PRO A 1 271 ? -15.813 60.587 64.027 1.00 18.82 ? 271  PRO A CA  1 
ATOM   2048 C  C   . PRO A 1 271 ? -14.997 60.493 65.297 1.00 19.35 ? 271  PRO A C   1 
ATOM   2049 O  O   . PRO A 1 271 ? -14.018 59.749 65.368 1.00 19.69 ? 271  PRO A O   1 
ATOM   2050 C  CB  . PRO A 1 271 ? -15.719 61.990 63.445 1.00 18.29 ? 271  PRO A CB  1 
ATOM   2051 C  CG  . PRO A 1 271 ? -17.008 62.181 62.794 1.00 19.41 ? 271  PRO A CG  1 
ATOM   2052 C  CD  . PRO A 1 271 ? -17.959 61.641 63.824 1.00 20.55 ? 271  PRO A CD  1 
ATOM   2053 N  N   . GLN A 1 272 ? -15.455 61.194 66.325 1.00 19.75 ? 272  GLN A N   1 
ATOM   2054 C  CA  . GLN A 1 272 ? -14.747 61.221 67.595 1.00 19.95 ? 272  GLN A CA  1 
ATOM   2055 C  C   . GLN A 1 272 ? -14.620 59.889 68.320 1.00 16.95 ? 272  GLN A C   1 
ATOM   2056 O  O   . GLN A 1 272 ? -13.620 59.647 68.979 1.00 15.84 ? 272  GLN A O   1 
ATOM   2057 C  CB  . GLN A 1 272 ? -15.340 62.278 68.518 1.00 22.73 ? 272  GLN A CB  1 
ATOM   2058 C  CG  . GLN A 1 272 ? -14.373 62.720 69.601 1.00 27.34 ? 272  GLN A CG  1 
ATOM   2059 C  CD  . GLN A 1 272 ? -12.972 62.969 69.068 1.00 28.97 ? 272  GLN A CD  1 
ATOM   2060 O  OE1 . GLN A 1 272 ? -12.689 63.996 68.434 1.00 29.40 ? 272  GLN A OE1 1 
ATOM   2061 N  NE2 . GLN A 1 272 ? -12.087 62.012 69.306 1.00 31.35 ? 272  GLN A NE2 1 
ATOM   2062 N  N   . GLU A 1 273 ? -15.610 59.019 68.197 1.00 16.13 ? 273  GLU A N   1 
ATOM   2063 C  CA  . GLU A 1 273 ? -15.529 57.727 68.862 1.00 18.07 ? 273  GLU A CA  1 
ATOM   2064 C  C   . GLU A 1 273 ? -14.255 57.021 68.418 1.00 18.64 ? 273  GLU A C   1 
ATOM   2065 O  O   . GLU A 1 273 ? -13.569 56.404 69.226 1.00 21.81 ? 273  GLU A O   1 
ATOM   2066 C  CB  . GLU A 1 273 ? -16.741 56.857 68.522 1.00 20.32 ? 273  GLU A CB  1 
ATOM   2067 C  CG  . GLU A 1 273 ? -17.743 56.677 69.646 1.00 23.48 ? 273  GLU A CG  1 
ATOM   2068 C  CD  . GLU A 1 273 ? -19.076 57.326 69.336 1.00 28.81 ? 273  GLU A CD  1 
ATOM   2069 O  OE1 . GLU A 1 273 ? -20.058 56.602 69.041 1.00 30.71 ? 273  GLU A OE1 1 
ATOM   2070 O  OE2 . GLU A 1 273 ? -19.148 58.572 69.395 1.00 33.13 ? 273  GLU A OE2 1 
ATOM   2071 N  N   . LEU A 1 274 ? -13.919 57.154 67.139 1.00 19.36 ? 274  LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 274 ? -12.727 56.514 66.585 1.00 18.48 ? 274  LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 274 ? -11.447 57.203 67.017 1.00 17.15 ? 274  LEU A C   1 
ATOM   2074 O  O   . LEU A 1 274 ? -10.479 56.552 67.390 1.00 14.74 ? 274  LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 274 ? -12.797 56.481 65.055 1.00 18.08 ? 274  LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 274 ? -13.842 55.581 64.402 1.00 17.79 ? 274  LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 274 ? -13.759 55.732 62.908 1.00 18.41 ? 274  LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 274 ? -13.590 54.151 64.771 1.00 17.07 ? 274  LEU A CD2 1 
ATOM   2079 N  N   . ILE A 1 275 ? -11.444 58.527 66.949 1.00 19.13 ? 275  ILE A N   1 
ATOM   2080 C  CA  . ILE A 1 275 ? -10.271 59.315 67.321 1.00 19.88 ? 275  ILE A CA  1 
ATOM   2081 C  C   . ILE A 1 275 ? -9.882  59.171 68.794 1.00 20.05 ? 275  ILE A C   1 
ATOM   2082 O  O   . ILE A 1 275 ? -8.703  59.225 69.129 1.00 21.74 ? 275  ILE A O   1 
ATOM   2083 C  CB  . ILE A 1 275 ? -10.471 60.800 66.986 1.00 18.34 ? 275  ILE A CB  1 
ATOM   2084 C  CG1 . ILE A 1 275 ? -10.912 60.948 65.533 1.00 17.56 ? 275  ILE A CG1 1 
ATOM   2085 C  CG2 . ILE A 1 275 ? -9.177  61.567 67.191 1.00 20.64 ? 275  ILE A CG2 1 
ATOM   2086 C  CD1 . ILE A 1 275 ? -11.022 62.383 65.079 1.00 18.01 ? 275  ILE A CD1 1 
ATOM   2087 N  N   . ASP A 1 276 ? -10.871 58.983 69.665 1.00 20.90 ? 276  ASP A N   1 
ATOM   2088 C  CA  . ASP A 1 276 ? -10.633 58.818 71.098 1.00 19.69 ? 276  ASP A CA  1 
ATOM   2089 C  C   . ASP A 1 276 ? -9.833  57.553 71.420 1.00 20.80 ? 276  ASP A C   1 
ATOM   2090 O  O   . ASP A 1 276 ? -8.829  57.608 72.130 1.00 24.60 ? 276  ASP A O   1 
ATOM   2091 C  CB  . ASP A 1 276 ? -11.960 58.777 71.854 1.00 17.96 ? 276  ASP A CB  1 
ATOM   2092 C  CG  . ASP A 1 276 ? -12.573 60.150 72.044 1.00 21.39 ? 276  ASP A CG  1 
ATOM   2093 O  OD1 . ASP A 1 276 ? -11.850 61.164 71.902 1.00 20.39 ? 276  ASP A OD1 1 
ATOM   2094 O  OD2 . ASP A 1 276 ? -13.782 60.211 72.364 1.00 23.44 ? 276  ASP A OD2 1 
ATOM   2095 N  N   . VAL A 1 277 ? -10.254 56.421 70.875 1.00 18.82 ? 277  VAL A N   1 
ATOM   2096 C  CA  . VAL A 1 277 ? -9.576  55.162 71.143 1.00 17.94 ? 277  VAL A CA  1 
ATOM   2097 C  C   . VAL A 1 277 ? -8.560  54.717 70.094 1.00 18.52 ? 277  VAL A C   1 
ATOM   2098 O  O   . VAL A 1 277 ? -7.925  53.681 70.262 1.00 20.15 ? 277  VAL A O   1 
ATOM   2099 C  CB  . VAL A 1 277 ? -10.597 54.029 71.293 1.00 17.61 ? 277  VAL A CB  1 
ATOM   2100 C  CG1 . VAL A 1 277 ? -11.679 54.429 72.277 1.00 18.64 ? 277  VAL A CG1 1 
ATOM   2101 C  CG2 . VAL A 1 277 ? -11.207 53.696 69.950 1.00 16.83 ? 277  VAL A CG2 1 
ATOM   2102 N  N   . GLU A 1 278 ? -8.354  55.508 69.045 1.00 19.29 ? 278  GLU A N   1 
ATOM   2103 C  CA  . GLU A 1 278 ? -7.444  55.106 67.976 1.00 17.16 ? 278  GLU A CA  1 
ATOM   2104 C  C   . GLU A 1 278 ? -6.006  54.831 68.363 1.00 16.09 ? 278  GLU A C   1 
ATOM   2105 O  O   . GLU A 1 278 ? -5.279  54.228 67.600 1.00 17.45 ? 278  GLU A O   1 
ATOM   2106 C  CB  . GLU A 1 278 ? -7.484  56.083 66.807 1.00 19.20 ? 278  GLU A CB  1 
ATOM   2107 C  CG  . GLU A 1 278 ? -6.520  57.240 66.937 1.00 21.84 ? 278  GLU A CG  1 
ATOM   2108 C  CD  . GLU A 1 278 ? -5.956  57.653 65.602 1.00 22.09 ? 278  GLU A CD  1 
ATOM   2109 O  OE1 . GLU A 1 278 ? -5.048  56.949 65.125 1.00 23.60 ? 278  GLU A OE1 1 
ATOM   2110 O  OE2 . GLU A 1 278 ? -6.419  58.666 65.034 1.00 22.30 ? 278  GLU A OE2 1 
ATOM   2111 N  N   . TRP A 1 279 ? -5.577  55.278 69.529 1.00 16.71 ? 279  TRP A N   1 
ATOM   2112 C  CA  . TRP A 1 279 ? -4.204  55.015 69.957 1.00 17.06 ? 279  TRP A CA  1 
ATOM   2113 C  C   . TRP A 1 279 ? -4.143  53.743 70.792 1.00 18.17 ? 279  TRP A C   1 
ATOM   2114 O  O   . TRP A 1 279 ? -3.065  53.222 71.091 1.00 18.76 ? 279  TRP A O   1 
ATOM   2115 C  CB  . TRP A 1 279 ? -3.667  56.181 70.773 1.00 16.41 ? 279  TRP A CB  1 
ATOM   2116 C  CG  . TRP A 1 279 ? -3.452  57.398 69.969 1.00 15.93 ? 279  TRP A CG  1 
ATOM   2117 C  CD1 . TRP A 1 279 ? -4.304  58.442 69.827 1.00 16.64 ? 279  TRP A CD1 1 
ATOM   2118 C  CD2 . TRP A 1 279 ? -2.288  57.718 69.212 1.00 16.57 ? 279  TRP A CD2 1 
ATOM   2119 N  NE1 . TRP A 1 279 ? -3.742  59.406 69.032 1.00 17.50 ? 279  TRP A NE1 1 
ATOM   2120 C  CE2 . TRP A 1 279 ? -2.500  58.987 68.642 1.00 16.57 ? 279  TRP A CE2 1 
ATOM   2121 C  CE3 . TRP A 1 279 ? -1.081  57.055 68.959 1.00 19.76 ? 279  TRP A CE3 1 
ATOM   2122 C  CZ2 . TRP A 1 279 ? -1.553  59.612 67.839 1.00 19.57 ? 279  TRP A CZ2 1 
ATOM   2123 C  CZ3 . TRP A 1 279 ? -0.138  57.672 68.159 1.00 21.74 ? 279  TRP A CZ3 1 
ATOM   2124 C  CH2 . TRP A 1 279 ? -0.379  58.942 67.609 1.00 22.10 ? 279  TRP A CH2 1 
ATOM   2125 N  N   . ASN A 1 280 ? -5.311  53.231 71.147 1.00 18.04 ? 280  ASN A N   1 
ATOM   2126 C  CA  . ASN A 1 280 ? -5.394  52.033 71.951 1.00 19.54 ? 280  ASN A CA  1 
ATOM   2127 C  C   . ASN A 1 280 ? -5.097  50.776 71.163 1.00 20.45 ? 280  ASN A C   1 
ATOM   2128 O  O   . ASN A 1 280 ? -5.109  49.682 71.721 1.00 22.62 ? 280  ASN A O   1 
ATOM   2129 C  CB  . ASN A 1 280 ? -6.783  51.926 72.575 1.00 22.17 ? 280  ASN A CB  1 
ATOM   2130 C  CG  . ASN A 1 280 ? -7.054  53.032 73.577 1.00 24.94 ? 280  ASN A CG  1 
ATOM   2131 O  OD1 . ASN A 1 280 ? -6.313  54.017 73.645 1.00 27.63 ? 280  ASN A OD1 1 
ATOM   2132 N  ND2 . ASN A 1 280 ? -8.117  52.880 74.362 1.00 25.60 ? 280  ASN A ND2 1 
ATOM   2133 N  N   . VAL A 1 281 ? -4.815  50.916 69.873 1.00 21.12 ? 281  VAL A N   1 
ATOM   2134 C  CA  . VAL A 1 281 ? -4.559  49.744 69.046 1.00 19.05 ? 281  VAL A CA  1 
ATOM   2135 C  C   . VAL A 1 281 ? -3.123  49.442 68.649 1.00 18.65 ? 281  VAL A C   1 
ATOM   2136 O  O   . VAL A 1 281 ? -2.879  48.422 68.016 1.00 18.02 ? 281  VAL A O   1 
ATOM   2137 C  CB  . VAL A 1 281 ? -5.415  49.761 67.787 1.00 20.46 ? 281  VAL A CB  1 
ATOM   2138 C  CG1 . VAL A 1 281 ? -6.880  49.855 68.163 1.00 20.00 ? 281  VAL A CG1 1 
ATOM   2139 C  CG2 . VAL A 1 281 ? -5.000  50.911 66.884 1.00 21.26 ? 281  VAL A CG2 1 
ATOM   2140 N  N   . LEU A 1 282 ? -2.177  50.324 68.966 1.00 18.03 ? 282  LEU A N   1 
ATOM   2141 C  CA  . LEU A 1 282 ? -0.788  50.040 68.628 1.00 18.05 ? 282  LEU A CA  1 
ATOM   2142 C  C   . LEU A 1 282 ? -0.473  48.727 69.320 1.00 20.66 ? 282  LEU A C   1 
ATOM   2143 O  O   . LEU A 1 282 ? -0.935  48.475 70.429 1.00 21.93 ? 282  LEU A O   1 
ATOM   2144 C  CB  . LEU A 1 282 ? 0.155   51.126 69.123 1.00 17.11 ? 282  LEU A CB  1 
ATOM   2145 C  CG  . LEU A 1 282 ? 0.405   52.337 68.231 1.00 14.70 ? 282  LEU A CG  1 
ATOM   2146 C  CD1 . LEU A 1 282 ? -0.886  53.033 67.941 1.00 16.86 ? 282  LEU A CD1 1 
ATOM   2147 C  CD2 . LEU A 1 282 ? 1.356   53.292 68.932 1.00 18.04 ? 282  LEU A CD2 1 
ATOM   2148 N  N   . PRO A 1 283 ? 0.301   47.862 68.666 1.00 23.45 ? 283  PRO A N   1 
ATOM   2149 C  CA  . PRO A 1 283 ? 0.647   46.570 69.243 1.00 25.02 ? 283  PRO A CA  1 
ATOM   2150 C  C   . PRO A 1 283 ? 1.723   46.619 70.297 1.00 27.08 ? 283  PRO A C   1 
ATOM   2151 O  O   . PRO A 1 283 ? 1.956   45.618 70.973 1.00 29.82 ? 283  PRO A O   1 
ATOM   2152 C  CB  . PRO A 1 283 ? 1.122   45.791 68.029 1.00 24.46 ? 283  PRO A CB  1 
ATOM   2153 C  CG  . PRO A 1 283 ? 1.860   46.835 67.277 1.00 24.87 ? 283  PRO A CG  1 
ATOM   2154 C  CD  . PRO A 1 283 ? 0.915   48.016 67.338 1.00 24.74 ? 283  PRO A CD  1 
ATOM   2155 N  N   . PHE A 1 284 ? 2.399   47.755 70.435 1.00 27.28 ? 284  PHE A N   1 
ATOM   2156 C  CA  . PHE A 1 284 ? 3.470   47.846 71.422 1.00 27.46 ? 284  PHE A CA  1 
ATOM   2157 C  C   . PHE A 1 284 ? 3.666   49.259 71.945 1.00 26.86 ? 284  PHE A C   1 
ATOM   2158 O  O   . PHE A 1 284 ? 3.523   50.215 71.192 1.00 30.33 ? 284  PHE A O   1 
ATOM   2159 C  CB  . PHE A 1 284 ? 4.779   47.337 70.802 1.00 25.92 ? 284  PHE A CB  1 
ATOM   2160 N  N   . ASP A 1 285 ? 3.945   49.390 73.241 1.00 26.15 ? 285  ASP A N   1 
ATOM   2161 C  CA  . ASP A 1 285 ? 4.200   50.698 73.862 1.00 25.73 ? 285  ASP A CA  1 
ATOM   2162 C  C   . ASP A 1 285 ? 5.363   51.250 73.045 1.00 23.28 ? 285  ASP A C   1 
ATOM   2163 O  O   . ASP A 1 285 ? 6.430   50.635 73.005 1.00 23.68 ? 285  ASP A O   1 
ATOM   2164 C  CB  . ASP A 1 285 ? 4.619   50.488 75.328 1.00 28.93 ? 285  ASP A CB  1 
ATOM   2165 C  CG  . ASP A 1 285 ? 4.786   51.789 76.109 1.00 27.71 ? 285  ASP A CG  1 
ATOM   2166 O  OD1 . ASP A 1 285 ? 5.386   51.730 77.203 1.00 29.16 ? 285  ASP A OD1 1 
ATOM   2167 O  OD2 . ASP A 1 285 ? 4.301   52.856 75.663 1.00 30.56 ? 285  ASP A OD2 1 
ATOM   2168 N  N   . SER A 1 286 ? 5.169   52.390 72.392 1.00 20.69 ? 286  SER A N   1 
ATOM   2169 C  CA  . SER A 1 286 ? 6.222   52.913 71.534 1.00 20.62 ? 286  SER A CA  1 
ATOM   2170 C  C   . SER A 1 286 ? 6.243   54.409 71.294 1.00 20.73 ? 286  SER A C   1 
ATOM   2171 O  O   . SER A 1 286 ? 5.407   55.159 71.803 1.00 23.54 ? 286  SER A O   1 
ATOM   2172 C  CB  . SER A 1 286 ? 6.112   52.247 70.172 1.00 20.39 ? 286  SER A CB  1 
ATOM   2173 O  OG  . SER A 1 286 ? 4.871   52.587 69.575 1.00 20.71 ? 286  SER A OG  1 
ATOM   2174 N  N   . ILE A 1 287 ? 7.173   54.804 70.431 1.00 18.70 ? 287  ILE A N   1 
ATOM   2175 C  CA  . ILE A 1 287 ? 7.380   56.186 70.030 1.00 18.41 ? 287  ILE A CA  1 
ATOM   2176 C  C   . ILE A 1 287 ? 7.590   56.209 68.519 1.00 16.49 ? 287  ILE A C   1 
ATOM   2177 O  O   . ILE A 1 287 ? 8.333   55.392 67.980 1.00 15.97 ? 287  ILE A O   1 
ATOM   2178 C  CB  . ILE A 1 287 ? 8.612   56.785 70.746 1.00 18.91 ? 287  ILE A CB  1 
ATOM   2179 C  CG1 . ILE A 1 287 ? 8.158   57.602 71.940 1.00 20.55 ? 287  ILE A CG1 1 
ATOM   2180 C  CG2 . ILE A 1 287 ? 9.440   57.656 69.816 1.00 19.78 ? 287  ILE A CG2 1 
ATOM   2181 C  CD1 . ILE A 1 287 ? 9.271   58.415 72.514 1.00 27.91 ? 287  ILE A CD1 1 
ATOM   2182 N  N   . PHE A 1 288 ? 6.939   57.152 67.851 1.00 12.67 ? 288  PHE A N   1 
ATOM   2183 C  CA  . PHE A 1 288 ? 7.030   57.289 66.404 1.00 12.05 ? 288  PHE A CA  1 
ATOM   2184 C  C   . PHE A 1 288 ? 6.409   56.079 65.741 1.00 12.82 ? 288  PHE A C   1 
ATOM   2185 O  O   . PHE A 1 288 ? 6.998   55.444 64.876 1.00 14.53 ? 288  PHE A O   1 
ATOM   2186 C  CB  . PHE A 1 288 ? 8.474   57.461 65.939 1.00 11.80 ? 288  PHE A CB  1 
ATOM   2187 C  CG  . PHE A 1 288 ? 8.642   58.488 64.866 1.00 10.13 ? 288  PHE A CG  1 
ATOM   2188 C  CD1 . PHE A 1 288 ? 7.725   58.595 63.838 1.00 9.20  ? 288  PHE A CD1 1 
ATOM   2189 C  CD2 . PHE A 1 288 ? 9.720   59.359 64.891 1.00 10.98 ? 288  PHE A CD2 1 
ATOM   2190 C  CE1 . PHE A 1 288 ? 7.878   59.555 62.851 1.00 9.99  ? 288  PHE A CE1 1 
ATOM   2191 C  CE2 . PHE A 1 288 ? 9.878   60.316 63.910 1.00 10.37 ? 288  PHE A CE2 1 
ATOM   2192 C  CZ  . PHE A 1 288 ? 8.954   60.412 62.889 1.00 8.71  ? 288  PHE A CZ  1 
ATOM   2193 N  N   . ARG A 1 289 ? 5.209   55.755 66.181 1.00 11.67 ? 289  ARG A N   1 
ATOM   2194 C  CA  . ARG A 1 289 ? 4.486   54.645 65.626 1.00 11.90 ? 289  ARG A CA  1 
ATOM   2195 C  C   . ARG A 1 289 ? 3.040   55.123 65.669 1.00 13.75 ? 289  ARG A C   1 
ATOM   2196 O  O   . ARG A 1 289 ? 2.629   55.779 66.626 1.00 14.71 ? 289  ARG A O   1 
ATOM   2197 C  CB  . ARG A 1 289 ? 4.710   53.404 66.475 1.00 9.98  ? 289  ARG A CB  1 
ATOM   2198 C  CG  . ARG A 1 289 ? 4.856   52.144 65.656 1.00 15.19 ? 289  ARG A CG  1 
ATOM   2199 C  CD  . ARG A 1 289 ? 6.287   51.621 65.607 1.00 14.52 ? 289  ARG A CD  1 
ATOM   2200 N  NE  . ARG A 1 289 ? 7.262   52.611 65.157 1.00 12.75 ? 289  ARG A NE  1 
ATOM   2201 C  CZ  . ARG A 1 289 ? 8.518   52.320 64.834 1.00 13.19 ? 289  ARG A CZ  1 
ATOM   2202 N  NH1 . ARG A 1 289 ? 8.950   51.066 64.898 1.00 15.03 ? 289  ARG A NH1 1 
ATOM   2203 N  NH2 . ARG A 1 289 ? 9.358   53.283 64.491 1.00 9.13  ? 289  ARG A NH2 1 
ATOM   2204 N  N   . PHE A 1 290 ? 2.297   54.875 64.597 1.00 14.60 ? 290  PHE A N   1 
ATOM   2205 C  CA  . PHE A 1 290 ? 0.918   55.320 64.508 1.00 12.97 ? 290  PHE A CA  1 
ATOM   2206 C  C   . PHE A 1 290 ? 0.045   54.139 64.154 1.00 14.49 ? 290  PHE A C   1 
ATOM   2207 O  O   . PHE A 1 290 ? 0.464   53.246 63.432 1.00 15.68 ? 290  PHE A O   1 
ATOM   2208 C  CB  . PHE A 1 290 ? 0.819   56.422 63.468 1.00 14.12 ? 290  PHE A CB  1 
ATOM   2209 C  CG  . PHE A 1 290 ? 1.927   57.431 63.567 1.00 13.77 ? 290  PHE A CG  1 
ATOM   2210 C  CD1 . PHE A 1 290 ? 1.967   58.335 64.615 1.00 15.31 ? 290  PHE A CD1 1 
ATOM   2211 C  CD2 . PHE A 1 290 ? 2.959   57.439 62.645 1.00 13.29 ? 290  PHE A CD2 1 
ATOM   2212 C  CE1 . PHE A 1 290 ? 3.023   59.231 64.749 1.00 16.57 ? 290  PHE A CE1 1 
ATOM   2213 C  CE2 . PHE A 1 290 ? 4.018   58.331 62.770 1.00 15.75 ? 290  PHE A CE2 1 
ATOM   2214 C  CZ  . PHE A 1 290 ? 4.050   59.230 63.828 1.00 15.21 ? 290  PHE A CZ  1 
ATOM   2215 N  N   . SER A 1 291 ? -1.177  54.149 64.661 1.00 15.88 ? 291  SER A N   1 
ATOM   2216 C  CA  . SER A 1 291 ? -2.114  53.053 64.486 1.00 15.69 ? 291  SER A CA  1 
ATOM   2217 C  C   . SER A 1 291 ? -2.465  52.679 63.071 1.00 16.86 ? 291  SER A C   1 
ATOM   2218 O  O   . SER A 1 291 ? -2.036  51.641 62.568 1.00 18.64 ? 291  SER A O   1 
ATOM   2219 C  CB  . SER A 1 291 ? -3.394  53.362 65.249 1.00 15.96 ? 291  SER A CB  1 
ATOM   2220 O  OG  . SER A 1 291 ? -3.107  54.177 66.362 1.00 15.63 ? 291  SER A OG  1 
ATOM   2221 N  N   . PHE A 1 292 ? -3.329  53.487 62.467 1.00 17.06 ? 292  PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 292 ? -3.803  53.257 61.117 1.00 15.22 ? 292  PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 292 ? -2.921  54.015 60.157 1.00 15.21 ? 292  PHE A C   1 
ATOM   2224 O  O   . PHE A 1 292 ? -2.977  55.241 60.039 1.00 15.27 ? 292  PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 292 ? -5.249  53.676 61.042 1.00 15.72 ? 292  PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 292 ? -6.071  53.074 62.125 1.00 16.28 ? 292  PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 292 ? -6.273  53.753 63.313 1.00 17.02 ? 292  PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 292 ? -6.584  51.796 61.987 1.00 17.85 ? 292  PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 292 ? -6.970  53.171 64.347 1.00 18.34 ? 292  PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 292 ? -7.282  51.206 63.016 1.00 18.13 ? 292  PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 292 ? -7.474  51.896 64.201 1.00 19.34 ? 292  PHE A CZ  1 
ATOM   2232 N  N   . VAL A 1 293 ? -2.097  53.243 59.470 1.00 14.99 ? 293  VAL A N   1 
ATOM   2233 C  CA  . VAL A 1 293 ? -1.119  53.764 58.551 1.00 13.28 ? 293  VAL A CA  1 
ATOM   2234 C  C   . VAL A 1 293 ? -1.198  52.850 57.306 1.00 15.33 ? 293  VAL A C   1 
ATOM   2235 O  O   . VAL A 1 293 ? -1.718  51.743 57.405 1.00 17.14 ? 293  VAL A O   1 
ATOM   2236 C  CB  . VAL A 1 293 ? 0.232   53.684 59.290 1.00 8.49  ? 293  VAL A CB  1 
ATOM   2237 C  CG1 . VAL A 1 293 ? 0.859   52.329 59.123 1.00 10.44 ? 293  VAL A CG1 1 
ATOM   2238 C  CG2 . VAL A 1 293 ? 1.122   54.803 58.919 1.00 9.65  ? 293  VAL A CG2 1 
ATOM   2239 N  N   . PRO A 1 294 ? -0.765  53.328 56.118 1.00 16.05 ? 294  PRO A N   1 
ATOM   2240 C  CA  . PRO A 1 294 ? -0.789  52.561 54.867 1.00 14.94 ? 294  PRO A CA  1 
ATOM   2241 C  C   . PRO A 1 294 ? -0.468  51.079 55.009 1.00 16.58 ? 294  PRO A C   1 
ATOM   2242 O  O   . PRO A 1 294 ? 0.584   50.703 55.517 1.00 21.36 ? 294  PRO A O   1 
ATOM   2243 C  CB  . PRO A 1 294 ? 0.276   53.253 54.042 1.00 15.57 ? 294  PRO A CB  1 
ATOM   2244 C  CG  . PRO A 1 294 ? 0.073   54.663 54.393 1.00 17.14 ? 294  PRO A CG  1 
ATOM   2245 C  CD  . PRO A 1 294 ? -0.116  54.633 55.893 1.00 17.97 ? 294  PRO A CD  1 
ATOM   2246 N  N   . VAL A 1 295 ? -1.381  50.240 54.549 1.00 15.83 ? 295  VAL A N   1 
ATOM   2247 C  CA  . VAL A 1 295 ? -1.218  48.806 54.610 1.00 13.93 ? 295  VAL A CA  1 
ATOM   2248 C  C   . VAL A 1 295 ? -0.638  48.291 53.292 1.00 14.77 ? 295  VAL A C   1 
ATOM   2249 O  O   . VAL A 1 295 ? -0.993  48.772 52.220 1.00 16.83 ? 295  VAL A O   1 
ATOM   2250 C  CB  . VAL A 1 295 ? -2.583  48.167 54.897 1.00 15.98 ? 295  VAL A CB  1 
ATOM   2251 C  CG1 . VAL A 1 295 ? -3.316  47.781 53.616 1.00 15.38 ? 295  VAL A CG1 1 
ATOM   2252 C  CG2 . VAL A 1 295 ? -2.424  47.007 55.815 1.00 20.28 ? 295  VAL A CG2 1 
ATOM   2253 N  N   . ILE A 1 296 ? 0.269   47.326 53.356 1.00 15.26 ? 296  ILE A N   1 
ATOM   2254 C  CA  . ILE A 1 296 ? 0.866   46.772 52.137 1.00 14.31 ? 296  ILE A CA  1 
ATOM   2255 C  C   . ILE A 1 296 ? -0.090  45.747 51.504 1.00 15.84 ? 296  ILE A C   1 
ATOM   2256 O  O   . ILE A 1 296 ? 0.126   44.544 51.588 1.00 18.28 ? 296  ILE A O   1 
ATOM   2257 C  CB  . ILE A 1 296 ? 2.222   46.103 52.433 1.00 11.19 ? 296  ILE A CB  1 
ATOM   2258 C  CG1 . ILE A 1 296 ? 3.141   47.063 53.190 1.00 6.40  ? 296  ILE A CG1 1 
ATOM   2259 C  CG2 . ILE A 1 296 ? 2.877   45.647 51.140 1.00 12.52 ? 296  ILE A CG2 1 
ATOM   2260 C  CD1 . ILE A 1 296 ? 3.451   48.323 52.465 1.00 6.92  ? 296  ILE A CD1 1 
ATOM   2261 N  N   . ASP A 1 297 ? -1.129  46.245 50.845 1.00 16.32 ? 297  ASP A N   1 
ATOM   2262 C  CA  . ASP A 1 297 ? -2.171  45.427 50.223 1.00 16.60 ? 297  ASP A CA  1 
ATOM   2263 C  C   . ASP A 1 297 ? -1.908  44.581 48.989 1.00 19.59 ? 297  ASP A C   1 
ATOM   2264 O  O   . ASP A 1 297 ? -2.652  43.638 48.735 1.00 22.74 ? 297  ASP A O   1 
ATOM   2265 C  CB  . ASP A 1 297 ? -3.389  46.294 49.929 1.00 16.38 ? 297  ASP A CB  1 
ATOM   2266 C  CG  . ASP A 1 297 ? -3.040  47.548 49.145 1.00 16.66 ? 297  ASP A CG  1 
ATOM   2267 O  OD1 . ASP A 1 297 ? -3.967  48.285 48.762 1.00 19.64 ? 297  ASP A OD1 1 
ATOM   2268 O  OD2 . ASP A 1 297 ? -1.842  47.827 48.929 1.00 19.89 ? 297  ASP A OD2 1 
ATOM   2269 N  N   . GLY A 1 298 ? -0.907  44.912 48.192 1.00 20.79 ? 298  GLY A N   1 
ATOM   2270 C  CA  . GLY A 1 298 ? -0.687  44.131 46.984 1.00 22.18 ? 298  GLY A CA  1 
ATOM   2271 C  C   . GLY A 1 298 ? -1.457  44.749 45.820 1.00 24.01 ? 298  GLY A C   1 
ATOM   2272 O  O   . GLY A 1 298 ? -1.344  44.318 44.667 1.00 25.44 ? 298  GLY A O   1 
ATOM   2273 N  N   . GLU A 1 299 ? -2.253  45.768 46.131 1.00 23.04 ? 299  GLU A N   1 
ATOM   2274 C  CA  . GLU A 1 299 ? -3.053  46.469 45.134 1.00 21.93 ? 299  GLU A CA  1 
ATOM   2275 C  C   . GLU A 1 299 ? -2.402  47.834 44.910 1.00 21.63 ? 299  GLU A C   1 
ATOM   2276 O  O   . GLU A 1 299 ? -1.960  48.150 43.805 1.00 24.34 ? 299  GLU A O   1 
ATOM   2277 C  CB  . GLU A 1 299 ? -4.492  46.618 45.644 1.00 22.00 ? 299  GLU A CB  1 
ATOM   2278 C  CG  . GLU A 1 299 ? -5.428  47.383 44.733 1.00 25.24 ? 299  GLU A CG  1 
ATOM   2279 N  N   . PHE A 1 300 ? -2.355  48.644 45.965 1.00 18.34 ? 300  PHE A N   1 
ATOM   2280 C  CA  . PHE A 1 300 ? -1.728  49.951 45.896 1.00 13.70 ? 300  PHE A CA  1 
ATOM   2281 C  C   . PHE A 1 300 ? -0.244  49.665 45.829 1.00 14.35 ? 300  PHE A C   1 
ATOM   2282 O  O   . PHE A 1 300 ? 0.452   50.199 44.987 1.00 16.78 ? 300  PHE A O   1 
ATOM   2283 C  CB  . PHE A 1 300 ? -2.054  50.758 47.146 1.00 9.37  ? 300  PHE A CB  1 
ATOM   2284 C  CG  . PHE A 1 300 ? -1.736  52.214 47.034 1.00 3.23  ? 300  PHE A CG  1 
ATOM   2285 C  CD1 . PHE A 1 300 ? -2.749  53.140 46.894 1.00 2.04  ? 300  PHE A CD1 1 
ATOM   2286 C  CD2 . PHE A 1 300 ? -0.429  52.664 47.112 1.00 3.42  ? 300  PHE A CD2 1 
ATOM   2287 C  CE1 . PHE A 1 300 ? -2.464  54.491 46.838 1.00 4.67  ? 300  PHE A CE1 1 
ATOM   2288 C  CE2 . PHE A 1 300 ? -0.135  54.016 47.059 1.00 2.00  ? 300  PHE A CE2 1 
ATOM   2289 C  CZ  . PHE A 1 300 ? -1.152  54.931 46.921 1.00 2.01  ? 300  PHE A CZ  1 
ATOM   2290 N  N   . PHE A 1 301 ? 0.232   48.794 46.710 1.00 15.81 ? 301  PHE A N   1 
ATOM   2291 C  CA  . PHE A 1 301 ? 1.642   48.420 46.730 1.00 17.86 ? 301  PHE A CA  1 
ATOM   2292 C  C   . PHE A 1 301 ? 1.706   46.993 46.225 1.00 20.97 ? 301  PHE A C   1 
ATOM   2293 O  O   . PHE A 1 301 ? 1.218   46.084 46.887 1.00 22.14 ? 301  PHE A O   1 
ATOM   2294 C  CB  . PHE A 1 301 ? 2.217   48.463 48.155 1.00 16.82 ? 301  PHE A CB  1 
ATOM   2295 C  CG  . PHE A 1 301 ? 2.085   49.797 48.821 1.00 13.83 ? 301  PHE A CG  1 
ATOM   2296 C  CD1 . PHE A 1 301 ? 2.908   50.846 48.459 1.00 12.12 ? 301  PHE A CD1 1 
ATOM   2297 C  CD2 . PHE A 1 301 ? 1.116   50.010 49.783 1.00 13.74 ? 301  PHE A CD2 1 
ATOM   2298 C  CE1 . PHE A 1 301 ? 2.764   52.083 49.040 1.00 12.66 ? 301  PHE A CE1 1 
ATOM   2299 C  CE2 . PHE A 1 301 ? 0.968   51.245 50.367 1.00 13.03 ? 301  PHE A CE2 1 
ATOM   2300 C  CZ  . PHE A 1 301 ? 1.793   52.284 49.996 1.00 11.91 ? 301  PHE A CZ  1 
ATOM   2301 N  N   . PRO A 1 302 ? 2.290   46.778 45.040 1.00 21.87 ? 302  PRO A N   1 
ATOM   2302 C  CA  . PRO A 1 302 ? 2.408   45.444 44.454 1.00 20.30 ? 302  PRO A CA  1 
ATOM   2303 C  C   . PRO A 1 302 ? 3.086   44.432 45.372 1.00 21.57 ? 302  PRO A C   1 
ATOM   2304 O  O   . PRO A 1 302 ? 2.726   43.252 45.382 1.00 24.69 ? 302  PRO A O   1 
ATOM   2305 C  CB  . PRO A 1 302 ? 3.242   45.709 43.211 1.00 18.74 ? 302  PRO A CB  1 
ATOM   2306 C  CG  . PRO A 1 302 ? 2.787   47.048 42.803 1.00 18.93 ? 302  PRO A CG  1 
ATOM   2307 C  CD  . PRO A 1 302 ? 2.780   47.799 44.100 1.00 21.40 ? 302  PRO A CD  1 
ATOM   2308 N  N   . THR A 1 303 ? 4.088   44.873 46.119 1.00 21.60 ? 303  THR A N   1 
ATOM   2309 C  CA  . THR A 1 303 ? 4.802   43.977 47.014 1.00 21.49 ? 303  THR A CA  1 
ATOM   2310 C  C   . THR A 1 303 ? 5.461   44.778 48.123 1.00 21.30 ? 303  THR A C   1 
ATOM   2311 O  O   . THR A 1 303 ? 5.255   45.985 48.246 1.00 21.02 ? 303  THR A O   1 
ATOM   2312 C  CB  . THR A 1 303 ? 5.907   43.208 46.270 1.00 24.98 ? 303  THR A CB  1 
ATOM   2313 O  OG1 . THR A 1 303 ? 5.599   43.135 44.871 1.00 24.77 ? 303  THR A OG1 1 
ATOM   2314 C  CG2 . THR A 1 303 ? 6.010   41.788 46.817 1.00 29.61 ? 303  THR A CG2 1 
ATOM   2315 N  N   . SER A 1 304 ? 6.255   44.110 48.941 1.00 21.83 ? 304  SER A N   1 
ATOM   2316 C  CA  . SER A 1 304 ? 6.923   44.799 50.023 1.00 23.35 ? 304  SER A CA  1 
ATOM   2317 C  C   . SER A 1 304 ? 7.770   45.919 49.435 1.00 22.94 ? 304  SER A C   1 
ATOM   2318 O  O   . SER A 1 304 ? 8.588   45.694 48.556 1.00 23.67 ? 304  SER A O   1 
ATOM   2319 C  CB  . SER A 1 304 ? 7.787   43.814 50.829 1.00 25.65 ? 304  SER A CB  1 
ATOM   2320 O  OG  . SER A 1 304 ? 8.603   42.997 49.994 1.00 24.77 ? 304  SER A OG  1 
ATOM   2321 N  N   . LEU A 1 305 ? 7.558   47.132 49.913 1.00 23.03 ? 305  LEU A N   1 
ATOM   2322 C  CA  . LEU A 1 305 ? 8.304   48.284 49.447 1.00 22.36 ? 305  LEU A CA  1 
ATOM   2323 C  C   . LEU A 1 305 ? 9.793   47.993 49.299 1.00 24.09 ? 305  LEU A C   1 
ATOM   2324 O  O   . LEU A 1 305 ? 10.493  48.701 48.578 1.00 25.36 ? 305  LEU A O   1 
ATOM   2325 C  CB  . LEU A 1 305 ? 8.105   49.429 50.420 1.00 22.19 ? 305  LEU A CB  1 
ATOM   2326 C  CG  . LEU A 1 305 ? 6.787   50.183 50.310 1.00 27.14 ? 305  LEU A CG  1 
ATOM   2327 C  CD1 . LEU A 1 305 ? 5.640   49.260 49.946 1.00 27.38 ? 305  LEU A CD1 1 
ATOM   2328 C  CD2 . LEU A 1 305 ? 6.527   50.941 51.611 1.00 27.96 ? 305  LEU A CD2 1 
ATOM   2329 N  N   . GLU A 1 306 ? 10.287  46.977 50.001 1.00 25.02 ? 306  GLU A N   1 
ATOM   2330 C  CA  . GLU A 1 306 ? 11.697  46.619 49.917 1.00 27.55 ? 306  GLU A CA  1 
ATOM   2331 C  C   . GLU A 1 306 ? 11.965  45.828 48.647 1.00 27.07 ? 306  GLU A C   1 
ATOM   2332 O  O   . GLU A 1 306 ? 13.006  46.001 48.005 1.00 25.74 ? 306  GLU A O   1 
