data_2JAJ
# 
_entry.id   2JAJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JAJ         
PDBE  EBI-30473    
WWPDB D_1290030473 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JAI unspecified 'DDAH1 COMPLEXED WITH CITRULLINE'   
PDB 1H70 unspecified 'DDAH FROM PSEUDOMONAS AERUGINOSA.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JAJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Murray-Rust, J.' 1 ? 
;O'Hara, B.P.
;
2 ? 
'Rossiter, S.'    3 ? 
'Leiper, J.M.'    4 ? 
'Vallance, P.'    5 ? 
'McDonald, N.Q.'  6 ? 
# 
_citation.id                        primary 
_citation.title                     'Disruption of methylarginine metabolism impairs vascular homeostasis.' 
_citation.journal_abbrev            'Nat. Med.' 
_citation.journal_volume            13 
_citation.page_first                198 
_citation.page_last                 203 
_citation.year                      2007 
_citation.journal_id_ASTM           NAMEFI 
_citation.country                   US 
_citation.journal_id_ISSN           1078-8956 
_citation.journal_id_CSD            2148 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17273169 
_citation.pdbx_database_id_DOI      10.1038/nm1543 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Leiper, J.'           1  ? 
primary 'Nandi, M.'            2  ? 
primary 'Torondel, B.'         3  ? 
primary 'Murray-Rust, J.'      4  ? 
primary 'Malaki, M.'           5  ? 
primary 
;O'Hara, B.
;
6  ? 
primary 'Rossiter, S.'         7  ? 
primary 'Anthony, S.'          8  ? 
primary 'Madhani, M.'          9  ? 
primary 'Selwood, D.'          10 ? 
primary 'Smith, C.'            11 ? 
primary 'Wojciak-Stothard, B.' 12 ? 
primary 'Rudiger, A.'          13 ? 
primary 'Stidwill, R.'         14 ? 
primary 'McDonald, N.Q.'       15 ? 
primary 'Vallance, P.'         16 ? 
# 
_cell.entry_id           2JAJ 
_cell.length_a           44.849 
_cell.length_b           46.914 
_cell.length_c           147.612 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.56 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JAJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NG, NG-DIMETHYLARGININE DIMETHYLAMINOHYDROLASE 1'      31487.166 2   3.5.3.18 ? ? ? 
2 non-polymer syn 'N~5~-{IMINO[(2-METHOXYETHYL)AMINO]METHYL}-L-ORNITHINE' 232.280   2   ?        ? ? ? 
3 water       nat water                                                   18.015    281 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DIMETHYLARGININASE-1, DIMETHYLARGININE DIMETHYLAMINOHYDROLASE 1, DDAHI, DDAH-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGMAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVF
VEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILAD
TFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLH
RTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGMAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVF
VEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILAD
TFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLH
RTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   MET n 
1 6   ALA n 
1 7   GLY n 
1 8   LEU n 
1 9   GLY n 
1 10  HIS n 
1 11  PRO n 
1 12  ALA n 
1 13  ALA n 
1 14  PHE n 
1 15  GLY n 
1 16  ARG n 
1 17  ALA n 
1 18  THR n 
1 19  HIS n 
1 20  ALA n 
1 21  VAL n 
1 22  VAL n 
1 23  ARG n 
1 24  ALA n 
1 25  LEU n 
1 26  PRO n 
1 27  GLU n 
1 28  SER n 
1 29  LEU n 
1 30  GLY n 
1 31  GLN n 
1 32  HIS n 
1 33  ALA n 
1 34  LEU n 
1 35  ARG n 
1 36  SER n 
1 37  ALA n 
1 38  LYS n 
1 39  GLY n 
1 40  GLU n 
1 41  GLU n 
1 42  VAL n 
1 43  ASP n 
1 44  VAL n 
1 45  ALA n 
1 46  ARG n 
1 47  ALA n 
1 48  GLU n 
1 49  ARG n 
1 50  GLN n 
1 51  HIS n 
1 52  GLN n 
1 53  LEU n 
1 54  TYR n 
1 55  VAL n 
1 56  GLY n 
1 57  VAL n 
1 58  LEU n 
1 59  GLY n 
1 60  SER n 
1 61  LYS n 
1 62  LEU n 
1 63  GLY n 
1 64  LEU n 
1 65  GLN n 
1 66  VAL n 
1 67  VAL n 
1 68  GLU n 
1 69  LEU n 
1 70  PRO n 
1 71  ALA n 
1 72  ASP n 
1 73  GLU n 
1 74  SER n 
1 75  LEU n 
1 76  PRO n 
1 77  ASP n 
1 78  CYS n 
1 79  VAL n 
1 80  PHE n 
1 81  VAL n 
1 82  GLU n 
1 83  ASP n 
1 84  VAL n 
1 85  ALA n 
1 86  VAL n 
1 87  VAL n 
1 88  CYS n 
1 89  GLU n 
1 90  GLU n 
1 91  THR n 
1 92  ALA n 
1 93  LEU n 
1 94  ILE n 
1 95  THR n 
1 96  ARG n 
1 97  PRO n 
1 98  GLY n 
1 99  ALA n 
1 100 PRO n 
1 101 SER n 
1 102 ARG n 
1 103 ARG n 
1 104 LYS n 
1 105 GLU n 
1 106 VAL n 
1 107 ASP n 
1 108 MET n 
1 109 MET n 
1 110 LYS n 
1 111 GLU n 
1 112 ALA n 
1 113 LEU n 
1 114 GLU n 
1 115 LYS n 
1 116 LEU n 
1 117 GLN n 
1 118 LEU n 
1 119 ASN n 
1 120 ILE n 
1 121 VAL n 
1 122 GLU n 
1 123 MET n 
1 124 LYS n 
1 125 ASP n 
1 126 GLU n 
1 127 ASN n 
1 128 ALA n 
1 129 THR n 
1 130 LEU n 
1 131 ASP n 
1 132 GLY n 
1 133 GLY n 
1 134 ASP n 
1 135 VAL n 
1 136 LEU n 
1 137 PHE n 
1 138 THR n 
1 139 GLY n 
1 140 ARG n 
1 141 GLU n 
1 142 PHE n 
1 143 PHE n 
1 144 VAL n 
1 145 GLY n 
1 146 LEU n 
1 147 SER n 
1 148 LYS n 
1 149 ARG n 
1 150 THR n 
1 151 ASN n 
1 152 GLN n 
1 153 ARG n 
1 154 GLY n 
1 155 ALA n 
1 156 GLU n 
1 157 ILE n 
1 158 LEU n 
1 159 ALA n 
1 160 ASP n 
1 161 THR n 
1 162 PHE n 
1 163 LYS n 
1 164 ASP n 
1 165 TYR n 
1 166 ALA n 
1 167 VAL n 
1 168 SER n 
1 169 THR n 
1 170 VAL n 
1 171 PRO n 
1 172 VAL n 
1 173 ALA n 
1 174 ASP n 
1 175 GLY n 
1 176 LEU n 
1 177 HIS n 
1 178 LEU n 
1 179 LYS n 
1 180 SER n 
1 181 PHE n 
1 182 CYS n 
1 183 SER n 
1 184 MET n 
1 185 ALA n 
1 186 GLY n 
1 187 PRO n 
1 188 ASN n 
1 189 LEU n 
1 190 ILE n 
1 191 ALA n 
1 192 ILE n 
1 193 GLY n 
1 194 SER n 
1 195 SER n 
1 196 GLU n 
1 197 SER n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ALA n 
1 202 LEU n 
1 203 LYS n 
1 204 ILE n 
1 205 MET n 
1 206 GLN n 
1 207 GLN n 
1 208 MET n 
1 209 SER n 
1 210 ASP n 
1 211 HIS n 
1 212 ARG n 
1 213 TYR n 
1 214 ASP n 
1 215 LYS n 
1 216 LEU n 
1 217 THR n 
1 218 VAL n 
1 219 PRO n 
1 220 ASP n 
1 221 ASP n 
1 222 ILE n 
1 223 ALA n 
1 224 ALA n 
1 225 ASN n 
1 226 CYS n 
1 227 ILE n 
1 228 TYR n 
1 229 LEU n 
1 230 ASN n 
1 231 ILE n 
1 232 PRO n 
1 233 ASN n 
1 234 LYS n 
1 235 GLY n 
1 236 HIS n 
1 237 VAL n 
1 238 LEU n 
1 239 LEU n 
1 240 HIS n 
1 241 ARG n 
1 242 THR n 
1 243 PRO n 
1 244 GLU n 
1 245 GLU n 
1 246 TYR n 
1 247 PRO n 
1 248 GLU n 
1 249 SER n 
1 250 ALA n 
1 251 LYS n 
1 252 VAL n 
1 253 TYR n 
1 254 GLU n 
1 255 LYS n 
1 256 LEU n 
1 257 LYS n 
1 258 ASP n 
1 259 HIS n 
1 260 MET n 
1 261 LEU n 
1 262 ILE n 
1 263 PRO n 
1 264 VAL n 
1 265 SER n 
1 266 MET n 
1 267 SER n 
1 268 GLU n 
1 269 LEU n 
1 270 GLU n 
1 271 LYS n 
1 272 VAL n 
1 273 ASP n 
1 274 GLY n 
1 275 LEU n 
1 276 LEU n 
1 277 THR n 
1 278 CYS n 
1 279 CYS n 
1 280 SER n 
1 281 VAL n 
1 282 LEU n 
1 283 ILE n 
1 284 ASN n 
1 285 LYS n 
1 286 LYS n 
1 287 VAL n 
1 288 ASP n 
1 289 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2JAJ        1 ? ? 2JAJ   ? 
2 UNP DDAH1_HUMAN 1 ? ? O94760 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JAJ A 1 ? 5   ? 2JAJ   -4 ? 0   ? -4 0   
2 2 2JAJ A 6 ? 289 ? O94760 1  ? 284 ? 1  284 
3 1 2JAJ B 1 ? 5   ? 2JAJ   -4 ? 0   ? -4 0   
4 2 2JAJ B 6 ? 289 ? O94760 1  ? 284 ? 1  284 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                ? 'C3 H7 N O2 S'   121.158 
D20 non-polymer         . 'N~5~-{IMINO[(2-METHOXYETHYL)AMINO]METHYL}-L-ORNITHINE' ? 'C9 H20 N4 O3'   232.280 
GLN 'L-peptide linking' y GLUTAMINE                                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                              ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                               ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JAJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   49 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN: 20MG/ML IN 20MM TRIS-HCL PH 8.0, 150MM NACL, 1MM DTT. PRECIPITANT: 50MM TRIS-HCL PH 8.5, 150-300MM SODIUM ACETATE, 20-30% W/V PEG4000, 1MM DTT CO-CRYSTALLISED WITH 10MM LIGAND IN PRECIPITATING SOLUTION EXPT:SITTING DROPS UNDER MINERAL OIL AT 16DEG C
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2005-06-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9330 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.9330 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JAJ 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             33.900 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   39147 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   86.8 
_reflns_shell.Rmerge_I_obs           0.15000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.200 
_reflns_shell.pdbx_redundancy        4.40 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JAJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     37137 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    93.6 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2005 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.897 
_refine.B_iso_mean                               38.64 
_refine.aniso_B[1][1]                            2.58000 
_refine.aniso_B[2][2]                            -0.16000 
_refine.aniso_B[3][3]                            -2.59000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -1.07000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PART-REFINED DDAH1, IN-HOUSE COORDINATES' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.208 
_refine.pdbx_overall_ESU_R_Free                  0.188 
_refine.overall_SU_ML                            0.125 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.264 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4058 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             281 
_refine_hist.number_atoms_total               4371 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 4164 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.669  1.984  ? 5659 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.997  5.000  ? 552  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.074 25.000 ? 162  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.098 15.000 ? 660  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.887 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.113  0.200  ? 678  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 3111 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.208  0.200  ? 1871 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.306  0.200  ? 2821 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.185  0.200  ? 379  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.224  0.200  ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.217  0.200  ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.967  1.500  ? 2833 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.419  2.000  ? 4417 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.408  3.000  ? 1458 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.580  4.500  ? 1240 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             2502 
_refine_ls_shell.R_factor_R_work                  0.2240 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2300 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             129 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.872400 
_struct_ncs_oper.matrix[1][2]   -0.046060 
_struct_ncs_oper.matrix[1][3]   -0.486610 
_struct_ncs_oper.matrix[2][1]   -0.043540 
_struct_ncs_oper.matrix[2][2]   0.998920 
_struct_ncs_oper.matrix[2][3]   -0.016500 
_struct_ncs_oper.matrix[3][1]   0.486840 
_struct_ncs_oper.matrix[3][2]   0.006790 
_struct_ncs_oper.matrix[3][3]   -0.873460 
_struct_ncs_oper.vector[1]      50.12644 
_struct_ncs_oper.vector[2]      27.42638 
_struct_ncs_oper.vector[3]      56.14977 
# 
_struct.entry_id                  2JAJ 
_struct.title                     'DDAH1 complexed with L-257' 
_struct.pdbx_descriptor           'NG, NG-DIMETHYLARGININE DIMETHYLAMINOHYDROLASE 1 (E.C.3.5.3.18)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JAJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'DDAH, HYDROLASE, NITRIC OXIDE SYNTHASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 28  ? ALA A 33  ? SER A 23  ALA A 28  1 ? 6  
HELX_P HELX_P2  2  ASP A 43  ? SER A 60  ? ASP A 38  SER A 55  1 ? 18 
HELX_P HELX_P3  3  PHE A 80  ? ASP A 83  ? PHE A 75  ASP A 78  5 ? 4  
HELX_P HELX_P4  4  ALA A 99  ? LYS A 104 ? ALA A 94  LYS A 99  5 ? 6  
HELX_P HELX_P5  5  GLU A 105 ? LEU A 116 ? GLU A 100 LEU A 111 1 ? 12 
HELX_P HELX_P6  6  ASP A 131 ? GLY A 133 ? ASP A 126 GLY A 128 5 ? 3  
HELX_P HELX_P7  7  ASN A 151 ? PHE A 162 ? ASN A 146 PHE A 157 1 ? 12 
HELX_P HELX_P8  8  HIS A 177 ? SER A 180 ? HIS A 172 SER A 175 5 ? 4  
HELX_P HELX_P9  9  SER A 195 ? MET A 208 ? SER A 190 MET A 203 1 ? 14 
HELX_P HELX_P10 10 ASP A 220 ? ASN A 225 ? ASP A 215 ASN A 220 5 ? 6  
HELX_P HELX_P11 11 TYR A 246 ? GLU A 254 ? TYR A 241 GLU A 249 1 ? 9  
HELX_P HELX_P12 12 MET A 266 ? LYS A 271 ? MET A 261 LYS A 266 1 ? 6  
HELX_P HELX_P13 13 LEU A 276 ? SER A 280 ? LEU A 271 SER A 275 5 ? 5  
HELX_P HELX_P14 14 SER B 28  ? ALA B 33  ? SER B 23  ALA B 28  1 ? 6  
HELX_P HELX_P15 15 ASP B 43  ? SER B 60  ? ASP B 38  SER B 55  1 ? 18 
HELX_P HELX_P16 16 PHE B 80  ? ASP B 83  ? PHE B 75  ASP B 78  5 ? 4  
HELX_P HELX_P17 17 ALA B 99  ? LYS B 104 ? ALA B 94  LYS B 99  5 ? 6  
HELX_P HELX_P18 18 GLU B 105 ? LEU B 116 ? GLU B 100 LEU B 111 1 ? 12 
HELX_P HELX_P19 19 ASP B 131 ? GLY B 133 ? ASP B 126 GLY B 128 5 ? 3  
HELX_P HELX_P20 20 ASN B 151 ? PHE B 162 ? ASN B 146 PHE B 157 1 ? 12 
HELX_P HELX_P21 21 HIS B 177 ? SER B 180 ? HIS B 172 SER B 175 5 ? 4  
HELX_P HELX_P22 22 LYS B 200 ? SER B 209 ? LYS B 195 SER B 204 1 ? 10 
HELX_P HELX_P23 23 TYR B 246 ? GLU B 254 ? TYR B 241 GLU B 249 1 ? 9  
HELX_P HELX_P24 24 GLU B 268 ? ASP B 273 ? GLU B 263 ASP B 268 5 ? 6  
HELX_P HELX_P25 25 LEU B 276 ? SER B 280 ? LEU B 271 SER B 275 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 3 ? 
BA ? 3 ? 
BB ? 3 ? 
BC ? 3 ? 
BD ? 3 ? 
BE ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? parallel      
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AE 2 3 ? parallel      
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? parallel      
BD 1 2 ? anti-parallel 
BD 2 3 ? parallel      
BE 1 2 ? anti-parallel 
BE 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 65  ? LEU A 69  ? GLN A 60  LEU A 64  
AA 2 HIS A 19  ? ARG A 23  ? HIS A 14  ARG A 18  
AA 3 VAL A 281 ? ILE A 283 ? VAL A 276 ILE A 278 
AB 1 ALA A 85  ? CYS A 88  ? ALA A 80  CYS A 83  
AB 2 THR A 91  ? ILE A 94  ? THR A 86  ILE A 89  
AB 3 ASN A 119 ? GLU A 122 ? ASN A 114 GLU A 117 
AC 1 VAL A 135 ? PHE A 137 ? VAL A 130 PHE A 132 
AC 2 GLU A 141 ? LEU A 146 ? GLU A 136 LEU A 141 
AC 3 ALA A 166 ? PRO A 171 ? ALA A 161 PRO A 166 
AC 4 PRO B 2   ? LEU B 3   ? PRO B -3  LEU B -2  
AD 1 CYS A 182 ? GLY A 186 ? CYS A 177 GLY A 181 
AD 2 LEU A 189 ? GLY A 193 ? LEU A 184 GLY A 188 
AD 3 ASP A 214 ? VAL A 218 ? ASP A 209 VAL A 213 
AE 1 ILE A 227 ? ILE A 231 ? ILE A 222 ILE A 226 
AE 2 GLY A 235 ? HIS A 240 ? GLY A 230 HIS A 235 
AE 3 MET A 260 ? PRO A 263 ? MET A 255 PRO A 258 
BA 1 GLN B 65  ? LEU B 69  ? GLN B 60  LEU B 64  
BA 2 HIS B 19  ? ARG B 23  ? HIS B 14  ARG B 18  
BA 3 VAL B 281 ? ILE B 283 ? VAL B 276 ILE B 278 
BB 1 ALA B 85  ? CYS B 88  ? ALA B 80  CYS B 83  
BB 2 THR B 91  ? ILE B 94  ? THR B 86  ILE B 89  
BB 3 ASN B 119 ? GLU B 122 ? ASN B 114 GLU B 117 
BC 1 VAL B 135 ? PHE B 137 ? VAL B 130 PHE B 132 
BC 2 PHE B 142 ? LEU B 146 ? PHE B 137 LEU B 141 
BC 3 VAL B 167 ? PRO B 171 ? VAL B 162 PRO B 166 
BD 1 CYS B 182 ? GLY B 186 ? CYS B 177 GLY B 181 
BD 2 LEU B 189 ? GLY B 193 ? LEU B 184 GLY B 188 
BD 3 ASP B 214 ? VAL B 218 ? ASP B 209 VAL B 213 
BE 1 ILE B 227 ? ILE B 231 ? ILE B 222 ILE B 226 
BE 2 GLY B 235 ? ARG B 241 ? GLY B 230 ARG B 236 
BE 3 MET B 260 ? VAL B 264 ? MET B 255 VAL B 259 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 67  ? N VAL A 62  O ALA A 20  ? O ALA A 15  
AA 2 3 N VAL A 21  ? N VAL A 16  O VAL A 281 ? O VAL A 276 
AB 1 2 N CYS A 88  ? N CYS A 83  O THR A 91  ? O THR A 86  
AB 2 3 N ALA A 92  ? N ALA A 87  O ASN A 119 ? O ASN A 114 
AC 1 2 N LEU A 136 ? N LEU A 131 O PHE A 143 ? O PHE A 138 
AC 2 3 N PHE A 142 ? N PHE A 137 O ALA A 166 ? O ALA A 161 
AC 3 4 N VAL A 167 ? N VAL A 162 O LEU B 3   ? O LEU B -2  
AD 1 2 N ALA A 185 ? N ALA A 180 O LEU A 189 ? O LEU A 184 
AD 2 3 N ILE A 190 ? N ILE A 185 O ASP A 214 ? O ASP A 209 
AE 1 2 N ILE A 231 ? N ILE A 226 O GLY A 235 ? O GLY A 230 
AE 2 3 N LEU A 238 ? N LEU A 233 O MET A 260 ? O MET A 255 
BA 1 2 N VAL B 67  ? N VAL B 62  O ALA B 20  ? O ALA B 15  
BA 2 3 N VAL B 21  ? N VAL B 16  O VAL B 281 ? O VAL B 276 
BB 1 2 N CYS B 88  ? N CYS B 83  O THR B 91  ? O THR B 86  
BB 2 3 N ALA B 92  ? N ALA B 87  O ASN B 119 ? O ASN B 114 
BC 1 2 N LEU B 136 ? N LEU B 131 O PHE B 143 ? O PHE B 138 
BC 2 3 N VAL B 144 ? N VAL B 139 O SER B 168 ? O SER B 163 
BD 1 2 N ALA B 185 ? N ALA B 180 O LEU B 189 ? O LEU B 184 
BD 2 3 N ILE B 190 ? N ILE B 185 O ASP B 214 ? O ASP B 209 
BE 1 2 N ILE B 231 ? N ILE B 226 O GLY B 235 ? O GLY B 230 
BE 2 3 N LEU B 238 ? N LEU B 233 O MET B 260 ? O MET B 255 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE D20 A 500' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE D20 B 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LEU A 34  ? LEU A 29   . ? 1_555 ? 
2  AC1 15 ASP A 77  ? ASP A 72   . ? 1_555 ? 
3  AC1 15 PHE A 80  ? PHE A 75   . ? 1_555 ? 
4  AC1 15 ASP A 83  ? ASP A 78   . ? 1_555 ? 
5  AC1 15 ARG A 102 ? ARG A 97   . ? 1_555 ? 
6  AC1 15 HIS A 177 ? HIS A 172  . ? 1_555 ? 
7  AC1 15 LYS A 179 ? LYS A 174  . ? 1_555 ? 
8  AC1 15 SER A 180 ? SER A 175  . ? 1_555 ? 
9  AC1 15 ASN A 225 ? ASN A 220  . ? 1_555 ? 
10 AC1 15 VAL A 272 ? VAL A 267  . ? 1_555 ? 
11 AC1 15 ASP A 273 ? ASP A 268  . ? 1_555 ? 
12 AC1 15 THR A 277 ? THR A 272  . ? 1_555 ? 
13 AC1 15 CYS A 278 ? CYS A 273  . ? 1_555 ? 
14 AC1 15 HOH E .   ? HOH A 2077 . ? 1_555 ? 
15 AC1 15 HOH E .   ? HOH A 2126 . ? 1_555 ? 
16 AC2 12 LEU B 34  ? LEU B 29   . ? 1_555 ? 
17 AC2 12 ASP B 77  ? ASP B 72   . ? 1_555 ? 
18 AC2 12 PHE B 80  ? PHE B 75   . ? 1_555 ? 
19 AC2 12 ASP B 83  ? ASP B 78   . ? 1_555 ? 
20 AC2 12 ARG B 102 ? ARG B 97   . ? 1_555 ? 
21 AC2 12 HIS B 177 ? HIS B 172  . ? 1_555 ? 
22 AC2 12 LYS B 179 ? LYS B 174  . ? 1_555 ? 
23 AC2 12 SER B 180 ? SER B 175  . ? 1_555 ? 
24 AC2 12 VAL B 272 ? VAL B 267  . ? 1_555 ? 
25 AC2 12 ASP B 273 ? ASP B 268  . ? 1_555 ? 
26 AC2 12 THR B 277 ? THR B 272  . ? 1_555 ? 
27 AC2 12 CYS B 278 ? CYS B 273  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JAJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JAJ 
_atom_sites.fract_transf_matrix[1][1]   0.022297 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001778 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006796 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 13  ? 21.822  -7.809  38.012  1.00 40.21 ? 8    ALA A N   1 
ATOM   2    C CA  . ALA A 1 13  ? 20.902  -8.667  38.849  1.00 39.25 ? 8    ALA A CA  1 
ATOM   3    C C   . ALA A 1 13  ? 20.599  -7.902  40.148  1.00 37.71 ? 8    ALA A C   1 
ATOM   4    O O   . ALA A 1 13  ? 21.490  -7.686  40.981  1.00 37.49 ? 8    ALA A O   1 
ATOM   5    C CB  . ALA A 1 13  ? 21.552  -9.962  39.164  1.00 39.24 ? 8    ALA A CB  1 
ATOM   6    N N   . PHE A 1 14  ? 19.354  -7.493  40.326  1.00 35.47 ? 9    PHE A N   1 
ATOM   7    C CA  . PHE A 1 14  ? 19.062  -6.650  41.445  1.00 34.75 ? 9    PHE A CA  1 
ATOM   8    C C   . PHE A 1 14  ? 19.114  -7.493  42.726  1.00 33.94 ? 9    PHE A C   1 
ATOM   9    O O   . PHE A 1 14  ? 18.695  -8.661  42.717  1.00 34.78 ? 9    PHE A O   1 
ATOM   10   C CB  . PHE A 1 14  ? 17.721  -5.957  41.207  1.00 34.23 ? 9    PHE A CB  1 
ATOM   11   C CG  . PHE A 1 14  ? 17.169  -5.314  42.415  1.00 35.18 ? 9    PHE A CG  1 
ATOM   12   C CD1 . PHE A 1 14  ? 17.682  -4.108  42.875  1.00 33.45 ? 9    PHE A CD1 1 
ATOM   13   C CD2 . PHE A 1 14  ? 16.148  -5.933  43.118  1.00 34.59 ? 9    PHE A CD2 1 
ATOM   14   C CE1 . PHE A 1 14  ? 17.159  -3.513  44.041  1.00 36.10 ? 9    PHE A CE1 1 
ATOM   15   C CE2 . PHE A 1 14  ? 15.626  -5.366  44.234  1.00 34.52 ? 9    PHE A CE2 1 
ATOM   16   C CZ  . PHE A 1 14  ? 16.130  -4.155  44.704  1.00 35.88 ? 9    PHE A CZ  1 
ATOM   17   N N   . GLY A 1 15  ? 19.647  -6.937  43.806  1.00 33.64 ? 10   GLY A N   1 
ATOM   18   C CA  . GLY A 1 15  ? 19.545  -7.597  45.124  1.00 33.35 ? 10   GLY A CA  1 
ATOM   19   C C   . GLY A 1 15  ? 20.714  -8.517  45.455  1.00 32.47 ? 10   GLY A C   1 
ATOM   20   O O   . GLY A 1 15  ? 20.800  -9.047  46.547  1.00 33.97 ? 10   GLY A O   1 
ATOM   21   N N   . ARG A 1 16  ? 21.605  -8.714  44.513  1.00 32.10 ? 11   ARG A N   1 
ATOM   22   C CA  . ARG A 1 16  ? 22.909  -9.376  44.748  1.00 32.06 ? 11   ARG A CA  1 
ATOM   23   C C   . ARG A 1 16  ? 23.685  -8.720  45.880  1.00 31.65 ? 11   ARG A C   1 
ATOM   24   O O   . ARG A 1 16  ? 23.851  -7.480  45.903  1.00 31.59 ? 11   ARG A O   1 
ATOM   25   C CB  . ARG A 1 16  ? 23.773  -9.322  43.489  1.00 32.26 ? 11   ARG A CB  1 
ATOM   26   C CG  . ARG A 1 16  ? 23.393  -10.357 42.457  1.00 34.75 ? 11   ARG A CG  1 
ATOM   27   C CD  . ARG A 1 16  ? 23.939  -11.754 42.843  1.00 37.07 ? 11   ARG A CD  1 
ATOM   28   N N   . ALA A 1 17  ? 24.125  -9.543  46.825  1.00 29.55 ? 12   ALA A N   1 
ATOM   29   C CA  . ALA A 1 17  ? 25.004  -9.084  47.895  1.00 30.11 ? 12   ALA A CA  1 
ATOM   30   C C   . ALA A 1 17  ? 26.057  -10.150 48.221  1.00 29.84 ? 12   ALA A C   1 
ATOM   31   O O   . ALA A 1 17  ? 25.785  -11.327 48.077  1.00 29.80 ? 12   ALA A O   1 
ATOM   32   C CB  . ALA A 1 17  ? 24.151  -8.682  49.146  1.00 29.90 ? 12   ALA A CB  1 
ATOM   33   N N   . THR A 1 18  ? 27.261  -9.769  48.641  1.00 29.46 ? 13   THR A N   1 
ATOM   34   C CA  . THR A 1 18  ? 28.239  -10.779 49.051  1.00 29.67 ? 13   THR A CA  1 
ATOM   35   C C   . THR A 1 18  ? 28.636  -10.627 50.529  1.00 29.80 ? 13   THR A C   1 
ATOM   36   O O   . THR A 1 18  ? 29.209  -11.554 51.145  1.00 28.11 ? 13   THR A O   1 
ATOM   37   C CB  . THR A 1 18  ? 29.471  -10.690 48.161  1.00 29.45 ? 13   THR A CB  1 
ATOM   38   O OG1 . THR A 1 18  ? 29.972  -9.357  48.187  1.00 29.48 ? 13   THR A OG1 1 
ATOM   39   C CG2 . THR A 1 18  ? 29.093  -11.004 46.725  1.00 31.47 ? 13   THR A CG2 1 
ATOM   40   N N   . HIS A 1 19  ? 28.338  -9.430  51.075  1.00 29.54 ? 14   HIS A N   1 
ATOM   41   C CA  . HIS A 1 19  ? 28.825  -8.993  52.370  1.00 29.41 ? 14   HIS A CA  1 
ATOM   42   C C   . HIS A 1 19  ? 27.712  -8.223  53.047  1.00 28.77 ? 14   HIS A C   1 
ATOM   43   O O   . HIS A 1 19  ? 26.905  -7.595  52.381  1.00 28.17 ? 14   HIS A O   1 
ATOM   44   C CB  . HIS A 1 19  ? 30.040  -8.057  52.264  1.00 30.48 ? 14   HIS A CB  1 
ATOM   45   C CG  . HIS A 1 19  ? 31.312  -8.728  51.806  1.00 32.81 ? 14   HIS A CG  1 
ATOM   46   N ND1 . HIS A 1 19  ? 31.604  -8.947  50.478  1.00 38.11 ? 14   HIS A ND1 1 
ATOM   47   C CD2 . HIS A 1 19  ? 32.370  -9.220  52.504  1.00 32.62 ? 14   HIS A CD2 1 
ATOM   48   C CE1 . HIS A 1 19  ? 32.785  -9.536  50.371  1.00 31.70 ? 14   HIS A CE1 1 
ATOM   49   N NE2 . HIS A 1 19  ? 33.262  -9.724  51.587  1.00 32.64 ? 14   HIS A NE2 1 
ATOM   50   N N   . ALA A 1 20  ? 27.657  -8.322  54.373  1.00 29.63 ? 15   ALA A N   1 
ATOM   51   C CA  . ALA A 1 20  ? 26.770  -7.480  55.165  1.00 30.50 ? 15   ALA A CA  1 
ATOM   52   C C   . ALA A 1 20  ? 27.542  -6.918  56.349  1.00 32.10 ? 15   ALA A C   1 
ATOM   53   O O   . ALA A 1 20  ? 28.466  -7.565  56.847  1.00 32.74 ? 15   ALA A O   1 
ATOM   54   C CB  . ALA A 1 20  ? 25.525  -8.248  55.604  1.00 30.18 ? 15   ALA A CB  1 
ATOM   55   N N   . VAL A 1 21  ? 27.272  -5.659  56.700  1.00 30.56 ? 16   VAL A N   1 
ATOM   56   C CA  . VAL A 1 21  ? 27.792  -5.053  57.943  1.00 29.35 ? 16   VAL A CA  1 
ATOM   57   C C   . VAL A 1 21  ? 26.673  -4.985  58.925  1.00 28.77 ? 16   VAL A C   1 
ATOM   58   O O   . VAL A 1 21  ? 25.568  -4.506  58.560  1.00 27.61 ? 16   VAL A O   1 
ATOM   59   C CB  . VAL A 1 21  ? 28.393  -3.642  57.753  1.00 29.71 ? 16   VAL A CB  1 
ATOM   60   C CG1 . VAL A 1 21  ? 28.857  -3.068  59.109  1.00 29.01 ? 16   VAL A CG1 1 
ATOM   61   C CG2 . VAL A 1 21  ? 29.623  -3.730  56.791  1.00 29.77 ? 16   VAL A CG2 1 
ATOM   62   N N   . VAL A 1 22  ? 26.933  -5.476  60.142  1.00 28.32 ? 17   VAL A N   1 
ATOM   63   C CA  . VAL A 1 22  ? 25.947  -5.379  61.228  1.00 29.28 ? 17   VAL A CA  1 
ATOM   64   C C   . VAL A 1 22  ? 26.620  -4.842  62.442  1.00 31.03 ? 17   VAL A C   1 
ATOM   65   O O   . VAL A 1 22  ? 27.850  -4.717  62.463  1.00 28.62 ? 17   VAL A O   1 
ATOM   66   C CB  . VAL A 1 22  ? 25.318  -6.718  61.600  1.00 30.13 ? 17   VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 22  ? 24.502  -7.252  60.407  1.00 27.10 ? 17   VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 22  ? 26.422  -7.758  62.068  1.00 29.02 ? 17   VAL A CG2 1 
ATOM   69   N N   . ARG A 1 23  ? 25.851  -4.535  63.477  1.00 29.36 ? 18   ARG A N   1 
ATOM   70   C CA  . ARG A 1 23  ? 26.569  -4.126  64.708  1.00 30.95 ? 18   ARG A CA  1 
ATOM   71   C C   . ARG A 1 23  ? 25.859  -4.596  65.949  1.00 30.82 ? 18   ARG A C   1 
ATOM   72   O O   . ARG A 1 23  ? 24.655  -4.529  66.001  1.00 31.91 ? 18   ARG A O   1 
ATOM   73   C CB  . ARG A 1 23  ? 26.842  -2.604  64.755  1.00 30.47 ? 18   ARG A CB  1 
ATOM   74   C CG  . ARG A 1 23  ? 27.599  -2.065  65.996  1.00 29.38 ? 18   ARG A CG  1 
ATOM   75   C CD  . ARG A 1 23  ? 28.056  -0.652  65.744  1.00 29.77 ? 18   ARG A CD  1 
ATOM   76   N NE  . ARG A 1 23  ? 29.043  -0.313  66.766  1.00 34.14 ? 18   ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 23  ? 29.692  0.847   66.846  1.00 36.20 ? 18   ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 23  ? 29.462  1.823   65.957  1.00 30.96 ? 18   ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 23  ? 30.588  1.035   67.836  1.00 36.03 ? 18   ARG A NH2 1 
ATOM   80   N N   . ALA A 1 24  ? 26.606  -5.150  66.899  1.00 31.29 ? 19   ALA A N   1 
ATOM   81   C CA  . ALA A 1 24  ? 25.988  -5.672  68.149  1.00 33.48 ? 19   ALA A CA  1 
ATOM   82   C C   . ALA A 1 24  ? 25.257  -4.543  68.923  1.00 32.95 ? 19   ALA A C   1 
ATOM   83   O O   . ALA A 1 24  ? 25.632  -3.382  68.816  1.00 33.90 ? 19   ALA A O   1 
ATOM   84   C CB  . ALA A 1 24  ? 27.047  -6.271  69.003  1.00 33.47 ? 19   ALA A CB  1 
ATOM   85   N N   . LEU A 1 25  ? 24.202  -4.871  69.664  1.00 33.19 ? 20   LEU A N   1 
ATOM   86   C CA  . LEU A 1 25  ? 23.424  -3.832  70.358  1.00 33.17 ? 20   LEU A CA  1 
ATOM   87   C C   . LEU A 1 25  ? 23.928  -3.703  71.786  1.00 32.72 ? 20   LEU A C   1 
ATOM   88   O O   . LEU A 1 25  ? 24.261  -4.702  72.409  1.00 33.57 ? 20   LEU A O   1 
ATOM   89   C CB  . LEU A 1 25  ? 21.899  -4.078  70.292  1.00 33.39 ? 20   LEU A CB  1 
ATOM   90   C CG  . LEU A 1 25  ? 21.394  -5.370  70.903  1.00 33.41 ? 20   LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 25  ? 20.952  -5.220  72.403  1.00 37.68 ? 20   LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 25  ? 20.249  -5.942  70.108  1.00 34.83 ? 20   LEU A CD2 1 
ATOM   93   N N   . PRO A 1 26  ? 24.047  -2.459  72.290  1.00 32.67 ? 21   PRO A N   1 
ATOM   94   C CA  . PRO A 1 26  ? 24.529  -2.229  73.649  1.00 32.54 ? 21   PRO A CA  1 
ATOM   95   C C   . PRO A 1 26  ? 23.516  -2.519  74.733  1.00 33.06 ? 21   PRO A C   1 
ATOM   96   O O   . PRO A 1 26  ? 22.306  -2.407  74.485  1.00 34.24 ? 21   PRO A O   1 
ATOM   97   C CB  . PRO A 1 26  ? 24.844  -0.724  73.650  1.00 32.92 ? 21   PRO A CB  1 
ATOM   98   C CG  . PRO A 1 26  ? 23.990  -0.137  72.602  1.00 30.89 ? 21   PRO A CG  1 
ATOM   99   C CD  . PRO A 1 26  ? 23.717  -1.196  71.586  1.00 32.27 ? 21   PRO A CD  1 
ATOM   100  N N   . GLU A 1 27  ? 23.980  -2.852  75.944  1.00 32.27 ? 22   GLU A N   1 
ATOM   101  C CA  . GLU A 1 27  ? 23.076  -2.903  77.102  1.00 32.67 ? 22   GLU A CA  1 
ATOM   102  C C   . GLU A 1 27  ? 22.239  -1.612  77.248  1.00 32.04 ? 22   GLU A C   1 
ATOM   103  O O   . GLU A 1 27  ? 21.020  -1.676  77.481  1.00 31.27 ? 22   GLU A O   1 
ATOM   104  C CB  . GLU A 1 27  ? 23.810  -3.298  78.387  1.00 33.58 ? 22   GLU A CB  1 
ATOM   105  C CG  . GLU A 1 27  ? 22.951  -3.375  79.640  1.00 38.43 ? 22   GLU A CG  1 
ATOM   106  C CD  . GLU A 1 27  ? 21.789  -4.402  79.562  1.00 45.90 ? 22   GLU A CD  1 
ATOM   107  O OE1 . GLU A 1 27  ? 21.982  -5.561  79.104  1.00 47.53 ? 22   GLU A OE1 1 
ATOM   108  O OE2 . GLU A 1 27  ? 20.686  -4.035  79.993  1.00 47.25 ? 22   GLU A OE2 1 
ATOM   109  N N   . SER A 1 28  ? 22.882  -0.471  77.007  1.00 30.83 ? 23   SER A N   1 
ATOM   110  C CA  . SER A 1 28  ? 22.226  0.844   77.060  1.00 30.84 ? 23   SER A CA  1 
ATOM   111  C C   . SER A 1 28  ? 20.997  1.085   76.106  1.00 29.14 ? 23   SER A C   1 
ATOM   112  O O   . SER A 1 28  ? 20.237  2.013   76.302  1.00 27.14 ? 23   SER A O   1 
ATOM   113  C CB  . SER A 1 28  ? 23.274  1.915   76.877  1.00 29.65 ? 23   SER A CB  1 
ATOM   114  O OG  . SER A 1 28  ? 23.740  1.925   75.544  1.00 31.13 ? 23   SER A OG  1 
ATOM   115  N N   . LEU A 1 29  ? 20.827  0.236   75.090  1.00 29.31 ? 24   LEU A N   1 
ATOM   116  C CA  . LEU A 1 29  ? 19.745  0.349   74.142  1.00 28.24 ? 24   LEU A CA  1 
ATOM   117  C C   . LEU A 1 29  ? 18.427  0.302   74.884  1.00 28.20 ? 24   LEU A C   1 
ATOM   118  O O   . LEU A 1 29  ? 17.481  1.060   74.571  1.00 27.85 ? 24   LEU A O   1 
ATOM   119  C CB  . LEU A 1 29  ? 19.786  -0.802  73.051  1.00 28.14 ? 24   LEU A CB  1 
ATOM   120  C CG  . LEU A 1 29  ? 18.637  -0.783  72.024  1.00 28.81 ? 24   LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 29  ? 19.058  -1.122  70.535  1.00 28.94 ? 24   LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 29  ? 17.382  -1.637  72.432  1.00 29.10 ? 24   LEU A CD2 1 
ATOM   123  N N   . GLY A 1 30  ? 18.337  -0.597  75.866  1.00 27.55 ? 25   GLY A N   1 
ATOM   124  C CA  . GLY A 1 30  ? 17.058  -0.844  76.528  1.00 27.89 ? 25   GLY A CA  1 
ATOM   125  C C   . GLY A 1 30  ? 16.510  0.453   77.101  1.00 29.26 ? 25   GLY A C   1 
ATOM   126  O O   . GLY A 1 30  ? 15.327  0.774   76.906  1.00 27.98 ? 25   GLY A O   1 
ATOM   127  N N   . GLN A 1 31  ? 17.365  1.228   77.783  1.00 28.59 ? 26   GLN A N   1 
ATOM   128  C CA  . GLN A 1 31  ? 16.864  2.486   78.390  1.00 30.09 ? 26   GLN A CA  1 
ATOM   129  C C   . GLN A 1 31  ? 17.169  3.748   77.567  1.00 29.48 ? 26   GLN A C   1 
ATOM   130  O O   . GLN A 1 31  ? 16.474  4.752   77.702  1.00 30.30 ? 26   GLN A O   1 
ATOM   131  C CB  . GLN A 1 31  ? 17.391  2.656   79.818  1.00 30.06 ? 26   GLN A CB  1 
ATOM   132  C CG  . GLN A 1 31  ? 16.867  1.625   80.831  1.00 32.94 ? 26   GLN A CG  1 
ATOM   133  C CD  . GLN A 1 31  ? 15.401  1.756   81.183  1.00 37.34 ? 26   GLN A CD  1 
ATOM   134  O OE1 . GLN A 1 31  ? 15.035  2.412   82.164  1.00 40.13 ? 26   GLN A OE1 1 
ATOM   135  N NE2 . GLN A 1 31  ? 14.552  1.057   80.435  1.00 39.54 ? 26   GLN A NE2 1 
ATOM   136  N N   . HIS A 1 32  ? 18.168  3.692   76.693  1.00 29.67 ? 27   HIS A N   1 
ATOM   137  C CA  . HIS A 1 32  ? 18.705  4.930   76.109  1.00 29.01 ? 27   HIS A CA  1 
ATOM   138  C C   . HIS A 1 32  ? 18.479  5.122   74.614  1.00 28.36 ? 27   HIS A C   1 
ATOM   139  O O   . HIS A 1 32  ? 18.619  6.244   74.125  1.00 27.27 ? 27   HIS A O   1 
ATOM   140  C CB  . HIS A 1 32  ? 20.210  5.095   76.462  1.00 29.16 ? 27   HIS A CB  1 
ATOM   141  C CG  . HIS A 1 32  ? 20.431  5.408   77.902  1.00 33.46 ? 27   HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 32  ? 20.103  6.630   78.460  1.00 37.19 ? 27   HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 32  ? 20.919  4.653   78.910  1.00 35.77 ? 27   HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 32  ? 20.367  6.598   79.755  1.00 37.71 ? 27   HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 32  ? 20.840  5.403   80.056  1.00 35.91 ? 27   HIS A NE2 1 
ATOM   146  N N   . ALA A 1 33  ? 18.144  4.056   73.872  1.00 26.02 ? 28   ALA A N   1 
ATOM   147  C CA  . ALA A 1 33  ? 17.859  4.224   72.451  1.00 26.13 ? 28   ALA A CA  1 
ATOM   148  C C   . ALA A 1 33  ? 16.662  5.184   72.267  1.00 25.84 ? 28   ALA A C   1 
ATOM   149  O O   . ALA A 1 33  ? 15.753  5.196   73.089  1.00 26.19 ? 28   ALA A O   1 
ATOM   150  C CB  . ALA A 1 33  ? 17.538  2.866   71.785  1.00 25.78 ? 28   ALA A CB  1 
ATOM   151  N N   . LEU A 1 34  ? 16.646  5.923   71.153  1.00 25.92 ? 29   LEU A N   1 
ATOM   152  C CA  . LEU A 1 34  ? 15.634  6.925   70.923  1.00 26.49 ? 29   LEU A CA  1 
ATOM   153  C C   . LEU A 1 34  ? 14.347  6.175   70.580  1.00 27.30 ? 29   LEU A C   1 
ATOM   154  O O   . LEU A 1 34  ? 14.366  5.134   69.949  1.00 28.42 ? 29   LEU A O   1 
ATOM   155  C CB  . LEU A 1 34  ? 16.019  7.787   69.703  1.00 26.29 ? 29   LEU A CB  1 
ATOM   156  C CG  . LEU A 1 34  ? 17.348  8.556   69.869  1.00 25.78 ? 29   LEU A CG  1 
ATOM   157  C CD1 . LEU A 1 34  ? 17.602  9.393   68.633  1.00 30.46 ? 29   LEU A CD1 1 
ATOM   158  C CD2 . LEU A 1 34  ? 17.486  9.451   71.155  1.00 23.42 ? 29   LEU A CD2 1 
ATOM   159  N N   . ARG A 1 35  ? 13.223  6.754   70.894  1.00 27.91 ? 30   ARG A N   1 
ATOM   160  C CA  . ARG A 1 35  ? 11.974  6.058   70.574  1.00 30.02 ? 30   ARG A CA  1 
ATOM   161  C C   . ARG A 1 35  ? 10.881  7.060   70.566  1.00 31.96 ? 30   ARG A C   1 
ATOM   162  O O   . ARG A 1 35  ? 10.959  8.090   71.230  1.00 29.99 ? 30   ARG A O   1 
ATOM   163  C CB  . ARG A 1 35  ? 11.677  4.991   71.646  1.00 28.63 ? 30   ARG A CB  1 
ATOM   164  C CG  . ARG A 1 35  ? 11.359  5.554   73.036  1.00 29.44 ? 30   ARG A CG  1 
ATOM   165  C CD  . ARG A 1 35  ? 11.582  4.425   74.082  1.00 31.59 ? 30   ARG A CD  1 
ATOM   166  N NE  . ARG A 1 35  ? 13.037  4.141   74.160  1.00 27.56 ? 30   ARG A NE  1 
ATOM   167  C CZ  . ARG A 1 35  ? 13.585  3.158   74.882  1.00 29.65 ? 30   ARG A CZ  1 
ATOM   168  N NH1 . ARG A 1 35  ? 12.822  2.299   75.549  1.00 25.93 ? 30   ARG A NH1 1 
ATOM   169  N NH2 . ARG A 1 35  ? 14.893  3.003   74.906  1.00 25.28 ? 30   ARG A NH2 1 
ATOM   170  N N   . SER A 1 36  ? 9.843   6.751   69.802  1.00 36.85 ? 31   SER A N   1 
ATOM   171  C CA  . SER A 1 36  ? 8.614   7.580   69.770  1.00 39.83 ? 31   SER A CA  1 
ATOM   172  C C   . SER A 1 36  ? 7.806   7.016   70.862  1.00 40.67 ? 31   SER A C   1 
ATOM   173  O O   . SER A 1 36  ? 7.170   7.764   71.564  1.00 45.07 ? 31   SER A O   1 
ATOM   174  C CB  . SER A 1 36  ? 7.835   7.417   68.467  1.00 39.84 ? 31   SER A CB  1 
ATOM   175  O OG  . SER A 1 36  ? 8.639   6.959   67.373  1.00 44.47 ? 31   SER A OG  1 
ATOM   176  N N   . GLY A 1 39  ? 5.277   3.166   75.270  1.00 53.10 ? 34   GLY A N   1 
ATOM   177  C CA  . GLY A 1 39  ? 5.738   2.779   76.612  1.00 52.33 ? 34   GLY A CA  1 