ATOM   2333 C  CB  . GLU A 1 306 ? 12.133  45.800 51.126 1.00 30.00 ? 306  GLU A CB  1 
ATOM   2334 C  CG  . GLU A 1 306 ? 13.601  45.391 51.066 1.00 33.54 ? 306  GLU A CG  1 
ATOM   2335 C  CD  . GLU A 1 306 ? 14.531  46.583 50.833 1.00 36.96 ? 306  GLU A CD  1 
ATOM   2336 O  OE1 . GLU A 1 306 ? 15.569  46.401 50.140 1.00 37.61 ? 306  GLU A OE1 1 
ATOM   2337 O  OE2 . GLU A 1 306 ? 14.213  47.700 51.334 1.00 36.36 ? 306  GLU A OE2 1 
ATOM   2338 N  N   . SER A 1 307 ? 11.036  44.931 48.323 1.00 26.38 ? 307  SER A N   1 
ATOM   2339 C  CA  . SER A 1 307 ? 11.115  44.107 47.128 1.00 25.65 ? 307  SER A CA  1 
ATOM   2340 C  C   . SER A 1 307 ? 11.039  45.043 45.924 1.00 24.20 ? 307  SER A C   1 
ATOM   2341 O  O   . SER A 1 307 ? 11.743  44.854 44.937 1.00 25.37 ? 307  SER A O   1 
ATOM   2342 C  CB  . SER A 1 307 ? 9.946   43.129 47.107 1.00 28.56 ? 307  SER A CB  1 
ATOM   2343 O  OG  . SER A 1 307 ? 10.065  42.187 46.052 1.00 36.14 ? 307  SER A OG  1 
ATOM   2344 N  N   . MET A 1 308 ? 10.197  46.067 46.025 1.00 22.98 ? 308  MET A N   1 
ATOM   2345 C  CA  . MET A 1 308 ? 10.046  47.054 44.964 1.00 20.04 ? 308  MET A CA  1 
ATOM   2346 C  C   . MET A 1 308 ? 11.330  47.846 44.899 1.00 20.89 ? 308  MET A C   1 
ATOM   2347 O  O   . MET A 1 308 ? 12.014  47.834 43.881 1.00 24.54 ? 308  MET A O   1 
ATOM   2348 C  CB  . MET A 1 308 ? 8.864   47.975 45.241 1.00 16.99 ? 308  MET A CB  1 
ATOM   2349 C  CG  . MET A 1 308 ? 7.533   47.263 45.150 1.00 18.33 ? 308  MET A CG  1 
ATOM   2350 S  SD  . MET A 1 308 ? 6.154   48.374 45.343 1.00 22.22 ? 308  MET A SD  1 
ATOM   2351 C  CE  . MET A 1 308 ? 5.928   48.928 43.660 1.00 20.84 ? 308  MET A CE  1 
ATOM   2352 N  N   . LEU A 1 309 ? 11.688  48.488 46.004 1.00 20.32 ? 309  LEU A N   1 
ATOM   2353 C  CA  . LEU A 1 309 ? 12.918  49.265 46.074 1.00 20.00 ? 309  LEU A CA  1 
ATOM   2354 C  C   . LEU A 1 309 ? 14.098  48.449 45.551 1.00 20.64 ? 309  LEU A C   1 
ATOM   2355 O  O   . LEU A 1 309 ? 14.942  48.968 44.836 1.00 20.28 ? 309  LEU A O   1 
ATOM   2356 C  CB  . LEU A 1 309 ? 13.186  49.692 47.521 1.00 20.31 ? 309  LEU A CB  1 
ATOM   2357 C  CG  . LEU A 1 309 ? 12.884  51.131 47.959 1.00 19.68 ? 309  LEU A CG  1 
ATOM   2358 C  CD1 . LEU A 1 309 ? 11.623  51.669 47.322 1.00 20.24 ? 309  LEU A CD1 1 
ATOM   2359 C  CD2 . LEU A 1 309 ? 12.772  51.166 49.467 1.00 19.48 ? 309  LEU A CD2 1 
ATOM   2360 N  N   . ASN A 1 310 ? 14.127  47.158 45.865 1.00 22.81 ? 310  ASN A N   1 
ATOM   2361 C  CA  . ASN A 1 310 ? 15.221  46.297 45.423 1.00 24.14 ? 310  ASN A CA  1 
ATOM   2362 C  C   . ASN A 1 310 ? 15.225  46.102 43.929 1.00 23.12 ? 310  ASN A C   1 
ATOM   2363 O  O   . ASN A 1 310 ? 16.231  46.344 43.270 1.00 23.15 ? 310  ASN A O   1 
ATOM   2364 C  CB  . ASN A 1 310 ? 15.152  44.921 46.087 1.00 28.68 ? 310  ASN A CB  1 
ATOM   2365 C  CG  . ASN A 1 310 ? 15.840  44.883 47.446 1.00 36.13 ? 310  ASN A CG  1 
ATOM   2366 O  OD1 . ASN A 1 310 ? 15.467  44.086 48.331 1.00 39.53 ? 310  ASN A OD1 1 
ATOM   2367 N  ND2 . ASN A 1 310 ? 16.869  45.719 47.618 1.00 36.37 ? 310  ASN A ND2 1 
ATOM   2368 N  N   . SER A 1 311 ? 14.088  45.661 43.404 1.00 21.97 ? 311  SER A N   1 
ATOM   2369 C  CA  . SER A 1 311 ? 13.927  45.391 41.984 1.00 20.96 ? 311  SER A CA  1 
ATOM   2370 C  C   . SER A 1 311 ? 13.820  46.647 41.128 1.00 19.99 ? 311  SER A C   1 
ATOM   2371 O  O   . SER A 1 311 ? 13.628  46.568 39.919 1.00 20.27 ? 311  SER A O   1 
ATOM   2372 C  CB  . SER A 1 311 ? 12.679  44.550 41.776 1.00 20.93 ? 311  SER A CB  1 
ATOM   2373 O  OG  . SER A 1 311 ? 11.524  45.330 42.021 1.00 23.10 ? 311  SER A OG  1 
ATOM   2374 N  N   . GLY A 1 312 ? 13.924  47.807 41.753 1.00 20.75 ? 312  GLY A N   1 
ATOM   2375 C  CA  . GLY A 1 312 ? 13.815  49.038 41.002 1.00 19.98 ? 312  GLY A CA  1 
ATOM   2376 C  C   . GLY A 1 312 ? 12.429  49.170 40.419 1.00 20.66 ? 312  GLY A C   1 
ATOM   2377 O  O   . GLY A 1 312 ? 12.234  49.835 39.398 1.00 21.17 ? 312  GLY A O   1 
ATOM   2378 N  N   . ASN A 1 313 ? 11.458  48.536 41.067 1.00 18.69 ? 313  ASN A N   1 
ATOM   2379 C  CA  . ASN A 1 313 ? 10.093  48.597 40.591 1.00 16.24 ? 313  ASN A CA  1 
ATOM   2380 C  C   . ASN A 1 313 ? 9.422   49.884 41.026 1.00 16.99 ? 313  ASN A C   1 
ATOM   2381 O  O   . ASN A 1 313 ? 8.468   49.863 41.788 1.00 20.14 ? 313  ASN A O   1 
ATOM   2382 C  CB  . ASN A 1 313 ? 9.292   47.395 41.076 1.00 14.43 ? 313  ASN A CB  1 
ATOM   2383 C  CG  . ASN A 1 313 ? 7.866   47.439 40.604 1.00 14.16 ? 313  ASN A CG  1 
ATOM   2384 O  OD1 . ASN A 1 313 ? 7.506   48.295 39.809 1.00 13.16 ? 313  ASN A OD1 1 
ATOM   2385 N  ND2 . ASN A 1 313 ? 7.046   46.516 41.081 1.00 16.66 ? 313  ASN A ND2 1 
ATOM   2386 N  N   . PHE A 1 314 ? 9.899   51.008 40.519 1.00 16.80 ? 314  PHE A N   1 
ATOM   2387 C  CA  . PHE A 1 314 ? 9.310   52.289 40.879 1.00 15.87 ? 314  PHE A CA  1 
ATOM   2388 C  C   . PHE A 1 314 ? 9.512   53.322 39.780 1.00 14.63 ? 314  PHE A C   1 
ATOM   2389 O  O   . PHE A 1 314 ? 10.291  53.116 38.863 1.00 18.37 ? 314  PHE A O   1 
ATOM   2390 C  CB  . PHE A 1 314 ? 9.900   52.786 42.203 1.00 15.77 ? 314  PHE A CB  1 
ATOM   2391 C  CG  . PHE A 1 314 ? 11.400  52.717 42.269 1.00 13.08 ? 314  PHE A CG  1 
ATOM   2392 C  CD1 . PHE A 1 314 ? 12.181  53.677 41.656 1.00 11.25 ? 314  PHE A CD1 1 
ATOM   2393 C  CD2 . PHE A 1 314 ? 12.026  51.669 42.921 1.00 11.87 ? 314  PHE A CD2 1 
ATOM   2394 C  CE1 . PHE A 1 314 ? 13.557  53.593 41.687 1.00 11.35 ? 314  PHE A CE1 1 
ATOM   2395 C  CE2 . PHE A 1 314 ? 13.403  51.583 42.954 1.00 11.71 ? 314  PHE A CE2 1 
ATOM   2396 C  CZ  . PHE A 1 314 ? 14.168  52.546 42.335 1.00 12.74 ? 314  PHE A CZ  1 
ATOM   2397 N  N   . LYS A 1 315 ? 8.793   54.426 39.874 1.00 11.89 ? 315  LYS A N   1 
ATOM   2398 C  CA  . LYS A 1 315 ? 8.886   55.494 38.904 1.00 10.74 ? 315  LYS A CA  1 
ATOM   2399 C  C   . LYS A 1 315 ? 10.277  56.097 38.938 1.00 12.10 ? 315  LYS A C   1 
ATOM   2400 O  O   . LYS A 1 315 ? 10.718  56.575 39.978 1.00 14.77 ? 315  LYS A O   1 
ATOM   2401 C  CB  . LYS A 1 315 ? 7.860   56.574 39.238 1.00 6.83  ? 315  LYS A CB  1 
ATOM   2402 C  CG  . LYS A 1 315 ? 7.850   57.724 38.265 1.00 10.27 ? 315  LYS A CG  1 
ATOM   2403 C  CD  . LYS A 1 315 ? 6.877   58.804 38.668 1.00 8.38  ? 315  LYS A CD  1 
ATOM   2404 C  CE  . LYS A 1 315 ? 6.966   59.980 37.721 1.00 9.48  ? 315  LYS A CE  1 
ATOM   2405 N  NZ  . LYS A 1 315 ? 6.617   59.618 36.324 1.00 6.12  ? 315  LYS A NZ  1 
ATOM   2406 N  N   . LYS A 1 316 ? 10.991  56.051 37.821 1.00 13.72 ? 316  LYS A N   1 
ATOM   2407 C  CA  . LYS A 1 316 ? 12.324  56.644 37.783 1.00 13.91 ? 316  LYS A CA  1 
ATOM   2408 C  C   . LYS A 1 316 ? 12.240  58.107 37.352 1.00 15.46 ? 316  LYS A C   1 
ATOM   2409 O  O   . LYS A 1 316 ? 11.861  58.422 36.226 1.00 17.60 ? 316  LYS A O   1 
ATOM   2410 C  CB  . LYS A 1 316 ? 13.269  55.877 36.861 1.00 11.37 ? 316  LYS A CB  1 
ATOM   2411 C  CG  . LYS A 1 316 ? 13.661  54.514 37.361 1.00 10.33 ? 316  LYS A CG  1 
ATOM   2412 C  CD  . LYS A 1 316 ? 12.652  53.480 36.974 1.00 11.43 ? 316  LYS A CD  1 
ATOM   2413 C  CE  . LYS A 1 316 ? 13.163  52.111 37.325 1.00 16.88 ? 316  LYS A CE  1 
ATOM   2414 N  NZ  . LYS A 1 316 ? 12.209  51.047 36.916 1.00 22.10 ? 316  LYS A NZ  1 
ATOM   2415 N  N   . THR A 1 317 ? 12.586  58.998 38.266 1.00 15.57 ? 317  THR A N   1 
ATOM   2416 C  CA  . THR A 1 317 ? 12.558  60.419 38.010 1.00 14.89 ? 317  THR A CA  1 
ATOM   2417 C  C   . THR A 1 317 ? 13.580  61.003 38.956 1.00 15.83 ? 317  THR A C   1 
ATOM   2418 O  O   . THR A 1 317 ? 14.394  60.269 39.511 1.00 17.72 ? 317  THR A O   1 
ATOM   2419 C  CB  . THR A 1 317 ? 11.175  61.022 38.298 1.00 16.08 ? 317  THR A CB  1 
ATOM   2420 O  OG1 . THR A 1 317 ? 11.183  62.412 37.965 1.00 14.92 ? 317  THR A OG1 1 
ATOM   2421 C  CG2 . THR A 1 317 ? 10.819  60.875 39.760 1.00 16.24 ? 317  THR A CG2 1 
ATOM   2422 N  N   . GLN A 1 318 ? 13.589  62.317 39.086 1.00 14.30 ? 318  GLN A N   1 
ATOM   2423 C  CA  . GLN A 1 318 ? 14.523  62.955 39.975 1.00 15.80 ? 318  GLN A CA  1 
ATOM   2424 C  C   . GLN A 1 318 ? 13.764  63.297 41.234 1.00 18.21 ? 318  GLN A C   1 
ATOM   2425 O  O   . GLN A 1 318 ? 12.626  63.777 41.164 1.00 18.79 ? 318  GLN A O   1 
ATOM   2426 C  CB  . GLN A 1 318 ? 15.110  64.220 39.345 1.00 17.56 ? 318  GLN A CB  1 
ATOM   2427 C  CG  . GLN A 1 318 ? 14.177  64.960 38.408 1.00 19.90 ? 318  GLN A CG  1 
ATOM   2428 C  CD  . GLN A 1 318 ? 14.112  64.325 37.034 1.00 22.49 ? 318  GLN A CD  1 
ATOM   2429 O  OE1 . GLN A 1 318 ? 13.053  64.264 36.404 1.00 23.33 ? 318  GLN A OE1 1 
ATOM   2430 N  NE2 . GLN A 1 318 ? 15.253  63.850 36.553 1.00 25.71 ? 318  GLN A NE2 1 
ATOM   2431 N  N   . ILE A 1 319 ? 14.358  62.987 42.382 1.00 17.55 ? 319  ILE A N   1 
ATOM   2432 C  CA  . ILE A 1 319 ? 13.740  63.293 43.662 1.00 15.93 ? 319  ILE A CA  1 
ATOM   2433 C  C   . ILE A 1 319 ? 14.701  64.103 44.507 1.00 15.31 ? 319  ILE A C   1 
ATOM   2434 O  O   . ILE A 1 319 ? 15.907  63.861 44.506 1.00 15.43 ? 319  ILE A O   1 
ATOM   2435 C  CB  . ILE A 1 319 ? 13.341  62.036 44.465 1.00 14.60 ? 319  ILE A CB  1 
ATOM   2436 C  CG1 . ILE A 1 319 ? 14.554  61.151 44.707 1.00 16.00 ? 319  ILE A CG1 1 
ATOM   2437 C  CG2 . ILE A 1 319 ? 12.241  61.276 43.772 1.00 12.90 ? 319  ILE A CG2 1 
ATOM   2438 C  CD1 . ILE A 1 319 ? 14.258  60.004 45.634 1.00 19.85 ? 319  ILE A CD1 1 
ATOM   2439 N  N   . LEU A 1 320 ? 14.160  65.094 45.193 1.00 13.49 ? 320  LEU A N   1 
ATOM   2440 C  CA  . LEU A 1 320 ? 14.941  65.937 46.071 1.00 13.66 ? 320  LEU A CA  1 
ATOM   2441 C  C   . LEU A 1 320 ? 14.382  65.573 47.437 1.00 15.15 ? 320  LEU A C   1 
ATOM   2442 O  O   . LEU A 1 320 ? 13.207  65.813 47.726 1.00 16.43 ? 320  LEU A O   1 
ATOM   2443 C  CB  . LEU A 1 320 ? 14.690  67.404 45.735 1.00 12.51 ? 320  LEU A CB  1 
ATOM   2444 C  CG  . LEU A 1 320 ? 15.548  68.468 46.398 1.00 12.06 ? 320  LEU A CG  1 
ATOM   2445 C  CD1 . LEU A 1 320 ? 15.414  69.758 45.638 1.00 9.93  ? 320  LEU A CD1 1 
ATOM   2446 C  CD2 . LEU A 1 320 ? 15.121  68.644 47.835 1.00 15.81 ? 320  LEU A CD2 1 
ATOM   2447 N  N   . LEU A 1 321 ? 15.197  64.908 48.242 1.00 15.67 ? 321  LEU A N   1 
ATOM   2448 C  CA  . LEU A 1 321 ? 14.773  64.471 49.559 1.00 14.82 ? 321  LEU A CA  1 
ATOM   2449 C  C   . LEU A 1 321 ? 15.802  64.847 50.614 1.00 16.31 ? 321  LEU A C   1 
ATOM   2450 O  O   . LEU A 1 321 ? 16.959  65.145 50.302 1.00 15.47 ? 321  LEU A O   1 
ATOM   2451 C  CB  . LEU A 1 321 ? 14.510  62.960 49.562 1.00 11.23 ? 321  LEU A CB  1 
ATOM   2452 C  CG  . LEU A 1 321 ? 15.646  61.941 49.480 1.00 10.03 ? 321  LEU A CG  1 
ATOM   2453 C  CD1 . LEU A 1 321 ? 15.047  60.584 49.253 1.00 13.08 ? 321  LEU A CD1 1 
ATOM   2454 C  CD2 . LEU A 1 321 ? 16.596  62.249 48.361 1.00 13.32 ? 321  LEU A CD2 1 
ATOM   2455 N  N   . GLY A 1 322 ? 15.367  64.878 51.864 1.00 16.88 ? 322  GLY A N   1 
ATOM   2456 C  CA  . GLY A 1 322 ? 16.279  65.232 52.922 1.00 17.09 ? 322  GLY A CA  1 
ATOM   2457 C  C   . GLY A 1 322 ? 15.668  65.002 54.269 1.00 16.72 ? 322  GLY A C   1 
ATOM   2458 O  O   . GLY A 1 322 ? 14.482  64.734 54.378 1.00 15.75 ? 322  GLY A O   1 
ATOM   2459 N  N   . VAL A 1 323 ? 16.477  65.201 55.296 1.00 18.39 ? 323  VAL A N   1 
ATOM   2460 C  CA  . VAL A 1 323 ? 16.073  64.980 56.665 1.00 17.87 ? 323  VAL A CA  1 
ATOM   2461 C  C   . VAL A 1 323 ? 16.531  66.176 57.512 1.00 17.71 ? 323  VAL A C   1 
ATOM   2462 O  O   . VAL A 1 323 ? 17.255  67.037 57.022 1.00 19.73 ? 323  VAL A O   1 
ATOM   2463 C  CB  . VAL A 1 323 ? 16.729  63.681 57.142 1.00 17.28 ? 323  VAL A CB  1 
ATOM   2464 C  CG1 . VAL A 1 323 ? 18.159  63.925 57.551 1.00 19.23 ? 323  VAL A CG1 1 
ATOM   2465 C  CG2 . VAL A 1 323 ? 15.941  63.069 58.230 1.00 23.51 ? 323  VAL A CG2 1 
ATOM   2466 N  N   . ASN A 1 324 ? 16.055  66.280 58.748 1.00 18.19 ? 324  ASN A N   1 
ATOM   2467 C  CA  . ASN A 1 324 ? 16.458  67.385 59.618 1.00 17.86 ? 324  ASN A CA  1 
ATOM   2468 C  C   . ASN A 1 324 ? 17.342  66.835 60.701 1.00 18.02 ? 324  ASN A C   1 
ATOM   2469 O  O   . ASN A 1 324 ? 17.172  65.691 61.114 1.00 20.14 ? 324  ASN A O   1 
ATOM   2470 C  CB  . ASN A 1 324 ? 15.260  68.080 60.259 1.00 17.86 ? 324  ASN A CB  1 
ATOM   2471 C  CG  . ASN A 1 324 ? 14.468  68.886 59.282 1.00 19.48 ? 324  ASN A CG  1 
ATOM   2472 O  OD1 . ASN A 1 324 ? 13.926  69.928 59.626 1.00 22.39 ? 324  ASN A OD1 1 
ATOM   2473 N  ND2 . ASN A 1 324 ? 14.390  68.415 58.048 1.00 23.86 ? 324  ASN A ND2 1 
ATOM   2474 N  N   . LYS A 1 325 ? 18.228  67.678 61.215 1.00 18.14 ? 325  LYS A N   1 
ATOM   2475 C  CA  . LYS A 1 325 ? 19.169  67.267 62.249 1.00 21.30 ? 325  LYS A CA  1 
ATOM   2476 C  C   . LYS A 1 325 ? 18.534  66.491 63.393 1.00 21.88 ? 325  LYS A C   1 
ATOM   2477 O  O   . LYS A 1 325 ? 18.957  65.376 63.712 1.00 23.81 ? 325  LYS A O   1 
ATOM   2478 C  CB  . LYS A 1 325 ? 19.920  68.480 62.805 1.00 23.14 ? 325  LYS A CB  1 
ATOM   2479 C  CG  . LYS A 1 325 ? 21.262  68.117 63.413 1.00 27.30 ? 325  LYS A CG  1 
ATOM   2480 C  CD  . LYS A 1 325 ? 22.089  69.349 63.802 1.00 32.12 ? 325  LYS A CD  1 
ATOM   2481 C  CE  . LYS A 1 325 ? 21.887  69.753 65.264 1.00 35.07 ? 325  LYS A CE  1 
ATOM   2482 N  NZ  . LYS A 1 325 ? 20.505  70.250 65.563 1.00 36.56 ? 325  LYS A NZ  1 
ATOM   2483 N  N   . ASP A 1 326 ? 17.496  67.064 63.986 1.00 21.59 ? 326  ASP A N   1 
ATOM   2484 C  CA  . ASP A 1 326 ? 16.839  66.428 65.110 1.00 20.52 ? 326  ASP A CA  1 
ATOM   2485 C  C   . ASP A 1 326 ? 15.435  65.972 64.776 1.00 20.56 ? 326  ASP A C   1 
ATOM   2486 O  O   . ASP A 1 326 ? 14.443  66.644 65.060 1.00 22.20 ? 326  ASP A O   1 
ATOM   2487 C  CB  . ASP A 1 326 ? 16.836  67.374 66.302 1.00 19.84 ? 326  ASP A CB  1 
ATOM   2488 C  CG  . ASP A 1 326 ? 18.204  67.958 66.572 1.00 20.84 ? 326  ASP A CG  1 
ATOM   2489 O  OD1 . ASP A 1 326 ? 18.327  69.194 66.541 1.00 19.33 ? 326  ASP A OD1 1 
ATOM   2490 O  OD2 . ASP A 1 326 ? 19.160  67.184 66.795 1.00 22.66 ? 326  ASP A OD2 1 
ATOM   2491 N  N   . GLU A 1 327 ? 15.359  64.810 64.160 1.00 20.30 ? 327  GLU A N   1 
ATOM   2492 C  CA  . GLU A 1 327 ? 14.085  64.252 63.793 1.00 20.03 ? 327  GLU A CA  1 
ATOM   2493 C  C   . GLU A 1 327 ? 13.313  63.739 64.995 1.00 19.66 ? 327  GLU A C   1 
ATOM   2494 O  O   . GLU A 1 327 ? 12.129  64.042 65.146 1.00 21.92 ? 327  GLU A O   1 
ATOM   2495 C  CB  . GLU A 1 327 ? 14.293  63.118 62.797 1.00 21.71 ? 327  GLU A CB  1 
ATOM   2496 C  CG  . GLU A 1 327 ? 14.796  63.586 61.463 1.00 20.86 ? 327  GLU A CG  1 
ATOM   2497 C  CD  . GLU A 1 327 ? 13.766  64.408 60.747 1.00 18.76 ? 327  GLU A CD  1 
ATOM   2498 O  OE1 . GLU A 1 327 ? 12.717  63.872 60.363 1.00 19.17 ? 327  GLU A OE1 1 
ATOM   2499 O  OE2 . GLU A 1 327 ? 13.993  65.603 60.588 1.00 20.67 ? 327  GLU A OE2 1 
ATOM   2500 N  N   . GLY A 1 328 ? 13.988  62.999 65.867 1.00 17.57 ? 328  GLY A N   1 
ATOM   2501 C  CA  . GLY A 1 328 ? 13.318  62.416 67.018 1.00 16.59 ? 328  GLY A CA  1 
ATOM   2502 C  C   . GLY A 1 328 ? 12.874  63.271 68.197 1.00 15.55 ? 328  GLY A C   1 
ATOM   2503 O  O   . GLY A 1 328 ? 11.934  62.887 68.900 1.00 16.86 ? 328  GLY A O   1 
ATOM   2504 N  N   . SER A 1 329 ? 13.494  64.430 68.401 1.00 13.21 ? 329  SER A N   1 
ATOM   2505 C  CA  . SER A 1 329 ? 13.166  65.283 69.531 1.00 11.53 ? 329  SER A CA  1 
ATOM   2506 C  C   . SER A 1 329 ? 11.689  65.427 69.825 1.00 14.67 ? 329  SER A C   1 
ATOM   2507 O  O   . SER A 1 329 ? 11.251  65.178 70.943 1.00 19.37 ? 329  SER A O   1 
ATOM   2508 C  CB  . SER A 1 329 ? 13.814  66.650 69.379 1.00 9.79  ? 329  SER A CB  1 
ATOM   2509 O  OG  . SER A 1 329 ? 13.495  67.244 68.141 1.00 10.73 ? 329  SER A OG  1 
ATOM   2510 N  N   . PHE A 1 330 ? 10.906  65.743 68.809 1.00 15.74 ? 330  PHE A N   1 
ATOM   2511 C  CA  . PHE A 1 330 ? 9.470   65.934 68.981 1.00 16.75 ? 330  PHE A CA  1 
ATOM   2512 C  C   . PHE A 1 330 ? 8.734   64.711 69.512 1.00 17.21 ? 330  PHE A C   1 
ATOM   2513 O  O   . PHE A 1 330 ? 7.787   64.836 70.291 1.00 18.30 ? 330  PHE A O   1 
ATOM   2514 C  CB  . PHE A 1 330 ? 8.856   66.350 67.655 1.00 17.81 ? 330  PHE A CB  1 
ATOM   2515 C  CG  . PHE A 1 330 ? 7.470   66.886 67.769 1.00 18.29 ? 330  PHE A CG  1 
ATOM   2516 C  CD1 . PHE A 1 330 ? 6.375   66.037 67.661 1.00 19.09 ? 330  PHE A CD1 1 
ATOM   2517 C  CD2 . PHE A 1 330 ? 7.258   68.251 67.909 1.00 18.86 ? 330  PHE A CD2 1 
ATOM   2518 C  CE1 . PHE A 1 330 ? 5.084   66.537 67.683 1.00 20.78 ? 330  PHE A CE1 1 
ATOM   2519 C  CE2 . PHE A 1 330 ? 5.976   68.768 67.932 1.00 19.51 ? 330  PHE A CE2 1 
ATOM   2520 C  CZ  . PHE A 1 330 ? 4.881   67.910 67.817 1.00 22.20 ? 330  PHE A CZ  1 
ATOM   2521 N  N   . PHE A 1 331 ? 9.170   63.528 69.103 1.00 15.78 ? 331  PHE A N   1 
ATOM   2522 C  CA  . PHE A 1 331 ? 8.505   62.312 69.527 1.00 15.92 ? 331  PHE A CA  1 
ATOM   2523 C  C   . PHE A 1 331 ? 8.892   61.875 70.918 1.00 16.47 ? 331  PHE A C   1 
ATOM   2524 O  O   . PHE A 1 331 ? 8.090   61.280 71.640 1.00 18.89 ? 331  PHE A O   1 
ATOM   2525 C  CB  . PHE A 1 331 ? 8.720   61.232 68.484 1.00 15.28 ? 331  PHE A CB  1 
ATOM   2526 C  CG  . PHE A 1 331 ? 8.250   61.654 67.134 1.00 17.06 ? 331  PHE A CG  1 
ATOM   2527 C  CD1 . PHE A 1 331 ? 9.046   62.471 66.338 1.00 18.77 ? 331  PHE A CD1 1 
ATOM   2528 C  CD2 . PHE A 1 331 ? 6.964   61.354 66.710 1.00 16.37 ? 331  PHE A CD2 1 
ATOM   2529 C  CE1 . PHE A 1 331 ? 8.565   62.985 65.155 1.00 16.35 ? 331  PHE A CE1 1 
ATOM   2530 C  CE2 . PHE A 1 331 ? 6.474   61.865 65.525 1.00 15.21 ? 331  PHE A CE2 1 
ATOM   2531 C  CZ  . PHE A 1 331 ? 7.271   62.682 64.749 1.00 16.90 ? 331  PHE A CZ  1 
ATOM   2532 N  N   . LEU A 1 332 ? 10.112  62.197 71.316 1.00 13.85 ? 332  LEU A N   1 
ATOM   2533 C  CA  . LEU A 1 332 ? 10.557  61.860 72.651 1.00 11.14 ? 332  LEU A CA  1 
ATOM   2534 C  C   . LEU A 1 332 ? 9.779   62.770 73.595 1.00 11.65 ? 332  LEU A C   1 
ATOM   2535 O  O   . LEU A 1 332 ? 8.967   62.302 74.379 1.00 12.58 ? 332  LEU A O   1 
ATOM   2536 C  CB  . LEU A 1 332 ? 12.053  62.095 72.773 1.00 6.77  ? 332  LEU A CB  1 
ATOM   2537 C  CG  . LEU A 1 332 ? 12.893  61.101 72.000 1.00 2.01  ? 332  LEU A CG  1 
ATOM   2538 C  CD1 . LEU A 1 332 ? 14.291  61.598 71.970 1.00 2.00  ? 332  LEU A CD1 1 
ATOM   2539 C  CD2 . LEU A 1 332 ? 12.796  59.737 72.638 1.00 2.02  ? 332  LEU A CD2 1 
ATOM   2540 N  N   . LEU A 1 333 ? 9.938   64.077 73.412 1.00 12.17 ? 333  LEU A N   1 
ATOM   2541 C  CA  . LEU A 1 333 ? 9.264   65.092 74.218 1.00 11.85 ? 333  LEU A CA  1 
ATOM   2542 C  C   . LEU A 1 333 ? 7.795   64.807 74.475 1.00 11.35 ? 333  LEU A C   1 
ATOM   2543 O  O   . LEU A 1 333 ? 7.244   65.266 75.464 1.00 14.38 ? 333  LEU A O   1 
ATOM   2544 C  CB  . LEU A 1 333 ? 9.412   66.456 73.536 1.00 15.83 ? 333  LEU A CB  1 
ATOM   2545 C  CG  . LEU A 1 333 ? 8.744   67.755 74.011 1.00 16.47 ? 333  LEU A CG  1 
ATOM   2546 C  CD1 . LEU A 1 333 ? 7.297   67.824 73.607 1.00 14.64 ? 333  LEU A CD1 1 
ATOM   2547 C  CD2 . LEU A 1 333 ? 8.912   67.921 75.482 1.00 14.61 ? 333  LEU A CD2 1 
ATOM   2548 N  N   . TYR A 1 334 ? 7.158   64.079 73.569 1.00 12.84 ? 334  TYR A N   1 
ATOM   2549 C  CA  . TYR A 1 334 ? 5.745   63.750 73.699 1.00 12.13 ? 334  TYR A CA  1 
ATOM   2550 C  C   . TYR A 1 334 ? 5.452   62.379 74.273 1.00 12.96 ? 334  TYR A C   1 
ATOM   2551 O  O   . TYR A 1 334 ? 4.432   62.194 74.927 1.00 17.63 ? 334  TYR A O   1 
ATOM   2552 C  CB  . TYR A 1 334 ? 5.060   63.827 72.343 1.00 9.25  ? 334  TYR A CB  1 
ATOM   2553 C  CG  . TYR A 1 334 ? 4.541   65.179 71.971 1.00 8.30  ? 334  TYR A CG  1 
ATOM   2554 C  CD1 . TYR A 1 334 ? 5.408   66.206 71.616 1.00 9.79  ? 334  TYR A CD1 1 
ATOM   2555 C  CD2 . TYR A 1 334 ? 3.173   65.421 71.922 1.00 8.41  ? 334  TYR A CD2 1 
ATOM   2556 C  CE1 . TYR A 1 334 ? 4.922   67.445 71.216 1.00 11.69 ? 334  TYR A CE1 1 
ATOM   2557 C  CE2 . TYR A 1 334 ? 2.675   66.649 71.522 1.00 9.55  ? 334  TYR A CE2 1 
ATOM   2558 C  CZ  . TYR A 1 334 ? 3.551   67.657 71.167 1.00 11.78 ? 334  TYR A CZ  1 
ATOM   2559 O  OH  . TYR A 1 334 ? 3.052   68.861 70.729 1.00 13.87 ? 334  TYR A OH  1 
ATOM   2560 N  N   . GLY A 1 335 ? 6.306   61.404 74.002 1.00 11.46 ? 335  GLY A N   1 
ATOM   2561 C  CA  . GLY A 1 335 ? 6.019   60.075 74.491 1.00 10.85 ? 335  GLY A CA  1 
ATOM   2562 C  C   . GLY A 1 335 ? 7.122   59.368 75.222 1.00 11.61 ? 335  GLY A C   1 
ATOM   2563 O  O   . GLY A 1 335 ? 6.975   58.203 75.552 1.00 15.44 ? 335  GLY A O   1 
ATOM   2564 N  N   . ALA A 1 336 ? 8.229   60.049 75.463 1.00 10.45 ? 336  ALA A N   1 
ATOM   2565 C  CA  . ALA A 1 336 ? 9.334   59.449 76.184 1.00 11.58 ? 336  ALA A CA  1 
ATOM   2566 C  C   . ALA A 1 336 ? 9.441   60.181 77.513 1.00 13.45 ? 336  ALA A C   1 
ATOM   2567 O  O   . ALA A 1 336 ? 9.299   61.404 77.573 1.00 14.88 ? 336  ALA A O   1 
ATOM   2568 C  CB  . ALA A 1 336 ? 10.618  59.577 75.404 1.00 9.75  ? 336  ALA A CB  1 
ATOM   2569 N  N   . PRO A 1 337 ? 9.645   59.436 78.605 1.00 13.55 ? 337  PRO A N   1 
ATOM   2570 C  CA  . PRO A 1 337 ? 9.768   59.997 79.947 1.00 14.47 ? 337  PRO A CA  1 
ATOM   2571 C  C   . PRO A 1 337 ? 11.084  60.737 80.151 1.00 15.31 ? 337  PRO A C   1 
ATOM   2572 O  O   . PRO A 1 337 ? 12.117  60.353 79.611 1.00 15.93 ? 337  PRO A O   1 
ATOM   2573 C  CB  . PRO A 1 337 ? 9.714   58.756 80.818 1.00 17.01 ? 337  PRO A CB  1 
ATOM   2574 C  CG  . PRO A 1 337 ? 10.421  57.749 79.972 1.00 16.39 ? 337  PRO A CG  1 
ATOM   2575 C  CD  . PRO A 1 337 ? 9.774   57.972 78.645 1.00 14.17 ? 337  PRO A CD  1 
ATOM   2576 N  N   . GLY A 1 338 ? 11.043  61.796 80.946 1.00 13.64 ? 338  GLY A N   1 
ATOM   2577 C  CA  . GLY A 1 338 ? 12.255  62.537 81.212 1.00 13.89 ? 338  GLY A CA  1 
ATOM   2578 C  C   . GLY A 1 338 ? 12.363  63.770 80.359 1.00 15.49 ? 338  GLY A C   1 
ATOM   2579 O  O   . GLY A 1 338 ? 13.133  64.690 80.667 1.00 18.85 ? 338  GLY A O   1 
ATOM   2580 N  N   . PHE A 1 339 ? 11.639  63.782 79.253 1.00 13.14 ? 339  PHE A N   1 
ATOM   2581 C  CA  . PHE A 1 339 ? 11.674  64.941 78.388 1.00 10.73 ? 339  PHE A CA  1 
ATOM   2582 C  C   . PHE A 1 339 ? 10.504  65.803 78.793 1.00 12.03 ? 339  PHE A C   1 
ATOM   2583 O  O   . PHE A 1 339 ? 9.442   65.293 79.136 1.00 14.30 ? 339  PHE A O   1 
ATOM   2584 C  CB  . PHE A 1 339 ? 11.550  64.522 76.935 1.00 8.69  ? 339  PHE A CB  1 
ATOM   2585 C  CG  . PHE A 1 339 ? 12.630  63.607 76.485 1.00 3.60  ? 339  PHE A CG  1 
ATOM   2586 C  CD1 . PHE A 1 339 ? 12.494  62.233 76.632 1.00 3.53  ? 339  PHE A CD1 1 
ATOM   2587 C  CD2 . PHE A 1 339 ? 13.786  64.112 75.915 1.00 2.87  ? 339  PHE A CD2 1 
ATOM   2588 C  CE1 . PHE A 1 339 ? 13.499  61.376 76.215 1.00 3.95  ? 339  PHE A CE1 1 
ATOM   2589 C  CE2 . PHE A 1 339 ? 14.789  63.273 75.496 1.00 2.01  ? 339  PHE A CE2 1 
ATOM   2590 C  CZ  . PHE A 1 339 ? 14.646  61.900 75.646 1.00 4.66  ? 339  PHE A CZ  1 
ATOM   2591 N  N   . SER A 1 340 ? 10.700  67.107 78.779 1.00 11.61 ? 340  SER A N   1 
ATOM   2592 C  CA  . SER A 1 340 ? 9.652   68.032 79.154 1.00 13.36 ? 340  SER A CA  1 
ATOM   2593 C  C   . SER A 1 340 ? 9.931   69.287 78.357 1.00 13.16 ? 340  SER A C   1 
ATOM   2594 O  O   . SER A 1 340 ? 11.083  69.642 78.131 1.00 14.73 ? 340  SER A O   1 
ATOM   2595 C  CB  . SER A 1 340 ? 9.731   68.337 80.654 1.00 16.51 ? 340  SER A CB  1 
ATOM   2596 O  OG  . SER A 1 340 ? 10.037  67.171 81.411 1.00 18.82 ? 340  SER A OG  1 
ATOM   2597 N  N   . LYS A 1 341 ? 8.883   69.946 77.898 1.00 11.58 ? 341  LYS A N   1 
ATOM   2598 C  CA  . LYS A 1 341 ? 9.061   71.140 77.115 1.00 12.34 ? 341  LYS A CA  1 
ATOM   2599 C  C   . LYS A 1 341 ? 9.830   72.182 77.897 1.00 15.62 ? 341  LYS A C   1 
ATOM   2600 O  O   . LYS A 1 341 ? 10.755  72.793 77.379 1.00 18.24 ? 341  LYS A O   1 
ATOM   2601 C  CB  . LYS A 1 341 ? 7.707   71.707 76.692 1.00 13.08 ? 341  LYS A CB  1 
ATOM   2602 C  CG  . LYS A 1 341 ? 7.801   73.071 76.029 1.00 13.13 ? 341  LYS A CG  1 
ATOM   2603 C  CD  . LYS A 1 341 ? 6.465   73.524 75.518 1.00 13.77 ? 341  LYS A CD  1 
ATOM   2604 C  CE  . LYS A 1 341 ? 5.519   73.882 76.638 1.00 16.24 ? 341  LYS A CE  1 
ATOM   2605 N  NZ  . LYS A 1 341 ? 5.901   75.157 77.284 1.00 17.79 ? 341  LYS A NZ  1 
ATOM   2606 N  N   . ASP A 1 342 ? 9.496   72.331 79.174 1.00 18.76 ? 342  ASP A N   1 
ATOM   2607 C  CA  . ASP A 1 342 ? 10.124  73.351 79.997 1.00 16.96 ? 342  ASP A CA  1 
ATOM   2608 C  C   . ASP A 1 342 ? 11.448  73.061 80.689 1.00 15.69 ? 342  ASP A C   1 
ATOM   2609 O  O   . ASP A 1 342 ? 11.969  73.933 81.381 1.00 16.29 ? 342  ASP A O   1 
ATOM   2610 C  CB  . ASP A 1 342 ? 9.109   73.867 80.992 1.00 21.05 ? 342  ASP A CB  1 
ATOM   2611 C  CG  . ASP A 1 342 ? 7.813   74.274 80.329 1.00 25.00 ? 342  ASP A CG  1 
ATOM   2612 O  OD1 . ASP A 1 342 ? 7.827   75.243 79.549 1.00 27.31 ? 342  ASP A OD1 1 
ATOM   2613 O  OD2 . ASP A 1 342 ? 6.780   73.618 80.575 1.00 30.88 ? 342  ASP A OD2 1 
ATOM   2614 N  N   . SER A 1 343 ? 12.011  71.872 80.484 1.00 13.15 ? 343  SER A N   1 
ATOM   2615 C  CA  . SER A 1 343 ? 13.282  71.518 81.106 1.00 13.38 ? 343  SER A CA  1 
ATOM   2616 C  C   . SER A 1 343 ? 14.304  71.070 80.085 1.00 14.43 ? 343  SER A C   1 
ATOM   2617 O  O   . SER A 1 343 ? 13.961  70.551 79.036 1.00 17.99 ? 343  SER A O   1 
ATOM   2618 C  CB  . SER A 1 343 ? 13.090  70.406 82.128 1.00 14.36 ? 343  SER A CB  1 
ATOM   2619 O  OG  . SER A 1 343 ? 12.678  69.205 81.506 1.00 18.36 ? 343  SER A OG  1 
ATOM   2620 N  N   . GLU A 1 344 ? 15.572  71.161 80.443 1.00 15.55 ? 344  GLU A N   1 
ATOM   2621 C  CA  . GLU A 1 344 ? 16.641  70.769 79.540 1.00 14.90 ? 344  GLU A CA  1 
ATOM   2622 C  C   . GLU A 1 344 ? 16.542  69.285 79.227 1.00 16.36 ? 344  GLU A C   1 
ATOM   2623 O  O   . GLU A 1 344 ? 17.351  68.754 78.484 1.00 18.37 ? 344  GLU A O   1 
ATOM   2624 C  CB  . GLU A 1 344 ? 17.994  71.089 80.178 1.00 14.55 ? 344  GLU A CB  1 
ATOM   2625 C  CG  . GLU A 1 344 ? 19.153  71.197 79.208 1.00 16.41 ? 344  GLU A CG  1 
ATOM   2626 N  N   . SER A 1 345 ? 15.571  68.612 79.829 1.00 16.96 ? 345  SER A N   1 
ATOM   2627 C  CA  . SER A 1 345 ? 15.365  67.189 79.619 1.00 18.46 ? 345  SER A CA  1 
ATOM   2628 C  C   . SER A 1 345 ? 16.662  66.396 79.572 1.00 19.10 ? 345  SER A C   1 
ATOM   2629 O  O   . SER A 1 345 ? 16.978  65.768 78.567 1.00 19.72 ? 345  SER A O   1 
ATOM   2630 C  CB  . SER A 1 345 ? 14.547  66.955 78.353 1.00 19.28 ? 345  SER A CB  1 
ATOM   2631 O  OG  . SER A 1 345 ? 13.302  67.632 78.433 1.00 21.16 ? 345  SER A OG  1 
ATOM   2632 N  N   . LYS A 1 346 ? 17.423  66.456 80.662 1.00 20.06 ? 346  LYS A N   1 
ATOM   2633 C  CA  . LYS A 1 346 ? 18.681  65.728 80.764 1.00 21.59 ? 346  LYS A CA  1 
ATOM   2634 C  C   . LYS A 1 346 ? 18.349  64.302 81.188 1.00 21.62 ? 346  LYS A C   1 
ATOM   2635 O  O   . LYS A 1 346 ? 18.486  63.944 82.356 1.00 25.23 ? 346  LYS A O   1 
ATOM   2636 C  CB  . LYS A 1 346 ? 19.612  66.370 81.806 1.00 22.47 ? 346  LYS A CB  1 
ATOM   2637 C  CG  . LYS A 1 346 ? 20.040  67.806 81.508 1.00 24.85 ? 346  LYS A CG  1 
ATOM   2638 C  CD  . LYS A 1 346 ? 21.211  68.240 82.398 1.00 27.95 ? 346  LYS A CD  1 
ATOM   2639 C  CE  . LYS A 1 346 ? 21.347  69.772 82.482 1.00 31.47 ? 346  LYS A CE  1 
ATOM   2640 N  NZ  . LYS A 1 346 ? 21.612  70.462 81.176 1.00 28.94 ? 346  LYS A NZ  1 
ATOM   2641 N  N   . ILE A 1 347 ? 17.877  63.503 80.243 1.00 21.72 ? 347  ILE A N   1 
ATOM   2642 C  CA  . ILE A 1 347 ? 17.505  62.120 80.508 1.00 19.61 ? 347  ILE A CA  1 
ATOM   2643 C  C   . ILE A 1 347 ? 18.533  61.291 81.259 1.00 20.39 ? 347  ILE A C   1 
ATOM   2644 O  O   . ILE A 1 347 ? 19.710  61.231 80.904 1.00 19.53 ? 347  ILE A O   1 
ATOM   2645 C  CB  . ILE A 1 347 ? 17.071  61.404 79.204 1.00 17.84 ? 347  ILE A CB  1 
ATOM   2646 C  CG1 . ILE A 1 347 ? 15.576  61.571 79.025 1.00 15.57 ? 347  ILE A CG1 1 
ATOM   2647 C  CG2 . ILE A 1 347 ? 17.417  59.944 79.216 1.00 16.59 ? 347  ILE A CG2 1 
ATOM   2648 C  CD1 . ILE A 1 347 ? 15.174  62.996 79.014 1.00 18.22 ? 347  ILE A CD1 1 
ATOM   2649 N  N   . SER A 1 348 ? 18.055  60.671 82.326 1.00 23.66 ? 348  SER A N   1 
ATOM   2650 C  CA  . SER A 1 348 ? 18.868  59.806 83.165 1.00 25.55 ? 348  SER A CA  1 
ATOM   2651 C  C   . SER A 1 348 ? 19.092  58.529 82.394 1.00 26.70 ? 348  SER A C   1 
ATOM   2652 O  O   . SER A 1 348 ? 18.363  58.224 81.445 1.00 28.15 ? 348  SER A O   1 
ATOM   2653 C  CB  . SER A 1 348 ? 18.100  59.436 84.434 1.00 26.52 ? 348  SER A CB  1 
ATOM   2654 O  OG  . SER A 1 348 ? 16.957  58.646 84.114 1.00 25.59 ? 348  SER A OG  1 
ATOM   2655 N  N   . ARG A 1 349 ? 20.026  57.727 82.874 1.00 28.18 ? 349  ARG A N   1 
ATOM   2656 C  CA  . ARG A 1 349 ? 20.308  56.460 82.234 1.00 30.06 ? 349  ARG A CA  1 
ATOM   2657 C  C   . ARG A 1 349 ? 19.092  55.537 82.362 1.00 29.54 ? 349  ARG A C   1 
ATOM   2658 O  O   . ARG A 1 349 ? 18.599  54.996 81.373 1.00 30.90 ? 349  ARG A O   1 
ATOM   2659 C  CB  . ARG A 1 349 ? 21.531  55.820 82.878 1.00 31.45 ? 349  ARG A CB  1 
ATOM   2660 C  CG  . ARG A 1 349 ? 21.916  54.503 82.269 1.00 34.02 ? 349  ARG A CG  1 
ATOM   2661 C  CD  . ARG A 1 349 ? 22.225  54.666 80.806 1.00 35.88 ? 349  ARG A CD  1 
ATOM   2662 N  NE  . ARG A 1 349 ? 22.727  53.421 80.241 1.00 40.64 ? 349  ARG A NE  1 
ATOM   2663 C  CZ  . ARG A 1 349 ? 23.287  53.331 79.042 1.00 41.35 ? 349  ARG A CZ  1 
ATOM   2664 N  NH1 . ARG A 1 349 ? 23.405  54.424 78.291 1.00 41.34 ? 349  ARG A NH1 1 
ATOM   2665 N  NH2 . ARG A 1 349 ? 23.752  52.162 78.611 1.00 42.38 ? 349  ARG A NH2 1 
ATOM   2666 N  N   . GLU A 1 350 ? 18.546  55.435 83.564 1.00 29.80 ? 350  GLU A N   1 
ATOM   2667 C  CA  . GLU A 1 350 ? 17.401  54.562 83.791 1.00 30.07 ? 350  GLU A CA  1 
ATOM   2668 C  C   . GLU A 1 350 ? 16.296  54.891 82.796 1.00 27.82 ? 350  GLU A C   1 
ATOM   2669 O  O   . GLU A 1 350 ? 15.520  54.022 82.404 1.00 26.11 ? 350  GLU A O   1 
ATOM   2670 C  CB  . GLU A 1 350 ? 16.902  54.687 85.243 1.00 32.03 ? 350  GLU A CB  1 
ATOM   2671 C  CG  . GLU A 1 350 ? 16.035  53.520 85.724 1.00 30.84 ? 350  GLU A CG  1 
ATOM   2672 N  N   . ASP A 1 351 ? 16.255  56.137 82.350 1.00 28.02 ? 351  ASP A N   1 
ATOM   2673 C  CA  . ASP A 1 351 ? 15.242  56.524 81.383 1.00 29.46 ? 351  ASP A CA  1 
ATOM   2674 C  C   . ASP A 1 351 ? 15.733  56.430 79.950 1.00 28.44 ? 351  ASP A C   1 
ATOM   2675 O  O   . ASP A 1 351 ? 14.938  56.238 79.035 1.00 28.15 ? 351  ASP A O   1 
ATOM   2676 C  CB  . ASP A 1 351 ? 14.712  57.914 81.686 1.00 32.85 ? 351  ASP A CB  1 
ATOM   2677 C  CG  . ASP A 1 351 ? 13.868  57.941 82.937 1.00 34.85 ? 351  ASP A CG  1 
ATOM   2678 O  OD1 . ASP A 1 351 ? 13.566  59.059 83.424 1.00 37.61 ? 351  ASP A OD1 1 
ATOM   2679 O  OD2 . ASP A 1 351 ? 13.505  56.840 83.425 1.00 35.70 ? 351  ASP A OD2 1 
ATOM   2680 N  N   . PHE A 1 352 ? 17.040  56.549 79.750 1.00 26.80 ? 352  PHE A N   1 
ATOM   2681 C  CA  . PHE A 1 352 ? 17.592  56.436 78.410 1.00 24.36 ? 352  PHE A CA  1 
ATOM   2682 C  C   . PHE A 1 352 ? 17.155  55.088 77.885 1.00 24.39 ? 352  PHE A C   1 
ATOM   2683 O  O   . PHE A 1 352 ? 16.594  54.989 76.796 1.00 27.03 ? 352  PHE A O   1 
ATOM   2684 C  CB  . PHE A 1 352 ? 19.106  56.496 78.441 1.00 21.98 ? 352  PHE A CB  1 
ATOM   2685 C  CG  . PHE A 1 352 ? 19.744  56.109 77.150 1.00 22.47 ? 352  PHE A CG  1 
ATOM   2686 C  CD1 . PHE A 1 352 ? 19.716  56.970 76.063 1.00 23.51 ? 352  PHE A CD1 1 
ATOM   2687 C  CD2 . PHE A 1 352 ? 20.393  54.886 77.023 1.00 21.79 ? 352  PHE A CD2 1 
ATOM   2688 C  CE1 . PHE A 1 352 ? 20.332  56.617 74.862 1.00 25.61 ? 352  PHE A CE1 1 
ATOM   2689 C  CE2 . PHE A 1 352 ? 21.012  54.521 75.832 1.00 23.94 ? 352  PHE A CE2 1 
ATOM   2690 C  CZ  . PHE A 1 352 ? 20.983  55.386 74.748 1.00 24.03 ? 352  PHE A CZ  1 
ATOM   2691 N  N   . MET A 1 353 ? 17.344  54.056 78.703 1.00 24.89 ? 353  MET A N   1 
ATOM   2692 C  CA  . MET A 1 353 ? 16.955  52.706 78.316 1.00 23.55 ? 353  MET A CA  1 
ATOM   2693 C  C   . MET A 1 353 ? 15.431  52.568 78.177 1.00 23.42 ? 353  MET A C   1 
ATOM   2694 O  O   . MET A 1 353 ? 14.944  51.641 77.536 1.00 23.47 ? 353  MET A O   1 
ATOM   2695 C  CB  . MET A 1 353 ? 17.538  51.676 79.284 1.00 22.51 ? 353  MET A CB  1 
ATOM   2696 C  CG  . MET A 1 353 ? 19.064  51.590 79.248 1.00 17.84 ? 353  MET A CG  1 
ATOM   2697 N  N   . SER A 1 354 ? 14.678  53.481 78.781 1.00 23.49 ? 354  SER A N   1 
ATOM   2698 C  CA  . SER A 1 354 ? 13.223  53.454 78.650 1.00 24.67 ? 354  SER A CA  1 
ATOM   2699 C  C   . SER A 1 354 ? 12.969  54.077 77.275 1.00 24.78 ? 354  SER A C   1 
ATOM   2700 O  O   . SER A 1 354 ? 12.005  53.751 76.581 1.00 25.91 ? 354  SER A O   1 
ATOM   2701 C  CB  . SER A 1 354 ? 12.554  54.309 79.735 1.00 25.23 ? 354  SER A CB  1 
ATOM   2702 O  OG  . SER A 1 354 ? 12.911  53.889 81.045 1.00 28.82 ? 354  SER A OG  1 
ATOM   2703 N  N   . GLY A 1 355 ? 13.851  54.993 76.889 1.00 24.44 ? 355  GLY A N   1 
ATOM   2704 C  CA  . GLY A 1 355 ? 13.728  55.636 75.601 1.00 21.97 ? 355  GLY A CA  1 
ATOM   2705 C  C   . GLY A 1 355 ? 13.943  54.569 74.558 1.00 21.77 ? 355  GLY A C   1 
ATOM   2706 O  O   . GLY A 1 355 ? 13.016  54.239 73.822 1.00 20.38 ? 355  GLY A O   1 
ATOM   2707 N  N   . VAL A 1 356 ? 15.116  53.936 74.586 1.00 20.35 ? 356  VAL A N   1 
ATOM   2708 C  CA  . VAL A 1 356 ? 15.435  52.903 73.610 1.00 19.56 ? 356  VAL A CA  1 
ATOM   2709 C  C   . VAL A 1 356 ? 14.364  51.834 73.503 1.00 20.24 ? 356  VAL A C   1 
ATOM   2710 O  O   . VAL A 1 356 ? 14.185  51.268 72.440 1.00 23.84 ? 356  VAL A O   1 
ATOM   2711 C  CB  . VAL A 1 356 ? 16.812  52.238 73.845 1.00 17.24 ? 356  VAL A CB  1 
ATOM   2712 C  CG1 . VAL A 1 356 ? 17.871  53.287 74.132 1.00 15.91 ? 356  VAL A CG1 1 
ATOM   2713 C  CG2 . VAL A 1 356 ? 16.741  51.223 74.938 1.00 19.53 ? 356  VAL A CG2 1 
ATOM   2714 N  N   . LYS A 1 357 ? 13.637  51.569 74.582 1.00 21.62 ? 357  LYS A N   1 
ATOM   2715 C  CA  . LYS A 1 357 ? 12.589  50.560 74.525 1.00 23.24 ? 357  LYS A CA  1 
ATOM   2716 C  C   . LYS A 1 357 ? 11.484  51.108 73.637 1.00 23.08 ? 357  LYS A C   1 
ATOM   2717 O  O   . LYS A 1 357 ? 11.027  50.434 72.731 1.00 26.03 ? 357  LYS A O   1 
ATOM   2718 C  CB  . LYS A 1 357 ? 12.028  50.221 75.929 1.00 27.71 ? 357  LYS A CB  1 
ATOM   2719 C  CG  . LYS A 1 357 ? 10.951  51.209 76.483 1.00 32.21 ? 357  LYS A CG  1 
ATOM   2720 C  CD  . LYS A 1 357 ? 10.326  50.791 77.823 1.00 32.83 ? 357  LYS A CD  1 
ATOM   2721 C  CE  . LYS A 1 357 ? 9.110   49.852 77.652 1.00 32.92 ? 357  LYS A CE  1 
ATOM   2722 N  NZ  . LYS A 1 357 ? 7.914   50.527 77.056 1.00 29.37 ? 357  LYS A NZ  1 
ATOM   2723 N  N   . LEU A 1 358 ? 11.111  52.363 73.856 1.00 21.74 ? 358  LEU A N   1 
ATOM   2724 C  CA  . LEU A 1 358 ? 10.047  52.993 73.090 1.00 19.69 ? 358  LEU A CA  1 
ATOM   2725 C  C   . LEU A 1 358 ? 10.393  53.246 71.639 1.00 19.54 ? 358  LEU A C   1 
ATOM   2726 O  O   . LEU A 1 358 ? 9.527   53.173 70.783 1.00 22.39 ? 358  LEU A O   1 
ATOM   2727 C  CB  . LEU A 1 358 ? 9.647   54.310 73.736 1.00 17.41 ? 358  LEU A CB  1 
ATOM   2728 C  CG  . LEU A 1 358 ? 8.960   54.166 75.078 1.00 14.86 ? 358  LEU A CG  1 
ATOM   2729 C  CD1 . LEU A 1 358 ? 8.731   55.531 75.650 1.00 14.48 ? 358  LEU A CD1 1 
ATOM   2730 C  CD2 . LEU A 1 358 ? 7.644   53.427 74.891 1.00 15.67 ? 358  LEU A CD2 1 
ATOM   2731 N  N   . SER A 1 359 ? 11.641  53.595 71.370 1.00 19.24 ? 359  SER A N   1 
ATOM   2732 C  CA  . SER A 1 359 ? 12.078  53.876 70.014 1.00 18.41 ? 359  SER A CA  1 
ATOM   2733 C  C   . SER A 1 359 ? 12.091  52.629 69.147 1.00 18.85 ? 359  SER A C   1 
ATOM   2734 O  O   . SER A 1 359 ? 11.567  52.627 68.033 1.00 20.12 ? 359  SER A O   1 
ATOM   2735 C  CB  . SER A 1 359 ? 13.475  54.480 70.039 1.00 18.06 ? 359  SER A CB  1 
ATOM   2736 O  OG  . SER A 1 359 ? 13.531  55.568 70.944 1.00 20.79 ? 359  SER A OG  1 
ATOM   2737 N  N   . VAL A 1 360 ? 12.658  51.555 69.675 1.00 17.82 ? 360  VAL A N   1 
ATOM   2738 C  CA  . VAL A 1 360 ? 12.778  50.300 68.954 1.00 15.18 ? 360  VAL A CA  1 
ATOM   2739 C  C   . VAL A 1 360 ? 11.834  49.262 69.561 1.00 16.94 ? 360  VAL A C   1 
ATOM   2740 O  O   . VAL A 1 360 ? 12.273  48.185 69.952 1.00 18.93 ? 360  VAL A O   1 
ATOM   2741 C  CB  . VAL A 1 360 ? 14.229  49.772 69.063 1.00 14.32 ? 360  VAL A CB  1 
ATOM   2742 C  CG1 . VAL A 1 360 ? 14.530  48.842 67.933 1.00 16.60 ? 360  VAL A CG1 1 
ATOM   2743 C  CG2 . VAL A 1 360 ? 15.222  50.922 69.080 1.00 12.58 ? 360  VAL A CG2 1 
ATOM   2744 N  N   . PRO A 1 361 ? 10.510  49.504 69.495 1.00 18.07 ? 361  PRO A N   1 
ATOM   2745 C  CA  . PRO A 1 361 ? 9.505   48.592 70.053 1.00 18.94 ? 361  PRO A CA  1 
ATOM   2746 C  C   . PRO A 1 361 ? 9.520   47.166 69.553 1.00 21.40 ? 361  PRO A C   1 
ATOM   2747 O  O   . PRO A 1 361 ? 8.869   46.299 70.127 1.00 24.29 ? 361  PRO A O   1 
ATOM   2748 C  CB  . PRO A 1 361 ? 8.192   49.272 69.686 1.00 17.52 ? 361  PRO A CB  1 
ATOM   2749 C  CG  . PRO A 1 361 ? 8.505   49.908 68.405 1.00 17.87 ? 361  PRO A CG  1 
ATOM   2750 C  CD  . PRO A 1 361 ? 9.845   50.537 68.686 1.00 17.81 ? 361  PRO A CD  1 
ATOM   2751 N  N   . HIS A 1 362 ? 10.225  46.914 68.464 1.00 23.62 ? 362  HIS A N   1 
ATOM   2752 C  CA  . HIS A 1 362 ? 10.273  45.559 67.928 1.00 26.92 ? 362  HIS A CA  1 
ATOM   2753 C  C   . HIS A 1 362 ? 11.484  44.790 68.443 1.00 28.29 ? 362  HIS A C   1 
ATOM   2754 O  O   . HIS A 1 362 ? 11.455  43.562 68.591 1.00 27.85 ? 362  HIS A O   1 
ATOM   2755 C  CB  . HIS A 1 362 ? 10.278  45.600 66.395 1.00 28.53 ? 362  HIS A CB  1 
ATOM   2756 C  CG  . HIS A 1 362 ? 11.137  46.686 65.819 1.00 27.83 ? 362  HIS A CG  1 
ATOM   2757 N  ND1 . HIS A 1 362 ? 10.678  47.973 65.620 1.00 26.38 ? 362  HIS A ND1 1 
ATOM   2758 C  CD2 . HIS A 1 362 ? 12.415  46.667 65.369 1.00 27.53 ? 362  HIS A CD2 1 
ATOM   2759 C  CE1 . HIS A 1 362 ? 11.636  48.696 65.068 1.00 28.50 ? 362  HIS A CE1 1 
ATOM   2760 N  NE2 . HIS A 1 362 ? 12.699  47.928 64.905 1.00 27.33 ? 362  HIS A NE2 1 
ATOM   2761 N  N   . ALA A 1 363 ? 12.534  45.541 68.749 1.00 28.97 ? 363  ALA A N   1 
ATOM   2762 C  CA  . ALA A 1 363 ? 13.780  44.973 69.219 1.00 29.34 ? 363  ALA A CA  1 
ATOM   2763 C  C   . ALA A 1 363 ? 13.659  44.118 70.462 1.00 29.62 ? 363  ALA A C   1 
ATOM   2764 O  O   . ALA A 1 363 ? 13.036  44.509 71.449 1.00 30.14 ? 363  ALA A O   1 
ATOM   2765 C  CB  . ALA A 1 363 ? 14.789  46.079 69.473 1.00 30.36 ? 363  ALA A CB  1 
ATOM   2766 N  N   . ASN A 1 364 ? 14.283  42.951 70.405 1.00 29.62 ? 364  ASN A N   1 
ATOM   2767 C  CA  . ASN A 1 364 ? 14.312  42.057 71.544 1.00 30.00 ? 364  ASN A CA  1 
ATOM   2768 C  C   . ASN A 1 364 ? 15.422  42.631 72.414 1.00 30.28 ? 364  ASN A C   1 
ATOM   2769 O  O   . ASN A 1 364 ? 16.091  43.580 72.006 1.00 30.93 ? 364  ASN A O   1 
ATOM   2770 C  CB  . ASN A 1 364 ? 14.648  40.627 71.101 1.00 31.27 ? 364  ASN A CB  1 
ATOM   2771 C  CG  . ASN A 1 364 ? 15.799  40.570 70.120 1.00 29.99 ? 364  ASN A CG  1 
ATOM   2772 O  OD1 . ASN A 1 364 ? 16.776  41.302 70.250 1.00 31.05 ? 364  ASN A OD1 1 
ATOM   2773 N  ND2 . ASN A 1 364 ? 15.685  39.700 69.126 1.00 32.35 ? 364  ASN A ND2 1 
ATOM   2774 N  N   . ASP A 1 365 ? 15.643  42.049 73.587 1.00 30.65 ? 365  ASP A N   1 
ATOM   2775 C  CA  . ASP A 1 365 ? 16.671  42.537 74.500 1.00 29.19 ? 365  ASP A CA  1 
ATOM   2776 C  C   . ASP A 1 365 ? 17.997  42.779 73.793 1.00 28.31 ? 365  ASP A C   1 
ATOM   2777 O  O   . ASP A 1 365 ? 18.600  43.845 73.940 1.00 29.34 ? 365  ASP A O   1 
ATOM   2778 C  CB  . ASP A 1 365 ? 16.865  41.562 75.660 1.00 31.70 ? 365  ASP A CB  1 
ATOM   2779 N  N   . LEU A 1 366 ? 18.431  41.814 72.991 1.00 24.77 ? 366  LEU A N   1 
ATOM   2780 C  CA  . LEU A 1 366 ? 19.684  41.965 72.269 1.00 19.85 ? 366  LEU A CA  1 
ATOM   2781 C  C   . LEU A 1 366 ? 19.587  43.151 71.340 1.00 18.38 ? 366  LEU A C   1 
ATOM   2782 O  O   . LEU A 1 366 ? 20.545  43.890 71.162 1.00 18.57 ? 366  LEU A O   1 
ATOM   2783 C  CB  . LEU A 1 366 ? 19.987  40.719 71.455 1.00 20.16 ? 366  LEU A CB  1 
ATOM   2784 C  CG  . LEU A 1 366 ? 21.242  39.959 71.849 1.00 19.44 ? 366  LEU A CG  1 
ATOM   2785 C  CD1 . LEU A 1 366 ? 21.605  39.043 70.715 1.00 21.43 ? 366  LEU A CD1 1 
ATOM   2786 C  CD2 . LEU A 1 366 ? 22.377  40.919 72.102 1.00 20.83 ? 366  LEU A CD2 1 
ATOM   2787 N  N   . GLY A 1 367 ? 18.418  43.324 70.743 1.00 18.26 ? 367  GLY A N   1 
ATOM   2788 C  CA  . GLY A 1 367 ? 18.209  44.432 69.840 1.00 18.29 ? 367  GLY A CA  1 
ATOM   2789 C  C   . GLY A 1 367 ? 18.498  45.693 70.610 1.00 18.12 ? 367  GLY A C   1 
ATOM   2790 O  O   . GLY A 1 367 ? 19.434  46.421 70.281 1.00 19.15 ? 367  GLY A O   1 
ATOM   2791 N  N   . LEU A 1 368 ? 17.758  45.891 71.698 1.00 17.70 ? 368  LEU A N   1 
ATOM   2792 C  CA  . LEU A 1 368 ? 17.921  47.063 72.548 1.00 17.99 ? 368  LEU A CA  1 
ATOM   2793 C  C   . LEU A 1 368 ? 19.373  47.193 72.983 1.00 18.88 ? 368  LEU A C   1 
ATOM   2794 O  O   . LEU A 1 368 ? 19.924  48.291 73.020 1.00 20.01 ? 368  LEU A O   1 
ATOM   2795 C  CB  . LEU A 1 368 ? 17.008  46.967 73.768 1.00 17.88 ? 368  LEU A CB  1 
ATOM   2796 C  CG  . LEU A 1 368 ? 15.506  46.911 73.468 1.00 17.53 ? 368  LEU A CG  1 
ATOM   2797 C  CD1 . LEU A 1 368 ? 14.722  46.587 74.716 1.00 17.22 ? 368  LEU A CD1 1 
ATOM   2798 C  CD2 . LEU A 1 368 ? 15.050  48.227 72.886 1.00 18.87 ? 368  LEU A CD2 1 
ATOM   2799 N  N   . ASP A 1 369 ? 20.011  46.062 73.246 1.00 19.29 ? 369  ASP A N   1 
ATOM   2800 C  CA  . ASP A 1 369 ? 21.406  46.065 73.657 1.00 19.72 ? 369  ASP A CA  1 
ATOM   2801 C  C   . ASP A 1 369 ? 22.288  46.654 72.566 1.00 18.82 ? 369  ASP A C   1 
ATOM   2802 O  O   . ASP A 1 369 ? 23.097  47.538 72.834 1.00 19.52 ? 369  ASP A O   1 
ATOM   2803 C  CB  . ASP A 1 369 ? 21.875  44.645 73.991 1.00 22.38 ? 369  ASP A CB  1 
ATOM   2804 C  CG  . ASP A 1 369 ? 21.955  44.384 75.485 1.00 23.71 ? 369  ASP A CG  1 
ATOM   2805 O  OD1 . ASP A 1 369 ? 21.513  45.245 76.282 1.00 24.74 ? 369  ASP A OD1 1 
ATOM   2806 O  OD2 . ASP A 1 369 ? 22.479  43.311 75.859 1.00 23.76 ? 369  ASP A OD2 1 
ATOM   2807 N  N   . ALA A 1 370 ? 22.095  46.199 71.332 1.00 18.28 ? 370  ALA A N   1 
ATOM   2808 C  CA  . ALA A 1 370 ? 22.892  46.670 70.208 1.00 15.99 ? 370  ALA A CA  1 
ATOM   2809 C  C   . ALA A 1 370 ? 22.674  48.146 69.960 1.00 14.65 ? 370  ALA A C   1 
ATOM   2810 O  O   . ALA A 1 370 ? 23.613  48.869 69.618 1.00 13.73 ? 370  ALA A O   1 
ATOM   2811 C  CB  . ALA A 1 370 ? 22.562  45.882 68.969 1.00 17.43 ? 370  ALA A CB  1 
ATOM   2812 N  N   . VAL A 1 371 ? 21.430  48.582 70.129 1.00 15.02 ? 371  VAL A N   1 
ATOM   2813 C  CA  . VAL A 1 371 ? 21.063  49.981 69.935 1.00 16.32 ? 371  VAL A CA  1 
ATOM   2814 C  C   . VAL A 1 371 ? 21.763  50.809 70.997 1.00 17.00 ? 371  VAL A C   1 
ATOM   2815 O  O   . VAL A 1 371 ? 22.424  51.802 70.700 1.00 19.21 ? 371  VAL A O   1 
ATOM   2816 C  CB  . VAL A 1 371 ? 19.547  50.199 70.077 1.00 15.73 ? 371  VAL A CB  1 
ATOM   2817 C  CG1 . VAL A 1 371 ? 19.208  51.663 69.882 1.00 14.60 ? 371  VAL A CG1 1 
ATOM   2818 C  CG2 . VAL A 1 371 ? 18.786  49.333 69.083 1.00 16.12 ? 371  VAL A CG2 1 
ATOM   2819 N  N   . THR A 1 372 ? 21.640  50.366 72.238 1.00 17.52 ? 372  THR A N   1 
ATOM   2820 C  CA  . THR A 1 372 ? 22.251  51.049 73.356 1.00 18.26 ? 372  THR A CA  1 
ATOM   2821 C  C   . THR A 1 372 ? 23.755  51.119 73.175 1.00 16.77 ? 372  THR A C   1 
ATOM   2822 O  O   . THR A 1 372 ? 24.369  52.147 73.407 1.00 15.29 ? 372  THR A O   1 
ATOM   2823 C  CB  . THR A 1 372 ? 21.896  50.340 74.653 1.00 21.03 ? 372  THR A CB  1 
ATOM   2824 O  OG1 . THR A 1 372 ? 20.483  50.465 74.879 1.00 24.84 ? 372  THR A OG1 1 
ATOM   2825 C  CG2 . THR A 1 372 ? 22.663  50.936 75.820 1.00 24.29 ? 372  THR A CG2 1 
ATOM   2826 N  N   . LEU A 1 373 ? 24.340  50.032 72.704 1.00 17.56 ? 373  LEU A N   1 
ATOM   2827 C  CA  . LEU A 1 373 ? 25.771  49.996 72.480 1.00 18.28 ? 373  LEU A CA  1 
ATOM   2828 C  C   . LEU A 1 373 ? 26.192  51.088 71.505 1.00 19.66 ? 373  LEU A C   1 
ATOM   2829 O  O   . LEU A 1 373 ? 27.188  51.767 71.732 1.00 21.49 ? 373  LEU A O   1 
ATOM   2830 C  CB  . LEU A 1 373 ? 26.195  48.632 71.934 1.00 16.78 ? 373  LEU A CB  1 
ATOM   2831 C  CG  . LEU A 1 373 ? 27.625  48.545 71.417 1.00 17.28 ? 373  LEU A CG  1 
ATOM   2832 C  CD1 . LEU A 1 373 ? 28.598  48.863 72.532 1.00 20.50 ? 373  LEU A CD1 1 
ATOM   2833 C  CD2 . LEU A 1 373 ? 27.882  47.163 70.862 1.00 20.67 ? 373  LEU A CD2 1 
ATOM   2834 N  N   . GLN A 1 374 ? 25.424  51.274 70.439 1.00 20.17 ? 374  GLN A N   1 
ATOM   2835 C  CA  . GLN A 1 374 ? 25.783  52.273 69.446 1.00 21.72 ? 374  GLN A CA  1 
ATOM   2836 C  C   . GLN A 1 374 ? 25.546  53.703 69.905 1.00 22.11 ? 374  GLN A C   1 
ATOM   2837 O  O   . GLN A 1 374 ? 26.318  54.601 69.574 1.00 23.96 ? 374  GLN A O   1 
ATOM   2838 C  CB  . GLN A 1 374 ? 25.028  52.051 68.127 1.00 23.97 ? 374  GLN A CB  1 
ATOM   2839 C  CG  . GLN A 1 374 ? 25.066  50.636 67.566 1.00 27.76 ? 374  GLN A CG  1 
ATOM   2840 C  CD  . GLN A 1 374 ? 26.474  50.082 67.406 1.00 30.87 ? 374  GLN A CD  1 
ATOM   2841 O  OE1 . GLN A 1 374 ? 27.296  50.613 66.647 1.00 28.81 ? 374  GLN A OE1 1 
ATOM   2842 N  NE2 . GLN A 1 374 ? 26.752  48.989 68.110 1.00 32.74 ? 374  GLN A NE2 1 
ATOM   2843 N  N   . TYR A 1 375 ? 24.491  53.924 70.672 1.00 21.09 ? 375  TYR A N   1 
ATOM   2844 C  CA  . TYR A 1 375 ? 24.179  55.275 71.091 1.00 19.91 ? 375  TYR A CA  1 
ATOM   2845 C  C   . TYR A 1 375 ? 24.687  55.745 72.437 1.00 20.85 ? 375  TYR A C   1 
ATOM   2846 O  O   . TYR A 1 375 ? 24.685  56.938 72.712 1.00 22.35 ? 375  TYR A O   1 
ATOM   2847 C  CB  . TYR A 1 375 ? 22.684  55.525 70.917 1.00 20.32 ? 375  TYR A CB  1 
ATOM   2848 C  CG  . TYR A 1 375 ? 22.316  55.607 69.446 1.00 20.10 ? 375  TYR A CG  1 
ATOM   2849 C  CD1 . TYR A 1 375 ? 21.931  54.471 68.729 1.00 18.63 ? 375  TYR A CD1 1 
ATOM   2850 C  CD2 . TYR A 1 375 ? 22.440  56.806 68.751 1.00 18.23 ? 375  TYR A CD2 1 
ATOM   2851 C  CE1 . TYR A 1 375 ? 21.690  54.534 67.359 1.00 16.25 ? 375  TYR A CE1 1 
ATOM   2852 C  CE2 . TYR A 1 375 ? 22.205  56.873 67.389 1.00 17.54 ? 375  TYR A CE2 1 
ATOM   2853 C  CZ  . TYR A 1 375 ? 21.833  55.742 66.702 1.00 17.97 ? 375  TYR A CZ  1 
ATOM   2854 O  OH  . TYR A 1 375 ? 21.616  55.837 65.349 1.00 20.09 ? 375  TYR A OH  1 
ATOM   2855 N  N   . THR A 1 376 ? 25.191  54.827 73.244 1.00 22.39 ? 376  THR A N   1 
ATOM   2856 C  CA  . THR A 1 376 ? 25.703  55.169 74.563 1.00 23.25 ? 376  THR A CA  1 
ATOM   2857 C  C   . THR A 1 376 ? 27.142  55.645 74.502 1.00 24.78 ? 376  THR A C   1 
ATOM   2858 O  O   . THR A 1 376 ? 27.961  55.082 73.781 1.00 26.62 ? 376  THR A O   1 
ATOM   2859 C  CB  . THR A 1 376 ? 25.617  53.968 75.497 1.00 22.63 ? 376  THR A CB  1 
ATOM   2860 O  OG1 . THR A 1 376 ? 24.249  53.569 75.616 1.00 24.39 ? 376  THR A OG1 1 
ATOM   2861 C  CG2 . THR A 1 376 ? 26.156  54.309 76.869 1.00 24.43 ? 376  THR A CG2 1 
ATOM   2862 N  N   . ASP A 1 377 ? 27.462  56.666 75.293 1.00 27.25 ? 377  ASP A N   1 
ATOM   2863 C  CA  . ASP A 1 377 ? 28.817  57.200 75.314 1.00 27.78 ? 377  ASP A CA  1 
ATOM   2864 C  C   . ASP A 1 377 ? 29.854  56.264 75.932 1.00 29.72 ? 377  ASP A C   1 
ATOM   2865 O  O   . ASP A 1 377 ? 31.036  56.366 75.600 1.00 33.65 ? 377  ASP A O   1 
ATOM   2866 C  CB  . ASP A 1 377 ? 28.864  58.544 76.025 1.00 25.75 ? 377  ASP A CB  1 
ATOM   2867 C  CG  . ASP A 1 377 ? 30.137  59.311 75.724 1.00 24.56 ? 377  ASP A CG  1 
ATOM   2868 O  OD1 . ASP A 1 377 ? 31.229  58.894 76.156 1.00 24.05 ? 377  ASP A OD1 1 
ATOM   2869 O  OD2 . ASP A 1 377 ? 30.048  60.338 75.035 1.00 28.18 ? 377  ASP A OD2 1 
ATOM   2870 N  N   . TRP A 1 378 ? 29.446  55.416 76.878 1.00 29.46 ? 378  TRP A N   1 
ATOM   2871 C  CA  . TRP A 1 378 ? 30.361  54.464 77.529 1.00 29.68 ? 378  TRP A CA  1 
ATOM   2872 C  C   . TRP A 1 378 ? 31.567  55.045 78.256 1.00 31.10 ? 378  TRP A C   1 
ATOM   2873 O  O   . TRP A 1 378 ? 32.217  54.353 79.022 1.00 32.47 ? 378  TRP A O   1 
ATOM   2874 C  CB  . TRP A 1 378 ? 30.829  53.401 76.541 1.00 27.97 ? 378  TRP A CB  1 
ATOM   2875 C  CG  . TRP A 1 378 ? 29.713  52.559 76.087 1.00 28.47 ? 378  TRP A CG  1 
ATOM   2876 C  CD1 . TRP A 1 378 ? 29.360  52.286 74.798 1.00 29.36 ? 378  TRP A CD1 1 
ATOM   2877 C  CD2 . TRP A 1 378 ? 28.728  51.942 76.914 1.00 26.99 ? 378  TRP A CD2 1 
ATOM   2878 N  NE1 . TRP A 1 378 ? 28.204  51.547 74.774 1.00 27.99 ? 378  TRP A NE1 1 
ATOM   2879 C  CE2 . TRP A 1 378 ? 27.795  51.323 76.061 1.00 26.45 ? 378  TRP A CE2 1 
ATOM   2880 C  CE3 . TRP A 1 378 ? 28.537  51.864 78.293 1.00 27.88 ? 378  TRP A CE3 1 
ATOM   2881 C  CZ2 . TRP A 1 378 ? 26.685  50.638 76.542 1.00 27.58 ? 378  TRP A CZ2 1 
ATOM   2882 C  CZ3 . TRP A 1 378 ? 27.429  51.183 78.773 1.00 30.02 ? 378  TRP A CZ3 1 
ATOM   2883 C  CH2 . TRP A 1 378 ? 26.517  50.580 77.899 1.00 28.32 ? 378  TRP A CH2 1 
ATOM   2884 N  N   . MET A 1 379 ? 31.880  56.304 77.994 1.00 33.49 ? 379  MET A N   1 
ATOM   2885 C  CA  . MET A 1 379 ? 32.985  57.000 78.639 1.00 35.04 ? 379  MET A CA  1 
ATOM   2886 C  C   . MET A 1 379 ? 32.324  58.123 79.423 1.00 34.67 ? 379  MET A C   1 
ATOM   2887 O  O   . MET A 1 379 ? 32.995  59.050 79.869 1.00 34.92 ? 379  MET A O   1 
ATOM   2888 C  CB  . MET A 1 379 ? 33.879  57.638 77.574 1.00 38.42 ? 379  MET A CB  1 
ATOM   2889 C  CG  . MET A 1 379 ? 35.196  56.951 77.330 1.00 42.52 ? 379  MET A CG  1 
ATOM   2890 S  SD  . MET A 1 379 ? 36.242  57.047 78.784 1.00 46.86 ? 379  MET A SD  1 
ATOM   2891 C  CE  . MET A 1 379 ? 35.958  58.786 79.352 1.00 45.69 ? 379  MET A CE  1 
ATOM   2892 N  N   . ASP A 1 380 ? 30.995  58.049 79.536 1.00 34.47 ? 380  ASP A N   1 
ATOM   2893 C  CA  . ASP A 1 380 ? 30.184  59.064 80.207 1.00 35.51 ? 380  ASP A CA  1 
ATOM   2894 C  C   . ASP A 1 380 ? 28.732  58.577 80.095 1.00 35.25 ? 380  ASP A C   1 
ATOM   2895 O  O   . ASP A 1 380 ? 27.817  59.366 79.865 1.00 35.52 ? 380  ASP A O   1 
ATOM   2896 C  CB  . ASP A 1 380 ? 30.354  60.390 79.445 1.00 36.11 ? 380  ASP A CB  1 
ATOM   2897 C  CG  . ASP A 1 380 ? 29.875  61.603 80.225 1.00 38.37 ? 380  ASP A CG  1 
ATOM   2898 O  OD1 . ASP A 1 380 ? 29.421  62.557 79.561 1.00 38.26 ? 380  ASP A OD1 1 
ATOM   2899 O  OD2 . ASP A 1 380 ? 29.985  61.635 81.478 1.00 41.68 ? 380  ASP A OD2 1 
ATOM   2900 N  N   . ASP A 1 381 ? 28.537  57.275 80.302 1.00 36.01 ? 381  ASP A N   1 
ATOM   2901 C  CA  . ASP A 1 381 ? 27.232  56.616 80.187 1.00 36.27 ? 381  ASP A CA  1 
ATOM   2902 C  C   . ASP A 1 381 ? 26.162  57.032 81.177 1.00 36.67 ? 381  ASP A C   1 
ATOM   2903 O  O   . ASP A 1 381 ? 25.237  56.261 81.452 1.00 37.17 ? 381  ASP A O   1 
ATOM   2904 C  CB  . ASP A 1 381 ? 27.401  55.099 80.285 1.00 37.66 ? 381  ASP A CB  1 
ATOM   2905 C  CG  . ASP A 1 381 ? 27.784  54.641 81.689 1.00 38.42 ? 381  ASP A CG  1 
ATOM   2906 O  OD1 . ASP A 1 381 ? 27.107  53.734 82.232 1.00 37.28 ? 381  ASP A OD1 1 
ATOM   2907 O  OD2 . ASP A 1 381 ? 28.759  55.196 82.250 1.00 39.30 ? 381  ASP A OD2 1 
ATOM   2908 N  N   . ASN A 1 382 ? 26.284  58.232 81.723 1.00 37.26 ? 382  ASN A N   1 
ATOM   2909 C  CA  . ASN A 1 382 ? 25.314  58.728 82.689 1.00 36.94 ? 382  ASN A CA  1 