ATOM   178  C C   . GLY A 1 39  ? 6.528   1.468   76.678  1.00 50.88 ? 34   GLY A C   1 
ATOM   179  O O   . GLY A 1 39  ? 7.642   1.453   77.203  1.00 51.82 ? 34   GLY A O   1 
ATOM   180  N N   . GLU A 1 40  ? 5.924   0.375   76.205  1.00 49.08 ? 35   GLU A N   1 
ATOM   181  C CA  . GLU A 1 40  ? 6.603   -0.911  75.916  1.00 46.47 ? 35   GLU A CA  1 
ATOM   182  C C   . GLU A 1 40  ? 8.067   -1.100  76.408  1.00 43.87 ? 35   GLU A C   1 
ATOM   183  O O   . GLU A 1 40  ? 9.013   -0.622  75.779  1.00 44.12 ? 35   GLU A O   1 
ATOM   184  C CB  . GLU A 1 40  ? 6.538   -1.166  74.393  1.00 47.20 ? 35   GLU A CB  1 
ATOM   185  C CG  . GLU A 1 40  ? 5.223   -1.841  73.928  1.00 47.89 ? 35   GLU A CG  1 
ATOM   186  N N   . GLU A 1 41  ? 8.253   -1.816  77.504  1.00 39.69 ? 36   GLU A N   1 
ATOM   187  C CA  . GLU A 1 41  ? 9.576   -2.000  78.046  1.00 36.50 ? 36   GLU A CA  1 
ATOM   188  C C   . GLU A 1 41  ? 10.393  -2.921  77.146  1.00 34.77 ? 36   GLU A C   1 
ATOM   189  O O   . GLU A 1 41  ? 9.893   -3.976  76.706  1.00 32.16 ? 36   GLU A O   1 
ATOM   190  C CB  . GLU A 1 41  ? 9.500   -2.559  79.456  1.00 36.58 ? 36   GLU A CB  1 
ATOM   191  C CG  . GLU A 1 41  ? 10.788  -3.201  79.920  1.00 38.73 ? 36   GLU A CG  1 
ATOM   192  C CD  . GLU A 1 41  ? 10.769  -3.606  81.405  1.00 36.89 ? 36   GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 41  ? 9.696   -3.985  81.950  1.00 36.43 ? 36   GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 41  ? 11.860  -3.574  82.019  1.00 34.85 ? 36   GLU A OE2 1 
ATOM   195  N N   . VAL A 1 42  ? 11.652  -2.540  76.877  1.00 33.00 ? 37   VAL A N   1 
ATOM   196  C CA  . VAL A 1 42  ? 12.489  -3.381  76.035  1.00 32.15 ? 37   VAL A CA  1 
ATOM   197  C C   . VAL A 1 42  ? 13.081  -4.544  76.866  1.00 32.57 ? 37   VAL A C   1 
ATOM   198  O O   . VAL A 1 42  ? 13.614  -4.310  77.947  1.00 33.85 ? 37   VAL A O   1 
ATOM   199  C CB  . VAL A 1 42  ? 13.567  -2.567  75.286  1.00 31.73 ? 37   VAL A CB  1 
ATOM   200  C CG1 . VAL A 1 42  ? 14.530  -3.464  74.547  1.00 32.46 ? 37   VAL A CG1 1 
ATOM   201  C CG2 . VAL A 1 42  ? 12.890  -1.616  74.285  1.00 30.91 ? 37   VAL A CG2 1 
ATOM   202  N N   . ASP A 1 43  ? 13.003  -5.767  76.318  1.00 30.80 ? 38   ASP A N   1 
ATOM   203  C CA  . ASP A 1 43  ? 13.695  -6.940  76.875  1.00 28.72 ? 38   ASP A CA  1 
ATOM   204  C C   . ASP A 1 43  ? 15.009  -7.074  76.108  1.00 27.83 ? 38   ASP A C   1 
ATOM   205  O O   . ASP A 1 43  ? 15.040  -7.531  74.981  1.00 27.97 ? 38   ASP A O   1 
ATOM   206  C CB  . ASP A 1 43  ? 12.817  -8.202  76.756  1.00 29.16 ? 38   ASP A CB  1 
ATOM   207  C CG  . ASP A 1 43  ? 13.448  -9.429  77.453  1.00 30.06 ? 38   ASP A CG  1 
ATOM   208  O OD1 . ASP A 1 43  ? 14.693  -9.466  77.502  1.00 27.81 ? 38   ASP A OD1 1 
ATOM   209  O OD2 . ASP A 1 43  ? 12.705  -10.336 77.927  1.00 26.96 ? 38   ASP A OD2 1 
ATOM   210  N N   . VAL A 1 44  ? 16.083  -6.572  76.683  1.00 26.93 ? 39   VAL A N   1 
ATOM   211  C CA  . VAL A 1 44  ? 17.355  -6.453  75.952  1.00 26.33 ? 39   VAL A CA  1 
ATOM   212  C C   . VAL A 1 44  ? 17.939  -7.840  75.571  1.00 26.87 ? 39   VAL A C   1 
ATOM   213  O O   . VAL A 1 44  ? 18.509  -8.025  74.472  1.00 27.55 ? 39   VAL A O   1 
ATOM   214  C CB  . VAL A 1 44  ? 18.325  -5.666  76.763  1.00 27.33 ? 39   VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 44  ? 19.779  -5.649  76.121  1.00 26.42 ? 39   VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 44  ? 17.845  -4.224  76.857  1.00 28.18 ? 39   VAL A CG2 1 
ATOM   217  N N   . ALA A 1 45  ? 17.807  -8.807  76.482  1.00 26.32 ? 40   ALA A N   1 
ATOM   218  C CA  . ALA A 1 45  ? 18.231  -10.208 76.190  1.00 25.89 ? 40   ALA A CA  1 
ATOM   219  C C   . ALA A 1 45  ? 17.459  -10.820 75.005  1.00 25.68 ? 40   ALA A C   1 
ATOM   220  O O   . ALA A 1 45  ? 18.041  -11.518 74.193  1.00 23.77 ? 40   ALA A O   1 
ATOM   221  C CB  . ALA A 1 45  ? 18.061  -11.076 77.454  1.00 25.97 ? 40   ALA A CB  1 
ATOM   222  N N   . ARG A 1 46  ? 16.136  -10.540 74.889  1.00 24.71 ? 41   ARG A N   1 
ATOM   223  C CA  . ARG A 1 46  ? 15.340  -11.024 73.765  1.00 25.18 ? 41   ARG A CA  1 
ATOM   224  C C   . ARG A 1 46  ? 15.711  -10.292 72.473  1.00 25.76 ? 41   ARG A C   1 
ATOM   225  O O   . ARG A 1 46  ? 15.775  -10.873 71.409  1.00 25.35 ? 41   ARG A O   1 
ATOM   226  C CB  . ARG A 1 46  ? 13.826  -10.861 74.053  1.00 25.64 ? 41   ARG A CB  1 
ATOM   227  C CG  . ARG A 1 46  ? 12.960  -11.435 72.986  1.00 24.53 ? 41   ARG A CG  1 
ATOM   228  C CD  . ARG A 1 46  ? 11.462  -11.452 73.501  1.00 26.94 ? 41   ARG A CD  1 
ATOM   229  N NE  . ARG A 1 46  ? 10.616  -12.078 72.499  1.00 30.90 ? 41   ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 46  ? 9.655   -11.479 71.793  1.00 38.10 ? 41   ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 46  ? 9.364   -10.182 71.961  1.00 40.62 ? 41   ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 46  ? 8.982   -12.196 70.896  1.00 40.09 ? 41   ARG A NH2 1 
ATOM   233  N N   . ALA A 1 47  ? 16.025  -9.010  72.569  1.00 26.02 ? 42   ALA A N   1 
ATOM   234  C CA  . ALA A 1 47  ? 16.505  -8.251  71.406  1.00 25.82 ? 42   ALA A CA  1 
ATOM   235  C C   . ALA A 1 47  ? 17.849  -8.812  70.896  1.00 25.37 ? 42   ALA A C   1 
ATOM   236  O O   . ALA A 1 47  ? 18.076  -8.933  69.702  1.00 26.50 ? 42   ALA A O   1 
ATOM   237  C CB  . ALA A 1 47  ? 16.690  -6.805  71.817  1.00 25.31 ? 42   ALA A CB  1 
ATOM   238  N N   . GLU A 1 48  ? 18.744  -9.141  71.802  1.00 25.73 ? 43   GLU A N   1 
ATOM   239  C CA  . GLU A 1 48  ? 20.047  -9.740  71.430  1.00 25.72 ? 43   GLU A CA  1 
ATOM   240  C C   . GLU A 1 48  ? 19.804  -11.073 70.737  1.00 26.45 ? 43   GLU A C   1 
ATOM   241  O O   . GLU A 1 48  ? 20.411  -11.384 69.732  1.00 25.97 ? 43   GLU A O   1 
ATOM   242  C CB  . GLU A 1 48  ? 20.854  -10.031 72.681  1.00 27.07 ? 43   GLU A CB  1 
ATOM   243  N N   . ARG A 1 49  ? 18.871  -11.844 71.271  1.00 26.52 ? 44   ARG A N   1 
ATOM   244  C CA  . ARG A 1 49  ? 18.503  -13.104 70.655  1.00 27.66 ? 44   ARG A CA  1 
ATOM   245  C C   . ARG A 1 49  ? 17.938  -12.955 69.242  1.00 28.03 ? 44   ARG A C   1 
ATOM   246  O O   . ARG A 1 49  ? 18.371  -13.580 68.336  1.00 29.03 ? 44   ARG A O   1 
ATOM   247  C CB  . ARG A 1 49  ? 17.597  -13.934 71.521  1.00 26.72 ? 44   ARG A CB  1 
ATOM   248  C CG  . ARG A 1 49  ? 17.319  -15.347 70.952  1.00 30.55 ? 44   ARG A CG  1 
ATOM   249  C CD  . ARG A 1 49  ? 18.216  -16.457 71.488  1.00 34.67 ? 44   ARG A CD  1 
ATOM   250  N NE  . ARG A 1 49  ? 19.564  -16.351 70.967  1.00 41.08 ? 44   ARG A NE  1 
ATOM   251  C CZ  . ARG A 1 49  ? 20.072  -17.042 69.961  1.00 37.14 ? 44   ARG A CZ  1 
ATOM   252  N NH1 . ARG A 1 49  ? 19.394  -17.958 69.325  1.00 35.84 ? 44   ARG A NH1 1 
ATOM   253  N NH2 . ARG A 1 49  ? 21.298  -16.808 69.599  1.00 28.53 ? 44   ARG A NH2 1 
ATOM   254  N N   . GLN A 1 50  ? 16.942  -12.110 69.110  1.00 27.18 ? 45   GLN A N   1 
ATOM   255  C CA  . GLN A 1 50  ? 16.446  -11.746 67.800  1.00 27.60 ? 45   GLN A CA  1 
ATOM   256  C C   . GLN A 1 50  ? 17.555  -11.230 66.854  1.00 26.67 ? 45   GLN A C   1 
ATOM   257  O O   . GLN A 1 50  ? 17.640  -11.660 65.702  1.00 26.85 ? 45   GLN A O   1 
ATOM   258  C CB  . GLN A 1 50  ? 15.308  -10.753 67.938  1.00 26.24 ? 45   GLN A CB  1 
ATOM   259  C CG  . GLN A 1 50  ? 14.074  -11.458 68.619  1.00 25.86 ? 45   GLN A CG  1 
ATOM   260  C CD  . GLN A 1 50  ? 12.887  -10.540 68.822  1.00 29.24 ? 45   GLN A CD  1 
ATOM   261  O OE1 . GLN A 1 50  ? 13.035  -9.349  68.796  1.00 29.22 ? 45   GLN A OE1 1 
ATOM   262  N NE2 . GLN A 1 50  ? 11.699  -11.115 69.087  1.00 26.20 ? 45   GLN A NE2 1 
ATOM   263  N N   . HIS A 1 51  ? 18.379  -10.320 67.333  1.00 25.93 ? 46   HIS A N   1 
ATOM   264  C CA  . HIS A 1 51  ? 19.468  -9.826  66.513  1.00 28.29 ? 46   HIS A CA  1 
ATOM   265  C C   . HIS A 1 51  ? 20.437  -10.946 66.096  1.00 28.50 ? 46   HIS A C   1 
ATOM   266  O O   . HIS A 1 51  ? 20.834  -11.022 64.892  1.00 26.92 ? 46   HIS A O   1 
ATOM   267  C CB  . HIS A 1 51  ? 20.211  -8.650  67.163  1.00 29.14 ? 46   HIS A CB  1 
ATOM   268  C CG  . HIS A 1 51  ? 21.251  -8.023  66.285  1.00 29.06 ? 46   HIS A CG  1 
ATOM   269  N ND1 . HIS A 1 51  ? 22.585  -8.378  66.343  1.00 30.06 ? 46   HIS A ND1 1 
ATOM   270  C CD2 . HIS A 1 51  ? 21.166  -7.017  65.368  1.00 28.30 ? 46   HIS A CD2 1 
ATOM   271  C CE1 . HIS A 1 51  ? 23.267  -7.649  65.480  1.00 29.41 ? 46   HIS A CE1 1 
ATOM   272  N NE2 . HIS A 1 51  ? 22.435  -6.812  64.881  1.00 30.48 ? 46   HIS A NE2 1 
ATOM   273  N N   . GLN A 1 52  ? 20.781  -11.825 67.054  1.00 29.20 ? 47   GLN A N   1 
ATOM   274  C CA  . GLN A 1 52  ? 21.688  -12.980 66.708  1.00 27.75 ? 47   GLN A CA  1 
ATOM   275  C C   . GLN A 1 52  ? 21.032  -13.880 65.651  1.00 26.40 ? 47   GLN A C   1 
ATOM   276  O O   . GLN A 1 52  ? 21.689  -14.326 64.734  1.00 25.41 ? 47   GLN A O   1 
ATOM   277  C CB  . GLN A 1 52  ? 22.044  -13.779 67.964  1.00 29.83 ? 47   GLN A CB  1 
ATOM   278  C CG  . GLN A 1 52  ? 23.018  -13.006 68.869  1.00 32.87 ? 47   GLN A CG  1 
ATOM   279  C CD  . GLN A 1 52  ? 23.198  -13.634 70.233  1.00 39.49 ? 47   GLN A CD  1 
ATOM   280  O OE1 . GLN A 1 52  ? 22.581  -14.662 70.567  1.00 43.43 ? 47   GLN A OE1 1 
ATOM   281  N NE2 . GLN A 1 52  ? 24.047  -13.009 71.047  1.00 40.63 ? 47   GLN A NE2 1 
ATOM   282  N N   . LEU A 1 53  ? 19.698  -14.114 65.766  1.00 25.75 ? 48   LEU A N   1 
ATOM   283  C CA  . LEU A 1 53  ? 19.028  -14.896 64.769  1.00 25.02 ? 48   LEU A CA  1 
ATOM   284  C C   . LEU A 1 53  ? 19.051  -14.279 63.364  1.00 26.71 ? 48   LEU A C   1 
ATOM   285  O O   . LEU A 1 53  ? 19.199  -14.992 62.369  1.00 26.94 ? 48   LEU A O   1 
ATOM   286  C CB  . LEU A 1 53  ? 17.621  -15.246 65.202  1.00 26.10 ? 48   LEU A CB  1 
ATOM   287  C CG  . LEU A 1 53  ? 17.541  -16.249 66.370  1.00 24.25 ? 48   LEU A CG  1 
ATOM   288  C CD1 . LEU A 1 53  ? 16.107  -16.180 66.886  1.00 28.20 ? 48   LEU A CD1 1 
ATOM   289  C CD2 . LEU A 1 53  ? 17.933  -17.677 65.927  1.00 26.84 ? 48   LEU A CD2 1 
ATOM   290  N N   . TYR A 1 54  ? 18.861  -12.965 63.286  1.00 26.17 ? 49   TYR A N   1 
ATOM   291  C CA  . TYR A 1 54  ? 18.905  -12.218 62.031  1.00 27.18 ? 49   TYR A CA  1 
ATOM   292  C C   . TYR A 1 54  ? 20.303  -12.264 61.414  1.00 27.59 ? 49   TYR A C   1 
ATOM   293  O O   . TYR A 1 54  ? 20.459  -12.537 60.206  1.00 28.41 ? 49   TYR A O   1 
ATOM   294  C CB  . TYR A 1 54  ? 18.527  -10.768 62.384  1.00 26.20 ? 49   TYR A CB  1 
ATOM   295  C CG  . TYR A 1 54  ? 18.728  -9.658  61.347  1.00 26.42 ? 49   TYR A CG  1 
ATOM   296  C CD1 . TYR A 1 54  ? 17.643  -9.149  60.621  1.00 28.32 ? 49   TYR A CD1 1 
ATOM   297  C CD2 . TYR A 1 54  ? 19.963  -9.034  61.193  1.00 26.12 ? 49   TYR A CD2 1 
ATOM   298  C CE1 . TYR A 1 54  ? 17.789  -8.081  59.707  1.00 27.28 ? 49   TYR A CE1 1 
ATOM   299  C CE2 . TYR A 1 54  ? 20.131  -7.959  60.287  1.00 24.54 ? 49   TYR A CE2 1 
ATOM   300  C CZ  . TYR A 1 54  ? 19.027  -7.480  59.574  1.00 29.00 ? 49   TYR A CZ  1 
ATOM   301  O OH  . TYR A 1 54  ? 19.129  -6.414  58.697  1.00 29.66 ? 49   TYR A OH  1 
ATOM   302  N N   . VAL A 1 55  ? 21.319  -12.039 62.232  1.00 28.44 ? 50   VAL A N   1 
ATOM   303  C CA  . VAL A 1 55  ? 22.727  -12.218 61.746  1.00 28.90 ? 50   VAL A CA  1 
ATOM   304  C C   . VAL A 1 55  ? 22.990  -13.671 61.242  1.00 29.75 ? 50   VAL A C   1 
ATOM   305  O O   . VAL A 1 55  ? 23.657  -13.875 60.227  1.00 28.51 ? 50   VAL A O   1 
ATOM   306  C CB  . VAL A 1 55  ? 23.736  -11.815 62.815  1.00 29.59 ? 50   VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 55  ? 25.206  -12.125 62.352  1.00 31.28 ? 50   VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 55  ? 23.572  -10.331 63.195  1.00 26.86 ? 50   VAL A CG2 1 
ATOM   309  N N   . GLY A 1 56  ? 22.455  -14.671 61.956  1.00 30.29 ? 51   GLY A N   1 
ATOM   310  C CA  . GLY A 1 56  ? 22.544  -16.062 61.513  1.00 30.17 ? 51   GLY A CA  1 
ATOM   311  C C   . GLY A 1 56  ? 21.984  -16.304 60.103  1.00 30.77 ? 51   GLY A C   1 
ATOM   312  O O   . GLY A 1 56  ? 22.560  -17.078 59.298  1.00 30.85 ? 51   GLY A O   1 
ATOM   313  N N   . VAL A 1 57  ? 20.851  -15.669 59.791  1.00 29.90 ? 52   VAL A N   1 
ATOM   314  C CA  . VAL A 1 57  ? 20.226  -15.825 58.485  1.00 29.42 ? 52   VAL A CA  1 
ATOM   315  C C   . VAL A 1 57  ? 21.127  -15.239 57.398  1.00 29.17 ? 52   VAL A C   1 
ATOM   316  O O   . VAL A 1 57  ? 21.367  -15.897 56.354  1.00 28.27 ? 52   VAL A O   1 
ATOM   317  C CB  . VAL A 1 57  ? 18.845  -15.110 58.423  1.00 30.36 ? 52   VAL A CB  1 
ATOM   318  C CG1 . VAL A 1 57  ? 18.372  -14.922 56.939  1.00 28.81 ? 52   VAL A CG1 1 
ATOM   319  C CG2 . VAL A 1 57  ? 17.808  -15.836 59.284  1.00 30.12 ? 52   VAL A CG2 1 
ATOM   320  N N   . LEU A 1 58  ? 21.659  -14.029 57.644  1.00 28.33 ? 53   LEU A N   1 
ATOM   321  C CA  . LEU A 1 58  ? 22.443  -13.313 56.621  1.00 29.32 ? 53   LEU A CA  1 
ATOM   322  C C   . LEU A 1 58  ? 23.692  -14.070 56.305  1.00 31.14 ? 53   LEU A C   1 
ATOM   323  O O   . LEU A 1 58  ? 23.987  -14.359 55.116  1.00 31.90 ? 53   LEU A O   1 
ATOM   324  C CB  . LEU A 1 58  ? 22.791  -11.891 57.068  1.00 30.00 ? 53   LEU A CB  1 
ATOM   325  C CG  . LEU A 1 58  ? 21.570  -10.907 57.044  1.00 30.12 ? 53   LEU A CG  1 
ATOM   326  C CD1 . LEU A 1 58  ? 21.947  -9.616  57.724  1.00 31.92 ? 53   LEU A CD1 1 
ATOM   327  C CD2 . LEU A 1 58  ? 21.076  -10.616 55.631  1.00 33.27 ? 53   LEU A CD2 1 
ATOM   328  N N   . GLY A 1 59  ? 24.375  -14.441 57.378  1.00 31.38 ? 54   GLY A N   1 
ATOM   329  C CA  . GLY A 1 59  ? 25.729  -14.996 57.333  1.00 35.17 ? 54   GLY A CA  1 
ATOM   330  C C   . GLY A 1 59  ? 25.766  -16.489 57.232  1.00 36.93 ? 54   GLY A C   1 
ATOM   331  O O   . GLY A 1 59  ? 26.465  -17.023 56.403  1.00 39.62 ? 54   GLY A O   1 
ATOM   332  N N   . SER A 1 60  ? 25.053  -17.178 58.107  1.00 38.68 ? 55   SER A N   1 
ATOM   333  C CA  . SER A 1 60  ? 25.082  -18.616 58.093  1.00 40.63 ? 55   SER A CA  1 
ATOM   334  C C   . SER A 1 60  ? 24.163  -19.200 56.992  1.00 40.77 ? 55   SER A C   1 
ATOM   335  O O   . SER A 1 60  ? 24.661  -19.848 56.045  1.00 41.66 ? 55   SER A O   1 
ATOM   336  C CB  . SER A 1 60  ? 24.775  -19.168 59.501  1.00 40.59 ? 55   SER A CB  1 
ATOM   337  O OG  . SER A 1 60  ? 24.631  -20.583 59.460  1.00 46.14 ? 55   SER A OG  1 
ATOM   338  N N   . LYS A 1 61  ? 22.855  -18.965 57.086  1.00 38.64 ? 56   LYS A N   1 
ATOM   339  C CA  . LYS A 1 61  ? 21.911  -19.552 56.149  1.00 38.03 ? 56   LYS A CA  1 
ATOM   340  C C   . LYS A 1 61  ? 22.072  -19.083 54.681  1.00 37.53 ? 56   LYS A C   1 
ATOM   341  O O   . LYS A 1 61  ? 22.077  -19.901 53.754  1.00 38.05 ? 56   LYS A O   1 
ATOM   342  C CB  . LYS A 1 61  ? 20.516  -19.312 56.657  1.00 38.01 ? 56   LYS A CB  1 
ATOM   343  C CG  . LYS A 1 61  ? 19.397  -20.001 55.909  1.00 40.99 ? 56   LYS A CG  1 
ATOM   344  C CD  . LYS A 1 61  ? 18.121  -19.310 56.326  1.00 41.64 ? 56   LYS A CD  1 
ATOM   345  C CE  . LYS A 1 61  ? 16.838  -20.000 55.867  1.00 44.76 ? 56   LYS A CE  1 
ATOM   346  N NZ  . LYS A 1 61  ? 16.089  -20.580 57.023  1.00 47.72 ? 56   LYS A NZ  1 
ATOM   347  N N   . LEU A 1 62  ? 22.240  -17.789 54.464  1.00 34.61 ? 57   LEU A N   1 
ATOM   348  C CA  . LEU A 1 62  ? 22.373  -17.274 53.083  1.00 34.03 ? 57   LEU A CA  1 
ATOM   349  C C   . LEU A 1 62  ? 23.817  -17.137 52.600  1.00 32.93 ? 57   LEU A C   1 
ATOM   350  O O   . LEU A 1 62  ? 24.068  -16.840 51.442  1.00 34.52 ? 57   LEU A O   1 
ATOM   351  C CB  . LEU A 1 62  ? 21.681  -15.921 52.964  1.00 31.17 ? 57   LEU A CB  1 
ATOM   352  C CG  . LEU A 1 62  ? 20.208  -16.048 53.309  1.00 33.45 ? 57   LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 62  ? 19.638  -14.615 53.231  1.00 29.50 ? 57   LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 62  ? 19.554  -17.052 52.336  1.00 30.83 ? 57   LEU A CD2 1 
ATOM   355  N N   . GLY A 1 63  ? 24.762  -17.244 53.496  1.00 32.60 ? 58   GLY A N   1 
ATOM   356  C CA  . GLY A 1 63  ? 26.185  -17.299 53.062  1.00 32.27 ? 58   GLY A CA  1 
ATOM   357  C C   . GLY A 1 63  ? 26.905  -15.981 52.830  1.00 32.40 ? 58   GLY A C   1 
ATOM   358  O O   . GLY A 1 63  ? 28.032  -15.971 52.354  1.00 30.09 ? 58   GLY A O   1 
ATOM   359  N N   . LEU A 1 64  ? 26.293  -14.845 53.183  1.00 31.25 ? 59   LEU A N   1 
ATOM   360  C CA  . LEU A 1 64  ? 27.036  -13.596 53.122  1.00 31.78 ? 59   LEU A CA  1 
ATOM   361  C C   . LEU A 1 64  ? 28.217  -13.607 54.099  1.00 31.81 ? 59   LEU A C   1 
ATOM   362  O O   . LEU A 1 64  ? 28.165  -14.246 55.138  1.00 32.58 ? 59   LEU A O   1 
ATOM   363  C CB  . LEU A 1 64  ? 26.129  -12.389 53.396  1.00 31.40 ? 59   LEU A CB  1 
ATOM   364  C CG  . LEU A 1 64  ? 24.899  -12.280 52.504  1.00 33.56 ? 59   LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 64  ? 24.110  -10.991 52.853  1.00 34.12 ? 59   LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 64  ? 25.252  -12.357 50.982  1.00 36.43 ? 59   LEU A CD2 1 
ATOM   367  N N   . GLN A 1 65  ? 29.272  -12.904 53.753  1.00 32.75 ? 60   GLN A N   1 
ATOM   368  C CA  . GLN A 1 65  ? 30.349  -12.626 54.658  1.00 34.63 ? 60   GLN A CA  1 
ATOM   369  C C   . GLN A 1 65  ? 29.911  -11.451 55.558  1.00 33.26 ? 60   GLN A C   1 
ATOM   370  O O   . GLN A 1 65  ? 29.807  -10.302 55.134  1.00 32.21 ? 60   GLN A O   1 
ATOM   371  C CB  . GLN A 1 65  ? 31.608  -12.280 53.860  1.00 33.46 ? 60   GLN A CB  1 
ATOM   372  C CG  . GLN A 1 65  ? 32.210  -13.480 53.051  1.00 39.42 ? 60   GLN A CG  1 
ATOM   373  C CD  . GLN A 1 65  ? 33.563  -13.181 52.365  1.00 40.40 ? 60   GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 65  ? 33.710  -13.330 51.146  1.00 46.28 ? 60   GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 65  ? 34.558  -12.771 53.153  1.00 48.74 ? 60   GLN A NE2 1 
ATOM   376  N N   . VAL A 1 66  ? 29.660  -11.735 56.823  1.00 34.44 ? 61   VAL A N   1 
ATOM   377  C CA  . VAL A 1 66  ? 29.181  -10.689 57.722  1.00 34.30 ? 61   VAL A CA  1 
ATOM   378  C C   . VAL A 1 66  ? 30.297  -10.073 58.496  1.00 34.93 ? 61   VAL A C   1 
ATOM   379  O O   . VAL A 1 66  ? 31.107  -10.775 59.085  1.00 35.75 ? 61   VAL A O   1 
ATOM   380  C CB  . VAL A 1 66  ? 28.068  -11.161 58.697  1.00 35.25 ? 61   VAL A CB  1 
ATOM   381  C CG1 . VAL A 1 66  ? 27.511  -9.922  59.497  1.00 32.90 ? 61   VAL A CG1 1 
ATOM   382  C CG2 . VAL A 1 66  ? 26.915  -11.824 57.957  1.00 32.31 ? 61   VAL A CG2 1 
ATOM   383  N N   . VAL A 1 67  ? 30.331  -8.747  58.505  1.00 34.41 ? 62   VAL A N   1 
ATOM   384  C CA  . VAL A 1 67  ? 31.214  -7.996  59.346  1.00 34.95 ? 62   VAL A CA  1 
ATOM   385  C C   . VAL A 1 67  ? 30.427  -7.516  60.567  1.00 35.20 ? 62   VAL A C   1 
ATOM   386  O O   . VAL A 1 67  ? 29.570  -6.680  60.434  1.00 33.93 ? 62   VAL A O   1 
ATOM   387  C CB  . VAL A 1 67  ? 31.839  -6.823  58.564  1.00 34.89 ? 62   VAL A CB  1 
ATOM   388  C CG1 . VAL A 1 67  ? 32.645  -5.932  59.479  1.00 36.74 ? 62   VAL A CG1 1 
ATOM   389  C CG2 . VAL A 1 67  ? 32.738  -7.379  57.414  1.00 37.28 ? 62   VAL A CG2 1 
ATOM   390  N N   . GLU A 1 68  ? 30.740  -8.066  61.739  1.00 35.01 ? 63   GLU A N   1 
ATOM   391  C CA  . GLU A 1 68  ? 30.018  -7.806  62.966  1.00 36.88 ? 63   GLU A CA  1 
ATOM   392  C C   . GLU A 1 68  ? 30.774  -6.758  63.759  1.00 35.84 ? 63   GLU A C   1 
ATOM   393  O O   . GLU A 1 68  ? 31.821  -7.047  64.333  1.00 34.43 ? 63   GLU A O   1 
ATOM   394  C CB  . GLU A 1 68  ? 29.857  -9.112  63.775  1.00 37.69 ? 63   GLU A CB  1 
ATOM   395  C CG  . GLU A 1 68  ? 29.229  -10.259 62.949  1.00 39.44 ? 63   GLU A CG  1 
ATOM   396  C CD  . GLU A 1 68  ? 28.661  -11.436 63.792  1.00 40.83 ? 63   GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 68  ? 27.957  -11.224 64.819  1.00 42.26 ? 63   GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 68  ? 28.876  -12.588 63.363  1.00 42.21 ? 63   GLU A OE2 1 
ATOM   399  N N   . LEU A 1 69  ? 30.227  -5.548  63.817  1.00 34.12 ? 64   LEU A N   1 
ATOM   400  C CA  . LEU A 1 69  ? 30.849  -4.474  64.549  1.00 34.01 ? 64   LEU A CA  1 
ATOM   401  C C   . LEU A 1 69  ? 30.554  -4.657  66.022  1.00 33.96 ? 64   LEU A C   1 
ATOM   402  O O   . LEU A 1 69  ? 29.476  -5.121  66.374  1.00 33.92 ? 64   LEU A O   1 
ATOM   403  C CB  . LEU A 1 69  ? 30.337  -3.137  64.027  1.00 33.32 ? 64   LEU A CB  1 
ATOM   404  C CG  . LEU A 1 69  ? 30.672  -2.811  62.556  1.00 35.53 ? 64   LEU A CG  1 
ATOM   405  C CD1 . LEU A 1 69  ? 30.279  -1.378  62.212  1.00 30.83 ? 64   LEU A CD1 1 
ATOM   406  C CD2 . LEU A 1 69  ? 32.163  -3.033  62.309  1.00 33.14 ? 64   LEU A CD2 1 
ATOM   407  N N   . PRO A 1 70  ? 31.507  -4.316  66.890  1.00 35.08 ? 65   PRO A N   1 
ATOM   408  C CA  . PRO A 1 70  ? 31.236  -4.359  68.337  1.00 34.37 ? 65   PRO A CA  1 
ATOM   409  C C   . PRO A 1 70  ? 30.308  -3.238  68.834  1.00 33.72 ? 65   PRO A C   1 
ATOM   410  O O   . PRO A 1 70  ? 30.335  -2.090  68.312  1.00 32.12 ? 65   PRO A O   1 
ATOM   411  C CB  . PRO A 1 70  ? 32.639  -4.185  68.952  1.00 34.36 ? 65   PRO A CB  1 
ATOM   412  C CG  . PRO A 1 70  ? 33.349  -3.362  67.970  1.00 35.02 ? 65   PRO A CG  1 
ATOM   413  C CD  . PRO A 1 70  ? 32.918  -3.921  66.628  1.00 35.24 ? 65   PRO A CD  1 
ATOM   414  N N   . ALA A 1 71  ? 29.511  -3.574  69.853  1.00 33.08 ? 66   ALA A N   1 
ATOM   415  C CA  . ALA A 1 71  ? 28.654  -2.590  70.480  1.00 33.38 ? 66   ALA A CA  1 
ATOM   416  C C   . ALA A 1 71  ? 29.459  -1.475  71.137  1.00 33.38 ? 66   ALA A C   1 
ATOM   417  O O   . ALA A 1 71  ? 30.567  -1.694  71.565  1.00 33.41 ? 66   ALA A O   1 
ATOM   418  C CB  . ALA A 1 71  ? 27.793  -3.235  71.471  1.00 33.95 ? 66   ALA A CB  1 
ATOM   419  N N   . ASP A 1 72  ? 28.877  -0.272  71.216  1.00 32.88 ? 67   ASP A N   1 
ATOM   420  C CA  . ASP A 1 72  ? 29.477  0.832   71.946  1.00 32.70 ? 67   ASP A CA  1 
ATOM   421  C C   . ASP A 1 72  ? 28.414  1.337   72.911  1.00 32.12 ? 67   ASP A C   1 
ATOM   422  O O   . ASP A 1 72  ? 27.404  1.905   72.479  1.00 31.37 ? 67   ASP A O   1 
ATOM   423  C CB  . ASP A 1 72  ? 29.870  1.952   70.989  1.00 33.17 ? 67   ASP A CB  1 
ATOM   424  C CG  . ASP A 1 72  ? 30.541  3.114   71.700  1.00 35.23 ? 67   ASP A CG  1 
ATOM   425  O OD1 . ASP A 1 72  ? 30.269  3.325   72.909  1.00 39.08 ? 67   ASP A OD1 1 
ATOM   426  O OD2 . ASP A 1 72  ? 31.336  3.808   71.057  1.00 35.36 ? 67   ASP A OD2 1 
ATOM   427  N N   . GLU A 1 73  ? 28.616  1.094   74.206  1.00 31.46 ? 68   GLU A N   1 
ATOM   428  C CA  . GLU A 1 73  ? 27.632  1.488   75.229  1.00 32.40 ? 68   GLU A CA  1 
ATOM   429  C C   . GLU A 1 73  ? 27.218  2.986   75.213  1.00 31.66 ? 68   GLU A C   1 
ATOM   430  O O   . GLU A 1 73  ? 26.141  3.346   75.625  1.00 32.36 ? 68   GLU A O   1 
ATOM   431  C CB  . GLU A 1 73  ? 28.069  1.030   76.619  1.00 31.03 ? 68   GLU A CB  1 
ATOM   432  C CG  . GLU A 1 73  ? 28.033  -0.458  76.860  1.00 31.27 ? 68   GLU A CG  1 
ATOM   433  C CD  . GLU A 1 73  ? 26.661  -1.052  76.802  1.00 36.57 ? 68   GLU A CD  1 
ATOM   434  O OE1 . GLU A 1 73  ? 25.681  -0.313  77.086  1.00 33.97 ? 68   GLU A OE1 1 
ATOM   435  O OE2 . GLU A 1 73  ? 26.557  -2.258  76.446  1.00 35.61 ? 68   GLU A OE2 1 
ATOM   436  N N   . SER A 1 74  ? 28.093  3.836   74.702  1.00 32.37 ? 69   SER A N   1 
ATOM   437  C CA  . SER A 1 74  ? 27.822  5.275   74.554  1.00 31.31 ? 69   SER A CA  1 
ATOM   438  C C   . SER A 1 74  ? 26.940  5.624   73.353  1.00 30.74 ? 69   SER A C   1 
ATOM   439  O O   . SER A 1 74  ? 26.440  6.753   73.209  1.00 28.06 ? 69   SER A O   1 
ATOM   440  C CB  . SER A 1 74  ? 29.162  6.027   74.520  1.00 31.52 ? 69   SER A CB  1 
ATOM   441  O OG  . SER A 1 74  ? 29.809  5.949   73.251  1.00 33.88 ? 69   SER A OG  1 
ATOM   442  N N   . LEU A 1 75  ? 26.686  4.630   72.497  1.00 30.37 ? 70   LEU A N   1 
ATOM   443  C CA  . LEU A 1 75  ? 25.839  4.822   71.345  1.00 28.63 ? 70   LEU A CA  1 
ATOM   444  C C   . LEU A 1 75  ? 24.664  3.793   71.351  1.00 28.67 ? 70   LEU A C   1 
ATOM   445  O O   . LEU A 1 75  ? 24.689  2.765   70.665  1.00 27.57 ? 70   LEU A O   1 
ATOM   446  C CB  . LEU A 1 75  ? 26.628  4.738   70.033  1.00 29.75 ? 70   LEU A CB  1 
ATOM   447  C CG  . LEU A 1 75  ? 27.911  5.615   69.984  1.00 31.34 ? 70   LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 75  ? 28.909  5.017   69.058  1.00 30.77 ? 70   LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 75  ? 27.531  7.037   69.574  1.00 32.81 ? 70   LEU A CD2 1 
ATOM   450  N N   . PRO A 1 76  ? 23.616  4.115   72.086  1.00 28.22 ? 71   PRO A N   1 
ATOM   451  C CA  . PRO A 1 76  ? 22.494  3.172   72.337  1.00 28.56 ? 71   PRO A CA  1 
ATOM   452  C C   . PRO A 1 76  ? 21.854  2.661   71.068  1.00 28.90 ? 71   PRO A C   1 
ATOM   453  O O   . PRO A 1 76  ? 21.302  1.577   71.086  1.00 30.46 ? 71   PRO A O   1 
ATOM   454  C CB  . PRO A 1 76  ? 21.513  3.988   73.160  1.00 27.65 ? 71   PRO A CB  1 
ATOM   455  C CG  . PRO A 1 76  ? 22.458  5.067   73.850  1.00 30.77 ? 71   PRO A CG  1 
ATOM   456  C CD  . PRO A 1 76  ? 23.446  5.406   72.775  1.00 28.86 ? 71   PRO A CD  1 
ATOM   457  N N   . ASP A 1 77  ? 21.937  3.426   69.969  1.00 28.03 ? 72   ASP A N   1 
ATOM   458  C CA  . ASP A 1 77  ? 21.320  3.031   68.730  1.00 30.02 ? 72   ASP A CA  1 
ATOM   459  C C   . ASP A 1 77  ? 22.298  2.420   67.704  1.00 30.16 ? 72   ASP A C   1 
ATOM   460  O O   . ASP A 1 77  ? 21.939  2.273   66.551  1.00 30.26 ? 72   ASP A O   1 
ATOM   461  C CB  . ASP A 1 77  ? 20.601  4.251   68.127  1.00 29.49 ? 72   ASP A CB  1 
ATOM   462  C CG  . ASP A 1 77  ? 19.177  4.420   68.677  1.00 30.97 ? 72   ASP A CG  1 
ATOM   463  O OD1 . ASP A 1 77  ? 18.339  3.541   68.426  1.00 32.98 ? 72   ASP A OD1 1 
ATOM   464  O OD2 . ASP A 1 77  ? 18.914  5.416   69.378  1.00 29.06 ? 72   ASP A OD2 1 
ATOM   465  N N   . CYS A 1 78  ? 23.529  2.083   68.124  1.00 29.39 ? 73   CYS A N   1 
ATOM   466  C CA  . CYS A 1 78  ? 24.537  1.621   67.216  1.00 28.13 ? 73   CYS A CA  1 
ATOM   467  C C   . CYS A 1 78  ? 24.183  0.396   66.406  1.00 28.01 ? 73   CYS A C   1 
ATOM   468  O O   . CYS A 1 78  ? 24.707  0.222   65.294  1.00 28.13 ? 73   CYS A O   1 
ATOM   469  C CB  . CYS A 1 78  ? 25.928  1.522   67.897  1.00 29.17 ? 73   CYS A CB  1 
ATOM   470  S SG  . CYS A 1 78  ? 25.953  0.253   69.152  1.00 29.63 ? 73   CYS A SG  1 
ATOM   471  N N   . VAL A 1 79  ? 23.279  -0.452  66.929  1.00 28.55 ? 74   VAL A N   1 
ATOM   472  C CA  . VAL A 1 79  ? 22.802  -1.607  66.150  1.00 27.20 ? 74   VAL A CA  1 
ATOM   473  C C   . VAL A 1 79  ? 22.236  -1.204  64.778  1.00 27.94 ? 74   VAL A C   1 
ATOM   474  O O   . VAL A 1 79  ? 22.255  -1.992  63.827  1.00 27.80 ? 74   VAL A O   1 
ATOM   475  C CB  . VAL A 1 79  ? 21.791  -2.441  66.934  1.00 28.62 ? 74   VAL A CB  1 
ATOM   476  C CG1 . VAL A 1 79  ? 20.575  -1.612  67.361  1.00 29.08 ? 74   VAL A CG1 1 
ATOM   477  C CG2 . VAL A 1 79  ? 21.348  -3.712  66.141  1.00 25.25 ? 74   VAL A CG2 1 
ATOM   478  N N   . PHE A 1 80  ? 21.731  0.025   64.664  1.00 28.12 ? 75   PHE A N   1 
ATOM   479  C CA  . PHE A 1 80  ? 20.997  0.394   63.480  1.00 28.77 ? 75   PHE A CA  1 
ATOM   480  C C   . PHE A 1 80  ? 21.867  0.979   62.386  1.00 27.35 ? 75   PHE A C   1 
ATOM   481  O O   . PHE A 1 80  ? 21.707  2.154   61.983  1.00 25.99 ? 75   PHE A O   1 
ATOM   482  C CB  . PHE A 1 80  ? 19.711  1.214   63.778  1.00 27.77 ? 75   PHE A CB  1 
ATOM   483  C CG  . PHE A 1 80  ? 18.807  0.596   64.847  1.00 30.73 ? 75   PHE A CG  1 
ATOM   484  C CD1 . PHE A 1 80  ? 18.600  1.236   66.079  1.00 27.77 ? 75   PHE A CD1 1 
ATOM   485  C CD2 . PHE A 1 80  ? 18.171  -0.615  64.616  1.00 29.67 ? 75   PHE A CD2 1 
ATOM   486  C CE1 . PHE A 1 80  ? 17.775  0.662   67.053  1.00 30.30 ? 75   PHE A CE1 1 
ATOM   487  C CE2 . PHE A 1 80  ? 17.379  -1.215  65.575  1.00 26.48 ? 75   PHE A CE2 1 
ATOM   488  C CZ  . PHE A 1 80  ? 17.175  -0.557  66.821  1.00 27.40 ? 75   PHE A CZ  1 
ATOM   489  N N   . VAL A 1 81  ? 22.689  0.094   61.813  1.00 26.38 ? 76   VAL A N   1 
ATOM   490  C CA  . VAL A 1 81  ? 23.828  0.509   60.950  1.00 26.90 ? 76   VAL A CA  1 
ATOM   491  C C   . VAL A 1 81  ? 23.255  1.046   59.634  1.00 27.54 ? 76   VAL A C   1 
ATOM   492  O O   . VAL A 1 81  ? 23.887  1.863   58.957  1.00 27.19 ? 76   VAL A O   1 
ATOM   493  C CB  . VAL A 1 81  ? 24.785  -0.659  60.629  1.00 26.22 ? 76   VAL A CB  1 
ATOM   494  C CG1 . VAL A 1 81  ? 25.594  -0.999  61.836  1.00 26.75 ? 76   VAL A CG1 1 
ATOM   495  C CG2 . VAL A 1 81  ? 23.965  -1.978  60.148  1.00 24.02 ? 76   VAL A CG2 1 
ATOM   496  N N   . GLU A 1 82  ? 22.021  0.658   59.290  1.00 28.04 ? 77   GLU A N   1 
ATOM   497  C CA  . GLU A 1 82  ? 21.463  1.199   58.051  1.00 28.30 ? 77   GLU A CA  1 
ATOM   498  C C   . GLU A 1 82  ? 21.416  2.719   57.988  1.00 29.24 ? 77   GLU A C   1 
ATOM   499  O O   . GLU A 1 82  ? 21.591  3.281   56.881  1.00 27.77 ? 77   GLU A O   1 
ATOM   500  C CB  . GLU A 1 82  ? 20.043  0.689   57.750  1.00 29.72 ? 77   GLU A CB  1 
ATOM   501  C CG  . GLU A 1 82  ? 19.388  1.451   56.561  1.00 30.43 ? 77   GLU A CG  1 
ATOM   502  C CD  . GLU A 1 82  ? 18.168  0.739   56.023  1.00 29.70 ? 77   GLU A CD  1 
ATOM   503  O OE1 . GLU A 1 82  ? 17.126  0.888   56.650  1.00 31.50 ? 77   GLU A OE1 1 
ATOM   504  O OE2 . GLU A 1 82  ? 18.303  0.000   55.028  1.00 32.22 ? 77   GLU A OE2 1 
ATOM   505  N N   . ASP A 1 83  ? 21.129  3.381   59.120  1.00 27.61 ? 78   ASP A N   1 
ATOM   506  C CA  . ASP A 1 83  ? 20.983  4.846   59.102  1.00 29.28 ? 78   ASP A CA  1 
ATOM   507  C C   . ASP A 1 83  ? 22.311  5.587   58.825  1.00 29.16 ? 78   ASP A C   1 
ATOM   508  O O   . ASP A 1 83  ? 22.299  6.774   58.480  1.00 30.65 ? 78   ASP A O   1 
ATOM   509  C CB  . ASP A 1 83  ? 20.353  5.351   60.421  1.00 27.63 ? 78   ASP A CB  1 
ATOM   510  C CG  . ASP A 1 83  ? 18.905  4.916   60.574  1.00 29.46 ? 78   ASP A CG  1 
ATOM   511  O OD1 . ASP A 1 83  ? 18.191  4.979   59.570  1.00 28.86 ? 78   ASP A OD1 1 
ATOM   512  O OD2 . ASP A 1 83  ? 18.510  4.440   61.672  1.00 26.73 ? 78   ASP A OD2 1 
ATOM   513  N N   . VAL A 1 84  ? 23.446  4.902   58.999  1.00 29.28 ? 79   VAL A N   1 
ATOM   514  C CA  . VAL A 1 84  ? 24.766  5.577   58.931  1.00 29.88 ? 79   VAL A CA  1 
ATOM   515  C C   . VAL A 1 84  ? 25.553  5.400   57.601  1.00 30.01 ? 79   VAL A C   1 
ATOM   516  O O   . VAL A 1 84  ? 26.628  6.025   57.364  1.00 29.16 ? 79   VAL A O   1 
ATOM   517  C CB  . VAL A 1 84  ? 25.667  5.210   60.161  1.00 32.70 ? 79   VAL A CB  1 
ATOM   518  C CG1 . VAL A 1 84  ? 24.901  5.447   61.472  1.00 30.07 ? 79   VAL A CG1 1 
ATOM   519  C CG2 . VAL A 1 84  ? 26.155  3.768   60.128  1.00 30.72 ? 79   VAL A CG2 1 
ATOM   520  N N   . ALA A 1 85  ? 25.028  4.583   56.719  1.00 29.93 ? 80   ALA A N   1 
ATOM   521  C CA  . ALA A 1 85  ? 25.746  4.302   55.464  1.00 31.76 ? 80   ALA A CA  1 
ATOM   522  C C   . ALA A 1 85  ? 24.793  3.855   54.391  1.00 31.60 ? 80   ALA A C   1 
ATOM   523  O O   . ALA A 1 85  ? 23.867  3.064   54.675  1.00 30.83 ? 80   ALA A O   1 
ATOM   524  C CB  . ALA A 1 85  ? 26.835  3.217   55.687  1.00 31.92 ? 80   ALA A CB  1 
ATOM   525  N N   . VAL A 1 86  ? 24.994  4.370   53.171  1.00 30.79 ? 81   VAL A N   1 
ATOM   526  C CA  . VAL A 1 86  ? 24.222  3.877   52.046  1.00 30.26 ? 81   VAL A CA  1 
ATOM   527  C C   . VAL A 1 86  ? 25.213  3.440   51.011  1.00 30.77 ? 81   VAL A C   1 
ATOM   528  O O   . VAL A 1 86  ? 26.086  4.238   50.603  1.00 30.68 ? 81   VAL A O   1 
ATOM   529  C CB  . VAL A 1 86  ? 23.277  4.986   51.445  1.00 31.70 ? 81   VAL A CB  1 
ATOM   530  C CG1 . VAL A 1 86  ? 22.689  4.536   50.093  1.00 30.19 ? 81   VAL A CG1 1 
ATOM   531  C CG2 . VAL A 1 86  ? 22.225  5.477   52.455  1.00 27.84 ? 81   VAL A CG2 1 
ATOM   532  N N   . VAL A 1 87  ? 25.095  2.182   50.572  1.00 30.49 ? 82   VAL A N   1 
ATOM   533  C CA  . VAL A 1 87  ? 26.126  1.603   49.664  1.00 30.69 ? 82   VAL A CA  1 
ATOM   534  C C   . VAL A 1 87  ? 25.479  1.307   48.346  1.00 31.54 ? 82   VAL A C   1 
ATOM   535  O O   . VAL A 1 87  ? 24.368  0.738   48.267  1.00 30.48 ? 82   VAL A O   1 
ATOM   536  C CB  . VAL A 1 87  ? 26.809  0.309   50.233  1.00 30.43 ? 82   VAL A CB  1 
ATOM   537  C CG1 . VAL A 1 87  ? 27.811  -0.311  49.191  1.00 32.75 ? 82   VAL A CG1 1 
ATOM   538  C CG2 . VAL A 1 87  ? 27.505  0.610   51.544  1.00 28.80 ? 82   VAL A CG2 1 
ATOM   539  N N   . CYS A 1 88  ? 26.114  1.758   47.289  1.00 32.26 ? 83   CYS A N   1 
ATOM   540  C CA  . CYS A 1 88  ? 25.559  1.458   45.988  1.00 33.52 ? 83   CYS A CA  1 
ATOM   541  C C   . CYS A 1 88  ? 26.709  1.178   45.064  1.00 33.10 ? 83   CYS A C   1 
ATOM   542  O O   . CYS A 1 88  ? 27.552  2.021   44.827  1.00 33.80 ? 83   CYS A O   1 
ATOM   543  C CB  . CYS A 1 88  ? 24.628  2.595   45.476  1.00 32.74 ? 83   CYS A CB  1 
ATOM   544  S SG  . CYS A 1 88  ? 24.161  2.404   43.745  1.00 38.18 ? 83   CYS A SG  1 
ATOM   545  N N   . GLU A 1 89  ? 26.767  -0.063  44.636  1.00 34.00 ? 84   GLU A N   1 
ATOM   546  C CA  . GLU A 1 89  ? 27.836  -0.595  43.818  1.00 34.75 ? 84   GLU A CA  1 
ATOM   547  C C   . GLU A 1 89  ? 29.137  -0.558  44.602  1.00 34.60 ? 84   GLU A C   1 
ATOM   548  O O   . GLU A 1 89  ? 29.181  -1.154  45.711  1.00 35.04 ? 84   GLU A O   1 
ATOM   549  C CB  . GLU A 1 89  ? 27.867  0.063   42.428  1.00 34.96 ? 84   GLU A CB  1 
ATOM   550  C CG  . GLU A 1 89  ? 26.526  -0.120  41.618  1.00 36.31 ? 84   GLU A CG  1 
ATOM   551  C CD  . GLU A 1 89  ? 26.597  0.552   40.255  1.00 38.89 ? 84   GLU A CD  1 
ATOM   552  O OE1 . GLU A 1 89  ? 27.703  0.666   39.670  1.00 47.85 ? 84   GLU A OE1 1 
ATOM   553  O OE2 . GLU A 1 89  ? 25.565  0.941   39.730  1.00 47.24 ? 84   GLU A OE2 1 
ATOM   554  N N   . GLU A 1 90  ? 30.153  0.142   44.077  1.00 32.79 ? 85   GLU A N   1 
ATOM   555  C CA  . GLU A 1 90  ? 31.454  0.281   44.736  1.00 34.30 ? 85   GLU A CA  1 
ATOM   556  C C   . GLU A 1 90  ? 31.667  1.580   45.568  1.00 32.78 ? 85   GLU A C   1 
ATOM   557  O O   . GLU A 1 90  ? 32.792  1.893   45.938  1.00 32.90 ? 85   GLU A O   1 
ATOM   558  C CB  . GLU A 1 90  ? 32.576  0.180   43.687  1.00 34.19 ? 85   GLU A CB  1 
ATOM   559  C CG  . GLU A 1 90  ? 32.696  -1.213  43.070  1.00 40.55 ? 85   GLU A CG  1 
ATOM   560  C CD  . GLU A 1 90  ? 32.100  -1.312  41.679  1.00 49.05 ? 85   GLU A CD  1 
ATOM   561  O OE1 . GLU A 1 90  ? 32.859  -1.616  40.720  1.00 51.78 ? 85   GLU A OE1 1 
ATOM   562  O OE2 . GLU A 1 90  ? 30.868  -1.102  41.531  1.00 54.54 ? 85   GLU A OE2 1 
ATOM   563  N N   . THR A 1 91  ? 30.594  2.304   45.849  1.00 32.13 ? 86   THR A N   1 
ATOM   564  C CA  . THR A 1 91  ? 30.599  3.569   46.553  1.00 31.81 ? 86   THR A CA  1 