ATOM   2910 C  C   . ASN A 1 382 ? 24.975  60.164 82.360 1.00 36.44 ? 382  ASN A C   1 
ATOM   2911 O  O   . ASN A 1 382 ? 24.049  60.729 82.944 1.00 38.14 ? 382  ASN A O   1 
ATOM   2912 C  CB  . ASN A 1 382 ? 25.899  58.673 84.107 1.00 37.73 ? 382  ASN A CB  1 
ATOM   2913 N  N   . ASN A 1 383 ? 25.725  60.752 81.429 1.00 35.30 ? 383  ASN A N   1 
ATOM   2914 C  CA  . ASN A 1 383 ? 25.514  62.141 81.059 1.00 31.98 ? 383  ASN A CA  1 
ATOM   2915 C  C   . ASN A 1 383 ? 24.085  62.350 80.630 1.00 30.90 ? 383  ASN A C   1 
ATOM   2916 O  O   . ASN A 1 383 ? 23.621  61.723 79.686 1.00 31.82 ? 383  ASN A O   1 
ATOM   2917 C  CB  . ASN A 1 383 ? 26.452  62.570 79.939 1.00 32.04 ? 383  ASN A CB  1 
ATOM   2918 C  CG  . ASN A 1 383 ? 26.336  64.060 79.630 1.00 33.84 ? 383  ASN A CG  1 
ATOM   2919 O  OD1 . ASN A 1 383 ? 25.229  64.589 79.478 1.00 35.61 ? 383  ASN A OD1 1 
ATOM   2920 N  ND2 . ASN A 1 383 ? 27.473  64.745 79.548 1.00 32.73 ? 383  ASN A ND2 1 
ATOM   2921 N  N   . GLY A 1 384 ? 23.393  63.231 81.343 1.00 30.16 ? 384  GLY A N   1 
ATOM   2922 C  CA  . GLY A 1 384 ? 22.008  63.517 81.033 1.00 26.66 ? 384  GLY A CA  1 
ATOM   2923 C  C   . GLY A 1 384 ? 21.893  63.974 79.603 1.00 23.79 ? 384  GLY A C   1 
ATOM   2924 O  O   . GLY A 1 384 ? 21.132  63.397 78.828 1.00 24.78 ? 384  GLY A O   1 
ATOM   2925 N  N   . ILE A 1 385 ? 22.699  64.966 79.244 1.00 20.21 ? 385  ILE A N   1 
ATOM   2926 C  CA  . ILE A 1 385 ? 22.691  65.507 77.900 1.00 19.94 ? 385  ILE A CA  1 
ATOM   2927 C  C   . ILE A 1 385 ? 22.957  64.411 76.880 1.00 21.39 ? 385  ILE A C   1 
ATOM   2928 O  O   . ILE A 1 385 ? 22.124  64.144 76.020 1.00 23.31 ? 385  ILE A O   1 
ATOM   2929 C  CB  . ILE A 1 385 ? 23.753  66.583 77.726 1.00 19.74 ? 385  ILE A CB  1 
ATOM   2930 C  CG1 . ILE A 1 385 ? 23.528  67.698 78.732 1.00 18.20 ? 385  ILE A CG1 1 
ATOM   2931 C  CG2 . ILE A 1 385 ? 23.709  67.126 76.315 1.00 21.13 ? 385  ILE A CG2 1 
ATOM   2932 C  CD1 . ILE A 1 385 ? 22.175  68.321 78.611 1.00 23.00 ? 385  ILE A CD1 1 
ATOM   2933 N  N   . LYS A 1 386 ? 24.103  63.755 76.995 1.00 21.56 ? 386  LYS A N   1 
ATOM   2934 C  CA  . LYS A 1 386 ? 24.456  62.698 76.064 1.00 19.97 ? 386  LYS A CA  1 
ATOM   2935 C  C   . LYS A 1 386 ? 23.334  61.686 75.907 1.00 21.33 ? 386  LYS A C   1 
ATOM   2936 O  O   . LYS A 1 386 ? 23.013  61.293 74.789 1.00 24.72 ? 386  LYS A O   1 
ATOM   2937 C  CB  . LYS A 1 386 ? 25.758  62.015 76.483 1.00 18.96 ? 386  LYS A CB  1 
ATOM   2938 C  CG  . LYS A 1 386 ? 26.961  62.942 76.418 1.00 17.18 ? 386  LYS A CG  1 
ATOM   2939 C  CD  . LYS A 1 386 ? 28.250  62.199 76.626 1.00 17.92 ? 386  LYS A CD  1 
ATOM   2940 C  CE  . LYS A 1 386 ? 29.447  63.127 76.463 1.00 20.12 ? 386  LYS A CE  1 
ATOM   2941 N  NZ  . LYS A 1 386 ? 30.772  62.437 76.649 1.00 22.95 ? 386  LYS A NZ  1 
ATOM   2942 N  N   . ASN A 1 387 ? 22.680  61.322 77.002 1.00 20.67 ? 387  ASN A N   1 
ATOM   2943 C  CA  . ASN A 1 387 ? 21.590  60.356 76.925 1.00 21.19 ? 387  ASN A CA  1 
ATOM   2944 C  C   . ASN A 1 387 ? 20.412  60.962 76.187 1.00 20.56 ? 387  ASN A C   1 
ATOM   2945 O  O   . ASN A 1 387 ? 19.719  60.273 75.442 1.00 23.18 ? 387  ASN A O   1 
ATOM   2946 C  CB  . ASN A 1 387 ? 21.123  59.918 78.316 1.00 24.22 ? 387  ASN A CB  1 
ATOM   2947 C  CG  . ASN A 1 387 ? 22.160  59.103 79.067 1.00 25.61 ? 387  ASN A CG  1 
ATOM   2948 O  OD1 . ASN A 1 387 ? 22.796  58.193 78.518 1.00 26.29 ? 387  ASN A OD1 1 
ATOM   2949 N  ND2 . ASN A 1 387 ? 22.324  59.418 80.343 1.00 28.34 ? 387  ASN A ND2 1 
ATOM   2950 N  N   . ARG A 1 388 ? 20.174  62.247 76.412 1.00 17.55 ? 388  ARG A N   1 
ATOM   2951 C  CA  . ARG A 1 388 ? 19.063  62.939 75.773 1.00 18.08 ? 388  ARG A CA  1 
ATOM   2952 C  C   . ARG A 1 388 ? 19.256  62.963 74.271 1.00 18.86 ? 388  ARG A C   1 
ATOM   2953 O  O   . ARG A 1 388 ? 18.396  62.522 73.513 1.00 19.97 ? 388  ARG A O   1 
ATOM   2954 C  CB  . ARG A 1 388 ? 18.954  64.374 76.289 1.00 17.12 ? 388  ARG A CB  1 
ATOM   2955 C  CG  . ARG A 1 388 ? 17.787  65.143 75.712 1.00 13.70 ? 388  ARG A CG  1 
ATOM   2956 C  CD  . ARG A 1 388 ? 18.255  66.397 75.030 1.00 14.12 ? 388  ARG A CD  1 
ATOM   2957 N  NE  . ARG A 1 388 ? 18.521  67.489 75.953 1.00 13.09 ? 388  ARG A NE  1 
ATOM   2958 C  CZ  . ARG A 1 388 ? 19.493  68.382 75.791 1.00 16.38 ? 388  ARG A CZ  1 
ATOM   2959 N  NH1 . ARG A 1 388 ? 19.658  69.351 76.676 1.00 19.60 ? 388  ARG A NH1 1 
ATOM   2960 N  NH2 . ARG A 1 388 ? 20.308  68.311 74.751 1.00 15.52 ? 388  ARG A NH2 1 
ATOM   2961 N  N   . ASP A 1 389 ? 20.405  63.478 73.851 1.00 19.86 ? 389  ASP A N   1 
ATOM   2962 C  CA  . ASP A 1 389 ? 20.751  63.584 72.446 1.00 17.42 ? 389  ASP A CA  1 
ATOM   2963 C  C   . ASP A 1 389 ? 20.850  62.198 71.841 1.00 17.68 ? 389  ASP A C   1 
ATOM   2964 O  O   . ASP A 1 389 ? 20.472  61.994 70.693 1.00 19.00 ? 389  ASP A O   1 
ATOM   2965 C  CB  . ASP A 1 389 ? 22.076  64.326 72.299 1.00 16.13 ? 389  ASP A CB  1 
ATOM   2966 C  CG  . ASP A 1 389 ? 22.026  65.737 72.877 1.00 14.88 ? 389  ASP A CG  1 
ATOM   2967 O  OD1 . ASP A 1 389 ? 23.093  66.361 73.031 1.00 15.27 ? 389  ASP A OD1 1 
ATOM   2968 O  OD2 . ASP A 1 389 ? 20.924  66.234 73.168 1.00 14.45 ? 389  ASP A OD2 1 
ATOM   2969 N  N   . GLY A 1 390 ? 21.324  61.238 72.626 1.00 17.34 ? 390  GLY A N   1 
ATOM   2970 C  CA  . GLY A 1 390 ? 21.445  59.880 72.131 1.00 17.27 ? 390  GLY A CA  1 
ATOM   2971 C  C   . GLY A 1 390 ? 20.096  59.376 71.661 1.00 18.33 ? 390  GLY A C   1 
ATOM   2972 O  O   . GLY A 1 390 ? 19.980  58.759 70.605 1.00 21.02 ? 390  GLY A O   1 
ATOM   2973 N  N   . LEU A 1 391 ? 19.060  59.652 72.439 1.00 18.52 ? 391  LEU A N   1 
ATOM   2974 C  CA  . LEU A 1 391 ? 17.718  59.222 72.085 1.00 18.17 ? 391  LEU A CA  1 
ATOM   2975 C  C   . LEU A 1 391 ? 17.217  60.055 70.919 1.00 19.10 ? 391  LEU A C   1 
ATOM   2976 O  O   . LEU A 1 391 ? 16.525  59.556 70.028 1.00 20.06 ? 391  LEU A O   1 
ATOM   2977 C  CB  . LEU A 1 391 ? 16.784  59.384 73.276 1.00 16.53 ? 391  LEU A CB  1 
ATOM   2978 C  CG  . LEU A 1 391 ? 17.026  58.456 74.453 1.00 16.84 ? 391  LEU A CG  1 
ATOM   2979 C  CD1 . LEU A 1 391 ? 16.025  58.768 75.543 1.00 19.56 ? 391  LEU A CD1 1 
ATOM   2980 C  CD2 . LEU A 1 391 ? 16.859  57.023 73.994 1.00 16.89 ? 391  LEU A CD2 1 
ATOM   2981 N  N   . ASP A 1 392 ? 17.576  61.332 70.921 1.00 18.72 ? 392  ASP A N   1 
ATOM   2982 C  CA  . ASP A 1 392 ? 17.169  62.231 69.858 1.00 18.43 ? 392  ASP A CA  1 
ATOM   2983 C  C   . ASP A 1 392 ? 17.661  61.703 68.527 1.00 18.37 ? 392  ASP A C   1 
ATOM   2984 O  O   . ASP A 1 392 ? 17.192  62.139 67.484 1.00 21.85 ? 392  ASP A O   1 
ATOM   2985 C  CB  . ASP A 1 392 ? 17.726  63.627 70.099 1.00 23.65 ? 392  ASP A CB  1 
ATOM   2986 C  CG  . ASP A 1 392 ? 17.480  64.552 68.937 1.00 27.03 ? 392  ASP A CG  1 
ATOM   2987 O  OD1 . ASP A 1 392 ? 16.299  64.852 68.676 1.00 28.10 ? 392  ASP A OD1 1 
ATOM   2988 O  OD2 . ASP A 1 392 ? 18.461  64.963 68.272 1.00 28.72 ? 392  ASP A OD2 1 
ATOM   2989 N  N   . ASP A 1 393 ? 18.630  60.787 68.581 1.00 17.99 ? 393  ASP A N   1 
ATOM   2990 C  CA  . ASP A 1 393 ? 19.212  60.143 67.406 1.00 15.17 ? 393  ASP A CA  1 
ATOM   2991 C  C   . ASP A 1 393 ? 18.650  58.741 67.195 1.00 14.34 ? 393  ASP A C   1 
ATOM   2992 O  O   . ASP A 1 393 ? 18.393  58.343 66.074 1.00 16.30 ? 393  ASP A O   1 
ATOM   2993 C  CB  . ASP A 1 393 ? 20.724  60.044 67.544 1.00 17.17 ? 393  ASP A CB  1 
ATOM   2994 C  CG  . ASP A 1 393 ? 21.406  61.389 67.514 1.00 20.33 ? 393  ASP A CG  1 
ATOM   2995 O  OD1 . ASP A 1 393 ? 20.710  62.423 67.459 1.00 21.77 ? 393  ASP A OD1 1 
ATOM   2996 O  OD2 . ASP A 1 393 ? 22.658  61.407 67.544 1.00 24.60 ? 393  ASP A OD2 1 
ATOM   2997 N  N   . ILE A 1 394 ? 18.513  57.958 68.255 1.00 14.46 ? 394  ILE A N   1 
ATOM   2998 C  CA  . ILE A 1 394 ? 17.956  56.617 68.101 1.00 13.48 ? 394  ILE A CA  1 
ATOM   2999 C  C   . ILE A 1 394 ? 16.619  56.776 67.382 1.00 15.49 ? 394  ILE A C   1 
ATOM   3000 O  O   . ILE A 1 394 ? 16.388  56.172 66.343 1.00 15.19 ? 394  ILE A O   1 
ATOM   3001 C  CB  . ILE A 1 394 ? 17.738  55.935 69.466 1.00 11.60 ? 394  ILE A CB  1 
ATOM   3002 C  CG1 . ILE A 1 394 ? 19.074  55.782 70.174 1.00 9.92  ? 394  ILE A CG1 1 
ATOM   3003 C  CG2 . ILE A 1 394 ? 17.074  54.591 69.298 1.00 8.08  ? 394  ILE A CG2 1 
ATOM   3004 C  CD1 . ILE A 1 394 ? 19.010  54.971 71.420 1.00 14.43 ? 394  ILE A CD1 1 
ATOM   3005 N  N   . VAL A 1 395 ? 15.794  57.687 67.891 1.00 17.28 ? 395  VAL A N   1 
ATOM   3006 C  CA  . VAL A 1 395 ? 14.478  57.967 67.328 1.00 16.79 ? 395  VAL A CA  1 
ATOM   3007 C  C   . VAL A 1 395 ? 14.607  58.646 65.976 1.00 16.48 ? 395  VAL A C   1 
ATOM   3008 O  O   . VAL A 1 395 ? 13.844  58.365 65.060 1.00 15.63 ? 395  VAL A O   1 
ATOM   3009 C  CB  . VAL A 1 395 ? 13.677  58.888 68.255 1.00 17.12 ? 395  VAL A CB  1 
ATOM   3010 C  CG1 . VAL A 1 395 ? 12.250  59.044 67.759 1.00 18.34 ? 395  VAL A CG1 1 
ATOM   3011 C  CG2 . VAL A 1 395 ? 13.696  58.339 69.650 1.00 18.77 ? 395  VAL A CG2 1 
ATOM   3012 N  N   . GLY A 1 396 ? 15.569  59.552 65.866 1.00 16.64 ? 396  GLY A N   1 
ATOM   3013 C  CA  . GLY A 1 396 ? 15.775  60.270 64.623 1.00 15.75 ? 396  GLY A CA  1 
ATOM   3014 C  C   . GLY A 1 396 ? 16.250  59.363 63.511 1.00 15.26 ? 396  GLY A C   1 
ATOM   3015 O  O   . GLY A 1 396 ? 15.578  59.213 62.497 1.00 16.95 ? 396  GLY A O   1 
ATOM   3016 N  N   . ASP A 1 397 ? 17.425  58.780 63.695 1.00 15.88 ? 397  ASP A N   1 
ATOM   3017 C  CA  . ASP A 1 397 ? 18.015  57.886 62.720 1.00 15.36 ? 397  ASP A CA  1 
ATOM   3018 C  C   . ASP A 1 397 ? 17.072  56.732 62.428 1.00 15.85 ? 397  ASP A C   1 
ATOM   3019 O  O   . ASP A 1 397 ? 16.599  56.586 61.307 1.00 19.85 ? 397  ASP A O   1 
ATOM   3020 C  CB  . ASP A 1 397 ? 19.359  57.340 63.227 1.00 15.33 ? 397  ASP A CB  1 
ATOM   3021 C  CG  . ASP A 1 397 ? 20.369  58.437 63.539 1.00 17.11 ? 397  ASP A CG  1 
ATOM   3022 O  OD1 . ASP A 1 397 ? 21.523  58.091 63.866 1.00 15.63 ? 397  ASP A OD1 1 
ATOM   3023 O  OD2 . ASP A 1 397 ? 20.018  59.638 63.470 1.00 16.85 ? 397  ASP A OD2 1 
ATOM   3024 N  N   . HIS A 1 398 ? 16.733  55.961 63.449 1.00 14.96 ? 398  HIS A N   1 
ATOM   3025 C  CA  . HIS A 1 398 ? 15.869  54.806 63.261 1.00 14.96 ? 398  HIS A CA  1 
ATOM   3026 C  C   . HIS A 1 398 ? 14.572  55.033 62.516 1.00 16.18 ? 398  HIS A C   1 
ATOM   3027 O  O   . HIS A 1 398 ? 14.175  54.190 61.712 1.00 19.21 ? 398  HIS A O   1 
ATOM   3028 C  CB  . HIS A 1 398 ? 15.530  54.137 64.589 1.00 11.33 ? 398  HIS A CB  1 
ATOM   3029 C  CG  . HIS A 1 398 ? 14.381  53.190 64.495 1.00 7.46  ? 398  HIS A CG  1 
ATOM   3030 N  ND1 . HIS A 1 398 ? 14.430  52.040 63.741 1.00 4.15  ? 398  HIS A ND1 1 
ATOM   3031 C  CD2 . HIS A 1 398 ? 13.131  53.254 65.006 1.00 6.01  ? 398  HIS A CD2 1 
ATOM   3032 C  CE1 . HIS A 1 398 ? 13.258  51.436 63.790 1.00 4.90  ? 398  HIS A CE1 1 
ATOM   3033 N  NE2 . HIS A 1 398 ? 12.452  52.154 64.550 1.00 6.34  ? 398  HIS A NE2 1 
ATOM   3034 N  N   . ASN A 1 399 ? 13.883  56.119 62.843 1.00 15.30 ? 399  ASN A N   1 
ATOM   3035 C  CA  . ASN A 1 399 ? 12.599  56.429 62.243 1.00 13.85 ? 399  ASN A CA  1 
ATOM   3036 C  C   . ASN A 1 399 ? 12.581  57.258 60.978 1.00 13.72 ? 399  ASN A C   1 
ATOM   3037 O  O   . ASN A 1 399 ? 11.713  57.059 60.146 1.00 16.55 ? 399  ASN A O   1 
ATOM   3038 C  CB  . ASN A 1 399 ? 11.699  57.111 63.260 1.00 16.05 ? 399  ASN A CB  1 
ATOM   3039 C  CG  . ASN A 1 399 ? 11.349  56.219 64.408 1.00 16.59 ? 399  ASN A CG  1 
ATOM   3040 O  OD1 . ASN A 1 399 ? 10.382  55.469 64.352 1.00 13.14 ? 399  ASN A OD1 1 
ATOM   3041 N  ND2 . ASN A 1 399 ? 12.147  56.280 65.460 1.00 18.82 ? 399  ASN A ND2 1 
ATOM   3042 N  N   . VAL A 1 400 ? 13.468  58.234 60.851 1.00 12.53 ? 400  VAL A N   1 
ATOM   3043 C  CA  . VAL A 1 400 ? 13.453  59.063 59.658 1.00 11.87 ? 400  VAL A CA  1 
ATOM   3044 C  C   . VAL A 1 400 ? 14.713  59.098 58.813 1.00 14.46 ? 400  VAL A C   1 
ATOM   3045 O  O   . VAL A 1 400 ? 14.633  59.014 57.591 1.00 16.59 ? 400  VAL A O   1 
ATOM   3046 C  CB  . VAL A 1 400 ? 13.057  60.500 59.973 1.00 9.23  ? 400  VAL A CB  1 
ATOM   3047 C  CG1 . VAL A 1 400 ? 13.062  61.311 58.709 1.00 10.59 ? 400  VAL A CG1 1 
ATOM   3048 C  CG2 . VAL A 1 400 ? 11.677  60.542 60.595 1.00 10.28 ? 400  VAL A CG2 1 
ATOM   3049 N  N   . ILE A 1 401 ? 15.877  59.239 59.436 1.00 14.56 ? 401  ILE A N   1 
ATOM   3050 C  CA  . ILE A 1 401 ? 17.100  59.310 58.653 1.00 14.72 ? 401  ILE A CA  1 
ATOM   3051 C  C   . ILE A 1 401 ? 17.471  58.015 57.976 1.00 16.44 ? 401  ILE A C   1 
ATOM   3052 O  O   . ILE A 1 401 ? 17.593  57.969 56.757 1.00 20.05 ? 401  ILE A O   1 
ATOM   3053 C  CB  . ILE A 1 401 ? 18.299  59.818 59.458 1.00 14.19 ? 401  ILE A CB  1 
ATOM   3054 C  CG1 . ILE A 1 401 ? 18.032  61.251 59.915 1.00 12.68 ? 401  ILE A CG1 1 
ATOM   3055 C  CG2 . ILE A 1 401 ? 19.571  59.734 58.616 1.00 8.92  ? 401  ILE A CG2 1 
ATOM   3056 C  CD1 . ILE A 1 401 ? 19.177  61.901 60.620 1.00 12.72 ? 401  ILE A CD1 1 
ATOM   3057 N  N   . CYS A 1 402 ? 17.619  56.949 58.747 1.00 16.90 ? 402  CYS A N   1 
ATOM   3058 C  CA  . CYS A 1 402 ? 18.010  55.687 58.159 1.00 16.47 ? 402  CYS A CA  1 
ATOM   3059 C  C   . CYS A 1 402 ? 17.097  55.116 57.108 1.00 16.03 ? 402  CYS A C   1 
ATOM   3060 O  O   . CYS A 1 402 ? 17.585  54.674 56.071 1.00 19.91 ? 402  CYS A O   1 
ATOM   3061 C  CB  . CYS A 1 402 ? 18.338  54.674 59.221 1.00 15.99 ? 402  CYS A CB  1 
ATOM   3062 S  SG  . CYS A 1 402 ? 19.804  55.237 60.116 1.00 22.88 ? 402  CYS A SG  1 
ATOM   3063 N  N   . PRO A 1 403 ? 15.770  55.109 57.337 1.00 13.68 ? 403  PRO A N   1 
ATOM   3064 C  CA  . PRO A 1 403 ? 14.943  54.549 56.270 1.00 11.32 ? 403  PRO A CA  1 
ATOM   3065 C  C   . PRO A 1 403 ? 15.060  55.425 55.021 1.00 11.86 ? 403  PRO A C   1 
ATOM   3066 O  O   . PRO A 1 403 ? 15.026  54.923 53.904 1.00 12.48 ? 403  PRO A O   1 
ATOM   3067 C  CB  . PRO A 1 403 ? 13.540  54.588 56.870 1.00 10.10 ? 403  PRO A CB  1 
ATOM   3068 C  CG  . PRO A 1 403 ? 13.789  54.456 58.313 1.00 9.75  ? 403  PRO A CG  1 
ATOM   3069 C  CD  . PRO A 1 403 ? 14.947  55.391 58.523 1.00 12.59 ? 403  PRO A CD  1 
ATOM   3070 N  N   . LEU A 1 404 ? 15.264  56.728 55.211 1.00 12.94 ? 404  LEU A N   1 
ATOM   3071 C  CA  . LEU A 1 404 ? 15.392  57.643 54.085 1.00 13.64 ? 404  LEU A CA  1 
ATOM   3072 C  C   . LEU A 1 404 ? 16.699  57.379 53.362 1.00 16.46 ? 404  LEU A C   1 
ATOM   3073 O  O   . LEU A 1 404 ? 16.746  57.402 52.137 1.00 17.97 ? 404  LEU A O   1 
ATOM   3074 C  CB  . LEU A 1 404 ? 15.296  59.103 54.533 1.00 11.45 ? 404  LEU A CB  1 
ATOM   3075 C  CG  . LEU A 1 404 ? 15.340  60.157 53.425 1.00 9.64  ? 404  LEU A CG  1 
ATOM   3076 C  CD1 . LEU A 1 404 ? 14.447  61.317 53.764 1.00 8.66  ? 404  LEU A CD1 1 
ATOM   3077 C  CD2 . LEU A 1 404 ? 16.764  60.614 53.210 1.00 10.91 ? 404  LEU A CD2 1 
ATOM   3078 N  N   . MET A 1 405 ? 17.765  57.121 54.109 1.00 18.44 ? 405  MET A N   1 
ATOM   3079 C  CA  . MET A 1 405 ? 19.042  56.820 53.478 1.00 19.44 ? 405  MET A CA  1 
ATOM   3080 C  C   . MET A 1 405 ? 18.924  55.516 52.705 1.00 19.73 ? 405  MET A C   1 
ATOM   3081 O  O   . MET A 1 405 ? 19.636  55.298 51.735 1.00 21.90 ? 405  MET A O   1 
ATOM   3082 C  CB  . MET A 1 405 ? 20.163  56.730 54.503 1.00 19.10 ? 405  MET A CB  1 
ATOM   3083 C  CG  . MET A 1 405 ? 20.527  58.071 55.059 1.00 18.16 ? 405  MET A CG  1 
ATOM   3084 S  SD  . MET A 1 405 ? 20.609  59.200 53.716 1.00 14.74 ? 405  MET A SD  1 
ATOM   3085 C  CE  . MET A 1 405 ? 22.208  58.848 53.100 1.00 17.90 ? 405  MET A CE  1 
ATOM   3086 N  N   . HIS A 1 406 ? 18.019  54.648 53.128 1.00 19.86 ? 406  HIS A N   1 
ATOM   3087 C  CA  . HIS A 1 406 ? 17.828  53.391 52.429 1.00 21.73 ? 406  HIS A CA  1 
ATOM   3088 C  C   . HIS A 1 406 ? 17.166  53.731 51.101 1.00 22.87 ? 406  HIS A C   1 
ATOM   3089 O  O   . HIS A 1 406 ? 17.741  53.512 50.043 1.00 25.22 ? 406  HIS A O   1 
ATOM   3090 C  CB  . HIS A 1 406 ? 16.920  52.463 53.222 1.00 19.13 ? 406  HIS A CB  1 
ATOM   3091 C  CG  . HIS A 1 406 ? 16.938  51.050 52.742 1.00 18.87 ? 406  HIS A CG  1 
ATOM   3092 N  ND1 . HIS A 1 406 ? 18.091  50.299 52.702 1.00 20.06 ? 406  HIS A ND1 1 
ATOM   3093 C  CD2 . HIS A 1 406 ? 15.941  50.235 52.324 1.00 18.90 ? 406  HIS A CD2 1 
ATOM   3094 C  CE1 . HIS A 1 406 ? 17.806  49.078 52.285 1.00 20.96 ? 406  HIS A CE1 1 
ATOM   3095 N  NE2 . HIS A 1 406 ? 16.508  49.013 52.048 1.00 18.94 ? 406  HIS A NE2 1 
ATOM   3096 N  N   . PHE A 1 407 ? 15.985  54.333 51.171 1.00 22.76 ? 407  PHE A N   1 
ATOM   3097 C  CA  . PHE A 1 407 ? 15.226  54.708 49.988 1.00 19.60 ? 407  PHE A CA  1 
ATOM   3098 C  C   . PHE A 1 407 ? 16.053  55.518 49.024 1.00 19.81 ? 407  PHE A C   1 
ATOM   3099 O  O   . PHE A 1 407 ? 16.006  55.270 47.829 1.00 24.85 ? 407  PHE A O   1 
ATOM   3100 C  CB  . PHE A 1 407 ? 13.989  55.506 50.385 1.00 17.27 ? 407  PHE A CB  1 
ATOM   3101 C  CG  . PHE A 1 407 ? 13.207  56.030 49.227 1.00 13.20 ? 407  PHE A CG  1 
ATOM   3102 C  CD1 . PHE A 1 407 ? 12.386  55.190 48.492 1.00 11.88 ? 407  PHE A CD1 1 
ATOM   3103 C  CD2 . PHE A 1 407 ? 13.268  57.371 48.889 1.00 12.49 ? 407  PHE A CD2 1 
ATOM   3104 C  CE1 . PHE A 1 407 ? 11.632  55.679 47.435 1.00 11.71 ? 407  PHE A CE1 1 
ATOM   3105 C  CE2 . PHE A 1 407 ? 12.519  57.868 47.835 1.00 14.39 ? 407  PHE A CE2 1 
ATOM   3106 C  CZ  . PHE A 1 407 ? 11.697  57.018 47.106 1.00 11.61 ? 407  PHE A CZ  1 
ATOM   3107 N  N   . VAL A 1 408 ? 16.828  56.471 49.527 1.00 18.26 ? 408  VAL A N   1 
ATOM   3108 C  CA  . VAL A 1 408 ? 17.627  57.291 48.632 1.00 15.50 ? 408  VAL A CA  1 
ATOM   3109 C  C   . VAL A 1 408 ? 18.622  56.407 47.922 1.00 16.86 ? 408  VAL A C   1 
ATOM   3110 O  O   . VAL A 1 408 ? 18.668  56.391 46.711 1.00 20.21 ? 408  VAL A O   1 
ATOM   3111 C  CB  . VAL A 1 408 ? 18.326  58.462 49.355 1.00 11.82 ? 408  VAL A CB  1 
ATOM   3112 C  CG1 . VAL A 1 408 ? 19.426  57.980 50.229 1.00 12.36 ? 408  VAL A CG1 1 
ATOM   3113 C  CG2 . VAL A 1 408 ? 18.870  59.428 48.363 1.00 11.78 ? 408  VAL A CG2 1 
ATOM   3114 N  N   . ASN A 1 409 ? 19.319  55.563 48.662 1.00 18.45 ? 409  ASN A N   1 
ATOM   3115 C  CA  . ASN A 1 409 ? 20.295  54.688 48.049 1.00 19.39 ? 409  ASN A CA  1 
ATOM   3116 C  C   . ASN A 1 409 ? 19.683  53.681 47.086 1.00 20.44 ? 409  ASN A C   1 
ATOM   3117 O  O   . ASN A 1 409 ? 20.152  53.541 45.966 1.00 23.37 ? 409  ASN A O   1 
ATOM   3118 C  CB  . ASN A 1 409 ? 21.123  53.990 49.119 1.00 21.01 ? 409  ASN A CB  1 
ATOM   3119 C  CG  . ASN A 1 409 ? 22.131  54.927 49.767 1.00 24.33 ? 409  ASN A CG  1 
ATOM   3120 O  OD1 . ASN A 1 409 ? 22.909  55.580 49.077 1.00 25.99 ? 409  ASN A OD1 1 
ATOM   3121 N  ND2 . ASN A 1 409 ? 22.119  55.001 51.094 1.00 24.68 ? 409  ASN A ND2 1 
ATOM   3122 N  N   . LYS A 1 410 ? 18.603  53.026 47.486 1.00 20.78 ? 410  LYS A N   1 
ATOM   3123 C  CA  . LYS A 1 410 ? 17.960  52.027 46.634 1.00 21.13 ? 410  LYS A CA  1 
ATOM   3124 C  C   . LYS A 1 410 ? 17.303  52.653 45.413 1.00 22.28 ? 410  LYS A C   1 
ATOM   3125 O  O   . LYS A 1 410 ? 17.177  52.014 44.370 1.00 22.70 ? 410  LYS A O   1 
ATOM   3126 C  CB  . LYS A 1 410 ? 16.898  51.244 47.410 1.00 23.15 ? 410  LYS A CB  1 
ATOM   3127 C  CG  . LYS A 1 410 ? 17.369  50.644 48.711 1.00 25.10 ? 410  LYS A CG  1 
ATOM   3128 C  CD  . LYS A 1 410 ? 18.482  49.666 48.483 1.00 26.91 ? 410  LYS A CD  1 
ATOM   3129 C  CE  . LYS A 1 410 ? 17.975  48.470 47.734 1.00 28.87 ? 410  LYS A CE  1 
ATOM   3130 N  NZ  . LYS A 1 410 ? 19.101  47.553 47.403 1.00 33.71 ? 410  LYS A NZ  1 
ATOM   3131 N  N   . TYR A 1 411 ? 16.838  53.886 45.556 1.00 21.25 ? 411  TYR A N   1 
ATOM   3132 C  CA  . TYR A 1 411 ? 16.190  54.569 44.452 1.00 20.77 ? 411  TYR A CA  1 
ATOM   3133 C  C   . TYR A 1 411 ? 17.232  55.106 43.484 1.00 22.94 ? 411  TYR A C   1 
ATOM   3134 O  O   . TYR A 1 411 ? 17.101  54.950 42.278 1.00 25.51 ? 411  TYR A O   1 
ATOM   3135 C  CB  . TYR A 1 411 ? 15.320  55.712 44.972 1.00 17.89 ? 411  TYR A CB  1 
ATOM   3136 C  CG  . TYR A 1 411 ? 14.570  56.452 43.896 1.00 16.35 ? 411  TYR A CG  1 
ATOM   3137 C  CD1 . TYR A 1 411 ? 13.269  56.089 43.557 1.00 16.17 ? 411  TYR A CD1 1 
ATOM   3138 C  CD2 . TYR A 1 411 ? 15.166  57.501 43.205 1.00 14.89 ? 411  TYR A CD2 1 
ATOM   3139 C  CE1 . TYR A 1 411 ? 12.582  56.742 42.556 1.00 15.83 ? 411  TYR A CE1 1 
ATOM   3140 C  CE2 . TYR A 1 411 ? 14.489  58.165 42.204 1.00 15.40 ? 411  TYR A CE2 1 
ATOM   3141 C  CZ  . TYR A 1 411 ? 13.200  57.776 41.882 1.00 18.46 ? 411  TYR A CZ  1 
ATOM   3142 O  OH  . TYR A 1 411 ? 12.548  58.390 40.851 1.00 19.87 ? 411  TYR A OH  1 
ATOM   3143 N  N   . THR A 1 412 ? 18.277  55.719 44.023 1.00 23.86 ? 412  THR A N   1 
ATOM   3144 C  CA  . THR A 1 412 ? 19.344  56.305 43.230 1.00 24.32 ? 412  THR A CA  1 
ATOM   3145 C  C   . THR A 1 412 ? 19.976  55.364 42.223 1.00 25.41 ? 412  THR A C   1 
ATOM   3146 O  O   . THR A 1 412 ? 20.488  55.808 41.200 1.00 27.06 ? 412  THR A O   1 
ATOM   3147 C  CB  . THR A 1 412 ? 20.407  56.934 44.138 1.00 23.63 ? 412  THR A CB  1 
ATOM   3148 O  OG1 . THR A 1 412 ? 19.897  58.165 44.656 1.00 25.06 ? 412  THR A OG1 1 
ATOM   3149 C  CG2 . THR A 1 412 ? 21.695  57.210 43.388 1.00 27.96 ? 412  THR A CG2 1 
ATOM   3150 N  N   . LYS A 1 413 ? 19.909  54.064 42.473 1.00 26.37 ? 413  LYS A N   1 
ATOM   3151 C  CA  . LYS A 1 413 ? 20.479  53.113 41.528 1.00 26.52 ? 413  LYS A CA  1 
ATOM   3152 C  C   . LYS A 1 413 ? 19.545  52.882 40.336 1.00 26.68 ? 413  LYS A C   1 
ATOM   3153 O  O   . LYS A 1 413 ? 19.758  51.958 39.563 1.00 29.49 ? 413  LYS A O   1 
ATOM   3154 C  CB  . LYS A 1 413 ? 20.802  51.785 42.219 1.00 26.07 ? 413  LYS A CB  1 
ATOM   3155 C  CG  . LYS A 1 413 ? 19.682  51.255 43.112 1.00 29.14 ? 413  LYS A CG  1 
ATOM   3156 C  CD  . LYS A 1 413 ? 19.889  49.779 43.485 1.00 33.04 ? 413  LYS A CD  1 
ATOM   3157 C  CE  . LYS A 1 413 ? 18.811  49.231 44.451 1.00 28.88 ? 413  LYS A CE  1 
ATOM   3158 N  NZ  . LYS A 1 413 ? 17.407  49.300 43.938 1.00 22.32 ? 413  LYS A NZ  1 
ATOM   3159 N  N   . PHE A 1 414 ? 18.513  53.714 40.187 1.00 26.10 ? 414  PHE A N   1 
ATOM   3160 C  CA  . PHE A 1 414 ? 17.555  53.584 39.080 1.00 26.05 ? 414  PHE A CA  1 
ATOM   3161 C  C   . PHE A 1 414 ? 16.888  54.906 38.663 1.00 25.70 ? 414  PHE A C   1 
ATOM   3162 O  O   . PHE A 1 414 ? 16.421  55.044 37.530 1.00 25.75 ? 414  PHE A O   1 
ATOM   3163 C  CB  . PHE A 1 414 ? 16.431  52.606 39.441 1.00 25.59 ? 414  PHE A CB  1 
ATOM   3164 C  CG  . PHE A 1 414 ? 16.861  51.177 39.540 1.00 27.49 ? 414  PHE A CG  1 
ATOM   3165 C  CD1 . PHE A 1 414 ? 17.439  50.533 38.463 1.00 29.40 ? 414  PHE A CD1 1 
ATOM   3166 C  CD2 . PHE A 1 414 ? 16.642  50.453 40.705 1.00 29.78 ? 414  PHE A CD2 1 
ATOM   3167 C  CE1 . PHE A 1 414 ? 17.790  49.173 38.544 1.00 31.36 ? 414  PHE A CE1 1 
ATOM   3168 C  CE2 . PHE A 1 414 ? 16.989  49.101 40.794 1.00 29.22 ? 414  PHE A CE2 1 
ATOM   3169 C  CZ  . PHE A 1 414 ? 17.560  48.462 39.713 1.00 30.08 ? 414  PHE A CZ  1 
ATOM   3170 N  N   . GLY A 1 415 ? 16.808  55.858 39.582 1.00 25.22 ? 415  GLY A N   1 
ATOM   3171 C  CA  . GLY A 1 415 ? 16.147  57.115 39.278 1.00 26.27 ? 415  GLY A CA  1 
ATOM   3172 C  C   . GLY A 1 415 ? 16.952  58.055 38.424 1.00 26.01 ? 415  GLY A C   1 
ATOM   3173 O  O   . GLY A 1 415 ? 18.144  57.839 38.220 1.00 27.06 ? 415  GLY A O   1 
ATOM   3174 N  N   . ASN A 1 416 ? 16.325  59.120 37.945 1.00 26.86 ? 416  ASN A N   1 
ATOM   3175 C  CA  . ASN A 1 416 ? 17.058  60.050 37.105 1.00 28.41 ? 416  ASN A CA  1 
ATOM   3176 C  C   . ASN A 1 416 ? 17.567  61.241 37.883 1.00 27.52 ? 416  ASN A C   1 
ATOM   3177 O  O   . ASN A 1 416 ? 17.317  62.391 37.515 1.00 28.65 ? 416  ASN A O   1 
ATOM   3178 C  CB  . ASN A 1 416 ? 16.241  60.501 35.882 1.00 29.95 ? 416  ASN A CB  1 
ATOM   3179 C  CG  . ASN A 1 416 ? 17.133  60.811 34.669 1.00 32.33 ? 416  ASN A CG  1 
ATOM   3180 O  OD1 . ASN A 1 416 ? 17.804  59.916 34.138 1.00 31.00 ? 416  ASN A OD1 1 
ATOM   3181 N  ND2 . ASN A 1 416 ? 17.167  62.074 34.249 1.00 31.63 ? 416  ASN A ND2 1 
ATOM   3182 N  N   . GLY A 1 417 ? 18.271  60.966 38.973 1.00 27.72 ? 417  GLY A N   1 
ATOM   3183 C  CA  . GLY A 1 417 ? 18.828  62.045 39.771 1.00 26.71 ? 417  GLY A CA  1 
ATOM   3184 C  C   . GLY A 1 417 ? 18.253  62.189 41.161 1.00 24.11 ? 417  GLY A C   1 
ATOM   3185 O  O   . GLY A 1 417 ? 17.043  62.224 41.352 1.00 23.01 ? 417  GLY A O   1 
ATOM   3186 N  N   . THR A 1 418 ? 19.139  62.302 42.135 1.00 23.96 ? 418  THR A N   1 
ATOM   3187 C  CA  . THR A 1 418 ? 18.735  62.450 43.516 1.00 24.09 ? 418  THR A CA  1 
ATOM   3188 C  C   . THR A 1 418 ? 19.475  63.615 44.141 1.00 23.51 ? 418  THR A C   1 
ATOM   3189 O  O   . THR A 1 418 ? 20.668  63.776 43.943 1.00 22.38 ? 418  THR A O   1 
ATOM   3190 C  CB  . THR A 1 418 ? 19.056  61.176 44.322 1.00 24.60 ? 418  THR A CB  1 
ATOM   3191 O  OG1 . THR A 1 418 ? 18.228  60.095 43.869 1.00 25.84 ? 418  THR A OG1 1 
ATOM   3192 C  CG2 . THR A 1 418 ? 18.818  61.410 45.798 1.00 23.77 ? 418  THR A CG2 1 
ATOM   3193 N  N   . TYR A 1 419 ? 18.752  64.466 44.847 1.00 24.02 ? 419  TYR A N   1 
ATOM   3194 C  CA  . TYR A 1 419 ? 19.377  65.592 45.516 1.00 25.39 ? 419  TYR A CA  1 
ATOM   3195 C  C   . TYR A 1 419 ? 18.967  65.457 46.968 1.00 24.68 ? 419  TYR A C   1 
ATOM   3196 O  O   . TYR A 1 419 ? 17.777  65.427 47.289 1.00 25.24 ? 419  TYR A O   1 
ATOM   3197 C  CB  . TYR A 1 419 ? 18.913  66.906 44.909 1.00 25.96 ? 419  TYR A CB  1 