ATOM   565  C C   . THR A 1 91  ? 29.801  3.533   47.830  1.00 31.54 ? 86   THR A C   1 
ATOM   566  O O   . THR A 1 91  ? 28.664  3.016   47.858  1.00 29.86 ? 86   THR A O   1 
ATOM   567  C CB  . THR A 1 91  ? 30.016  4.729   45.645  1.00 32.76 ? 86   THR A CB  1 
ATOM   568  O OG1 . THR A 1 91  ? 30.734  4.777   44.411  1.00 36.69 ? 86   THR A OG1 1 
ATOM   569  C CG2 . THR A 1 91  ? 30.188  6.111   46.313  1.00 32.03 ? 86   THR A CG2 1 
ATOM   570  N N   . ALA A 1 92  ? 30.359  4.107   48.902  1.00 30.81 ? 87   ALA A N   1 
ATOM   571  C CA  . ALA A 1 92  ? 29.616  4.155   50.173  1.00 30.67 ? 87   ALA A CA  1 
ATOM   572  C C   . ALA A 1 92  ? 29.500  5.615   50.529  1.00 30.75 ? 87   ALA A C   1 
ATOM   573  O O   . ALA A 1 92  ? 30.503  6.325   50.562  1.00 30.33 ? 87   ALA A O   1 
ATOM   574  C CB  . ALA A 1 92  ? 30.337  3.376   51.332  1.00 29.32 ? 87   ALA A CB  1 
ATOM   575  N N   . LEU A 1 93  ? 28.266  6.073   50.674  1.00 30.14 ? 88   LEU A N   1 
ATOM   576  C CA  . LEU A 1 93  ? 27.998  7.337   51.340  1.00 30.26 ? 88   LEU A CA  1 
ATOM   577  C C   . LEU A 1 93  ? 27.891  7.076   52.862  1.00 29.99 ? 88   LEU A C   1 
ATOM   578  O O   . LEU A 1 93  ? 27.015  6.351   53.321  1.00 30.29 ? 88   LEU A O   1 
ATOM   579  C CB  . LEU A 1 93  ? 26.677  7.930   50.798  1.00 31.10 ? 88   LEU A CB  1 
ATOM   580  C CG  . LEU A 1 93  ? 26.141  9.204   51.420  1.00 31.19 ? 88   LEU A CG  1 
ATOM   581  C CD1 . LEU A 1 93  ? 27.190  10.300  51.149  1.00 26.77 ? 88   LEU A CD1 1 
ATOM   582  C CD2 . LEU A 1 93  ? 24.832  9.506   50.792  1.00 32.18 ? 88   LEU A CD2 1 
ATOM   583  N N   . ILE A 1 94  ? 28.781  7.697   53.635  1.00 30.10 ? 89   ILE A N   1 
ATOM   584  C CA  . ILE A 1 94  ? 28.714  7.697   55.094  1.00 29.69 ? 89   ILE A CA  1 
ATOM   585  C C   . ILE A 1 94  ? 27.758  8.877   55.378  1.00 29.66 ? 89   ILE A C   1 
ATOM   586  O O   . ILE A 1 94  ? 28.046  10.028  54.995  1.00 28.89 ? 89   ILE A O   1 
ATOM   587  C CB  . ILE A 1 94  ? 30.134  7.979   55.690  1.00 30.00 ? 89   ILE A CB  1 
ATOM   588  C CG1 . ILE A 1 94  ? 31.156  6.887   55.283  1.00 31.11 ? 89   ILE A CG1 1 
ATOM   589  C CG2 . ILE A 1 94  ? 30.075  8.257   57.209  1.00 30.47 ? 89   ILE A CG2 1 
ATOM   590  C CD1 . ILE A 1 94  ? 30.766  5.446   55.584  1.00 33.73 ? 89   ILE A CD1 1 
ATOM   591  N N   . THR A 1 95  ? 26.599  8.613   55.972  1.00 27.10 ? 90   THR A N   1 
ATOM   592  C CA  . THR A 1 95  ? 25.649  9.689   56.142  1.00 26.88 ? 90   THR A CA  1 
ATOM   593  C C   . THR A 1 95  ? 25.980  10.652  57.340  1.00 27.38 ? 90   THR A C   1 
ATOM   594  O O   . THR A 1 95  ? 26.884  10.434  58.096  1.00 28.23 ? 90   THR A O   1 
ATOM   595  C CB  . THR A 1 95  ? 24.237  9.117   56.296  1.00 25.53 ? 90   THR A CB  1 
ATOM   596  O OG1 . THR A 1 95  ? 24.151  8.490   57.588  1.00 29.31 ? 90   THR A OG1 1 
ATOM   597  C CG2 . THR A 1 95  ? 23.950  8.030   55.217  1.00 24.86 ? 90   THR A CG2 1 
ATOM   598  N N   . ARG A 1 96  ? 25.201  11.712  57.510  1.00 28.54 ? 91   ARG A N   1 
ATOM   599  C CA  . ARG A 1 96  ? 25.286  12.556  58.721  1.00 27.47 ? 91   ARG A CA  1 
ATOM   600  C C   . ARG A 1 96  ? 23.918  12.379  59.386  1.00 27.77 ? 91   ARG A C   1 
ATOM   601  O O   . ARG A 1 96  ? 22.957  13.018  59.017  1.00 27.20 ? 91   ARG A O   1 
ATOM   602  C CB  . ARG A 1 96  ? 25.617  14.008  58.341  1.00 27.29 ? 91   ARG A CB  1 
ATOM   603  C CG  . ARG A 1 96  ? 25.788  14.929  59.583  1.00 23.85 ? 91   ARG A CG  1 
ATOM   604  C CD  . ARG A 1 96  ? 26.460  16.252  59.141  1.00 26.33 ? 91   ARG A CD  1 
ATOM   605  N NE  . ARG A 1 96  ? 26.636  17.171  60.285  1.00 26.94 ? 91   ARG A NE  1 
ATOM   606  C CZ  . ARG A 1 96  ? 25.757  18.094  60.648  1.00 25.57 ? 91   ARG A CZ  1 
ATOM   607  N NH1 . ARG A 1 96  ? 24.635  18.225  59.980  1.00 24.43 ? 91   ARG A NH1 1 
ATOM   608  N NH2 . ARG A 1 96  ? 25.988  18.885  61.707  1.00 28.54 ? 91   ARG A NH2 1 
ATOM   609  N N   . PRO A 1 97  ? 23.793  11.414  60.316  1.00 28.29 ? 92   PRO A N   1 
ATOM   610  C CA  . PRO A 1 97  ? 22.469  11.113  60.875  1.00 27.62 ? 92   PRO A CA  1 
ATOM   611  C C   . PRO A 1 97  ? 21.669  12.319  61.421  1.00 28.81 ? 92   PRO A C   1 
ATOM   612  O O   . PRO A 1 97  ? 22.255  13.277  61.932  1.00 27.40 ? 92   PRO A O   1 
ATOM   613  C CB  . PRO A 1 97  ? 22.767  10.116  62.014  1.00 29.45 ? 92   PRO A CB  1 
ATOM   614  C CG  . PRO A 1 97  ? 24.038  9.434   61.599  1.00 28.85 ? 92   PRO A CG  1 
ATOM   615  C CD  . PRO A 1 97  ? 24.832  10.454  60.743  1.00 28.38 ? 92   PRO A CD  1 
ATOM   616  N N   . GLY A 1 98  ? 20.332  12.273  61.331  1.00 27.97 ? 93   GLY A N   1 
ATOM   617  C CA  . GLY A 1 98  ? 19.564  13.442  61.731  1.00 28.94 ? 93   GLY A CA  1 
ATOM   618  C C   . GLY A 1 98  ? 19.556  13.685  63.226  1.00 29.32 ? 93   GLY A C   1 
ATOM   619  O O   . GLY A 1 98  ? 19.387  14.804  63.673  1.00 31.50 ? 93   GLY A O   1 
ATOM   620  N N   . ALA A 1 99  ? 19.673  12.629  64.023  1.00 28.71 ? 94   ALA A N   1 
ATOM   621  C CA  . ALA A 1 99  ? 19.779  12.812  65.485  1.00 27.40 ? 94   ALA A CA  1 
ATOM   622  C C   . ALA A 1 99  ? 21.270  13.034  65.791  1.00 26.41 ? 94   ALA A C   1 
ATOM   623  O O   . ALA A 1 99  ? 22.081  12.154  65.560  1.00 26.79 ? 94   ALA A O   1 
ATOM   624  C CB  . ALA A 1 99  ? 19.290  11.574  66.219  1.00 28.57 ? 94   ALA A CB  1 
ATOM   625  N N   . PRO A 1 100 ? 21.617  14.194  66.350  1.00 26.77 ? 95   PRO A N   1 
ATOM   626  C CA  . PRO A 1 100 ? 23.008  14.529  66.595  1.00 26.01 ? 95   PRO A CA  1 
ATOM   627  C C   . PRO A 1 100 ? 23.668  13.523  67.475  1.00 28.10 ? 95   PRO A C   1 
ATOM   628  O O   . PRO A 1 100 ? 24.851  13.221  67.264  1.00 28.42 ? 95   PRO A O   1 
ATOM   629  C CB  . PRO A 1 100 ? 22.895  15.912  67.286  1.00 26.36 ? 95   PRO A CB  1 
ATOM   630  C CG  . PRO A 1 100 ? 21.701  16.479  66.628  1.00 26.66 ? 95   PRO A CG  1 
ATOM   631  C CD  . PRO A 1 100 ? 20.731  15.331  66.715  1.00 23.74 ? 95   PRO A CD  1 
ATOM   632  N N   . SER A 1 101 ? 22.939  12.898  68.407  1.00 28.10 ? 96   SER A N   1 
ATOM   633  C CA  . SER A 1 101 ? 23.626  11.902  69.273  1.00 28.96 ? 96   SER A CA  1 
ATOM   634  C C   . SER A 1 101 ? 24.096  10.621  68.569  1.00 29.93 ? 96   SER A C   1 
ATOM   635  O O   . SER A 1 101 ? 24.920  9.878   69.096  1.00 31.42 ? 96   SER A O   1 
ATOM   636  C CB  . SER A 1 101 ? 22.757  11.519  70.470  1.00 29.81 ? 96   SER A CB  1 
ATOM   637  O OG  . SER A 1 101 ? 21.523  10.972  70.008  1.00 29.71 ? 96   SER A OG  1 
ATOM   638  N N   . ARG A 1 102 ? 23.634  10.392  67.357  1.00 28.76 ? 97   ARG A N   1 
ATOM   639  C CA  . ARG A 1 102 ? 24.032  9.193   66.662  1.00 29.19 ? 97   ARG A CA  1 
ATOM   640  C C   . ARG A 1 102 ? 25.204  9.390   65.714  1.00 29.61 ? 97   ARG A C   1 
ATOM   641  O O   . ARG A 1 102 ? 25.682  8.437   65.103  1.00 30.58 ? 97   ARG A O   1 
ATOM   642  C CB  . ARG A 1 102 ? 22.846  8.710   65.878  1.00 27.98 ? 97   ARG A CB  1 
ATOM   643  C CG  . ARG A 1 102 ? 21.707  8.160   66.808  1.00 29.59 ? 97   ARG A CG  1 
ATOM   644  C CD  . ARG A 1 102 ? 20.655  7.383   65.924  1.00 26.16 ? 97   ARG A CD  1 
ATOM   645  N NE  . ARG A 1 102 ? 21.339  6.245   65.325  1.00 28.09 ? 97   ARG A NE  1 
ATOM   646  C CZ  . ARG A 1 102 ? 20.853  5.485   64.344  1.00 29.21 ? 97   ARG A CZ  1 
ATOM   647  N NH1 . ARG A 1 102 ? 19.619  5.692   63.874  1.00 30.38 ? 97   ARG A NH1 1 
ATOM   648  N NH2 . ARG A 1 102 ? 21.582  4.492   63.865  1.00 25.48 ? 97   ARG A NH2 1 
ATOM   649  N N   . ARG A 1 103 ? 25.708  10.617  65.631  1.00 29.60 ? 98   ARG A N   1 
ATOM   650  C CA  . ARG A 1 103 ? 26.722  10.972  64.630  1.00 30.66 ? 98   ARG A CA  1 
ATOM   651  C C   . ARG A 1 103 ? 28.071  10.231  64.800  1.00 32.44 ? 98   ARG A C   1 
ATOM   652  O O   . ARG A 1 103 ? 28.709  9.871   63.801  1.00 32.93 ? 98   ARG A O   1 
ATOM   653  C CB  . ARG A 1 103 ? 26.844  12.511  64.502  1.00 31.12 ? 98   ARG A CB  1 
ATOM   654  C CG  . ARG A 1 103 ? 25.579  13.065  63.775  1.00 28.42 ? 98   ARG A CG  1 
ATOM   655  C CD  . ARG A 1 103 ? 25.574  14.570  63.422  1.00 29.42 ? 98   ARG A CD  1 
ATOM   656  N NE  . ARG A 1 103 ? 24.233  14.883  62.943  1.00 27.61 ? 98   ARG A NE  1 
ATOM   657  C CZ  . ARG A 1 103 ? 23.619  16.038  63.140  1.00 28.56 ? 98   ARG A CZ  1 
ATOM   658  N NH1 . ARG A 1 103 ? 24.250  17.010  63.768  1.00 30.74 ? 98   ARG A NH1 1 
ATOM   659  N NH2 . ARG A 1 103 ? 22.380  16.224  62.708  1.00 28.55 ? 98   ARG A NH2 1 
ATOM   660  N N   . LYS A 1 104 ? 28.468  9.920   66.033  1.00 32.20 ? 99   LYS A N   1 
ATOM   661  C CA  . LYS A 1 104 ? 29.725  9.154   66.206  1.00 31.47 ? 99   LYS A CA  1 
ATOM   662  C C   . LYS A 1 104 ? 29.654  7.711   65.772  1.00 30.66 ? 99   LYS A C   1 
ATOM   663  O O   . LYS A 1 104 ? 30.672  7.042   65.692  1.00 31.08 ? 99   LYS A O   1 
ATOM   664  C CB  . LYS A 1 104 ? 30.220  9.245   67.637  1.00 33.38 ? 99   LYS A CB  1 
ATOM   665  C CG  . LYS A 1 104 ? 30.647  10.691  68.005  1.00 37.27 ? 99   LYS A CG  1 
ATOM   666  C CD  . LYS A 1 104 ? 32.157  10.821  68.257  1.00 38.00 ? 99   LYS A CD  1 
ATOM   667  C CE  . LYS A 1 104 ? 32.486  12.161  68.926  1.00 40.32 ? 99   LYS A CE  1 
ATOM   668  N NZ  . LYS A 1 104 ? 32.623  12.098  70.425  1.00 44.36 ? 99   LYS A NZ  1 
ATOM   669  N N   . GLU A 1 105 ? 28.451  7.216   65.487  1.00 29.54 ? 100  GLU A N   1 
ATOM   670  C CA  . GLU A 1 105 ? 28.316  5.883   64.919  1.00 29.31 ? 100  GLU A CA  1 
ATOM   671  C C   . GLU A 1 105 ? 29.009  5.765   63.579  1.00 30.04 ? 100  GLU A C   1 
ATOM   672  O O   . GLU A 1 105 ? 29.373  4.688   63.201  1.00 31.20 ? 100  GLU A O   1 
ATOM   673  C CB  . GLU A 1 105 ? 26.806  5.515   64.756  1.00 28.35 ? 100  GLU A CB  1 
ATOM   674  C CG  . GLU A 1 105 ? 26.079  5.338   66.067  1.00 27.38 ? 100  GLU A CG  1 
ATOM   675  C CD  . GLU A 1 105 ? 24.552  5.046   65.794  1.00 29.51 ? 100  GLU A CD  1 
ATOM   676  O OE1 . GLU A 1 105 ? 24.178  4.467   64.725  1.00 28.79 ? 100  GLU A OE1 1 
ATOM   677  O OE2 . GLU A 1 105 ? 23.779  5.407   66.645  1.00 26.48 ? 100  GLU A OE2 1 
ATOM   678  N N   . VAL A 1 106 ? 29.219  6.869   62.857  1.00 31.36 ? 101  VAL A N   1 
ATOM   679  C CA  . VAL A 1 106 ? 29.895  6.772   61.562  1.00 32.43 ? 101  VAL A CA  1 
ATOM   680  C C   . VAL A 1 106 ? 31.349  6.293   61.618  1.00 33.29 ? 101  VAL A C   1 
ATOM   681  O O   . VAL A 1 106 ? 31.847  5.803   60.618  1.00 33.43 ? 101  VAL A O   1 
ATOM   682  C CB  . VAL A 1 106 ? 29.860  8.067   60.747  1.00 32.82 ? 101  VAL A CB  1 
ATOM   683  C CG1 . VAL A 1 106 ? 28.395  8.509   60.549  1.00 30.49 ? 101  VAL A CG1 1 
ATOM   684  C CG2 . VAL A 1 106 ? 30.764  9.169   61.389  1.00 33.83 ? 101  VAL A CG2 1 
ATOM   685  N N   . ASP A 1 107 ? 31.985  6.388   62.774  1.00 32.51 ? 102  ASP A N   1 
ATOM   686  C CA  . ASP A 1 107 ? 33.444  6.204   62.848  1.00 35.86 ? 102  ASP A CA  1 
ATOM   687  C C   . ASP A 1 107 ? 33.753  4.759   62.549  1.00 34.76 ? 102  ASP A C   1 
ATOM   688  O O   . ASP A 1 107 ? 34.507  4.467   61.640  1.00 35.56 ? 102  ASP A O   1 
ATOM   689  C CB  . ASP A 1 107 ? 34.000  6.586   64.227  1.00 35.59 ? 102  ASP A CB  1 
ATOM   690  C CG  . ASP A 1 107 ? 33.870  8.099   64.534  1.00 39.06 ? 102  ASP A CG  1 
ATOM   691  O OD1 . ASP A 1 107 ? 33.718  8.927   63.604  1.00 40.35 ? 102  ASP A OD1 1 
ATOM   692  O OD2 . ASP A 1 107 ? 33.947  8.461   65.721  1.00 40.08 ? 102  ASP A OD2 1 
ATOM   693  N N   . MET A 1 108 ? 33.133  3.863   63.297  1.00 34.40 ? 103  MET A N   1 
ATOM   694  C CA  . MET A 1 108 ? 33.368  2.449   63.115  1.00 35.70 ? 103  MET A CA  1 
ATOM   695  C C   . MET A 1 108 ? 32.906  1.933   61.740  1.00 33.78 ? 103  MET A C   1 
ATOM   696  O O   . MET A 1 108 ? 33.509  1.029   61.170  1.00 30.72 ? 103  MET A O   1 
ATOM   697  C CB  . MET A 1 108 ? 32.722  1.663   64.263  1.00 34.69 ? 103  MET A CB  1 
ATOM   698  C CG  . MET A 1 108 ? 33.051  0.243   64.189  1.00 38.18 ? 103  MET A CG  1 
ATOM   699  S SD  . MET A 1 108 ? 33.000  -0.560  65.762  1.00 44.32 ? 103  MET A SD  1 
ATOM   700  C CE  . MET A 1 108 ? 34.540  0.040   66.476  1.00 42.98 ? 103  MET A CE  1 
ATOM   701  N N   . MET A 1 109 ? 31.813  2.490   61.225  1.00 32.32 ? 104  MET A N   1 
ATOM   702  C CA  . MET A 1 109 ? 31.313  2.089   59.928  1.00 32.52 ? 104  MET A CA  1 
ATOM   703  C C   . MET A 1 109 ? 32.239  2.522   58.794  1.00 31.97 ? 104  MET A C   1 
ATOM   704  O O   . MET A 1 109 ? 32.457  1.778   57.830  1.00 31.12 ? 104  MET A O   1 
ATOM   705  C CB  . MET A 1 109 ? 29.917  2.703   59.682  1.00 33.31 ? 104  MET A CB  1 
ATOM   706  C CG  . MET A 1 109 ? 29.409  2.437   58.268  1.00 36.06 ? 104  MET A CG  1 
ATOM   707  S SD  . MET A 1 109 ? 29.156  0.682   58.015  1.00 38.31 ? 104  MET A SD  1 
ATOM   708  C CE  . MET A 1 109 ? 27.700  0.420   59.021  1.00 39.92 ? 104  MET A CE  1 
ATOM   709  N N   . LYS A 1 110 ? 32.734  3.748   58.867  1.00 31.11 ? 105  LYS A N   1 
ATOM   710  C CA  . LYS A 1 110 ? 33.748  4.203   57.879  1.00 31.93 ? 105  LYS A CA  1 
ATOM   711  C C   . LYS A 1 110 ? 34.946  3.241   57.765  1.00 31.31 ? 105  LYS A C   1 
ATOM   712  O O   . LYS A 1 110 ? 35.407  2.903   56.667  1.00 32.12 ? 105  LYS A O   1 
ATOM   713  C CB  . LYS A 1 110 ? 34.243  5.586   58.236  1.00 31.77 ? 105  LYS A CB  1 
ATOM   714  C CG  . LYS A 1 110 ? 35.132  6.205   57.157  1.00 35.10 ? 105  LYS A CG  1 
ATOM   715  C CD  . LYS A 1 110 ? 35.605  7.572   57.625  1.00 39.77 ? 105  LYS A CD  1 
ATOM   716  C CE  . LYS A 1 110 ? 37.079  7.562   58.025  1.00 42.63 ? 105  LYS A CE  1 
ATOM   717  N NZ  . LYS A 1 110 ? 37.894  8.158   56.951  1.00 42.77 ? 105  LYS A NZ  1 
ATOM   718  N N   . GLU A 1 111 ? 35.457  2.799   58.894  1.00 31.54 ? 106  GLU A N   1 
ATOM   719  C CA  . GLU A 1 111 ? 36.577  1.864   58.887  1.00 31.72 ? 106  GLU A CA  1 
ATOM   720  C C   . GLU A 1 111 ? 36.235  0.491   58.352  1.00 31.28 ? 106  GLU A C   1 
ATOM   721  O O   . GLU A 1 111 ? 37.049  -0.102  57.657  1.00 29.41 ? 106  GLU A O   1 
ATOM   722  C CB  . GLU A 1 111 ? 37.175  1.771   60.270  1.00 32.95 ? 106  GLU A CB  1 
ATOM   723  C CG  . GLU A 1 111 ? 38.100  2.997   60.553  1.00 36.12 ? 106  GLU A CG  1 
ATOM   724  N N   . ALA A 1 112 ? 35.010  0.003   58.635  1.00 29.46 ? 107  ALA A N   1 
ATOM   725  C CA  . ALA A 1 112 ? 34.615  -1.299  58.140  1.00 29.22 ? 107  ALA A CA  1 
ATOM   726  C C   . ALA A 1 112 ? 34.428  -1.222  56.617  1.00 30.04 ? 107  ALA A C   1 
ATOM   727  O O   . ALA A 1 112 ? 34.824  -2.153  55.887  1.00 30.03 ? 107  ALA A O   1 
ATOM   728  C CB  . ALA A 1 112 ? 33.337  -1.759  58.827  1.00 30.40 ? 107  ALA A CB  1 
ATOM   729  N N   . LEU A 1 113 ? 33.835  -0.116  56.139  1.00 29.45 ? 108  LEU A N   1 
ATOM   730  C CA  . LEU A 1 113 ? 33.581  0.037   54.704  1.00 29.08 ? 108  LEU A CA  1 
ATOM   731  C C   . LEU A 1 113 ? 34.911  0.301   53.972  1.00 27.70 ? 108  LEU A C   1 
ATOM   732  O O   . LEU A 1 113 ? 35.120  -0.189  52.855  1.00 27.66 ? 108  LEU A O   1 
ATOM   733  C CB  . LEU A 1 113 ? 32.562  1.110   54.433  1.00 29.03 ? 108  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 113 ? 31.113  0.743   54.927  1.00 27.69 ? 108  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 113 ? 30.224  1.870   54.489  1.00 33.83 ? 108  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 113 ? 30.562  -0.535  54.384  1.00 26.09 ? 108  LEU A CD2 1 
ATOM   737  N N   . GLU A 1 114 ? 35.798  1.091   54.581  1.00 26.99 ? 109  GLU A N   1 
ATOM   738  C CA  . GLU A 1 114 ? 37.195  1.164   54.084  1.00 26.55 ? 109  GLU A CA  1 
ATOM   739  C C   . GLU A 1 114 ? 37.830  -0.215  53.854  1.00 25.40 ? 109  GLU A C   1 
ATOM   740  O O   . GLU A 1 114 ? 38.346  -0.478  52.767  1.00 27.86 ? 109  GLU A O   1 
ATOM   741  C CB  . GLU A 1 114 ? 38.084  1.997   55.006  1.00 26.57 ? 109  GLU A CB  1 
ATOM   742  C CG  . GLU A 1 114 ? 37.837  3.467   54.863  1.00 30.63 ? 109  GLU A CG  1 
ATOM   743  C CD  . GLU A 1 114 ? 38.531  4.307   55.952  1.00 38.07 ? 109  GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 114 ? 39.115  3.717   56.873  1.00 39.28 ? 109  GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 114 ? 38.469  5.557   55.885  1.00 37.22 ? 109  GLU A OE2 1 
ATOM   746  N N   . LYS A 1 115 ? 37.804  -1.079  54.852  1.00 24.94 ? 110  LYS A N   1 
ATOM   747  C CA  . LYS A 1 115 ? 38.414  -2.413  54.738  1.00 26.72 ? 110  LYS A CA  1 
ATOM   748  C C   . LYS A 1 115 ? 37.756  -3.269  53.635  1.00 28.08 ? 110  LYS A C   1 
ATOM   749  O O   . LYS A 1 115 ? 38.358  -4.194  53.122  1.00 26.28 ? 110  LYS A O   1 
ATOM   750  C CB  . LYS A 1 115 ? 38.360  -3.105  56.111  1.00 27.06 ? 110  LYS A CB  1 
ATOM   751  C CG  . LYS A 1 115 ? 39.247  -2.364  57.150  1.00 26.56 ? 110  LYS A CG  1 
ATOM   752  C CD  . LYS A 1 115 ? 39.180  -2.997  58.545  1.00 27.02 ? 110  LYS A CD  1 
ATOM   753  C CE  . LYS A 1 115 ? 39.809  -1.984  59.541  1.00 31.27 ? 110  LYS A CE  1 
ATOM   754  N NZ  . LYS A 1 115 ? 40.101  -2.599  60.849  1.00 35.95 ? 110  LYS A NZ  1 
ATOM   755  N N   . LEU A 1 116 ? 36.499  -2.950  53.294  1.00 28.88 ? 111  LEU A N   1 
ATOM   756  C CA  . LEU A 1 116 ? 35.766  -3.643  52.216  1.00 30.02 ? 111  LEU A CA  1 
ATOM   757  C C   . LEU A 1 116 ? 36.090  -3.055  50.822  1.00 30.34 ? 111  LEU A C   1 
ATOM   758  O O   . LEU A 1 116 ? 35.550  -3.497  49.793  1.00 29.88 ? 111  LEU A O   1 
ATOM   759  C CB  . LEU A 1 116 ? 34.262  -3.611  52.529  1.00 29.82 ? 111  LEU A CB  1 
ATOM   760  C CG  . LEU A 1 116 ? 33.791  -4.573  53.627  1.00 31.53 ? 111  LEU A CG  1 
ATOM   761  C CD1 . LEU A 1 116 ? 32.269  -4.513  53.835  1.00 34.08 ? 111  LEU A CD1 1 
ATOM   762  C CD2 . LEU A 1 116 ? 34.220  -6.025  53.414  1.00 35.02 ? 111  LEU A CD2 1 
ATOM   763  N N   . GLN A 1 117 ? 36.995  -2.067  50.811  1.00 30.16 ? 112  GLN A N   1 
ATOM   764  C CA  . GLN A 1 117 ? 37.547  -1.465  49.586  1.00 31.44 ? 112  GLN A CA  1 
ATOM   765  C C   . GLN A 1 117 ? 36.511  -0.653  48.801  1.00 31.83 ? 112  GLN A C   1 
ATOM   766  O O   . GLN A 1 117 ? 36.599  -0.518  47.594  1.00 30.47 ? 112  GLN A O   1 
ATOM   767  C CB  . GLN A 1 117 ? 38.181  -2.551  48.692  1.00 31.96 ? 112  GLN A CB  1 
ATOM   768  C CG  . GLN A 1 117 ? 39.375  -3.246  49.352  1.00 33.75 ? 112  GLN A CG  1 
ATOM   769  C CD  . GLN A 1 117 ? 40.040  -4.199  48.420  1.00 34.75 ? 112  GLN A CD  1 
ATOM   770  O OE1 . GLN A 1 117 ? 40.794  -3.801  47.554  1.00 38.84 ? 112  GLN A OE1 1 
ATOM   771  N NE2 . GLN A 1 117 ? 39.736  -5.454  48.561  1.00 33.97 ? 112  GLN A NE2 1 
ATOM   772  N N   . LEU A 1 118 ? 35.548  -0.075  49.518  1.00 31.54 ? 113  LEU A N   1 
ATOM   773  C CA  . LEU A 1 118 ? 34.582  0.798   48.907  1.00 32.09 ? 113  LEU A CA  1 
ATOM   774  C C   . LEU A 1 118 ? 35.196  2.165   48.719  1.00 31.85 ? 113  LEU A C   1 
ATOM   775  O O   . LEU A 1 118 ? 36.033  2.557   49.515  1.00 32.35 ? 113  LEU A O   1 
ATOM   776  C CB  . LEU A 1 118 ? 33.366  0.871   49.804  1.00 31.26 ? 113  LEU A CB  1 
ATOM   777  C CG  . LEU A 1 118 ? 32.675  -0.489  49.780  1.00 33.84 ? 113  LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 118 ? 31.732  -0.705  50.980  1.00 25.23 ? 113  LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 118 ? 31.951  -0.638  48.433  1.00 36.62 ? 113  LEU A CD2 1 
ATOM   780  N N   . ASN A 1 119 ? 34.812  2.876   47.661  1.00 31.66 ? 114  ASN A N   1 
ATOM   781  C CA  . ASN A 1 119 ? 35.063  4.298   47.582  1.00 32.20 ? 114  ASN A CA  1 
ATOM   782  C C   . ASN A 1 119 ? 34.178  5.002   48.599  1.00 32.21 ? 114  ASN A C   1 
ATOM   783  O O   . ASN A 1 119 ? 32.963  4.757   48.649  1.00 32.77 ? 114  ASN A O   1 
ATOM   784  C CB  . ASN A 1 119 ? 34.797  4.806   46.164  1.00 32.59 ? 114  ASN A CB  1 
ATOM   785  C CG  . ASN A 1 119 ? 35.509  3.981   45.139  1.00 35.95 ? 114  ASN A CG  1 
ATOM   786  O OD1 . ASN A 1 119 ? 36.767  4.022   45.041  1.00 38.61 ? 114  ASN A OD1 1 
ATOM   787  N ND2 . ASN A 1 119 ? 34.742  3.184   44.382  1.00 37.44 ? 114  ASN A ND2 1 
ATOM   788  N N   . ILE A 1 120 ? 34.761  5.836   49.452  1.00 32.25 ? 115  ILE A N   1 
ATOM   789  C CA  . ILE A 1 120 ? 33.980  6.412   50.560  1.00 32.50 ? 115  ILE A CA  1 
ATOM   790  C C   . ILE A 1 120 ? 33.685  7.887   50.313  1.00 31.96 ? 115  ILE A C   1 
ATOM   791  O O   . ILE A 1 120 ? 34.602  8.639   50.062  1.00 30.08 ? 115  ILE A O   1 
ATOM   792  C CB  . ILE A 1 120 ? 34.716  6.253   51.936  1.00 34.38 ? 115  ILE A CB  1 
ATOM   793  C CG1 . ILE A 1 120 ? 35.121  4.780   52.244  1.00 34.28 ? 115  ILE A CG1 1 
ATOM   794  C CG2 . ILE A 1 120 ? 33.915  6.909   53.107  1.00 31.29 ? 115  ILE A CG2 1 
ATOM   795  C CD1 . ILE A 1 120 ? 34.001  3.756   52.210  1.00 38.38 ? 115  ILE A CD1 1 
ATOM   796  N N   . VAL A 1 121 ? 32.416  8.316   50.408  1.00 30.39 ? 116  VAL A N   1 
ATOM   797  C CA  . VAL A 1 121 ? 32.120  9.749   50.406  1.00 30.37 ? 116  VAL A CA  1 
ATOM   798  C C   . VAL A 1 121 ? 31.467  10.090  51.758  1.00 30.85 ? 116  VAL A C   1 
ATOM   799  O O   . VAL A 1 121 ? 30.441  9.470   52.115  1.00 30.14 ? 116  VAL A O   1 
ATOM   800  C CB  . VAL A 1 121 ? 31.185  10.138  49.259  1.00 30.98 ? 116  VAL A CB  1 
ATOM   801  C CG1 . VAL A 1 121 ? 30.856  11.623  49.306  1.00 31.16 ? 116  VAL A CG1 1 
ATOM   802  C CG2 . VAL A 1 121 ? 31.795  9.753   47.938  1.00 34.49 ? 116  VAL A CG2 1 
ATOM   803  N N   . GLU A 1 122 ? 32.020  11.042  52.511  1.00 30.71 ? 117  GLU A N   1 
ATOM   804  C CA  . GLU A 1 122 ? 31.415  11.402  53.823  1.00 30.97 ? 117  GLU A CA  1 
ATOM   805  C C   . GLU A 1 122 ? 30.558  12.613  53.724  1.00 31.19 ? 117  GLU A C   1 
ATOM   806  O O   . GLU A 1 122 ? 30.974  13.617  53.139  1.00 28.35 ? 117  GLU A O   1 
ATOM   807  C CB  . GLU A 1 122 ? 32.431  11.659  54.898  1.00 30.44 ? 117  GLU A CB  1 
ATOM   808  C CG  . GLU A 1 122 ? 33.205  10.433  55.326  1.00 36.53 ? 117  GLU A CG  1 
ATOM   809  C CD  . GLU A 1 122 ? 34.284  10.799  56.310  1.00 39.61 ? 117  GLU A CD  1 
ATOM   810  O OE1 . GLU A 1 122 ? 33.982  10.943  57.514  1.00 44.36 ? 117  GLU A OE1 1 
ATOM   811  O OE2 . GLU A 1 122 ? 35.407  10.991  55.865  1.00 41.36 ? 117  GLU A OE2 1 
ATOM   812  N N   . MET A 1 123 ? 29.333  12.508  54.272  1.00 31.57 ? 118  MET A N   1 
ATOM   813  C CA  . MET A 1 123 ? 28.435  13.640  54.342  1.00 31.58 ? 118  MET A CA  1 
ATOM   814  C C   . MET A 1 123 ? 28.929  14.470  55.540  1.00 32.90 ? 118  MET A C   1 
ATOM   815  O O   . MET A 1 123 ? 28.694  14.106  56.691  1.00 33.21 ? 118  MET A O   1 
ATOM   816  C CB  . MET A 1 123 ? 26.974  13.165  54.542  1.00 31.92 ? 118  MET A CB  1 
ATOM   817  C CG  . MET A 1 123 ? 25.942  14.283  54.529  1.00 28.60 ? 118  MET A CG  1 
ATOM   818  S SD  . MET A 1 123 ? 24.238  13.752  54.628  1.00 31.96 ? 118  MET A SD  1 
ATOM   819  C CE  . MET A 1 123 ? 24.211  12.675  53.168  1.00 32.73 ? 118  MET A CE  1 
ATOM   820  N N   . LYS A 1 124 ? 29.686  15.530  55.262  1.00 33.33 ? 119  LYS A N   1 
ATOM   821  C CA  . LYS A 1 124 ? 30.258  16.399  56.311  1.00 34.03 ? 119  LYS A CA  1 
ATOM   822  C C   . LYS A 1 124 ? 29.520  17.765  56.454  1.00 33.57 ? 119  LYS A C   1 
ATOM   823  O O   . LYS A 1 124 ? 29.595  18.389  57.505  1.00 33.10 ? 119  LYS A O   1 
ATOM   824  C CB  . LYS A 1 124 ? 31.744  16.681  56.006  1.00 34.99 ? 119  LYS A CB  1 
ATOM   825  C CG  . LYS A 1 124 ? 32.744  15.508  56.228  1.00 36.45 ? 119  LYS A CG  1 
ATOM   826  N N   . ASP A 1 125 ? 28.880  18.242  55.381  1.00 34.74 ? 120  ASP A N   1 
ATOM   827  C CA  . ASP A 1 125 ? 28.105  19.530  55.353  1.00 34.82 ? 120  ASP A CA  1 
ATOM   828  C C   . ASP A 1 125 ? 27.281  19.701  56.642  1.00 34.95 ? 120  ASP A C   1 
ATOM   829  O O   . ASP A 1 125 ? 26.441  18.855  56.930  1.00 33.73 ? 120  ASP A O   1 
ATOM   830  C CB  . ASP A 1 125 ? 27.172  19.550  54.103  1.00 35.26 ? 120  ASP A CB  1 
ATOM   831  C CG  . ASP A 1 125 ? 26.534  20.949  53.809  1.00 36.77 ? 120  ASP A CG  1 
ATOM   832  O OD1 . ASP A 1 125 ? 26.181  21.677  54.769  1.00 36.81 ? 120  ASP A OD1 1 
ATOM   833  O OD2 . ASP A 1 125 ? 26.326  21.304  52.610  1.00 36.00 ? 120  ASP A OD2 1 
ATOM   834  N N   . GLU A 1 126 ? 27.510  20.789  57.398  1.00 33.90 ? 121  GLU A N   1 
ATOM   835  C CA  . GLU A 1 126 ? 26.821  21.006  58.686  1.00 34.64 ? 121  GLU A CA  1 
ATOM   836  C C   . GLU A 1 126 ? 25.344  21.411  58.584  1.00 33.68 ? 121  GLU A C   1 
ATOM   837  O O   . GLU A 1 126 ? 24.663  21.533  59.577  1.00 33.70 ? 121  GLU A O   1 
ATOM   838  C CB  . GLU A 1 126 ? 27.597  22.008  59.562  1.00 36.50 ? 121  GLU A CB  1 
ATOM   839  C CG  . GLU A 1 126 ? 28.909  21.381  60.025  1.00 42.18 ? 121  GLU A CG  1 
ATOM   840  C CD  . GLU A 1 126 ? 29.740  22.278  60.899  1.00 51.45 ? 121  GLU A CD  1 
ATOM   841  O OE1 . GLU A 1 126 ? 29.492  23.516  60.946  1.00 53.97 ? 121  GLU A OE1 1 
ATOM   842  O OE2 . GLU A 1 126 ? 30.666  21.722  61.539  1.00 56.07 ? 121  GLU A OE2 1 
ATOM   843  N N   . ASN A 1 127 ? 24.860  21.592  57.378  1.00 32.41 ? 122  ASN A N   1 
ATOM   844  C CA  . ASN A 1 127 ? 23.459  21.791  57.181  1.00 33.17 ? 122  ASN A CA  1 
ATOM   845  C C   . ASN A 1 127 ? 22.798  20.615  56.512  1.00 31.79 ? 122  ASN A C   1 
ATOM   846  O O   . ASN A 1 127 ? 21.634  20.700  56.163  1.00 30.84 ? 122  ASN A O   1 
ATOM   847  C CB  . ASN A 1 127 ? 23.206  23.099  56.420  1.00 33.84 ? 122  ASN A CB  1 
ATOM   848  C CG  . ASN A 1 127 ? 23.281  24.290  57.342  1.00 37.82 ? 122  ASN A CG  1 
ATOM   849  O OD1 . ASN A 1 127 ? 22.410  24.491  58.230  1.00 43.61 ? 122  ASN A OD1 1 
ATOM   850  N ND2 . ASN A 1 127 ? 24.328  25.069  57.184  1.00 39.36 ? 122  ASN A ND2 1 
ATOM   851  N N   . ALA A 1 128 ? 23.532  19.505  56.359  1.00 30.85 ? 123  ALA A N   1 
ATOM   852  C CA  . ALA A 1 128 ? 22.948  18.322  55.768  1.00 29.70 ? 123  ALA A CA  1 
ATOM   853  C C   . ALA A 1 128 ? 22.710  17.195  56.783  1.00 30.56 ? 123  ALA A C   1 
ATOM   854  O O   . ALA A 1 128 ? 23.587  16.919  57.601  1.00 30.27 ? 123  ALA A O   1 
ATOM   855  C CB  . ALA A 1 128 ? 23.787  17.832  54.642  1.00 29.74 ? 123  ALA A CB  1 
ATOM   856  N N   . THR A 1 129 ? 21.522  16.562  56.718  1.00 29.63 ? 124  THR A N   1 
ATOM   857  C CA  . THR A 1 129 ? 21.256  15.351  57.485  1.00 30.39 ? 124  THR A CA  1 
ATOM   858  C C   . THR A 1 129 ? 20.587  14.303  56.619  1.00 29.25 ? 124  THR A C   1 
ATOM   859  O O   . THR A 1 129 ? 19.783  14.618  55.731  1.00 30.31 ? 124  THR A O   1 
ATOM   860  C CB  . THR A 1 129 ? 20.384  15.584  58.739  1.00 30.85 ? 124  THR A CB  1 
ATOM   861  O OG1 . THR A 1 129 ? 19.069  15.997  58.342  1.00 31.17 ? 124  THR A OG1 1 
ATOM   862  C CG2 . THR A 1 129 ? 20.997  16.644  59.631  1.00 31.23 ? 124  THR A CG2 1 
ATOM   863  N N   . LEU A 1 130 ? 20.984  13.062  56.837  1.00 29.58 ? 125  LEU A N   1 
ATOM   864  C CA  . LEU A 1 130 ? 20.308  11.949  56.212  1.00 28.56 ? 125  LEU A CA  1 
ATOM   865  C C   . LEU A 1 130 ? 20.467  10.693  57.046  1.00 28.23 ? 125  LEU A C   1 
ATOM   866  O O   . LEU A 1 130 ? 21.541  10.392  57.500  1.00 27.82 ? 125  LEU A O   1 
ATOM   867  C CB  . LEU A 1 130 ? 20.784  11.763  54.767  1.00 28.41 ? 125  LEU A CB  1 
ATOM   868  C CG  . LEU A 1 130 ? 20.127  10.676  53.882  1.00 29.07 ? 125  LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 130 ? 19.925  11.201  52.438  1.00 28.92 ? 125  LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 130 ? 21.006  9.468   53.854  1.00 31.73 ? 125  LEU A CD2 1 
ATOM   871  N N   . ASP A 1 131 ? 19.353  9.977   57.230  1.00 27.55 ? 126  ASP A N   1 
ATOM   872  C CA  . ASP A 1 131 ? 19.299  8.664   57.792  1.00 28.48 ? 126  ASP A CA  1 
ATOM   873  C C   . ASP A 1 131 ? 19.118  7.682   56.611  1.00 27.85 ? 126  ASP A C   1 
ATOM   874  O O   . ASP A 1 131 ? 18.149  7.815   55.816  1.00 28.30 ? 126  ASP A O   1 
ATOM   875  C CB  . ASP A 1 131 ? 18.066  8.481   58.699  1.00 29.63 ? 126  ASP A CB  1 
ATOM   876  C CG  . ASP A 1 131 ? 18.311  8.920   60.165  1.00 32.46 ? 126  ASP A CG  1 
ATOM   877  O OD1 . ASP A 1 131 ? 19.352  9.583   60.468  1.00 31.33 ? 126  ASP A OD1 1 
ATOM   878  O OD2 . ASP A 1 131 ? 17.466  8.546   61.025  1.00 29.69 ? 126  ASP A OD2 1 
ATOM   879  N N   . GLY A 1 132 ? 19.968  6.653   56.562  1.00 24.48 ? 127  GLY A N   1 
ATOM   880  C CA  . GLY A 1 132 ? 19.894  5.622   55.515  1.00 24.99 ? 127  GLY A CA  1 
ATOM   881  C C   . GLY A 1 132 ? 18.474  4.991   55.446  1.00 27.50 ? 127  GLY A C   1 
ATOM   882  O O   . GLY A 1 132 ? 18.077  4.465   54.396  1.00 27.62 ? 127  GLY A O   1 
ATOM   883  N N   . GLY A 1 133 ? 17.725  5.027   56.551  1.00 27.78 ? 128  GLY A N   1 
ATOM   884  C CA  . GLY A 1 133 ? 16.345  4.405   56.562  1.00 29.72 ? 128  GLY A CA  1 
ATOM   885  C C   . GLY A 1 133 ? 15.347  5.225   55.689  1.00 29.24 ? 128  GLY A C   1 
ATOM   886  O O   . GLY A 1 133 ? 14.281  4.740   55.354  1.00 30.46 ? 128  GLY A O   1 
ATOM   887  N N   . ASP A 1 134 ? 15.699  6.466   55.323  1.00 28.93 ? 129  ASP A N   1 
ATOM   888  C CA  . ASP A 1 134 ? 14.891  7.291   54.394  1.00 28.30 ? 129  ASP A CA  1 
ATOM   889  C C   . ASP A 1 134 ? 15.166  7.044   52.918  1.00 27.43 ? 129  ASP A C   1 
ATOM   890  O O   . ASP A 1 134 ? 14.625  7.710   52.028  1.00 25.22 ? 129  ASP A O   1 
ATOM   891  C CB  . ASP A 1 134 ? 15.059  8.781   54.689  1.00 28.07 ? 129  ASP A CB  1 
ATOM   892  C CG  . ASP A 1 134 ? 14.216  9.236   55.861  1.00 31.32 ? 129  ASP A CG  1 
ATOM   893  O OD1 . ASP A 1 134 ? 12.988  8.891   55.882  1.00 29.02 ? 129  ASP A OD1 1 
ATOM   894  O OD2 . ASP A 1 134 ? 14.749  10.004  56.709  1.00 27.17 ? 129  ASP A OD2 1 
ATOM   895  N N   . VAL A 1 135 ? 16.061  6.102   52.638  1.00 27.07 ? 130  VAL A N   1 
ATOM   896  C CA  . VAL A 1 135 ? 16.479  5.906   51.253  1.00 27.70 ? 130  VAL A CA  1 
ATOM   897  C C   . VAL A 1 135 ? 16.041  4.548   50.732  1.00 27.90 ? 130  VAL A C   1 
ATOM   898  O O   . VAL A 1 135 ? 16.397  3.470   51.315  1.00 26.21 ? 130  VAL A O   1 
ATOM   899  C CB  . VAL A 1 135 ? 18.091  5.899   51.127  1.00 27.56 ? 130  VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 135 ? 18.532  5.643   49.673  1.00 25.57 ? 130  VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 135 ? 18.658  7.207   51.677  1.00 26.98 ? 130  VAL A CG2 1 
ATOM   902  N N   . LEU A 1 136 ? 15.329  4.607   49.611  1.00 27.73 ? 131  LEU A N   1 
ATOM   903  C CA  . LEU A 1 136 ? 14.832  3.402   48.936  1.00 29.28 ? 131  LEU A CA  1 
ATOM   904  C C   . LEU A 1 136 ? 15.553  3.344   47.614  1.00 28.93 ? 131  LEU A C   1 
ATOM   905  O O   . LEU A 1 136 ? 15.420  4.248   46.783  1.00 28.05 ? 131  LEU A O   1 
ATOM   906  C CB  . LEU A 1 136 ? 13.299  3.484   48.752  1.00 28.95 ? 131  LEU A CB  1 
ATOM   907  C CG  . LEU A 1 136 ? 12.692  2.301   47.942  1.00 29.47 ? 131  LEU A CG  1 
ATOM   908  C CD1 . LEU A 1 136 ? 12.779  1.027   48.772  1.00 29.86 ? 131  LEU A CD1 1 
ATOM   909  C CD2 . LEU A 1 136 ? 11.205  2.528   47.498  1.00 28.60 ? 131  LEU A CD2 1 
ATOM   910  N N   . PHE A 1 137 ? 16.337  2.301   47.414  1.00 28.77 ? 132  PHE A N   1 
ATOM   911  C CA  . PHE A 1 137 ? 16.945  2.155   46.139  1.00 29.90 ? 132  PHE A CA  1 
ATOM   912  C C   . PHE A 1 137 ? 16.191  1.020   45.471  1.00 29.34 ? 132  PHE A C   1 
ATOM   913  O O   . PHE A 1 137 ? 16.135  -0.081  46.017  1.00 28.72 ? 132  PHE A O   1 
ATOM   914  C CB  . PHE A 1 137 ? 18.449  1.783   46.288  1.00 29.96 ? 132  PHE A CB  1 
ATOM   915  C CG  . PHE A 1 137 ? 19.096  1.385   44.992  1.00 30.90 ? 132  PHE A CG  1 
ATOM   916  C CD1 . PHE A 1 137 ? 19.242  2.313   43.944  1.00 32.95 ? 132  PHE A CD1 1 
ATOM   917  C CD2 . PHE A 1 137 ? 19.605  0.121   44.817  1.00 30.56 ? 132  PHE A CD2 1 
ATOM   918  C CE1 . PHE A 1 137 ? 19.877  1.952   42.752  1.00 34.39 ? 132  PHE A CE1 1 
ATOM   919  C CE2 . PHE A 1 137 ? 20.222  -0.239  43.620  1.00 33.00 ? 132  PHE A CE2 1 
ATOM   920  C CZ  . PHE A 1 137 ? 20.368  0.684   42.601  1.00 32.11 ? 132  PHE A CZ  1 
ATOM   921  N N   . THR A 1 138 ? 15.697  1.282   44.269  1.00 28.08 ? 133  THR A N   1 
ATOM   922  C CA  . THR A 1 138 ? 14.840  0.338   43.562  1.00 29.83 ? 133  THR A CA  1 
ATOM   923  C C   . THR A 1 138 ? 15.611  -0.552  42.596  1.00 28.73 ? 133  THR A C   1 
ATOM   924  O O   . THR A 1 138 ? 15.046  -1.456  42.023  1.00 30.09 ? 133  THR A O   1 
ATOM   925  C CB  . THR A 1 138 ? 13.688  1.046   42.797  1.00 29.81 ? 133  THR A CB  1 
ATOM   926  O OG1 . THR A 1 138 ? 14.238  1.667   41.594  1.00 29.14 ? 133  THR A OG1 1 
ATOM   927  C CG2 . THR A 1 138 ? 13.005  2.095   43.673  1.00 29.04 ? 133  THR A CG2 1 
ATOM   928  N N   . GLY A 1 139 ? 16.905  -0.342  42.435  1.00 29.64 ? 134  GLY A N   1 
ATOM   929  C CA  . GLY A 1 139 ? 17.632  -1.046  41.378  1.00 27.87 ? 134  GLY A CA  1 
ATOM   930  C C   . GLY A 1 139 ? 17.748  -0.144  40.151  1.00 29.96 ? 134  GLY A C   1 
ATOM   931  O O   . GLY A 1 139 ? 18.656  -0.310  39.360  1.00 30.18 ? 134  GLY A O   1 
ATOM   932  N N   . ARG A 1 140 ? 16.843  0.833   40.017  1.00 28.38 ? 135  ARG A N   1 
ATOM   933  C CA  . ARG A 1 140 ? 16.792  1.729   38.856  1.00 29.90 ? 135  ARG A CA  1 
ATOM   934  C C   . ARG A 1 140 ? 17.048  3.207   39.230  1.00 29.09 ? 135  ARG A C   1 
ATOM   935  O O   . ARG A 1 140 ? 17.438  3.998   38.387  1.00 29.22 ? 135  ARG A O   1 
ATOM   936  C CB  . ARG A 1 140 ? 15.386  1.662   38.211  1.00 30.80 ? 135  ARG A CB  1 
ATOM   937  C CG  . ARG A 1 140 ? 15.134  0.441   37.290  1.00 33.61 ? 135  ARG A CG  1 
ATOM   938  N N   . GLU A 1 141 ? 16.734  3.562   40.471  1.00 28.80 ? 136  GLU A N   1 
ATOM   939  C CA  . GLU A 1 141 ? 16.749  4.950   40.940  1.00 28.12 ? 136  GLU A CA  1 
ATOM   940  C C   . GLU A 1 141 ? 16.605  4.961   42.451  1.00 28.40 ? 136  GLU A C   1 
ATOM   941  O O   . GLU A 1 141 ? 16.335  3.924   43.091  1.00 28.20 ? 136  GLU A O   1 
ATOM   942  C CB  . GLU A 1 141 ? 15.616  5.771   40.299  1.00 29.89 ? 136  GLU A CB  1 
ATOM   943  C CG  . GLU A 1 141 ? 14.240  5.247   40.745  1.00 29.67 ? 136  GLU A CG  1 
ATOM   944  C CD  . GLU A 1 141 ? 13.097  5.875   39.976  1.00 32.91 ? 136  GLU A CD  1 
ATOM   945  O OE1 . GLU A 1 141 ? 13.112  7.115   39.768  1.00 33.30 ? 136  GLU A OE1 1 
ATOM   946  O OE2 . GLU A 1 141 ? 12.186  5.122   39.567  1.00 32.56 ? 136  GLU A OE2 1 
ATOM   947  N N   . PHE A 1 142 ? 16.803  6.139   43.041  1.00 27.80 ? 137  PHE A N   1 
ATOM   948  C CA  . PHE A 1 142 ? 16.616  6.293   44.494  1.00 27.17 ? 137  PHE A CA  1 
ATOM   949  C C   . PHE A 1 142 ? 15.414  7.168   44.734  1.00 27.67 ? 137  PHE A C   1 
ATOM   950  O O   . PHE A 1 142 ? 15.206  8.158   44.018  1.00 27.24 ? 137  PHE A O   1 
ATOM   951  C CB  . PHE A 1 142 ? 17.826  7.044   45.074  1.00 26.76 ? 137  PHE A CB  1 
ATOM   952  C CG  . PHE A 1 142 ? 19.113  6.221   45.126  1.00 26.19 ? 137  PHE A CG  1 
ATOM   953  C CD1 . PHE A 1 142 ? 20.009  6.233   44.086  1.00 29.84 ? 137  PHE A CD1 1 
ATOM   954  C CD2 . PHE A 1 142 ? 19.427  5.492   46.279  1.00 23.22 ? 137  PHE A CD2 1 
ATOM   955  C CE1 . PHE A 1 142 ? 21.222  5.495   44.166  1.00 29.93 ? 137  PHE A CE1 1 
ATOM   956  C CE2 . PHE A 1 142 ? 20.666  4.761   46.381  1.00 29.08 ? 137  PHE A CE2 1 
ATOM   957  C CZ  . PHE A 1 142 ? 21.528  4.730   45.324  1.00 27.95 ? 137  PHE A CZ  1 
ATOM   958  N N   . PHE A 1 143 ? 14.637  6.810   45.753  1.00 27.89 ? 138  PHE A N   1 
ATOM   959  C CA  . PHE A 1 143 ? 13.690  7.714   46.350  1.00 29.00 ? 138  PHE A CA  1 
ATOM   960  C C   . PHE A 1 143 ? 14.212  8.033   47.736  1.00 29.78 ? 138  PHE A C   1 
ATOM   961  O O   . PHE A 1 143 ? 14.674  7.138   48.457  1.00 29.60 ? 138  PHE A O   1 
ATOM   962  C CB  . PHE A 1 143 ? 12.251  7.100   46.397  1.00 27.78 ? 138  PHE A CB  1 
ATOM   963  C CG  . PHE A 1 143 ? 11.649  6.868   45.056  1.00 30.69 ? 138  PHE A CG  1 
ATOM   964  C CD1 . PHE A 1 143 ? 11.559  5.571   44.512  1.00 31.02 ? 138  PHE A CD1 1 
ATOM   965  C CD2 . PHE A 1 143 ? 11.176  7.953   44.294  1.00 28.04 ? 138  PHE A CD2 1 
ATOM   966  C CE1 . PHE A 1 143 ? 10.999  5.365   43.214  1.00 30.70 ? 138  PHE A CE1 1 
ATOM   967  C CE2 . PHE A 1 143 ? 10.622  7.763   43.029  1.00 30.48 ? 138  PHE A CE2 1 
ATOM   968  C CZ  . PHE A 1 143 ? 10.503  6.496   42.476  1.00 27.79 ? 138  PHE A CZ  1 
ATOM   969  N N   . VAL A 1 144 ? 14.120  9.302   48.125  1.00 29.59 ? 139  VAL A N   1 
ATOM   970  C CA  . VAL A 1 144 ? 14.644  9.751   49.409  1.00 29.61 ? 139  VAL A CA  1 
ATOM   971  C C   . VAL A 1 144 ? 13.570  10.488  50.185  1.00 30.85 ? 139  VAL A C   1 
ATOM   972  O O   . VAL A 1 144 ? 13.134  11.560  49.751  1.00 28.91 ? 139  VAL A O   1 
ATOM   973  C CB  . VAL A 1 144 ? 15.891  10.643  49.266  1.00 29.74 ? 139  VAL A CB  1 
ATOM   974  C CG1 . VAL A 1 144 ? 16.364  11.144  50.651  1.00 29.28 ? 139  VAL A CG1 1 
ATOM   975  C CG2 . VAL A 1 144 ? 16.993  9.873   48.607  1.00 30.94 ? 139  VAL A CG2 1 
ATOM   976  N N   . GLY A 1 145 ? 13.196  9.922   51.347  1.00 30.14 ? 140  GLY A N   1 
ATOM   977  C CA  . GLY A 1 145 ? 12.228  10.555  52.249  1.00 31.51 ? 140  GLY A CA  1 
ATOM   978  C C   . GLY A 1 145 ? 12.770  11.849  52.828  1.00 31.11 ? 140  GLY A C   1 
ATOM   979  O O   . GLY A 1 145 ? 13.839  11.866  53.327  1.00 31.27 ? 140  GLY A O   1 
ATOM   980  N N   . LEU A 1 146 ? 12.012  12.939  52.736  1.00 31.56 ? 141  LEU A N   1 
ATOM   981  C CA  . LEU A 1 146 ? 12.318  14.177  53.450  1.00 30.53 ? 141  LEU A CA  1 
ATOM   982  C C   . LEU A 1 146 ? 11.502  14.190  54.718  1.00 31.39 ? 141  LEU A C   1 
ATOM   983  O O   . LEU A 1 146 ? 10.249  14.246  54.684  1.00 31.32 ? 141  LEU A O   1 
ATOM   984  C CB  . LEU A 1 146 ? 11.992  15.366  52.556  1.00 31.21 ? 141  LEU A CB  1 
ATOM   985  C CG  . LEU A 1 146 ? 12.804  15.623  51.268  1.00 31.28 ? 141  LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 146 ? 12.397  16.960  50.672  1.00 32.73 ? 141  LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 146 ? 14.342  15.675  51.524  1.00 33.95 ? 141  LEU A CD2 1 
ATOM   988  N N   . SER A 1 147 ? 12.187  14.021  55.837  1.00 31.76 ? 142  SER A N   1 
ATOM   989  C CA  . SER A 1 147 ? 11.546  13.601  57.102  1.00 31.06 ? 142  SER A CA  1 
ATOM   990  C C   . SER A 1 147 ? 12.069  14.403  58.290  1.00 31.72 ? 142  SER A C   1 
ATOM   991  O O   . SER A 1 147 ? 12.779  15.348  58.097  1.00 31.01 ? 142  SER A O   1 
ATOM   992  C CB  . SER A 1 147 ? 11.852  12.158  57.377  1.00 31.55 ? 142  SER A CB  1 
ATOM   993  O OG  . SER A 1 147 ? 13.253  11.994  57.627  1.00 31.70 ? 142  SER A OG  1 
ATOM   994  N N   . LYS A 1 148 ? 11.780  13.959  59.519  1.00 32.45 ? 143  LYS A N   1 
ATOM   995  C CA  . LYS A 1 148 ? 12.355  14.612  60.714  1.00 32.31 ? 143  LYS A CA  1 
ATOM   996  C C   . LYS A 1 148 ? 13.884  14.422  60.716  1.00 32.87 ? 143  LYS A C   1 
ATOM   997  O O   . LYS A 1 148 ? 14.607  15.205  61.292  1.00 31.81 ? 143  LYS A O   1 
ATOM   998  C CB  . LYS A 1 148 ? 11.755  14.035  62.013  1.00 30.96 ? 143  LYS A CB  1 
ATOM   999  N N   . ARG A 1 149 ? 14.358  13.379  60.040  1.00 33.13 ? 144  ARG A N   1 
ATOM   1000 C CA  . ARG A 1 149 ? 15.764  13.021  60.108  1.00 31.77 ? 144  ARG A CA  1 
ATOM   1001 C C   . ARG A 1 149 ? 16.556  13.337  58.856  1.00 31.55 ? 144  ARG A C   1 
ATOM   1002 O O   . ARG A 1 149 ? 17.767  13.536  58.924  1.00 34.00 ? 144  ARG A O   1 
ATOM   1003 C CB  . ARG A 1 149 ? 15.878  11.542  60.420  1.00 32.18 ? 144  ARG A CB  1 
ATOM   1004 C CG  . ARG A 1 149 ? 15.331  11.124  61.760  1.00 33.23 ? 144  ARG A CG  1 
ATOM   1005 C CD  . ARG A 1 149 ? 16.063  11.811  62.876  1.00 35.81 ? 144  ARG A CD  1 
ATOM   1006 N NE  . ARG A 1 149 ? 15.489  11.516  64.175  1.00 40.40 ? 144  ARG A NE  1 
ATOM   1007 C CZ  . ARG A 1 149 ? 15.509  12.369  65.194  1.00 43.93 ? 144  ARG A CZ  1 
ATOM   1008 N NH1 . ARG A 1 149 ? 16.130  13.566  65.094  1.00 41.96 ? 144  ARG A NH1 1 
ATOM   1009 N NH2 . ARG A 1 149 ? 14.919  12.020  66.316  1.00 43.92 ? 144  ARG A NH2 1 
ATOM   1010 N N   . THR A 1 150 ? 15.902  13.394  57.713  1.00 29.25 ? 145  THR A N   1 
ATOM   1011 C CA  . THR A 1 150 ? 16.566  13.657  56.456  1.00 28.35 ? 145  THR A CA  1 
ATOM   1012 C C   . THR A 1 150 ? 16.106  14.955  55.825  1.00 29.16 ? 145  THR A C   1 
ATOM   1013 O O   . THR A 1 150 ? 14.882  15.168  55.579  1.00 26.90 ? 145  THR A O   1 
ATOM   1014 C CB  . THR A 1 150 ? 16.235  12.535  55.481  1.00 28.24 ? 145  THR A CB  1 
ATOM   1015 O OG1 . THR A 1 150 ? 16.648  11.303  56.081  1.00 29.03 ? 145  THR A OG1 1 
ATOM   1016 C CG2 . THR A 1 150 ? 16.976  12.716  54.146  1.00 30.19 ? 145  THR A CG2 1 
ATOM   1017 N N   . ASN A 1 151 ? 17.062  15.787  55.439  1.00 28.36 ? 146  ASN A N   1 
ATOM   1018 C CA  . ASN A 1 151 ? 16.596  17.004  54.809  1.00 29.32 ? 146  ASN A CA  1 
ATOM   1019 C C   . ASN A 1 151 ? 16.994  17.086  53.378  1.00 30.29 ? 146  ASN A C   1 
ATOM   1020 O O   . ASN A 1 151 ? 17.803  16.264  52.878  1.00 29.76 ? 146  ASN A O   1 
ATOM   1021 C CB  . ASN A 1 151 ? 17.006  18.261  55.594  1.00 28.63 ? 146  ASN A CB  1 
ATOM   1022 C CG  . ASN A 1 151 ? 18.516  18.459  55.672  1.00 29.73 ? 146  ASN A CG  1 
ATOM   1023 O OD1 . ASN A 1 151 ? 19.321  17.848  54.931  1.00 29.51 ? 146  ASN A OD1 1 
ATOM   1024 N ND2 . ASN A 1 151 ? 18.919  19.367  56.570  1.00 31.72 ? 146  ASN A ND2 1 
ATOM   1025 N N   . GLN A 1 152 ? 16.490  18.151  52.743  1.00 30.19 ? 147  GLN A N   1 
ATOM   1026 C CA  . GLN A 1 152 ? 16.781  18.433  51.354  1.00 31.71 ? 147  GLN A CA  1 
ATOM   1027 C C   . GLN A 1 152 ? 18.279  18.444  51.054  1.00 31.15 ? 147  GLN A C   1 
ATOM   1028 O O   . GLN A 1 152 ? 18.686  17.898  50.046  1.00 30.91 ? 147  GLN A O   1 
ATOM   1029 C CB  . GLN A 1 152 ? 16.132  19.760  50.982  1.00 32.43 ? 147  GLN A CB  1 
ATOM   1030 C CG  . GLN A 1 152 ? 16.587  20.312  49.679  1.00 37.69 ? 147  GLN A CG  1 
ATOM   1031 C CD  . GLN A 1 152 ? 15.909  19.659  48.522  1.00 43.56 ? 147  GLN A CD  1 
ATOM   1032 O OE1 . GLN A 1 152 ? 14.763  19.205  48.629  1.00 45.50 ? 147  GLN A OE1 1 
ATOM   1033 N NE2 . GLN A 1 152 ? 16.602  19.603  47.398  1.00 44.06 ? 147  GLN A NE2 1 
ATOM   1034 N N   . ARG A 1 153 ? 19.097  19.071  51.898  1.00 29.79 ? 148  ARG A N   1 
ATOM   1035 C CA  . ARG A 1 153 ? 20.531  19.094  51.586  1.00 31.18 ? 148  ARG A CA  1 
ATOM   1036 C C   . ARG A 1 153 ? 21.153  17.681  51.606  1.00 30.61 ? 148  ARG A C   1 
ATOM   1037 O O   . ARG A 1 153 ? 22.023  17.380  50.789  1.00 31.55 ? 148  ARG A O   1 
ATOM   1038 C CB  . ARG A 1 153 ? 21.279  20.043  52.512  1.00 31.15 ? 148  ARG A CB  1 
ATOM   1039 C CG  . ARG A 1 153 ? 22.785  20.184  52.213  1.00 35.01 ? 148  ARG A CG  1 
ATOM   1040 C CD  . ARG A 1 153 ? 23.105  21.121  51.031  1.00 38.44 ? 148  ARG A CD  1 
ATOM   1041 N NE  . ARG A 1 153 ? 24.480  20.889  50.612  1.00 43.55 ? 148  ARG A NE  1 
ATOM   1042 C CZ  . ARG A 1 153 ? 24.850  20.437  49.421  1.00 42.48 ? 148  ARG A CZ  1 
ATOM   1043 N NH1 . ARG A 1 153 ? 23.928  20.216  48.486  1.00 41.70 ? 148  ARG A NH1 1 
ATOM   1044 N NH2 . ARG A 1 153 ? 26.160  20.272  49.158  1.00 44.54 ? 148  ARG A NH2 1 
ATOM   1045 N N   . GLY A 1 154 ? 20.694  16.831  52.527  1.00 29.87 ? 149  GLY A N   1 
ATOM   1046 C CA  . GLY A 1 154 ? 21.236  15.490  52.660  1.00 28.59 ? 149  GLY A CA  1 
ATOM   1047 C C   . GLY A 1 154 ? 20.950  14.729  51.389  1.00 28.37 ? 149  GLY A C   1 
ATOM   1048 O O   . GLY A 1 154 ? 21.792  14.012  50.872  1.00 27.21 ? 149  GLY A O   1 
ATOM   1049 N N   . ALA A 1 155 ? 19.735  14.914  50.883  1.00 27.60 ? 150  ALA A N   1 
ATOM   1050 C CA  . ALA A 1 155 ? 19.254  14.305  49.652  1.00 28.73 ? 150  ALA A CA  1 
ATOM   1051 C C   . ALA A 1 155 ? 20.006  14.767  48.448  1.00 28.37 ? 150  ALA A C   1 
ATOM   1052 O O   . ALA A 1 155 ? 20.338  13.959  47.570  1.00 29.51 ? 150  ALA A O   1 
ATOM   1053 C CB  . ALA A 1 155 ? 17.705  14.593  49.481  1.00 27.22 ? 150  ALA A CB  1 
ATOM   1054 N N   . GLU A 1 156 ? 20.254  16.068  48.357  1.00 29.01 ? 151  GLU A N   1 
ATOM   1055 C CA  . GLU A 1 156 ? 21.183  16.575  47.332  1.00 29.82 ? 151  GLU A CA  1 
ATOM   1056 C C   . GLU A 1 156 ? 22.570  15.916  47.388  1.00 30.30 ? 151  GLU A C   1 
ATOM   1057 O O   . GLU A 1 156 ? 23.159  15.567  46.348  1.00 29.96 ? 151  GLU A O   1 
ATOM   1058 C CB  . GLU A 1 156 ? 21.324  18.086  47.408  1.00 30.54 ? 151  GLU A CB  1 
ATOM   1059 C CG  . GLU A 1 156 ? 20.014  18.800  47.062  1.00 32.51 ? 151  GLU A CG  1 
ATOM   1060 C CD  . GLU A 1 156 ? 20.042  20.296  47.349  1.00 38.18 ? 151  GLU A CD  1 
ATOM   1061 O OE1 . GLU A 1 156 ? 21.090  20.822  47.818  1.00 37.95 ? 151  GLU A OE1 1 
ATOM   1062 O OE2 . GLU A 1 156 ? 18.985  20.938  47.123  1.00 39.96 ? 151  GLU A OE2 1 
ATOM   1063 N N   . ILE A 1 157 ? 23.130  15.758  48.578  1.00 30.37 ? 152  ILE A N   1 
ATOM   1064 C CA  . ILE A 1 157 ? 24.516  15.174  48.622  1.00 30.31 ? 152  ILE A CA  1 
ATOM   1065 C C   . ILE A 1 157 ? 24.471  13.672  48.225  1.00 30.65 ? 152  ILE A C   1 
ATOM   1066 O O   . ILE A 1 157 ? 25.454  13.131  47.665  1.00 30.90 ? 152  ILE A O   1 
ATOM   1067 C CB  . ILE A 1 157 ? 25.205  15.360  50.015  1.00 30.89 ? 152  ILE A CB  1 
ATOM   1068 C CG1 . ILE A 1 157 ? 25.603  16.839  50.222  1.00 29.37 ? 152  ILE A CG1 1 
ATOM   1069 C CG2 . ILE A 1 157 ? 26.476  14.436  50.171  1.00 29.90 ? 152  ILE A CG2 1 
ATOM   1070 C CD1 . ILE A 1 157 ? 25.749  17.202  51.709  1.00 32.18 ? 152  ILE A CD1 1 
ATOM   1071 N N   . LEU A 1 158 ? 23.358  12.995  48.529  1.00 30.46 ? 153  LEU A N   1 
ATOM   1072 C CA  . LEU A 1 158 ? 23.153  11.626  48.000  1.00 30.54 ? 153  LEU A CA  1 
ATOM   1073 C C   . LEU A 1 158 ? 23.108  11.653  46.474  1.00 30.93 ? 153  LEU A C   1 
ATOM   1074 O O   . LEU A 1 158 ? 23.769  10.856  45.814  1.00 32.20 ? 153  LEU A O   1 
ATOM   1075 C CB  . LEU A 1 158 ? 21.875  10.971  48.571  1.00 31.94 ? 153  LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 158 ? 21.839  9.446   48.320  1.00 32.27 ? 153  LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 158 ? 21.343  8.638   49.512  1.00 30.94 ? 153  LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 158 ? 21.117  9.127   47.056  1.00 30.74 ? 153  LEU A CD2 1 
ATOM   1079 N N   . ALA A 1 159 ? 22.344  12.571  45.897  1.00 30.35 ? 154  ALA A N   1 
ATOM   1080 C CA  . ALA A 1 159 ? 22.281  12.672  44.438  1.00 30.79 ? 154  ALA A CA  1 
ATOM   1081 C C   . ALA A 1 159 ? 23.679  12.877  43.843  1.00 31.15 ? 154  ALA A C   1 
ATOM   1082 O O   . ALA A 1 159 ? 24.024  12.273  42.814  1.00 31.97 ? 154  ALA A O   1 
ATOM   1083 C CB  . ALA A 1 159 ? 21.366  13.783  44.037  1.00 29.69 ? 154  ALA A CB  1 
ATOM   1084 N N   . ASP A 1 160 ? 24.474  13.740  44.475  1.00 31.19 ? 155  ASP A N   1 
ATOM   1085 C CA  A ASP A 1 160 ? 25.833  14.097  44.012  0.50 31.67 ? 155  ASP A CA  1 
ATOM   1086 C CA  B ASP A 1 160 ? 25.813  14.077  43.952  0.50 31.42 ? 155  ASP A CA  1 
ATOM   1087 C C   . ASP A 1 160 ? 26.776  12.911  44.098  1.00 31.67 ? 155  ASP A C   1 
ATOM   1088 O O   . ASP A 1 160 ? 27.822  12.862  43.405  1.00 32.59 ? 155  ASP A O   1 
ATOM   1089 C CB  A ASP A 1 160 ? 26.419  15.194  44.905  0.50 32.35 ? 155  ASP A CB  1 
ATOM   1090 C CB  B ASP A 1 160 ? 26.379  15.290  44.686  0.50 31.91 ? 155  ASP A CB  1 
ATOM   1091 C CG  A ASP A 1 160 ? 25.734  16.551  44.732  0.50 34.96 ? 155  ASP A CG  1 
ATOM   1092 C CG  B ASP A 1 160 ? 27.755  15.721  44.165  0.50 33.49 ? 155  ASP A CG  1 
ATOM   1093 O OD1 A ASP A 1 160 ? 24.901  16.696  43.811  0.50 39.34 ? 155  ASP A OD1 1 
ATOM   1094 O OD1 B ASP A 1 160 ? 27.894  15.974  42.946  0.50 34.81 ? 155  ASP A OD1 1 
ATOM   1095 O OD2 A ASP A 1 160 ? 26.041  17.478  45.527  0.50 37.36 ? 155  ASP A OD2 1 
ATOM   1096 O OD2 B ASP A 1 160 ? 28.694  15.831  44.987  0.50 36.02 ? 155  ASP A OD2 1 
ATOM   1097 N N   . THR A 1 161 ? 26.449  11.973  44.995  1.00 30.04 ? 156  THR A N   1 
ATOM   1098 C CA  . THR A 1 161 ? 27.341  10.859  45.262  1.00 30.41 ? 156  THR A CA  1 
ATOM   1099 C C   . THR A 1 161 ? 27.044  9.727   44.304  1.00 30.26 ? 156  THR A C   1 
ATOM   1100 O O   . THR A 1 161 ? 27.953  9.060   43.881  1.00 29.76 ? 156  THR A O   1 
ATOM   1101 C CB  . THR A 1 161 ? 27.185  10.352  46.709  1.00 30.32 ? 156  THR A CB  1 
ATOM   1102 O OG1 . THR A 1 161 ? 27.393  11.452  47.588  1.00 30.03 ? 156  THR A OG1 1 
ATOM   1103 C CG2 . THR A 1 161 ? 28.145  9.194   47.029  1.00 30.42 ? 156  THR A CG2 1 
ATOM   1104 N N   . PHE A 1 162 ? 25.750  9.465   44.061  1.00 29.00 ? 157  PHE A N   1 
ATOM   1105 C CA  . PHE A 1 162 ? 25.350  8.383   43.190  1.00 29.67 ? 157  PHE A CA  1 
ATOM   1106 C C   . PHE A 1 162 ? 24.936  8.898   41.845  1.00 29.76 ? 157  PHE A C   1 
ATOM   1107 O O   . PHE A 1 162 ? 23.789  8.846   41.473  1.00 29.93 ? 157  PHE A O   1 
ATOM   1108 C CB  . PHE A 1 162 ? 24.281  7.537   43.850  1.00 29.33 ? 157  PHE A CB  1 
ATOM   1109 C CG  . PHE A 1 162 ? 24.742  6.948   45.130  1.00 29.04 ? 157  PHE A CG  1 
ATOM   1110 C CD1 . PHE A 1 162 ? 24.053  7.186   46.290  1.00 29.97 ? 157  PHE A CD1 1 
ATOM   1111 C CD2 . PHE A 1 162 ? 25.940  6.210   45.172  1.00 28.90 ? 157  PHE A CD2 1 
ATOM   1112 C CE1 . PHE A 1 162 ? 24.523  6.654   47.531  1.00 34.46 ? 157  PHE A CE1 1 
ATOM   1113 C CE2 . PHE A 1 162 ? 26.411  5.672   46.384  1.00 31.54 ? 157  PHE A CE2 1 
ATOM   1114 C CZ  . PHE A 1 162 ? 25.714  5.893   47.555  1.00 31.05 ? 157  PHE A CZ  1 
ATOM   1115 N N   . LYS A 1 163 ? 25.918  9.401   41.117  1.00 30.29 ? 158  LYS A N   1 
ATOM   1116 C CA  . LYS A 1 163 ? 25.699  10.192  39.920  1.00 32.33 ? 158  LYS A CA  1 
ATOM   1117 C C   . LYS A 1 163 ? 25.110  9.394   38.772  1.00 32.76 ? 158  LYS A C   1 
ATOM   1118 O O   . LYS A 1 163 ? 24.472  9.954   37.880  1.00 35.73 ? 158  LYS A O   1 
ATOM   1119 C CB  . LYS A 1 163 ? 27.049  10.782  39.451  1.00 31.90 ? 158  LYS A CB  1 
ATOM   1120 C CG  . LYS A 1 163 ? 27.616  11.829  40.386  1.00 34.42 ? 158  LYS A CG  1 
ATOM   1121 N N   . ASP A 1 164 ? 25.347  8.102   38.761  1.00 33.74 ? 159  ASP A N   1 
ATOM   1122 C CA  . ASP A 1 164 ? 24.793  7.241   37.734  1.00 35.05 ? 159  ASP A CA  1 
ATOM   1123 C C   . ASP A 1 164 ? 23.261  7.065   37.840  1.00 34.80 ? 159  ASP A C   1 
ATOM   1124 O O   . ASP A 1 164 ? 22.618  6.594   36.881  1.00 35.99 ? 159  ASP A O   1 
ATOM   1125 C CB  . ASP A 1 164 ? 25.487  5.871   37.784  1.00 35.48 ? 159  ASP A CB  1 
ATOM   1126 C CG  . ASP A 1 164 ? 26.951  5.944   37.368  1.00 37.93 ? 159  ASP A CG  1 
ATOM   1127 O OD1 . ASP A 1 164 ? 27.333  6.932   36.697  1.00 39.73 ? 159  ASP A OD1 1 
ATOM   1128 O OD2 . ASP A 1 164 ? 27.708  5.013   37.740  1.00 43.18 ? 159  ASP A OD2 1 
ATOM   1129 N N   . TYR A 1 165 ? 22.667  7.453   38.968  1.00 33.40 ? 160  TYR A N   1 
ATOM   1130 C CA  . TYR A 1 165 ? 21.240  7.122   39.221  1.00 32.21 ? 160  TYR A CA  1 
ATOM   1131 C C   . TYR A 1 165 ? 20.392  8.362   39.501  1.00 32.36 ? 160  TYR A C   1 
ATOM   1132 O O   . TYR A 1 165 ? 20.861  9.290   40.159  1.00 32.01 ? 160  TYR A O   1 
ATOM   1133 C CB  . TYR A 1 165 ? 21.137  6.182   40.436  1.00 33.06 ? 160  TYR A CB  1 
ATOM   1134 C CG  . TYR A 1 165 ? 21.649  4.767   40.214  1.00 31.60 ? 160  TYR A CG  1 
ATOM   1135 C CD1 . TYR A 1 165 ? 22.958  4.402   40.578  1.00 34.32 ? 160  TYR A CD1 1 
ATOM   1136 C CD2 . TYR A 1 165 ? 20.855  3.817   39.582  1.00 34.55 ? 160  TYR A CD2 1 
ATOM   1137 C CE1 . TYR A 1 165 ? 23.458  3.117   40.325  1.00 34.08 ? 160  TYR A CE1 1 
ATOM   1138 C CE2 . TYR A 1 165 ? 21.339  2.516   39.325  1.00 34.52 ? 160  TYR A CE2 1 
ATOM   1139 C CZ  . TYR A 1 165 ? 22.640  2.184   39.705  1.00 36.30 ? 160  TYR A CZ  1 
ATOM   1140 O OH  . TYR A 1 165 ? 23.106  0.909   39.471  1.00 36.06 ? 160  TYR A OH  1 
ATOM   1141 N N   . ALA A 1 166 ? 19.131  8.352   39.054  1.00 32.49 ? 161  ALA A N   1 
ATOM   1142 C CA  . ALA A 1 166 ? 18.203  9.415   39.403  1.00 32.28 ? 161  ALA A CA  1 
ATOM   1143 C C   . ALA A 1 166 ? 17.789  9.255   40.866  1.00 32.53 ? 161  ALA A C   1 
ATOM   1144 O O   . ALA A 1 166 ? 17.711  8.126   41.392  1.00 29.90 ? 161  ALA A O   1 
ATOM   1145 C CB  . ALA A 1 166 ? 16.981  9.427   38.460  1.00 32.92 ? 161  ALA A CB  1 
ATOM   1146 N N   . VAL A 1 167 ? 17.632  10.416  41.504  1.00 31.88 ? 162  VAL A N   1 
ATOM   1147 C CA  . VAL A 1 167 ? 17.268  10.583  42.912  1.00 32.97 ? 162  VAL A CA  1 
ATOM   1148 C C   . VAL A 1 167 ? 16.013  11.513  42.910  1.00 32.83 ? 162  VAL A C   1 
ATOM   1149 O O   . VAL A 1 167 ? 15.937  12.532  42.176  1.00 32.79 ? 162  VAL A O   1 
ATOM   1150 C CB  . VAL A 1 167 ? 18.478  11.106  43.781  1.00 31.64 ? 162  VAL A CB  1 
ATOM   1151 C CG1 . VAL A 1 167 ? 18.121  11.132  45.243  1.00 34.27 ? 162  VAL A CG1 1 
ATOM   1152 C CG2 . VAL A 1 167 ? 19.693  10.162  43.683  1.00 34.30 ? 162  VAL A CG2 1 
ATOM   1153 N N   . SER A 1 168 ? 14.983  11.113  43.614  1.00 32.59 ? 163  SER A N   1 
ATOM   1154 C CA  . SER A 1 168 ? 13.793  11.961  43.792  1.00 31.60 ? 163  SER A CA  1 
ATOM   1155 C C   . SER A 1 168 ? 13.391  11.967  45.276  1.00 32.17 ? 163  SER A C   1 
ATOM   1156 O O   . SER A 1 168 ? 13.592  10.956  45.985  1.00 30.47 ? 163  SER A O   1 
ATOM   1157 C CB  . SER A 1 168 ? 12.619  11.422  42.963  1.00 32.00 ? 163  SER A CB  1 
ATOM   1158 O OG  . SER A 1 168 ? 12.995  11.108  41.639  1.00 34.76 ? 163  SER A OG  1 
ATOM   1159 N N   . THR A 1 169 ? 12.850  13.068  45.774  1.00 31.15 ? 164  THR A N   1 
ATOM   1160 C CA  . THR A 1 169 ? 12.447  13.159  47.159  1.00 32.06 ? 164  THR A CA  1 
ATOM   1161 C C   . THR A 1 169 ? 10.952  13.002  47.356  1.00 31.03 ? 164  THR A C   1 
ATOM   1162 O O   . THR A 1 169 ? 10.183  13.351  46.511  1.00 31.77 ? 164  THR A O   1 
ATOM   1163 C CB  . THR A 1 169 ? 12.845  14.480  47.792  1.00 31.89 ? 164  THR A CB  1 
ATOM   1164 O OG1 . THR A 1 169 ? 12.211  15.547  47.108  1.00 31.59 ? 164  THR A OG1 1 
ATOM   1165 C CG2 . THR A 1 169 ? 14.342  14.667  47.806  1.00 32.47 ? 164  THR A CG2 1 
ATOM   1166 N N   . VAL A 1 170 ? 10.571  12.469  48.493  1.00 30.88 ? 165  VAL A N   1 
ATOM   1167 C CA  . VAL A 1 170 ? 9.182   12.342  48.867  1.00 30.30 ? 165  VAL A CA  1 
ATOM   1168 C C   . VAL A 1 170 ? 8.996   12.730  50.325  1.00 30.71 ? 165  VAL A C   1 
ATOM   1169 O O   . VAL A 1 170 ? 9.652   12.206  51.184  1.00 29.40 ? 165  VAL A O   1 
ATOM   1170 C CB  . VAL A 1 170 ? 8.612   10.949  48.574  1.00 32.23 ? 165  VAL A CB  1 
ATOM   1171 C CG1 . VAL A 1 170 ? 9.516   9.877   48.979  1.00 32.11 ? 165  VAL A CG1 1 
ATOM   1172 C CG2 . VAL A 1 170 ? 7.289   10.768  49.154  1.00 31.15 ? 165  VAL A CG2 1 
ATOM   1173 N N   . PRO A 1 171 ? 8.105   13.682  50.583  1.00 31.12 ? 166  PRO A N   1 
ATOM   1174 C CA  . PRO A 1 171 ? 7.842   14.096  51.949  1.00 30.95 ? 166  PRO A CA  1 
ATOM   1175 C C   . PRO A 1 171 ? 7.349   12.928  52.752  1.00 31.81 ? 166  PRO A C   1 
ATOM   1176 O O   . PRO A 1 171 ? 6.605   12.131  52.291  1.00 32.42 ? 166  PRO A O   1 
ATOM   1177 C CB  . PRO A 1 171 ? 6.746   15.128  51.797  1.00 31.46 ? 166  PRO A CB  1 
ATOM   1178 C CG  . PRO A 1 171 ? 6.838   15.575  50.458  1.00 31.71 ? 166  PRO A CG  1 
ATOM   1179 C CD  . PRO A 1 171 ? 7.249   14.419  49.656  1.00 30.74 ? 166  PRO A CD  1 
ATOM   1180 N N   . VAL A 1 172 ? 7.804   12.828  53.966  1.00 33.05 ? 167  VAL A N   1 
ATOM   1181 C CA  . VAL A 1 172 ? 7.354   11.737  54.818  1.00 34.30 ? 167  VAL A CA  1 
ATOM   1182 C C   . VAL A 1 172 ? 6.968   12.364  56.127  1.00 36.15 ? 167  VAL A C   1 
ATOM   1183 O O   . VAL A 1 172 ? 7.714   13.126  56.692  1.00 37.73 ? 167  VAL A O   1 
ATOM   1184 C CB  . VAL A 1 172 ? 8.448   10.681  55.013  1.00 34.92 ? 167  VAL A CB  1 
ATOM   1185 C CG1 . VAL A 1 172 ? 8.114   9.752   56.218  1.00 35.03 ? 167  VAL A CG1 1 
ATOM   1186 C CG2 . VAL A 1 172 ? 8.619   9.863   53.686  1.00 32.85 ? 167  VAL A CG2 1 
ATOM   1187 N N   . ALA A 1 173 ? 5.809   11.993  56.609  1.00 37.47 ? 168  ALA A N   1 
ATOM   1188 C CA  . ALA A 1 173 ? 5.216   12.652  57.718  1.00 39.88 ? 168  ALA A CA  1 
ATOM   1189 C C   . ALA A 1 173 ? 5.687   12.161  59.062  1.00 39.77 ? 168  ALA A C   1 
ATOM   1190 O O   . ALA A 1 173 ? 6.253   11.087  59.172  1.00 39.56 ? 168  ALA A O   1 
ATOM   1191 C CB  . ALA A 1 173 ? 3.682   12.453  57.615  1.00 41.37 ? 168  ALA A CB  1 
ATOM   1192 N N   . ASP A 1 174 ? 5.423   12.964  60.095  1.00 39.79 ? 169  ASP A N   1 
ATOM   1193 C CA  . ASP A 1 174 ? 5.034   12.424  61.404  1.00 40.72 ? 169  ASP A CA  1 
ATOM   1194 C C   . ASP A 1 174 ? 6.047   11.541  62.101  1.00 38.88 ? 169  ASP A C   1 
ATOM   1195 O O   . ASP A 1 174 ? 5.672   10.515  62.652  1.00 40.41 ? 169  ASP A O   1 
ATOM   1196 C CB  . ASP A 1 174 ? 3.766   11.553  61.242  1.00 42.02 ? 169  ASP A CB  1 
ATOM   1197 C CG  . ASP A 1 174 ? 2.461   12.354  61.258  1.00 46.10 ? 169  ASP A CG  1 
ATOM   1198 O OD1 . ASP A 1 174 ? 2.230   13.132  62.217  1.00 50.85 ? 169  ASP A OD1 1 
ATOM   1199 O OD2 . ASP A 1 174 ? 1.634   12.163  60.324  1.00 51.85 ? 169  ASP A OD2 1 
ATOM   1200 N N   . GLY A 1 175 ? 7.320   11.867  62.085  1.00 37.48 ? 170  GLY A N   1 
ATOM   1201 C CA  . GLY A 1 175 ? 8.240   10.944  62.740  1.00 37.41 ? 170  GLY A CA  1 
ATOM   1202 C C   . GLY A 1 175 ? 8.525   9.623   62.034  1.00 36.46 ? 170  GLY A C   1 
ATOM   1203 O O   . GLY A 1 175 ? 9.285   8.818   62.558  1.00 38.47 ? 170  GLY A O   1 
ATOM   1204 N N   . LEU A 1 176 ? 7.981   9.404   60.834  1.00 34.32 ? 171  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 176 ? 8.296   8.181   60.030  1.00 32.95 ? 171  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 176 ? 9.633   8.311   59.251  1.00 31.04 ? 171  LEU A C   1 
ATOM   1207 O O   . LEU A 1 176 ? 10.135  9.432   59.102  1.00 29.60 ? 171  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 176 ? 7.142   7.866   59.061  1.00 31.99 ? 171  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 176 ? 5.821   7.544   59.738  1.00 34.71 ? 171  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 176 ? 4.676   7.462   58.721  1.00 33.65 ? 171  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 176 ? 5.993   6.274   60.525  1.00 33.32 ? 171  LEU A CD2 1 
ATOM   1212 N N   . HIS A 1 177 ? 10.204  7.176   58.772  1.00 30.12 ? 172  HIS A N   1 
ATOM   1213 C CA  . HIS A 1 177 ? 11.246  7.163   57.707  1.00 28.71 ? 172  HIS A CA  1 
ATOM   1214 C C   . HIS A 1 177 ? 10.573  6.632   56.452  1.00 28.73 ? 172  HIS A C   1 
ATOM   1215 O O   . HIS A 1 177 ? 9.547   5.952   56.542  1.00 29.71 ? 172  HIS A O   1 
ATOM   1216 C CB  . HIS A 1 177 ? 12.543  6.313   58.029  1.00 28.70 ? 172  HIS A CB  1 
ATOM   1217 C CG  . HIS A 1 177 ? 13.413  6.910   59.093  1.00 30.48 ? 172  HIS A CG  1 
ATOM   1218 N ND1 . HIS A 1 177 ? 12.973  7.096   60.387  1.00 32.13 ? 172  HIS A ND1 1 
ATOM   1219 C CD2 . HIS A 1 177 ? 14.690  7.382   59.060  1.00 31.13 ? 172  HIS A CD2 1 
ATOM   1220 C CE1 . HIS A 1 177 ? 13.943  7.621   61.111  1.00 33.07 ? 172  HIS A CE1 1 
ATOM   1221 N NE2 . HIS A 1 177 ? 14.994  7.793   60.335  1.00 29.24 ? 172  HIS A NE2 1 
ATOM   1222 N N   . LEU A 1 178 ? 11.062  6.982   55.274  1.00 27.18 ? 173  LEU A N   1 
ATOM   1223 C CA  . LEU A 1 178 ? 10.473  6.345   54.066  1.00 28.69 ? 173  LEU A CA  1 
ATOM   1224 C C   . LEU A 1 178 ? 10.289  4.836   54.199  1.00 29.29 ? 173  LEU A C   1 
ATOM   1225 O O   . LEU A 1 178 ? 9.195   4.289   53.932  1.00 29.54 ? 173  LEU A O   1 
ATOM   1226 C CB  . LEU A 1 178 ? 11.238  6.672   52.810  1.00 27.67 ? 173  LEU A CB  1 
ATOM   1227 C CG  . LEU A 1 178 ? 10.724  6.192   51.422  1.00 28.57 ? 173  LEU A CG  1 
ATOM   1228 C CD1 . LEU A 1 178 ? 9.283   6.666   51.087  1.00 26.94 ? 173  LEU A CD1 1 
ATOM   1229 C CD2 . LEU A 1 178 ? 11.630  6.849   50.410  1.00 27.81 ? 173  LEU A CD2 1 
ATOM   1230 N N   . LYS A 1 179 ? 11.309  4.141   54.675  1.00 29.15 ? 174  LYS A N   1 
ATOM   1231 C CA  . LYS A 1 179 ? 11.152  2.698   54.744  1.00 30.33 ? 174  LYS A CA  1 
ATOM   1232 C C   . LYS A 1 179 ? 10.438  2.217   56.018  1.00 29.86 ? 174  LYS A C   1 
ATOM   1233 O O   . LYS A 1 179 ? 10.401  1.013   56.377  1.00 28.10 ? 174  LYS A O   1 
ATOM   1234 C CB  . LYS A 1 179 ? 12.512  2.037   54.497  1.00 30.34 ? 174  LYS A CB  1 
ATOM   1235 C CG  . LYS A 1 179 ? 13.001  2.267   53.049  1.00 31.46 ? 174  LYS A CG  1 
ATOM   1236 C CD  . LYS A 1 179 ? 14.095  1.257   52.736  1.00 29.51 ? 174  LYS A CD  1 
ATOM   1237 C CE  . LYS A 1 179 ? 15.338  1.640   53.502  1.00 32.45 ? 174  LYS A CE  1 
ATOM   1238 N NZ  . LYS A 1 179 ? 16.529  1.132   52.803  1.00 32.37 ? 174  LYS A NZ  1 
ATOM   1239 N N   . SER A 1 180 ? 9.859   3.162   56.743  1.00 30.86 ? 175  SER A N   1 
ATOM   1240 C CA  . SER A 1 180 ? 8.957   2.737   57.803  1.00 29.60 ? 175  SER A CA  1 
ATOM   1241 C C   . SER A 1 180 ? 7.742   1.989   57.204  1.00 29.67 ? 175  SER A C   1 
ATOM   1242 O O   . SER A 1 180 ? 7.083   1.300   57.939  1.00 30.26 ? 175  SER A O   1 
ATOM   1243 C CB  . SER A 1 180 ? 8.437   3.907   58.629  1.00 29.98 ? 175  SER A CB  1 
ATOM   1244 O OG  . SER A 1 180 ? 9.481   4.532   59.300  1.00 30.44 ? 175  SER A OG  1 
ATOM   1245 N N   . PHE A 1 181 ? 7.469   2.144   55.904  1.00 27.76 ? 176  PHE A N   1 
ATOM   1246 C CA  . PHE A 1 181 ? 6.219   1.571   55.332  1.00 29.17 ? 176  PHE A CA  1 
ATOM   1247 C C   . PHE A 1 181 ? 6.452   1.018   53.931  1.00 28.37 ? 176  PHE A C   1 
ATOM   1248 O O   . PHE A 1 181 ? 5.493   0.737   53.179  1.00 26.73 ? 176  PHE A O   1 
ATOM   1249 C CB  . PHE A 1 181 ? 5.094   2.603   55.370  1.00 27.93 ? 176  PHE A CB  1 
ATOM   1250 C CG  . PHE A 1 181 ? 5.483   3.908   54.740  1.00 27.91 ? 176  PHE A CG  1 
ATOM   1251 C CD1 . PHE A 1 181 ? 5.603   4.019   53.352  1.00 27.67 ? 176  PHE A CD1 1 
ATOM   1252 C CD2 . PHE A 1 181 ? 5.778   5.018   55.537  1.00 32.01 ? 176  PHE A CD2 1 
ATOM   1253 C CE1 . PHE A 1 181 ? 6.012   5.180   52.760  1.00 25.70 ? 176  PHE A CE1 1 
ATOM   1254 C CE2 . PHE A 1 181 ? 6.177   6.239   54.940  1.00 31.54 ? 176  PHE A CE2 1 
ATOM   1255 C CZ  . PHE A 1 181 ? 6.254   6.329   53.571  1.00 29.63 ? 176  PHE A CZ  1 
ATOM   1256 N N   . CYS A 1 182 ? 7.719   0.831   53.562  1.00 25.64 ? 177  CYS A N   1 
ATOM   1257 C CA  . CYS A 1 182 ? 7.985   0.246   52.234  1.00 27.14 ? 177  CYS A CA  1 
ATOM   1258 C C   . CYS A 1 182 ? 9.407   -0.308  52.203  1.00 28.03 ? 177  CYS A C   1 
ATOM   1259 O O   . CYS A 1 182 ? 10.181  0.027   53.071  1.00 28.03 ? 177  CYS A O   1 
ATOM   1260 C CB  . CYS A 1 182 ? 7.817   1.283   51.087  1.00 28.19 ? 177  CYS A CB  1 
ATOM   1261 S SG  . CYS A 1 182 ? 9.079   2.636   50.988  1.00 29.62 ? 177  CYS A SG  1 
ATOM   1262 N N   . SER A 1 183 ? 9.701   -1.153  51.213  1.00 26.81 ? 178  SER A N   1 
ATOM   1263 C CA  . SER A 1 183 ? 11.078  -1.574  50.923  1.00 29.08 ? 178  SER A CA  1 
ATOM   1264 C C   . SER A 1 183 ? 10.893  -2.466  49.670  1.00 28.84 ? 178  SER A C   1 
ATOM   1265 O O   . SER A 1 183 ? 9.721   -2.745  49.247  1.00 26.92 ? 178  SER A O   1 
ATOM   1266 C CB  . SER A 1 183 ? 11.655  -2.335  52.137  1.00 29.72 ? 178  SER A CB  1 
ATOM   1267 O OG  . SER A 1 183 ? 10.737  -3.357  52.371  1.00 34.71 ? 178  SER A OG  1 
ATOM   1268 N N   . MET A 1 184 ? 11.986  -2.837  49.035  1.00 27.65 ? 179  MET A N   1 
ATOM   1269 C CA  . MET A 1 184 ? 11.913  -3.713  47.833  1.00 29.70 ? 179  MET A CA  1 
ATOM   1270 C C   . MET A 1 184 ? 11.681  -5.191  48.232  1.00 30.28 ? 179  MET A C   1 
ATOM   1271 O O   . MET A 1 184 ? 12.373  -5.719  49.116  1.00 31.66 ? 179  MET A O   1 
ATOM   1272 C CB  . MET A 1 184 ? 13.227  -3.590  47.025  1.00 29.25 ? 179  MET A CB  1 
ATOM   1273 C CG  . MET A 1 184 ? 13.519  -2.215  46.457  1.00 28.58 ? 179  MET A CG  1 
ATOM   1274 S SD  . MET A 1 184 ? 12.181  -1.365  45.613  1.00 28.84 ? 179  MET A SD  1 
ATOM   1275 C CE  . MET A 1 184 ? 12.068  -2.358  44.085  1.00 28.31 ? 179  MET A CE  1 
ATOM   1276 N N   . ALA A 1 185 ? 10.719  -5.860  47.606  1.00 30.98 ? 180  ALA A N   1 
ATOM   1277 C CA  . ALA A 1 185 ? 10.442  -7.258  47.884  1.00 30.18 ? 180  ALA A CA  1 
ATOM   1278 C C   . ALA A 1 185 ? 10.964  -8.162  46.736  1.00 30.49 ? 180  ALA A C   1 
ATOM   1279 O O   . ALA A 1 185 ? 10.938  -9.397  46.840  1.00 30.56 ? 180  ALA A O   1 
ATOM   1280 C CB  . ALA A 1 185 ? 8.917   -7.460  48.049  1.00 30.01 ? 180  ALA A CB  1 
ATOM   1281 N N   . GLY A 1 186 ? 11.433  -7.556  45.644  1.00 30.31 ? 181  GLY A N   1 
ATOM   1282 C CA  . GLY A 1 186 ? 11.899  -8.338  44.491  1.00 30.29 ? 181  GLY A CA  1 
ATOM   1283 C C   . GLY A 1 186 ? 12.329  -7.364  43.413  1.00 31.11 ? 181  GLY A C   1 
ATOM   1284 O O   . GLY A 1 186 ? 12.242  -6.147  43.619  1.00 30.79 ? 181  GLY A O   1 
ATOM   1285 N N   . PRO A 1 187 ? 12.821  -7.875  42.270  1.00 31.69 ? 182  PRO A N   1 
ATOM   1286 C CA  . PRO A 1 187 ? 13.112  -6.949  41.163  1.00 31.69 ? 182  PRO A CA  1 
ATOM   1287 C C   . PRO A 1 187 ? 11.797  -6.282  40.773  1.00 33.17 ? 182  PRO A C   1 
ATOM   1288 O O   . PRO A 1 187 ? 10.707  -6.921  40.804  1.00 34.15 ? 182  PRO A O   1 
ATOM   1289 C CB  . PRO A 1 187 ? 13.613  -7.868  40.043  1.00 32.72 ? 182  PRO A CB  1 
ATOM   1290 C CG  . PRO A 1 187 ? 13.341  -9.282  40.462  1.00 31.63 ? 182  PRO A CG  1 
ATOM   1291 C CD  . PRO A 1 187 ? 13.069  -9.291  41.937  1.00 30.46 ? 182  PRO A CD  1 
ATOM   1292 N N   . ASN A 1 188 ? 11.856  -5.002  40.449  1.00 32.77 ? 183  ASN A N   1 
ATOM   1293 C CA  . ASN A 1 188 ? 10.659  -4.259  40.096  1.00 32.79 ? 183  ASN A CA  1 
ATOM   1294 C C   . ASN A 1 188 ? 9.486   -4.311  41.077  1.00 32.07 ? 183  ASN A C   1 
ATOM   1295 O O   . ASN A 1 188 ? 8.404   -3.925  40.698  1.00 32.18 ? 183  ASN A O   1 
ATOM   1296 C CB  . ASN A 1 188 ? 10.148  -4.596  38.663  1.00 34.05 ? 183  ASN A CB  1 
ATOM   1297 C CG  . ASN A 1 188 ? 9.445   -3.417  38.021  1.00 35.43 ? 183  ASN A CG  1 
ATOM   1298 O OD1 . ASN A 1 188 ? 9.990   -2.318  38.021  1.00 41.24 ? 183  ASN A OD1 1 
ATOM   1299 N ND2 . ASN A 1 188 ? 8.215   -3.614  37.521  1.00 35.69 ? 183  ASN A ND2 1 
ATOM   1300 N N   . LEU A 1 189 ? 9.708   -4.735  42.330  1.00 29.41 ? 184  LEU A N   1 
ATOM   1301 C CA  . LEU A 1 189 ? 8.590   -4.979  43.270  1.00 29.35 ? 184  LEU A CA  1 
ATOM   1302 C C   . LEU A 1 189 ? 8.760   -4.212  44.580  1.00 28.06 ? 184  LEU A C   1 
ATOM   1303 O O   . LEU A 1 189 ? 9.621   -4.523  45.363  1.00 27.62 ? 184  LEU A O   1 
ATOM   1304 C CB  . LEU A 1 189 ? 8.479   -6.485  43.579  1.00 28.28 ? 184  LEU A CB  1 
ATOM   1305 C CG  . LEU A 1 189 ? 7.338   -6.973  44.467  1.00 30.02 ? 184  LEU A CG  1 
ATOM   1306 C CD1 . LEU A 1 189 ? 5.988   -6.747  43.839  1.00 29.55 ? 184  LEU A CD1 1 
ATOM   1307 C CD2 . LEU A 1 189 ? 7.517   -8.488  44.683  1.00 30.99 ? 184  LEU A CD2 1 
ATOM   1308 N N   . ILE A 1 190 ? 7.906   -3.241  44.813  1.00 28.63 ? 185  ILE A N   1 
ATOM   1309 C CA  . ILE A 1 190 ? 7.891   -2.442  46.051  1.00 29.01 ? 185  ILE A CA  1 
ATOM   1310 C C   . ILE A 1 190 ? 6.822   -2.959  47.026  1.00 29.72 ? 185  ILE A C   1 
ATOM   1311 O O   . ILE A 1 190 ? 5.581   -2.878  46.729  1.00 30.92 ? 185  ILE A O   1 
ATOM   1312 C CB  . ILE A 1 190 ? 7.587   -0.954  45.766  1.00 28.97 ? 185  ILE A CB  1 
ATOM   1313 C CG1 . ILE A 1 190 ? 8.582   -0.384  44.746  1.00 28.89 ? 185  ILE A CG1 1 
ATOM   1314 C CG2 . ILE A 1 190 ? 7.730   -0.178  47.050  1.00 29.99 ? 185  ILE A CG2 1 
ATOM   1315 C CD1 . ILE A 1 190 ? 8.198   1.028   44.218  1.00 30.83 ? 185  ILE A CD1 1 
ATOM   1316 N N   . ALA A 1 191 ? 7.287   -3.463  48.167  1.00 28.63 ? 186  ALA A N   1 
ATOM   1317 C CA  . ALA A 1 191 ? 6.427   -3.838  49.262  1.00 29.14 ? 186  ALA A CA  1 
ATOM   1318 C C   . ALA A 1 191 ? 5.988   -2.498  49.862  1.00 28.86 ? 186  ALA A C   1 
ATOM   1319 O O   . ALA A 1 191 ? 6.834   -1.643  50.082  1.00 26.74 ? 186  ALA A O   1 
ATOM   1320 C CB  . ALA A 1 191 ? 7.210   -4.646  50.277  1.00 30.21 ? 186  ALA A CB  1 
ATOM   1321 N N   . ILE A 1 192 ? 4.683   -2.298  50.011  1.00 27.76 ? 187  ILE A N   1 
ATOM   1322 C CA  . ILE A 1 192 ? 4.118   -0.990  50.457  1.00 27.75 ? 187  ILE A CA  1 
ATOM   1323 C C   . ILE A 1 192 ? 2.927   -1.204  51.424  1.00 27.80 ? 187  ILE A C   1 
ATOM   1324 O O   . ILE A 1 192 ? 2.130   -2.120  51.209  1.00 26.71 ? 187  ILE A O   1 
ATOM   1325 C CB  . ILE A 1 192 ? 3.586   -0.133  49.259  1.00 28.51 ? 187  ILE A CB  1 
ATOM   1326 C CG1 . ILE A 1 192 ? 3.140   1.241   49.767  1.00 29.24 ? 187  ILE A CG1 1 
ATOM   1327 C CG2 . ILE A 1 192 ? 2.410   -0.876  48.551  1.00 29.33 ? 187  ILE A CG2 1 
ATOM   1328 C CD1 . ILE A 1 192 ? 4.239   2.158   50.123  1.00 27.88 ? 187  ILE A CD1 1 
ATOM   1329 N N   . GLY A 1 193 ? 2.843   -0.398  52.496  1.00 26.48 ? 188  GLY A N   1 
ATOM   1330 C CA  . GLY A 1 193 ? 1.797   -0.569  53.491  1.00 27.53 ? 188  GLY A CA  1 
ATOM   1331 C C   . GLY A 1 193 ? 0.516   0.109   52.969  1.00 27.73 ? 188  GLY A C   1 
ATOM   1332 O O   . GLY A 1 193 ? 0.544   0.793   51.939  1.00 27.44 ? 188  GLY A O   1 
ATOM   1333 N N   . SER A 1 194 ? -0.599  -0.101  53.654  1.00 29.14 ? 189  SER A N   1 
ATOM   1334 C CA  . SER A 1 194 ? -1.899  0.417   53.237  1.00 31.03 ? 189  SER A CA  1 
ATOM   1335 C C   . SER A 1 194 ? -2.370  1.687   53.948  1.00 31.30 ? 189  SER A C   1 
ATOM   1336 O O   . SER A 1 194 ? -3.441  2.167   53.650  1.00 31.55 ? 189  SER A O   1 
ATOM   1337 C CB  . SER A 1 194 ? -2.959  -0.650  53.523  1.00 31.28 ? 189  SER A CB  1 
ATOM   1338 O OG  . SER A 1 194 ? -2.562  -1.882  52.921  1.00 33.55 ? 189  SER A OG  1 
ATOM   1339 N N   . SER A 1 195 ? -1.617  2.211   54.910  1.00 30.61 ? 190  SER A N   1 
ATOM   1340 C CA  . SER A 1 195 ? -2.102  3.408   55.626  1.00 31.14 ? 190  SER A CA  1 