ATOM   3198 C  CG  . TYR A 1 419 ? 19.291  67.030 43.453 1.00 27.58 ? 419  TYR A CG  1 
ATOM   3199 C  CD1 . TYR A 1 419 ? 18.434  66.570 42.461 1.00 29.27 ? 419  TYR A CD1 1 
ATOM   3200 C  CD2 . TYR A 1 419 ? 20.503  67.604 43.064 1.00 27.48 ? 419  TYR A CD2 1 
ATOM   3201 C  CE1 . TYR A 1 419 ? 18.762  66.671 41.121 1.00 30.99 ? 419  TYR A CE1 1 
ATOM   3202 C  CE2 . TYR A 1 419 ? 20.842  67.712 41.718 1.00 28.46 ? 419  TYR A CE2 1 
ATOM   3203 C  CZ  . TYR A 1 419 ? 19.961  67.238 40.754 1.00 29.89 ? 419  TYR A CZ  1 
ATOM   3204 O  OH  . TYR A 1 419 ? 20.260  67.306 39.415 1.00 33.38 ? 419  TYR A OH  1 
ATOM   3205 N  N   . LEU A 1 420 ? 19.961  65.303 47.829 1.00 22.42 ? 420  LEU A N   1 
ATOM   3206 C  CA  . LEU A 1 420 ? 19.734  65.099 49.247 1.00 21.89 ? 420  LEU A CA  1 
ATOM   3207 C  C   . LEU A 1 420 ? 20.262  66.246 50.079 1.00 21.75 ? 420  LEU A C   1 
ATOM   3208 O  O   . LEU A 1 420 ? 21.392  66.704 49.879 1.00 22.64 ? 420  LEU A O   1 
ATOM   3209 C  CB  . LEU A 1 420 ? 20.428  63.803 49.670 1.00 22.29 ? 420  LEU A CB  1 
ATOM   3210 C  CG  . LEU A 1 420 ? 20.320  63.307 51.101 1.00 20.54 ? 420  LEU A CG  1 
ATOM   3211 C  CD1 . LEU A 1 420 ? 18.869  63.027 51.424 1.00 23.26 ? 420  LEU A CD1 1 
ATOM   3212 C  CD2 . LEU A 1 420 ? 21.139  62.039 51.251 1.00 22.17 ? 420  LEU A CD2 1 
ATOM   3213 N  N   . TYR A 1 421 ? 19.456  66.706 51.026 1.00 20.91 ? 421  TYR A N   1 
ATOM   3214 C  CA  . TYR A 1 421 ? 19.884  67.790 51.896 1.00 20.13 ? 421  TYR A CA  1 
ATOM   3215 C  C   . TYR A 1 421 ? 19.812  67.351 53.345 1.00 21.33 ? 421  TYR A C   1 
ATOM   3216 O  O   . TYR A 1 421 ? 19.221  66.309 53.672 1.00 22.78 ? 421  TYR A O   1 
ATOM   3217 C  CB  . TYR A 1 421 ? 19.003  69.014 51.706 1.00 17.10 ? 421  TYR A CB  1 
ATOM   3218 C  CG  . TYR A 1 421 ? 17.579  68.808 52.140 1.00 16.37 ? 421  TYR A CG  1 
ATOM   3219 C  CD1 . TYR A 1 421 ? 17.115  69.332 53.338 1.00 14.16 ? 421  TYR A CD1 1 
ATOM   3220 C  CD2 . TYR A 1 421 ? 16.685  68.103 51.346 1.00 16.28 ? 421  TYR A CD2 1 
ATOM   3221 C  CE1 . TYR A 1 421 ? 15.797  69.158 53.733 1.00 13.26 ? 421  TYR A CE1 1 
ATOM   3222 C  CE2 . TYR A 1 421 ? 15.361  67.931 51.735 1.00 14.47 ? 421  TYR A CE2 1 
ATOM   3223 C  CZ  . TYR A 1 421 ? 14.930  68.457 52.925 1.00 12.67 ? 421  TYR A CZ  1 
ATOM   3224 O  OH  . TYR A 1 421 ? 13.633  68.275 53.314 1.00 14.91 ? 421  TYR A OH  1 
ATOM   3225 N  N   . PHE A 1 422 ? 20.421  68.152 54.210 1.00 20.21 ? 422  PHE A N   1 
ATOM   3226 C  CA  . PHE A 1 422 ? 20.418  67.900 55.641 1.00 16.57 ? 422  PHE A CA  1 
ATOM   3227 C  C   . PHE A 1 422 ? 20.106  69.236 56.255 1.00 16.48 ? 422  PHE A C   1 
ATOM   3228 O  O   . PHE A 1 422 ? 20.980  70.097 56.348 1.00 17.18 ? 422  PHE A O   1 
ATOM   3229 C  CB  . PHE A 1 422 ? 21.780  67.458 56.122 1.00 15.05 ? 422  PHE A CB  1 
ATOM   3230 C  CG  . PHE A 1 422 ? 21.791  67.038 57.555 1.00 17.94 ? 422  PHE A CG  1 
ATOM   3231 C  CD1 . PHE A 1 422 ? 20.914  66.064 58.006 1.00 17.49 ? 422  PHE A CD1 1 
ATOM   3232 C  CD2 . PHE A 1 422 ? 22.686  67.603 58.455 1.00 17.99 ? 422  PHE A CD2 1 
ATOM   3233 C  CE1 . PHE A 1 422 ? 20.931  65.661 59.323 1.00 16.73 ? 422  PHE A CE1 1 
ATOM   3234 C  CE2 . PHE A 1 422 ? 22.705  67.205 59.767 1.00 15.49 ? 422  PHE A CE2 1 
ATOM   3235 C  CZ  . PHE A 1 422 ? 21.830  66.235 60.202 1.00 17.14 ? 422  PHE A CZ  1 
ATOM   3236 N  N   . PHE A 1 423 ? 18.846  69.440 56.605 1.00 14.75 ? 423  PHE A N   1 
ATOM   3237 C  CA  . PHE A 1 423 ? 18.439  70.695 57.188 1.00 14.18 ? 423  PHE A CA  1 
ATOM   3238 C  C   . PHE A 1 423 ? 18.844  70.726 58.657 1.00 16.15 ? 423  PHE A C   1 
ATOM   3239 O  O   . PHE A 1 423 ? 18.273  70.025 59.500 1.00 16.66 ? 423  PHE A O   1 
ATOM   3240 C  CB  . PHE A 1 423 ? 16.935  70.877 57.040 1.00 15.66 ? 423  PHE A CB  1 
ATOM   3241 C  CG  . PHE A 1 423 ? 16.460  72.235 57.424 1.00 13.83 ? 423  PHE A CG  1 
ATOM   3242 C  CD1 . PHE A 1 423 ? 16.557  73.287 56.534 1.00 12.28 ? 423  PHE A CD1 1 
ATOM   3243 C  CD2 . PHE A 1 423 ? 15.926  72.465 58.680 1.00 13.27 ? 423  PHE A CD2 1 
ATOM   3244 C  CE1 . PHE A 1 423 ? 16.134  74.545 56.880 1.00 11.04 ? 423  PHE A CE1 1 
ATOM   3245 C  CE2 . PHE A 1 423 ? 15.500  73.726 59.032 1.00 15.03 ? 423  PHE A CE2 1 
ATOM   3246 C  CZ  . PHE A 1 423 ? 15.607  74.769 58.123 1.00 12.22 ? 423  PHE A CZ  1 
ATOM   3247 N  N   . ASN A 1 424 ? 19.867  71.511 58.948 1.00 14.94 ? 424  ASN A N   1 
ATOM   3248 C  CA  . ASN A 1 424 ? 20.358  71.649 60.290 1.00 13.26 ? 424  ASN A CA  1 
ATOM   3249 C  C   . ASN A 1 424 ? 20.288  73.125 60.637 1.00 16.10 ? 424  ASN A C   1 
ATOM   3250 O  O   . ASN A 1 424 ? 21.297  73.820 60.672 1.00 18.99 ? 424  ASN A O   1 
ATOM   3251 C  CB  . ASN A 1 424 ? 21.786  71.136 60.369 1.00 12.64 ? 424  ASN A CB  1 
ATOM   3252 C  CG  . ASN A 1 424 ? 22.709  71.860 59.432 1.00 16.00 ? 424  ASN A CG  1 
ATOM   3253 O  OD1 . ASN A 1 424 ? 22.264  72.587 58.544 1.00 20.08 ? 424  ASN A OD1 1 
ATOM   3254 N  ND2 . ASN A 1 424 ? 24.007  71.687 59.628 1.00 19.29 ? 424  ASN A ND2 1 
ATOM   3255 N  N   . HIS A 1 425 ? 19.079  73.617 60.863 1.00 17.25 ? 425  HIS A N   1 
ATOM   3256 C  CA  . HIS A 1 425 ? 18.889  75.016 61.210 1.00 17.74 ? 425  HIS A CA  1 
ATOM   3257 C  C   . HIS A 1 425 ? 17.720  75.201 62.151 1.00 20.75 ? 425  HIS A C   1 
ATOM   3258 O  O   . HIS A 1 425 ? 16.573  74.915 61.799 1.00 22.14 ? 425  HIS A O   1 
ATOM   3259 C  CB  . HIS A 1 425 ? 18.654  75.863 59.969 1.00 16.01 ? 425  HIS A CB  1 
ATOM   3260 C  CG  . HIS A 1 425 ? 18.335  77.293 60.275 1.00 13.43 ? 425  HIS A CG  1 
ATOM   3261 N  ND1 . HIS A 1 425 ? 19.307  78.239 60.517 1.00 14.04 ? 425  HIS A ND1 1 
ATOM   3262 C  CD2 . HIS A 1 425 ? 17.150  77.936 60.385 1.00 12.86 ? 425  HIS A CD2 1 
ATOM   3263 C  CE1 . HIS A 1 425 ? 18.735  79.404 60.762 1.00 12.90 ? 425  HIS A CE1 1 
ATOM   3264 N  NE2 . HIS A 1 425 ? 17.426  79.246 60.686 1.00 12.68 ? 425  HIS A NE2 1 
ATOM   3265 N  N   . ARG A 1 426 ? 18.013  75.694 63.347 1.00 23.21 ? 426  ARG A N   1 
ATOM   3266 C  CA  . ARG A 1 426 ? 16.974  75.930 64.327 1.00 23.94 ? 426  ARG A CA  1 
ATOM   3267 C  C   . ARG A 1 426 ? 16.469  77.338 64.074 1.00 23.40 ? 426  ARG A C   1 
ATOM   3268 O  O   . ARG A 1 426 ? 17.204  78.320 64.236 1.00 23.16 ? 426  ARG A O   1 
ATOM   3269 C  CB  . ARG A 1 426 ? 17.517  75.790 65.757 1.00 25.71 ? 426  ARG A CB  1 
ATOM   3270 C  CG  . ARG A 1 426 ? 16.409  75.739 66.807 1.00 30.30 ? 426  ARG A CG  1 
ATOM   3271 C  CD  . ARG A 1 426 ? 16.929  75.717 68.227 1.00 30.60 ? 426  ARG A CD  1 
ATOM   3272 N  NE  . ARG A 1 426 ? 15.907  76.178 69.170 1.00 32.04 ? 426  ARG A NE  1 
ATOM   3273 C  CZ  . ARG A 1 426 ? 15.639  77.463 69.416 1.00 34.84 ? 426  ARG A CZ  1 
ATOM   3274 N  NH1 . ARG A 1 426 ? 16.305  78.434 68.782 1.00 34.39 ? 426  ARG A NH1 1 
ATOM   3275 N  NH2 . ARG A 1 426 ? 14.748  77.788 70.348 1.00 34.40 ? 426  ARG A NH2 1 
ATOM   3276 N  N   . ALA A 1 427 ? 15.246  77.429 63.574 1.00 22.52 ? 427  ALA A N   1 
ATOM   3277 C  CA  . ALA A 1 427 ? 14.646  78.716 63.300 1.00 22.76 ? 427  ALA A CA  1 
ATOM   3278 C  C   . ALA A 1 427 ? 14.824  79.601 64.532 1.00 22.72 ? 427  ALA A C   1 
ATOM   3279 O  O   . ALA A 1 427 ? 14.339  79.286 65.613 1.00 23.39 ? 427  ALA A O   1 
ATOM   3280 C  CB  . ALA A 1 427 ? 13.165  78.544 62.972 1.00 22.84 ? 427  ALA A CB  1 
ATOM   3281 N  N   . SER A 1 428 ? 15.567  80.685 64.372 1.00 22.88 ? 428  SER A N   1 
ATOM   3282 C  CA  . SER A 1 428 ? 15.816  81.625 65.453 1.00 23.50 ? 428  SER A CA  1 
ATOM   3283 C  C   . SER A 1 428 ? 14.569  82.055 66.219 1.00 22.82 ? 428  SER A C   1 
ATOM   3284 O  O   . SER A 1 428 ? 14.669  82.505 67.358 1.00 25.64 ? 428  SER A O   1 
ATOM   3285 C  CB  . SER A 1 428 ? 16.505  82.874 64.913 1.00 22.45 ? 428  SER A CB  1 
ATOM   3286 O  OG  . SER A 1 428 ? 15.599  83.649 64.159 1.00 21.16 ? 428  SER A OG  1 
ATOM   3287 N  N   . ASN A 1 429 ? 13.404  81.947 65.604 1.00 20.89 ? 429  ASN A N   1 
ATOM   3288 C  CA  . ASN A 1 429 ? 12.189  82.365 66.283 1.00 21.44 ? 429  ASN A CA  1 
ATOM   3289 C  C   . ASN A 1 429 ? 11.374  81.182 66.757 1.00 22.29 ? 429  ASN A C   1 
ATOM   3290 O  O   . ASN A 1 429 ? 10.168  81.312 66.963 1.00 25.14 ? 429  ASN A O   1 
ATOM   3291 C  CB  . ASN A 1 429 ? 11.333  83.202 65.341 1.00 21.67 ? 429  ASN A CB  1 
ATOM   3292 C  CG  . ASN A 1 429 ? 10.713  82.372 64.256 1.00 22.25 ? 429  ASN A CG  1 
ATOM   3293 O  OD1 . ASN A 1 429 ? 11.244  81.323 63.885 1.00 20.59 ? 429  ASN A OD1 1 
ATOM   3294 N  ND2 . ASN A 1 429 ? 9.573   82.811 63.756 1.00 27.05 ? 429  ASN A ND2 1 
ATOM   3295 N  N   . LEU A 1 430 ? 12.014  80.027 66.902 1.00 22.94 ? 430  LEU A N   1 
ATOM   3296 C  CA  . LEU A 1 430 ? 11.315  78.817 67.328 1.00 21.43 ? 430  LEU A CA  1 
ATOM   3297 C  C   . LEU A 1 430 ? 10.774  79.021 68.734 1.00 21.24 ? 430  LEU A C   1 
ATOM   3298 O  O   . LEU A 1 430 ? 11.282  79.853 69.477 1.00 24.08 ? 430  LEU A O   1 
ATOM   3299 C  CB  . LEU A 1 430 ? 12.261  77.607 67.272 1.00 19.41 ? 430  LEU A CB  1 
ATOM   3300 C  CG  . LEU A 1 430 ? 11.653  76.280 66.793 1.00 18.98 ? 430  LEU A CG  1 
ATOM   3301 C  CD1 . LEU A 1 430 ? 11.012  76.475 65.442 1.00 18.18 ? 430  LEU A CD1 1 
ATOM   3302 C  CD2 . LEU A 1 430 ? 12.712  75.196 66.712 1.00 18.59 ? 430  LEU A CD2 1 
ATOM   3303 N  N   . VAL A 1 431 ? 9.698   78.324 69.070 1.00 20.89 ? 431  VAL A N   1 
ATOM   3304 C  CA  . VAL A 1 431 ? 9.107   78.445 70.404 1.00 21.32 ? 431  VAL A CA  1 
ATOM   3305 C  C   . VAL A 1 431 ? 9.359   77.198 71.248 1.00 21.39 ? 431  VAL A C   1 
ATOM   3306 O  O   . VAL A 1 431 ? 9.091   77.173 72.446 1.00 20.26 ? 431  VAL A O   1 
ATOM   3307 C  CB  . VAL A 1 431 ? 7.596   78.698 70.323 1.00 21.17 ? 431  VAL A CB  1 
ATOM   3308 C  CG1 . VAL A 1 431 ? 7.333   80.083 69.761 1.00 24.24 ? 431  VAL A CG1 1 
ATOM   3309 C  CG2 . VAL A 1 431 ? 6.939   77.652 69.448 1.00 20.63 ? 431  VAL A CG2 1 
ATOM   3310 N  N   . TRP A 1 432 ? 9.847   76.152 70.598 1.00 20.23 ? 432  TRP A N   1 
ATOM   3311 C  CA  . TRP A 1 432 ? 10.136  74.904 71.264 1.00 17.34 ? 432  TRP A CA  1 
ATOM   3312 C  C   . TRP A 1 432 ? 11.479  75.013 71.955 1.00 17.72 ? 432  TRP A C   1 
ATOM   3313 O  O   . TRP A 1 432 ? 12.313  75.846 71.597 1.00 18.43 ? 432  TRP A O   1 
ATOM   3314 C  CB  . TRP A 1 432 ? 10.182  73.777 70.248 1.00 16.92 ? 432  TRP A CB  1 
ATOM   3315 C  CG  . TRP A 1 432 ? 8.859   73.347 69.764 1.00 17.20 ? 432  TRP A CG  1 
ATOM   3316 C  CD1 . TRP A 1 432 ? 8.306   73.611 68.552 1.00 15.13 ? 432  TRP A CD1 1 
ATOM   3317 C  CD2 . TRP A 1 432 ? 7.919   72.523 70.466 1.00 20.17 ? 432  TRP A CD2 1 
ATOM   3318 N  NE1 . TRP A 1 432 ? 7.084   73.000 68.448 1.00 16.28 ? 432  TRP A NE1 1 
ATOM   3319 C  CE2 . TRP A 1 432 ? 6.821   72.323 69.608 1.00 18.03 ? 432  TRP A CE2 1 
ATOM   3320 C  CE3 . TRP A 1 432 ? 7.900   71.936 71.738 1.00 20.73 ? 432  TRP A CE3 1 
ATOM   3321 C  CZ2 . TRP A 1 432 ? 5.711   71.560 69.978 1.00 19.89 ? 432  TRP A CZ2 1 
ATOM   3322 C  CZ3 . TRP A 1 432 ? 6.797   71.181 72.106 1.00 21.59 ? 432  TRP A CZ3 1 
ATOM   3323 C  CH2 . TRP A 1 432 ? 5.717   71.000 71.230 1.00 20.80 ? 432  TRP A CH2 1 
ATOM   3324 N  N   . PRO A 1 433 ? 11.723  74.139 72.935 1.00 16.79 ? 433  PRO A N   1 
ATOM   3325 C  CA  . PRO A 1 433 ? 12.970  74.123 73.692 1.00 16.55 ? 433  PRO A CA  1 
ATOM   3326 C  C   . PRO A 1 433 ? 14.180  73.975 72.782 1.00 18.51 ? 433  PRO A C   1 
ATOM   3327 O  O   . PRO A 1 433 ? 14.161  73.229 71.805 1.00 21.33 ? 433  PRO A O   1 
ATOM   3328 C  CB  . PRO A 1 433 ? 12.804  72.899 74.578 1.00 15.57 ? 433  PRO A CB  1 
ATOM   3329 C  CG  . PRO A 1 433 ? 11.354  72.779 74.728 1.00 15.93 ? 433  PRO A CG  1 
ATOM   3330 C  CD  . PRO A 1 433 ? 10.838  73.052 73.377 1.00 16.31 ? 433  PRO A CD  1 
ATOM   3331 N  N   . GLU A 1 434 ? 15.260  74.638 73.160 1.00 20.56 ? 434  GLU A N   1 
ATOM   3332 C  CA  . GLU A 1 434 ? 16.493  74.610 72.398 1.00 21.88 ? 434  GLU A CA  1 
ATOM   3333 C  C   . GLU A 1 434 ? 17.062  73.196 72.277 1.00 22.04 ? 434  GLU A C   1 
ATOM   3334 O  O   . GLU A 1 434 ? 17.735  72.881 71.296 1.00 23.69 ? 434  GLU A O   1 
ATOM   3335 C  CB  . GLU A 1 434 ? 17.520  75.515 73.082 1.00 25.53 ? 434  GLU A CB  1 
ATOM   3336 C  CG  . GLU A 1 434 ? 18.518  76.206 72.150 1.00 34.46 ? 434  GLU A CG  1 
ATOM   3337 C  CD  . GLU A 1 434 ? 18.117  77.651 71.799 1.00 39.83 ? 434  GLU A CD  1 
ATOM   3338 O  OE1 . GLU A 1 434 ? 18.415  78.095 70.656 1.00 43.25 ? 434  GLU A OE1 1 
ATOM   3339 O  OE2 . GLU A 1 434 ? 17.514  78.345 72.668 1.00 43.07 ? 434  GLU A OE2 1 
ATOM   3340 N  N   . TRP A 1 435 ? 16.782  72.341 73.259 1.00 21.84 ? 435  TRP A N   1 
ATOM   3341 C  CA  . TRP A 1 435 ? 17.330  70.988 73.260 1.00 20.82 ? 435  TRP A CA  1 
ATOM   3342 C  C   . TRP A 1 435 ? 16.787  70.116 72.143 1.00 22.27 ? 435  TRP A C   1 
ATOM   3343 O  O   . TRP A 1 435 ? 17.478  69.220 71.645 1.00 24.44 ? 435  TRP A O   1 
ATOM   3344 C  CB  . TRP A 1 435 ? 17.167  70.312 74.636 1.00 19.99 ? 435  TRP A CB  1 
ATOM   3345 C  CG  . TRP A 1 435 ? 15.758  70.079 75.073 1.00 20.29 ? 435  TRP A CG  1 
ATOM   3346 C  CD1 . TRP A 1 435 ? 14.979  70.934 75.783 1.00 20.70 ? 435  TRP A CD1 1 
ATOM   3347 C  CD2 . TRP A 1 435 ? 14.942  68.928 74.789 1.00 19.92 ? 435  TRP A CD2 1 
ATOM   3348 N  NE1 . TRP A 1 435 ? 13.721  70.400 75.951 1.00 21.15 ? 435  TRP A NE1 1 
ATOM   3349 C  CE2 . TRP A 1 435 ? 13.671  69.171 75.351 1.00 20.30 ? 435  TRP A CE2 1 
ATOM   3350 C  CE3 . TRP A 1 435 ? 15.160  67.721 74.110 1.00 20.10 ? 435  TRP A CE3 1 
ATOM   3351 C  CZ2 . TRP A 1 435 ? 12.617  68.252 75.254 1.00 22.01 ? 435  TRP A CZ2 1 
ATOM   3352 C  CZ3 . TRP A 1 435 ? 14.114  66.807 74.012 1.00 19.31 ? 435  TRP A CZ3 1 
ATOM   3353 C  CH2 . TRP A 1 435 ? 12.858  67.080 74.581 1.00 20.85 ? 435  TRP A CH2 1 
ATOM   3354 N  N   . MET A 1 436 ? 15.554  70.385 71.737 1.00 22.11 ? 436  MET A N   1 
ATOM   3355 C  CA  . MET A 1 436 ? 14.938  69.624 70.663 1.00 21.83 ? 436  MET A CA  1 
ATOM   3356 C  C   . MET A 1 436 ? 15.691  69.936 69.380 1.00 22.35 ? 436  MET A C   1 
ATOM   3357 O  O   . MET A 1 436 ? 15.670  69.158 68.441 1.00 23.61 ? 436  MET A O   1 
ATOM   3358 C  CB  . MET A 1 436 ? 13.472  70.013 70.513 1.00 21.37 ? 436  MET A CB  1 
ATOM   3359 C  CG  . MET A 1 436 ? 12.663  69.817 71.765 1.00 18.09 ? 436  MET A CG  1 
ATOM   3360 S  SD  . MET A 1 436 ? 10.958  70.275 71.508 1.00 20.14 ? 436  MET A SD  1 
ATOM   3361 C  CE  . MET A 1 436 ? 10.387  68.836 70.707 1.00 19.21 ? 436  MET A CE  1 
ATOM   3362 N  N   . GLY A 1 437 ? 16.344  71.092 69.354 1.00 23.54 ? 437  GLY A N   1 
ATOM   3363 C  CA  . GLY A 1 437 ? 17.118  71.506 68.199 1.00 22.83 ? 437  GLY A CA  1 
ATOM   3364 C  C   . GLY A 1 437 ? 16.305  71.673 66.937 1.00 21.87 ? 437  GLY A C   1 
ATOM   3365 O  O   . GLY A 1 437 ? 15.196  72.200 66.974 1.00 24.25 ? 437  GLY A O   1 
ATOM   3366 N  N   . VAL A 1 438 ? 16.894  71.285 65.810 1.00 20.83 ? 438  VAL A N   1 
ATOM   3367 C  CA  . VAL A 1 438 ? 16.238  71.368 64.510 1.00 18.49 ? 438  VAL A CA  1 
ATOM   3368 C  C   . VAL A 1 438 ? 15.173  70.284 64.503 1.00 16.22 ? 438  VAL A C   1 
ATOM   3369 O  O   . VAL A 1 438 ? 15.457  69.126 64.226 1.00 15.92 ? 438  VAL A O   1 
ATOM   3370 C  CB  . VAL A 1 438 ? 17.231  71.120 63.376 1.00 16.43 ? 438  VAL A CB  1 
ATOM   3371 C  CG1 . VAL A 1 438 ? 16.535  71.295 62.048 1.00 22.24 ? 438  VAL A CG1 1 
ATOM   3372 C  CG2 . VAL A 1 438 ? 18.413  72.065 63.493 1.00 13.95 ? 438  VAL A CG2 1 
ATOM   3373 N  N   . ILE A 1 439 ? 13.948  70.683 64.811 1.00 14.67 ? 439  ILE A N   1 
ATOM   3374 C  CA  . ILE A 1 439 ? 12.825  69.770 64.917 1.00 14.28 ? 439  ILE A CA  1 
ATOM   3375 C  C   . ILE A 1 439 ? 12.185  69.279 63.626 1.00 14.24 ? 439  ILE A C   1 
ATOM   3376 O  O   . ILE A 1 439 ? 12.020  70.007 62.646 1.00 13.44 ? 439  ILE A O   1 
ATOM   3377 C  CB  . ILE A 1 439 ? 11.730  70.385 65.824 1.00 14.20 ? 439  ILE A CB  1 
ATOM   3378 C  CG1 . ILE A 1 439 ? 12.348  70.814 67.153 1.00 14.69 ? 439  ILE A CG1 1 
ATOM   3379 C  CG2 . ILE A 1 439 ? 10.598  69.397 66.082 1.00 11.29 ? 439  ILE A CG2 1 
ATOM   3380 C  CD1 . ILE A 1 439 ? 11.579  71.897 67.849 1.00 13.09 ? 439  ILE A CD1 1 
ATOM   3381 N  N   . HIS A 1 440 ? 11.769  68.028 63.683 1.00 14.01 ? 440  HIS A N   1 
ATOM   3382 C  CA  . HIS A 1 440 ? 11.098  67.348 62.598 1.00 13.04 ? 440  HIS A CA  1 
ATOM   3383 C  C   . HIS A 1 440 ? 9.866   68.166 62.264 1.00 12.78 ? 440  HIS A C   1 
ATOM   3384 O  O   . HIS A 1 440 ? 9.045   68.436 63.127 1.00 12.40 ? 440  HIS A O   1 
ATOM   3385 C  CB  . HIS A 1 440 ? 10.745  65.941 63.081 1.00 7.77  ? 440  HIS A CB  1 
ATOM   3386 C  CG  . HIS A 1 440 ? 9.707   65.238 62.272 1.00 8.88  ? 440  HIS A CG  1 
ATOM   3387 N  ND1 . HIS A 1 440 ? 10.025  64.311 61.306 1.00 11.55 ? 440  HIS A ND1 1 
ATOM   3388 C  CD2 . HIS A 1 440 ? 8.357   65.217 62.381 1.00 11.52 ? 440  HIS A CD2 1 
ATOM   3389 C  CE1 . HIS A 1 440 ? 8.920   63.741 60.862 1.00 13.26 ? 440  HIS A CE1 1 
ATOM   3390 N  NE2 . HIS A 1 440 ? 7.893   64.272 61.499 1.00 13.73 ? 440  HIS A NE2 1 
ATOM   3391 N  N   . GLY A 1 441 ? 9.801   68.647 61.028 1.00 14.81 ? 441  GLY A N   1 
ATOM   3392 C  CA  . GLY A 1 441 ? 8.653   69.421 60.601 1.00 12.99 ? 441  GLY A CA  1 
ATOM   3393 C  C   . GLY A 1 441 ? 8.875   70.902 60.683 1.00 13.23 ? 441  GLY A C   1 
ATOM   3394 O  O   . GLY A 1 441 ? 7.967   71.674 60.417 1.00 12.68 ? 441  GLY A O   1 
ATOM   3395 N  N   . TYR A 1 442 ? 10.087  71.315 61.023 1.00 16.14 ? 442  TYR A N   1 
ATOM   3396 C  CA  . TYR A 1 442 ? 10.361  72.736 61.116 1.00 16.42 ? 442  TYR A CA  1 
ATOM   3397 C  C   . TYR A 1 442 ? 11.140  73.362 59.980 1.00 18.37 ? 442  TYR A C   1 
ATOM   3398 O  O   . TYR A 1 442 ? 11.626  74.491 60.089 1.00 21.05 ? 442  TYR A O   1 
ATOM   3399 C  CB  . TYR A 1 442 ? 10.908  73.098 62.492 1.00 16.34 ? 442  TYR A CB  1 
ATOM   3400 C  CG  . TYR A 1 442 ? 9.770   73.204 63.478 1.00 15.85 ? 442  TYR A CG  1 
ATOM   3401 C  CD1 . TYR A 1 442 ? 9.280   72.075 64.121 1.00 14.71 ? 442  TYR A CD1 1 
ATOM   3402 C  CD2 . TYR A 1 442 ? 9.116   74.413 63.686 1.00 13.10 ? 442  TYR A CD2 1 
ATOM   3403 C  CE1 . TYR A 1 442 ? 8.176   72.145 64.933 1.00 12.26 ? 442  TYR A CE1 1 
ATOM   3404 C  CE2 . TYR A 1 442 ? 8.007   74.488 64.498 1.00 12.51 ? 442  TYR A CE2 1 
ATOM   3405 C  CZ  . TYR A 1 442 ? 7.545   73.347 65.115 1.00 11.19 ? 442  TYR A CZ  1 
ATOM   3406 O  OH  . TYR A 1 442 ? 6.440   73.395 65.914 1.00 13.70 ? 442  TYR A OH  1 
ATOM   3407 N  N   . GLU A 1 443 ? 11.232  72.629 58.875 1.00 20.43 ? 443  GLU A N   1 
ATOM   3408 C  CA  . GLU A 1 443 ? 11.900  73.124 57.679 1.00 18.35 ? 443  GLU A CA  1 
ATOM   3409 C  C   . GLU A 1 443 ? 10.795  73.599 56.748 1.00 17.49 ? 443  GLU A C   1 
ATOM   3410 O  O   . GLU A 1 443 ? 11.042  74.364 55.825 1.00 18.74 ? 443  GLU A O   1 
ATOM   3411 C  CB  . GLU A 1 443 ? 12.716  72.022 57.002 1.00 18.59 ? 443  GLU A CB  1 
ATOM   3412 C  CG  . GLU A 1 443 ? 11.942  71.109 56.052 1.00 18.57 ? 443  GLU A CG  1 
ATOM   3413 C  CD  . GLU A 1 443 ? 11.113  70.053 56.750 1.00 16.59 ? 443  GLU A CD  1 
ATOM   3414 O  OE1 . GLU A 1 443 ? 11.670  69.261 57.524 1.00 21.30 ? 443  GLU A OE1 1 
ATOM   3415 O  OE2 . GLU A 1 443 ? 9.903   69.985 56.495 1.00 16.21 ? 443  GLU A OE2 1 
ATOM   3416 N  N   . ILE A 1 444 ? 9.570   73.148 57.022 1.00 16.34 ? 444  ILE A N   1 
ATOM   3417 C  CA  . ILE A 1 444 ? 8.401   73.502 56.227 1.00 14.25 ? 444  ILE A CA  1 
ATOM   3418 C  C   . ILE A 1 444 ? 8.232   75.007 56.169 1.00 17.57 ? 444  ILE A C   1 
ATOM   3419 O  O   . ILE A 1 444 ? 8.227   75.589 55.092 1.00 22.54 ? 444  ILE A O   1 
ATOM   3420 C  CB  . ILE A 1 444 ? 7.110   72.893 56.792 1.00 10.92 ? 444  ILE A CB  1 
ATOM   3421 C  CG1 . ILE A 1 444 ? 7.196   71.366 56.792 1.00 9.28  ? 444  ILE A CG1 1 
ATOM   3422 C  CG2 . ILE A 1 444 ? 5.918   73.356 55.966 1.00 11.54 ? 444  ILE A CG2 1 
ATOM   3423 C  CD1 . ILE A 1 444 ? 6.033   70.668 57.433 1.00 4.04  ? 444  ILE A CD1 1 
ATOM   3424 N  N   . GLU A 1 445 ? 8.156   75.650 57.328 1.00 19.07 ? 445  GLU A N   1 
ATOM   3425 C  CA  . GLU A 1 445 ? 7.987   77.097 57.381 1.00 17.91 ? 445  GLU A CA  1 
ATOM   3426 C  C   . GLU A 1 445 ? 9.002   77.814 56.524 1.00 15.98 ? 445  GLU A C   1 
ATOM   3427 O  O   . GLU A 1 445 ? 8.821   78.980 56.216 1.00 16.19 ? 445  GLU A O   1 
ATOM   3428 C  CB  . GLU A 1 445 ? 8.065   77.599 58.815 1.00 19.59 ? 445  GLU A CB  1 
ATOM   3429 C  CG  . GLU A 1 445 ? 9.334   77.225 59.519 1.00 20.88 ? 445  GLU A CG  1 
ATOM   3430 C  CD  . GLU A 1 445 ? 9.259   77.499 60.993 1.00 22.47 ? 445  GLU A CD  1 
ATOM   3431 O  OE1 . GLU A 1 445 ? 10.118  78.265 61.483 1.00 22.05 ? 445  GLU A OE1 1 
ATOM   3432 O  OE2 . GLU A 1 445 ? 8.346   76.950 61.654 1.00 19.80 ? 445  GLU A OE2 1 
ATOM   3433 N  N   . PHE A 1 446 ? 10.088  77.132 56.180 1.00 16.00 ? 446  PHE A N   1 
ATOM   3434 C  CA  . PHE A 1 446 ? 11.110  77.706 55.318 1.00 17.59 ? 446  PHE A CA  1 
ATOM   3435 C  C   . PHE A 1 446 ? 10.738  77.389 53.880 1.00 17.73 ? 446  PHE A C   1 
ATOM   3436 O  O   . PHE A 1 446 ? 10.667  78.278 53.037 1.00 18.77 ? 446  PHE A O   1 
ATOM   3437 C  CB  . PHE A 1 446 ? 12.491  77.151 55.652 1.00 15.55 ? 446  PHE A CB  1 
ATOM   3438 C  CG  . PHE A 1 446 ? 13.141  77.822 56.821 1.00 16.54 ? 446  PHE A CG  1 
ATOM   3439 C  CD1 . PHE A 1 446 ? 12.988  77.318 58.099 1.00 18.08 ? 446  PHE A CD1 1 
ATOM   3440 C  CD2 . PHE A 1 446 ? 13.915  78.955 56.639 1.00 17.67 ? 446  PHE A CD2 1 
ATOM   3441 C  CE1 . PHE A 1 446 ? 13.599  77.932 59.181 1.00 19.97 ? 446  PHE A CE1 1 
ATOM   3442 C  CE2 . PHE A 1 446 ? 14.529  79.577 57.706 1.00 18.05 ? 446  PHE A CE2 1 
ATOM   3443 C  CZ  . PHE A 1 446 ? 14.374  79.069 58.982 1.00 20.26 ? 446  PHE A CZ  1 
ATOM   3444 N  N   . VAL A 1 447 ? 10.457  76.118 53.616 1.00 17.98 ? 447  VAL A N   1 
ATOM   3445 C  CA  . VAL A 1 447 ? 10.055  75.673 52.289 1.00 16.19 ? 447  VAL A CA  1 
ATOM   3446 C  C   . VAL A 1 447 ? 8.857   76.489 51.804 1.00 15.84 ? 447  VAL A C   1 
ATOM   3447 O  O   . VAL A 1 447 ? 8.720   76.725 50.609 1.00 17.61 ? 447  VAL A O   1 
ATOM   3448 C  CB  . VAL A 1 447 ? 9.675   74.176 52.299 1.00 15.26 ? 447  VAL A CB  1 
ATOM   3449 C  CG1 . VAL A 1 447 ? 9.042   73.773 50.982 1.00 14.78 ? 447  VAL A CG1 1 
ATOM   3450 C  CG2 . VAL A 1 447 ? 10.899  73.340 52.553 1.00 14.94 ? 447  VAL A CG2 1 
ATOM   3451 N  N   . PHE A 1 448 ? 8.010   76.936 52.731 1.00 14.03 ? 448  PHE A N   1 
ATOM   3452 C  CA  . PHE A 1 448 ? 6.830   77.719 52.387 1.00 12.82 ? 448  PHE A CA  1 
ATOM   3453 C  C   . PHE A 1 448 ? 6.999   79.212 52.536 1.00 14.61 ? 448  PHE A C   1 
ATOM   3454 O  O   . PHE A 1 448 ? 6.029   79.961 52.676 1.00 14.73 ? 448  PHE A O   1 
ATOM   3455 C  CB  . PHE A 1 448 ? 5.619   77.220 53.143 1.00 11.80 ? 448  PHE A CB  1 
ATOM   3456 C  CG  . PHE A 1 448 ? 5.044   75.967 52.562 1.00 13.90 ? 448  PHE A CG  1 
ATOM   3457 C  CD1 . PHE A 1 448 ? 3.792   75.976 51.961 1.00 13.37 ? 448  PHE A CD1 1 
ATOM   3458 C  CD2 . PHE A 1 448 ? 5.773   74.787 52.568 1.00 11.49 ? 448  PHE A CD2 1 
ATOM   3459 C  CE1 . PHE A 1 448 ? 3.278   74.835 51.374 1.00 12.77 ? 448  PHE A CE1 1 
ATOM   3460 C  CE2 . PHE A 1 448 ? 5.266   73.644 51.982 1.00 13.57 ? 448  PHE A CE2 1 
ATOM   3461 C  CZ  . PHE A 1 448 ? 4.017   73.668 51.384 1.00 13.93 ? 448  PHE A CZ  1 
ATOM   3462 N  N   . GLY A 1 449 ? 8.265   79.620 52.502 1.00 17.56 ? 449  GLY A N   1 
ATOM   3463 C  CA  . GLY A 1 449 ? 8.659   81.012 52.578 1.00 16.92 ? 449  GLY A CA  1 
ATOM   3464 C  C   . GLY A 1 449 ? 8.170   81.877 53.706 1.00 18.14 ? 449  GLY A C   1 
ATOM   3465 O  O   . GLY A 1 449 ? 8.184   83.100 53.564 1.00 20.35 ? 449  GLY A O   1 
ATOM   3466 N  N   . LEU A 1 450 ? 7.793   81.281 54.834 1.00 19.29 ? 450  LEU A N   1 
ATOM   3467 C  CA  . LEU A 1 450 ? 7.314   82.059 55.975 1.00 18.68 ? 450  LEU A CA  1 
ATOM   3468 C  C   . LEU A 1 450 ? 8.261   83.160 56.439 1.00 17.36 ? 450  LEU A C   1 
ATOM   3469 O  O   . LEU A 1 450 ? 7.810   84.240 56.782 1.00 19.58 ? 450  LEU A O   1 
ATOM   3470 C  CB  . LEU A 1 450 ? 6.930   81.158 57.136 1.00 19.02 ? 450  LEU A CB  1 
ATOM   3471 C  CG  . LEU A 1 450 ? 5.422   81.019 57.283 1.00 19.39 ? 450  LEU A CG  1 
ATOM   3472 C  CD1 . LEU A 1 450 ? 4.818   80.449 56.017 1.00 19.66 ? 450  LEU A CD1 1 
ATOM   3473 C  CD2 . LEU A 1 450 ? 5.119   80.144 58.472 1.00 21.61 ? 450  LEU A CD2 1 
ATOM   3474 N  N   . PRO A 1 451 ? 9.581   82.906 56.464 1.00 15.70 ? 451  PRO A N   1 
ATOM   3475 C  CA  . PRO A 1 451 ? 10.511  83.949 56.892 1.00 17.78 ? 451  PRO A CA  1 
ATOM   3476 C  C   . PRO A 1 451 ? 10.296  85.262 56.138 1.00 21.70 ? 451  PRO A C   1 
ATOM   3477 O  O   . PRO A 1 451 ? 10.679  86.334 56.602 1.00 25.00 ? 451  PRO A O   1 
ATOM   3478 C  CB  . PRO A 1 451 ? 11.858  83.339 56.548 1.00 15.49 ? 451  PRO A CB  1 
ATOM   3479 C  CG  . PRO A 1 451 ? 11.648  81.916 56.877 1.00 13.64 ? 451  PRO A CG  1 
ATOM   3480 C  CD  . PRO A 1 451 ? 10.291  81.627 56.293 1.00 14.50 ? 451  PRO A CD  1 
ATOM   3481 N  N   . LEU A 1 452 ? 9.682   85.170 54.966 1.00 25.40 ? 452  LEU A N   1 
ATOM   3482 C  CA  . LEU A 1 452 ? 9.419   86.347 54.150 1.00 27.68 ? 452  LEU A CA  1 
ATOM   3483 C  C   . LEU A 1 452 ? 8.539   87.346 54.880 1.00 28.97 ? 452  LEU A C   1 
ATOM   3484 O  O   . LEU A 1 452 ? 8.832   88.545 54.899 1.00 30.41 ? 452  LEU A O   1 
ATOM   3485 C  CB  . LEU A 1 452 ? 8.761   85.945 52.830 1.00 26.73 ? 452  LEU A CB  1 
ATOM   3486 C  CG  . LEU A 1 452 ? 9.680   85.654 51.648 1.00 23.53 ? 452  LEU A CG  1 
ATOM   3487 C  CD1 . LEU A 1 452 ? 10.728  84.621 52.004 1.00 22.49 ? 452  LEU A CD1 1 
ATOM   3488 C  CD2 . LEU A 1 452 ? 8.820   85.197 50.490 1.00 24.65 ? 452  LEU A CD2 1 
ATOM   3489 N  N   . VAL A 1 453 ? 7.444   86.867 55.454 1.00 29.61 ? 453  VAL A N   1 
ATOM   3490 C  CA  . VAL A 1 453 ? 6.561   87.766 56.176 1.00 32.32 ? 453  VAL A CA  1 
ATOM   3491 C  C   . VAL A 1 453 ? 7.285   88.257 57.441 1.00 35.20 ? 453  VAL A C   1 
ATOM   3492 O  O   . VAL A 1 453 ? 7.612   87.473 58.337 1.00 35.79 ? 453  VAL A O   1 
ATOM   3493 C  CB  . VAL A 1 453 ? 5.180   87.114 56.479 1.00 31.17 ? 453  VAL A CB  1 
ATOM   3494 C  CG1 . VAL A 1 453 ? 5.211   85.615 56.233 1.00 30.27 ? 453  VAL A CG1 1 
ATOM   3495 C  CG2 . VAL A 1 453 ? 4.727   87.427 57.891 1.00 30.58 ? 453  VAL A CG2 1 
ATOM   3496 N  N   . LYS A 1 454 ? 7.575   89.558 57.480 1.00 38.07 ? 454  LYS A N   1 
ATOM   3497 C  CA  . LYS A 1 454 ? 8.281   90.171 58.609 1.00 38.29 ? 454  LYS A CA  1 
ATOM   3498 C  C   . LYS A 1 454 ? 7.548   90.019 59.933 1.00 37.08 ? 454  LYS A C   1 
ATOM   3499 O  O   . LYS A 1 454 ? 8.168   89.955 60.992 1.00 35.74 ? 454  LYS A O   1 
ATOM   3500 C  CB  . LYS A 1 454 ? 8.522   91.666 58.348 1.00 40.79 ? 454  LYS A CB  1 
ATOM   3501 C  CG  . LYS A 1 454 ? 9.678   91.978 57.374 1.00 46.50 ? 454  LYS A CG  1 
ATOM   3502 C  CD  . LYS A 1 454 ? 9.378   91.557 55.917 1.00 50.01 ? 454  LYS A CD  1 
ATOM   3503 C  CE  . LYS A 1 454 ? 10.593  91.747 54.991 1.00 49.89 ? 454  LYS A CE  1 
ATOM   3504 N  NZ  . LYS A 1 454 ? 11.713  90.808 55.325 1.00 49.71 ? 454  LYS A NZ  1 
ATOM   3505 N  N   . GLU A 1 455 ? 6.227   89.918 59.861 1.00 36.29 ? 455  GLU A N   1 
ATOM   3506 C  CA  . GLU A 1 455 ? 5.389   89.812 61.049 1.00 35.05 ? 455  GLU A CA  1 
ATOM   3507 C  C   . GLU A 1 455 ? 5.718   88.587 61.884 1.00 33.55 ? 455  GLU A C   1 
ATOM   3508 O  O   . GLU A 1 455 ? 5.524   88.591 63.091 1.00 34.34 ? 455  GLU A O   1 
ATOM   3509 C  CB  . GLU A 1 455 ? 3.910   89.802 60.648 1.00 37.54 ? 455  GLU A CB  1 
ATOM   3510 C  CG  . GLU A 1 455 ? 3.439   91.077 59.929 1.00 41.89 ? 455  GLU A CG  1 
ATOM   3511 C  CD  . GLU A 1 455 ? 4.260   91.404 58.671 1.00 45.02 ? 455  GLU A CD  1 
ATOM   3512 O  OE1 . GLU A 1 455 ? 4.186   90.624 57.687 1.00 45.84 ? 455  GLU A OE1 1 
ATOM   3513 O  OE2 . GLU A 1 455 ? 5.007   92.423 58.682 1.00 46.02 ? 455  GLU A OE2 1 
ATOM   3514 N  N   . LEU A 1 456 ? 6.247   87.549 61.249 1.00 32.73 ? 456  LEU A N   1 
ATOM   3515 C  CA  . LEU A 1 456 ? 6.590   86.323 61.965 1.00 33.77 ? 456  LEU A CA  1 
ATOM   3516 C  C   . LEU A 1 456 ? 8.032   86.415 62.473 1.00 34.98 ? 456  LEU A C   1 
ATOM   3517 O  O   . LEU A 1 456 ? 8.558   85.503 63.136 1.00 34.50 ? 456  LEU A O   1 
ATOM   3518 C  CB  . LEU A 1 456 ? 6.399   85.119 61.040 1.00 31.74 ? 456  LEU A CB  1 
ATOM   3519 C  CG  . LEU A 1 456 ? 5.074   85.222 60.275 1.00 31.27 ? 456  LEU A CG  1 
ATOM   3520 C  CD1 . LEU A 1 456 ? 4.852   84.013 59.384 1.00 32.30 ? 456  LEU A CD1 1 
ATOM   3521 C  CD2 . LEU A 1 456 ? 3.922   85.403 61.252 1.00 32.61 ? 456  LEU A CD2 1 
ATOM   3522 N  N   . ASN A 1 457 ? 8.627   87.566 62.178 1.00 35.55 ? 457  ASN A N   1 
ATOM   3523 C  CA  . ASN A 1 457 ? 9.994   87.925 62.526 1.00 35.98 ? 457  ASN A CA  1 
ATOM   3524 C  C   . ASN A 1 457 ? 11.089  86.880 62.639 1.00 33.90 ? 457  ASN A C   1 
ATOM   3525 O  O   . ASN A 1 457 ? 11.348  86.324 63.712 1.00 34.11 ? 457  ASN A O   1 
ATOM   3526 C  CB  . ASN A 1 457 ? 10.033  88.889 63.714 1.00 38.74 ? 457  ASN A CB  1 
ATOM   3527 C  CG  . ASN A 1 457 ? 10.588  90.264 63.322 1.00 42.43 ? 457  ASN A CG  1 
ATOM   3528 O  OD1 . ASN A 1 457 ? 11.184  90.973 64.142 1.00 44.32 ? 457  ASN A OD1 1 
ATOM   3529 N  ND2 . ASN A 1 457 ? 10.416  90.633 62.049 1.00 43.48 ? 457  ASN A ND2 1 
ATOM   3530 N  N   . TYR A 1 458 ? 11.713  86.613 61.496 1.00 30.71 ? 458  TYR A N   1 
ATOM   3531 C  CA  . TYR A 1 458 ? 12.838  85.699 61.406 1.00 27.20 ? 458  TYR A CA  1 
ATOM   3532 C  C   . TYR A 1 458 ? 13.983  86.642 61.086 1.00 28.12 ? 458  TYR A C   1 
ATOM   3533 O  O   . TYR A 1 458 ? 13.767  87.744 60.566 1.00 28.59 ? 458  TYR A O   1 
ATOM   3534 C  CB  . TYR A 1 458 ? 12.679  84.716 60.243 1.00 22.11 ? 458  TYR A CB  1 
ATOM   3535 C  CG  . TYR A 1 458 ? 11.668  83.618 60.457 1.00 16.17 ? 458  TYR A CG  1 
ATOM   3536 C  CD1 . TYR A 1 458 ? 12.076  82.324 60.761 1.00 15.04 ? 458  TYR A CD1 1 
ATOM   3537 C  CD2 . TYR A 1 458 ? 10.307  83.863 60.312 1.00 13.38 ? 458  TYR A CD2 1 
ATOM   3538 C  CE1 . TYR A 1 458 ? 11.153  81.302 60.912 1.00 14.68 ? 458  TYR A CE1 1 
ATOM   3539 C  CE2 . TYR A 1 458 ? 9.375   82.847 60.461 1.00 11.26 ? 458  TYR A CE2 1 
ATOM   3540 C  CZ  . TYR A 1 458 ? 9.803   81.569 60.761 1.00 13.32 ? 458  TYR A CZ  1 
ATOM   3541 O  OH  . TYR A 1 458 ? 8.880   80.558 60.910 1.00 12.81 ? 458  TYR A OH  1 
ATOM   3542 N  N   . THR A 1 459 ? 15.199  86.239 61.419 1.00 28.87 ? 459  THR A N   1 
ATOM   3543 C  CA  . THR A 1 459 ? 16.347  87.074 61.128 1.00 28.92 ? 459  THR A CA  1 
ATOM   3544 C  C   . THR A 1 459 ? 16.493  87.129 59.618 1.00 31.22 ? 459  THR A C   1 
ATOM   3545 O  O   . THR A 1 459 ? 16.248  86.133 58.935 1.00 33.03 ? 459  THR A O   1 
ATOM   3546 C  CB  . THR A 1 459 ? 17.612  86.478 61.728 1.00 27.68 ? 459  THR A CB  1 
ATOM   3547 O  OG1 . THR A 1 459 ? 17.800  85.149 61.222 1.00 24.74 ? 459  THR A OG1 1 
ATOM   3548 C  CG2 . THR A 1 459 ? 17.484  86.429 63.243 1.00 30.19 ? 459  THR A CG2 1 
ATOM   3549 N  N   . ALA A 1 460 ? 16.874  88.289 59.093 1.00 33.05 ? 460  ALA A N   1 
ATOM   3550 C  CA  . ALA A 1 460 ? 17.065  88.457 57.653 1.00 31.80 ? 460  ALA A CA  1 
ATOM   3551 C  C   . ALA A 1 460 ? 17.817  87.264 57.065 1.00 31.57 ? 460  ALA A C   1 
ATOM   3552 O  O   . ALA A 1 460 ? 17.444  86.742 56.012 1.00 33.25 ? 460  ALA A O   1 
ATOM   3553 C  CB  . ALA A 1 460 ? 17.838  89.733 57.382 1.00 32.33 ? 460  ALA A CB  1 
ATOM   3554 N  N   . GLU A 1 461 ? 18.837  86.798 57.782 1.00 30.01 ? 461  GLU A N   1 
ATOM   3555 C  CA  . GLU A 1 461 ? 19.642  85.672 57.325 1.00 29.15 ? 461  GLU A CA  1 
ATOM   3556 C  C   . GLU A 1 461 ? 18.792  84.446 57.002 1.00 28.53 ? 461  GLU A C   1 
ATOM   3557 O  O   . GLU A 1 461 ? 19.131  83.662 56.107 1.00 28.38 ? 461  GLU A O   1 
ATOM   3558 C  CB  . GLU A 1 461 ? 20.714  85.333 58.363 1.00 30.00 ? 461  GLU A CB  1 
ATOM   3559 C  CG  . GLU A 1 461 ? 21.670  86.486 58.660 1.00 29.61 ? 461  GLU A CG  1 
ATOM   3560 N  N   . GLU A 1 462 ? 17.689  84.285 57.729 1.00 27.65 ? 462  GLU A N   1 
ATOM   3561 C  CA  . GLU A 1 462 ? 16.767  83.168 57.511 1.00 26.42 ? 462  GLU A CA  1 
ATOM   3562 C  C   . GLU A 1 462 ? 15.842  83.417 56.337 1.00 25.16 ? 462  GLU A C   1 
ATOM   3563 O  O   . GLU A 1 462 ? 15.431  82.478 55.665 1.00 25.69 ? 462  GLU A O   1 
ATOM   3564 C  CB  . GLU A 1 462 ? 15.935  82.898 58.753 1.00 24.07 ? 462  GLU A CB  1 
ATOM   3565 C  CG  . GLU A 1 462 ? 16.761  82.429 59.910 1.00 24.89 ? 462  GLU A CG  1 
ATOM   3566 C  CD  . GLU A 1 462 ? 15.969  82.386 61.176 1.00 24.97 ? 462  GLU A CD  1 
ATOM   3567 O  OE1 . GLU A 1 462 ? 15.877  81.299 61.768 1.00 24.11 ? 462  GLU A OE1 1 
ATOM   3568 O  OE2 . GLU A 1 462 ? 15.427  83.437 61.567 1.00 24.82 ? 462  GLU A OE2 1 
ATOM   3569 N  N   . GLU A 1 463 ? 15.463  84.671 56.122 1.00 25.30 ? 463  GLU A N   1 
ATOM   3570 C  CA  . GLU A 1 463 ? 14.609  84.997 54.988 1.00 26.01 ? 463  GLU A CA  1 
ATOM   3571 C  C   . GLU A 1 463 ? 15.398  84.525 53.787 1.00 24.18 ? 463  GLU A C   1 
ATOM   3572 O  O   . GLU A 1 463 ? 14.854  83.938 52.856 1.00 24.05 ? 463  GLU A O   1 
ATOM   3573 C  CB  . GLU A 1 463 ? 14.390  86.500 54.859 1.00 29.58 ? 463  GLU A CB  1 
ATOM   3574 C  CG  . GLU A 1 463 ? 13.528  86.857 53.660 1.00 34.75 ? 463  GLU A CG  1 
ATOM   3575 C  CD  . GLU A 1 463 ? 13.608  88.321 53.275 1.00 37.93 ? 463  GLU A CD  1 
ATOM   3576 O  OE1 . GLU A 1 463 ? 13.747  88.595 52.056 1.00 40.24 ? 463  GLU A OE1 1 
ATOM   3577 O  OE2 . GLU A 1 463 ? 13.531  89.192 54.180 1.00 40.24 ? 463  GLU A OE2 1 
ATOM   3578 N  N   . ALA A 1 464 ? 16.700  84.767 53.848 1.00 23.86 ? 464  ALA A N   1 
ATOM   3579 C  CA  . ALA A 1 464 ? 17.608  84.361 52.800 1.00 23.90 ? 464  ALA A CA  1 
ATOM   3580 C  C   . ALA A 1 464 ? 17.465  82.860 52.631 1.00 23.70 ? 464  ALA A C   1 
ATOM   3581 O  O   . ALA A 1 464 ? 17.047  82.390 51.576 1.00 25.76 ? 464  ALA A O   1 
ATOM   3582 C  CB  . ALA A 1 464 ? 19.034  84.716 53.183 1.00 26.12 ? 464  ALA A CB  1 
ATOM   3583 N  N   . LEU A 1 465 ? 17.747  82.116 53.695 1.00 22.49 ? 465  LEU A N   1 
ATOM   3584 C  CA  . LEU A 1 465 ? 17.645  80.664 53.656 1.00 19.99 ? 465  LEU A CA  1 
ATOM   3585 C  C   . LEU A 1 465 ? 16.312  80.217 53.076 1.00 20.16 ? 465  LEU A C   1 
ATOM   3586 O  O   . LEU A 1 465 ? 16.261  79.284 52.279 1.00 21.19 ? 465  LEU A O   1 
ATOM   3587 C  CB  . LEU A 1 465 ? 17.803  80.072 55.054 1.00 19.84 ? 465  LEU A CB  1 
ATOM   3588 C  CG  . LEU A 1 465 ? 17.785  78.545 55.092 1.00 18.28 ? 465  LEU A CG  1 
ATOM   3589 C  CD1 . LEU A 1 465 ? 18.997  78.034 54.349 1.00 20.58 ? 465  LEU A CD1 1 
ATOM   3590 C  CD2 . LEU A 1 465 ? 17.784  78.030 56.521 1.00 16.94 ? 465  LEU A CD2 1 
ATOM   3591 N  N   . SER A 1 466 ? 15.238  80.892 53.466 1.00 19.52 ? 466  SER A N   1 
ATOM   3592 C  CA  . SER A 1 466 ? 13.915  80.540 52.988 1.00 19.71 ? 466  SER A CA  1 
ATOM   3593 C  C   . SER A 1 466 ? 13.930  80.613 51.471 1.00 22.50 ? 466  SER A C   1 
ATOM   3594 O  O   . SER A 1 466 ? 13.753  79.605 50.793 1.00 23.47 ? 466  SER A O   1 
ATOM   3595 C  CB  . SER A 1 466 ? 12.883  81.503 53.546 1.00 19.05 ? 466  SER A CB  1 
ATOM   3596 O  OG  . SER A 1 466 ? 11.571  81.112 53.185 1.00 20.87 ? 466  SER A OG  1 
ATOM   3597 N  N   . ARG A 1 467 ? 14.228  81.794 50.941 1.00 24.18 ? 467  ARG A N   1 
ATOM   3598 C  CA  . ARG A 1 467 ? 14.277  81.988 49.501 1.00 23.17 ? 467  ARG A CA  1 
ATOM   3599 C  C   . ARG A 1 467 ? 15.204  80.979 48.819 1.00 24.31 ? 467  ARG A C   1 
ATOM   3600 O  O   . ARG A 1 467 ? 14.899  80.504 47.728 1.00 26.84 ? 467  ARG A O   1 
ATOM   3601 C  CB  . ARG A 1 467 ? 14.708  83.410 49.173 1.00 23.15 ? 467  ARG A CB  1 
ATOM   3602 C  CG  . ARG A 1 467 ? 13.721  84.495 49.609 1.00 25.26 ? 467  ARG A CG  1 
ATOM   3603 C  CD  . ARG A 1 467 ? 14.234  85.863 49.156 1.00 27.85 ? 467  ARG A CD  1 
ATOM   3604 N  NE  . ARG A 1 467 ? 13.360  86.958 49.541 1.00 31.15 ? 467  ARG A NE  1 
ATOM   3605 C  CZ  . ARG A 1 467 ? 12.101  87.084 49.143 1.00 34.23 ? 467  ARG A CZ  1 
ATOM   3606 N  NH1 . ARG A 1 467 ? 11.374  88.116 49.553 1.00 36.30 ? 467  ARG A NH1 1 
ATOM   3607 N  NH2 . ARG A 1 467 ? 11.562  86.181 48.337 1.00 37.29 ? 467  ARG A NH2 1 
ATOM   3608 N  N   . ARG A 1 468 ? 16.314  80.625 49.459 1.00 23.32 ? 468  ARG A N   1 
ATOM   3609 C  CA  . ARG A 1 468 ? 17.227  79.652 48.867 1.00 23.05 ? 468  ARG A CA  1 
ATOM   3610 C  C   . ARG A 1 468 ? 16.525  78.319 48.791 1.00 23.06 ? 468  ARG A C   1 
ATOM   3611 O  O   . ARG A 1 468 ? 16.570  77.641 47.775 1.00 25.45 ? 468  ARG A O   1 
ATOM   3612 C  CB  . ARG A 1 468 ? 18.482  79.469 49.713 1.00 23.64 ? 468  ARG A CB  1 
ATOM   3613 C  CG  . ARG A 1 468 ? 19.614  80.419 49.418 1.00 27.30 ? 468  ARG A CG  1 
ATOM   3614 C  CD  . ARG A 1 468 ? 20.828  80.041 50.245 1.00 28.77 ? 468  ARG A CD  1 
ATOM   3615 N  NE  . ARG A 1 468 ? 21.144  78.618 50.105 1.00 32.72 ? 468  ARG A NE  1 
ATOM   3616 C  CZ  . ARG A 1 468 ? 21.620  77.853 51.089 1.00 34.11 ? 468  ARG A CZ  1 
ATOM   3617 N  NH1 . ARG A 1 468 ? 21.881  76.567 50.863 1.00 33.24 ? 468  ARG A NH1 1 
ATOM   3618 N  NH2 . ARG A 1 468 ? 21.838  78.370 52.298 1.00 31.53 ? 468  ARG A NH2 1 
ATOM   3619 N  N   . ILE A 1 469 ? 15.860  77.950 49.873 1.00 23.77 ? 469  ILE A N   1 
ATOM   3620 C  CA  . ILE A 1 469 ? 15.164  76.676 49.928 1.00 23.54 ? 469  ILE A CA  1 
ATOM   3621 C  C   . ILE A 1 469 ? 14.012  76.616 48.924 1.00 24.96 ? 469  ILE A C   1 
ATOM   3622 O  O   . ILE A 1 469 ? 13.911  75.655 48.152 1.00 27.18 ? 469  ILE A O   1 
ATOM   3623 C  CB  . ILE A 1 469 ? 14.689  76.366 51.360 1.00 19.28 ? 469  ILE A CB  1 
ATOM   3624 C  CG1 . ILE A 1 469 ? 15.909  76.226 52.268 1.00 16.96 ? 469  ILE A CG1 1 
ATOM   3625 C  CG2 . ILE A 1 469 ? 13.868  75.102 51.385 1.00 18.17 ? 469  ILE A CG2 1 
ATOM   3626 C  CD1 . ILE A 1 469 ? 15.590  75.750 53.637 1.00 17.41 ? 469  ILE A CD1 1 
ATOM   3627 N  N   . MET A 1 470 ? 13.199  77.667 48.879 1.00 23.19 ? 470  MET A N   1 
ATOM   3628 C  CA  . MET A 1 470 ? 12.075  77.720 47.960 1.00 22.43 ? 470  MET A CA  1 
ATOM   3629 C  C   . MET A 1 470 ? 12.546  77.698 46.528 1.00 23.15 ? 470  MET A C   1 
ATOM   3630 O  O   . MET A 1 470 ? 11.866  77.168 45.660 1.00 24.71 ? 470  MET A O   1 
ATOM   3631 C  CB  . MET A 1 470 ? 11.258  78.984 48.162 1.00 21.25 ? 470  MET A CB  1 
ATOM   3632 C  CG  . MET A 1 470 ? 10.535  79.072 49.474 1.00 19.35 ? 470  MET A CG  1 
ATOM   3633 S  SD  . MET A 1 470 ? 9.435   80.450 49.381 1.00 14.34 ? 470  MET A SD  1 
ATOM   3634 C  CE  . MET A 1 470 ? 10.588  81.724 49.170 1.00 17.91 ? 470  MET A CE  1 
ATOM   3635 N  N   . HIS A 1 471 ? 13.687  78.312 46.260 1.00 24.87 ? 471  HIS A N   1 
ATOM   3636 C  CA  . HIS A 1 471 ? 14.185  78.327 44.893 1.00 27.98 ? 471  HIS A CA  1 
ATOM   3637 C  C   . HIS A 1 471 ? 14.687  76.934 44.564 1.00 27.99 ? 471  HIS A C   1 
ATOM   3638 O  O   . HIS A 1 471 ? 14.452  76.434 43.466 1.00 30.89 ? 471  HIS A O   1 
ATOM   3639 C  CB  . HIS A 1 471 ? 15.290  79.368 44.702 1.00 30.37 ? 471  HIS A CB  1 
ATOM   3640 C  CG  . HIS A 1 471 ? 15.576  79.685 43.266 1.00 31.82 ? 471  HIS A CG  1 
ATOM   3641 N  ND1 . HIS A 1 471 ? 14.675  80.378 42.484 1.00 30.93 ? 471  HIS A ND1 1 
ATOM   3642 C  CD2 . HIS A 1 471 ? 16.668  79.370 42.524 1.00 32.91 ? 471  HIS A CD2 1 
ATOM   3643 C  CE1 . HIS A 1 471 ? 15.235  80.466 41.290 1.00 33.40 ? 471  HIS A CE1 1 
ATOM   3644 N  NE2 . HIS A 1 471 ? 16.439  79.873 41.265 1.00 35.23 ? 471  HIS A NE2 1 
ATOM   3645 N  N   . TYR A 1 472 ? 15.355  76.304 45.526 1.00 27.94 ? 472  TYR A N   1 
ATOM   3646 C  CA  . TYR A 1 472 ? 15.871  74.942 45.367 1.00 25.18 ? 472  TYR A CA  1 
ATOM   3647 C  C   . TYR A 1 472 ? 14.694  74.034 45.019 1.00 24.26 ? 472  TYR A C   1 
ATOM   3648 O  O   . TYR A 1 472 ? 14.764  73.203 44.113 1.00 23.40 ? 472  TYR A O   1 
ATOM   3649 C  CB  . TYR A 1 472 ? 16.485  74.456 46.685 1.00 25.34 ? 472  TYR A CB  1 
ATOM   3650 C  CG  . TYR A 1 472 ? 17.914  74.878 46.935 1.00 24.59 ? 472  TYR A CG  1 
ATOM   3651 C  CD1 . TYR A 1 472 ? 18.390  75.038 48.232 1.00 23.87 ? 472  TYR A CD1 1 
ATOM   3652 C  CD2 . TYR A 1 472 ? 18.805  75.035 45.884 1.00 23.66 ? 472  TYR A CD2 1 
ATOM   3653 C  CE1 . TYR A 1 472 ? 19.713  75.330 48.476 1.00 24.97 ? 472  TYR A CE1 1 
ATOM   3654 C  CE2 . TYR A 1 472 ? 20.129  75.325 46.113 1.00 25.45 ? 472  TYR A CE2 1 
ATOM   3655 C  CZ  . TYR A 1 472 ? 20.584  75.465 47.411 1.00 27.11 ? 472  TYR A CZ  1 
ATOM   3656 O  OH  . TYR A 1 472 ? 21.932  75.681 47.637 1.00 30.98 ? 472  TYR A OH  1 
ATOM   3657 N  N   . TRP A 1 473 ? 13.602  74.218 45.749 1.00 22.60 ? 473  TRP A N   1 
ATOM   3658 C  CA  . TRP A 1 473 ? 12.410  73.432 45.539 1.00 21.39 ? 473  TRP A CA  1 
ATOM   3659 C  C   . TRP A 1 473 ? 11.809  73.729 44.181 1.00 21.87 ? 473  TRP A C   1 
ATOM   3660 O  O   . TRP A 1 473 ? 11.732  72.836 43.339 1.00 23.71 ? 473  TRP A O   1 
ATOM   3661 C  CB  . TRP A 1 473 ? 11.400  73.693 46.656 1.00 19.45 ? 473  TRP A CB  1 
ATOM   3662 C  CG  . TRP A 1 473 ? 11.550  72.774 47.833 1.00 19.24 ? 473  TRP A CG  1 
ATOM   3663 C  CD1 . TRP A 1 473 ? 10.548  72.115 48.480 1.00 21.06 ? 473  TRP A CD1 1 
ATOM   3664 C  CD2 . TRP A 1 473 ? 12.769  72.384 48.484 1.00 19.28 ? 473  TRP A CD2 1 
ATOM   3665 N  NE1 . TRP A 1 473 ? 11.063  71.336 49.485 1.00 20.52 ? 473  TRP A NE1 1 
ATOM   3666 C  CE2 . TRP A 1 473 ? 12.423  71.485 49.511 1.00 19.46 ? 473  TRP A CE2 1 
ATOM   3667 C  CE3 . TRP A 1 473 ? 14.115  72.706 48.297 1.00 19.34 ? 473  TRP A CE3 1 
ATOM   3668 C  CZ2 . TRP A 1 473 ? 13.374  70.905 50.351 1.00 19.42 ? 473  TRP A CZ2 1 
ATOM   3669 C  CZ3 . TRP A 1 473 ? 15.059  72.129 49.130 1.00 19.68 ? 473  TRP A CZ3 1 
ATOM   3670 C  CH2 . TRP A 1 473 ? 14.682  71.238 50.146 1.00 19.19 ? 473  TRP A CH2 1 
ATOM   3671 N  N   . ALA A 1 474 ? 11.458  74.993 43.944 1.00 21.13 ? 474  ALA A N   1 
ATOM   3672 C  CA  . ALA A 1 474 ? 10.847  75.417 42.685 1.00 18.26 ? 474  ALA A CA  1 
ATOM   3673 C  C   . ALA A 1 474 ? 11.688  75.059 41.486 1.00 16.65 ? 474  ALA A C   1 
ATOM   3674 O  O   . ALA A 1 474 ? 11.236  74.306 40.626 1.00 16.92 ? 474  ALA A O   1 
ATOM   3675 C  CB  . ALA A 1 474 ? 10.579  76.881 42.695 1.00 17.40 ? 474  ALA A CB  1 
ATOM   3676 N  N   . THR A 1 475 ? 12.913  75.572 41.438 1.00 15.39 ? 475  THR A N   1 
ATOM   3677 C  CA  . THR A 1 475 ? 13.823  75.286 40.327 1.00 16.68 ? 475  THR A CA  1 
ATOM   3678 C  C   . THR A 1 475 ? 13.877  73.783 40.046 1.00 18.86 ? 475  THR A C   1 
ATOM   3679 O  O   . THR A 1 475 ? 13.981  73.360 38.891 1.00 20.13 ? 475  THR A O   1 
ATOM   3680 C  CB  . THR A 1 475 ? 15.238  75.796 40.601 1.00 13.97 ? 475  THR A CB  1 
ATOM   3681 O  OG1 . THR A 1 475 ? 15.194  77.206 40.847 1.00 13.64 ? 475  THR A OG1 1 
ATOM   3682 C  CG2 . THR A 1 475 ? 16.136  75.521 39.409 1.00 13.06 ? 475  THR A CG2 1 
ATOM   3683 N  N   . PHE A 1 476 ? 13.763  72.982 41.101 1.00 18.87 ? 476  PHE A N   1 
ATOM   3684 C  CA  . PHE A 1 476 ? 13.767  71.532 40.973 1.00 16.55 ? 476  PHE A CA  1 
ATOM   3685 C  C   . PHE A 1 476 ? 12.441  71.041 40.380 1.00 17.00 ? 476  PHE A C   1 
ATOM   3686 O  O   . PHE A 1 476 ? 12.422  70.143 39.543 1.00 15.37 ? 476  PHE A O   1 
ATOM   3687 C  CB  . PHE A 1 476 ? 13.996  70.883 42.338 1.00 11.36 ? 476  PHE A CB  1 
ATOM   3688 C  CG  . PHE A 1 476 ? 13.849  69.401 42.323 1.00 7.67  ? 476  PHE A CG  1 
ATOM   3689 C  CD1 . PHE A 1 476 ? 14.919  68.592 41.983 1.00 9.25  ? 476  PHE A CD1 1 
ATOM   3690 C  CD2 . PHE A 1 476 ? 12.630  68.815 42.599 1.00 2.57  ? 476  PHE A CD2 1 
ATOM   3691 C  CE1 . PHE A 1 476 ? 14.770  67.222 41.916 1.00 8.90  ? 476  PHE A CE1 1 
ATOM   3692 C  CE2 . PHE A 1 476 ? 12.473  67.454 42.534 1.00 3.52  ? 476  PHE A CE2 1 
ATOM   3693 C  CZ  . PHE A 1 476 ? 13.541  66.654 42.192 1.00 5.79  ? 476  PHE A CZ  1 
ATOM   3694 N  N   . ALA A 1 477 ? 11.334  71.605 40.842 1.00 17.62 ? 477  ALA A N   1 
ATOM   3695 C  CA  . ALA A 1 477 ? 10.026  71.204 40.345 1.00 20.56 ? 477  ALA A CA  1 
ATOM   3696 C  C   . ALA A 1 477 ? 9.941   71.468 38.842 1.00 23.79 ? 477  ALA A C   1 
ATOM   3697 O  O   . ALA A 1 477 ? 9.360   70.674 38.090 1.00 26.04 ? 477  ALA A O   1 
ATOM   3698 C  CB  . ALA A 1 477 ? 8.944   71.948 41.075 1.00 19.18 ? 477  ALA A CB  1 
ATOM   3699 N  N   . LYS A 1 478 ? 10.528  72.587 38.413 1.00 24.56 ? 478  LYS A N   1 
ATOM   3700 C  CA  . LYS A 1 478 ? 10.556  72.969 37.004 1.00 22.06 ? 478  LYS A CA  1 
ATOM   3701 C  C   . LYS A 1 478 ? 11.559  72.087 36.263 1.00 20.99 ? 478  LYS A C   1 
ATOM   3702 O  O   . LYS A 1 478 ? 11.179  71.127 35.606 1.00 21.07 ? 478  LYS A O   1 
ATOM   3703 C  CB  . LYS A 1 478 ? 10.978  74.431 36.861 1.00 22.98 ? 478  LYS A CB  1 
ATOM   3704 C  CG  . LYS A 1 478 ? 10.194  75.397 37.739 1.00 25.87 ? 478  LYS A CG  1 
ATOM   3705 C  CD  . LYS A 1 478 ? 10.752  76.815 37.681 1.00 28.57 ? 478  LYS A CD  1 
ATOM   3706 C  CE  . LYS A 1 478 ? 10.124  77.701 38.761 1.00 26.70 ? 478  LYS A CE  1 
ATOM   3707 N  NZ  . LYS A 1 478 ? 10.883  78.971 38.966 1.00 26.16 ? 478  LYS A NZ  1 
ATOM   3708 N  N   . THR A 1 479 ? 12.843  72.351 36.468 1.00 17.47 ? 479  THR A N   1 
ATOM   3709 C  CA  . THR A 1 479 ? 13.894  71.615 35.784 1.00 18.09 ? 479  THR A CA  1 
ATOM   3710 C  C   . THR A 1 479 ? 14.227  70.193 36.218 1.00 17.81 ? 479  THR A C   1 
ATOM   3711 O  O   . THR A 1 479 ? 14.762  69.426 35.432 1.00 21.50 ? 479  THR A O   1 
ATOM   3712 C  CB  . THR A 1 479 ? 15.208  72.393 35.807 1.00 19.85 ? 479  THR A CB  1 
ATOM   3713 O  OG1 . THR A 1 479 ? 15.776  72.324 37.114 1.00 26.45 ? 479  THR A OG1 1 
ATOM   3714 C  CG2 . THR A 1 479 ? 14.971  73.845 35.480 1.00 25.18 ? 479  THR A CG2 1 
ATOM   3715 N  N   . GLY A 1 480 ? 13.966  69.836 37.463 1.00 18.76 ? 480  GLY A N   1 
ATOM   3716 C  CA  . GLY A 1 480 ? 14.324  68.498 37.913 1.00 17.10 ? 480  GLY A CA  1 
ATOM   3717 C  C   . GLY A 1 480 ? 15.716  68.504 38.520 1.00 15.72 ? 480  GLY A C   1 
ATOM   3718 O  O   . GLY A 1 480 ? 16.285  67.459 38.856 1.00 13.72 ? 480  GLY A O   1 
ATOM   3719 N  N   . ASN A 1 481 ? 16.257  69.710 38.644 1.00 15.46 ? 481  ASN A N   1 
ATOM   3720 C  CA  . ASN A 1 481 ? 17.564  69.967 39.222 1.00 16.81 ? 481  ASN A CA  1 
ATOM   3721 C  C   . ASN A 1 481 ? 17.295  71.173 40.118 1.00 19.87 ? 481  ASN A C   1 
ATOM   3722 O  O   . ASN A 1 481 ? 16.585  72.095 39.719 1.00 21.52 ? 481  ASN A O   1 
ATOM   3723 C  CB  . ASN A 1 481 ? 18.554  70.341 38.122 1.00 16.53 ? 481  ASN A CB  1 
ATOM   3724 C  CG  . ASN A 1 481 ? 19.953  70.553 38.644 1.00 17.51 ? 481  ASN A CG  1 
ATOM   3725 O  OD1 . ASN A 1 481 ? 20.191  71.429 39.460 1.00 20.36 ? 481  ASN A OD1 1 
ATOM   3726 N  ND2 . ASN A 1 481 ? 20.888  69.747 38.176 1.00 16.23 ? 481  ASN A ND2 1 
ATOM   3727 N  N   . PRO A 1 482 ? 17.771  71.143 41.373 1.00 21.24 ? 482  PRO A N   1 
ATOM   3728 C  CA  . PRO A 1 482 ? 17.555  72.256 42.301 1.00 23.59 ? 482  PRO A CA  1 
ATOM   3729 C  C   . PRO A 1 482 ? 18.337  73.507 41.916 1.00 25.63 ? 482  PRO A C   1 
ATOM   3730 O  O   . PRO A 1 482 ? 18.021  74.617 42.359 1.00 27.20 ? 482  PRO A O   1 
ATOM   3731 C  CB  . PRO A 1 482 ? 18.045  71.683 43.623 1.00 20.52 ? 482  PRO A CB  1 
ATOM   3732 C  CG  . PRO A 1 482 ? 19.152  70.805 43.194 1.00 21.43 ? 482  PRO A CG  1 
ATOM   3733 C  CD  . PRO A 1 482 ? 18.546  70.079 42.023 1.00 21.50 ? 482  PRO A CD  1 
ATOM   3734 N  N   . ASN A 1 483 ? 19.373  73.311 41.111 1.00 27.59 ? 483  ASN A N   1 
ATOM   3735 C  CA  . ASN A 1 483 ? 20.235  74.392 40.644 1.00 29.05 ? 483  ASN A CA  1 
ATOM   3736 C  C   . ASN A 1 483 ? 19.756  75.041 39.338 1.00 30.43 ? 483  ASN A C   1 
ATOM   3737 O  O   . ASN A 1 483 ? 19.204  74.365 38.462 1.00 30.84 ? 483  ASN A O   1 
ATOM   3738 C  CB  . ASN A 1 483 ? 21.651  73.859 40.483 1.00 25.41 ? 483  ASN A CB  1 
ATOM   3739 C  CG  . ASN A 1 483 ? 22.218  73.355 41.782 1.00 24.17 ? 483  ASN A CG  1 
ATOM   3740 O  OD1 . ASN A 1 483 ? 22.546  72.171 41.925 1.00 19.78 ? 483  ASN A OD1 1 
ATOM   3741 N  ND2 . ASN A 1 483 ? 22.326  74.255 42.756 1.00 24.39 ? 483  ASN A ND2 1 
ATOM   3742 N  N   . GLU A 1 484 ? 19.939  76.356 39.228 1.00 32.50 ? 484  GLU A N   1 
ATOM   3743 C  CA  . GLU A 1 484 ? 19.526  77.075 38.023 1.00 36.86 ? 484  GLU A CA  1 
ATOM   3744 C  C   . GLU A 1 484 ? 20.727  77.408 37.127 1.00 38.28 ? 484  GLU A C   1 
ATOM   3745 O  O   . GLU A 1 484 ? 20.656  77.091 35.913 1.00 38.98 ? 484  GLU A O   1 
ATOM   3746 C  CB  . GLU A 1 484 ? 18.737  78.356 38.374 1.00 35.03 ? 484  GLU A CB  1 
ATOM   3747 C  CG  . GLU A 1 484 ? 19.548  79.463 39.028 1.00 31.69 ? 484  GLU A CG  1 
ATOM   3748 N  N   . SER A 1 490 ? 27.802  76.011 46.450 1.00 39.68 ? 490  SER A N   1 
ATOM   3749 C  CA  . SER A 1 490 ? 27.380  76.475 45.097 1.00 38.29 ? 490  SER A CA  1 
ATOM   3750 C  C   . SER A 1 490 ? 26.466  75.419 44.459 1.00 35.75 ? 490  SER A C   1 
ATOM   3751 O  O   . SER A 1 490 ? 25.283  75.361 44.761 1.00 36.27 ? 490  SER A O   1 
ATOM   3752 C  CB  . SER A 1 490 ? 28.621  76.714 44.231 1.00 40.71 ? 490  SER A CB  1 
ATOM   3753 O  OG  . SER A 1 490 ? 29.469  75.566 44.261 1.00 42.50 ? 490  SER A OG  1 
ATOM   3754 N  N   . LYS A 1 491 ? 27.028  74.549 43.633 1.00 32.28 ? 491  LYS A N   1 
ATOM   3755 C  CA  . LYS A 1 491 ? 26.241  73.522 42.975 1.00 31.11 ? 491  LYS A CA  1 
ATOM   3756 C  C   . LYS A 1 491 ? 25.758  72.542 44.022 1.00 28.75 ? 491  LYS A C   1 
ATOM   3757 O  O   . LYS A 1 491 ? 26.551  72.116 44.858 1.00 29.64 ? 491  LYS A O   1 
ATOM   3758 C  CB  . LYS A 1 491 ? 27.112  72.762 41.972 1.00 34.31 ? 491  LYS A CB  1 
ATOM   3759 C  CG  . LYS A 1 491 ? 26.375  72.344 40.718 1.00 37.83 ? 491  LYS A CG  1 
ATOM   3760 C  CD  . LYS A 1 491 ? 26.061  73.566 39.866 1.00 42.08 ? 491  LYS A CD  1 
ATOM   3761 C  CE  . LYS A 1 491 ? 27.345  74.219 39.337 1.00 44.98 ? 491  LYS A CE  1 
ATOM   3762 N  NZ  . LYS A 1 491 ? 28.033  73.388 38.289 1.00 46.76 ? 491  LYS A NZ  1 
ATOM   3763 N  N   . TRP A 1 492 ? 24.470  72.207 44.004 1.00 25.05 ? 492  TRP A N   1 
ATOM   3764 C  CA  . TRP A 1 492 ? 23.929  71.239 44.952 1.00 20.78 ? 492  TRP A CA  1 
ATOM   3765 C  C   . TRP A 1 492 ? 24.197  69.880 44.293 1.00 20.29 ? 492  TRP A C   1 
ATOM   3766 O  O   . TRP A 1 492 ? 23.459  69.452 43.406 1.00 19.59 ? 492  TRP A O   1 
ATOM   3767 C  CB  . TRP A 1 492 ? 22.428  71.478 45.172 1.00 16.18 ? 492  TRP A CB  1 
ATOM   3768 C  CG  . TRP A 1 492 ? 21.757  70.487 46.107 1.00 16.15 ? 492  TRP A CG  1 
ATOM   3769 C  CD1 . TRP A 1 492 ? 22.205  69.233 46.448 1.00 16.15 ? 492  TRP A CD1 1 
ATOM   3770 C  CD2 . TRP A 1 492 ? 20.472  70.629 46.728 1.00 13.44 ? 492  TRP A CD2 1 
ATOM   3771 N  NE1 . TRP A 1 492 ? 21.270  68.591 47.219 1.00 15.59 ? 492  TRP A NE1 1 
ATOM   3772 C  CE2 . TRP A 1 492 ? 20.197  69.422 47.406 1.00 14.06 ? 492  TRP A CE2 1 
ATOM   3773 C  CE3 . TRP A 1 492 ? 19.522  71.654 46.767 1.00 14.03 ? 492  TRP A CE3 1 
ATOM   3774 C  CZ2 . TRP A 1 492 ? 19.010  69.212 48.111 1.00 12.00 ? 492  TRP A CZ2 1 