ATOM   1341 C C   . SER A 1 195 ? -2.266  4.601   54.680  1.00 31.86 ? 190  SER A C   1 
ATOM   1342 O O   . SER A 1 195 ? -1.780  4.578   53.546  1.00 32.14 ? 190  SER A O   1 
ATOM   1343 C CB  . SER A 1 195 ? -1.158  3.777   56.743  1.00 31.82 ? 190  SER A CB  1 
ATOM   1344 O OG  . SER A 1 195 ? 0.109   4.183   56.202  1.00 30.73 ? 190  SER A OG  1 
ATOM   1345 N N   . GLU A 1 196 ? -2.935  5.652   55.139  1.00 32.52 ? 191  GLU A N   1 
ATOM   1346 C CA  . GLU A 1 196 ? -3.079  6.870   54.350  1.00 33.24 ? 191  GLU A CA  1 
ATOM   1347 C C   . GLU A 1 196 ? -1.662  7.421   54.014  1.00 32.27 ? 191  GLU A C   1 
ATOM   1348 O O   . GLU A 1 196 ? -1.380  7.765   52.871  1.00 33.42 ? 191  GLU A O   1 
ATOM   1349 C CB  . GLU A 1 196 ? -3.907  7.912   55.131  1.00 32.93 ? 191  GLU A CB  1 
ATOM   1350 C CG  . GLU A 1 196 ? -4.260  9.143   54.320  1.00 34.47 ? 191  GLU A CG  1 
ATOM   1351 C CD  . GLU A 1 196 ? -4.986  10.239  55.123  1.00 36.53 ? 191  GLU A CD  1 
ATOM   1352 O OE1 . GLU A 1 196 ? -5.350  10.039  56.324  1.00 35.97 ? 191  GLU A OE1 1 
ATOM   1353 O OE2 . GLU A 1 196 ? -5.150  11.318  54.531  1.00 41.75 ? 191  GLU A OE2 1 
ATOM   1354 N N   . SER A 1 197 ? -0.785  7.498   55.009  1.00 32.58 ? 192  SER A N   1 
ATOM   1355 C CA  . SER A 1 197 ? 0.640   7.916   54.803  1.00 31.95 ? 192  SER A CA  1 
ATOM   1356 C C   . SER A 1 197 ? 1.316   7.140   53.685  1.00 30.72 ? 192  SER A C   1 
ATOM   1357 O O   . SER A 1 197 ? 1.773   7.730   52.698  1.00 30.82 ? 192  SER A O   1 
ATOM   1358 C CB  . SER A 1 197 ? 1.451   7.725   56.084  1.00 32.58 ? 192  SER A CB  1 
ATOM   1359 O OG  . SER A 1 197 ? 1.053   8.699   57.020  1.00 38.89 ? 192  SER A OG  1 
ATOM   1360 N N   . ALA A 1 198 ? 1.405   5.821   53.857  1.00 29.19 ? 193  ALA A N   1 
ATOM   1361 C CA  . ALA A 1 198 ? 2.134   4.938   52.906  1.00 29.55 ? 193  ALA A CA  1 
ATOM   1362 C C   . ALA A 1 198 ? 1.598   5.104   51.478  1.00 29.98 ? 193  ALA A C   1 
ATOM   1363 O O   . ALA A 1 198 ? 2.375   5.301   50.519  1.00 29.40 ? 193  ALA A O   1 
ATOM   1364 C CB  . ALA A 1 198 ? 2.031   3.501   53.347  1.00 27.60 ? 193  ALA A CB  1 
ATOM   1365 N N   . GLN A 1 199 ? 0.259   5.094   51.336  1.00 29.13 ? 194  GLN A N   1 
ATOM   1366 C CA  . GLN A 1 199 ? -0.329  5.229   50.008  1.00 28.52 ? 194  GLN A CA  1 
ATOM   1367 C C   . GLN A 1 199 ? -0.076  6.602   49.405  1.00 27.92 ? 194  GLN A C   1 
ATOM   1368 O O   . GLN A 1 199 ? 0.084   6.719   48.218  1.00 27.78 ? 194  GLN A O   1 
ATOM   1369 C CB  . GLN A 1 199 ? -1.820  4.884   50.036  1.00 27.81 ? 194  GLN A CB  1 
ATOM   1370 C CG  . GLN A 1 199 ? -1.990  3.442   50.373  1.00 29.17 ? 194  GLN A CG  1 
ATOM   1371 C CD  . GLN A 1 199 ? -1.620  2.582   49.166  1.00 31.24 ? 194  GLN A CD  1 
ATOM   1372 O OE1 . GLN A 1 199 ? -1.975  2.921   48.023  1.00 30.78 ? 194  GLN A OE1 1 
ATOM   1373 N NE2 . GLN A 1 199 ? -0.916  1.480   49.399  1.00 28.00 ? 194  GLN A NE2 1 
ATOM   1374 N N   . LYS A 1 200 ? -0.108  7.650   50.218  1.00 29.26 ? 195  LYS A N   1 
ATOM   1375 C CA  . LYS A 1 200 ? 0.172   9.006   49.734  1.00 30.52 ? 195  LYS A CA  1 
ATOM   1376 C C   . LYS A 1 200 ? 1.610   9.079   49.228  1.00 30.03 ? 195  LYS A C   1 
ATOM   1377 O O   . LYS A 1 200 ? 1.901   9.720   48.219  1.00 29.74 ? 195  LYS A O   1 
ATOM   1378 C CB  . LYS A 1 200 ? 0.054   10.011  50.870  1.00 31.15 ? 195  LYS A CB  1 
ATOM   1379 C CG  . LYS A 1 200 ? -1.315  10.499  51.167  1.00 34.52 ? 195  LYS A CG  1 
ATOM   1380 C CD  . LYS A 1 200 ? -1.275  11.454  52.374  1.00 39.26 ? 195  LYS A CD  1 
ATOM   1381 C CE  . LYS A 1 200 ? -2.603  12.187  52.562  1.00 41.18 ? 195  LYS A CE  1 
ATOM   1382 N NZ  . LYS A 1 200 ? -2.687  12.776  53.971  1.00 45.30 ? 195  LYS A NZ  1 
ATOM   1383 N N   . ALA A 1 201 ? 2.499   8.406   49.942  1.00 29.15 ? 196  ALA A N   1 
ATOM   1384 C CA  . ALA A 1 201 ? 3.937   8.364   49.572  1.00 29.47 ? 196  ALA A CA  1 
ATOM   1385 C C   . ALA A 1 201 ? 4.189   7.549   48.273  1.00 29.21 ? 196  ALA A C   1 
ATOM   1386 O O   . ALA A 1 201 ? 4.818   7.996   47.342  1.00 28.55 ? 196  ALA A O   1 
ATOM   1387 C CB  . ALA A 1 201 ? 4.722   7.808   50.770  1.00 28.07 ? 196  ALA A CB  1 
ATOM   1388 N N   . LEU A 1 202 ? 3.589   6.367   48.181  1.00 30.47 ? 197  LEU A N   1 
ATOM   1389 C CA  . LEU A 1 202 ? 3.677   5.538   46.975  1.00 30.28 ? 197  LEU A CA  1 
ATOM   1390 C C   . LEU A 1 202 ? 3.267   6.274   45.679  1.00 31.37 ? 197  LEU A C   1 
ATOM   1391 O O   . LEU A 1 202 ? 3.930   6.138   44.652  1.00 31.91 ? 197  LEU A O   1 
ATOM   1392 C CB  . LEU A 1 202 ? 2.798   4.303   47.167  1.00 30.43 ? 197  LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 202 ? 2.695   3.313   45.998  1.00 32.20 ? 197  LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 202 ? 4.067   2.775   45.698  1.00 31.12 ? 197  LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 202 ? 1.766   2.176   46.378  1.00 31.80 ? 197  LEU A CD2 1 
ATOM   1396 N N   . LYS A 1 203 ? 2.157   7.006   45.739  1.00 30.41 ? 198  LYS A N   1 
ATOM   1397 C CA  . LYS A 1 203 ? 1.625   7.781   44.618  1.00 32.45 ? 198  LYS A CA  1 
ATOM   1398 C C   . LYS A 1 203 ? 2.571   8.877   44.153  1.00 32.35 ? 198  LYS A C   1 
ATOM   1399 O O   . LYS A 1 203 ? 2.829   9.006   42.968  1.00 33.45 ? 198  LYS A O   1 
ATOM   1400 C CB  . LYS A 1 203 ? 0.263   8.356   44.993  1.00 31.58 ? 198  LYS A CB  1 
ATOM   1401 C CG  . LYS A 1 203 ? -0.758  7.227   45.135  1.00 36.17 ? 198  LYS A CG  1 
ATOM   1402 C CD  . LYS A 1 203 ? -2.035  7.614   45.855  1.00 39.69 ? 198  LYS A CD  1 
ATOM   1403 C CE  . LYS A 1 203 ? -3.089  6.508   45.783  1.00 38.39 ? 198  LYS A CE  1 
ATOM   1404 N NZ  . LYS A 1 203 ? -4.024  6.682   46.911  1.00 40.82 ? 198  LYS A NZ  1 
ATOM   1405 N N   . ILE A 1 204 ? 3.110   9.628   45.096  1.00 32.61 ? 199  ILE A N   1 
ATOM   1406 C CA  . ILE A 1 204 ? 4.145   10.604  44.801  1.00 33.21 ? 199  ILE A CA  1 
ATOM   1407 C C   . ILE A 1 204 ? 5.334   9.986   44.095  1.00 33.60 ? 199  ILE A C   1 
ATOM   1408 O O   . ILE A 1 204 ? 5.722   10.481  43.048  1.00 34.26 ? 199  ILE A O   1 
ATOM   1409 C CB  . ILE A 1 204 ? 4.520   11.398  46.055  1.00 33.50 ? 199  ILE A CB  1 
ATOM   1410 C CG1 . ILE A 1 204 ? 3.305   12.261  46.434  1.00 32.82 ? 199  ILE A CG1 1 
ATOM   1411 C CG2 . ILE A 1 204 ? 5.723   12.319  45.787  1.00 32.77 ? 199  ILE A CG2 1 
ATOM   1412 C CD1 . ILE A 1 204 ? 3.459   12.971  47.798  1.00 35.12 ? 199  ILE A CD1 1 
ATOM   1413 N N   . MET A 1 205 ? 5.856   8.877   44.633  1.00 34.12 ? 200  MET A N   1 
ATOM   1414 C CA  . MET A 1 205 ? 7.002   8.149   44.047  1.00 35.49 ? 200  MET A CA  1 
ATOM   1415 C C   . MET A 1 205 ? 6.706   7.681   42.607  1.00 35.78 ? 200  MET A C   1 
ATOM   1416 O O   . MET A 1 205 ? 7.512   7.906   41.682  1.00 35.46 ? 200  MET A O   1 
ATOM   1417 C CB  . MET A 1 205 ? 7.386   6.949   44.931  1.00 35.09 ? 200  MET A CB  1 
ATOM   1418 C CG  . MET A 1 205 ? 7.935   7.284   46.342  1.00 35.28 ? 200  MET A CG  1 
ATOM   1419 S SD  . MET A 1 205 ? 8.672   5.854   47.217  1.00 38.83 ? 200  MET A SD  1 
ATOM   1420 C CE  . MET A 1 205 ? 7.264   4.854   47.678  1.00 35.61 ? 200  MET A CE  1 
ATOM   1421 N N   . GLN A 1 206 ? 5.537   7.059   42.431  1.00 36.71 ? 201  GLN A N   1 
ATOM   1422 C CA  . GLN A 1 206 ? 5.040   6.597   41.128  1.00 37.75 ? 201  GLN A CA  1 
ATOM   1423 C C   . GLN A 1 206 ? 4.814   7.760   40.143  1.00 38.67 ? 201  GLN A C   1 
ATOM   1424 O O   . GLN A 1 206 ? 5.066   7.625   38.945  1.00 39.79 ? 201  GLN A O   1 
ATOM   1425 C CB  . GLN A 1 206 ? 3.742   5.814   41.293  1.00 38.28 ? 201  GLN A CB  1 
ATOM   1426 C CG  . GLN A 1 206 ? 3.859   4.645   42.256  1.00 41.32 ? 201  GLN A CG  1 
ATOM   1427 C CD  . GLN A 1 206 ? 2.886   3.538   41.971  1.00 46.13 ? 201  GLN A CD  1 
ATOM   1428 O OE1 . GLN A 1 206 ? 1.726   3.572   42.421  1.00 46.64 ? 201  GLN A OE1 1 
ATOM   1429 N NE2 . GLN A 1 206 ? 3.345   2.534   41.211  1.00 47.59 ? 201  GLN A NE2 1 
ATOM   1430 N N   . GLN A 1 207 ? 4.360   8.901   40.651  1.00 38.93 ? 202  GLN A N   1 
ATOM   1431 C CA  . GLN A 1 207 ? 4.193   10.097  39.822  1.00 39.21 ? 202  GLN A CA  1 
ATOM   1432 C C   . GLN A 1 207 ? 5.512   10.692  39.315  1.00 38.18 ? 202  GLN A C   1 
ATOM   1433 O O   . GLN A 1 207 ? 5.533   11.333  38.251  1.00 39.61 ? 202  GLN A O   1 
ATOM   1434 C CB  . GLN A 1 207 ? 3.426   11.154  40.599  1.00 40.03 ? 202  GLN A CB  1 
ATOM   1435 C CG  . GLN A 1 207 ? 1.924   11.003  40.465  1.00 45.20 ? 202  GLN A CG  1 
ATOM   1436 C CD  . GLN A 1 207 ? 1.118   11.902  41.402  1.00 50.23 ? 202  GLN A CD  1 
ATOM   1437 O OE1 . GLN A 1 207 ? 0.068   12.434  41.005  1.00 53.73 ? 202  GLN A OE1 1 
ATOM   1438 N NE2 . GLN A 1 207 ? 1.579   12.046  42.663  1.00 50.27 ? 202  GLN A NE2 1 
ATOM   1439 N N   . MET A 1 208 ? 6.604   10.501  40.054  1.00 36.78 ? 203  MET A N   1 
ATOM   1440 C CA  . MET A 1 208 ? 7.891   11.174  39.761  1.00 36.42 ? 203  MET A CA  1 
ATOM   1441 C C   . MET A 1 208 ? 8.799   10.368  38.878  1.00 36.87 ? 203  MET A C   1 
ATOM   1442 O O   . MET A 1 208 ? 9.898   10.810  38.509  1.00 37.09 ? 203  MET A O   1 
ATOM   1443 C CB  . MET A 1 208 ? 8.682   11.381  41.047  1.00 36.78 ? 203  MET A CB  1 
ATOM   1444 C CG  . MET A 1 208 ? 8.214   12.554  41.805  1.00 37.77 ? 203  MET A CG  1 
ATOM   1445 S SD  . MET A 1 208 ? 9.101   12.736  43.326  1.00 37.23 ? 203  MET A SD  1 
ATOM   1446 C CE  . MET A 1 208 ? 9.338   11.140  44.090  1.00 35.44 ? 203  MET A CE  1 
ATOM   1447 N N   . SER A 1 209 ? 8.381   9.153   38.593  1.00 35.79 ? 204  SER A N   1 
ATOM   1448 C CA  . SER A 1 209 ? 9.221   8.280   37.855  1.00 35.04 ? 204  SER A CA  1 
ATOM   1449 C C   . SER A 1 209 ? 8.486   7.750   36.661  1.00 34.93 ? 204  SER A C   1 
ATOM   1450 O O   . SER A 1 209 ? 7.288   7.461   36.743  1.00 33.81 ? 204  SER A O   1 
ATOM   1451 C CB  . SER A 1 209 ? 9.595   7.085   38.719  1.00 35.34 ? 204  SER A CB  1 
ATOM   1452 O OG  . SER A 1 209 ? 10.400  6.227   37.955  1.00 33.27 ? 204  SER A OG  1 
ATOM   1453 N N   . ASP A 1 210 ? 9.216   7.574   35.571  1.00 34.74 ? 205  ASP A N   1 
ATOM   1454 C CA  . ASP A 1 210 ? 8.651   6.887   34.405  1.00 36.06 ? 205  ASP A CA  1 
ATOM   1455 C C   . ASP A 1 210 ? 8.700   5.342   34.564  1.00 37.19 ? 205  ASP A C   1 
ATOM   1456 O O   . ASP A 1 210 ? 8.011   4.626   33.855  1.00 39.05 ? 205  ASP A O   1 
ATOM   1457 C CB  . ASP A 1 210 ? 9.360   7.305   33.129  1.00 35.30 ? 205  ASP A CB  1 
ATOM   1458 C CG  . ASP A 1 210 ? 9.280   8.812   32.851  1.00 35.62 ? 205  ASP A CG  1 
ATOM   1459 O OD1 . ASP A 1 210 ? 8.206   9.433   33.043  1.00 33.86 ? 205  ASP A OD1 1 
ATOM   1460 O OD2 . ASP A 1 210 ? 10.299  9.367   32.372  1.00 37.13 ? 205  ASP A OD2 1 
ATOM   1461 N N   . HIS A 1 211 ? 9.520   4.809   35.461  1.00 38.88 ? 206  HIS A N   1 
ATOM   1462 C CA  . HIS A 1 211 ? 9.571   3.344   35.608  1.00 38.65 ? 206  HIS A CA  1 
ATOM   1463 C C   . HIS A 1 211 ? 8.199   2.880   36.176  1.00 38.07 ? 206  HIS A C   1 
ATOM   1464 O O   . HIS A 1 211 ? 7.643   3.506   37.095  1.00 38.26 ? 206  HIS A O   1 
ATOM   1465 C CB  . HIS A 1 211 ? 10.738  2.878   36.504  1.00 39.90 ? 206  HIS A CB  1 
ATOM   1466 C CG  . HIS A 1 211 ? 12.097  3.420   36.141  1.00 42.35 ? 206  HIS A CG  1 
ATOM   1467 N ND1 . HIS A 1 211 ? 12.666  4.509   36.780  1.00 45.05 ? 206  HIS A ND1 1 
ATOM   1468 C CD2 . HIS A 1 211 ? 13.034  2.978   35.258  1.00 46.64 ? 206  HIS A CD2 1 
ATOM   1469 C CE1 . HIS A 1 211 ? 13.881  4.722   36.295  1.00 44.13 ? 206  HIS A CE1 1 
ATOM   1470 N NE2 . HIS A 1 211 ? 14.121  3.819   35.357  1.00 47.37 ? 206  HIS A NE2 1 
ATOM   1471 N N   . ARG A 1 212 ? 7.643   1.805   35.629  1.00 36.84 ? 207  ARG A N   1 
ATOM   1472 C CA  . ARG A 1 212 ? 6.374   1.251   36.111  1.00 35.28 ? 207  ARG A CA  1 
ATOM   1473 C C   . ARG A 1 212 ? 6.650   0.148   37.149  1.00 34.72 ? 207  ARG A C   1 
ATOM   1474 O O   . ARG A 1 212 ? 6.899   -0.980  36.756  1.00 34.53 ? 207  ARG A O   1 
ATOM   1475 C CB  . ARG A 1 212 ? 5.619   0.633   34.932  1.00 36.60 ? 207  ARG A CB  1 
ATOM   1476 N N   . TYR A 1 213 ? 6.590   0.443   38.447  1.00 33.11 ? 208  TYR A N   1 
ATOM   1477 C CA  . TYR A 1 213 ? 6.893   -0.611  39.449  1.00 32.45 ? 208  TYR A CA  1 
ATOM   1478 C C   . TYR A 1 213 ? 5.695   -1.442  39.758  1.00 32.04 ? 208  TYR A C   1 
ATOM   1479 O O   . TYR A 1 213 ? 4.558   -0.936  39.734  1.00 31.59 ? 208  TYR A O   1 
ATOM   1480 C CB  . TYR A 1 213 ? 7.432   -0.038  40.766  1.00 31.71 ? 208  TYR A CB  1 
ATOM   1481 C CG  . TYR A 1 213 ? 8.745   0.681   40.566  1.00 30.50 ? 208  TYR A CG  1 
ATOM   1482 C CD1 . TYR A 1 213 ? 8.780   2.042   40.284  1.00 31.48 ? 208  TYR A CD1 1 
ATOM   1483 C CD2 . TYR A 1 213 ? 9.940   -0.014  40.626  1.00 27.56 ? 208  TYR A CD2 1 
ATOM   1484 C CE1 . TYR A 1 213 ? 10.013  2.709   40.092  1.00 30.55 ? 208  TYR A CE1 1 
ATOM   1485 C CE2 . TYR A 1 213 ? 11.129  0.611   40.430  1.00 28.54 ? 208  TYR A CE2 1 
ATOM   1486 C CZ  . TYR A 1 213 ? 11.167  1.961   40.161  1.00 30.40 ? 208  TYR A CZ  1 
ATOM   1487 O OH  . TYR A 1 213 ? 12.374  2.536   39.999  1.00 30.74 ? 208  TYR A OH  1 
ATOM   1488 N N   . ASP A 1 214 ? 5.936   -2.702  40.123  1.00 32.03 ? 209  ASP A N   1 
ATOM   1489 C CA  . ASP A 1 214 ? 4.817   -3.477  40.669  1.00 32.11 ? 209  ASP A CA  1 
ATOM   1490 C C   . ASP A 1 214 ? 4.804   -3.242  42.165  1.00 31.70 ? 209  ASP A C   1 
ATOM   1491 O O   . ASP A 1 214 ? 5.808   -2.819  42.753  1.00 29.39 ? 209  ASP A O   1 
ATOM   1492 C CB  . ASP A 1 214 ? 4.949   -4.973  40.412  1.00 33.07 ? 209  ASP A CB  1 
ATOM   1493 C CG  . ASP A 1 214 ? 4.896   -5.343  38.939  1.00 36.65 ? 209  ASP A CG  1 
ATOM   1494 O OD1 . ASP A 1 214 ? 4.147   -4.747  38.133  1.00 39.90 ? 209  ASP A OD1 1 
ATOM   1495 O OD2 . ASP A 1 214 ? 5.591   -6.295  38.602  1.00 41.74 ? 209  ASP A OD2 1 
ATOM   1496 N N   . LYS A 1 215 ? 3.672   -3.530  42.790  1.00 31.59 ? 210  LYS A N   1 
ATOM   1497 C CA  . LYS A 1 215 ? 3.621   -3.387  44.220  1.00 32.61 ? 210  LYS A CA  1 
ATOM   1498 C C   . LYS A 1 215 ? 3.171   -4.656  44.911  1.00 32.48 ? 210  LYS A C   1 
ATOM   1499 O O   . LYS A 1 215 ? 2.361   -5.409  44.364  1.00 32.79 ? 210  LYS A O   1 
ATOM   1500 C CB  . LYS A 1 215 ? 2.737   -2.213  44.625  1.00 32.29 ? 210  LYS A CB  1 
ATOM   1501 C CG  . LYS A 1 215 ? 1.320   -2.285  44.082  1.00 35.85 ? 210  LYS A CG  1 
ATOM   1502 C CD  . LYS A 1 215 ? 0.618   -0.963  44.322  1.00 38.58 ? 210  LYS A CD  1 
ATOM   1503 C CE  . LYS A 1 215 ? -0.895  -1.069  44.020  1.00 42.42 ? 210  LYS A CE  1 
ATOM   1504 N NZ  . LYS A 1 215 ? -1.483  0.151   44.620  1.00 37.08 ? 210  LYS A NZ  1 
ATOM   1505 N N   . LEU A 1 216 ? 3.616   -4.829  46.145  1.00 30.98 ? 211  LEU A N   1 
ATOM   1506 C CA  . LEU A 1 216 ? 3.051   -5.877  47.016  1.00 30.69 ? 211  LEU A CA  1 
ATOM   1507 C C   . LEU A 1 216 ? 2.480   -5.189  48.237  1.00 29.60 ? 211  LEU A C   1 
ATOM   1508 O O   . LEU A 1 216 ? 3.209   -4.737  49.084  1.00 29.04 ? 211  LEU A O   1 
ATOM   1509 C CB  . LEU A 1 216 ? 4.139   -6.883  47.412  1.00 30.24 ? 211  LEU A CB  1 
ATOM   1510 C CG  . LEU A 1 216 ? 3.734   -8.085  48.273  1.00 32.50 ? 211  LEU A CG  1 
ATOM   1511 C CD1 . LEU A 1 216 ? 2.622   -8.851  47.600  1.00 38.23 ? 211  LEU A CD1 1 
ATOM   1512 C CD2 . LEU A 1 216 ? 4.899   -8.999  48.468  1.00 32.95 ? 211  LEU A CD2 1 
ATOM   1513 N N   . THR A 1 217 ? 1.153   -5.076  48.289  1.00 30.43 ? 212  THR A N   1 
ATOM   1514 C CA  . THR A 1 217 ? 0.501   -4.291  49.318  1.00 28.74 ? 212  THR A CA  1 
ATOM   1515 C C   . THR A 1 217 ? 0.186   -5.135  50.544  1.00 29.72 ? 212  THR A C   1 
ATOM   1516 O O   . THR A 1 217 ? -0.384  -6.214  50.438  1.00 27.77 ? 212  THR A O   1 
ATOM   1517 C CB  . THR A 1 217 ? -0.748  -3.639  48.750  1.00 29.83 ? 212  THR A CB  1 
ATOM   1518 O OG1 . THR A 1 217 ? -0.374  -2.961  47.528  1.00 30.33 ? 212  THR A OG1 1 
ATOM   1519 C CG2 . THR A 1 217 ? -1.280  -2.630  49.737  1.00 26.48 ? 212  THR A CG2 1 
ATOM   1520 N N   . VAL A 1 218 ? 0.616   -4.665  51.708  1.00 29.19 ? 213  VAL A N   1 
ATOM   1521 C CA  . VAL A 1 218 ? 0.401   -5.403  52.946  1.00 30.98 ? 213  VAL A CA  1 
ATOM   1522 C C   . VAL A 1 218 ? -0.372  -4.528  53.919  1.00 31.57 ? 213  VAL A C   1 
ATOM   1523 O O   . VAL A 1 218 ? -0.164  -3.299  53.912  1.00 32.55 ? 213  VAL A O   1 
ATOM   1524 C CB  . VAL A 1 218 ? 1.729   -5.796  53.574  1.00 29.49 ? 213  VAL A CB  1 
ATOM   1525 C CG1 . VAL A 1 218 ? 2.377   -6.866  52.708  1.00 29.04 ? 213  VAL A CG1 1 
ATOM   1526 C CG2 . VAL A 1 218 ? 2.628   -4.568  53.758  1.00 33.60 ? 213  VAL A CG2 1 
ATOM   1527 N N   . PRO A 1 219 ? -1.230  -5.147  54.762  1.00 31.55 ? 214  PRO A N   1 
ATOM   1528 C CA  . PRO A 1 219 ? -2.107  -4.359  55.660  1.00 31.22 ? 214  PRO A CA  1 
ATOM   1529 C C   . PRO A 1 219 ? -1.398  -3.751  56.840  1.00 31.10 ? 214  PRO A C   1 
ATOM   1530 O O   . PRO A 1 219 ? -1.932  -2.851  57.446  1.00 30.46 ? 214  PRO A O   1 
ATOM   1531 C CB  . PRO A 1 219 ? -3.173  -5.364  56.105  1.00 31.50 ? 214  PRO A CB  1 
ATOM   1532 C CG  . PRO A 1 219 ? -2.500  -6.663  56.032  1.00 33.00 ? 214  PRO A CG  1 
ATOM   1533 C CD  . PRO A 1 219 ? -1.525  -6.592  54.863  1.00 32.30 ? 214  PRO A CD  1 
ATOM   1534 N N   . ASP A 1 220 ? -0.168  -4.198  57.130  1.00 31.72 ? 215  ASP A N   1 
ATOM   1535 C CA  . ASP A 1 220 ? 0.600   -3.606  58.214  1.00 31.50 ? 215  ASP A CA  1 
ATOM   1536 C C   . ASP A 1 220 ? 1.802   -2.854  57.684  1.00 31.30 ? 215  ASP A C   1 
ATOM   1537 O O   . ASP A 1 220 ? 2.754   -3.474  57.208  1.00 30.22 ? 215  ASP A O   1 
ATOM   1538 C CB  . ASP A 1 220 ? 0.992   -4.703  59.238  1.00 31.14 ? 215  ASP A CB  1 
ATOM   1539 C CG  . ASP A 1 220 ? -0.178  -5.537  59.635  1.00 31.47 ? 215  ASP A CG  1 
ATOM   1540 O OD1 . ASP A 1 220 ? -1.029  -5.006  60.387  1.00 29.70 ? 215  ASP A OD1 1 
ATOM   1541 O OD2 . ASP A 1 220 ? -0.269  -6.720  59.198  1.00 34.61 ? 215  ASP A OD2 1 
ATOM   1542 N N   . ASP A 1 221 ? 1.745   -1.522  57.760  1.00 30.87 ? 216  ASP A N   1 
ATOM   1543 C CA  . ASP A 1 221 ? 2.841   -0.679  57.314  1.00 30.64 ? 216  ASP A CA  1 
ATOM   1544 C C   . ASP A 1 221 ? 4.159   -1.233  57.747  1.00 30.25 ? 216  ASP A C   1 
ATOM   1545 O O   . ASP A 1 221 ? 5.007   -1.429  56.906  1.00 29.24 ? 216  ASP A O   1 
ATOM   1546 C CB  . ASP A 1 221 ? 2.711   0.752   57.862  1.00 32.32 ? 216  ASP A CB  1 
ATOM   1547 C CG  . ASP A 1 221 ? 1.805   1.617   57.007  1.00 35.95 ? 216  ASP A CG  1 
ATOM   1548 O OD1 . ASP A 1 221 ? 1.029   1.052   56.198  1.00 36.54 ? 216  ASP A OD1 1 
ATOM   1549 O OD2 . ASP A 1 221 ? 1.884   2.858   57.146  1.00 37.86 ? 216  ASP A OD2 1 
ATOM   1550 N N   . ILE A 1 222 ? 4.347   -1.490  59.057  1.00 28.24 ? 217  ILE A N   1 
ATOM   1551 C CA  . ILE A 1 222 ? 5.633   -2.006  59.553  1.00 29.12 ? 217  ILE A CA  1 
ATOM   1552 C C   . ILE A 1 222 ? 6.148   -3.281  58.812  1.00 28.19 ? 217  ILE A C   1 
ATOM   1553 O O   . ILE A 1 222 ? 7.396   -3.510  58.623  1.00 27.65 ? 217  ILE A O   1 
ATOM   1554 C CB  . ILE A 1 222 ? 5.583   -2.227  61.110  1.00 27.90 ? 217  ILE A CB  1 
ATOM   1555 C CG1 . ILE A 1 222 ? 5.546   -0.852  61.807  1.00 29.51 ? 217  ILE A CG1 1 
ATOM   1556 C CG2 . ILE A 1 222 ? 6.728   -3.102  61.560  1.00 30.48 ? 217  ILE A CG2 1 
ATOM   1557 C CD1 . ILE A 1 222 ? 5.524   -0.883  63.314  1.00 29.61 ? 217  ILE A CD1 1 
ATOM   1558 N N   . ALA A 1 223 ? 5.216   -4.125  58.436  1.00 26.26 ? 218  ALA A N   1 
ATOM   1559 C CA  . ALA A 1 223 ? 5.523   -5.408  57.803  1.00 27.68 ? 218  ALA A CA  1 
ATOM   1560 C C   . ALA A 1 223 ? 5.898   -5.257  56.327  1.00 27.19 ? 218  ALA A C   1 
ATOM   1561 O O   . ALA A 1 223 ? 6.361   -6.244  55.662  1.00 28.89 ? 218  ALA A O   1 
ATOM   1562 C CB  . ALA A 1 223 ? 4.304   -6.419  57.995  1.00 27.43 ? 218  ALA A CB  1 
ATOM   1563 N N   . ALA A 1 224 ? 5.770   -4.031  55.809  1.00 26.37 ? 219  ALA A N   1 
ATOM   1564 C CA  . ALA A 1 224 ? 6.217   -3.734  54.443  1.00 26.32 ? 219  ALA A CA  1 
ATOM   1565 C C   . ALA A 1 224 ? 7.730   -3.572  54.431  1.00 27.43 ? 219  ALA A C   1 
ATOM   1566 O O   . ALA A 1 224 ? 8.327   -3.480  53.332  1.00 25.31 ? 219  ALA A O   1 
ATOM   1567 C CB  . ALA A 1 224 ? 5.557   -2.464  53.871  1.00 27.14 ? 219  ALA A CB  1 
ATOM   1568 N N   . ASN A 1 225 ? 8.333   -3.492  55.626  1.00 25.35 ? 220  ASN A N   1 
ATOM   1569 C CA  . ASN A 1 225 ? 9.820   -3.336  55.675  1.00 26.28 ? 220  ASN A CA  1 
ATOM   1570 C C   . ASN A 1 225 ? 10.378  -4.729  55.669  1.00 26.09 ? 220  ASN A C   1 
ATOM   1571 O O   . ASN A 1 225 ? 10.284  -5.444  56.661  1.00 27.87 ? 220  ASN A O   1 
ATOM   1572 C CB  . ASN A 1 225 ? 10.252  -2.632  56.962  1.00 25.04 ? 220  ASN A CB  1 
ATOM   1573 C CG  . ASN A 1 225 ? 11.774  -2.429  57.054  1.00 25.48 ? 220  ASN A CG  1 
ATOM   1574 O OD1 . ASN A 1 225 ? 12.500  -3.314  57.504  1.00 24.77 ? 220  ASN A OD1 1 
ATOM   1575 N ND2 . ASN A 1 225 ? 12.240  -1.246  56.687  1.00 26.55 ? 220  ASN A ND2 1 
ATOM   1576 N N   . CYS A 1 226 ? 10.918  -5.150  54.555  1.00 27.84 ? 221  CYS A N   1 
ATOM   1577 C CA  . CYS A 1 226 ? 11.482  -6.498  54.448  1.00 28.59 ? 221  CYS A CA  1 
ATOM   1578 C C   . CYS A 1 226 ? 12.875  -6.439  53.785  1.00 29.51 ? 221  CYS A C   1 
ATOM   1579 O O   . CYS A 1 226 ? 13.338  -5.381  53.327  1.00 28.69 ? 221  CYS A O   1 
ATOM   1580 C CB  . CYS A 1 226 ? 10.569  -7.386  53.623  1.00 29.85 ? 221  CYS A CB  1 
ATOM   1581 S SG  . CYS A 1 226 ? 10.228  -6.680  51.985  1.00 34.09 ? 221  CYS A SG  1 
ATOM   1582 N N   . ILE A 1 227 ? 13.560  -7.580  53.754  1.00 28.16 ? 222  ILE A N   1 
ATOM   1583 C CA  . ILE A 1 227 ? 14.825  -7.602  53.049  1.00 28.84 ? 222  ILE A CA  1 
ATOM   1584 C C   . ILE A 1 227 ? 14.759  -8.590  51.861  1.00 28.79 ? 222  ILE A C   1 
ATOM   1585 O O   . ILE A 1 227 ? 14.596  -9.770  52.075  1.00 27.44 ? 222  ILE A O   1 
ATOM   1586 C CB  . ILE A 1 227 ? 15.973  -7.975  53.985  1.00 29.11 ? 222  ILE A CB  1 
ATOM   1587 C CG1 . ILE A 1 227 ? 16.186  -6.866  55.035  1.00 30.58 ? 222  ILE A CG1 1 
ATOM   1588 C CG2 . ILE A 1 227 ? 17.316  -8.187  53.200  1.00 27.07 ? 222  ILE A CG2 1 
ATOM   1589 C CD1 . ILE A 1 227 ? 17.390  -7.197  55.981  1.00 30.86 ? 222  ILE A CD1 1 
ATOM   1590 N N   . TYR A 1 228 ? 14.918  -8.090  50.628  1.00 28.85 ? 223  TYR A N   1 
ATOM   1591 C CA  . TYR A 1 228 ? 15.118  -8.956  49.430  1.00 27.99 ? 223  TYR A CA  1 
ATOM   1592 C C   . TYR A 1 228 ? 16.608  -9.149  49.109  1.00 28.53 ? 223  TYR A C   1 
ATOM   1593 O O   . TYR A 1 228 ? 17.397  -8.190  49.114  1.00 27.51 ? 223  TYR A O   1 
ATOM   1594 C CB  . TYR A 1 228 ? 14.394  -8.374  48.196  1.00 28.34 ? 223  TYR A CB  1 
ATOM   1595 C CG  . TYR A 1 228 ? 14.755  -9.109  46.920  1.00 29.38 ? 223  TYR A CG  1 
ATOM   1596 C CD1 . TYR A 1 228 ? 14.139  -10.328 46.609  1.00 28.30 ? 223  TYR A CD1 1 
ATOM   1597 C CD2 . TYR A 1 228 ? 15.742  -8.614  46.034  1.00 28.95 ? 223  TYR A CD2 1 
ATOM   1598 C CE1 . TYR A 1 228 ? 14.456  -11.018 45.466  1.00 29.08 ? 223  TYR A CE1 1 
ATOM   1599 C CE2 . TYR A 1 228 ? 16.033  -9.315  44.855  1.00 26.80 ? 223  TYR A CE2 1 
ATOM   1600 C CZ  . TYR A 1 228 ? 15.374  -10.509 44.595  1.00 31.46 ? 223  TYR A CZ  1 
ATOM   1601 O OH  . TYR A 1 228 ? 15.686  -11.226 43.461  1.00 31.13 ? 223  TYR A OH  1 
ATOM   1602 N N   . LEU A 1 229 ? 16.989  -10.387 48.813  1.00 28.69 ? 224  LEU A N   1 
ATOM   1603 C CA  . LEU A 1 229 ? 18.311  -10.678 48.271  1.00 28.93 ? 224  LEU A CA  1 
ATOM   1604 C C   . LEU A 1 229 ? 18.165  -11.656 47.113  1.00 29.42 ? 224  LEU A C   1 
ATOM   1605 O O   . LEU A 1 229 ? 17.210  -12.450 47.065  1.00 28.22 ? 224  LEU A O   1 
ATOM   1606 C CB  . LEU A 1 229 ? 19.194  -11.315 49.357  1.00 30.22 ? 224  LEU A CB  1 
ATOM   1607 C CG  . LEU A 1 229 ? 19.583  -10.418 50.547  1.00 31.11 ? 224  LEU A CG  1 
ATOM   1608 C CD1 . LEU A 1 229 ? 19.813  -11.175 51.824  1.00 35.60 ? 224  LEU A CD1 1 
ATOM   1609 C CD2 . LEU A 1 229 ? 20.868  -9.684  50.193  1.00 35.57 ? 224  LEU A CD2 1 
ATOM   1610 N N   . ASN A 1 230 ? 19.138  -11.621 46.210  1.00 30.09 ? 225  ASN A N   1 
ATOM   1611 C CA  . ASN A 1 230 ? 19.194  -12.544 45.084  1.00 31.25 ? 225  ASN A CA  1 
ATOM   1612 C C   . ASN A 1 230 ? 20.473  -13.315 45.338  1.00 32.25 ? 225  ASN A C   1 
ATOM   1613 O O   . ASN A 1 230 ? 21.567  -12.760 45.253  1.00 31.84 ? 225  ASN A O   1 
ATOM   1614 C CB  . ASN A 1 230 ? 19.232  -11.706 43.765  1.00 30.84 ? 225  ASN A CB  1 
ATOM   1615 C CG  . ASN A 1 230 ? 19.204  -12.554 42.511  1.00 34.04 ? 225  ASN A CG  1 
ATOM   1616 O OD1 . ASN A 1 230 ? 19.594  -13.698 42.529  1.00 36.73 ? 225  ASN A OD1 1 
ATOM   1617 N ND2 . ASN A 1 230 ? 18.796  -11.957 41.390  1.00 35.62 ? 225  ASN A ND2 1 
ATOM   1618 N N   . ILE A 1 231 ? 20.350  -14.596 45.686  1.00 33.02 ? 226  ILE A N   1 
ATOM   1619 C CA  . ILE A 1 231 ? 21.505  -15.328 46.193  1.00 33.40 ? 226  ILE A CA  1 
ATOM   1620 C C   . ILE A 1 231 ? 21.871  -16.440 45.203  1.00 33.79 ? 226  ILE A C   1 
ATOM   1621 O O   . ILE A 1 231 ? 20.974  -17.145 44.769  1.00 33.23 ? 226  ILE A O   1 
ATOM   1622 C CB  . ILE A 1 231 ? 21.225  -15.940 47.618  1.00 32.96 ? 226  ILE A CB  1 
ATOM   1623 C CG1 . ILE A 1 231 ? 20.989  -14.866 48.701  1.00 33.39 ? 226  ILE A CG1 1 
ATOM   1624 C CG2 . ILE A 1 231 ? 22.352  -16.867 48.043  1.00 33.58 ? 226  ILE A CG2 1 
ATOM   1625 C CD1 . ILE A 1 231 ? 22.205  -13.931 48.978  1.00 34.04 ? 226  ILE A CD1 1 
ATOM   1626 N N   . PRO A 1 232 ? 23.170  -16.558 44.824  1.00 34.66 ? 227  PRO A N   1 
ATOM   1627 C CA  . PRO A 1 232 ? 23.684  -17.616 43.967  1.00 36.53 ? 227  PRO A CA  1 
ATOM   1628 C C   . PRO A 1 232 ? 23.199  -18.958 44.462  1.00 37.47 ? 227  PRO A C   1 
ATOM   1629 O O   . PRO A 1 232 ? 23.289  -19.240 45.666  1.00 37.48 ? 227  PRO A O   1 
ATOM   1630 C CB  . PRO A 1 232 ? 25.196  -17.559 44.200  1.00 36.62 ? 227  PRO A CB  1 
ATOM   1631 C CG  . PRO A 1 232 ? 25.471  -16.208 44.682  1.00 35.96 ? 227  PRO A CG  1 
ATOM   1632 C CD  . PRO A 1 232 ? 24.245  -15.635 45.239  1.00 35.38 ? 227  PRO A CD  1 
ATOM   1633 N N   . ASN A 1 233 ? 22.673  -19.763 43.551  1.00 39.45 ? 228  ASN A N   1 
ATOM   1634 C CA  . ASN A 1 233 ? 22.243  -21.122 43.872  1.00 40.75 ? 228  ASN A CA  1 
ATOM   1635 C C   . ASN A 1 233 ? 21.052  -21.170 44.795  1.00 40.83 ? 228  ASN A C   1 
ATOM   1636 O O   . ASN A 1 233 ? 20.655  -22.243 45.246  1.00 41.33 ? 228  ASN A O   1 
ATOM   1637 C CB  . ASN A 1 233 ? 23.410  -21.937 44.448  1.00 41.49 ? 228  ASN A CB  1 
ATOM   1638 C CG  . ASN A 1 233 ? 24.548  -22.104 43.445  1.00 45.19 ? 228  ASN A CG  1 
ATOM   1639 O OD1 . ASN A 1 233 ? 24.319  -22.169 42.223  1.00 46.90 ? 228  ASN A OD1 1 
ATOM   1640 N ND2 . ASN A 1 233 ? 25.780  -22.175 43.952  1.00 47.63 ? 228  ASN A ND2 1 
ATOM   1641 N N   . LYS A 1 234 ? 20.490  -20.000 45.093  1.00 40.89 ? 229  LYS A N   1 
ATOM   1642 C CA  . LYS A 1 234 ? 19.282  -19.927 45.901  1.00 40.16 ? 229  LYS A CA  1 
ATOM   1643 C C   . LYS A 1 234 ? 18.196  -19.143 45.168  1.00 39.15 ? 229  LYS A C   1 
ATOM   1644 O O   . LYS A 1 234 ? 17.020  -19.560 45.161  1.00 39.45 ? 229  LYS A O   1 
ATOM   1645 C CB  . LYS A 1 234 ? 19.574  -19.358 47.294  1.00 40.71 ? 229  LYS A CB  1 
ATOM   1646 C CG  . LYS A 1 234 ? 20.463  -20.268 48.189  1.00 42.21 ? 229  LYS A CG  1 
ATOM   1647 C CD  . LYS A 1 234 ? 20.559  -19.732 49.632  1.00 40.51 ? 229  LYS A CD  1 
ATOM   1648 C CE  . LYS A 1 234 ? 21.072  -20.787 50.603  1.00 41.77 ? 229  LYS A CE  1 
ATOM   1649 N NZ  . LYS A 1 234 ? 22.560  -20.916 50.598  1.00 47.63 ? 229  LYS A NZ  1 
ATOM   1650 N N   . GLY A 1 235 ? 18.584  -18.041 44.519  1.00 37.59 ? 230  GLY A N   1 
ATOM   1651 C CA  . GLY A 1 235 ? 17.625  -17.202 43.746  1.00 35.13 ? 230  GLY A CA  1 
ATOM   1652 C C   . GLY A 1 235 ? 16.957  -16.111 44.581  1.00 34.11 ? 230  GLY A C   1 
ATOM   1653 O O   . GLY A 1 235 ? 17.571  -15.523 45.481  1.00 32.52 ? 230  GLY A O   1 
ATOM   1654 N N   . HIS A 1 236 ? 15.682  -15.831 44.313  1.00 31.55 ? 231  HIS A N   1 
ATOM   1655 C CA  . HIS A 1 236 ? 14.992  -14.796 45.103  1.00 31.20 ? 231  HIS A CA  1 
ATOM   1656 C C   . HIS A 1 236 ? 14.910  -15.231 46.570  1.00 30.33 ? 231  HIS A C   1 
ATOM   1657 O O   . HIS A 1 236 ? 14.540  -16.353 46.816  1.00 29.24 ? 231  HIS A O   1 
ATOM   1658 C CB  . HIS A 1 236 ? 13.553  -14.570 44.583  1.00 31.09 ? 231  HIS A CB  1 
ATOM   1659 C CG  . HIS A 1 236 ? 13.479  -14.237 43.122  1.00 33.76 ? 231  HIS A CG  1 
ATOM   1660 N ND1 . HIS A 1 236 ? 14.178  -13.186 42.565  1.00 31.77 ? 231  HIS A ND1 1 
ATOM   1661 C CD2 . HIS A 1 236 ? 12.779  -14.811 42.108  1.00 36.34 ? 231  HIS A CD2 1 
ATOM   1662 C CE1 . HIS A 1 236 ? 13.933  -13.141 41.264  1.00 38.73 ? 231  HIS A CE1 1 
ATOM   1663 N NE2 . HIS A 1 236 ? 13.083  -14.115 40.960  1.00 38.60 ? 231  HIS A NE2 1 
ATOM   1664 N N   . VAL A 1 237 ? 15.175  -14.309 47.518  1.00 28.17 ? 232  VAL A N   1 
ATOM   1665 C CA  . VAL A 1 237 ? 15.162  -14.630 48.929  1.00 28.81 ? 232  VAL A CA  1 
ATOM   1666 C C   . VAL A 1 237 ? 14.478  -13.408 49.586  1.00 30.23 ? 232  VAL A C   1 
ATOM   1667 O O   . VAL A 1 237 ? 14.727  -12.269 49.186  1.00 29.98 ? 232  VAL A O   1 
ATOM   1668 C CB  . VAL A 1 237 ? 16.595  -14.835 49.539  1.00 29.88 ? 232  VAL A CB  1 
ATOM   1669 C CG1 . VAL A 1 237 ? 16.510  -15.033 51.067  1.00 29.68 ? 232  VAL A CG1 1 
ATOM   1670 C CG2 . VAL A 1 237 ? 17.384  -16.031 48.856  1.00 26.20 ? 232  VAL A CG2 1 
ATOM   1671 N N   . LEU A 1 238 ? 13.575  -13.642 50.535  1.00 30.32 ? 233  LEU A N   1 
ATOM   1672 C CA  . LEU A 1 238 ? 12.961  -12.521 51.274  1.00 30.98 ? 233  LEU A CA  1 
ATOM   1673 C C   . LEU A 1 238 ? 12.862  -12.789 52.782  1.00 30.64 ? 233  LEU A C   1 
ATOM   1674 O O   . LEU A 1 238 ? 12.183  -13.734 53.207  1.00 29.40 ? 233  LEU A O   1 
ATOM   1675 C CB  . LEU A 1 238 ? 11.557  -12.212 50.705  1.00 31.79 ? 233  LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 238 ? 10.890  -10.946 51.246  1.00 30.80 ? 233  LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 238 ? 11.560  -9.802  50.612  1.00 30.82 ? 233  LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 238 ? 9.398   -10.888 50.879  1.00 32.62 ? 233  LEU A CD2 1 
ATOM   1679 N N   . LEU A 1 239 ? 13.479  -11.912 53.569  1.00 29.12 ? 234  LEU A N   1 
ATOM   1680 C CA  . LEU A 1 239 ? 13.275  -11.910 55.017  1.00 30.78 ? 234  LEU A CA  1 
ATOM   1681 C C   . LEU A 1 239 ? 12.099  -10.983 55.292  1.00 30.71 ? 234  LEU A C   1 
ATOM   1682 O O   . LEU A 1 239 ? 12.103  -9.820  54.850  1.00 29.60 ? 234  LEU A O   1 
ATOM   1683 C CB  . LEU A 1 239 ? 14.472  -11.348 55.770  1.00 31.89 ? 234  LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 239 ? 15.969  -11.606 55.377  1.00 34.99 ? 234  LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 239 ? 16.926  -11.507 56.572  1.00 32.38 ? 234  LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 239 ? 16.284  -12.784 54.527  1.00 31.98 ? 234  LEU A CD2 1 
ATOM   1687 N N   . HIS A 1 240 ? 11.113  -11.512 55.998  1.00 29.20 ? 235  HIS A N   1 
ATOM   1688 C CA  . HIS A 1 240 ? 9.882   -10.767 56.270  1.00 30.46 ? 235  HIS A CA  1 
ATOM   1689 C C   . HIS A 1 240 ? 9.431   -11.002 57.701  1.00 29.50 ? 235  HIS A C   1 
ATOM   1690 O O   . HIS A 1 240 ? 9.852   -11.985 58.346  1.00 28.07 ? 235  HIS A O   1 
ATOM   1691 C CB  . HIS A 1 240 ? 8.816   -11.166 55.282  1.00 30.51 ? 235  HIS A CB  1 
ATOM   1692 C CG  . HIS A 1 240 ? 8.370   -12.596 55.425  1.00 31.85 ? 235  HIS A CG  1 
ATOM   1693 N ND1 . HIS A 1 240 ? 7.360   -12.977 56.292  1.00 31.24 ? 235  HIS A ND1 1 
ATOM   1694 C CD2 . HIS A 1 240 ? 8.740   -13.720 54.764  1.00 34.88 ? 235  HIS A CD2 1 
ATOM   1695 C CE1 . HIS A 1 240 ? 7.162   -14.284 56.191  1.00 32.89 ? 235  HIS A CE1 1 
ATOM   1696 N NE2 . HIS A 1 240 ? 7.988   -14.762 55.276  1.00 32.43 ? 235  HIS A NE2 1 
ATOM   1697 N N   . ARG A 1 241 ? 8.572   -10.131 58.225  1.00 29.33 ? 236  ARG A N   1 
ATOM   1698 C CA  . ARG A 1 241 ? 8.156   -10.294 59.637  1.00 29.37 ? 236  ARG A CA  1 
ATOM   1699 C C   . ARG A 1 241 ? 7.263   -11.529 59.799  1.00 29.38 ? 236  ARG A C   1 
ATOM   1700 O O   . ARG A 1 241 ? 6.682   -12.005 58.801  1.00 29.61 ? 236  ARG A O   1 
ATOM   1701 C CB  . ARG A 1 241 ? 7.460   -9.037  60.189  1.00 29.25 ? 236  ARG A CB  1 
ATOM   1702 C CG  . ARG A 1 241 ? 8.374   -7.791  60.086  1.00 30.52 ? 236  ARG A CG  1 
ATOM   1703 C CD  . ARG A 1 241 ? 9.615   -7.884  61.001  1.00 31.27 ? 236  ARG A CD  1 
ATOM   1704 N NE  . ARG A 1 241 ? 9.207   -7.822  62.412  1.00 30.22 ? 236  ARG A NE  1 
ATOM   1705 C CZ  . ARG A 1 241 ? 8.957   -6.688  63.052  1.00 30.07 ? 236  ARG A CZ  1 
ATOM   1706 N NH1 . ARG A 1 241 ? 9.105   -5.519  62.429  1.00 31.30 ? 236  ARG A NH1 1 
ATOM   1707 N NH2 . ARG A 1 241 ? 8.591   -6.722  64.311  1.00 30.46 ? 236  ARG A NH2 1 
ATOM   1708 N N   . THR A 1 242 ? 7.162   -12.070 61.032  1.00 27.70 ? 237  THR A N   1 
ATOM   1709 C CA  . THR A 1 242 ? 6.641   -13.421 61.198  1.00 28.40 ? 237  THR A CA  1 
ATOM   1710 C C   . THR A 1 242 ? 5.118   -13.382 61.298  1.00 29.17 ? 237  THR A C   1 
ATOM   1711 O O   . THR A 1 242 ? 4.528   -12.310 61.638  1.00 27.50 ? 237  THR A O   1 
ATOM   1712 C CB  . THR A 1 242 ? 7.211   -14.099 62.468  1.00 28.73 ? 237  THR A CB  1 
ATOM   1713 O OG1 . THR A 1 242 ? 6.567   -13.559 63.612  1.00 30.43 ? 237  THR A OG1 1 
ATOM   1714 C CG2 . THR A 1 242 ? 8.713   -13.820 62.633  1.00 30.47 ? 237  THR A CG2 1 
ATOM   1715 N N   . PRO A 1 243 ? 4.471   -14.536 61.011  1.00 30.33 ? 238  PRO A N   1 
ATOM   1716 C CA  . PRO A 1 243 ? 3.024   -14.600 61.164  1.00 31.44 ? 238  PRO A CA  1 
ATOM   1717 C C   . PRO A 1 243 ? 2.558   -14.352 62.621  1.00 33.10 ? 238  PRO A C   1 
ATOM   1718 O O   . PRO A 1 243 ? 1.405   -14.015 62.868  1.00 33.67 ? 238  PRO A O   1 
ATOM   1719 C CB  . PRO A 1 243 ? 2.667   -16.026 60.752  1.00 32.27 ? 238  PRO A CB  1 
ATOM   1720 C CG  . PRO A 1 243 ? 3.869   -16.705 60.290  1.00 31.86 ? 238  PRO A CG  1 
ATOM   1721 C CD  . PRO A 1 243 ? 5.053   -15.779 60.440  1.00 29.73 ? 238  PRO A CD  1 
ATOM   1722 N N   . GLU A 1 244 ? 3.429   -14.572 63.582  1.00 33.27 ? 239  GLU A N   1 
ATOM   1723 C CA  . GLU A 1 244 ? 3.064   -14.315 64.966  1.00 33.76 ? 239  GLU A CA  1 
ATOM   1724 C C   . GLU A 1 244 ? 3.072   -12.807 65.260  1.00 33.75 ? 239  GLU A C   1 
ATOM   1725 O O   . GLU A 1 244 ? 2.349   -12.352 66.151  1.00 34.49 ? 239  GLU A O   1 
ATOM   1726 C CB  . GLU A 1 244 ? 4.031   -15.074 65.885  1.00 34.46 ? 239  GLU A CB  1 
ATOM   1727 C CG  . GLU A 1 244 ? 3.930   -16.623 65.804  1.00 36.29 ? 239  GLU A CG  1 
ATOM   1728 C CD  . GLU A 1 244 ? 4.601   -17.293 64.568  1.00 40.33 ? 239  GLU A CD  1 