ATOM   3775 C  CZ3 . TRP A 1 492 ? 18.336  71.442 47.471 1.00 13.59 ? 492  TRP A CZ3 1 
ATOM   3776 C  CH2 . TRP A 1 492 ? 18.094  70.229 48.130 1.00 12.13 ? 492  TRP A CH2 1 
ATOM   3777 N  N   . PRO A 1 493 ? 25.260  69.184 44.732 1.00 20.26 ? 493  PRO A N   1 
ATOM   3778 C  CA  . PRO A 1 493 ? 25.666  67.875 44.206 1.00 21.56 ? 493  PRO A CA  1 
ATOM   3779 C  C   . PRO A 1 493 ? 24.547  66.871 44.023 1.00 22.28 ? 493  PRO A C   1 
ATOM   3780 O  O   . PRO A 1 493 ? 23.577  66.846 44.780 1.00 25.12 ? 493  PRO A O   1 
ATOM   3781 C  CB  . PRO A 1 493 ? 26.660  67.374 45.258 1.00 20.01 ? 493  PRO A CB  1 
ATOM   3782 C  CG  . PRO A 1 493 ? 27.274  68.620 45.742 1.00 22.24 ? 493  PRO A CG  1 
ATOM   3783 C  CD  . PRO A 1 493 ? 26.075  69.530 45.908 1.00 21.07 ? 493  PRO A CD  1 
ATOM   3784 N  N   . LEU A 1 494 ? 24.696  66.033 43.010 1.00 21.46 ? 494  LEU A N   1 
ATOM   3785 C  CA  . LEU A 1 494 ? 23.718  65.002 42.748 1.00 21.06 ? 494  LEU A CA  1 
ATOM   3786 C  C   . LEU A 1 494 ? 24.094  63.930 43.749 1.00 20.81 ? 494  LEU A C   1 
ATOM   3787 O  O   . LEU A 1 494 ? 25.240  63.859 44.187 1.00 24.19 ? 494  LEU A O   1 
ATOM   3788 C  CB  . LEU A 1 494 ? 23.877  64.489 41.317 1.00 22.33 ? 494  LEU A CB  1 
ATOM   3789 C  CG  . LEU A 1 494 ? 22.651  63.961 40.566 1.00 24.50 ? 494  LEU A CG  1 
ATOM   3790 C  CD1 . LEU A 1 494 ? 22.984  63.881 39.092 1.00 24.58 ? 494  LEU A CD1 1 
ATOM   3791 C  CD2 . LEU A 1 494 ? 22.209  62.592 41.103 1.00 27.01 ? 494  LEU A CD2 1 
ATOM   3792 N  N   . PHE A 1 495 ? 23.140  63.125 44.161 1.00 20.58 ? 495  PHE A N   1 
ATOM   3793 C  CA  . PHE A 1 495 ? 23.463  62.092 45.107 1.00 21.54 ? 495  PHE A CA  1 
ATOM   3794 C  C   . PHE A 1 495 ? 23.743  60.865 44.284 1.00 23.60 ? 495  PHE A C   1 
ATOM   3795 O  O   . PHE A 1 495 ? 22.922  60.448 43.460 1.00 23.69 ? 495  PHE A O   1 
ATOM   3796 C  CB  . PHE A 1 495 ? 22.316  61.839 46.083 1.00 21.64 ? 495  PHE A CB  1 
ATOM   3797 C  CG  . PHE A 1 495 ? 22.586  60.729 47.051 1.00 19.03 ? 495  PHE A CG  1 
ATOM   3798 C  CD1 . PHE A 1 495 ? 23.336  60.953 48.187 1.00 20.12 ? 495  PHE A CD1 1 
ATOM   3799 C  CD2 . PHE A 1 495 ? 22.114  59.450 46.806 1.00 19.62 ? 495  PHE A CD2 1 
ATOM   3800 C  CE1 . PHE A 1 495 ? 23.614  59.916 49.064 1.00 21.44 ? 495  PHE A CE1 1 
ATOM   3801 C  CE2 . PHE A 1 495 ? 22.387  58.412 47.676 1.00 19.18 ? 495  PHE A CE2 1 
ATOM   3802 C  CZ  . PHE A 1 495 ? 23.139  58.644 48.806 1.00 18.94 ? 495  PHE A CZ  1 
ATOM   3803 N  N   . THR A 1 496 ? 24.923  60.307 44.497 1.00 25.22 ? 496  THR A N   1 
ATOM   3804 C  CA  . THR A 1 496 ? 25.356  59.127 43.782 1.00 26.08 ? 496  THR A CA  1 
ATOM   3805 C  C   . THR A 1 496 ? 25.791  58.085 44.793 1.00 25.52 ? 496  THR A C   1 
ATOM   3806 O  O   . THR A 1 496 ? 26.527  58.393 45.722 1.00 25.00 ? 496  THR A O   1 
ATOM   3807 C  CB  . THR A 1 496 ? 26.557  59.472 42.905 1.00 27.04 ? 496  THR A CB  1 
ATOM   3808 O  OG1 . THR A 1 496 ? 27.609  59.987 43.737 1.00 31.94 ? 496  THR A OG1 1 
ATOM   3809 C  CG2 . THR A 1 496 ? 26.177  60.533 41.876 1.00 25.02 ? 496  THR A CG2 1 
ATOM   3810 N  N   . THR A 1 497 ? 25.381  56.846 44.583 1.00 27.38 ? 497  THR A N   1 
ATOM   3811 C  CA  . THR A 1 497 ? 25.739  55.758 45.482 1.00 29.52 ? 497  THR A CA  1 
ATOM   3812 C  C   . THR A 1 497 ? 27.250  55.634 45.724 1.00 31.58 ? 497  THR A C   1 
ATOM   3813 O  O   . THR A 1 497 ? 27.692  55.135 46.764 1.00 33.41 ? 497  THR A O   1 
ATOM   3814 C  CB  . THR A 1 497 ? 25.214  54.450 44.922 1.00 29.12 ? 497  THR A CB  1 
ATOM   3815 O  OG1 . THR A 1 497 ? 25.224  54.522 43.487 1.00 29.93 ? 497  THR A OG1 1 
ATOM   3816 C  CG2 . THR A 1 497 ? 23.797  54.207 45.409 1.00 28.34 ? 497  THR A CG2 1 
ATOM   3817 N  N   . LYS A 1 498 ? 28.044  56.075 44.756 1.00 32.68 ? 498  LYS A N   1 
ATOM   3818 C  CA  . LYS A 1 498 ? 29.493  56.002 44.887 1.00 34.02 ? 498  LYS A CA  1 
ATOM   3819 C  C   . LYS A 1 498 ? 30.035  56.997 45.915 1.00 34.71 ? 498  LYS A C   1 
ATOM   3820 O  O   . LYS A 1 498 ? 30.695  56.605 46.880 1.00 35.64 ? 498  LYS A O   1 
ATOM   3821 N  N   . GLU A 1 499 ? 29.767  58.284 45.689 1.00 34.73 ? 499  GLU A N   1 
ATOM   3822 C  CA  . GLU A 1 499 ? 30.243  59.354 46.574 1.00 34.94 ? 499  GLU A CA  1 
ATOM   3823 C  C   . GLU A 1 499 ? 29.264  59.773 47.689 1.00 33.29 ? 499  GLU A C   1 
ATOM   3824 O  O   . GLU A 1 499 ? 29.684  60.207 48.757 1.00 33.98 ? 499  GLU A O   1 
ATOM   3825 C  CB  . GLU A 1 499 ? 30.656  60.569 45.736 1.00 37.03 ? 499  GLU A CB  1 
ATOM   3826 C  CG  . GLU A 1 499 ? 31.744  60.277 44.696 1.00 37.13 ? 499  GLU A CG  1 
ATOM   3827 N  N   . GLN A 1 500 ? 27.969  59.738 47.400 1.00 30.59 ? 500  GLN A N   1 
ATOM   3828 C  CA  . GLN A 1 500 ? 26.934  60.062 48.383 1.00 28.29 ? 500  GLN A CA  1 
ATOM   3829 C  C   . GLN A 1 500 ? 26.935  61.477 48.931 1.00 27.73 ? 500  GLN A C   1 
ATOM   3830 O  O   . GLN A 1 500 ? 26.672  61.696 50.112 1.00 28.25 ? 500  GLN A O   1 
ATOM   3831 C  CB  . GLN A 1 500 ? 26.965  59.055 49.531 1.00 28.18 ? 500  GLN A CB  1 
ATOM   3832 C  CG  . GLN A 1 500 ? 26.740  57.636 49.059 1.00 31.08 ? 500  GLN A CG  1 
ATOM   3833 C  CD  . GLN A 1 500 ? 26.434  56.675 50.184 1.00 33.20 ? 500  GLN A CD  1 
ATOM   3834 O  OE1 . GLN A 1 500 ? 25.646  56.977 51.093 1.00 34.80 ? 500  GLN A OE1 1 
ATOM   3835 N  NE2 . GLN A 1 500 ? 27.039  55.499 50.124 1.00 35.26 ? 500  GLN A NE2 1 
ATOM   3836 N  N   . LYS A 1 501 ? 27.188  62.442 48.057 1.00 28.77 ? 501  LYS A N   1 
ATOM   3837 C  CA  . LYS A 1 501 ? 27.204  63.843 48.448 1.00 27.09 ? 501  LYS A CA  1 
ATOM   3838 C  C   . LYS A 1 501 ? 25.784  64.304 48.753 1.00 26.42 ? 501  LYS A C   1 
ATOM   3839 O  O   . LYS A 1 501 ? 24.823  63.811 48.155 1.00 25.35 ? 501  LYS A O   1 
ATOM   3840 C  CB  . LYS A 1 501 ? 27.782  64.707 47.322 1.00 26.74 ? 501  LYS A CB  1 
ATOM   3841 C  CG  . LYS A 1 501 ? 29.228  64.406 46.977 1.00 28.13 ? 501  LYS A CG  1 
ATOM   3842 C  CD  . LYS A 1 501 ? 29.780  65.416 45.981 1.00 29.26 ? 501  LYS A CD  1 
ATOM   3843 C  CE  . LYS A 1 501 ? 31.280  65.263 45.811 1.00 27.25 ? 501  LYS A CE  1 
ATOM   3844 N  NZ  . LYS A 1 501 ? 31.642  63.907 45.297 1.00 27.78 ? 501  LYS A NZ  1 
ATOM   3845 N  N   . PHE A 1 502 ? 25.676  65.236 49.697 1.00 26.28 ? 502  PHE A N   1 
ATOM   3846 C  CA  . PHE A 1 502 ? 24.418  65.846 50.118 1.00 24.62 ? 502  PHE A CA  1 
ATOM   3847 C  C   . PHE A 1 502 ? 24.835  67.185 50.702 1.00 24.65 ? 502  PHE A C   1 
ATOM   3848 O  O   . PHE A 1 502 ? 26.011  67.387 51.004 1.00 25.47 ? 502  PHE A O   1 
ATOM   3849 C  CB  . PHE A 1 502 ? 23.731  65.013 51.191 1.00 23.28 ? 502  PHE A CB  1 
ATOM   3850 C  CG  . PHE A 1 502 ? 24.397  65.080 52.530 1.00 22.41 ? 502  PHE A CG  1 
ATOM   3851 C  CD1 . PHE A 1 502 ? 25.279  64.087 52.931 1.00 23.14 ? 502  PHE A CD1 1 
ATOM   3852 C  CD2 . PHE A 1 502 ? 24.104  66.113 53.416 1.00 21.57 ? 502  PHE A CD2 1 
ATOM   3853 C  CE1 . PHE A 1 502 ? 25.853  64.119 54.197 1.00 22.43 ? 502  PHE A CE1 1 
ATOM   3854 C  CE2 . PHE A 1 502 ? 24.673  66.149 54.674 1.00 20.18 ? 502  PHE A CE2 1 
ATOM   3855 C  CZ  . PHE A 1 502 ? 25.545  65.153 55.065 1.00 21.10 ? 502  PHE A CZ  1 
ATOM   3856 N  N   . ILE A 1 503 ? 23.899  68.093 50.912 1.00 24.12 ? 503  ILE A N   1 
ATOM   3857 C  CA  . ILE A 1 503 ? 24.302  69.378 51.453 1.00 24.93 ? 503  ILE A CA  1 
ATOM   3858 C  C   . ILE A 1 503 ? 23.542  69.783 52.687 1.00 26.10 ? 503  ILE A C   1 
ATOM   3859 O  O   . ILE A 1 503 ? 22.425  69.317 52.939 1.00 27.90 ? 503  ILE A O   1 
ATOM   3860 C  CB  . ILE A 1 503 ? 24.136  70.517 50.441 1.00 25.42 ? 503  ILE A CB  1 
ATOM   3861 C  CG1 . ILE A 1 503 ? 22.669  70.669 50.066 1.00 25.36 ? 503  ILE A CG1 1 
ATOM   3862 C  CG2 . ILE A 1 503 ? 24.980  70.262 49.214 1.00 28.37 ? 503  ILE A CG2 1 
ATOM   3863 C  CD1 . ILE A 1 503 ? 22.359  71.966 49.390 1.00 27.97 ? 503  ILE A CD1 1 
ATOM   3864 N  N   . ASP A 1 504 ? 24.169  70.660 53.457 1.00 26.07 ? 504  ASP A N   1 
ATOM   3865 C  CA  . ASP A 1 504 ? 23.567  71.195 54.656 1.00 25.05 ? 504  ASP A CA  1 
ATOM   3866 C  C   . ASP A 1 504 ? 22.645  72.301 54.168 1.00 23.81 ? 504  ASP A C   1 
ATOM   3867 O  O   . ASP A 1 504 ? 22.961  73.017 53.216 1.00 21.71 ? 504  ASP A O   1 
ATOM   3868 C  CB  . ASP A 1 504 ? 24.641  71.764 55.584 1.00 27.75 ? 504  ASP A CB  1 
ATOM   3869 C  CG  . ASP A 1 504 ? 25.275  70.706 56.461 1.00 30.01 ? 504  ASP A CG  1 
ATOM   3870 O  OD1 . ASP A 1 504 ? 26.283  71.007 57.135 1.00 32.78 ? 504  ASP A OD1 1 
ATOM   3871 O  OD2 . ASP A 1 504 ? 24.757  69.574 56.501 1.00 34.76 ? 504  ASP A OD2 1 
ATOM   3872 N  N   . LEU A 1 505 ? 21.485  72.408 54.789 1.00 22.84 ? 505  LEU A N   1 
ATOM   3873 C  CA  . LEU A 1 505 ? 20.547  73.423 54.396 1.00 22.82 ? 505  LEU A CA  1 
ATOM   3874 C  C   . LEU A 1 505 ? 20.408  74.372 55.565 1.00 23.10 ? 505  LEU A C   1 
ATOM   3875 O  O   . LEU A 1 505 ? 19.491  74.282 56.383 1.00 24.51 ? 505  LEU A O   1 
ATOM   3876 C  CB  . LEU A 1 505 ? 19.215  72.789 54.004 1.00 22.50 ? 505  LEU A CB  1 
ATOM   3877 C  CG  . LEU A 1 505 ? 18.491  73.473 52.849 1.00 23.42 ? 505  LEU A CG  1 
ATOM   3878 C  CD1 . LEU A 1 505 ? 19.471  73.819 51.737 1.00 23.24 ? 505  LEU A CD1 1 
ATOM   3879 C  CD2 . LEU A 1 505 ? 17.408  72.550 52.335 1.00 24.44 ? 505  LEU A CD2 1 
ATOM   3880 N  N   . ASN A 1 506 ? 21.390  75.243 55.685 1.00 23.43 ? 506  ASN A N   1 
ATOM   3881 C  CA  . ASN A 1 506 ? 21.379  76.213 56.744 1.00 24.80 ? 506  ASN A CA  1 
ATOM   3882 C  C   . ASN A 1 506 ? 21.803  77.564 56.220 1.00 26.42 ? 506  ASN A C   1 
ATOM   3883 O  O   . ASN A 1 506 ? 22.100  77.732 55.039 1.00 27.11 ? 506  ASN A O   1 
ATOM   3884 C  CB  . ASN A 1 506 ? 22.280  75.777 57.896 1.00 25.02 ? 506  ASN A CB  1 
ATOM   3885 C  CG  . ASN A 1 506 ? 23.718  75.605 57.482 1.00 23.66 ? 506  ASN A CG  1 
ATOM   3886 O  OD1 . ASN A 1 506 ? 24.253  76.394 56.707 1.00 25.01 ? 506  ASN A OD1 1 
ATOM   3887 N  ND2 . ASN A 1 506 ? 24.361  74.572 58.010 1.00 23.85 ? 506  ASN A ND2 1 
ATOM   3888 N  N   . THR A 1 507 ? 21.817  78.527 57.124 1.00 29.88 ? 507  THR A N   1 
ATOM   3889 C  CA  . THR A 1 507 ? 22.174  79.893 56.816 1.00 31.70 ? 507  THR A CA  1 
ATOM   3890 C  C   . THR A 1 507 ? 23.654  80.055 56.489 1.00 31.97 ? 507  THR A C   1 
ATOM   3891 O  O   . THR A 1 507 ? 24.072  81.075 55.952 1.00 32.85 ? 507  THR A O   1 
ATOM   3892 C  CB  . THR A 1 507 ? 21.774  80.769 57.990 1.00 33.18 ? 507  THR A CB  1 
ATOM   3893 O  OG1 . THR A 1 507 ? 20.368  80.587 58.229 1.00 33.72 ? 507  THR A OG1 1 
ATOM   3894 C  CG2 . THR A 1 507 ? 22.052  82.228 57.693 1.00 39.30 ? 507  THR A CG2 1 
ATOM   3895 N  N   . GLU A 1 508 ? 24.446  79.046 56.816 1.00 33.34 ? 508  GLU A N   1 
ATOM   3896 C  CA  . GLU A 1 508 ? 25.871  79.094 56.538 1.00 35.04 ? 508  GLU A CA  1 
ATOM   3897 C  C   . GLU A 1 508 ? 26.066  78.731 55.069 1.00 37.67 ? 508  GLU A C   1 
ATOM   3898 O  O   . GLU A 1 508 ? 25.153  78.197 54.420 1.00 37.15 ? 508  GLU A O   1 
ATOM   3899 N  N   . PRO A 1 509 ? 27.232  79.082 54.502 1.00 39.57 ? 509  PRO A N   1 
ATOM   3900 C  CA  . PRO A 1 509 ? 27.514  78.767 53.098 1.00 39.48 ? 509  PRO A CA  1 
ATOM   3901 C  C   . PRO A 1 509 ? 27.325  77.273 52.856 1.00 39.15 ? 509  PRO A C   1 
ATOM   3902 O  O   . PRO A 1 509 ? 28.028  76.440 53.430 1.00 38.85 ? 509  PRO A O   1 
ATOM   3903 C  CB  . PRO A 1 509 ? 28.974  79.188 52.950 1.00 39.49 ? 509  PRO A CB  1 
ATOM   3904 C  CG  . PRO A 1 509 ? 29.040  80.410 53.841 1.00 40.52 ? 509  PRO A CG  1 
ATOM   3905 C  CD  . PRO A 1 509 ? 28.307  79.911 55.082 1.00 40.90 ? 509  PRO A CD  1 
ATOM   3906 N  N   . MET A 1 510 ? 26.312  76.955 52.060 1.00 39.66 ? 510  MET A N   1 
ATOM   3907 C  CA  . MET A 1 510 ? 25.965  75.577 51.709 1.00 39.51 ? 510  MET A CA  1 
ATOM   3908 C  C   . MET A 1 510 ? 27.176  74.700 51.440 1.00 37.22 ? 510  MET A C   1 
ATOM   3909 O  O   . MET A 1 510 ? 27.772  74.761 50.360 1.00 37.39 ? 510  MET A O   1 
ATOM   3910 C  CB  . MET A 1 510 ? 25.060  75.573 50.478 1.00 40.73 ? 510  MET A CB  1 
ATOM   3911 C  CG  . MET A 1 510 ? 24.659  74.204 50.015 1.00 39.14 ? 510  MET A CG  1 
ATOM   3912 S  SD  . MET A 1 510 ? 24.675  74.192 48.225 1.00 37.70 ? 510  MET A SD  1 
ATOM   3913 C  CE  . MET A 1 510 ? 26.389  73.643 47.975 1.00 36.45 ? 510  MET A CE  1 
ATOM   3914 N  N   . LYS A 1 511 ? 27.523  73.890 52.434 1.00 35.64 ? 511  LYS A N   1 
ATOM   3915 C  CA  . LYS A 1 511 ? 28.658  72.983 52.353 1.00 33.80 ? 511  LYS A CA  1 
ATOM   3916 C  C   . LYS A 1 511 ? 28.223  71.608 51.850 1.00 31.65 ? 511  LYS A C   1 
ATOM   3917 O  O   . LYS A 1 511 ? 27.049  71.248 51.936 1.00 31.85 ? 511  LYS A O   1 
ATOM   3918 C  CB  . LYS A 1 511 ? 29.297  72.844 53.739 1.00 34.89 ? 511  LYS A CB  1 
ATOM   3919 N  N   . VAL A 1 512 ? 29.166  70.826 51.345 1.00 29.16 ? 512  VAL A N   1 
ATOM   3920 C  CA  . VAL A 1 512 ? 28.836  69.496 50.854 1.00 25.94 ? 512  VAL A CA  1 
ATOM   3921 C  C   . VAL A 1 512 ? 29.429  68.446 51.759 1.00 26.10 ? 512  VAL A C   1 
ATOM   3922 O  O   . VAL A 1 512 ? 30.591  68.544 52.167 1.00 28.12 ? 512  VAL A O   1 
ATOM   3923 C  CB  . VAL A 1 512 ? 29.344  69.269 49.431 1.00 22.58 ? 512  VAL A CB  1 
ATOM   3924 C  CG1 . VAL A 1 512 ? 29.291  67.796 49.077 1.00 18.74 ? 512  VAL A CG1 1 
ATOM   3925 C  CG2 . VAL A 1 512 ? 28.497  70.055 48.476 1.00 21.91 ? 512  VAL A CG2 1 
ATOM   3926 N  N   . HIS A 1 513 ? 28.620  67.451 52.089 1.00 24.54 ? 513  HIS A N   1 
ATOM   3927 C  CA  . HIS A 1 513 ? 29.057  66.369 52.951 1.00 24.97 ? 513  HIS A CA  1 
ATOM   3928 C  C   . HIS A 1 513 ? 28.744  65.072 52.226 1.00 26.24 ? 513  HIS A C   1 
ATOM   3929 O  O   . HIS A 1 513 ? 28.066  65.076 51.199 1.00 26.82 ? 513  HIS A O   1 
ATOM   3930 C  CB  . HIS A 1 513 ? 28.323  66.433 54.297 1.00 24.51 ? 513  HIS A CB  1 
ATOM   3931 C  CG  . HIS A 1 513 ? 28.347  67.788 54.926 1.00 21.17 ? 513  HIS A CG  1 
ATOM   3932 N  ND1 . HIS A 1 513 ? 29.518  68.414 55.291 1.00 21.87 ? 513  HIS A ND1 1 
ATOM   3933 C  CD2 . HIS A 1 513 ? 27.358  68.684 55.148 1.00 20.37 ? 513  HIS A CD2 1 
ATOM   3934 C  CE1 . HIS A 1 513 ? 29.252  69.642 55.698 1.00 22.55 ? 513  HIS A CE1 1 
ATOM   3935 N  NE2 . HIS A 1 513 ? 27.948  69.832 55.618 1.00 20.43 ? 513  HIS A NE2 1 
ATOM   3936 N  N   . GLN A 1 514 ? 29.226  63.962 52.763 1.00 27.13 ? 514  GLN A N   1 
ATOM   3937 C  CA  . GLN A 1 514 ? 28.994  62.681 52.134 1.00 28.07 ? 514  GLN A CA  1 
ATOM   3938 C  C   . GLN A 1 514 ? 28.576  61.624 53.134 1.00 28.25 ? 514  GLN A C   1 
ATOM   3939 O  O   . GLN A 1 514 ? 29.120  61.545 54.236 1.00 28.35 ? 514  GLN A O   1 
ATOM   3940 C  CB  . GLN A 1 514 ? 30.271  62.200 51.463 1.00 30.87 ? 514  GLN A CB  1 
ATOM   3941 C  CG  . GLN A 1 514 ? 30.836  63.122 50.412 1.00 34.49 ? 514  GLN A CG  1 
ATOM   3942 C  CD  . GLN A 1 514 ? 32.127  62.580 49.842 1.00 36.54 ? 514  GLN A CD  1 
ATOM   3943 O  OE1 . GLN A 1 514 ? 32.374  61.366 49.866 1.00 36.90 ? 514  GLN A OE1 1 
ATOM   3944 N  NE2 . GLN A 1 514 ? 32.975  63.477 49.346 1.00 38.77 ? 514  GLN A NE2 1 
ATOM   3945 N  N   . ARG A 1 515 ? 27.600  60.820 52.740 1.00 28.99 ? 515  ARG A N   1 
ATOM   3946 C  CA  . ARG A 1 515 ? 27.138  59.713 53.558 1.00 29.10 ? 515  ARG A CA  1 
ATOM   3947 C  C   . ARG A 1 515 ? 26.499  60.142 54.859 1.00 27.93 ? 515  ARG A C   1 
ATOM   3948 O  O   . ARG A 1 515 ? 27.103  59.987 55.924 1.00 28.72 ? 515  ARG A O   1 
ATOM   3949 C  CB  . ARG A 1 515 ? 28.312  58.766 53.857 1.00 29.04 ? 515  ARG A CB  1 
ATOM   3950 C  CG  . ARG A 1 515 ? 29.131  58.398 52.627 1.00 30.10 ? 515  ARG A CG  1 
ATOM   3951 C  CD  . ARG A 1 515 ? 30.370  57.584 52.965 1.00 30.94 ? 515  ARG A CD  1 
ATOM   3952 N  NE  . ARG A 1 515 ? 30.996  57.042 51.759 1.00 32.96 ? 515  ARG A NE  1 
ATOM   3953 N  N   . LEU A 1 516 ? 25.267  60.642 54.779 1.00 25.76 ? 516  LEU A N   1 
ATOM   3954 C  CA  . LEU A 1 516 ? 24.528  61.062 55.973 1.00 23.98 ? 516  LEU A CA  1 
ATOM   3955 C  C   . LEU A 1 516 ? 24.553  59.932 56.995 1.00 24.57 ? 516  LEU A C   1 
ATOM   3956 O  O   . LEU A 1 516 ? 24.416  58.769 56.618 1.00 24.09 ? 516  LEU A O   1 
ATOM   3957 C  CB  . LEU A 1 516 ? 23.069  61.363 55.642 1.00 20.02 ? 516  LEU A CB  1 
ATOM   3958 C  CG  . LEU A 1 516 ? 22.534  62.711 56.104 1.00 17.76 ? 516  LEU A CG  1 
ATOM   3959 C  CD1 . LEU A 1 516 ? 21.040  62.604 56.176 1.00 18.78 ? 516  LEU A CD1 1 
ATOM   3960 C  CD2 . LEU A 1 516 ? 23.088  63.097 57.453 1.00 16.55 ? 516  LEU A CD2 1 
ATOM   3961 N  N   . ARG A 1 517 ? 24.743  60.302 58.267 1.00 25.75 ? 517  ARG A N   1 
ATOM   3962 C  CA  . ARG A 1 517 ? 24.798  59.392 59.417 1.00 23.71 ? 517  ARG A CA  1 
ATOM   3963 C  C   . ARG A 1 517 ? 25.042  57.977 58.929 1.00 22.61 ? 517  ARG A C   1 
ATOM   3964 O  O   . ARG A 1 517 ? 24.175  57.124 59.062 1.00 23.92 ? 517  ARG A O   1 
ATOM   3965 C  CB  . ARG A 1 517 ? 23.482  59.452 60.222 1.00 24.87 ? 517  ARG A CB  1 
ATOM   3966 C  CG  . ARG A 1 517 ? 22.763  60.819 60.220 1.00 28.68 ? 517  ARG A CG  1 
ATOM   3967 C  CD  . ARG A 1 517 ? 23.006  61.695 61.463 1.00 31.21 ? 517  ARG A CD  1 
ATOM   3968 N  NE  . ARG A 1 517 ? 21.823  61.748 62.337 1.00 35.50 ? 517  ARG A NE  1 
ATOM   3969 C  CZ  . ARG A 1 517 ? 21.280  62.860 62.857 1.00 35.35 ? 517  ARG A CZ  1 
ATOM   3970 N  NH1 . ARG A 1 517 ? 21.794  64.061 62.600 1.00 33.52 ? 517  ARG A NH1 1 
ATOM   3971 N  NH2 . ARG A 1 517 ? 20.224  62.766 63.669 1.00 33.58 ? 517  ARG A NH2 1 
ATOM   3972 N  N   . VAL A 1 518 ? 26.191  57.749 58.297 1.00 21.89 ? 518  VAL A N   1 
ATOM   3973 C  CA  . VAL A 1 518 ? 26.502  56.429 57.755 1.00 21.05 ? 518  VAL A CA  1 
ATOM   3974 C  C   . VAL A 1 518 ? 26.768  55.325 58.777 1.00 23.42 ? 518  VAL A C   1 
ATOM   3975 O  O   . VAL A 1 518 ? 26.120  54.272 58.721 1.00 23.64 ? 518  VAL A O   1 
ATOM   3976 C  CB  . VAL A 1 518 ? 27.629  56.482 56.705 1.00 19.32 ? 518  VAL A CB  1 
ATOM   3977 C  CG1 . VAL A 1 518 ? 28.895  57.038 57.312 1.00 18.31 ? 518  VAL A CG1 1 
ATOM   3978 C  CG2 . VAL A 1 518 ? 27.850  55.105 56.106 1.00 15.17 ? 518  VAL A CG2 1 
ATOM   3979 N  N   . GLN A 1 519 ? 27.681  55.561 59.721 1.00 24.74 ? 519  GLN A N   1 
ATOM   3980 C  CA  . GLN A 1 519 ? 27.996  54.558 60.749 1.00 25.58 ? 519  GLN A CA  1 
ATOM   3981 C  C   . GLN A 1 519 ? 26.705  54.020 61.373 1.00 24.68 ? 519  GLN A C   1 
ATOM   3982 O  O   . GLN A 1 519 ? 26.496  52.804 61.465 1.00 26.09 ? 519  GLN A O   1 
ATOM   3983 C  CB  . GLN A 1 519 ? 28.866  55.148 61.872 1.00 29.10 ? 519  GLN A CB  1 
ATOM   3984 C  CG  . GLN A 1 519 ? 30.237  55.690 61.447 1.00 35.01 ? 519  GLN A CG  1 
ATOM   3985 C  CD  . GLN A 1 519 ? 30.185  57.130 60.919 1.00 40.04 ? 519  GLN A CD  1 
ATOM   3986 O  OE1 . GLN A 1 519 ? 29.095  57.705 60.693 1.00 40.20 ? 519  GLN A OE1 1 
ATOM   3987 N  NE2 . GLN A 1 519 ? 31.365  57.722 60.718 1.00 40.06 ? 519  GLN A NE2 1 
ATOM   3988 N  N   . MET A 1 520 ? 25.824  54.939 61.748 1.00 20.93 ? 520  MET A N   1 
ATOM   3989 C  CA  . MET A 1 520 ? 24.570  54.581 62.369 1.00 19.71 ? 520  MET A CA  1 
ATOM   3990 C  C   . MET A 1 520 ? 23.653  53.815 61.428 1.00 19.80 ? 520  MET A C   1 
ATOM   3991 O  O   . MET A 1 520 ? 23.336  52.648 61.679 1.00 20.37 ? 520  MET A O   1 
ATOM   3992 C  CB  . MET A 1 520 ? 23.884  55.831 62.900 1.00 22.60 ? 520  MET A CB  1 
ATOM   3993 C  CG  . MET A 1 520 ? 24.648  56.512 64.020 1.00 26.46 ? 520  MET A CG  1 
ATOM   3994 S  SD  . MET A 1 520 ? 25.010  55.362 65.385 1.00 30.47 ? 520  MET A SD  1 
ATOM   3995 C  CE  . MET A 1 520 ? 26.806  55.325 65.345 1.00 31.12 ? 520  MET A CE  1 
ATOM   3996 N  N   . CYS A 1 521 ? 23.269  54.446 60.320 1.00 19.31 ? 521  CYS A N   1 
ATOM   3997 C  CA  . CYS A 1 521 ? 22.383  53.820 59.345 1.00 15.03 ? 521  CYS A CA  1 
ATOM   3998 C  C   . CYS A 1 521 ? 22.842  52.449 58.837 1.00 16.53 ? 521  CYS A C   1 
ATOM   3999 O  O   . CYS A 1 521 ? 22.026  51.642 58.412 1.00 15.93 ? 521  CYS A O   1 
ATOM   4000 C  CB  . CYS A 1 521 ? 22.088  54.774 58.204 1.00 11.48 ? 521  CYS A CB  1 
ATOM   4001 S  SG  . CYS A 1 521 ? 20.984  56.122 58.727 1.00 14.75 ? 521  CYS A SG  1 
ATOM   4002 N  N   . VAL A 1 522 ? 24.135  52.162 58.890 1.00 16.40 ? 522  VAL A N   1 
ATOM   4003 C  CA  . VAL A 1 522 ? 24.583  50.847 58.471 1.00 17.63 ? 522  VAL A CA  1 
ATOM   4004 C  C   . VAL A 1 522 ? 24.072  49.890 59.533 1.00 18.36 ? 522  VAL A C   1 
ATOM   4005 O  O   . VAL A 1 522 ? 23.582  48.808 59.222 1.00 17.64 ? 522  VAL A O   1 
ATOM   4006 C  CB  . VAL A 1 522 ? 26.102  50.739 58.414 1.00 19.31 ? 522  VAL A CB  1 
ATOM   4007 C  CG1 . VAL A 1 522 ? 26.507  49.296 58.163 1.00 17.91 ? 522  VAL A CG1 1 
ATOM   4008 C  CG2 . VAL A 1 522 ? 26.650  51.646 57.325 1.00 20.91 ? 522  VAL A CG2 1 
ATOM   4009 N  N   . PHE A 1 523 ? 24.180  50.305 60.794 1.00 19.47 ? 523  PHE A N   1 
ATOM   4010 C  CA  . PHE A 1 523 ? 23.715  49.492 61.915 1.00 18.28 ? 523  PHE A CA  1 
ATOM   4011 C  C   . PHE A 1 523 ? 22.203  49.374 61.839 1.00 17.67 ? 523  PHE A C   1 
ATOM   4012 O  O   . PHE A 1 523 ? 21.649  48.303 62.047 1.00 16.05 ? 523  PHE A O   1 
ATOM   4013 C  CB  . PHE A 1 523 ? 24.126  50.123 63.256 1.00 17.77 ? 523  PHE A CB  1 
ATOM   4014 C  CG  . PHE A 1 523 ? 23.148  49.867 64.378 1.00 18.23 ? 523  PHE A CG  1 
ATOM   4015 C  CD1 . PHE A 1 523 ? 23.152  48.664 65.066 1.00 18.03 ? 523  PHE A CD1 1 
ATOM   4016 C  CD2 . PHE A 1 523 ? 22.182  50.811 64.703 1.00 19.25 ? 523  PHE A CD2 1 
ATOM   4017 C  CE1 . PHE A 1 523 ? 22.210  48.403 66.049 1.00 15.63 ? 523  PHE A CE1 1 
ATOM   4018 C  CE2 . PHE A 1 523 ? 21.234  50.553 65.688 1.00 18.10 ? 523  PHE A CE2 1 
ATOM   4019 C  CZ  . PHE A 1 523 ? 21.250  49.349 66.357 1.00 16.76 ? 523  PHE A CZ  1 
ATOM   4020 N  N   . TRP A 1 524 ? 21.537  50.485 61.550 1.00 15.68 ? 524  TRP A N   1 
ATOM   4021 C  CA  . TRP A 1 524 ? 20.085  50.487 61.471 1.00 16.04 ? 524  TRP A CA  1 
ATOM   4022 C  C   . TRP A 1 524 ? 19.546  49.707 60.293 1.00 16.38 ? 524  TRP A C   1 
ATOM   4023 O  O   . TRP A 1 524 ? 18.705  48.822 60.458 1.00 18.03 ? 524  TRP A O   1 
ATOM   4024 C  CB  . TRP A 1 524 ? 19.539  51.919 61.430 1.00 14.97 ? 524  TRP A CB  1 
ATOM   4025 C  CG  . TRP A 1 524 ? 19.455  52.558 62.770 1.00 13.31 ? 524  TRP A CG  1 
ATOM   4026 C  CD1 . TRP A 1 524 ? 20.106  53.674 63.182 1.00 15.66 ? 524  TRP A CD1 1 
ATOM   4027 C  CD2 . TRP A 1 524 ? 18.675  52.112 63.884 1.00 14.23 ? 524  TRP A CD2 1 
ATOM   4028 N  NE1 . TRP A 1 524 ? 19.785  53.954 64.485 1.00 15.76 ? 524  TRP A NE1 1 
ATOM   4029 C  CE2 . TRP A 1 524 ? 18.906  53.009 64.940 1.00 14.30 ? 524  TRP A CE2 1 
ATOM   4030 C  CE3 . TRP A 1 524 ? 17.800  51.039 64.091 1.00 15.86 ? 524  TRP A CE3 1 
ATOM   4031 C  CZ2 . TRP A 1 524 ? 18.297  52.871 66.184 1.00 14.21 ? 524  TRP A CZ2 1 
ATOM   4032 C  CZ3 . TRP A 1 524 ? 17.193  50.904 65.329 1.00 14.16 ? 524  TRP A CZ3 1 
ATOM   4033 C  CH2 . TRP A 1 524 ? 17.445  51.817 66.358 1.00 13.22 ? 524  TRP A CH2 1 
ATOM   4034 N  N   . ASN A 1 525 ? 20.049  50.028 59.109 1.00 15.53 ? 525  ASN A N   1 
ATOM   4035 C  CA  . ASN A 1 525 ? 19.606  49.390 57.878 1.00 14.45 ? 525  ASN A CA  1 
ATOM   4036 C  C   . ASN A 1 525 ? 20.231  48.038 57.548 1.00 15.07 ? 525  ASN A C   1 
ATOM   4037 O  O   . ASN A 1 525 ? 19.638  47.255 56.816 1.00 18.19 ? 525  ASN A O   1 
ATOM   4038 C  CB  . ASN A 1 525 ? 19.790  50.344 56.703 1.00 11.35 ? 525  ASN A CB  1 
ATOM   4039 C  CG  . ASN A 1 525 ? 19.073  51.660 56.905 1.00 12.21 ? 525  ASN A CG  1 
ATOM   4040 O  OD1 . ASN A 1 525 ? 17.966  51.716 57.443 1.00 15.54 ? 525  ASN A OD1 1 
ATOM   4041 N  ND2 . ASN A 1 525 ? 19.700  52.731 56.469 1.00 13.89 ? 525  ASN A ND2 1 
ATOM   4042 N  N   . GLN A 1 526 ? 21.409  47.744 58.081 1.00 13.82 ? 526  GLN A N   1 
ATOM   4043 C  CA  . GLN A 1 526 ? 22.044  46.471 57.781 1.00 15.19 ? 526  GLN A CA  1 
ATOM   4044 C  C   . GLN A 1 526 ? 22.167  45.514 58.963 1.00 16.10 ? 526  GLN A C   1 
ATOM   4045 O  O   . GLN A 1 526 ? 21.679  44.388 58.904 1.00 16.14 ? 526  GLN A O   1 
ATOM   4046 C  CB  . GLN A 1 526 ? 23.413  46.702 57.148 1.00 18.31 ? 526  GLN A CB  1 
ATOM   4047 C  CG  . GLN A 1 526 ? 23.397  47.611 55.905 1.00 20.89 ? 526  GLN A CG  1 
ATOM   4048 N  N   . PHE A 1 527 ? 22.795  45.964 60.045 1.00 18.47 ? 527  PHE A N   1 
ATOM   4049 C  CA  . PHE A 1 527 ? 22.994  45.117 61.223 1.00 18.77 ? 527  PHE A CA  1 
ATOM   4050 C  C   . PHE A 1 527 ? 21.761  44.827 62.089 1.00 19.64 ? 527  PHE A C   1 
ATOM   4051 O  O   . PHE A 1 527 ? 21.357  43.675 62.219 1.00 20.52 ? 527  PHE A O   1 
ATOM   4052 C  CB  . PHE A 1 527 ? 24.115  45.674 62.092 1.00 16.87 ? 527  PHE A CB  1 
ATOM   4053 C  CG  . PHE A 1 527 ? 24.456  44.807 63.265 1.00 16.01 ? 527  PHE A CG  1 
ATOM   4054 C  CD1 . PHE A 1 527 ? 24.975  43.535 63.076 1.00 17.34 ? 527  PHE A CD1 1 
ATOM   4055 C  CD2 . PHE A 1 527 ? 24.277  45.272 64.561 1.00 16.90 ? 527  PHE A CD2 1 
ATOM   4056 C  CE1 . PHE A 1 527 ? 25.314  42.738 64.158 1.00 16.27 ? 527  PHE A CE1 1 
ATOM   4057 C  CE2 . PHE A 1 527 ? 24.608  44.488 65.649 1.00 16.01 ? 527  PHE A CE2 1 
ATOM   4058 C  CZ  . PHE A 1 527 ? 25.129  43.215 65.448 1.00 18.17 ? 527  PHE A CZ  1 
ATOM   4059 N  N   . LEU A 1 528 ? 21.181  45.858 62.697 1.00 19.50 ? 528  LEU A N   1 
ATOM   4060 C  CA  . LEU A 1 528 ? 20.016  45.689 63.564 1.00 19.81 ? 528  LEU A CA  1 
ATOM   4061 C  C   . LEU A 1 528 ? 18.981  44.702 63.051 1.00 21.10 ? 528  LEU A C   1 
ATOM   4062 O  O   . LEU A 1 528 ? 18.712  43.698 63.703 1.00 23.36 ? 528  LEU A O   1 
ATOM   4063 C  CB  . LEU A 1 528 ? 19.355  47.037 63.878 1.00 21.61 ? 528  LEU A CB  1 
ATOM   4064 C  CG  . LEU A 1 528 ? 18.587  47.244 65.203 1.00 20.99 ? 528  LEU A CG  1 
ATOM   4065 C  CD1 . LEU A 1 528 ? 17.115  47.530 64.949 1.00 19.80 ? 528  LEU A CD1 1 
ATOM   4066 C  CD2 . LEU A 1 528 ? 18.769  46.052 66.142 1.00 20.26 ? 528  LEU A CD2 1 
ATOM   4067 N  N   . PRO A 1 529 ? 18.462  44.908 61.834 1.00 22.59 ? 529  PRO A N   1 
ATOM   4068 C  CA  . PRO A 1 529 ? 17.454  43.972 61.326 1.00 21.32 ? 529  PRO A CA  1 
ATOM   4069 C  C   . PRO A 1 529 ? 18.010  42.583 61.152 1.00 20.44 ? 529  PRO A C   1 
ATOM   4070 O  O   . PRO A 1 529 ? 17.313  41.603 61.374 1.00 23.55 ? 529  PRO A O   1 
ATOM   4071 C  CB  . PRO A 1 529 ? 17.070  44.580 59.992 1.00 23.26 ? 529  PRO A CB  1 
ATOM   4072 C  CG  . PRO A 1 529 ? 18.370  45.174 59.534 1.00 26.01 ? 529  PRO A CG  1 
ATOM   4073 C  CD  . PRO A 1 529 ? 18.864  45.859 60.788 1.00 24.37 ? 529  PRO A CD  1 
ATOM   4074 N  N   . LYS A 1 530 ? 19.277  42.497 60.780 1.00 20.14 ? 530  LYS A N   1 
ATOM   4075 C  CA  . LYS A 1 530 ? 19.901  41.204 60.580 1.00 21.53 ? 530  LYS A CA  1 
ATOM   4076 C  C   . LYS A 1 530 ? 20.013  40.526 61.934 1.00 22.94 ? 530  LYS A C   1 
ATOM   4077 O  O   . LYS A 1 530 ? 19.745  39.329 62.063 1.00 23.66 ? 530  LYS A O   1 
ATOM   4078 C  CB  . LYS A 1 530 ? 21.277  41.374 59.942 1.00 22.74 ? 530  LYS A CB  1 
ATOM   4079 C  CG  . LYS A 1 530 ? 21.885  40.087 59.444 1.00 25.74 ? 530  LYS A CG  1 
ATOM   4080 C  CD  . LYS A 1 530 ? 23.250  40.348 58.851 1.00 29.23 ? 530  LYS A CD  1 
ATOM   4081 C  CE  . LYS A 1 530 ? 23.870  39.066 58.315 1.00 33.25 ? 530  LYS A CE  1 
ATOM   4082 N  NZ  . LYS A 1 530 ? 23.905  37.971 59.332 1.00 35.69 ? 530  LYS A NZ  1 
ATOM   4083 N  N   . LEU A 1 531 ? 20.345  41.312 62.956 1.00 23.48 ? 531  LEU A N   1 
ATOM   4084 C  CA  . LEU A 1 531 ? 20.469  40.788 64.307 1.00 22.98 ? 531  LEU A CA  1 
ATOM   4085 C  C   . LEU A 1 531 ? 19.088  40.258 64.682 1.00 23.34 ? 531  LEU A C   1 
ATOM   4086 O  O   . LEU A 1 531 ? 18.911  39.061 64.902 1.00 22.40 ? 531  LEU A O   1 
ATOM   4087 C  CB  . LEU A 1 531 ? 20.890  41.900 65.276 1.00 22.22 ? 531  LEU A CB  1 
ATOM   4088 C  CG  . LEU A 1 531 ? 21.482  41.523 66.647 1.00 22.96 ? 531  LEU A CG  1 
ATOM   4089 C  CD1 . LEU A 1 531 ? 21.749  42.778 67.444 1.00 21.98 ? 531  LEU A CD1 1 
ATOM   4090 C  CD2 . LEU A 1 531 ? 20.570  40.606 67.442 1.00 21.13 ? 531  LEU A CD2 1 
ATOM   4091 N  N   . LEU A 1 532 ? 18.103  41.150 64.638 1.00 23.93 ? 532  LEU A N   1 
ATOM   4092 C  CA  . LEU A 1 532 ? 16.728  40.819 64.982 1.00 26.79 ? 532  LEU A CA  1 
ATOM   4093 C  C   . LEU A 1 532 ? 16.186  39.569 64.296 1.00 28.88 ? 532  LEU A C   1 
ATOM   4094 O  O   . LEU A 1 532 ? 15.383  38.844 64.884 1.00 30.81 ? 532  LEU A O   1 
ATOM   4095 C  CB  . LEU A 1 532 ? 15.806  42.008 64.705 1.00 25.02 ? 532  LEU A CB  1 
ATOM   4096 C  CG  . LEU A 1 532 ? 15.918  43.212 65.646 1.00 27.24 ? 532  LEU A CG  1 
ATOM   4097 C  CD1 . LEU A 1 532 ? 15.186  44.413 65.052 1.00 27.07 ? 532  LEU A CD1 1 
ATOM   4098 C  CD2 . LEU A 1 532 ? 15.364  42.864 67.024 1.00 26.10 ? 532  LEU A CD2 1 
ATOM   4099 N  N   . ASN A 1 533 ? 16.590  39.330 63.051 1.00 30.49 ? 533  ASN A N   1 
ATOM   4100 C  CA  . ASN A 1 533 ? 16.114  38.147 62.331 1.00 32.75 ? 533  ASN A CA  1 
ATOM   4101 C  C   . ASN A 1 533 ? 16.772  36.884 62.894 1.00 33.16 ? 533  ASN A C   1 
ATOM   4102 O  O   . ASN A 1 533 ? 16.135  35.828 63.022 1.00 31.73 ? 533  ASN A O   1 
ATOM   4103 C  CB  . ASN A 1 533 ? 16.410  38.263 60.827 1.00 32.27 ? 533  ASN A CB  1 
ATOM   4104 N  N   . ALA A 1 534 ? 18.055  37.002 63.212 1.00 33.93 ? 534  ALA A N   1 
ATOM   4105 C  CA  . ALA A 1 534 ? 18.802  35.877 63.738 1.00 35.76 ? 534  ALA A CA  1 
ATOM   4106 C  C   . ALA A 1 534 ? 18.344  35.527 65.154 1.00 36.84 ? 534  ALA A C   1 
ATOM   4107 O  O   . ALA A 1 534 ? 18.036  34.365 65.438 1.00 38.24 ? 534  ALA A O   1 
ATOM   4108 C  CB  . ALA A 1 534 ? 20.299  36.181 63.708 1.00 35.41 ? 534  ALA A CB  1 
ATOM   4109 N  N   . THR A 1 535 ? 18.301  36.523 66.037 1.00 36.82 ? 535  THR A N   1 
ATOM   4110 C  CA  . THR A 1 535 ? 17.881  36.296 67.415 1.00 35.51 ? 535  THR A CA  1 
ATOM   4111 C  C   . THR A 1 535 ? 16.359  36.217 67.551 1.00 35.91 ? 535  THR A C   1 
ATOM   4112 O  O   . THR A 1 535 ? 15.694  37.280 67.572 1.00 36.09 ? 535  THR A O   1 
ATOM   4113 C  CB  . THR A 1 535 ? 18.454  37.379 68.366 1.00 35.29 ? 535  THR A CB  1 
ATOM   4114 O  OG1 . THR A 1 535 ? 18.129  38.693 67.883 1.00 32.94 ? 535  THR A OG1 1 
ATOM   4115 C  CG2 . THR A 1 535 ? 19.959  37.241 68.455 1.00 32.94 ? 535  THR A CG2 1 
HETATM 4116 HG HG  . HG  B 2 .   ? 13.776  81.812 42.564 0.45 44.00 ? 1536 HG  A HG  1 
HETATM 4117 HG HG  . HG  C 2 .   ? 10.319  57.855 55.685 0.65 30.38 ? 1537 HG  A HG  1 
HETATM 4118 O  O   . HOH D 3 .   ? -14.364 65.951 38.519 1.00 22.94 ? 2001 HOH A O   1 
HETATM 4119 O  O   . HOH D 3 .   ? -7.740  50.420 40.911 1.00 44.60 ? 2002 HOH A O   1 
HETATM 4120 O  O   . HOH D 3 .   ? -10.451 52.109 42.867 1.00 38.38 ? 2003 HOH A O   1 
HETATM 4121 O  O   . HOH D 3 .   ? -9.948  52.637 54.396 1.00 12.64 ? 2004 HOH A O   1 
HETATM 4122 O  O   . HOH D 3 .   ? -8.492  50.436 43.674 1.00 43.10 ? 2005 HOH A O   1 
HETATM 4123 O  O   . HOH D 3 .   ? 3.745   66.667 63.943 1.00 21.28 ? 2006 HOH A O   1 
HETATM 4124 O  O   . HOH D 3 .   ? -10.535 81.075 54.163 1.00 26.39 ? 2007 HOH A O   1 
HETATM 4125 O  O   . HOH D 3 .   ? -8.543  59.975 62.695 1.00 22.28 ? 2008 HOH A O   1 
HETATM 4126 O  O   . HOH D 3 .   ? -11.955 62.146 58.415 1.00 20.03 ? 2009 HOH A O   1 
HETATM 4127 O  O   . HOH D 3 .   ? -4.556  60.984 73.823 1.00 21.97 ? 2010 HOH A O   1 
HETATM 4128 O  O   . HOH D 3 .   ? -2.900  67.149 65.964 1.00 30.70 ? 2011 HOH A O   1 
HETATM 4129 O  O   . HOH D 3 .   ? -0.179  61.090 71.174 1.00 21.76 ? 2012 HOH A O   1 
HETATM 4130 O  O   . HOH D 3 .   ? 0.489   68.654 67.143 1.00 37.01 ? 2013 HOH A O   1 
HETATM 4131 O  O   . HOH D 3 .   ? -6.833  53.862 39.940 1.00 50.21 ? 2014 HOH A O   1 
HETATM 4132 O  O   . HOH D 3 .   ? -0.299  68.509 61.673 1.00 25.90 ? 2015 HOH A O   1 
HETATM 4133 O  O   . HOH D 3 .   ? -13.679 61.243 55.768 1.00 17.57 ? 2016 HOH A O   1 
HETATM 4134 O  O   . HOH D 3 .   ? -9.295  69.710 53.509 1.00 26.26 ? 2017 HOH A O   1 
HETATM 4135 O  O   . HOH D 3 .   ? -14.813 65.620 51.079 1.00 32.67 ? 2018 HOH A O   1 
HETATM 4136 O  O   . HOH D 3 .   ? -5.580  47.790 75.090 1.00 35.15 ? 2019 HOH A O   1 
HETATM 4137 O  O   . HOH D 3 .   ? -19.521 69.663 49.167 1.00 42.85 ? 2020 HOH A O   1 
HETATM 4138 O  O   . HOH D 3 .   ? 3.304   80.856 31.628 1.00 17.89 ? 2021 HOH A O   1 
HETATM 4139 O  O   . HOH D 3 .   ? 0.452   67.831 58.930 1.00 15.77 ? 2022 HOH A O   1 
HETATM 4140 O  O   . HOH D 3 .   ? -0.842  65.542 66.926 1.00 38.32 ? 2023 HOH A O   1 
HETATM 4141 O  O   . HOH D 3 .   ? 3.091   63.906 64.332 1.00 30.59 ? 2024 HOH A O   1 
HETATM 4142 O  O   . HOH D 3 .   ? -1.140  62.373 57.807 1.00 5.22  ? 2025 HOH A O   1 
HETATM 4143 O  O   . HOH D 3 .   ? 0.722   65.989 63.618 1.00 31.97 ? 2026 HOH A O   1 
HETATM 4144 O  O   . HOH D 3 .   ? -7.248  66.847 56.754 1.00 9.67  ? 2027 HOH A O   1 
HETATM 4145 O  O   . HOH D 3 .   ? -7.288  69.436 55.594 1.00 9.11  ? 2028 HOH A O   1 
HETATM 4146 O  O   . HOH D 3 .   ? 0.181   81.702 56.343 1.00 30.91 ? 2029 HOH A O   1 
HETATM 4147 O  O   . HOH D 3 .   ? 4.139   67.951 56.895 1.00 14.57 ? 2030 HOH A O   1 
HETATM 4148 O  O   . HOH D 3 .   ? -4.123  84.375 53.236 1.00 35.53 ? 2031 HOH A O   1 
HETATM 4149 O  O   . HOH D 3 .   ? -1.426  68.803 52.097 1.00 6.50  ? 2032 HOH A O   1 
HETATM 4150 O  O   . HOH D 3 .   ? -9.362  61.588 58.666 1.00 8.90  ? 2033 HOH A O   1 
HETATM 4151 O  O   . HOH D 3 .   ? -14.015 57.882 56.080 1.00 12.28 ? 2034 HOH A O   1 
HETATM 4152 O  O   . HOH D 3 .   ? -4.016  51.780 55.612 1.00 24.67 ? 2035 HOH A O   1 
HETATM 4153 O  O   . HOH D 3 .   ? -7.204  58.184 39.955 1.00 11.84 ? 2036 HOH A O   1 
HETATM 4154 O  O   . HOH D 3 .   ? -2.340  60.506 33.335 1.00 21.07 ? 2037 HOH A O   1 
HETATM 4155 O  O   . HOH D 3 .   ? -5.388  64.960 31.576 1.00 33.31 ? 2038 HOH A O   1 
HETATM 4156 O  O   . HOH D 3 .   ? -11.173 66.069 36.407 1.00 23.71 ? 2039 HOH A O   1 
HETATM 4157 O  O   . HOH D 3 .   ? 4.957   67.377 61.173 1.00 20.35 ? 2040 HOH A O   1 
HETATM 4158 O  O   . HOH D 3 .   ? -4.927  55.785 38.877 1.00 24.45 ? 2041 HOH A O   1 
HETATM 4159 O  O   . HOH D 3 .   ? 5.370   56.548 34.932 1.00 28.72 ? 2042 HOH A O   1 
HETATM 4160 O  O   . HOH D 3 .   ? 13.668  50.837 56.244 1.00 20.12 ? 2043 HOH A O   1 
HETATM 4161 O  O   . HOH D 3 .   ? 12.288  50.192 58.603 1.00 43.41 ? 2044 HOH A O   1 
HETATM 4162 O  O   . HOH D 3 .   ? 7.664   51.210 55.571 1.00 14.78 ? 2045 HOH A O   1 
HETATM 4163 O  O   . HOH D 3 .   ? -6.402  49.158 60.467 1.00 38.68 ? 2046 HOH A O   1 
HETATM 4164 O  O   . HOH D 3 .   ? -9.332  44.821 74.618 1.00 30.25 ? 2047 HOH A O   1 
HETATM 4165 O  O   . HOH D 3 .   ? -8.170  49.090 75.680 1.00 35.15 ? 2048 HOH A O   1 
HETATM 4166 O  O   . HOH D 3 .   ? -8.542  57.472 63.753 1.00 28.72 ? 2049 HOH A O   1 
HETATM 4167 O  O   . HOH D 3 .   ? -3.179  56.161 63.367 1.00 39.20 ? 2050 HOH A O   1 
HETATM 4168 O  O   . HOH D 3 .   ? 2.695   52.239 63.195 1.00 13.38 ? 2051 HOH A O   1 
HETATM 4169 O  O   . HOH D 3 .   ? -1.853  57.328 61.402 1.00 13.76 ? 2052 HOH A O   1 
HETATM 4170 O  O   . HOH D 3 .   ? -3.737  49.687 59.157 1.00 18.92 ? 2053 HOH A O   1 
HETATM 4171 O  O   . HOH D 3 .   ? -1.404  50.049 41.543 1.00 32.28 ? 2054 HOH A O   1 
HETATM 4172 O  O   . HOH D 3 .   ? 8.261   48.486 36.757 1.00 35.86 ? 2055 HOH A O   1 
HETATM 4173 O  O   . HOH D 3 .   ? 8.675   58.146 34.735 1.00 20.94 ? 2056 HOH A O   1 
HETATM 4174 O  O   . HOH D 3 .   ? 8.268   61.484 34.443 1.00 28.82 ? 2057 HOH A O   1 
HETATM 4175 O  O   . HOH D 3 .   ? 12.267  47.950 36.622 1.00 41.16 ? 2058 HOH A O   1 
HETATM 4176 O  O   . HOH D 3 .   ? 9.543   55.299 35.173 1.00 12.80 ? 2059 HOH A O   1 
HETATM 4177 O  O   . HOH D 3 .   ? 10.722  62.828 35.135 1.00 17.88 ? 2060 HOH A O   1 
HETATM 4178 O  O   . HOH D 3 .   ? 12.935  65.538 33.631 1.00 34.85 ? 2061 HOH A O   1 
HETATM 4179 O  O   . HOH D 3 .   ? 13.613  67.250 55.779 1.00 27.06 ? 2062 HOH A O   1 
HETATM 4180 O  O   . HOH D 3 .   ? 11.869  66.472 66.067 1.00 14.03 ? 2063 HOH A O   1 
HETATM 4181 O  O   . HOH D 3 .   ? 7.549   63.424 78.041 1.00 22.21 ? 2064 HOH A O   1 
HETATM 4182 O  O   . HOH D 3 .   ? 8.011   63.885 81.646 1.00 29.81 ? 2065 HOH A O   1 
HETATM 4183 O  O   . HOH D 3 .   ? 3.219   76.500 77.265 1.00 27.57 ? 2066 HOH A O   1 
HETATM 4184 O  O   . HOH D 3 .   ? 15.670  63.614 82.704 1.00 39.08 ? 2067 HOH A O   1 
HETATM 4185 O  O   . HOH D 3 .   ? 20.290  63.533 84.280 1.00 33.48 ? 2068 HOH A O   1 
HETATM 4186 O  O   . HOH D 3 .   ? 14.640  51.261 82.631 1.00 18.13 ? 2069 HOH A O   1 
HETATM 4187 O  O   . HOH D 3 .   ? 10.884  54.892 67.446 1.00 7.17  ? 2070 HOH A O   1 
HETATM 4188 O  O   . HOH D 3 .   ? 14.103  47.030 62.715 1.00 37.41 ? 2071 HOH A O   1 
HETATM 4189 O  O   . HOH D 3 .   ? 25.683  46.598 68.184 1.00 26.54 ? 2072 HOH A O   1 
HETATM 4190 O  O   . HOH D 3 .   ? 21.085  65.702 68.946 1.00 25.83 ? 2073 HOH A O   1 
HETATM 4191 O  O   . HOH D 3 .   ? 23.385  60.264 64.334 1.00 13.21 ? 2074 HOH A O   1 
HETATM 4192 O  O   . HOH D 3 .   ? 15.287  51.834 60.004 1.00 34.71 ? 2075 HOH A O   1 
HETATM 4193 O  O   . HOH D 3 .   ? 20.931  50.382 52.922 1.00 11.88 ? 2076 HOH A O   1 
HETATM 4194 O  O   . HOH D 3 .   ? 17.836  53.376 35.599 1.00 20.96 ? 2077 HOH A O   1 
HETATM 4195 O  O   . HOH D 3 .   ? 20.364  60.087 36.364 1.00 23.84 ? 2078 HOH A O   1 
HETATM 4196 O  O   . HOH D 3 .   ? 20.237  61.559 33.923 1.00 38.12 ? 2079 HOH A O   1 
HETATM 4197 O  O   . HOH D 3 .   ? 15.827  63.495 31.888 1.00 45.70 ? 2080 HOH A O   1 
HETATM 4198 O  O   . HOH D 3 .   ? 13.941  75.131 62.403 1.00 26.14 ? 2081 HOH A O   1 
HETATM 4199 O  O   . HOH D 3 .   ? 9.450   79.345 64.031 1.00 26.25 ? 2082 HOH A O   1 
HETATM 4200 O  O   . HOH D 3 .   ? 7.674   82.155 67.011 1.00 35.27 ? 2083 HOH A O   1 
HETATM 4201 O  O   . HOH D 3 .   ? 19.128  67.392 70.189 1.00 25.12 ? 2084 HOH A O   1 
HETATM 4202 O  O   . HOH D 3 .   ? 6.221   67.836 64.352 1.00 18.77 ? 2085 HOH A O   1 
HETATM 4203 O  O   . HOH D 3 .   ? 8.082   74.484 60.194 1.00 38.18 ? 2086 HOH A O   1 
HETATM 4204 O  O   . HOH D 3 .   ? 6.784   78.800 62.856 1.00 39.56 ? 2087 HOH A O   1 
HETATM 4205 O  O   . HOH D 3 .   ? 13.722  82.336 45.803 1.00 37.12 ? 2088 HOH A O   1 
HETATM 4206 O  O   . HOH D 3 .   ? 13.849  85.018 46.215 1.00 18.19 ? 2089 HOH A O   1 
HETATM 4207 O  O   . HOH D 3 .   ? 9.525   80.377 36.268 1.00 20.66 ? 2090 HOH A O   1 
HETATM 4208 O  O   . HOH D 3 .   ? 22.926  65.242 47.449 1.00 20.28 ? 2091 HOH A O   1 
HETATM 4209 O  O   . HOH D 3 .   ? 23.247  75.836 53.269 1.00 12.69 ? 2092 HOH A O   1 
HETATM 4210 O  O   . HOH D 3 .   ? 22.568  51.177 54.936 1.00 32.14 ? 2093 HOH A O   1 
HETATM 4211 O  O   . HOH D 3 .   ? 16.018  48.811 61.733 1.00 25.06 ? 2094 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 ?   ?   ?   A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HG  1  1536 1536 HG  HG  A . 
C 2 HG  1  1537 1537 HG  HG  A . 
D 3 HOH 1  2001 2001 HOH HOH A . 
D 3 HOH 2  2002 2002 HOH HOH A . 
D 3 HOH 3  2003 2003 HOH HOH A . 
D 3 HOH 4  2004 2004 HOH HOH A . 
D 3 HOH 5  2005 2005 HOH HOH A . 
D 3 HOH 6  2006 2006 HOH HOH A . 
D 3 HOH 7  2007 2007 HOH HOH A . 
D 3 HOH 8  2008 2008 HOH HOH A . 
D 3 HOH 9  2009 2009 HOH HOH A . 
D 3 HOH 10 2010 2010 HOH HOH A . 
D 3 HOH 11 2011 2011 HOH HOH A . 
D 3 HOH 12 2012 2012 HOH HOH A . 
D 3 HOH 13 2013 2013 HOH HOH A . 
D 3 HOH 14 2014 2014 HOH HOH A . 
D 3 HOH 15 2015 2015 HOH HOH A . 
D 3 HOH 16 2016 2016 HOH HOH A . 
D 3 HOH 17 2017 2017 HOH HOH A . 
D 3 HOH 18 2018 2018 HOH HOH A . 
D 3 HOH 19 2019 2019 HOH HOH A . 
D 3 HOH 20 2020 2020 HOH HOH A . 
D 3 HOH 21 2021 2021 HOH HOH A . 
D 3 HOH 22 2022 2022 HOH HOH A . 
D 3 HOH 23 2023 2023 HOH HOH A . 
D 3 HOH 24 2024 2024 HOH HOH A . 
D 3 HOH 25 2025 2025 HOH HOH A . 
D 3 HOH 26 2026 2026 HOH HOH A . 
D 3 HOH 27 2027 2027 HOH HOH A . 
D 3 HOH 28 2028 2028 HOH HOH A . 
D 3 HOH 29 2029 2029 HOH HOH A . 
D 3 HOH 30 2030 2030 HOH HOH A . 
D 3 HOH 31 2031 2031 HOH HOH A . 
D 3 HOH 32 2032 2032 HOH HOH A . 
D 3 HOH 33 2033 2033 HOH HOH A . 
D 3 HOH 34 2034 2034 HOH HOH A . 
D 3 HOH 35 2035 2035 HOH HOH A . 
D 3 HOH 36 2036 2036 HOH HOH A . 
D 3 HOH 37 2037 2037 HOH HOH A . 
D 3 HOH 38 2038 2038 HOH HOH A . 
D 3 HOH 39 2039 2039 HOH HOH A . 
D 3 HOH 40 2040 2040 HOH HOH A . 
D 3 HOH 41 2041 2041 HOH HOH A . 
D 3 HOH 42 2042 2042 HOH HOH A . 
D 3 HOH 43 2043 2043 HOH HOH A . 
D 3 HOH 44 2044 2044 HOH HOH A . 
D 3 HOH 45 2045 2045 HOH HOH A . 
D 3 HOH 46 2046 2046 HOH HOH A . 
D 3 HOH 47 2047 2047 HOH HOH A . 
D 3 HOH 48 2048 2048 HOH HOH A . 
D 3 HOH 49 2049 2049 HOH HOH A . 
D 3 HOH 50 2050 2050 HOH HOH A . 
D 3 HOH 51 2051 2051 HOH HOH A . 
D 3 HOH 52 2052 2052 HOH HOH A . 
D 3 HOH 53 2053 2053 HOH HOH A . 
D 3 HOH 54 2054 2054 HOH HOH A . 
D 3 HOH 55 2055 2055 HOH HOH A . 
D 3 HOH 56 2056 2056 HOH HOH A . 
D 3 HOH 57 2057 2057 HOH HOH A . 
D 3 HOH 58 2058 2058 HOH HOH A . 
D 3 HOH 59 2059 2059 HOH HOH A . 
D 3 HOH 60 2060 2060 HOH HOH A . 
D 3 HOH 61 2061 2061 HOH HOH A . 
D 3 HOH 62 2062 2062 HOH HOH A . 
D 3 HOH 63 2063 2063 HOH HOH A . 
D 3 HOH 64 2064 2064 HOH HOH A . 
D 3 HOH 65 2065 2065 HOH HOH A . 
D 3 HOH 66 2066 2066 HOH HOH A . 
D 3 HOH 67 2067 2067 HOH HOH A . 
D 3 HOH 68 2068 2068 HOH HOH A . 
D 3 HOH 69 2069 2069 HOH HOH A . 
D 3 HOH 70 2070 2070 HOH HOH A . 
D 3 HOH 71 2071 2071 HOH HOH A . 
D 3 HOH 72 2072 2072 HOH HOH A . 
D 3 HOH 73 2073 2073 HOH HOH A . 
D 3 HOH 74 2074 2074 HOH HOH A . 
D 3 HOH 75 2075 2075 HOH HOH A . 
D 3 HOH 76 2076 2076 HOH HOH A . 
D 3 HOH 77 2077 2077 HOH HOH A . 
D 3 HOH 78 2078 2078 HOH HOH A . 
D 3 HOH 79 2079 2079 HOH HOH A . 
D 3 HOH 80 2080 2080 HOH HOH A . 
D 3 HOH 81 2081 2081 HOH HOH A . 
D 3 HOH 82 2082 2082 HOH HOH A . 
D 3 HOH 83 2083 2083 HOH HOH A . 
D 3 HOH 84 2084 2084 HOH HOH A . 
D 3 HOH 85 2085 2085 HOH HOH A . 
D 3 HOH 86 2086 2086 HOH HOH A . 
D 3 HOH 87 2087 2087 HOH HOH A . 
D 3 HOH 88 2088 2088 HOH HOH A . 
D 3 HOH 89 2089 2089 HOH HOH A . 
D 3 HOH 90 2090 2090 HOH HOH A . 
D 3 HOH 91 2091 2091 HOH HOH A . 
D 3 HOH 92 2092 2092 HOH HOH A . 
D 3 HOH 93 2093 2093 HOH HOH A . 
D 3 HOH 94 2094 2094 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2040  ? 
1 MORE         -56   ? 
1 'SSA (A^2)'  33940 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 135.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 139 ? A GLU 139 ? 1_555 HG ? B HG . ? A HG 1536 ? 1_555 OE2 ? A GLU 139 ? A GLU 139  ? 1_555 50.6  ? 
2  OE1 ? A GLU 139 ? A GLU 139 ? 1_555 HG ? B HG . ? A HG 1536 ? 1_555 ND1 ? A HIS 471 ? A HIS 471  ? 1_555 75.5  ? 
3  OE2 ? A GLU 139 ? A GLU 139 ? 1_555 HG ? B HG . ? A HG 1536 ? 1_555 ND1 ? A HIS 471 ? A HIS 471  ? 1_555 113.3 ? 
4  OE1 ? A GLU 139 ? A GLU 139 ? 1_555 HG ? B HG . ? A HG 1536 ? 1_555 O   ? D HOH .   ? A HOH 2088 ? 1_555 98.5  ? 
5  OE2 ? A GLU 139 ? A GLU 139 ? 1_555 HG ? B HG . ? A HG 1536 ? 1_555 O   ? D HOH .   ? A HOH 2088 ? 1_555 59.8  ? 
6  ND1 ? A HIS 471 ? A HIS 471 ? 1_555 HG ? B HG . ? A HG 1536 ? 1_555 O   ? D HOH .   ? A HOH 2088 ? 1_555 101.0 ? 
7  OG  ? A SER 228 ? A SER 228 ? 1_555 HG ? C HG . ? A HG 1537 ? 1_555 N   ? A SER 228 ? A SER 228  ? 1_555 75.8  ? 
8  OG  ? A SER 228 ? A SER 228 ? 1_555 HG ? C HG . ? A HG 1537 ? 1_555 O   ? A SER 228 ? A SER 228  ? 1_555 73.4  ? 
9  N   ? A SER 228 ? A SER 228 ? 1_555 HG ? C HG . ? A HG 1537 ? 1_555 O   ? A SER 228 ? A SER 228  ? 1_555 69.0  ? 
10 OG  ? A SER 228 ? A SER 228 ? 1_555 HG ? C HG . ? A HG 1537 ? 1_555 SG  ? A CYS 231 ? A CYS 231  ? 1_555 90.2  ? 
11 N   ? A SER 228 ? A SER 228 ? 1_555 HG ? C HG . ? A HG 1537 ? 1_555 SG  ? A CYS 231 ? A CYS 231  ? 1_555 164.5 ? 
12 O   ? A SER 228 ? A SER 228 ? 1_555 HG ? C HG . ? A HG 1537 ? 1_555 SG  ? A CYS 231 ? A CYS 231  ? 1_555 101.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-05 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-05-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status      
2 4 'Structure model' pdbx_struct_assembly      
3 4 'Structure model' pdbx_struct_assembly_gen  
4 4 'Structure model' pdbx_struct_assembly_prop 
5 4 'Structure model' pdbx_struct_conn_angle    
6 4 'Structure model' pdbx_struct_oper_list     
7 4 'Structure model' struct_conn               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_database_status.status_code_sf'        
2  4 'Structure model' '_pdbx_struct_assembly.method_details'        
3  4 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
4  4 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
5  4 'Structure model' '_pdbx_struct_assembly_gen.oper_expression'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
16 4 'Structure model' '_pdbx_struct_conn_angle.value'               
17 4 'Structure model' '_struct_conn.pdbx_dist_value'                
18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR refinement       NULL ? 1 
XDS    'data reduction' .    ? 2 
XSCALE 'data scaling'   .    ? 3 
X-PLOR phasing          .    ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 5   ? ? 63.15   -76.00  
2  1 LEU A 23  ? ? 51.43   -120.59 
3  1 SER A 25  ? ? -127.04 -151.22 
4  1 PRO A 39  ? ? -72.87  36.51   
5  1 PHE A 45  ? ? 78.67   -30.00  
6  1 ALA A 60  ? ? -108.08 50.16   
7  1 PHE A 75  ? ? -154.46 68.91   
8  1 PRO A 102 ? ? -47.61  161.37  
9  1 SER A 108 ? ? -175.91 105.77  
10 1 PHE A 120 ? ? 66.85   -3.41   
11 1 ASN A 131 ? ? -65.66  96.86   
12 1 TYR A 137 ? ? -67.69  -71.04  
13 1 GLU A 140 ? ? 49.49   25.37   
14 1 ALA A 157 ? ? -111.85 74.02   
15 1 ALA A 164 ? ? -157.18 65.06   
16 1 ASN A 167 ? ? 44.38   15.73   
17 1 THR A 193 ? ? -148.25 48.83   
18 1 SER A 200 ? ? 55.96   -119.95 
19 1 SER A 228 ? ? -177.01 140.81  
20 1 ASN A 253 ? ? 50.86   72.28   
21 1 SER A 291 ? ? -58.42  -77.27  
22 1 PRO A 294 ? ? -37.34  123.81  
23 1 GLU A 299 ? ? -107.04 -62.19  
24 1 VAL A 360 ? ? -109.32 63.65   
25 1 TRP A 378 ? ? 58.76   -15.40  
26 1 ASP A 380 ? ? 179.84  41.95   
27 1 ASP A 381 ? ? -64.72  23.78   
28 1 PHE A 414 ? ? -152.26 -25.37  
29 1 ASN A 416 ? ? -97.45  52.59   
30 1 ASN A 457 ? ? 30.73   87.69   
31 1 LYS A 478 ? ? -74.19  -74.53  
32 1 LEU A 505 ? ? -114.94 78.99   
33 1 MET A 510 ? ? -40.53  101.32  
34 1 ARG A 515 ? ? 64.82   75.48   
35 1 ARG A 517 ? ? 17.55   62.88   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 14  ? CE  ? A LYS 14  CE  
2  1 Y 1 A LYS 14  ? NZ  ? A LYS 14  NZ  
3  1 Y 1 A ARG 19  ? CZ  ? A ARG 19  CZ  
4  1 Y 1 A ARG 19  ? NH1 ? A ARG 19  NH1 
5  1 Y 1 A ARG 19  ? NH2 ? A ARG 19  NH2 
6  1 Y 1 A HIS 26  ? CG  ? A HIS 26  CG  
7  1 Y 1 A HIS 26  ? ND1 ? A HIS 26  ND1 
8  1 Y 1 A HIS 26  ? CD2 ? A HIS 26  CD2 
9  1 Y 1 A HIS 26  ? CE1 ? A HIS 26  CE1 
10 1 Y 1 A HIS 26  ? NE2 ? A HIS 26  NE2 
11 1 Y 1 A ASN 42  ? CG  ? A ASN 42  CG  
12 1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
13 1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
14 1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
15 1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
16 1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
17 1 Y 1 A GLN 162 ? CG  ? A GLN 162 CG  
18 1 Y 1 A GLN 162 ? CD  ? A GLN 162 CD  
19 1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 
20 1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 
21 1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
22 1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
23 1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
24 1 Y 1 A GLU 260 ? CG  ? A GLU 260 CG  
25 1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
26 1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
27 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
28 1 Y 1 A GLU 261 ? CD  ? A GLU 261 CD  
29 1 Y 1 A GLU 261 ? OE1 ? A GLU 261 OE1 
30 1 Y 1 A GLU 261 ? OE2 ? A GLU 261 OE2 
31 1 Y 1 A LYS 270 ? CD  ? A LYS 270 CD  
32 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
33 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
34 1 Y 1 A PHE 284 ? CG  ? A PHE 284 CG  
35 1 Y 1 A PHE 284 ? CD1 ? A PHE 284 CD1 
36 1 Y 1 A PHE 284 ? CD2 ? A PHE 284 CD2 
37 1 Y 1 A PHE 284 ? CE1 ? A PHE 284 CE1 
38 1 Y 1 A PHE 284 ? CE2 ? A PHE 284 CE2 
39 1 Y 1 A PHE 284 ? CZ  ? A PHE 284 CZ  
40 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
41 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
42 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
43 1 Y 1 A GLU 344 ? CD  ? A GLU 344 CD  
44 1 Y 1 A GLU 344 ? OE1 ? A GLU 344 OE1 
45 1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
46 1 Y 1 A GLU 350 ? CD  ? A GLU 350 CD  
47 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
48 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
49 1 Y 1 A MET 353 ? SD  ? A MET 353 SD  
50 1 Y 1 A MET 353 ? CE  ? A MET 353 CE  
51 1 Y 1 A ASP 365 ? CG  ? A ASP 365 CG  
52 1 Y 1 A ASP 365 ? OD1 ? A ASP 365 OD1 
53 1 Y 1 A ASP 365 ? OD2 ? A ASP 365 OD2 
54 1 Y 1 A ASN 382 ? CG  ? A ASN 382 CG  
55 1 Y 1 A ASN 382 ? OD1 ? A ASN 382 OD1 
56 1 Y 1 A ASN 382 ? ND2 ? A ASN 382 ND2 
57 1 Y 1 A GLU 461 ? CD  ? A GLU 461 CD  
58 1 Y 1 A GLU 461 ? OE1 ? A GLU 461 OE1 
59 1 Y 1 A GLU 461 ? OE2 ? A GLU 461 OE2 
60 1 Y 1 A GLU 484 ? CD  ? A GLU 484 CD  
61 1 Y 1 A GLU 484 ? OE1 ? A GLU 484 OE1 
62 1 Y 1 A GLU 484 ? OE2 ? A GLU 484 OE2 
63 1 Y 1 A LYS 498 ? CB  ? A LYS 498 CB  
64 1 Y 1 A LYS 498 ? CG  ? A LYS 498 CG  
65 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
66 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
67 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
68 1 Y 1 A GLU 499 ? CD  ? A GLU 499 CD  
69 1 Y 1 A GLU 499 ? OE1 ? A GLU 499 OE1 
70 1 Y 1 A GLU 499 ? OE2 ? A GLU 499 OE2 
71 1 Y 1 A GLU 508 ? CB  ? A GLU 508 CB  
72 1 Y 1 A GLU 508 ? CG  ? A GLU 508 CG  
73 1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
74 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
75 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
76 1 Y 1 A LYS 511 ? CG  ? A LYS 511 CG  
77 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
78 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
79 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
80 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
81 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
82 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
83 1 Y 1 A GLN 526 ? CD  ? A GLN 526 CD  
84 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
85 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
86 1 Y 1 A ASN 533 ? CG  ? A ASN 533 CG  
87 1 Y 1 A ASN 533 ? OD1 ? A ASN 533 OD1 
88 1 Y 1 A ASN 533 ? ND2 ? A ASN 533 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A PRO 485 ? A PRO 485 
5  1 Y 1 A HIS 486 ? A HIS 486 
6  1 Y 1 A SER 487 ? A SER 487 
7  1 Y 1 A GLN 488 ? A GLN 488 
8  1 Y 1 A GLU 489 ? A GLU 489 
9  1 Y 1 A ALA 536 ? A ALA 536 
10 1 Y 1 A CYS 537 ? A CYS 537 
11 1 Y 1 A ASP 538 ? A ASP 538 
12 1 Y 1 A GLY 539 ? A GLY 539 
13 1 Y 1 A GLU 540 ? A GLU 540 
14 1 Y 1 A LEU 541 ? A LEU 541 
15 1 Y 1 A SER 542 ? A SER 542 
16 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MERCURY (II) ION' HG  
3 water              HOH 
#