ATOM   1729 O OE1 . GLU A 1 244 ? 5.623   -16.796 63.997  1.00 40.30 ? 239  GLU A OE1 1 
ATOM   1730 O OE2 . GLU A 1 244 ? 4.080   -18.363 64.161  1.00 42.49 ? 239  GLU A OE2 1 
ATOM   1731 N N   . GLU A 1 245 ? 3.932   -12.045 64.550  1.00 32.59 ? 240  GLU A N   1 
ATOM   1732 C CA  . GLU A 1 245 ? 3.985   -10.605 64.667  1.00 31.73 ? 240  GLU A CA  1 
ATOM   1733 C C   . GLU A 1 245 ? 2.905   -9.897  63.852  1.00 31.83 ? 240  GLU A C   1 
ATOM   1734 O O   . GLU A 1 245 ? 2.273   -8.962  64.370  1.00 31.69 ? 240  GLU A O   1 
ATOM   1735 C CB  . GLU A 1 245 ? 5.338   -10.033 64.212  1.00 30.64 ? 240  GLU A CB  1 
ATOM   1736 C CG  . GLU A 1 245 ? 6.523   -10.548 64.987  1.00 32.89 ? 240  GLU A CG  1 
ATOM   1737 C CD  . GLU A 1 245 ? 7.864   -10.122 64.410  1.00 32.16 ? 240  GLU A CD  1 
ATOM   1738 O OE1 . GLU A 1 245 ? 8.169   -10.312 63.200  1.00 32.74 ? 240  GLU A OE1 1 
ATOM   1739 O OE2 . GLU A 1 245 ? 8.614   -9.570  65.193  1.00 33.54 ? 240  GLU A OE2 1 
ATOM   1740 N N   . TYR A 1 246 ? 2.758   -10.299 62.583  1.00 30.64 ? 241  TYR A N   1 
ATOM   1741 C CA  . TYR A 1 246 ? 1.879   -9.625  61.610  1.00 31.85 ? 241  TYR A CA  1 
ATOM   1742 C C   . TYR A 1 246 ? 1.261   -10.695 60.735  1.00 31.71 ? 241  TYR A C   1 
ATOM   1743 O O   . TYR A 1 246 ? 1.679   -10.874 59.593  1.00 32.07 ? 241  TYR A O   1 
ATOM   1744 C CB  . TYR A 1 246 ? 2.651   -8.600  60.758  1.00 31.64 ? 241  TYR A CB  1 
ATOM   1745 C CG  . TYR A 1 246 ? 3.140   -7.434  61.583  1.00 33.75 ? 241  TYR A CG  1 
ATOM   1746 C CD1 . TYR A 1 246 ? 4.524   -7.263  61.884  1.00 34.57 ? 241  TYR A CD1 1 
ATOM   1747 C CD2 . TYR A 1 246 ? 2.235   -6.532  62.104  1.00 33.56 ? 241  TYR A CD2 1 
ATOM   1748 C CE1 . TYR A 1 246 ? 4.936   -6.200  62.655  1.00 33.37 ? 241  TYR A CE1 1 
ATOM   1749 C CE2 . TYR A 1 246 ? 2.626   -5.479  62.854  1.00 35.62 ? 241  TYR A CE2 1 
ATOM   1750 C CZ  . TYR A 1 246 ? 3.985   -5.327  63.144  1.00 35.14 ? 241  TYR A CZ  1 
ATOM   1751 O OH  . TYR A 1 246 ? 4.281   -4.251  63.927  1.00 37.70 ? 241  TYR A OH  1 
ATOM   1752 N N   . PRO A 1 247 ? 0.301   -11.465 61.303  1.00 32.21 ? 242  PRO A N   1 
ATOM   1753 C CA  . PRO A 1 247 ? -0.337  -12.568 60.578  1.00 31.09 ? 242  PRO A CA  1 
ATOM   1754 C C   . PRO A 1 247 ? -0.898  -12.195 59.200  1.00 31.39 ? 242  PRO A C   1 
ATOM   1755 O O   . PRO A 1 247 ? -0.698  -12.940 58.234  1.00 31.28 ? 242  PRO A O   1 
ATOM   1756 C CB  . PRO A 1 247 ? -1.449  -13.043 61.530  1.00 32.07 ? 242  PRO A CB  1 
ATOM   1757 C CG  . PRO A 1 247 ? -1.612  -12.013 62.564  1.00 32.28 ? 242  PRO A CG  1 
ATOM   1758 C CD  . PRO A 1 247 ? -0.181  -11.370 62.691  1.00 30.87 ? 242  PRO A CD  1 
ATOM   1759 N N   . GLU A 1 248 ? -1.601  -11.068 59.106  1.00 32.19 ? 243  GLU A N   1 
ATOM   1760 C CA  . GLU A 1 248 ? -2.259  -10.633 57.847  1.00 32.80 ? 243  GLU A CA  1 
ATOM   1761 C C   . GLU A 1 248 ? -1.265  -10.122 56.779  1.00 32.49 ? 243  GLU A C   1 
ATOM   1762 O O   . GLU A 1 248 ? -1.540  -10.130 55.573  1.00 33.12 ? 243  GLU A O   1 
ATOM   1763 C CB  . GLU A 1 248 ? -3.301  -9.539  58.136  1.00 34.11 ? 243  GLU A CB  1 
ATOM   1764 C CG  . GLU A 1 248 ? -4.208  -9.760  59.365  1.00 37.99 ? 243  GLU A CG  1 
ATOM   1765 C CD  . GLU A 1 248 ? -4.963  -11.083 59.383  1.00 45.51 ? 243  GLU A CD  1 
ATOM   1766 O OE1 . GLU A 1 248 ? -5.177  -11.694 58.300  1.00 46.95 ? 243  GLU A OE1 1 
ATOM   1767 O OE2 . GLU A 1 248 ? -5.335  -11.524 60.512  1.00 47.94 ? 243  GLU A OE2 1 
ATOM   1768 N N   . SER A 1 249 ? -0.107  -9.661  57.205  1.00 31.27 ? 244  SER A N   1 
ATOM   1769 C CA  . SER A 1 249 ? 0.941   -9.357  56.230  1.00 30.91 ? 244  SER A CA  1 
ATOM   1770 C C   . SER A 1 249 ? 1.688   -10.583 55.800  1.00 30.57 ? 244  SER A C   1 
ATOM   1771 O O   . SER A 1 249 ? 2.004   -10.728 54.626  1.00 29.57 ? 244  SER A O   1 
ATOM   1772 C CB  . SER A 1 249 ? 1.899   -8.358  56.808  1.00 31.48 ? 244  SER A CB  1 
ATOM   1773 O OG  . SER A 1 249 ? 1.240   -7.121  56.894  1.00 30.51 ? 244  SER A OG  1 
ATOM   1774 N N   . ALA A 1 250 ? 1.972   -11.497 56.732  1.00 30.15 ? 245  ALA A N   1 
ATOM   1775 C CA  . ALA A 1 250 ? 2.681   -12.744 56.340  1.00 30.55 ? 245  ALA A CA  1 
ATOM   1776 C C   . ALA A 1 250 ? 1.883   -13.566 55.312  1.00 30.60 ? 245  ALA A C   1 
ATOM   1777 O O   . ALA A 1 250 ? 2.478   -14.197 54.443  1.00 30.40 ? 245  ALA A O   1 
ATOM   1778 C CB  . ALA A 1 250 ? 3.044   -13.634 57.606  1.00 30.17 ? 245  ALA A CB  1 
ATOM   1779 N N   . LYS A 1 251 ? 0.539   -13.534 55.394  1.00 29.90 ? 246  LYS A N   1 
ATOM   1780 C CA  . LYS A 1 251 ? -0.317  -14.202 54.409  1.00 31.19 ? 246  LYS A CA  1 
ATOM   1781 C C   . LYS A 1 251 ? -0.111  -13.604 53.010  1.00 30.59 ? 246  LYS A C   1 
ATOM   1782 O O   . LYS A 1 251 ? -0.214  -14.296 51.988  1.00 30.52 ? 246  LYS A O   1 
ATOM   1783 C CB  . LYS A 1 251 ? -1.815  -14.104 54.780  1.00 30.94 ? 246  LYS A CB  1 
ATOM   1784 C CG  . LYS A 1 251 ? -2.318  -14.968 55.926  1.00 32.51 ? 246  LYS A CG  1 
ATOM   1785 C CD  . LYS A 1 251 ? -3.830  -14.571 56.217  1.00 34.00 ? 246  LYS A CD  1 
ATOM   1786 C CE  . LYS A 1 251 ? -4.229  -14.821 57.683  1.00 36.45 ? 246  LYS A CE  1 
ATOM   1787 N NZ  . LYS A 1 251 ? -5.624  -14.277 57.978  1.00 35.69 ? 246  LYS A NZ  1 
ATOM   1788 N N   . VAL A 1 252 ? 0.188   -12.314 52.950  1.00 31.41 ? 247  VAL A N   1 
ATOM   1789 C CA  . VAL A 1 252 ? 0.500   -11.683 51.660  1.00 32.37 ? 247  VAL A CA  1 
ATOM   1790 C C   . VAL A 1 252 ? 1.856   -12.205 51.105  1.00 32.63 ? 247  VAL A C   1 
ATOM   1791 O O   . VAL A 1 252 ? 1.920   -12.656 49.954  1.00 32.17 ? 247  VAL A O   1 
ATOM   1792 C CB  . VAL A 1 252 ? 0.517   -10.161 51.739  1.00 32.90 ? 247  VAL A CB  1 
ATOM   1793 C CG1 . VAL A 1 252 ? 1.039   -9.571  50.409  1.00 32.58 ? 247  VAL A CG1 1 
ATOM   1794 C CG2 . VAL A 1 252 ? -0.924  -9.602  52.053  1.00 33.22 ? 247  VAL A CG2 1 
ATOM   1795 N N   . TYR A 1 253 ? 2.929   -12.151 51.899  1.00 32.81 ? 248  TYR A N   1 
ATOM   1796 C CA  . TYR A 1 253 ? 4.234   -12.686 51.419  1.00 33.50 ? 248  TYR A CA  1 
ATOM   1797 C C   . TYR A 1 253 ? 4.187   -14.138 51.011  1.00 34.39 ? 248  TYR A C   1 
ATOM   1798 O O   . TYR A 1 253 ? 4.923   -14.515 50.101  1.00 33.70 ? 248  TYR A O   1 
ATOM   1799 C CB  . TYR A 1 253 ? 5.360   -12.517 52.448  1.00 32.77 ? 248  TYR A CB  1 
ATOM   1800 C CG  . TYR A 1 253 ? 5.682   -11.067 52.722  1.00 33.67 ? 248  TYR A CG  1 
ATOM   1801 C CD1 . TYR A 1 253 ? 5.340   -10.457 53.938  1.00 32.96 ? 248  TYR A CD1 1 
ATOM   1802 C CD2 . TYR A 1 253 ? 6.313   -10.300 51.753  1.00 32.59 ? 248  TYR A CD2 1 
ATOM   1803 C CE1 . TYR A 1 253 ? 5.688   -9.112  54.177  1.00 29.86 ? 248  TYR A CE1 1 
ATOM   1804 C CE2 . TYR A 1 253 ? 6.619   -8.999  51.967  1.00 31.85 ? 248  TYR A CE2 1 
ATOM   1805 C CZ  . TYR A 1 253 ? 6.320   -8.407  53.177  1.00 31.96 ? 248  TYR A CZ  1 
ATOM   1806 O OH  . TYR A 1 253 ? 6.608   -7.077  53.334  1.00 31.08 ? 248  TYR A OH  1 
ATOM   1807 N N   . GLU A 1 254 ? 3.358   -14.954 51.698  1.00 36.15 ? 249  GLU A N   1 
ATOM   1808 C CA  . GLU A 1 254 ? 3.226   -16.424 51.418  1.00 37.95 ? 249  GLU A CA  1 
ATOM   1809 C C   . GLU A 1 254 ? 2.912   -16.681 49.919  1.00 37.65 ? 249  GLU A C   1 
ATOM   1810 O O   . GLU A 1 254 ? 3.253   -17.736 49.349  1.00 38.27 ? 249  GLU A O   1 
ATOM   1811 C CB  . GLU A 1 254 ? 2.184   -17.082 52.382  1.00 37.13 ? 249  GLU A CB  1 
ATOM   1812 C CG  . GLU A 1 254 ? 1.986   -18.621 52.263  1.00 40.04 ? 249  GLU A CG  1 
ATOM   1813 C CD  . GLU A 1 254 ? 0.938   -19.250 53.245  1.00 43.53 ? 249  GLU A CD  1 
ATOM   1814 O OE1 . GLU A 1 254 ? 0.314   -18.531 54.082  1.00 51.07 ? 249  GLU A OE1 1 
ATOM   1815 O OE2 . GLU A 1 254 ? 0.732   -20.497 53.174  1.00 51.19 ? 249  GLU A OE2 1 
ATOM   1816 N N   . LYS A 1 255 ? 2.324   -15.688 49.266  1.00 37.35 ? 250  LYS A N   1 
ATOM   1817 C CA  . LYS A 1 255 ? 1.950   -15.785 47.846  1.00 37.37 ? 250  LYS A CA  1 
ATOM   1818 C C   . LYS A 1 255 ? 3.139   -15.685 46.908  1.00 37.24 ? 250  LYS A C   1 
ATOM   1819 O O   . LYS A 1 255 ? 3.030   -15.984 45.727  1.00 37.68 ? 250  LYS A O   1 
ATOM   1820 C CB  . LYS A 1 255 ? 0.872   -14.752 47.498  1.00 37.61 ? 250  LYS A CB  1 
ATOM   1821 N N   . LEU A 1 256 ? 4.296   -15.289 47.428  1.00 36.93 ? 251  LEU A N   1 
ATOM   1822 C CA  . LEU A 1 256 ? 5.508   -15.272 46.629  1.00 36.59 ? 251  LEU A CA  1 
ATOM   1823 C C   . LEU A 1 256 ? 6.092   -16.681 46.480  1.00 36.41 ? 251  LEU A C   1 
ATOM   1824 O O   . LEU A 1 256 ? 7.090   -17.037 47.136  1.00 36.75 ? 251  LEU A O   1 
ATOM   1825 C CB  . LEU A 1 256 ? 6.551   -14.305 47.246  1.00 36.42 ? 251  LEU A CB  1 
ATOM   1826 C CG  . LEU A 1 256 ? 6.215   -12.811 47.194  1.00 36.94 ? 251  LEU A CG  1 
ATOM   1827 C CD1 . LEU A 1 256 ? 7.168   -12.020 48.100  1.00 34.69 ? 251  LEU A CD1 1 
ATOM   1828 C CD2 . LEU A 1 256 ? 6.264   -12.225 45.759  1.00 38.81 ? 251  LEU A CD2 1 
ATOM   1829 N N   . LYS A 1 257 ? 5.515   -17.463 45.561  1.00 36.09 ? 252  LYS A N   1 
ATOM   1830 C CA  . LYS A 1 257 ? 5.886   -18.874 45.404  1.00 35.34 ? 252  LYS A CA  1 
ATOM   1831 C C   . LYS A 1 257 ? 7.257   -19.093 44.790  1.00 34.80 ? 252  LYS A C   1 
ATOM   1832 O O   . LYS A 1 257 ? 7.818   -20.179 44.928  1.00 33.96 ? 252  LYS A O   1 
ATOM   1833 C CB  . LYS A 1 257 ? 4.817   -19.665 44.638  1.00 35.23 ? 252  LYS A CB  1 
ATOM   1834 C CG  . LYS A 1 257 ? 3.527   -19.938 45.441  1.00 35.20 ? 252  LYS A CG  1 
ATOM   1835 N N   . ASP A 1 258 ? 7.821   -18.067 44.149  1.00 34.48 ? 253  ASP A N   1 
ATOM   1836 C CA  . ASP A 1 258 ? 9.175   -18.165 43.633  1.00 33.94 ? 253  ASP A CA  1 
ATOM   1837 C C   . ASP A 1 258 ? 10.241  -17.482 44.506  1.00 34.04 ? 253  ASP A C   1 
ATOM   1838 O O   . ASP A 1 258 ? 11.390  -17.375 44.098  1.00 33.53 ? 253  ASP A O   1 
ATOM   1839 C CB  . ASP A 1 258 ? 9.217   -17.727 42.164  1.00 35.18 ? 253  ASP A CB  1 
ATOM   1840 C CG  . ASP A 1 258 ? 8.183   -18.504 41.298  1.00 37.33 ? 253  ASP A CG  1 
ATOM   1841 O OD1 . ASP A 1 258 ? 8.123   -19.754 41.373  1.00 38.72 ? 253  ASP A OD1 1 
ATOM   1842 O OD2 . ASP A 1 258 ? 7.381   -17.853 40.618  1.00 40.48 ? 253  ASP A OD2 1 
ATOM   1843 N N   . HIS A 1 259 ? 9.861   -17.069 45.719  1.00 32.64 ? 254  HIS A N   1 
ATOM   1844 C CA  . HIS A 1 259 ? 10.835  -16.576 46.705  1.00 32.44 ? 254  HIS A CA  1 
ATOM   1845 C C   . HIS A 1 259 ? 11.130  -17.660 47.741  1.00 30.87 ? 254  HIS A C   1 
ATOM   1846 O O   . HIS A 1 259 ? 10.254  -18.406 48.133  1.00 30.09 ? 254  HIS A O   1 
ATOM   1847 C CB  . HIS A 1 259 ? 10.301  -15.347 47.485  1.00 31.32 ? 254  HIS A CB  1 
ATOM   1848 C CG  . HIS A 1 259 ? 10.404  -14.048 46.742  1.00 34.04 ? 254  HIS A CG  1 
ATOM   1849 N ND1 . HIS A 1 259 ? 9.823   -13.848 45.515  1.00 31.52 ? 254  HIS A ND1 1 
ATOM   1850 C CD2 . HIS A 1 259 ? 11.006  -12.876 47.066  1.00 31.79 ? 254  HIS A CD2 1 
ATOM   1851 C CE1 . HIS A 1 259 ? 10.059  -12.610 45.110  1.00 34.39 ? 254  HIS A CE1 1 
ATOM   1852 N NE2 . HIS A 1 259 ? 10.782  -12.005 46.032  1.00 34.61 ? 254  HIS A NE2 1 
ATOM   1853 N N   . MET A 1 260 ? 12.364  -17.719 48.206  1.00 30.65 ? 255  MET A N   1 
ATOM   1854 C CA  . MET A 1 260 ? 12.618  -18.433 49.453  1.00 31.65 ? 255  MET A CA  1 
ATOM   1855 C C   . MET A 1 260 ? 12.199  -17.488 50.593  1.00 30.37 ? 255  MET A C   1 
ATOM   1856 O O   . MET A 1 260 ? 12.860  -16.478 50.824  1.00 30.09 ? 255  MET A O   1 
ATOM   1857 C CB  . MET A 1 260 ? 14.099  -18.797 49.557  1.00 29.81 ? 255  MET A CB  1 
ATOM   1858 C CG  . MET A 1 260 ? 14.513  -19.374 50.882  1.00 30.47 ? 255  MET A CG  1 
ATOM   1859 S SD  . MET A 1 260 ? 16.299  -19.739 50.878  1.00 37.34 ? 255  MET A SD  1 
ATOM   1860 N N   . LEU A 1 261 ? 11.116  -17.804 51.304  1.00 30.07 ? 256  LEU A N   1 
ATOM   1861 C CA  . LEU A 1 261 ? 10.628  -16.919 52.356  1.00 30.22 ? 256  LEU A CA  1 
ATOM   1862 C C   . LEU A 1 261 ? 11.219  -17.225 53.725  1.00 31.17 ? 256  LEU A C   1 
ATOM   1863 O O   . LEU A 1 261 ? 11.194  -18.388 54.184  1.00 31.43 ? 256  LEU A O   1 
ATOM   1864 C CB  . LEU A 1 261 ? 9.087   -16.937 52.405  1.00 29.53 ? 256  LEU A CB  1 
ATOM   1865 C CG  . LEU A 1 261 ? 8.378   -16.514 51.113  1.00 30.23 ? 256  LEU A CG  1 
ATOM   1866 C CD1 . LEU A 1 261 ? 6.953   -16.976 51.158  1.00 33.84 ? 256  LEU A CD1 1 
ATOM   1867 C CD2 . LEU A 1 261 ? 8.493   -14.964 50.854  1.00 30.97 ? 256  LEU A CD2 1 
ATOM   1868 N N   . ILE A 1 262 ? 11.740  -16.193 54.401  1.00 31.17 ? 257  ILE A N   1 
ATOM   1869 C CA  . ILE A 1 262 ? 12.333  -16.436 55.707  1.00 30.74 ? 257  ILE A CA  1 
ATOM   1870 C C   . ILE A 1 262 ? 11.692  -15.517 56.726  1.00 32.13 ? 257  ILE A C   1 
ATOM   1871 O O   . ILE A 1 262 ? 11.921  -14.282 56.715  1.00 31.83 ? 257  ILE A O   1 
ATOM   1872 C CB  . ILE A 1 262 ? 13.911  -16.287 55.720  1.00 31.26 ? 257  ILE A CB  1 
ATOM   1873 C CG1 . ILE A 1 262 ? 14.506  -17.115 54.581  1.00 28.81 ? 257  ILE A CG1 1 
ATOM   1874 C CG2 . ILE A 1 262 ? 14.504  -16.665 57.118  1.00 29.99 ? 257  ILE A CG2 1 
ATOM   1875 C CD1 . ILE A 1 262 ? 16.031  -16.916 54.378  1.00 29.19 ? 257  ILE A CD1 1 
ATOM   1876 N N   . PRO A 1 263 ? 10.882  -16.106 57.621  1.00 31.35 ? 258  PRO A N   1 
ATOM   1877 C CA  . PRO A 1 263 ? 10.344  -15.293 58.716  1.00 31.23 ? 258  PRO A CA  1 
ATOM   1878 C C   . PRO A 1 263 ? 11.414  -14.921 59.768  1.00 30.15 ? 258  PRO A C   1 
ATOM   1879 O O   . PRO A 1 263 ? 12.103  -15.779 60.374  1.00 27.40 ? 258  PRO A O   1 
ATOM   1880 C CB  . PRO A 1 263 ? 9.213   -16.154 59.299  1.00 31.40 ? 258  PRO A CB  1 
ATOM   1881 C CG  . PRO A 1 263 ? 9.521   -17.529 58.889  1.00 32.66 ? 258  PRO A CG  1 
ATOM   1882 C CD  . PRO A 1 263 ? 10.431  -17.506 57.666  1.00 32.52 ? 258  PRO A CD  1 
ATOM   1883 N N   . VAL A 1 264 ? 11.523  -13.621 59.992  1.00 29.76 ? 259  VAL A N   1 
ATOM   1884 C CA  . VAL A 1 264 ? 12.459  -13.111 60.971  1.00 28.65 ? 259  VAL A CA  1 
ATOM   1885 C C   . VAL A 1 264 ? 11.773  -12.167 61.964  1.00 28.49 ? 259  VAL A C   1 
ATOM   1886 O O   . VAL A 1 264 ? 11.193  -11.200 61.562  1.00 26.94 ? 259  VAL A O   1 
ATOM   1887 C CB  . VAL A 1 264 ? 13.600  -12.416 60.227  1.00 28.81 ? 259  VAL A CB  1 
ATOM   1888 C CG1 . VAL A 1 264 ? 14.613  -11.802 61.201  1.00 29.03 ? 259  VAL A CG1 1 
ATOM   1889 C CG2 . VAL A 1 264 ? 14.277  -13.445 59.182  1.00 27.88 ? 259  VAL A CG2 1 
ATOM   1890 N N   . SER A 1 265 ? 11.869  -12.481 63.253  1.00 28.52 ? 260  SER A N   1 
ATOM   1891 C CA  . SER A 1 265 ? 11.313  -11.661 64.321  1.00 30.04 ? 260  SER A CA  1 
ATOM   1892 C C   . SER A 1 265 ? 12.145  -10.448 64.641  1.00 29.34 ? 260  SER A C   1 
ATOM   1893 O O   . SER A 1 265 ? 13.388  -10.526 64.673  1.00 27.94 ? 260  SER A O   1 
ATOM   1894 C CB  . SER A 1 265 ? 11.262  -12.478 65.601  1.00 31.41 ? 260  SER A CB  1 
ATOM   1895 O OG  . SER A 1 265 ? 10.542  -13.681 65.433  1.00 35.93 ? 260  SER A OG  1 
ATOM   1896 N N   . MET A 1 266 ? 11.481  -9.342  64.982  1.00 28.66 ? 261  MET A N   1 
ATOM   1897 C CA  . MET A 1 266 ? 12.212  -8.120  65.310  1.00 29.24 ? 261  MET A CA  1 
ATOM   1898 C C   . MET A 1 266 ? 11.355  -7.305  66.281  1.00 30.26 ? 261  MET A C   1 
ATOM   1899 O O   . MET A 1 266 ? 11.430  -6.090  66.355  1.00 28.62 ? 261  MET A O   1 
ATOM   1900 C CB  . MET A 1 266 ? 12.523  -7.335  63.997  1.00 30.50 ? 261  MET A CB  1 
ATOM   1901 C CG  . MET A 1 266 ? 13.556  -6.165  64.145  1.00 31.02 ? 261  MET A CG  1 
ATOM   1902 S SD  . MET A 1 266 ? 15.165  -6.763  64.634  1.00 39.59 ? 261  MET A SD  1 
ATOM   1903 C CE  . MET A 1 266 ? 15.369  -8.130  63.477  1.00 30.71 ? 261  MET A CE  1 
ATOM   1904 N N   . SER A 1 267 ? 10.507  -8.018  67.007  1.00 30.42 ? 262  SER A N   1 
ATOM   1905 C CA  . SER A 1 267 ? 9.530   -7.427  67.895  1.00 30.98 ? 262  SER A CA  1 
ATOM   1906 C C   . SER A 1 267 ? 10.154  -6.495  68.979  1.00 30.48 ? 262  SER A C   1 
ATOM   1907 O O   . SER A 1 267 ? 9.575   -5.445  69.319  1.00 29.13 ? 262  SER A O   1 
ATOM   1908 C CB  . SER A 1 267 ? 8.645   -8.534  68.502  1.00 29.88 ? 262  SER A CB  1 
ATOM   1909 O OG  . SER A 1 267 ? 9.392   -9.442  69.325  1.00 35.14 ? 262  SER A OG  1 
ATOM   1910 N N   . GLU A 1 268 ? 11.296  -6.885  69.522  1.00 29.27 ? 263  GLU A N   1 
ATOM   1911 C CA  . GLU A 1 268 ? 11.868  -6.096  70.626  1.00 29.34 ? 263  GLU A CA  1 
ATOM   1912 C C   . GLU A 1 268 ? 12.489  -4.847  70.071  1.00 29.19 ? 263  GLU A C   1 
ATOM   1913 O O   . GLU A 1 268 ? 12.306  -3.786  70.652  1.00 28.66 ? 263  GLU A O   1 
ATOM   1914 C CB  . GLU A 1 268 ? 12.910  -6.868  71.446  1.00 29.51 ? 263  GLU A CB  1 
ATOM   1915 C CG  . GLU A 1 268 ? 12.287  -7.956  72.320  1.00 28.60 ? 263  GLU A CG  1 
ATOM   1916 C CD  . GLU A 1 268 ? 11.328  -7.455  73.367  1.00 31.66 ? 263  GLU A CD  1 
ATOM   1917 O OE1 . GLU A 1 268 ? 11.459  -6.302  73.888  1.00 35.33 ? 263  GLU A OE1 1 
ATOM   1918 O OE2 . GLU A 1 268 ? 10.407  -8.248  73.700  1.00 35.79 ? 263  GLU A OE2 1 
ATOM   1919 N N   . LEU A 1 269 ? 13.271  -4.956  68.984  1.00 29.62 ? 264  LEU A N   1 
ATOM   1920 C CA  . LEU A 1 269 ? 13.949  -3.744  68.443  1.00 29.25 ? 264  LEU A CA  1 
ATOM   1921 C C   . LEU A 1 269 ? 12.902  -2.832  67.829  1.00 29.31 ? 264  LEU A C   1 
ATOM   1922 O O   . LEU A 1 269 ? 13.085  -1.611  67.708  1.00 28.93 ? 264  LEU A O   1 
ATOM   1923 C CB  . LEU A 1 269 ? 15.043  -4.097  67.411  1.00 30.34 ? 264  LEU A CB  1 
ATOM   1924 C CG  . LEU A 1 269 ? 16.323  -4.706  68.059  1.00 30.68 ? 264  LEU A CG  1 
ATOM   1925 C CD1 . LEU A 1 269 ? 17.416  -4.770  67.066  1.00 32.04 ? 264  LEU A CD1 1 
ATOM   1926 C CD2 . LEU A 1 269 ? 16.824  -3.907  69.303  1.00 29.45 ? 264  LEU A CD2 1 
ATOM   1927 N N   . GLU A 1 270 ? 11.806  -3.413  67.392  1.00 27.93 ? 265  GLU A N   1 
ATOM   1928 C CA  . GLU A 1 270 ? 10.651  -2.558  66.970  1.00 27.39 ? 265  GLU A CA  1 
ATOM   1929 C C   . GLU A 1 270 ? 10.164  -1.502  67.974  1.00 26.38 ? 265  GLU A C   1 
ATOM   1930 O O   . GLU A 1 270 ? 9.686   -0.432  67.579  1.00 27.53 ? 265  GLU A O   1 
ATOM   1931 C CB  . GLU A 1 270 ? 9.502   -3.454  66.517  1.00 27.01 ? 265  GLU A CB  1 
ATOM   1932 C CG  . GLU A 1 270 ? 8.172   -2.650  66.181  1.00 30.70 ? 265  GLU A CG  1 
ATOM   1933 C CD  . GLU A 1 270 ? 7.124   -3.507  65.514  1.00 31.72 ? 265  GLU A CD  1 
ATOM   1934 O OE1 . GLU A 1 270 ? 7.473   -4.435  64.816  1.00 34.13 ? 265  GLU A OE1 1 
ATOM   1935 O OE2 . GLU A 1 270 ? 5.923   -3.208  65.657  1.00 47.10 ? 265  GLU A OE2 1 
ATOM   1936 N N   . LYS A 1 271 ? 10.238  -1.799  69.268  1.00 25.72 ? 266  LYS A N   1 
ATOM   1937 C CA  . LYS A 1 271 ? 9.902   -0.835  70.325  1.00 25.95 ? 266  LYS A CA  1 
ATOM   1938 C C   . LYS A 1 271 ? 10.764  0.454   70.296  1.00 28.06 ? 266  LYS A C   1 
ATOM   1939 O O   . LYS A 1 271 ? 10.358  1.495   70.809  1.00 26.80 ? 266  LYS A O   1 
ATOM   1940 C CB  . LYS A 1 271 ? 10.067  -1.499  71.707  1.00 26.75 ? 266  LYS A CB  1 
ATOM   1941 C CG  . LYS A 1 271 ? 9.165   -2.711  71.882  1.00 25.56 ? 266  LYS A CG  1 
ATOM   1942 C CD  . LYS A 1 271 ? 9.401   -3.491  73.194  1.00 24.78 ? 266  LYS A CD  1 
ATOM   1943 C CE  . LYS A 1 271 ? 8.574   -4.774  73.239  1.00 20.32 ? 266  LYS A CE  1 
ATOM   1944 N NZ  . LYS A 1 271 ? 8.911   -5.446  74.597  1.00 24.89 ? 266  LYS A NZ  1 
ATOM   1945 N N   . VAL A 1 272 ? 11.985  0.372   69.771  1.00 27.35 ? 267  VAL A N   1 
ATOM   1946 C CA  . VAL A 1 272 ? 12.736  1.612   69.560  1.00 27.62 ? 267  VAL A CA  1 
ATOM   1947 C C   . VAL A 1 272 ? 12.861  1.893   68.035  1.00 29.10 ? 267  VAL A C   1 
ATOM   1948 O O   . VAL A 1 272 ? 13.882  2.402   67.563  1.00 29.00 ? 267  VAL A O   1 
ATOM   1949 C CB  . VAL A 1 272 ? 14.095  1.573   70.259  1.00 28.59 ? 267  VAL A CB  1 
ATOM   1950 C CG1 . VAL A 1 272 ? 13.886  1.482   71.818  1.00 24.29 ? 267  VAL A CG1 1 
ATOM   1951 C CG2 . VAL A 1 272 ? 14.919  0.396   69.719  1.00 26.21 ? 267  VAL A CG2 1 
ATOM   1952 N N   . ASP A 1 273 ? 11.804  1.526   67.317  1.00 29.82 ? 268  ASP A N   1 
ATOM   1953 C CA  A ASP A 1 273 ? 11.596  1.813   65.885  0.50 30.21 ? 268  ASP A CA  1 
ATOM   1954 C CA  B ASP A 1 273 ? 11.617  1.814   65.870  0.50 30.48 ? 268  ASP A CA  1 
ATOM   1955 C C   . ASP A 1 273 ? 12.634  1.127   64.971  1.00 30.31 ? 268  ASP A C   1 
ATOM   1956 O O   . ASP A 1 273 ? 12.968  1.623   63.880  1.00 28.38 ? 268  ASP A O   1 
ATOM   1957 C CB  A ASP A 1 273 ? 11.483  3.328   65.660  0.50 30.43 ? 268  ASP A CB  1 
ATOM   1958 C CB  B ASP A 1 273 ? 11.600  3.315   65.576  0.50 31.20 ? 268  ASP A CB  1 
ATOM   1959 C CG  A ASP A 1 273 ? 10.980  3.688   64.284  0.50 33.05 ? 268  ASP A CG  1 
ATOM   1960 C CG  B ASP A 1 273 ? 10.480  4.026   66.269  0.50 34.14 ? 268  ASP A CG  1 
ATOM   1961 O OD1 A ASP A 1 273 ? 10.279  2.864   63.624  0.50 34.91 ? 268  ASP A OD1 1 
ATOM   1962 O OD1 B ASP A 1 273 ? 9.332   3.505   66.284  0.50 38.47 ? 268  ASP A OD1 1 
ATOM   1963 O OD2 A ASP A 1 273 ? 11.316  4.814   63.844  0.50 34.55 ? 268  ASP A OD2 1 
ATOM   1964 O OD2 B ASP A 1 273 ? 10.746  5.135   66.801  0.50 42.19 ? 268  ASP A OD2 1 
ATOM   1965 N N   . GLY A 1 274 ? 13.094  -0.041  65.405  1.00 29.72 ? 269  GLY A N   1 
ATOM   1966 C CA  . GLY A 1 274 ? 14.087  -0.777  64.630  1.00 29.73 ? 269  GLY A CA  1 
ATOM   1967 C C   . GLY A 1 274 ? 13.402  -1.919  63.881  1.00 29.34 ? 269  GLY A C   1 
ATOM   1968 O O   . GLY A 1 274 ? 12.889  -2.860  64.500  1.00 29.18 ? 269  GLY A O   1 
ATOM   1969 N N   . LEU A 1 275 ? 13.411  -1.824  62.563  1.00 28.13 ? 270  LEU A N   1 
ATOM   1970 C CA  . LEU A 1 275 ? 12.768  -2.813  61.668  1.00 29.16 ? 270  LEU A CA  1 
ATOM   1971 C C   . LEU A 1 275 ? 13.843  -3.654  60.965  1.00 29.38 ? 270  LEU A C   1 
ATOM   1972 O O   . LEU A 1 275 ? 14.991  -3.663  61.383  1.00 29.04 ? 270  LEU A O   1 
ATOM   1973 C CB  . LEU A 1 275 ? 11.853  -2.091  60.646  1.00 29.00 ? 270  LEU A CB  1 
ATOM   1974 C CG  . LEU A 1 275 ? 10.890  -1.010  61.229  1.00 30.65 ? 270  LEU A CG  1 
ATOM   1975 C CD1 . LEU A 1 275 ? 9.873   -0.572  60.182  1.00 29.70 ? 270  LEU A CD1 1 
ATOM   1976 C CD2 . LEU A 1 275 ? 10.244  -1.590  62.454  1.00 29.20 ? 270  LEU A CD2 1 
ATOM   1977 N N   . LEU A 1 276 ? 13.475  -4.442  59.948  1.00 29.41 ? 271  LEU A N   1 
ATOM   1978 C CA  . LEU A 1 276 ? 14.471  -5.381  59.387  1.00 27.22 ? 271  LEU A CA  1 
ATOM   1979 C C   . LEU A 1 276 ? 15.619  -4.722  58.655  1.00 27.98 ? 271  LEU A C   1 
ATOM   1980 O O   . LEU A 1 276 ? 16.772  -5.132  58.822  1.00 29.39 ? 271  LEU A O   1 
ATOM   1981 C CB  . LEU A 1 276 ? 13.802  -6.421  58.459  1.00 26.16 ? 271  LEU A CB  1 
ATOM   1982 C CG  . LEU A 1 276 ? 12.841  -7.343  59.220  1.00 27.99 ? 271  LEU A CG  1 
ATOM   1983 C CD1 . LEU A 1 276 ? 12.023  -8.274  58.251  1.00 26.79 ? 271  LEU A CD1 1 
ATOM   1984 C CD2 . LEU A 1 276 ? 13.664  -8.204  60.162  1.00 33.31 ? 271  LEU A CD2 1 
ATOM   1985 N N   . THR A 1 277 ? 15.328  -3.731  57.793  1.00 26.58 ? 272  THR A N   1 
ATOM   1986 C CA  . THR A 1 277 ? 16.378  -3.138  57.003  1.00 27.73 ? 272  THR A CA  1 
ATOM   1987 C C   . THR A 1 277 ? 17.377  -2.369  57.824  1.00 27.79 ? 272  THR A C   1 
ATOM   1988 O O   . THR A 1 277 ? 18.569  -2.321  57.448  1.00 28.51 ? 272  THR A O   1 
ATOM   1989 C CB  . THR A 1 277 ? 15.813  -2.188  55.873  1.00 27.03 ? 272  THR A CB  1 
ATOM   1990 O OG1 . THR A 1 277 ? 15.140  -1.064  56.489  1.00 28.46 ? 272  THR A OG1 1 
ATOM   1991 C CG2 . THR A 1 277 ? 14.837  -3.007  54.956  1.00 26.31 ? 272  THR A CG2 1 
ATOM   1992 N N   . CYS A 1 278 ? 16.904  -1.837  58.950  1.00 28.12 ? 273  CYS A N   1 
ATOM   1993 C CA  . CYS A 1 278 ? 17.702  -1.018  59.855  1.00 29.22 ? 273  CYS A CA  1 
ATOM   1994 C C   . CYS A 1 278 ? 18.991  -1.676  60.351  1.00 29.18 ? 273  CYS A C   1 
ATOM   1995 O O   . CYS A 1 278 ? 19.941  -0.986  60.627  1.00 28.03 ? 273  CYS A O   1 
ATOM   1996 C CB  . CYS A 1 278 ? 16.922  -0.636  61.065  1.00 29.96 ? 273  CYS A CB  1 
ATOM   1997 S SG  . CYS A 1 278 ? 15.324  0.137   60.679  1.00 34.98 ? 273  CYS A SG  1 
ATOM   1998 N N   . CYS A 1 279 ? 18.980  -2.993  60.459  1.00 28.57 ? 274  CYS A N   1 
ATOM   1999 C CA  . CYS A 1 279 ? 20.023  -3.747  61.137  1.00 28.86 ? 274  CYS A CA  1 
ATOM   2000 C C   . CYS A 1 279 ? 21.141  -4.244  60.240  1.00 28.50 ? 274  CYS A C   1 
ATOM   2001 O O   . CYS A 1 279 ? 22.037  -4.942  60.725  1.00 29.04 ? 274  CYS A O   1 
ATOM   2002 C CB  . CYS A 1 279 ? 19.442  -4.911  61.961  1.00 29.44 ? 274  CYS A CB  1 
ATOM   2003 S SG  . CYS A 1 279 ? 18.402  -4.333  63.372  1.00 32.45 ? 274  CYS A SG  1 
ATOM   2004 N N   . SER A 1 280 ? 21.157  -3.895  58.947  1.00 28.00 ? 275  SER A N   1 
ATOM   2005 C CA  . SER A 1 280 ? 22.360  -4.290  58.157  1.00 28.75 ? 275  SER A CA  1 
ATOM   2006 C C   . SER A 1 280 ? 22.567  -3.314  57.036  1.00 29.01 ? 275  SER A C   1 
ATOM   2007 O O   . SER A 1 280 ? 21.627  -2.595  56.672  1.00 27.58 ? 275  SER A O   1 
ATOM   2008 C CB  . SER A 1 280 ? 22.176  -5.673  57.520  1.00 28.52 ? 275  SER A CB  1 
ATOM   2009 O OG  . SER A 1 280 ? 20.950  -5.748  56.831  1.00 29.00 ? 275  SER A OG  1 
ATOM   2010 N N   . VAL A 1 281 ? 23.827  -3.234  56.575  1.00 29.00 ? 276  VAL A N   1 
ATOM   2011 C CA  . VAL A 1 281 ? 24.176  -2.584  55.314  1.00 28.21 ? 276  VAL A CA  1 
ATOM   2012 C C   . VAL A 1 281 ? 24.655  -3.707  54.413  1.00 29.61 ? 276  VAL A C   1 
ATOM   2013 O O   . VAL A 1 281 ? 25.491  -4.519  54.828  1.00 29.57 ? 276  VAL A O   1 
ATOM   2014 C CB  . VAL A 1 281 ? 25.265  -1.497  55.493  1.00 27.79 ? 276  VAL A CB  1 
ATOM   2015 C CG1 . VAL A 1 281 ? 25.528  -0.838  54.186  1.00 27.93 ? 276  VAL A CG1 1 
ATOM   2016 C CG2 . VAL A 1 281 ? 24.791  -0.417  56.517  1.00 27.44 ? 276  VAL A CG2 1 
ATOM   2017 N N   . LEU A 1 282 ? 24.125  -3.783  53.199  1.00 29.54 ? 277  LEU A N   1 
ATOM   2018 C CA  . LEU A 1 282 ? 24.448  -4.912  52.288  1.00 29.63 ? 277  LEU A CA  1 
ATOM   2019 C C   . LEU A 1 282 ? 25.327  -4.415  51.189  1.00 30.06 ? 277  LEU A C   1 
ATOM   2020 O O   . LEU A 1 282 ? 25.117  -3.315  50.680  1.00 30.27 ? 277  LEU A O   1 
ATOM   2021 C CB  . LEU A 1 282 ? 23.140  -5.468  51.664  1.00 30.14 ? 277  LEU A CB  1 
ATOM   2022 C CG  . LEU A 1 282 ? 22.143  -5.965  52.705  1.00 31.78 ? 277  LEU A CG  1 
ATOM   2023 C CD1 . LEU A 1 282 ? 20.718  -6.377  52.147  1.00 35.15 ? 277  LEU A CD1 1 
ATOM   2024 C CD2 . LEU A 1 282 ? 22.721  -7.096  53.538  1.00 31.09 ? 277  LEU A CD2 1 
ATOM   2025 N N   . ILE A 1 283 ? 26.284  -5.241  50.778  1.00 29.63 ? 278  ILE A N   1 
ATOM   2026 C CA  . ILE A 1 283 ? 27.300  -4.844  49.856  1.00 30.27 ? 278  ILE A CA  1 
ATOM   2027 C C   . ILE A 1 283 ? 27.521  -5.967  48.836  1.00 29.14 ? 278  ILE A C   1 
ATOM   2028 O O   . ILE A 1 283 ? 27.534  -7.133  49.197  1.00 28.33 ? 278  ILE A O   1 
ATOM   2029 C CB  . ILE A 1 283 ? 28.600  -4.496  50.638  1.00 29.11 ? 278  ILE A CB  1 
ATOM   2030 C CG1 . ILE A 1 283 ? 28.347  -3.323  51.617  1.00 31.29 ? 278  ILE A CG1 1 
ATOM   2031 C CG2 . ILE A 1 283 ? 29.786  -4.195  49.674  1.00 31.60 ? 278  ILE A CG2 1 
ATOM   2032 C CD1 . ILE A 1 283 ? 28.920  -3.524  53.005  1.00 31.51 ? 278  ILE A CD1 1 
ATOM   2033 N N   . ASN A 1 284 ? 27.633  -5.609  47.561  1.00 29.60 ? 279  ASN A N   1 
ATOM   2034 C CA  . ASN A 1 284 ? 28.008  -6.569  46.513  1.00 31.29 ? 279  ASN A CA  1 
ATOM   2035 C C   . ASN A 1 284 ? 29.494  -6.375  46.108  1.00 33.61 ? 279  ASN A C   1 
ATOM   2036 O O   . ASN A 1 284 ? 29.828  -5.415  45.420  1.00 33.76 ? 279  ASN A O   1 
ATOM   2037 C CB  . ASN A 1 284 ? 27.148  -6.351  45.280  1.00 30.20 ? 279  ASN A CB  1 
ATOM   2038 C CG  . ASN A 1 284 ? 27.163  -7.503  44.374  1.00 29.19 ? 279  ASN A CG  1 
ATOM   2039 O OD1 . ASN A 1 284 ? 27.248  -8.638  44.824  1.00 32.60 ? 279  ASN A OD1 1 
ATOM   2040 N ND2 . ASN A 1 284 ? 27.086  -7.248  43.072  1.00 31.64 ? 279  ASN A ND2 1 
ATOM   2041 N N   . LYS A 1 285 ? 30.365  -7.286  46.495  1.00 36.07 ? 280  LYS A N   1 
ATOM   2042 C CA  . LYS A 1 285 ? 31.807  -7.082  46.262  1.00 39.27 ? 280  LYS A CA  1 
ATOM   2043 C C   . LYS A 1 285 ? 32.258  -7.963  45.064  1.00 40.15 ? 280  LYS A C   1 
ATOM   2044 O O   . LYS A 1 285 ? 31.932  -9.145  44.991  1.00 41.32 ? 280  LYS A O   1 
ATOM   2045 C CB  . LYS A 1 285 ? 32.566  -7.298  47.610  1.00 38.61 ? 280  LYS A CB  1 
ATOM   2046 C CG  . LYS A 1 285 ? 34.134  -7.188  47.639  1.00 39.39 ? 280  LYS A CG  1 
ATOM   2047 C CD  . LYS A 1 285 ? 34.698  -6.955  49.108  1.00 40.09 ? 280  LYS A CD  1 
ATOM   2048 C CE  . LYS A 1 285 ? 36.250  -6.835  49.101  1.00 43.89 ? 280  LYS A CE  1 
ATOM   2049 N NZ  . LYS A 1 285 ? 36.994  -7.305  50.355  1.00 45.05 ? 280  LYS A NZ  1 
ATOM   2050 N N   . LYS A 1 286 ? 32.932  -7.384  44.071  1.00 42.70 ? 281  LYS A N   1 
ATOM   2051 C CA  . LYS A 1 286 ? 33.661  -8.230  43.062  1.00 42.90 ? 281  LYS A CA  1 
ATOM   2052 C C   . LYS A 1 286 ? 34.380  -9.439  43.711  1.00 43.69 ? 281  LYS A C   1 
ATOM   2053 O O   . LYS A 1 286 ? 35.613  -9.606  43.623  1.00 44.28 ? 281  LYS A O   1 
ATOM   2054 C CB  . LYS A 1 286 ? 34.635  -7.396  42.255  1.00 42.72 ? 281  LYS A CB  1 
ATOM   2055 N N   . GLY B 1 1   ? 10.647  16.026  44.450  1.00 33.49 ? -4   GLY B N   1 
ATOM   2056 C CA  . GLY B 1 1   ? 10.978  15.814  43.031  1.00 34.17 ? -4   GLY B CA  1 
ATOM   2057 C C   . GLY B 1 1   ? 12.399  15.341  42.799  1.00 36.08 ? -4   GLY B C   1 
ATOM   2058 O O   . GLY B 1 1   ? 13.132  15.056  43.771  1.00 34.01 ? -4   GLY B O   1 
ATOM   2059 N N   . PRO B 1 2   ? 12.778  15.243  41.505  1.00 37.17 ? -3   PRO B N   1 
ATOM   2060 C CA  . PRO B 1 2   ? 14.076  14.836  41.006  1.00 38.62 ? -3   PRO B CA  1 
ATOM   2061 C C   . PRO B 1 2   ? 15.189  15.779  41.384  1.00 39.48 ? -3   PRO B C   1 
ATOM   2062 O O   . PRO B 1 2   ? 15.032  17.000  41.363  1.00 39.63 ? -3   PRO B O   1 
ATOM   2063 C CB  . PRO B 1 2   ? 13.892  14.800  39.479  1.00 39.42 ? -3   PRO B CB  1 
ATOM   2064 C CG  . PRO B 1 2   ? 12.693  15.620  39.199  1.00 38.10 ? -3   PRO B CG  1 
ATOM   2065 C CD  . PRO B 1 2   ? 11.831  15.538  40.405  1.00 38.35 ? -3   PRO B CD  1 
ATOM   2066 N N   . LEU B 1 3   ? 16.311  15.184  41.744  1.00 40.25 ? -2   LEU B N   1 
ATOM   2067 C CA  . LEU B 1 3   ? 17.529  15.900  42.002  1.00 41.53 ? -2   LEU B CA  1 
ATOM   2068 C C   . LEU B 1 3   ? 18.561  15.308  41.105  1.00 43.18 ? -2   LEU B C   1 
ATOM   2069 O O   . LEU B 1 3   ? 18.437  14.148  40.651  1.00 43.27 ? -2   LEU B O   1 
ATOM   2070 C CB  . LEU B 1 3   ? 18.002  15.692  43.440  1.00 40.85 ? -2   LEU B CB  1 
ATOM   2071 C CG  . LEU B 1 3   ? 17.098  16.181  44.562  1.00 40.88 ? -2   LEU B CG  1 
ATOM   2072 C CD1 . LEU B 1 3   ? 17.505  15.507  45.864  1.00 37.72 ? -2   LEU B CD1 1 
ATOM   2073 C CD2 . LEU B 1 3   ? 17.160  17.697  44.671  1.00 40.84 ? -2   LEU B CD2 1 
ATOM   2074 N N   . GLY B 1 4   ? 19.610  16.093  40.879  1.00 44.79 ? -1   GLY B N   1 
ATOM   2075 C CA  . GLY B 1 4   ? 20.765  15.612  40.142  1.00 46.38 ? -1   GLY B CA  1 
ATOM   2076 C C   . GLY B 1 4   ? 20.416  15.658  38.673  1.00 47.16 ? -1   GLY B C   1 
ATOM   2077 O O   . GLY B 1 4   ? 19.470  16.359  38.277  1.00 47.25 ? -1   GLY B O   1 
ATOM   2078 N N   . MET B 1 5   ? 21.151  14.883  37.880  1.00 47.73 ? 0    MET B N   1 
ATOM   2079 C CA  . MET B 1 5   ? 21.082  14.964  36.423  1.00 48.98 ? 0    MET B CA  1 
ATOM   2080 C C   . MET B 1 5   ? 20.498  13.700  35.754  1.00 49.29 ? 0    MET B C   1 
ATOM   2081 O O   . MET B 1 5   ? 19.747  13.797  34.760  1.00 50.59 ? 0    MET B O   1 
ATOM   2082 C CB  . MET B 1 5   ? 22.504  15.243  35.895  1.00 48.41 ? 0    MET B CB  1 
ATOM   2083 N N   . ALA B 1 6   ? 20.817  12.540  36.347  1.00 48.77 ? 1    ALA B N   1 
ATOM   2084 C CA  . ALA B 1 6   ? 20.826  11.226  35.696  1.00 47.88 ? 1    ALA B CA  1 
ATOM   2085 C C   . ALA B 1 6   ? 19.473  10.647  35.285  1.00 47.28 ? 1    ALA B C   1 
ATOM   2086 O O   . ALA B 1 6   ? 18.423  11.135  35.670  1.00 47.40 ? 1    ALA B O   1 
ATOM   2087 C CB  . ALA B 1 6   ? 21.551  10.235  36.592  1.00 47.74 ? 1    ALA B CB  1 
ATOM   2088 N N   . GLY B 1 7   ? 19.519  9.562   34.521  1.00 46.76 ? 2    GLY B N   1 
ATOM   2089 C CA  . GLY B 1 7   ? 18.303  8.947   34.007  1.00 45.61 ? 2    GLY B CA  1 
ATOM   2090 C C   . GLY B 1 7   ? 18.036  9.297   32.554  1.00 44.92 ? 2    GLY B C   1 
ATOM   2091 O O   . GLY B 1 7   ? 18.749  10.120  31.963  1.00 45.31 ? 2    GLY B O   1 
ATOM   2092 N N   . LEU B 1 8   ? 17.020  8.651   31.980  1.00 42.93 ? 3    LEU B N   1 
ATOM   2093 C CA  . LEU B 1 8   ? 16.583  8.914   30.614  1.00 41.85 ? 3    LEU B CA  1 
ATOM   2094 C C   . LEU B 1 8   ? 15.652  10.109  30.594  1.00 40.61 ? 3    LEU B C   1 
ATOM   2095 O O   . LEU B 1 8   ? 15.414  10.696  29.537  1.00 41.15 ? 3    LEU B O   1 
ATOM   2096 C CB  . LEU B 1 8   ? 15.855  7.692   30.036  1.00 41.70 ? 3    LEU B CB  1 
ATOM   2097 C CG  . LEU B 1 8   ? 16.566  6.336   30.041  1.00 42.01 ? 3    LEU B CG  1 
ATOM   2098 C CD1 . LEU B 1 8   ? 15.713  5.238   29.419  1.00 39.98 ? 3    LEU B CD1 1 
ATOM   2099 C CD2 . LEU B 1 8   ? 17.908  6.458   29.300  1.00 42.50 ? 3    LEU B CD2 1 
ATOM   2100 N N   . GLY B 1 9   ? 15.133  10.471  31.764  1.00 38.77 ? 4    GLY B N   1 
ATOM   2101 C CA  . GLY B 1 9   ? 14.134  11.525  31.898  1.00 37.56 ? 4    GLY B CA  1 
ATOM   2102 C C   . GLY B 1 9   ? 13.028  11.172  32.889  1.00 36.11 ? 4    GLY B C   1 
ATOM   2103 O O   . GLY B 1 9   ? 13.124  10.162  33.616  1.00 36.02 ? 4    GLY B O   1 
ATOM   2104 N N   . HIS B 1 10  ? 11.995  12.013  32.928  1.00 35.46 ? 5    HIS B N   1 
ATOM   2105 C CA  . HIS B 1 10  ? 10.946  11.948  33.913  1.00 35.30 ? 5    HIS B CA  1 
ATOM   2106 C C   . HIS B 1 10  ? 9.898   12.985  33.543  1.00 36.63 ? 5    HIS B C   1 
ATOM   2107 O O   . HIS B 1 10  ? 10.154  13.818  32.681  1.00 37.98 ? 5    HIS B O   1 
ATOM   2108 C CB  . HIS B 1 10  ? 11.496  12.229  35.314  1.00 35.56 ? 5    HIS B CB  1 
ATOM   2109 C CG  . HIS B 1 10  ? 12.305  13.481  35.407  1.00 34.58 ? 5    HIS B CG  1 
ATOM   2110 N ND1 . HIS B 1 10  ? 11.739  14.713  35.637  1.00 34.29 ? 5    HIS B ND1 1 
ATOM   2111 C CD2 . HIS B 1 10  ? 13.642  13.689  35.307  1.00 35.71 ? 5    HIS B CD2 1 
ATOM   2112 C CE1 . HIS B 1 10  ? 12.688  15.631  35.675  1.00 34.39 ? 5    HIS B CE1 1 
ATOM   2113 N NE2 . HIS B 1 10  ? 13.850  15.038  35.463  1.00 36.72 ? 5    HIS B NE2 1 
ATOM   2114 N N   . PRO B 1 11  ? 8.717   12.941  34.190  1.00 36.54 ? 6    PRO B N   1 
ATOM   2115 C CA  . PRO B 1 11  ? 7.540   13.788  33.917  1.00 36.22 ? 6    PRO B CA  1 
ATOM   2116 C C   . PRO B 1 11  ? 7.763   15.298  33.815  1.00 37.44 ? 6    PRO B C   1 
ATOM   2117 O O   . PRO B 1 11  ? 6.847   16.028  33.395  1.00 37.93 ? 6    PRO B O   1 
ATOM   2118 C CB  . PRO B 1 11  ? 6.607   13.446  35.080  1.00 36.26 ? 6    PRO B CB  1 
ATOM   2119 C CG  . PRO B 1 11  ? 6.884   12.035  35.336  1.00 35.13 ? 6    PRO B CG  1 
ATOM   2120 C CD  . PRO B 1 11  ? 8.414   11.966  35.260  1.00 36.44 ? 6    PRO B CD  1 
ATOM   2121 N N   . ALA B 1 12  ? 8.961   15.751  34.179  1.00 36.89 ? 7    ALA B N   1 
ATOM   2122 C CA  . ALA B 1 12  ? 9.307   17.169  34.204  1.00 36.00 ? 7    ALA B CA  1 
ATOM   2123 C C   . ALA B 1 12  ? 10.694  17.429  33.542  1.00 35.52 ? 7    ALA B C   1 
ATOM   2124 O O   . ALA B 1 12  ? 11.239  18.546  33.643  1.00 35.55 ? 7    ALA B O   1 
ATOM   2125 C CB  . ALA B 1 12  ? 9.286   17.703  35.652  1.00 35.87 ? 7    ALA B CB  1 
ATOM   2126 N N   . ALA B 1 13  ? 11.226  16.416  32.856  1.00 33.45 ? 8    ALA B N   1 
ATOM   2127 C CA  . ALA B 1 13  ? 12.434  16.562  32.071  1.00 32.75 ? 8    ALA B CA  1 
ATOM   2128 C C   . ALA B 1 13  ? 12.195  17.574  30.931  1.00 32.96 ? 8    ALA B C   1 
ATOM   2129 O O   . ALA B 1 13  ? 11.055  17.782  30.489  1.00 31.42 ? 8    ALA B O   1 
ATOM   2130 C CB  . ALA B 1 13  ? 12.865  15.224  31.500  1.00 31.92 ? 8    ALA B CB  1 
ATOM   2131 N N   . PHE B 1 14  ? 13.274  18.226  30.505  1.00 32.68 ? 9    PHE B N   1 
ATOM   2132 C CA  . PHE B 1 14  ? 13.220  19.110  29.363  1.00 34.27 ? 9    PHE B CA  1 
ATOM   2133 C C   . PHE B 1 14  ? 12.827  18.275  28.133  1.00 33.97 ? 9    PHE B C   1 
ATOM   2134 O O   . PHE B 1 14  ? 13.431  17.229  27.884  1.00 33.67 ? 9    PHE B O   1 
ATOM   2135 C CB  . PHE B 1 14  ? 14.577  19.772  29.075  1.00 33.84 ? 9    PHE B CB  1 
ATOM   2136 C CG  . PHE B 1 14  ? 14.622  20.422  27.718  1.00 35.59 ? 9    PHE B CG  1 
ATOM   2137 C CD1 . PHE B 1 14  ? 13.978  21.626  27.516  1.00 37.56 ? 9    PHE B CD1 1 
ATOM   2138 C CD2 . PHE B 1 14  ? 15.201  19.777  26.626  1.00 37.93 ? 9    PHE B CD2 1 
ATOM   2139 C CE1 . PHE B 1 14  ? 13.960  22.223  26.264  1.00 40.66 ? 9    PHE B CE1 1 
ATOM   2140 C CE2 . PHE B 1 14  ? 15.197  20.364  25.370  1.00 39.51 ? 9    PHE B CE2 1 
ATOM   2141 C CZ  . PHE B 1 14  ? 14.562  21.592  25.184  1.00 38.38 ? 9    PHE B CZ  1 
ATOM   2142 N N   . GLY B 1 15  ? 11.827  18.757  27.389  1.00 34.62 ? 10   GLY B N   1 
ATOM   2143 C CA  . GLY B 1 15  ? 11.392  18.135  26.136  1.00 33.55 ? 10   GLY B CA  1 
ATOM   2144 C C   . GLY B 1 15  ? 10.237  17.172  26.330  1.00 33.41 ? 10   GLY B C   1 
ATOM   2145 O O   . GLY B 1 15  ? 9.832   16.465  25.391  1.00 32.60 ? 10   GLY B O   1 
ATOM   2146 N N   . ARG B 1 16  ? 9.728   17.106  27.562  1.00 32.59 ? 11   ARG B N   1 
ATOM   2147 C CA  . ARG B 1 16  ? 8.646   16.199  27.872  1.00 32.24 ? 11   ARG B CA  1 
ATOM   2148 C C   . ARG B 1 16  ? 7.352   16.858  27.454  1.00 31.92 ? 11   ARG B C   1 
ATOM   2149 O O   . ARG B 1 16  ? 7.127   18.025  27.744  1.00 30.99 ? 11   ARG B O   1 
ATOM   2150 C CB  . ARG B 1 16  ? 8.658   15.794  29.367  1.00 31.53 ? 11   ARG B CB  1 
ATOM   2151 C CG  . ARG B 1 16  ? 7.538   14.867  29.812  1.00 31.50 ? 11   ARG B CG  1 
ATOM   2152 C CD  . ARG B 1 16  ? 7.501   13.514  29.093  1.00 28.82 ? 11   ARG B CD  1 
ATOM   2153 N NE  . ARG B 1 16  ? 8.758   12.780  29.238  1.00 30.08 ? 11   ARG B NE  1 
ATOM   2154 C CZ  . ARG B 1 16  ? 8.973   11.912  30.220  1.00 29.35 ? 11   ARG B CZ  1 
ATOM   2155 N NH1 . ARG B 1 16  ? 8.014   11.691  31.093  1.00 29.18 ? 11   ARG B NH1 1 
ATOM   2156 N NH2 . ARG B 1 16  ? 10.116  11.265  30.319  1.00 28.68 ? 11   ARG B NH2 1 
ATOM   2157 N N   . ALA B 1 17  ? 6.526   16.124  26.713  1.00 31.76 ? 12   ALA B N   1 
ATOM   2158 C CA  . ALA B 1 17  ? 5.173   16.605  26.431  1.00 31.99 ? 12   ALA B CA  1 
ATOM   2159 C C   . ALA B 1 17  ? 4.232   15.454  26.572  1.00 32.44 ? 12   ALA B C   1 
ATOM   2160 O O   . ALA B 1 17  ? 4.604   14.320  26.337  1.00 33.40 ? 12   ALA B O   1 
ATOM   2161 C CB  . ALA B 1 17  ? 5.071   17.201  25.023  1.00 32.13 ? 12   ALA B CB  1 
ATOM   2162 N N   . THR B 1 18  ? 3.004   15.757  26.944  1.00 32.83 ? 13   THR B N   1 
ATOM   2163 C CA  . THR B 1 18  ? 1.987   14.754  27.091  1.00 32.43 ? 13   THR B CA  1 
ATOM   2164 C C   . THR B 1 18  ? 1.021   14.847  25.943  1.00 33.28 ? 13   THR B C   1 
ATOM   2165 O O   . THR B 1 18  ? 0.288   13.886  25.648  1.00 31.74 ? 13   THR B O   1 
ATOM   2166 C CB  . THR B 1 18  ? 1.251   14.938  28.400  1.00 33.63 ? 13   THR B CB  1 
ATOM   2167 O OG1 . THR B 1 18  ? 0.800   16.301  28.524  1.00 32.16 ? 13   THR B OG1 1 
ATOM   2168 C CG2 . THR B 1 18  ? 2.177   14.536  29.560  1.00 32.10 ? 13   THR B CG2 1 
ATOM   2169 N N   . HIS B 1 19  ? 1.042   16.009  25.276  1.00 33.88 ? 14   HIS B N   1 
ATOM   2170 C CA  . HIS B 1 19  ? 0.069   16.337  24.255  1.00 35.28 ? 14   HIS B CA  1 
ATOM   2171 C C   . HIS B 1 19  ? 0.767   17.053  23.095  1.00 35.80 ? 14   HIS B C   1 
ATOM   2172 O O   . HIS B 1 19  ? 1.827   17.689  23.283  1.00 34.96 ? 14   HIS B O   1 
ATOM   2173 C CB  . HIS B 1 19  ? -1.015  17.268  24.814  1.00 35.74 ? 14   HIS B CB  1 
ATOM   2174 C CG  . HIS B 1 19  ? -1.986  16.610  25.752  1.00 39.98 ? 14   HIS B CG  1 
ATOM   2175 N ND1 . HIS B 1 19  ? -1.633  16.169  27.011  1.00 41.07 ? 14   HIS B ND1 1 
ATOM   2176 C CD2 . HIS B 1 19  ? -3.316  16.368  25.629  1.00 44.32 ? 14   HIS B CD2 1 
ATOM   2177 C CE1 . HIS B 1 19  ? -2.700  15.670  27.616  1.00 44.38 ? 14   HIS B CE1 1 
ATOM   2178 N NE2 . HIS B 1 19  ? -3.735  15.777  26.799  1.00 44.30 ? 14   HIS B NE2 1 
ATOM   2179 N N   . ALA B 1 20  ? 0.190   16.885  21.903  1.00 35.97 ? 15   ALA B N   1 
ATOM   2180 C CA  . ALA B 1 20  ? 0.471   17.750  20.739  1.00 36.40 ? 15   ALA B CA  1 
ATOM   2181 C C   . ALA B 1 20  ? -0.827  18.304  20.184  1.00 36.89 ? 15   ALA B C   1 
ATOM   2182 O O   . ALA B 1 20  ? -1.830  17.583  20.033  1.00 38.14 ? 15   ALA B O   1 
ATOM   2183 C CB  . ALA B 1 20  ? 1.218   16.997  19.691  1.00 35.82 ? 15   ALA B CB  1 
ATOM   2184 N N   . VAL B 1 21  ? -0.850  19.594  19.882  1.00 37.32 ? 16   VAL B N   1 
ATOM   2185 C CA  . VAL B 1 21  ? -1.982  20.093  19.116  1.00 36.38 ? 16   VAL B CA  1 
ATOM   2186 C C   . VAL B 1 21  ? -1.481  20.247  17.692  1.00 36.37 ? 16   VAL B C   1 
ATOM   2187 O O   . VAL B 1 21  ? -0.415  20.835  17.454  1.00 35.27 ? 16   VAL B O   1 
ATOM   2188 C CB  . VAL B 1 21  ? -2.541  21.428  19.617  1.00 36.80 ? 16   VAL B CB  1 
ATOM   2189 C CG1 . VAL B 1 21  ? -3.637  21.876  18.698  1.00 35.87 ? 16   VAL B CG1 1 
ATOM   2190 C CG2 . VAL B 1 21  ? -3.032  21.322  21.081  1.00 33.22 ? 16   VAL B CG2 1 
ATOM   2191 N N   . VAL B 1 22  ? -2.235  19.666  16.765  1.00 35.59 ? 17   VAL B N   1 
ATOM   2192 C CA  . VAL B 1 22  ? -2.008  19.844  15.335  1.00 35.82 ? 17   VAL B CA  1 
ATOM   2193 C C   . VAL B 1 22  ? -3.275  20.379  14.642  1.00 36.15 ? 17   VAL B C   1 
ATOM   2194 O O   . VAL B 1 22  ? -4.342  20.525  15.270  1.00 36.49 ? 17   VAL B O   1 
ATOM   2195 C CB  . VAL B 1 22  ? -1.416  18.561  14.668  1.00 35.35 ? 17   VAL B CB  1 
ATOM   2196 C CG1 . VAL B 1 22  ? -0.203  18.039  15.469  1.00 36.62 ? 17   VAL B CG1 1 
ATOM   2197 C CG2 . VAL B 1 22  ? -2.454  17.460  14.510  1.00 35.29 ? 17   VAL B CG2 1 
ATOM   2198 N N   . ARG B 1 23  ? -3.161  20.680  13.346  1.00 37.86 ? 18   ARG B N   1 
ATOM   2199 C CA  . ARG B 1 23  ? -4.317  21.152  12.557  1.00 38.34 ? 18   ARG B CA  1 
ATOM   2200 C C   . ARG B 1 23  ? -4.218  20.648  11.116  1.00 38.88 ? 18   ARG B C   1 
ATOM   2201 O O   . ARG B 1 23  ? -3.144  20.661  10.532  1.00 37.99 ? 18   ARG B O   1 
ATOM   2202 C CB  . ARG B 1 23  ? -4.420  22.683  12.589  1.00 38.57 ? 18   ARG B CB  1 
ATOM   2203 C CG  . ARG B 1 23  ? -5.660  23.233  11.869  1.00 38.93 ? 18   ARG B CG  1 
ATOM   2204 C CD  . ARG B 1 23  ? -6.048  24.604  12.322  1.00 38.63 ? 18   ARG B CD  1 
ATOM   2205 N NE  . ARG B 1 23  ? -7.454  24.840  12.025  1.00 41.58 ? 18   ARG B NE  1 
ATOM   2206 C CZ  . ARG B 1 23  ? -8.111  25.957  12.298  1.00 41.99 ? 18   ARG B CZ  1 
ATOM   2207 N NH1 . ARG B 1 23  ? -7.489  26.980  12.887  1.00 43.73 ? 18   ARG B NH1 1 
ATOM   2208 N NH2 . ARG B 1 23  ? -9.394  26.052  11.977  1.00 42.13 ? 18   ARG B NH2 1 
ATOM   2209 N N   . ALA B 1 24  ? -5.341  20.163  10.572  1.00 40.44 ? 19   ALA B N   1 
ATOM   2210 C CA  . ALA B 1 24  ? -5.386  19.651  9.202   1.00 41.57 ? 19   ALA B CA  1 
ATOM   2211 C C   . ALA B 1 24  ? -5.170  20.805  8.228   1.00 42.39 ? 19   ALA B C   1 
ATOM   2212 O O   . ALA B 1 24  ? -5.679  21.908  8.466   1.00 43.29 ? 19   ALA B O   1 
ATOM   2213 C CB  . ALA B 1 24  ? -6.732  18.965  8.930   1.00 41.63 ? 19   ALA B CB  1 
ATOM   2214 N N   . LEU B 1 25  ? -4.400  20.566  7.168   1.00 42.81 ? 20   LEU B N   1 
ATOM   2215 C CA  . LEU B 1 25  ? -4.250  21.556  6.085   1.00 43.68 ? 20   LEU B CA  1 
ATOM   2216 C C   . LEU B 1 25  ? -5.456  21.571  5.123   1.00 44.10 ? 20   LEU B C   1 
ATOM   2217 O O   . LEU B 1 25  ? -6.033  20.511  4.830   1.00 44.29 ? 20   LEU B O   1 
ATOM   2218 C CB  . LEU B 1 25  ? -2.934  21.343  5.327   1.00 43.64 ? 20   LEU B CB  1 
ATOM   2219 C CG  . LEU B 1 25  ? -2.694  20.079  4.507   1.00 43.03 ? 20   LEU B CG  1 
ATOM   2220 C CD1 . LEU B 1 25  ? -3.030  20.340  3.009   1.00 43.89 ? 20   LEU B CD1 1 
ATOM   2221 C CD2 . LEU B 1 25  ? -1.271  19.664  4.640   1.00 42.93 ? 20   LEU B CD2 1 
ATOM   2222 N N   . PRO B 1 26  ? -5.846  22.772  4.627   1.00 44.38 ? 21   PRO B N   1 
ATOM   2223 C CA  . PRO B 1 26  ? -6.995  22.861  3.720   1.00 43.85 ? 21   PRO B CA  1 
ATOM   2224 C C   . PRO B 1 26  ? -6.533  22.761  2.278   1.00 43.95 ? 21   PRO B C   1 
ATOM   2225 O O   . PRO B 1 26  ? -5.354  22.961  2.012   1.00 44.15 ? 21   PRO B O   1 
ATOM   2226 C CB  . PRO B 1 26  ? -7.552  24.253  4.014   1.00 43.88 ? 21   PRO B CB  1 
ATOM   2227 C CG  . PRO B 1 26  ? -6.306  25.079  4.413   1.00 43.98 ? 21   PRO B CG  1 
ATOM   2228 C CD  . PRO B 1 26  ? -5.234  24.099  4.871   1.00 43.87 ? 21   PRO B CD  1 
ATOM   2229 N N   . GLU B 1 27  ? -7.433  22.449  1.341   1.00 43.86 ? 22   GLU B N   1 
ATOM   2230 C CA  . GLU B 1 27  ? -6.995  22.294  -0.061  1.00 43.30 ? 22   GLU B CA  1 
ATOM   2231 C C   . GLU B 1 27  ? -6.486  23.644  -0.571  1.00 42.88 ? 22   GLU B C   1 
ATOM   2232 O O   . GLU B 1 27  ? -5.533  23.723  -1.359  1.00 42.99 ? 22   GLU B O   1 
ATOM   2233 C CB  . GLU B 1 27  ? -8.124  21.739  -0.939  1.00 43.67 ? 22   GLU B CB  1 
ATOM   2234 N N   . SER B 1 28  ? -7.101  24.704  -0.054  1.00 42.39 ? 23   SER B N   1 
ATOM   2235 C CA  . SER B 1 28  ? -6.680  26.099  -0.278  1.00 41.26 ? 23   SER B CA  1 
ATOM   2236 C C   . SER B 1 28  ? -5.236  26.465  0.043   1.00 40.21 ? 23   SER B C   1 
ATOM   2237 O O   . SER B 1 28  ? -4.790  27.541  -0.353  1.00 39.78 ? 23   SER B O   1 
ATOM   2238 C CB  . SER B 1 28  ? -7.583  27.036  0.503   1.00 41.46 ? 23   SER B CB  1 
ATOM   2239 O OG  . SER B 1 28  ? -7.113  27.171  1.828   1.00 43.29 ? 23   SER B OG  1 
ATOM   2240 N N   . LEU B 1 29  ? -4.530  25.618  0.797   1.00 38.71 ? 24   LEU B N   1 
ATOM   2241 C CA  . LEU B 1 29  ? -3.108  25.823  1.063   1.00 37.68 ? 24   LEU B CA  1 
ATOM   2242 C C   . LEU B 1 29  ? -2.326  25.878  -0.237  1.00 37.62 ? 24   LEU B C   1 
ATOM   2243 O O   . LEU B 1 29  ? -1.427  26.709  -0.409  1.00 36.90 ? 24   LEU B O   1 
ATOM   2244 C CB  . LEU B 1 29  ? -2.536  24.702  1.958   1.00 37.57 ? 24   LEU B CB  1 
ATOM   2245 C CG  . LEU B 1 29  ? -1.032  24.777  2.263   1.00 36.79 ? 24   LEU B CG  1 
ATOM   2246 C CD1 . LEU B 1 29  ? -0.741  24.275  3.658   1.00 38.40 ? 24   LEU B CD1 1 
ATOM   2247 C CD2 . LEU B 1 29  ? -0.123  24.011  1.247   1.00 35.79 ? 24   LEU B CD2 1 
ATOM   2248 N N   . GLY B 1 30  ? -2.659  24.952  -1.136  1.00 37.37 ? 25   GLY B N   1 
ATOM   2249 C CA  . GLY B 1 30  ? -1.957  24.766  -2.384  1.00 37.15 ? 25   GLY B CA  1 
ATOM   2250 C C   . GLY B 1 30  ? -1.726  26.050  -3.136  1.00 37.15 ? 25   GLY B C   1 
ATOM   2251 O O   . GLY B 1 30  ? -0.604  26.312  -3.591  1.00 37.64 ? 25   GLY B O   1 
ATOM   2252 N N   . GLN B 1 31  ? -2.773  26.850  -3.256  1.00 37.04 ? 26   GLN B N   1 
ATOM   2253 C CA  . GLN B 1 31  ? -2.720  28.092  -4.045  1.00 38.25 ? 26   GLN B CA  1 
ATOM   2254 C C   . GLN B 1 31  ? -2.505  29.341  -3.193  1.00 38.29 ? 26   GLN B C   1 
ATOM   2255 O O   . GLN B 1 31  ? -1.882  30.295  -3.664  1.00 36.93 ? 26   GLN B O   1 
ATOM   2256 C CB  . GLN B 1 31  ? -4.002  28.283  -4.852  1.00 38.24 ? 26   GLN B CB  1 
ATOM   2257 C CG  . GLN B 1 31  ? -4.250  27.225  -5.924  1.00 41.00 ? 26   GLN B CG  1 
ATOM   2258 C CD  . GLN B 1 31  ? -3.790  27.669  -7.280  1.00 42.82 ? 26   GLN B CD  1 
ATOM   2259 O OE1 . GLN B 1 31  ? -4.604  28.096  -8.100  1.00 45.00 ? 26   GLN B OE1 1 
ATOM   2260 N NE2 . GLN B 1 31  ? -2.472  27.586  -7.533  1.00 42.25 ? 26   GLN B NE2 1 
ATOM   2261 N N   . HIS B 1 32  ? -2.998  29.299  -1.948  1.00 38.05 ? 27   HIS B N   1 
ATOM   2262 C CA  . HIS B 1 32  ? -3.208  30.507  -1.139  1.00 38.87 ? 27   HIS B CA  1 
ATOM   2263 C C   . HIS B 1 32  ? -2.358  30.690  0.119   1.00 38.59 ? 27   HIS B C   1 
ATOM   2264 O O   . HIS B 1 32  ? -2.338  31.785  0.687   1.00 37.41 ? 27   HIS B O   1 
ATOM   2265 C CB  . HIS B 1 32  ? -4.680  30.608  -0.743  1.00 39.12 ? 27   HIS B CB  1 
ATOM   2266 C CG  . HIS B 1 32  ? -5.613  30.537  -1.902  1.00 42.73 ? 27   HIS B CG  1 
ATOM   2267 N ND1 . HIS B 1 32  ? -5.785  31.584  -2.780  1.00 45.21 ? 27   HIS B ND1 1 
ATOM   2268 C CD2 . HIS B 1 32  ? -6.425  29.544  -2.332  1.00 44.44 ? 27   HIS B CD2 1 
ATOM   2269 C CE1 . HIS B 1 32  ? -6.669  31.240  -3.699  1.00 45.90 ? 27   HIS B CE1 1 
ATOM   2270 N NE2 . HIS B 1 32  ? -7.069  30.007  -3.452  1.00 46.48 ? 27   HIS B NE2 1 
ATOM   2271 N N   . ALA B 1 33  ? -1.683  29.628  0.577   1.00 38.51 ? 28   ALA B N   1 
ATOM   2272 C CA  . ALA B 1 33  ? -0.839  29.770  1.754   1.00 39.00 ? 28   ALA B CA  1 
ATOM   2273 C C   . ALA B 1 33  ? 0.160   30.812  1.349   1.00 39.00 ? 28   ALA B C   1 
ATOM   2274 O O   . ALA B 1 33  ? 0.578   30.851  0.177   1.00 39.25 ? 28   ALA B O   1 
ATOM   2275 C CB  . ALA B 1 33  ? -0.133  28.456  2.123   1.00 38.57 ? 28   ALA B CB  1 
ATOM   2276 N N   . LEU B 1 34  ? 0.529   31.668  2.297   1.00 38.77 ? 29   LEU B N   1 
ATOM   2277 C CA  . LEU B 1 34  ? 1.587   32.639  2.060   1.00 39.17 ? 29   LEU B CA  1 
ATOM   2278 C C   . LEU B 1 34  ? 2.863   31.867  1.806   1.00 39.37 ? 29   LEU B C   1 
ATOM   2279 O O   . LEU B 1 34  ? 3.053   30.783  2.341   1.00 39.22 ? 29   LEU B O   1 
ATOM   2280 C CB  . LEU B 1 34  ? 1.747   33.586  3.259   1.00 37.66 ? 29   LEU B CB  1 
ATOM   2281 C CG  . LEU B 1 34  ? 0.474   34.267  3.744   1.00 39.50 ? 29   LEU B CG  1 
ATOM   2282 C CD1 . LEU B 1 34  ? 0.737   35.109  5.009   1.00 37.00 ? 29   LEU B CD1 1 
ATOM   2283 C CD2 . LEU B 1 34  ? -0.189  35.130  2.637   1.00 38.69 ? 29   LEU B CD2 1 
ATOM   2284 N N   . ARG B 1 35  ? 3.747   32.440  1.009   1.00 40.77 ? 30   ARG B N   1 
ATOM   2285 C CA  . ARG B 1 35  ? 4.976   31.802  0.643   1.00 42.59 ? 30   ARG B CA  1 
ATOM   2286 C C   . ARG B 1 35  ? 5.833   32.866  0.020   1.00 45.39 ? 30   ARG B C   1 
ATOM   2287 O O   . ARG B 1 35  ? 5.331   33.901  -0.432  1.00 45.62 ? 30   ARG B O   1 
ATOM   2288 C CB  . ARG B 1 35  ? 4.722   30.660  -0.353  1.00 43.19 ? 30   ARG B CB  1 
ATOM   2289 C CG  . ARG B 1 35  ? 4.373   31.094  -1.801  1.00 41.45 ? 30   ARG B CG  1 
ATOM   2290 C CD  . ARG B 1 35  ? 3.738   29.956  -2.564  1.00 40.97 ? 30   ARG B CD  1 
ATOM   2291 N NE  . ARG B 1 35  ? 2.397   29.725  -2.048  1.00 37.65 ? 30   ARG B NE  1 
ATOM   2292 C CZ  . ARG B 1 35  ? 1.531   28.858  -2.546  1.00 39.18 ? 30   ARG B CZ  1 
ATOM   2293 N NH1 . ARG B 1 35  ? 1.862   28.114  -3.598  1.00 42.68 ? 30   ARG B NH1 1 
ATOM   2294 N NH2 . ARG B 1 35  ? 0.330   28.730  -1.983  1.00 39.95 ? 30   ARG B NH2 1 
ATOM   2295 N N   . SER B 1 36  ? 7.124   32.599  -0.038  1.00 48.41 ? 31   SER B N   1 
ATOM   2296 C CA  . SER B 1 36  ? 8.097   33.648  -0.269  1.00 51.67 ? 31   SER B CA  1 
ATOM   2297 C C   . SER B 1 36  ? 9.067   33.310  -1.388  1.00 53.29 ? 31   SER B C   1 
ATOM   2298 O O   . SER B 1 36  ? 9.690   34.208  -1.959  1.00 54.05 ? 31   SER B O   1 
ATOM   2299 C CB  . SER B 1 36  ? 8.873   33.908  1.024   1.00 51.75 ? 31   SER B CB  1 
ATOM   2300 O OG  . SER B 1 36  ? 9.531   32.723  1.452   1.00 54.30 ? 31   SER B OG  1 
ATOM   2301 N N   . ALA B 1 37  ? 9.212   32.017  -1.676  1.00 55.44 ? 32   ALA B N   1 
ATOM   2302 C CA  . ALA B 1 37  ? 10.045  31.545  -2.786  1.00 57.06 ? 32   ALA B CA  1 
ATOM   2303 C C   . ALA B 1 37  ? 9.162   31.049  -3.917  1.00 58.05 ? 32   ALA B C   1 
ATOM   2304 O O   . ALA B 1 37  ? 8.211   30.301  -3.670  1.00 58.60 ? 32   ALA B O   1 
ATOM   2305 C CB  . ALA B 1 37  ? 10.981  30.427  -2.324  1.00 57.14 ? 32   ALA B CB  1 
ATOM   2306 N N   . LYS B 1 38  ? 9.476   31.469  -5.146  1.00 58.83 ? 33   LYS B N   1 
ATOM   2307 C CA  . LYS B 1 38  ? 8.715   31.067  -6.337  1.00 59.51 ? 33   LYS B CA  1 
ATOM   2308 C C   . LYS B 1 38  ? 8.933   29.594  -6.698  1.00 59.97 ? 33   LYS B C   1 
ATOM   2309 O O   . LYS B 1 38  ? 8.006   28.901  -7.147  1.00 60.71 ? 33   LYS B O   1 
ATOM   2310 C CB  . LYS B 1 38  ? 9.079   31.962  -7.526  1.00 59.71 ? 33   LYS B CB  1 
ATOM   2311 N N   . GLU B 1 41  ? 5.348   24.554  -7.265  1.00 47.93 ? 36   GLU B N   1 
ATOM   2312 C CA  . GLU B 1 41  ? 4.047   23.889  -7.268  1.00 47.86 ? 36   GLU B CA  1 
ATOM   2313 C C   . GLU B 1 41  ? 3.907   22.930  -6.077  1.00 47.82 ? 36   GLU B C   1 
ATOM   2314 O O   . GLU B 1 41  ? 4.812   22.141  -5.814  1.00 47.50 ? 36   GLU B O   1 
ATOM   2315 C CB  . GLU B 1 41  ? 3.850   23.115  -8.564  1.00 47.95 ? 36   GLU B CB  1 
ATOM   2316 C CG  . GLU B 1 41  ? 2.525   22.384  -8.647  1.00 49.29 ? 36   GLU B CG  1 
ATOM   2317 C CD  . GLU B 1 41  ? 2.183   21.960  -10.059 1.00 52.68 ? 36   GLU B CD  1 
ATOM   2318 O OE1 . GLU B 1 41  ? 3.106   21.554  -10.833 1.00 50.59 ? 36   GLU B OE1 1 
ATOM   2319 O OE2 . GLU B 1 41  ? 0.974   22.028  -10.379 1.00 53.48 ? 36   GLU B OE2 1 
ATOM   2320 N N   . VAL B 1 42  ? 2.755   23.003  -5.402  1.00 47.52 ? 37   VAL B N   1 
ATOM   2321 C CA  . VAL B 1 42  ? 2.477   22.230  -4.189  1.00 47.36 ? 37   VAL B CA  1 
ATOM   2322 C C   . VAL B 1 42  ? 1.491   21.091  -4.458  1.00 47.13 ? 37   VAL B C   1 
ATOM   2323 O O   . VAL B 1 42  ? 0.290   21.306  -4.756  1.00 46.77 ? 37   VAL B O   1 
ATOM   2324 C CB  . VAL B 1 42  ? 1.882   23.095  -3.019  1.00 47.56 ? 37   VAL B CB  1 
ATOM   2325 C CG1 . VAL B 1 42  ? 1.753   22.239  -1.731  1.00 46.94 ? 37   VAL B CG1 1 
ATOM   2326 C CG2 . VAL B 1 42  ? 2.699   24.380  -2.763  1.00 46.88 ? 37   VAL B CG2 1 
ATOM   2327 N N   . ASP B 1 43  ? 2.009   19.880  -4.308  1.00 46.35 ? 38   ASP B N   1 
ATOM   2328 C CA  . ASP B 1 43  ? 1.191   18.703  -4.317  1.00 45.86 ? 38   ASP B CA  1 
ATOM   2329 C C   . ASP B 1 43  ? 0.551   18.652  -2.935  1.00 45.26 ? 38   ASP B C   1 
ATOM   2330 O O   . ASP B 1 43  ? 1.226   18.280  -1.962  1.00 45.41 ? 38   ASP B O   1 
ATOM   2331 C CB  . ASP B 1 43  ? 2.079   17.480  -4.562  1.00 46.03 ? 38   ASP B CB  1 
ATOM   2332 C CG  . ASP B 1 43  ? 1.286   16.230  -4.869  1.00 46.42 ? 38   ASP B CG  1 
ATOM   2333 O OD1 . ASP B 1 43  ? 0.050   16.212  -4.650  1.00 47.33 ? 38   ASP B OD1 1 
ATOM   2334 O OD2 . ASP B 1 43  ? 1.915   15.258  -5.344  1.00 46.62 ? 38   ASP B OD2 1 
ATOM   2335 N N   . VAL B 1 44  ? -0.725  19.054  -2.850  1.00 44.31 ? 39   VAL B N   1 
ATOM   2336 C CA  . VAL B 1 44  ? -1.499  19.035  -1.594  1.00 43.68 ? 39   VAL B CA  1 
ATOM   2337 C C   . VAL B 1 44  ? -1.645  17.613  -1.038  1.00 43.96 ? 39   VAL B C   1 
ATOM   2338 O O   . VAL B 1 44  ? -1.531  17.391  0.172   1.00 44.07 ? 39   VAL B O   1 
ATOM   2339 C CB  . VAL B 1 44  ? -2.904  19.728  -1.752  1.00 43.73 ? 39   VAL B CB  1 
ATOM   2340 C CG1 . VAL B 1 44  ? -3.768  19.604  -0.499  1.00 42.63 ? 39   VAL B CG1 1 
ATOM   2341 C CG2 . VAL B 1 44  ? -2.755  21.201  -2.083  1.00 43.98 ? 39   VAL B CG2 1 
ATOM   2342 N N   . ALA B 1 45  ? -1.892  16.633  -1.910  1.00 43.90 ? 40   ALA B N   1 
ATOM   2343 C CA  . ALA B 1 45  ? -2.052  15.249  -1.431  1.00 43.09 ? 40   ALA B CA  1 
ATOM   2344 C C   . ALA B 1 45  ? -0.729  14.676  -0.911  1.00 42.36 ? 40   ALA B C   1 
ATOM   2345 O O   . ALA B 1 45  ? -0.724  13.913  0.047   1.00 41.47 ? 40   ALA B O   1 
ATOM   2346 C CB  . ALA B 1 45  ? -2.696  14.331  -2.530  1.00 42.94 ? 40   ALA B CB  1 
ATOM   2347 N N   . ARG B 1 46  ? 0.404   15.040  -1.514  1.00 42.25 ? 41   ARG B N   1 
ATOM   2348 C CA  . ARG B 1 46  ? 1.648   14.571  -0.924  1.00 42.87 ? 41   ARG B CA  1 
ATOM   2349 C C   . ARG B 1 46  ? 1.808   15.270  0.441   1.00 43.65 ? 41   ARG B C   1 
ATOM   2350 O O   . ARG B 1 46  ? 2.280   14.662  1.397   1.00 42.86 ? 41   ARG B O   1 
ATOM   2351 C CB  . ARG B 1 46  ? 2.858   14.792  -1.825  1.00 42.40 ? 41   ARG B CB  1 
ATOM   2352 C CG  . ARG B 1 46  ? 4.128   14.004  -1.415  1.00 42.22 ? 41   ARG B CG  1 
ATOM   2353 C CD  . ARG B 1 46  ? 5.290   14.353  -2.352  1.00 44.23 ? 41   ARG B CD  1 
ATOM   2354 N NE  . ARG B 1 46  ? 6.540   13.650  -2.051  1.00 48.24 ? 41   ARG B NE  1 
ATOM   2355 C CZ  . ARG B 1 46  ? 7.737   14.231  -1.949  1.00 52.23 ? 41   ARG B CZ  1 
ATOM   2356 N NH1 . ARG B 1 46  ? 7.889   15.541  -2.131  1.00 53.30 ? 41   ARG B NH1 1 
ATOM   2357 N NH2 . ARG B 1 46  ? 8.805   13.494  -1.670  1.00 55.50 ? 41   ARG B NH2 1 
ATOM   2358 N N   . ALA B 1 47  ? 1.370   16.523  0.536   1.00 44.40 ? 42   ALA B N   1 
ATOM   2359 C CA  . ALA B 1 47  ? 1.478   17.260  1.803   1.00 45.80 ? 42   ALA B CA  1 
ATOM   2360 C C   . ALA B 1 47  ? 0.555   16.709  2.896   1.00 46.94 ? 42   ALA B C   1 
ATOM   2361 O O   . ALA B 1 47  ? 0.987   16.589  4.049   1.00 47.66 ? 42   ALA B O   1 
ATOM   2362 C CB  . ALA B 1 47  ? 1.257   18.749  1.597   1.00 45.17 ? 42   ALA B CB  1 
ATOM   2363 N N   . GLU B 1 48  ? -0.696  16.370  2.547   1.00 47.95 ? 43   GLU B N   1 
ATOM   2364 C CA  . GLU B 1 48  ? -1.619  15.744  3.502   1.00 49.10 ? 43   GLU B CA  1 
ATOM   2365 C C   . GLU B 1 48  ? -1.053  14.398  3.950   1.00 49.00 ? 43   GLU B C   1 
ATOM   2366 O O   . GLU B 1 48  ? -1.233  13.981  5.093   1.00 48.97 ? 43   GLU B O   1 
ATOM   2367 C CB  . GLU B 1 48  ? -3.050  15.597  2.937   1.00 48.63 ? 43   GLU B CB  1 
ATOM   2368 C CG  . GLU B 1 48  ? -3.788  16.957  2.717   1.00 51.08 ? 43   GLU B CG  1 
ATOM   2369 C CD  . GLU B 1 48  ? -5.255  16.876  2.186   1.00 51.31 ? 43   GLU B CD  1 
ATOM   2370 O OE1 . GLU B 1 48  ? -5.777  15.756  1.936   1.00 55.71 ? 43   GLU B OE1 1 
ATOM   2371 O OE2 . GLU B 1 48  ? -5.894  17.962  2.020   1.00 50.10 ? 43   GLU B OE2 1 
ATOM   2372 N N   . ARG B 1 49  ? -0.337  13.723  3.070   1.00 48.85 ? 44   ARG B N   1 
ATOM   2373 C CA  . ARG B 1 49  ? 0.231   12.445  3.425   1.00 48.21 ? 44   ARG B CA  1 
ATOM   2374 C C   . ARG B 1 49  ? 1.392   12.630  4.364   1.00 47.37 ? 44   ARG B C   1 
ATOM   2375 O O   . ARG B 1 49  ? 1.467   11.983  5.369   1.00 46.89 ? 44   ARG B O   1 
ATOM   2376 C CB  . ARG B 1 49  ? 0.638   11.638  2.188   1.00 48.17 ? 44   ARG B CB  1 
ATOM   2377 C CG  . ARG B 1 49  ? 1.441   10.373  2.486   1.00 48.73 ? 44   ARG B CG  1 
ATOM   2378 C CD  . ARG B 1 49  ? 0.595   9.108   2.583   1.00 47.88 ? 44   ARG B CD  1 
ATOM   2379 N NE  . ARG B 1 49  ? -0.651  9.364   3.250   1.00 48.38 ? 44   ARG B NE  1 
ATOM   2380 C CZ  . ARG B 1 49  ? -1.071  8.762   4.342   1.00 48.08 ? 44   ARG B CZ  1 
ATOM   2381 N NH1 . ARG B 1 49  ? -0.355  7.828   4.927   1.00 47.40 ? 44   ARG B NH1 1 
ATOM   2382 N NH2 . ARG B 1 49  ? -2.221  9.115   4.851   1.00 46.11 ? 44   ARG B NH2 1 
ATOM   2383 N N   . GLN B 1 50  ? 2.300   13.525  4.002   1.00 46.83 ? 45   GLN B N   1 
ATOM   2384 C CA  . GLN B 1 50  ? 3.465   13.847  4.819   1.00 46.55 ? 45   GLN B CA  1 
ATOM   2385 C C   . GLN B 1 50  ? 3.081   14.362  6.211   1.00 46.02 ? 45   GLN B C   1 
ATOM   2386 O O   . GLN B 1 50  ? 3.709   13.987  7.223   1.00 46.88 ? 45   GLN B O   1 
ATOM   2387 C CB  . GLN B 1 50  ? 4.322   14.877  4.105   1.00 46.28 ? 45   GLN B CB  1 
ATOM   2388 C CG  . GLN B 1 50  ? 5.026   14.345  2.889   1.00 46.14 ? 45   GLN B CG  1 
ATOM   2389 C CD  . GLN B 1 50  ? 5.938   15.369  2.288   1.00 45.49 ? 45   GLN B CD  1 
ATOM   2390 O OE1 . GLN B 1 50  ? 5.631   16.557  2.300   1.00 44.46 ? 45   GLN B OE1 1 
ATOM   2391 N NE2 . GLN B 1 50  ? 7.084   14.922  1.767   1.00 45.43 ? 45   GLN B NE2 1 
ATOM   2392 N N   . HIS B 1 51  ? 2.059   15.211  6.255   1.00 45.13 ? 46   HIS B N   1 
ATOM   2393 C CA  . HIS B 1 51  ? 1.484   15.648  7.512   1.00 44.81 ? 46   HIS B CA  1 
ATOM   2394 C C   . HIS B 1 51  ? 1.064   14.451  8.325   1.00 45.12 ? 46   HIS B C   1 
ATOM   2395 O O   . HIS B 1 51  ? 1.455   14.329  9.486   1.00 44.89 ? 46   HIS B O   1 
ATOM   2396 C CB  . HIS B 1 51  ? 0.270   16.555  7.305   1.00 44.09 ? 46   HIS B CB  1 
ATOM   2397 C CG  . HIS B 1 51  ? -0.144  17.312  8.540   1.00 41.33 ? 46   HIS B CG  1 
ATOM   2398 N ND1 . HIS B 1 51  ? -1.351  17.105  9.177   1.00 36.68 ? 46   HIS B ND1 1 
ATOM   2399 C CD2 . HIS B 1 51  ? 0.494   18.280  9.247   1.00 37.68 ? 46   HIS B CD2 1 
ATOM   2400 C CE1 . HIS B 1 51  ? -1.436  17.904  10.227  1.00 39.01 ? 46   HIS B CE1 1 
ATOM   2401 N NE2 . HIS B 1 51  ? -0.333  18.632  10.288  1.00 37.87 ? 46   HIS B NE2 1 
ATOM   2402 N N   . GLN B 1 52  ? 0.262   13.575  7.709   1.00 45.53 ? 47   GLN B N   1 
ATOM   2403 C CA  . GLN B 1 52  ? -0.342  12.437  8.401   1.00 45.61 ? 47   GLN B CA  1 
ATOM   2404 C C   . GLN B 1 52  ? 0.745   11.518  8.986   1.00 45.12 ? 47   GLN B C   1 
ATOM   2405 O O   . GLN B 1 52  ? 0.574   10.957  10.058  1.00 46.01 ? 47   GLN B O   1 
ATOM   2406 C CB  . GLN B 1 52  ? -1.280  11.671  7.460   1.00 46.42 ? 47   GLN B CB  1 
ATOM   2407 C CG  . GLN B 1 52  ? -2.730  12.183  7.433   1.00 48.22 ? 47   GLN B CG  1 
ATOM   2408 C CD  . GLN B 1 52  ? -3.417  11.967  6.074   1.00 52.72 ? 47   GLN B CD  1 
ATOM   2409 O OE1 . GLN B 1 52  ? -3.592  10.828  5.608   1.00 53.33 ? 47   GLN B OE1 1 
ATOM   2410 N NE2 . GLN B 1 52  ? -3.796  13.069  5.429   1.00 53.20 ? 47   GLN B NE2 1 
ATOM   2411 N N   . LEU B 1 53  ? 1.875   11.395  8.298   1.00 43.71 ? 48   LEU B N   1 
ATOM   2412 C CA  . LEU B 1 53  ? 2.993   10.614  8.828   1.00 43.20 ? 48   LEU B CA  1 
ATOM   2413 C C   . LEU B 1 53  ? 3.640   11.284  10.059  1.00 42.88 ? 48   LEU B C   1 
ATOM   2414 O O   . LEU B 1 53  ? 4.012   10.612  11.043  1.00 43.40 ? 48   LEU B O   1 
ATOM   2415 C CB  . LEU B 1 53  ? 4.012   10.316  7.731   1.00 42.90 ? 48   LEU B CB  1 
ATOM   2416 C CG  . LEU B 1 53  ? 3.375   9.444   6.637   1.00 43.43 ? 48   LEU B CG  1 
ATOM   2417 C CD1 . LEU B 1 53  ? 4.246   9.416   5.426   1.00 41.71 ? 48   LEU B CD1 1 
ATOM   2418 C CD2 . LEU B 1 53  ? 3.074   8.032   7.134   1.00 44.06 ? 48   LEU B CD2 1 
ATOM   2419 N N   . TYR B 1 54  ? 3.737   12.611  9.996   1.00 41.10 ? 49   TYR B N   1 
ATOM   2420 C CA  . TYR B 1 54  ? 4.227   13.442  11.082  1.00 38.80 ? 49   TYR B CA  1 
ATOM   2421 C C   . TYR B 1 54  ? 3.363   13.205  12.306  1.00 38.64 ? 49   TYR B C   1 
ATOM   2422 O O   . TYR B 1 54  ? 3.860   12.712  13.301  1.00 38.29 ? 49   TYR B O   1 
ATOM   2423 C CB  . TYR B 1 54  ? 4.146   14.872  10.624  1.00 37.01 ? 49   TYR B CB  1 
ATOM   2424 C CG  . TYR B 1 54  ? 4.487   15.957  11.610  1.00 34.78 ? 49   TYR B CG  1 
ATOM   2425 C CD1 . TYR B 1 54  ? 5.755   16.488  11.648  1.00 31.62 ? 49   TYR B CD1 1 
ATOM   2426 C CD2 . TYR B 1 54  ? 3.524   16.518  12.423  1.00 30.55 ? 49   TYR B CD2 1 
ATOM   2427 C CE1 . TYR B 1 54  ? 6.067   17.516  12.495  1.00 30.59 ? 49   TYR B CE1 1 
ATOM   2428 C CE2 . TYR B 1 54  ? 3.838   17.558  13.284  1.00 27.96 ? 49   TYR B CE2 1 
ATOM   2429 C CZ  . TYR B 1 54  ? 5.100   18.045  13.318  1.00 31.19 ? 49   TYR B CZ  1 
ATOM   2430 O OH  . TYR B 1 54  ? 5.421   19.132  14.113  1.00 32.28 ? 49   TYR B OH  1 
ATOM   2431 N N   . VAL B 1 55  ? 2.073   13.527  12.213  1.00 38.49 ? 50   VAL B N   1 
ATOM   2432 C CA  . VAL B 1 55  ? 1.127   13.247  13.283  1.00 38.16 ? 50   VAL B CA  1 
ATOM   2433 C C   . VAL B 1 55  ? 1.264   11.812  13.807  1.00 39.52 ? 50   VAL B C   1 
ATOM   2434 O O   . VAL B 1 55  ? 1.276   11.570  15.037  1.00 39.79 ? 50   VAL B O   1 
ATOM   2435 C CB  . VAL B 1 55  ? -0.337  13.534  12.858  1.00 38.22 ? 50   VAL B CB  1 
ATOM   2436 C CG1 . VAL B 1 55  ? -1.301  13.270  14.003  1.00 34.49 ? 50   VAL B CG1 1 
ATOM   2437 C CG2 . VAL B 1 55  ? -0.493  14.965  12.352  1.00 37.71 ? 50   VAL B CG2 1 
ATOM   2438 N N   . GLY B 1 56  ? 1.391   10.865  12.876  1.00 40.34 ? 51   GLY B N   1 
ATOM   2439 C CA  . GLY B 1 56  ? 1.616   9.459   13.211  1.00 40.53 ? 51   GLY B CA  1 
ATOM   2440 C C   . GLY B 1 56  ? 2.827   9.232   14.097  1.00 41.08 ? 51   GLY B C   1 
ATOM   2441 O O   . GLY B 1 56  ? 2.807   8.355   14.966  1.00 40.55 ? 51   GLY B O   1 
ATOM   2442 N N   . VAL B 1 57  ? 3.895   10.000  13.879  1.00 41.62 ? 52   VAL B N   1 
ATOM   2443 C CA  . VAL B 1 57  ? 5.078   9.819   14.699  1.00 42.54 ? 52   VAL B CA  1 
ATOM   2444 C C   . VAL B 1 57  ? 4.796   10.262  16.138  1.00 42.94 ? 52   VAL B C   1 
ATOM   2445 O O   . VAL B 1 57  ? 4.996   9.488   17.070  1.00 42.98 ? 52   VAL B O   1 
ATOM   2446 C CB  . VAL B 1 57  ? 6.343   10.496  14.143  1.00 42.44 ? 52   VAL B CB  1 
ATOM   2447 C CG1 . VAL B 1 57  ? 7.429   10.445  15.198  1.00 42.99 ? 52   VAL B CG1 1 
ATOM   2448 C CG2 . VAL B 1 57  ? 6.841   9.771   12.886  1.00 42.38 ? 52   VAL B CG2 1 
ATOM   2449 N N   . LEU B 1 58  ? 4.290   11.477  16.303  1.00 43.53 ? 53   LEU B N   1 
ATOM   2450 C CA  . LEU B 1 58  ? 3.923   11.996  17.641  1.00 43.86 ? 53   LEU B CA  1 
ATOM   2451 C C   . LEU B 1 58  ? 2.838   11.208  18.404  1.00 44.49 ? 53   LEU B C   1 
ATOM   2452 O O   . LEU B 1 58  ? 2.794   11.209  19.652  1.00 44.83 ? 53   LEU B O   1 
ATOM   2453 C CB  . LEU B 1 58  ? 3.423   13.435  17.524  1.00 43.16 ? 53   LEU B CB  1 
ATOM   2454 C CG  . LEU B 1 58  ? 4.271   14.449  16.784  1.00 42.69 ? 53   LEU B CG  1 
ATOM   2455 C CD1 . LEU B 1 58  ? 3.459   15.742  16.642  1.00 37.13 ? 53   LEU B CD1 1 
ATOM   2456 C CD2 . LEU B 1 58  ? 5.654   14.636  17.454  1.00 37.82 ? 53   LEU B CD2 1 
ATOM   2457 N N   . GLY B 1 59  ? 1.916   10.608  17.676  1.00 44.39 ? 54   GLY B N   1 
ATOM   2458 C CA  . GLY B 1 59  ? 0.673   10.161  18.301  1.00 44.74 ? 54   GLY B CA  1 
ATOM   2459 C C   . GLY B 1 59  ? 0.633   8.666   18.530  1.00 45.45 ? 54   GLY B C   1 
ATOM   2460 O O   . GLY B 1 59  ? 0.337   8.197   19.641  1.00 46.52 ? 54   GLY B O   1 
ATOM   2461 N N   . SER B 1 60  ? 0.942   7.928   17.465  1.00 45.19 ? 55   SER B N   1 
ATOM   2462 C CA  . SER B 1 60  ? 0.893   6.485   17.443  1.00 44.96 ? 55   SER B CA  1 
ATOM   2463 C C   . SER B 1 60  ? 2.258   5.877   17.773  1.00 44.70 ? 55   SER B C   1 
ATOM   2464 O O   . SER B 1 60  ? 2.332   4.872   18.487  1.00 45.37 ? 55   SER B O   1 
ATOM   2465 C CB  . SER B 1 60  ? 0.376   5.990   16.068  1.00 45.28 ? 55   SER B CB  1 
ATOM   2466 O OG  . SER B 1 60  ? 1.440   5.701   15.148  1.00 45.68 ? 55   SER B OG  1 
ATOM   2467 N N   . LYS B 1 61  ? 3.335   6.455   17.250  1.00 43.83 ? 56   LYS B N   1 
ATOM   2468 C CA  . LYS B 1 61  ? 4.676   5.916   17.532  1.00 43.26 ? 56   LYS B CA  1 
ATOM   2469 C C   . LYS B 1 61  ? 5.174   6.372   18.923  1.00 43.56 ? 56   LYS B C   1 
ATOM   2470 O O   . LYS B 1 61  ? 5.412   5.547   19.809  1.00 42.98 ? 56   LYS B O   1 
ATOM   2471 C CB  . LYS B 1 61  ? 5.668   6.307   16.445  1.00 42.66 ? 56   LYS B CB  1 
ATOM   2472 C CG  . LYS B 1 61  ? 7.037   5.623   16.545  1.00 42.47 ? 56   LYS B CG  1 
ATOM   2473 N N   . LEU B 1 62  ? 5.297   7.688   19.098  1.00 43.53 ? 57   LEU B N   1 
ATOM   2474 C CA  . LEU B 1 62  ? 5.909   8.264   20.304  1.00 43.54 ? 57   LEU B CA  1 
ATOM   2475 C C   . LEU B 1 62  ? 4.962   8.301   21.477  1.00 43.14 ? 57   LEU B C   1 
ATOM   2476 O O   . LEU B 1 62  ? 5.389   8.351   22.630  1.00 43.85 ? 57   LEU B O   1 
ATOM   2477 C CB  . LEU B 1 62  ? 6.492   9.653   20.032  1.00 43.16 ? 57   LEU B CB  1 
ATOM   2478 C CG  . LEU B 1 62  ? 7.742   9.565   19.180  1.00 42.35 ? 57   LEU B CG  1 
ATOM   2479 C CD1 . LEU B 1 62  ? 8.493   10.897  19.160  1.00 42.46 ? 57   LEU B CD1 1 
ATOM   2480 C CD2 . LEU B 1 62  ? 8.617   8.429   19.676  1.00 44.11 ? 57   LEU B CD2 1 
ATOM   2481 N N   . GLY B 1 63  ? 3.674   8.269   21.173  1.00 43.02 ? 58   GLY B N   1 
ATOM   2482 C CA  . GLY B 1 63  ? 2.680   7.978   22.165  1.00 40.83 ? 58   GLY B CA  1 
ATOM   2483 C C   . GLY B 1 63  ? 2.098   9.182   22.825  1.00 40.61 ? 58   GLY B C   1 
ATOM   2484 O O   . GLY B 1 63  ? 1.357   9.024   23.796  1.00 40.25 ? 58   GLY B O   1 
ATOM   2485 N N   . LEU B 1 64  ? 2.374   10.389  22.307  1.00 39.74 ? 59   LEU B N   1 
ATOM   2486 C CA  . LEU B 1 64  ? 1.725   11.579  22.873  1.00 39.09 ? 59   LEU B CA  1 
ATOM   2487 C C   . LEU B 1 64  ? 0.252   11.536  22.544  1.00 39.44 ? 59   LEU B C   1 
ATOM   2488 O O   . LEU B 1 64  ? -0.172  10.797  21.649  1.00 38.92 ? 59   LEU B O   1 
ATOM   2489 C CB  . LEU B 1 64  ? 2.331   12.908  22.361  1.00 39.61 ? 59   LEU B CB  1 
ATOM   2490 C CG  . LEU B 1 64  ? 3.847   13.151  22.353  1.00 39.50 ? 59   LEU B CG  1 
ATOM   2491 C CD1 . LEU B 1 64  ? 4.126   14.620  21.987  1.00 41.02 ? 59   LEU B CD1 1 
ATOM   2492 C CD2 . LEU B 1 64  ? 4.491   12.803  23.679  1.00 42.18 ? 59   LEU B CD2 1 
ATOM   2493 N N   . GLN B 1 65  ? -0.540  12.332  23.247  1.00 39.92 ? 60   GLN B N   1 
ATOM   2494 C CA  . GLN B 1 65  ? -1.899  12.552  22.819  1.00 42.00 ? 60   GLN B CA  1 
ATOM   2495 C C   . GLN B 1 65  ? -1.983  13.683  21.794  1.00 42.99 ? 60   GLN B C   1 
ATOM   2496 O O   . GLN B 1 65  ? -1.502  14.807  22.036  1.00 43.85 ? 60   GLN B O   1 
ATOM   2497 C CB  . GLN B 1 65  ? -2.783  12.871  23.999  1.00 42.00 ? 60   GLN B CB  1 
ATOM   2498 C CG  . GLN B 1 65  ? -3.019  11.667  24.876  1.00 46.18 ? 60   GLN B CG  1 
ATOM   2499 C CD  . GLN B 1 65  ? -4.265  11.837  25.687  1.00 50.40 ? 60   GLN B CD  1 
ATOM   2500 O OE1 . GLN B 1 65  ? -4.199  12.052  26.903  1.00 54.58 ? 60   GLN B OE1 1 
ATOM   2501 N NE2 . GLN B 1 65  ? -5.425  11.768  25.021  1.00 52.85 ? 60   GLN B NE2 1 
ATOM   2502 N N   . VAL B 1 66  ? -2.599  13.391  20.651  1.00 43.30 ? 61   VAL B N   1 
ATOM   2503 C CA  . VAL B 1 66  ? -2.792  14.408  19.622  1.00 43.55 ? 61   VAL B CA  1 
ATOM   2504 C C   . VAL B 1 66  ? -4.205  14.973  19.636  1.00 44.01 ? 61   VAL B C   1 
ATOM   2505 O O   . VAL B 1 66  ? -5.182  14.257  19.795  1.00 44.64 ? 61   VAL B O   1 
ATOM   2506 C CB  . VAL B 1 66  ? -2.339  13.938  18.226  1.00 43.46 ? 61   VAL B CB  1 
ATOM   2507 C CG1 . VAL B 1 66  ? -2.386  15.111  17.212  1.00 43.38 ? 61   VAL B CG1 1 
ATOM   2508 C CG2 . VAL B 1 66  ? -0.912  13.446  18.303  1.00 42.18 ? 61   VAL B CG2 1 
ATOM   2509 N N   . VAL B 1 67  ? -4.287  16.288  19.553  1.00 44.72 ? 62   VAL B N   1 
ATOM   2510 C CA  . VAL B 1 67  ? -5.532  16.960  19.237  1.00 44.93 ? 62   VAL B CA  1 
ATOM   2511 C C   . VAL B 1 67  ? -5.319  17.413  17.792  1.00 45.46 ? 62   VAL B C   1 
ATOM   2512 O O   . VAL B 1 67  ? -4.352  18.106  17.492  1.00 45.23 ? 62   VAL B O   1 
ATOM   2513 C CB  . VAL B 1 67  ? -5.810  18.135  20.193  1.00 44.50 ? 62   VAL B CB  1 
ATOM   2514 C CG1 . VAL B 1 67  ? -7.156  18.781  19.891  1.00 44.13 ? 62   VAL B CG1 1 
ATOM   2515 C CG2 . VAL B 1 67  ? -5.782  17.638  21.616  1.00 45.56 ? 62   VAL B CG2 1 
ATOM   2516 N N   . GLU B 1 68  ? -6.185  16.936  16.901  1.00 45.78 ? 63   GLU B N   1 
ATOM   2517 C CA  . GLU B 1 68  ? -6.115  17.258  15.490  1.00 46.33 ? 63   GLU B CA  1 
ATOM   2518 C C   . GLU B 1 68  ? -7.302  18.129  15.173  1.00 45.96 ? 63   GLU B C   1 
ATOM   2519 O O   . GLU B 1 68  ? -8.445  17.667  15.178  1.00 45.70 ? 63   GLU B O   1 
ATOM   2520 C CB  . GLU B 1 68  ? -6.204  16.002  14.629  1.00 46.66 ? 63   GLU B CB  1 
ATOM   2521 C CG  . GLU B 1 68  ? -5.416  14.799  15.086  1.00 47.25 ? 63   GLU B CG  1 
ATOM   2522 C CD  . GLU B 1 68  ? -5.524  13.641  14.097  1.00 48.37 ? 63   GLU B CD  1 
ATOM   2523 O OE1 . GLU B 1 68  ? -5.271  13.853  12.877  1.00 49.54 ? 63   GLU B OE1 1 
ATOM   2524 O OE2 . GLU B 1 68  ? -5.848  12.517  14.548  1.00 50.23 ? 63   GLU B OE2 1 
ATOM   2525 N N   . LEU B 1 69  ? -7.025  19.399  14.914  1.00 45.53 ? 64   LEU B N   1 
ATOM   2526 C CA  . LEU B 1 69  ? -8.062  20.370  14.623  1.00 45.37 ? 64   LEU B CA  1 
ATOM   2527 C C   . LEU B 1 69  ? -8.410  20.307  13.150  1.00 45.53 ? 64   LEU B C   1 
ATOM   2528 O O   . LEU B 1 69  ? -7.544  19.992  12.333  1.00 45.52 ? 64   LEU B O   1 
ATOM   2529 C CB  . LEU B 1 69  ? -7.577  21.778  14.986  1.00 44.73 ? 64   LEU B CB  1 
ATOM   2530 C CG  . LEU B 1 69  ? -7.145  21.995  16.438  1.00 43.65 ? 64   LEU B CG  1 
ATOM   2531 C CD1 . LEU B 1 69  ? -6.193  23.184  16.552  1.00 37.67 ? 64   LEU B CD1 1 
ATOM   2532 C CD2 . LEU B 1 69  ? -8.348  22.183  17.313  1.00 42.29 ? 64   LEU B CD2 1 
ATOM   2533 N N   . PRO B 1 70  ? -9.673  20.636  12.799  1.00 46.33 ? 65   PRO B N   1 
ATOM   2534 C CA  . PRO B 1 70  ? -10.096 20.631  11.391  1.00 46.69 ? 65   PRO B CA  1 
ATOM   2535 C C   . PRO B 1 70  ? -9.467  21.776  10.573  1.00 47.25 ? 65   PRO B C   1 
ATOM   2536 O O   . PRO B 1 70  ? -8.972  22.760  11.137  1.00 47.93 ? 65   PRO B O   1 
ATOM   2537 C CB  . PRO B 1 70  ? -11.621 20.783  11.485  1.00 46.42 ? 65   PRO B CB  1 
ATOM   2538 C CG  . PRO B 1 70  ? -11.859 21.528  12.744  1.00 46.24 ? 65   PRO B CG  1 
ATOM   2539 C CD  . PRO B 1 70  ? -10.765 21.065  13.702  1.00 46.28 ? 65   PRO B CD  1 
ATOM   2540 N N   . ALA B 1 71  ? -9.444  21.623  9.256   1.00 48.07 ? 66   ALA B N   1 
ATOM   2541 C CA  . ALA B 1 71  ? -8.943  22.669  8.369   1.00 48.34 ? 66   ALA B CA  1 
ATOM   2542 C C   . ALA B 1 71  ? -10.038 23.686  8.118   1.00 49.02 ? 66   ALA B C   1 
ATOM   2543 O O   . ALA B 1 71  ? -11.220 23.345  8.110   1.00 49.12 ? 66   ALA B O   1 
ATOM   2544 C CB  . ALA B 1 71  ? -8.452  22.081  7.062   1.00 48.13 ? 66   ALA B CB  1 
ATOM   2545 N N   . ASP B 1 72  ? -9.621  24.940  7.958   1.00 49.81 ? 67   ASP B N   1 
ATOM   2546 C CA  . ASP B 1 72  ? -10.472 26.042  7.528   1.00 50.19 ? 67   ASP B CA  1 
ATOM   2547 C C   . ASP B 1 72  ? -9.950  26.463  6.172   1.00 49.85 ? 67   ASP B C   1 
ATOM   2548 O O   . ASP B 1 72  ? -8.784  26.861  6.059   1.00 50.05 ? 67   ASP B O   1 
ATOM   2549 C CB  . ASP B 1 72  ? -10.344 27.216  8.503   1.00 50.58 ? 67   ASP B CB  1 
ATOM   2550 C CG  . ASP B 1 72  ? -11.554 28.148  8.488   1.00 51.90 ? 67   ASP B CG  1 
ATOM   2551 O OD1 . ASP B 1 72  ? -12.266 28.248  7.456   1.00 53.51 ? 67   ASP B OD1 1 
ATOM   2552 O OD2 . ASP B 1 72  ? -11.779 28.815  9.527   1.00 53.57 ? 67   ASP B OD2 1 
ATOM   2553 N N   . GLU B 1 73  ? -10.803 26.366  5.143   1.00 49.82 ? 68   GLU B N   1 
ATOM   2554 C CA  . GLU B 1 73  ? -10.425 26.729  3.765   1.00 49.32 ? 68   GLU B CA  1 
ATOM   2555 C C   . GLU B 1 73  ? -10.095 28.203  3.654   1.00 48.50 ? 68   GLU B C   1 
ATOM   2556 O O   . GLU B 1 73  ? -9.223  28.589  2.883   1.00 48.15 ? 68   GLU B O   1 
ATOM   2557 C CB  . GLU B 1 73  ? -11.527 26.374  2.746   1.00 49.53 ? 68   GLU B CB  1 
ATOM   2558 C CG  . GLU B 1 73  ? -11.703 24.879  2.456   1.00 50.54 ? 68   GLU B CG  1 
ATOM   2559 C CD  . GLU B 1 73  ? -10.439 24.189  1.973   1.00 51.65 ? 68   GLU B CD  1 
ATOM   2560 O OE1 . GLU B 1 73  ? -9.617  24.826  1.267   1.00 53.30 ? 68   GLU B OE1 1 
ATOM   2561 O OE2 . GLU B 1 73  ? -10.265 22.996  2.304   1.00 51.43 ? 68   GLU B OE2 1 
ATOM   2562 N N   . SER B 1 74  ? -10.793 29.020  4.430   1.00 48.09 ? 69   SER B N   1 
ATOM   2563 C CA  . SER B 1 74  ? -10.557 30.450  4.400   1.00 48.27 ? 69   SER B CA  1 
ATOM   2564 C C   . SER B 1 74  ? -9.300  30.843  5.164   1.00 47.42 ? 69   SER B C   1 
ATOM   2565 O O   . SER B 1 74  ? -9.047  32.031  5.331   1.00 47.94 ? 69   SER B O   1 
ATOM   2566 C CB  . SER B 1 74  ? -11.775 31.223  4.921   1.00 48.46 ? 69   SER B CB  1 
ATOM   2567 O OG  . SER B 1 74  ? -11.723 31.417  6.328   1.00 50.38 ? 69   SER B OG  1 
ATOM   2568 N N   . LEU B 1 75  ? -8.523  29.850  5.612   1.00 46.67 ? 70   LEU B N   1 
ATOM   2569 C CA  . LEU B 1 75  ? -7.255  30.058  6.338   1.00 45.34 ? 70   LEU B CA  1 
ATOM   2570 C C   . LEU B 1 75  ? -6.151  29.097  5.835   1.00 44.70 ? 70   LEU B C   1 
ATOM   2571 O O   . LEU B 1 75  ? -5.763  28.149  6.524   1.00 45.15 ? 70   LEU B O   1 
ATOM   2572 C CB  . LEU B 1 75  ? -7.455  29.879  7.848   1.00 45.52 ? 70   LEU B CB  1 
ATOM   2573 C CG  . LEU B 1 75  ? -8.467  30.722  8.626   1.00 45.32 ? 70   LEU B CG  1 
ATOM   2574 C CD1 . LEU B 1 75  ? -8.757  30.094  10.001  1.00 46.41 ? 70   LEU B CD1 1 
ATOM   2575 C CD2 . LEU B 1 75  ? -7.987  32.150  8.781   1.00 46.25 ? 70   LEU B CD2 1 
ATOM   2576 N N   . PRO B 1 76  ? -5.604  29.370  4.654   1.00 43.58 ? 71   PRO B N   1 
ATOM   2577 C CA  . PRO B 1 76  ? -4.720  28.434  3.958   1.00 42.67 ? 71   PRO B CA  1 
ATOM   2578 C C   . PRO B 1 76  ? -3.520  27.994  4.768   1.00 41.32 ? 71   PRO B C   1 
ATOM   2579 O O   . PRO B 1 76  ? -2.889  26.990  4.415   1.00 40.92 ? 71   PRO B O   1 
ATOM   2580 C CB  . PRO B 1 76  ? -4.215  29.238  2.759   1.00 42.27 ? 71   PRO B CB  1 
ATOM   2581 C CG  . PRO B 1 76  ? -5.117  30.395  2.641   1.00 43.73 ? 71   PRO B CG  1 
ATOM   2582 C CD  . PRO B 1 76  ? -5.760  30.649  3.939   1.00 44.08 ? 71   PRO B CD  1 
ATOM   2583 N N   . ASP B 1 77  ? -3.185  28.751  5.818   1.00 40.18 ? 72   ASP B N   1 
ATOM   2584 C CA  . ASP B 1 77  ? -1.972  28.480  6.631   1.00 39.39 ? 72   ASP B CA  1 
ATOM   2585 C C   . ASP B 1 77  ? -2.251  27.854  8.014   1.00 38.65 ? 72   ASP B C   1 
ATOM   2586 O O   . ASP B 1 77  ? -1.329  27.688  8.816   1.00 38.09 ? 72   ASP B O   1 
ATOM   2587 C CB  . ASP B 1 77  ? -1.138  29.755  6.793   1.00 38.35 ? 72   ASP B CB  1 
ATOM   2588 C CG  . ASP B 1 77  ? -0.166  29.972  5.656   1.00 38.39 ? 72   ASP B CG  1 
ATOM   2589 O OD1 . ASP B 1 77  ? 0.699   29.096  5.418   1.00 37.84 ? 72   ASP B OD1 1 
ATOM   2590 O OD2 . ASP B 1 77  ? -0.240  31.044  5.011   1.00 37.45 ? 72   ASP B OD2 1 
ATOM   2591 N N   . CYS B 1 78  ? -3.501  27.459  8.250   1.00 38.26 ? 73   CYS B N   1 
ATOM   2592 C CA  . CYS B 1 78  ? -3.965  26.976  9.561   1.00 37.90 ? 73   CYS B CA  1 
ATOM   2593 C C   . CYS B 1 78  ? -3.295  25.697  10.060  1.00 37.81 ? 73   CYS B C   1 
ATOM   2594 O O   . CYS B 1 78  ? -3.349  25.398  11.261  1.00 38.24 ? 73   CYS B O   1 
ATOM   2595 C CB  . CYS B 1 78  ? -5.488  26.846  9.579   1.00 37.32 ? 73   CYS B CB  1 
ATOM   2596 S SG  . CYS B 1 78  ? -6.104  25.595  8.426   1.00 38.15 ? 73   CYS B SG  1 
ATOM   2597 N N   . VAL B 1 79  ? -2.642  24.966  9.162   1.00 37.09 ? 74   VAL B N   1 
ATOM   2598 C CA  . VAL B 1 79  ? -1.817  23.819  9.553   1.00 36.55 ? 74   VAL B CA  1 
ATOM   2599 C C   . VAL B 1 79  ? -0.658  24.239  10.476  1.00 35.88 ? 74   VAL B C   1 
ATOM   2600 O O   . VAL B 1 79  ? -0.224  23.478  11.338  1.00 35.44 ? 74   VAL B O   1 
ATOM   2601 C CB  . VAL B 1 79  ? -1.300  23.011  8.317   1.00 35.84 ? 74   VAL B CB  1 
ATOM   2602 C CG1 . VAL B 1 79  ? -0.461  23.872  7.354   1.00 36.15 ? 74   VAL B CG1 1 
ATOM   2603 C CG2 . VAL B 1 79  ? -0.526  21.771  8.720   1.00 34.56 ? 74   VAL B CG2 1 
ATOM   2604 N N   . PHE B 1 80  ? -0.173  25.459  10.282  1.00 36.17 ? 75   PHE B N   1 
ATOM   2605 C CA  . PHE B 1 80  ? 1.035   25.960  10.962  1.00 34.75 ? 75   PHE B CA  1 
ATOM   2606 C C   . PHE B 1 80  ? 0.710   26.558  12.350  1.00 35.18 ? 75   PHE B C   1 
ATOM   2607 O O   . PHE B 1 80  ? 1.009   27.725  12.650  1.00 34.16 ? 75   PHE B O   1 
ATOM   2608 C CB  . PHE B 1 80  ? 1.784   26.895  10.017  1.00 35.34 ? 75   PHE B CB  1 
ATOM   2609 C CG  . PHE B 1 80  ? 2.206   26.213  8.726   1.00 35.79 ? 75   PHE B CG  1 
ATOM   2610 C CD1 . PHE B 1 80  ? 1.873   26.755  7.474   1.00 36.01 ? 75   PHE B CD1 1 
ATOM   2611 C CD2 . PHE B 1 80  ? 2.926   25.001  8.767   1.00 36.44 ? 75   PHE B CD2 1 
ATOM   2612 C CE1 . PHE B 1 80  ? 2.267   26.125  6.288   1.00 35.20 ? 75   PHE B CE1 1 
ATOM   2613 C CE2 . PHE B 1 80  ? 3.323   24.346  7.584   1.00 37.12 ? 75   PHE B CE2 1 
ATOM   2614 C CZ  . PHE B 1 80  ? 2.994   24.917  6.326   1.00 35.67 ? 75   PHE B CZ  1 
ATOM   2615 N N   . VAL B 1 81  ? 0.098   25.701  13.184  1.00 34.60 ? 76   VAL B N   1 
ATOM   2616 C CA  . VAL B 1 81  ? -0.396  26.020  14.540  1.00 34.98 ? 76   VAL B CA  1 
ATOM   2617 C C   . VAL B 1 81  ? 0.621   26.671  15.486  1.00 35.08 ? 76   VAL B C   1 
ATOM   2618 O O   . VAL B 1 81  ? 0.246   27.402  16.401  1.00 36.37 ? 76   VAL B O   1 
ATOM   2619 C CB  . VAL B 1 81  ? -0.919  24.731  15.281  1.00 34.06 ? 76   VAL B CB  1 
ATOM   2620 C CG1 . VAL B 1 81  ? -2.297  24.316  14.781  1.00 34.52 ? 76   VAL B CG1 1 
ATOM   2621 C CG2 . VAL B 1 81  ? 0.074   23.629  15.169  1.00 34.04 ? 76   VAL B CG2 1 
ATOM   2622 N N   . GLU B 1 82  ? 1.887   26.356  15.286  1.00 35.90 ? 77   GLU B N   1 
ATOM   2623 C CA  . GLU B 1 82  ? 2.948   26.912  16.093  1.00 36.31 ? 77   GLU B CA  1 
ATOM   2624 C C   . GLU B 1 82  ? 2.964   28.432  16.126  1.00 37.01 ? 77   GLU B C   1 
ATOM   2625 O O   . GLU B 1 82  ? 3.091   29.030  17.206  1.00 35.70 ? 77   GLU B O   1 
ATOM   2626 C CB  . GLU B 1 82  ? 4.285   26.411  15.641  1.00 36.56 ? 77   GLU B CB  1 
ATOM   2627 C CG  . GLU B 1 82  ? 5.434   27.220  16.255  1.00 37.93 ? 77   GLU B CG  1 
ATOM   2628 C CD  . GLU B 1 82  ? 6.744   26.529  16.140  1.00 37.90 ? 77   GLU B CD  1 
ATOM   2629 O OE1 . GLU B 1 82  ? 7.475   26.765  15.162  1.00 41.96 ? 77   GLU B OE1 1 
ATOM   2630 O OE2 . GLU B 1 82  ? 7.069   25.710  17.016  1.00 43.70 ? 77   GLU B OE2 1 
ATOM   2631 N N   . ASP B 1 83  ? 2.817   29.077  14.971  1.00 36.34 ? 78   ASP B N   1 
ATOM   2632 C CA  . ASP B 1 83  ? 2.820   30.535  14.978  1.00 36.65 ? 78   ASP B CA  1 
ATOM   2633 C C   . ASP B 1 83  ? 1.728   31.187  15.867  1.00 36.38 ? 78   ASP B C   1 
ATOM   2634 O O   . ASP B 1 83  ? 1.896   32.330  16.310  1.00 36.42 ? 78   ASP B O   1 
ATOM   2635 C CB  . ASP B 1 83  ? 2.800   31.117  13.547  1.00 36.40 ? 78   ASP B CB  1 
ATOM   2636 C CG  . ASP B 1 83  ? 3.886   30.553  12.674  1.00 38.07 ? 78   ASP B CG  1 
ATOM   2637 O OD1 . ASP B 1 83  ? 5.089   30.647  12.994  1.00 37.49 ? 78   ASP B OD1 1 
ATOM   2638 O OD2 . ASP B 1 83  ? 3.542   29.980  11.631  1.00 42.82 ? 78   ASP B OD2 1 
ATOM   2639 N N   . VAL B 1 84  ? 0.636   30.477  16.140  1.00 35.81 ? 79   VAL B N   1 
ATOM   2640 C CA  . VAL B 1 84  ? -0.505  31.079  16.873  1.00 35.71 ? 79   VAL B CA  1 
ATOM   2641 C C   . VAL B 1 84  ? -0.503  30.888  18.417  1.00 35.75 ? 79   VAL B C   1 
ATOM   2642 O O   . VAL B 1 84  ? -1.322  31.493  19.116  1.00 36.46 ? 79   VAL B O   1 
ATOM   2643 C CB  . VAL B 1 84  ? -1.890  30.671  16.276  1.00 35.93 ? 79   VAL B CB  1 
ATOM   2644 C CG1 . VAL B 1 84  ? -1.993  31.133  14.789  1.00 37.19 ? 79   VAL B CG1 1 
ATOM   2645 C CG2 . VAL B 1 84  ? -2.166  29.156  16.406  1.00 36.23 ? 79   VAL B CG2 1 
ATOM   2646 N N   . ALA B 1 85  ? 0.387   30.040  18.912  1.00 34.75 ? 80   ALA B N   1 
ATOM   2647 C CA  . ALA B 1 85  ? 0.529   29.771  20.346  1.00 34.83 ? 80   ALA B CA  1 
ATOM   2648 C C   . ALA B 1 85  ? 1.963   29.415  20.756  1.00 34.46 ? 80   ALA B C   1 
ATOM   2649 O O   . ALA B 1 85  ? 2.661   28.620  20.091  1.00 32.63 ? 80   ALA B O   1 
ATOM   2650 C CB  . ALA B 1 85  ? -0.419  28.644  20.774  1.00 35.40 ? 80   ALA B CB  1 
ATOM   2651 N N   . VAL B 1 86  ? 2.372   30.015  21.879  1.00 35.40 ? 81   VAL B N   1 
ATOM   2652 C CA  . VAL B 1 86  ? 3.543   29.602  22.643  1.00 35.48 ? 81   VAL B CA  1 
ATOM   2653 C C   . VAL B 1 86  ? 3.030   29.105  24.025  1.00 36.32 ? 81   VAL B C   1 
ATOM   2654 O O   . VAL B 1 86  ? 2.300   29.803  24.757  1.00 35.76 ? 81   VAL B O   1 
ATOM   2655 C CB  . VAL B 1 86  ? 4.644   30.717  22.764  1.00 36.29 ? 81   VAL B CB  1 
ATOM   2656 C CG1 . VAL B 1 86  ? 5.947   30.177  23.378  1.00 34.19 ? 81   VAL B CG1 1 
ATOM   2657 C CG2 . VAL B 1 86  ? 4.996   31.261  21.382  1.00 35.39 ? 81   VAL B CG2 1 
ATOM   2658 N N   . VAL B 1 87  ? 3.418   27.884  24.338  1.00 36.93 ? 82   VAL B N   1 
ATOM   2659 C CA  . VAL B 1 87  ? 3.068   27.244  25.607  1.00 37.73 ? 82   VAL B CA  1 
ATOM   2660 C C   . VAL B 1 87  ? 4.315   27.066  26.425  1.00 38.21 ? 82   VAL B C   1 
ATOM   2661 O O   . VAL B 1 87  ? 5.293   26.503  25.947  1.00 37.67 ? 82   VAL B O   1 
ATOM   2662 C CB  . VAL B 1 87  ? 2.396   25.898  25.349  1.00 36.99 ? 82   VAL B CB  1 
ATOM   2663 C CG1 . VAL B 1 87  ? 2.331   25.046  26.630  1.00 38.04 ? 82   VAL B CG1 1 
ATOM   2664 C CG2 . VAL B 1 87  ? 1.006   26.149  24.810  1.00 37.26 ? 82   VAL B CG2 1 
ATOM   2665 N N   . CYS B 1 88  ? 4.292   27.574  27.659  1.00 40.44 ? 83   CYS B N   1 
ATOM   2666 C CA  . CYS B 1 88  ? 5.384   27.277  28.606  1.00 40.81 ? 83   CYS B CA  1 
ATOM   2667 C C   . CYS B 1 88  ? 4.821   26.785  29.934  1.00 40.97 ? 83   CYS B C   1 
ATOM   2668 O O   . CYS B 1 88  ? 3.934   27.426  30.557  1.00 40.22 ? 83   CYS B O   1 
ATOM   2669 C CB  . CYS B 1 88  ? 6.315   28.483  28.798  1.00 41.87 ? 83   CYS B CB  1 
ATOM   2670 S SG  . CYS B 1 88  ? 7.843   28.129  29.730  1.00 43.61 ? 83   CYS B SG  1 
ATOM   2671 N N   . GLU B 1 89  ? 5.300   25.611  30.341  1.00 40.76 ? 84   GLU B N   1 
ATOM   2672 C CA  . GLU B 1 89  ? 4.693   24.909  31.470  1.00 41.79 ? 84   GLU B CA  1 
ATOM   2673 C C   . GLU B 1 89  ? 3.161   24.924  31.324  1.00 41.43 ? 84   GLU B C   1 
ATOM   2674 O O   . GLU B 1 89  ? 2.635   24.348  30.365  1.00 41.39 ? 84   GLU B O   1 
ATOM   2675 C CB  . GLU B 1 89  ? 5.165   25.525  32.792  1.00 41.79 ? 84   GLU B CB  1 
ATOM   2676 C CG  . GLU B 1 89  ? 6.681   25.361  32.975  1.00 44.40 ? 84   GLU B CG  1 
ATOM   2677 C CD  . GLU B 1 89  ? 7.243   26.188  34.125  1.00 49.36 ? 84   GLU B CD  1 
ATOM   2678 O OE1 . GLU B 1 89  ? 6.534   26.374  35.147  1.00 51.83 ? 84   GLU B OE1 1 
ATOM   2679 O OE2 . GLU B 1 89  ? 8.402   26.647  34.008  1.00 50.18 ? 84   GLU B OE2 1 
ATOM   2680 N N   . GLU B 1 90  ? 2.460   25.600  32.239  1.00 40.56 ? 85   GLU B N   1 
ATOM   2681 C CA  . GLU B 1 90  ? 0.992   25.648  32.217  1.00 40.78 ? 85   GLU B CA  1 
ATOM   2682 C C   . GLU B 1 90  ? 0.385   26.914  31.589  1.00 40.75 ? 85   GLU B C   1 
ATOM   2683 O O   . GLU B 1 90  ? -0.847  27.087  31.570  1.00 40.90 ? 85   GLU B O   1 
ATOM   2684 C CB  . GLU B 1 90  ? 0.428   25.448  33.642  1.00 40.91 ? 85   GLU B CB  1 
ATOM   2685 N N   . THR B 1 91  ? 1.238   27.794  31.076  1.00 41.07 ? 86   THR B N   1 
ATOM   2686 C CA  . THR B 1 91  ? 0.764   29.031  30.437  1.00 41.34 ? 86   THR B CA  1 
ATOM   2687 C C   . THR B 1 91  ? 0.804   28.961  28.905  1.00 41.08 ? 86   THR B C   1 
ATOM   2688 O O   . THR B 1 91  ? 1.794   28.525  28.313  1.00 40.02 ? 86   THR B O   1 
ATOM   2689 C CB  . THR B 1 91  ? 1.565   30.280  30.904  1.00 41.41 ? 86   THR B CB  1 
ATOM   2690 O OG1 . THR B 1 91  ? 1.453   30.430  32.325  1.00 43.39 ? 86   THR B OG1 1 
ATOM   2691 C CG2 . THR B 1 91  ? 1.013   31.553  30.241  1.00 40.88 ? 86   THR B CG2 1 
ATOM   2692 N N   . ALA B 1 92  ? -0.280  29.429  28.292  1.00 41.48 ? 87   ALA B N   1 
ATOM   2693 C CA  . ALA B 1 92  ? -0.402  29.509  26.834  1.00 41.63 ? 87   ALA B CA  1 
ATOM   2694 C C   . ALA B 1 92  ? -0.511  30.957  26.372  1.00 41.65 ? 87   ALA B C   1 
ATOM   2695 O O   . ALA B 1 92  ? -1.506  31.627  26.647  1.00 41.53 ? 87   ALA B O   1 
ATOM   2696 C CB  . ALA B 1 92  ? -1.632  28.705  26.367  1.00 41.40 ? 87   ALA B CB  1 
ATOM   2697 N N   . LEU B 1 93  ? 0.516   31.442  25.680  1.00 42.12 ? 88   LEU B N   1 
ATOM   2698 C CA  . LEU B 1 93  ? 0.415   32.737  24.998  1.00 42.99 ? 88   LEU B CA  1 
ATOM   2699 C C   . LEU B 1 93  ? -0.235  32.532  23.620  1.00 43.44 ? 88   LEU B C   1 
ATOM   2700 O O   . LEU B 1 93  ? 0.388   31.948  22.724  1.00 43.87 ? 88   LEU B O   1 
ATOM   2701 C CB  . LEU B 1 93  ? 1.790   33.407  24.862  1.00 42.59 ? 88   LEU B CB  1 
ATOM   2702 C CG  . LEU B 1 93  ? 1.823   34.752  24.121  1.00 43.49 ? 88   LEU B CG  1 
ATOM   2703 C CD1 . LEU B 1 93  ? 1.041   35.809  24.832  1.00 45.41 ? 88   LEU B CD1 1 
ATOM   2704 C CD2 . LEU B 1 93  ? 3.228   35.215  23.937  1.00 43.63 ? 88   LEU B CD2 1 
ATOM   2705 N N   . ILE B 1 94  ? -1.497  32.958  23.494  1.00 43.52 ? 89   ILE B N   1 
ATOM   2706 C CA  . ILE B 1 94  ? -2.159  33.097  22.201  1.00 43.75 ? 89   ILE B CA  1 
ATOM   2707 C C   . ILE B 1 94  ? -1.623  34.351  21.486  1.00 43.24 ? 89   ILE B C   1 
ATOM   2708 O O   . ILE B 1 94  ? -1.789  35.468  21.972  1.00 42.75 ? 89   ILE B O   1 
ATOM   2709 C CB  . ILE B 1 94  ? -3.685  33.245  22.354  1.00 43.52 ? 89   ILE B CB  1 
ATOM   2710 C CG1 . ILE B 1 94  ? -4.260  32.179  23.299  1.00 44.09 ? 89   ILE B CG1 1 
ATOM   2711 C CG2 . ILE B 1 94  ? -4.352  33.192  20.978  1.00 44.76 ? 89   ILE B CG2 1 
ATOM   2712 C CD1 . ILE B 1 94  ? -4.300  30.755  22.752  1.00 40.18 ? 89   ILE B CD1 1 
ATOM   2713 N N   . THR B 1 95  ? -0.993  34.161  20.330  1.00 42.72 ? 90   THR B N   1 
ATOM   2714 C CA  . THR B 1 95  ? -0.252  35.254  19.678  1.00 42.11 ? 90   THR B CA  1 
ATOM   2715 C C   . THR B 1 95  ? -1.158  36.157  18.857  1.00 41.40 ? 90   THR B C   1 
ATOM   2716 O O   . THR B 1 95  ? -2.368  35.974  18.828  1.00 42.27 ? 90   THR B O   1 
ATOM   2717 C CB  . THR B 1 95  ? 0.882   34.724  18.807  1.00 42.37 ? 90   THR B CB  1 
ATOM   2718 O OG1 . THR B 1 95  ? 0.326   34.170  17.599  1.00 41.76 ? 90   THR B OG1 1 
ATOM   2719 C CG2 . THR B 1 95  ? 1.698   33.653  19.567  1.00 42.71 ? 90   THR B CG2 1 
ATOM   2720 N N   . ARG B 1 96  ? -0.569  37.180  18.252  1.00 41.42 ? 91   ARG B N   1 
ATOM   2721 C CA  . ARG B 1 96  ? -1.245  38.028  17.268  1.00 41.44 ? 91   ARG B CA  1 
ATOM   2722 C C   . ARG B 1 96  ? -0.316  37.987  16.055  1.00 40.96 ? 91   ARG B C   1 
ATOM   2723 O O   . ARG B 1 96  ? 0.667   38.726  16.003  1.00 39.88 ? 91   ARG B O   1 
ATOM   2724 C CB  . ARG B 1 96  ? -1.465  39.470  17.777  1.00 41.31 ? 91   ARG B CB  1 
ATOM   2725 C CG  . ARG B 1 96  ? -2.856  40.032  17.381  1.00 42.43 ? 91   ARG B CG  1 
ATOM   2726 C CD  . ARG B 1 96  ? -3.094  41.450  17.914  1.00 42.37 ? 91   ARG B CD  1 
ATOM   2727 N NE  . ARG B 1 96  ? -4.025  42.235  17.099  1.00 37.70 ? 91   ARG B NE  1 
ATOM   2728 C CZ  . ARG B 1 96  ? -3.633  43.167  16.224  1.00 39.49 ? 91   ARG B CZ  1 
ATOM   2729 N NH1 . ARG B 1 96  ? -2.321  43.422  16.029  1.00 34.76 ? 91   ARG B NH1 1 
ATOM   2730 N NH2 . ARG B 1 96  ? -4.552  43.843  15.529  1.00 38.74 ? 91   ARG B NH2 1 
ATOM   2731 N N   . PRO B 1 97  ? -0.557  37.013  15.136  1.00 40.63 ? 92   PRO B N   1 
ATOM   2732 C CA  . PRO B 1 97  ? 0.300   36.793  13.964  1.00 40.51 ? 92   PRO B CA  1 
ATOM   2733 C C   . PRO B 1 97  ? 0.647   38.078  13.196  1.00 40.13 ? 92   PRO B C   1 
ATOM   2734 O O   . PRO B 1 97  ? -0.167  38.980  13.097  1.00 40.05 ? 92   PRO B O   1 
ATOM   2735 C CB  . PRO B 1 97  ? -0.533  35.864  13.073  1.00 40.65 ? 92   PRO B CB  1 
ATOM   2736 C CG  . PRO B 1 97  ? -1.561  35.239  13.945  1.00 39.40 ? 92   PRO B CG  1 
ATOM   2737 C CD  . PRO B 1 97  ? -1.658  36.031  15.227  1.00 40.93 ? 92   PRO B CD  1 
ATOM   2738 N N   . GLY B 1 98  ? 1.857   38.136  12.663  1.00 40.70 ? 93   GLY B N   1 
ATOM   2739 C CA  . GLY B 1 98  ? 2.303   39.264  11.861  1.00 42.97 ? 93   GLY B CA  1 
ATOM   2740 C C   . GLY B 1 98  ? 1.614   39.423  10.511  1.00 43.52 ? 93   GLY B C   1 
ATOM   2741 O O   . GLY B 1 98  ? 1.643   40.513  9.919   1.00 44.09 ? 93   GLY B O   1 
ATOM   2742 N N   . ALA B 1 99  ? 1.010   38.336  10.025  1.00 43.85 ? 94   ALA B N   1 
ATOM   2743 C CA  . ALA B 1 99  ? 0.251   38.345  8.782   1.00 43.50 ? 94   ALA B CA  1 
ATOM   2744 C C   . ALA B 1 99  ? -1.214  38.450  9.136   1.00 43.63 ? 94   ALA B C   1 
ATOM   2745 O O   . ALA B 1 99  ? -1.787  37.515  9.692   1.00 44.54 ? 94   ALA B O   1 
ATOM   2746 C CB  . ALA B 1 99  ? 0.534   37.082  7.969   1.00 43.45 ? 94   ALA B CB  1 
ATOM   2747 N N   . PRO B 1 100 ? -1.822  39.617  8.881   1.00 43.55 ? 95   PRO B N   1 
ATOM   2748 C CA  . PRO B 1 100 ? -3.203  39.888  9.283   1.00 43.73 ? 95   PRO B CA  1 
ATOM   2749 C C   . PRO B 1 100 ? -4.233  38.853  8.865   1.00 44.14 ? 95   PRO B C   1 
ATOM   2750 O O   . PRO B 1 100 ? -5.235  38.660  9.557   1.00 44.12 ? 95   PRO B O   1 
ATOM   2751 C CB  . PRO B 1 100 ? -3.499  41.234  8.601   1.00 43.93 ? 95   PRO B CB  1 
ATOM   2752 C CG  . PRO B 1 100 ? -2.178  41.908  8.530   1.00 43.75 ? 95   PRO B CG  1 
ATOM   2753 C CD  . PRO B 1 100 ? -1.187  40.803  8.263   1.00 43.59 ? 95   PRO B CD  1 
ATOM   2754 N N   . SER B 1 101 ? -3.994  38.213  7.725   1.00 44.49 ? 96   SER B N   1 
ATOM   2755 C CA  . SER B 1 101 ? -4.892  37.190  7.183   1.00 44.14 ? 96   SER B CA  1 
ATOM   2756 C C   . SER B 1 101 ? -4.845  35.886  8.005   1.00 44.37 ? 96   SER B C   1 
ATOM   2757 O O   . SER B 1 101 ? -5.676  34.976  7.819   1.00 43.83 ? 96   SER B O   1 
ATOM   2758 C CB  . SER B 1 101 ? -4.518  36.905  5.722   1.00 43.10 ? 96   SER B CB  1 
ATOM   2759 O OG  . SER B 1 101 ? -3.174  36.434  5.610   1.00 43.84 ? 96   SER B OG  1 
ATOM   2760 N N   . ARG B 1 102 ? -3.862  35.797  8.899   1.00 44.14 ? 97   ARG B N   1 
ATOM   2761 C CA  . ARG B 1 102 ? -3.691  34.602  9.734   1.00 43.47 ? 97   ARG B CA  1 
ATOM   2762 C C   . ARG B 1 102 ? -4.324  34.685  11.134  1.00 44.30 ? 97   ARG B C   1 
ATOM   2763 O O   . ARG B 1 102 ? -4.271  33.731  11.906  1.00 45.29 ? 97   ARG B O   1 
ATOM   2764 C CB  . ARG B 1 102 ? -2.214  34.291  9.836   1.00 42.45 ? 97   ARG B CB  1 
ATOM   2765 C CG  . ARG B 1 102 ? -1.655  33.680  8.584   1.00 38.73 ? 97   ARG B CG  1 
ATOM   2766 C CD  . ARG B 1 102 ? -0.394  32.910  8.888   1.00 35.85 ? 97   ARG B CD  1 
ATOM   2767 N NE  . ARG B 1 102 ? -0.676  31.745  9.739   1.00 33.55 ? 97   ARG B NE  1 
ATOM   2768 C CZ  . ARG B 1 102 ? 0.253   30.974  10.279  1.00 30.38 ? 97   ARG B CZ  1 
ATOM   2769 N NH1 . ARG B 1 102 ? 1.545   31.239  10.080  1.00 28.71 ? 97   ARG B NH1 1 
ATOM   2770 N NH2 . ARG B 1 102 ? -0.126  29.937  11.029  1.00 30.69 ? 97   ARG B NH2 1 
ATOM   2771 N N   . ARG B 1 103 ? -4.947  35.807  11.453  1.00 45.21 ? 98   ARG B N   1 
ATOM   2772 C CA  . ARG B 1 103 ? -5.334  36.089  12.836  1.00 46.05 ? 98   ARG B CA  1 
ATOM   2773 C C   . ARG B 1 103 ? -6.603  35.386  13.270  1.00 46.79 ? 98   ARG B C   1 
ATOM   2774 O O   . ARG B 1 103 ? -6.866  35.282  14.463  1.00 47.97 ? 98   ARG B O   1 
ATOM   2775 C CB  . ARG B 1 103 ? -5.395  37.615  13.116  1.00 46.33 ? 98   ARG B CB  1 
ATOM   2776 C CG  . ARG B 1 103 ? -4.005  38.212  13.365  1.00 45.98 ? 98   ARG B CG  1 
ATOM   2777 C CD  . ARG B 1 103 ? -3.959  39.735  13.480  1.00 44.59 ? 98   ARG B CD  1 
ATOM   2778 N NE  . ARG B 1 103 ? -2.607  40.165  13.129  1.00 43.38 ? 98   ARG B NE  1 
ATOM   2779 C CZ  . ARG B 1 103 ? -2.291  41.334  12.575  1.00 41.46 ? 98   ARG B CZ  1 
ATOM   2780 N NH1 . ARG B 1 103 ? -3.217  42.260  12.318  1.00 39.70 ? 98   ARG B NH1 1 
ATOM   2781 N NH2 . ARG B 1 103 ? -1.027  41.577  12.279  1.00 38.63 ? 98   ARG B NH2 1 
ATOM   2782 N N   . LYS B 1 104 ? -7.374  34.857  12.326  1.00 46.74 ? 99   LYS B N   1 
ATOM   2783 C CA  . LYS B 1 104 ? -8.510  34.029  12.715  1.00 46.26 ? 99   LYS B CA  1 
ATOM   2784 C C   . LYS B 1 104 ? -8.064  32.653  13.181  1.00 46.84 ? 99   LYS B C   1 
ATOM   2785 O O   . LYS B 1 104 ? -8.865  31.901  13.747  1.00 47.03 ? 99   LYS B O   1 
ATOM   2786 C CB  . LYS B 1 104 ? -9.537  33.907  11.593  1.00 46.56 ? 99   LYS B CB  1 
ATOM   2787 N N   . GLU B 1 105 ? -6.792  32.310  12.965  1.00 45.91 ? 100  GLU B N   1 
ATOM   2788 C CA  . GLU B 1 105 ? -6.331  30.978  13.356  1.00 46.21 ? 100  GLU B CA  1 
ATOM   2789 C C   . GLU B 1 105 ? -6.325  30.804  14.879  1.00 46.83 ? 100  GLU B C   1 
ATOM   2790 O O   . GLU B 1 105 ? -6.442  29.683  15.376  1.00 46.93 ? 100  GLU B O   1 
ATOM   2791 C CB  . GLU B 1 105 ? -4.947  30.680  12.783  1.00 45.69 ? 100  GLU B CB  1 
ATOM   2792 C CG  . GLU B 1 105 ? -4.889  30.625  11.282  1.00 44.86 ? 100  GLU B CG  1 
ATOM   2793 C CD  . GLU B 1 105 ? -3.497  30.383  10.753  1.00 43.86 ? 100  GLU B CD  1 
ATOM   2794 O OE1 . GLU B 1 105 ? -2.672  29.754  11.456  1.00 42.22 ? 100  GLU B OE1 1 
ATOM   2795 O OE2 . GLU B 1 105 ? -3.215  30.835  9.615   1.00 44.08 ? 100  GLU B OE2 1 
ATOM   2796 N N   . VAL B 1 106 ? -6.212  31.919  15.599  1.00 47.35 ? 101  VAL B N   1 
ATOM   2797 C CA  . VAL B 1 106 ? -6.106  31.920  17.064  1.00 48.23 ? 101  VAL B CA  1 
ATOM   2798 C C   . VAL B 1 106 ? -7.371  31.424  17.758  1.00 49.75 ? 101  VAL B C   1 
ATOM   2799 O O   . VAL B 1 106 ? -7.309  30.900  18.877  1.00 49.91 ? 101  VAL B O   1 
ATOM   2800 C CB  . VAL B 1 106 ? -5.741  33.319  17.632  1.00 47.77 ? 101  VAL B CB  1 
ATOM   2801 C CG1 . VAL B 1 106 ? -4.556  33.890  16.904  1.00 46.04 ? 101  VAL B CG1 1 
ATOM   2802 C CG2 . VAL B 1 106 ? -6.948  34.271  17.603  1.00 46.66 ? 101  VAL B CG2 1 
ATOM   2803 N N   . ASP B 1 107 ? -8.499  31.596  17.083  1.00 50.77 ? 102  ASP B N   1 
ATOM   2804 C CA  . ASP B 1 107 ? -9.810  31.227  17.608  1.00 52.37 ? 102  ASP B CA  1 
ATOM   2805 C C   . ASP B 1 107 ? -9.925  29.740  17.917  1.00 52.30 ? 102  ASP B C   1 
ATOM   2806 O O   . ASP B 1 107 ? -10.222 29.382  19.045  1.00 52.69 ? 102  ASP B O   1 
ATOM   2807 C CB  . ASP B 1 107 ? -10.920 31.678  16.642  1.00 53.23 ? 102  ASP B CB  1 
ATOM   2808 C CG  . ASP B 1 107 ? -10.859 33.173  16.332  1.00 55.14 ? 102  ASP B CG  1 
ATOM   2809 O OD1 . ASP B 1 107 ? -10.348 33.952  17.179  1.00 56.78 ? 102  ASP B OD1 1 
ATOM   2810 O OD2 . ASP B 1 107 ? -11.322 33.562  15.240  1.00 56.77 ? 102  ASP B OD2 1 
ATOM   2811 N N   . MET B 1 108 ? -9.691  28.886  16.920  1.00 52.33 ? 103  MET B N   1 
ATOM   2812 C CA  . MET B 1 108 ? -9.648  27.444  17.141  1.00 52.60 ? 103  MET B CA  1 
ATOM   2813 C C   . MET B 1 108 ? -8.592  27.040  18.190  1.00 51.95 ? 103  MET B C   1 
ATOM   2814 O O   . MET B 1 108 ? -8.889  26.278  19.088  1.00 52.05 ? 103  MET B O   1 
ATOM   2815 C CB  . MET B 1 108 ? -9.416  26.700  15.819  1.00 53.13 ? 103  MET B CB  1 
ATOM   2816 C CG  . MET B 1 108 ? -9.646  25.186  15.851  1.00 54.88 ? 103  MET B CG  1 
ATOM   2817 S SD  . MET B 1 108 ? -11.216 24.605  15.142  1.00 59.53 ? 103  MET B SD  1 
ATOM   2818 N N   . MET B 1 109 ? -7.369  27.556  18.076  1.00 51.70 ? 104  MET B N   1 
ATOM   2819 C CA  . MET B 1 109 ? -6.315  27.260  19.045  1.00 51.30 ? 104  MET B CA  1 
ATOM   2820 C C   . MET B 1 109 ? -6.691  27.597  20.506  1.00 51.95 ? 104  MET B C   1 
ATOM   2821 O O   . MET B 1 109 ? -6.470  26.794  21.414  1.00 51.74 ? 104  MET B O   1 
ATOM   2822 C CB  . MET B 1 109 ? -5.008  27.960  18.662  1.00 51.00 ? 104  MET B CB  1 
ATOM   2823 C CG  . MET B 1 109 ? -3.835  27.606  19.558  1.00 48.57 ? 104  MET B CG  1 
ATOM   2824 S SD  . MET B 1 109 ? -3.468  25.847  19.497  1.00 47.89 ? 104  MET B SD  1 
ATOM   2825 N N   . LYS B 1 110 ? -7.256  28.776  20.723  1.00 52.63 ? 105  LYS B N   1 
ATOM   2826 C CA  . LYS B 1 110 ? -7.676  29.174  22.050  1.00 53.32 ? 105  LYS B CA  1 
ATOM   2827 C C   . LYS B 1 110 ? -8.699  28.204  22.650  1.00 53.56 ? 105  LYS B C   1 
ATOM   2828 O O   . LYS B 1 110 ? -8.587  27.851  23.820  1.00 53.80 ? 105  LYS B O   1 
ATOM   2829 C CB  . LYS B 1 110 ? -8.194  30.606  22.044  1.00 53.64 ? 105  LYS B CB  1 
ATOM   2830 C CG  . LYS B 1 110 ? -8.923  31.034  23.332  1.00 54.51 ? 105  LYS B CG  1 
ATOM   2831 C CD  . LYS B 1 110 ? -9.278  32.514  23.310  1.00 54.34 ? 105  LYS B CD  1 
ATOM   2832 C CE  . LYS B 1 110 ? -10.198 32.853  24.463  1.00 56.43 ? 105  LYS B CE  1 
ATOM   2833 N NZ  . LYS B 1 110 ? -10.333 34.328  24.634  1.00 58.79 ? 105  LYS B NZ  1 
ATOM   2834 N N   . GLU B 1 111 ? -9.669  27.750  21.855  1.00 53.94 ? 106  GLU B N   1 
ATOM   2835 C CA  . GLU B 1 111 ? -10.602 26.700  22.302  1.00 54.02 ? 106  GLU B CA  1 
ATOM   2836 C C   . GLU B 1 111 ? -9.884  25.378  22.666  1.00 53.80 ? 106  GLU B C   1 
ATOM   2837 O O   . GLU B 1 111 ? -10.202 24.748  23.663  1.00 54.25 ? 106  GLU B O   1 
ATOM   2838 C CB  . GLU B 1 111 ? -11.700 26.444  21.260  1.00 54.11 ? 106  GLU B CB  1 
ATOM   2839 C CG  . GLU B 1 111 ? -12.681 27.593  21.053  1.00 54.44 ? 106  GLU B CG  1 
ATOM   2840 N N   . ALA B 1 112 ? -8.920  24.973  21.850  1.00 53.60 ? 107  ALA B N   1 
ATOM   2841 C CA  . ALA B 1 112 ? -8.113  23.773  22.103  1.00 53.18 ? 107  ALA B CA  1 
ATOM   2842 C C   . ALA B 1 112 ? -7.373  23.771  23.450  1.00 52.73 ? 107  ALA B C   1 
ATOM   2843 O O   . ALA B 1 112 ? -7.325  22.746  24.136  1.00 51.89 ? 107  ALA B O   1 
ATOM   2844 C CB  . ALA B 1 112 ? -7.110  23.570  20.959  1.00 53.08 ? 107  ALA B CB  1 
ATOM   2845 N N   . LEU B 1 113 ? -6.795  24.915  23.807  1.00 52.97 ? 108  LEU B N   1 
ATOM   2846 C CA  . LEU B 1 113 ? -5.903  25.028  24.974  1.00 53.28 ? 108  LEU B CA  1 
ATOM   2847 C C   . LEU B 1 113 ? -6.655  25.229  26.297  1.00 54.16 ? 108  LEU B C   1 
ATOM   2848 O O   . LEU B 1 113 ? -6.163  24.838  27.359  1.00 53.62 ? 108  LEU B O   1 
ATOM   2849 C CB  . LEU B 1 113 ? -4.842  26.124  24.751  1.00 52.77 ? 108  LEU B CB  1 
ATOM   2850 C CG  . LEU B 1 113 ? -3.893  25.944  23.552  1.00 51.47 ? 108  LEU B CG  1 
ATOM   2851 C CD1 . LEU B 1 113 ? -3.073  27.203  23.267  1.00 50.52 ? 108  LEU B CD1 1 
ATOM   2852 C CD2 . LEU B 1 113 ? -2.974  24.756  23.710  1.00 47.72 ? 108  LEU B CD2 1 
ATOM   2853 N N   . GLU B 1 114 ? -7.842  25.834  26.208  1.00 55.50 ? 109  GLU B N   1 
ATOM   2854 C CA  . GLU B 1 114 ? -8.822  25.894  27.305  1.00 56.74 ? 109  GLU B CA  1 
ATOM   2855 C C   . GLU B 1 114 ? -9.255  24.503  27.802  1.00 57.03 ? 109  GLU B C   1 
ATOM   2856 O O   . GLU B 1 114 ? -9.086  24.183  28.985  1.00 57.67 ? 109  GLU B O   1 
ATOM   2857 C CB  . GLU B 1 114 ? -10.062 26.665  26.857  1.00 56.83 ? 109  GLU B CB  1 
ATOM   2858 C CG  . GLU B 1 114 ? -9.869  28.164  26.769  1.00 57.65 ? 109  GLU B CG  1 
ATOM   2859 C CD  . GLU B 1 114 ? -11.162 28.924  26.516  1.00 57.87 ? 109  GLU B CD  1 
ATOM   2860 O OE1 . GLU B 1 114 ? -12.243 28.462  26.964  1.00 60.35 ? 109  GLU B OE1 1 
ATOM   2861 O OE2 . GLU B 1 114 ? -11.085 30.003  25.880  1.00 59.27 ? 109  GLU B OE2 1 
ATOM   2862 N N   . LYS B 1 115 ? -9.830  23.692  26.909  1.00 56.78 ? 110  LYS B N   1 
ATOM   2863 C CA  . LYS B 1 115 ? -10.140 22.296  27.225  1.00 56.22 ? 110  LYS B CA  1 
ATOM   2864 C C   . LYS B 1 115 ? -8.963  21.621  27.921  1.00 56.02 ? 110  LYS B C   1 
ATOM   2865 O O   . LYS B 1 115 ? -9.155  20.808  28.838  1.00 56.14 ? 110  LYS B O   1 
ATOM   2866 C CB  . LYS B 1 115 ? -10.491 21.500  25.961  1.00 55.91 ? 110  LYS B CB  1 
ATOM   2867 C CG  . LYS B 1 115 ? -11.969 21.293  25.736  1.00 55.73 ? 110  LYS B CG  1 
ATOM   2868 N N   . LEU B 1 116 ? -7.752  21.954  27.473  1.00 55.45 ? 111  LEU B N   1 
ATOM   2869 C CA  . LEU B 1 116 ? -6.524  21.384  28.031  1.00 54.82 ? 111  LEU B CA  1 
ATOM   2870 C C   . LEU B 1 116 ? -6.098  22.052  29.339  1.00 54.65 ? 111  LEU B C   1 
ATOM   2871 O O   . LEU B 1 116 ? -5.046  21.725  29.902  1.00 54.50 ? 111  LEU B O   1 
ATOM   2872 C CB  . LEU B 1 116 ? -5.396  21.390  26.997  1.00 54.62 ? 111  LEU B CB  1 
ATOM   2873 C CG  . LEU B 1 116 ? -5.561  20.421  25.823  1.00 54.36 ? 111  LEU B CG  1 
ATOM   2874 C CD1 . LEU B 1 116 ? -4.519  20.679  24.745  1.00 54.57 ? 111  LEU B CD1 1 
ATOM   2875 C CD2 . LEU B 1 116 ? -5.514  18.974  26.284  1.00 55.38 ? 111  LEU B CD2 1 
ATOM   2876 N N   . GLN B 1 117 ? -6.934  22.972  29.822  1.00 54.60 ? 112  GLN B N   1 
ATOM   2877 C CA  . GLN B 1 117 ? -6.840  23.531  31.186  1.00 54.84 ? 112  GLN B CA  1 
ATOM   2878 C C   . GLN B 1 117 ? -5.599  24.382  31.408  1.00 54.52 ? 112  GLN B C   1 
ATOM   2879 O O   . GLN B 1 117 ? -5.256  24.729  32.540  1.00 54.96 ? 112  GLN B O   1 
ATOM   2880 C CB  . GLN B 1 117 ? -6.960  22.427  32.259  1.00 55.20 ? 112  GLN B CB  1 
ATOM   2881 C CG  . GLN B 1 117 ? -8.330  21.700  32.281  1.00 55.50 ? 112  GLN B CG  1 
ATOM   2882 C CD  . GLN B 1 117 ? -8.477  20.688  33.429  1.00 55.37 ? 112  GLN B CD  1 
ATOM   2883 O OE1 . GLN B 1 117 ? -9.553  20.583  34.024  1.00 56.86 ? 112  GLN B OE1 1 
ATOM   2884 N NE2 . GLN B 1 117 ? -7.407  19.939  33.737  1.00 54.04 ? 112  GLN B NE2 1 
ATOM   2885 N N   . LEU B 1 118 ? -4.940  24.743  30.313  1.00 54.04 ? 113  LEU B N   1 
ATOM   2886 C CA  . LEU B 1 118 ? -3.827  25.658  30.370  1.00 53.37 ? 113  LEU B CA  1 
ATOM   2887 C C   . LEU B 1 118 ? -4.359  27.027  30.755  1.00 53.24 ? 113  LEU B C   1 
ATOM   2888 O O   . LEU B 1 118 ? -5.550  27.305  30.606  1.00 52.78 ? 113  LEU B O   1 
ATOM   2889 C CB  . LEU B 1 118 ? -3.133  25.723  29.005  1.00 53.75 ? 113  LEU B CB  1 
ATOM   2890 C CG  . LEU B 1 118 ? -2.416  24.485  28.451  1.00 53.35 ? 113  LEU B CG  1 
ATOM   2891 C CD1 . LEU B 1 118 ? -2.025  24.772  27.038  1.00 54.46 ? 113  LEU B CD1 1 
ATOM   2892 C CD2 . LEU B 1 118 ? -1.186  24.103  29.249  1.00 53.84 ? 113  LEU B CD2 1 
ATOM   2893 N N   . ASN B 1 119 ? -3.477  27.873  31.266  1.00 53.32 ? 114  ASN B N   1 
ATOM   2894 C CA  . ASN B 1 119 ? -3.840  29.250  31.538  1.00 53.93 ? 114  ASN B CA  1 
ATOM   2895 C C   . ASN B 1 119 ? -3.497  30.154  30.353  1.00 54.03 ? 114  ASN B C   1 
ATOM   2896 O O   . ASN B 1 119 ? -2.336  30.209  29.882  1.00 53.87 ? 114  ASN B O   1 
ATOM   2897 C CB  . ASN B 1 119 ? -3.224  29.730  32.850  1.00 53.89 ? 114  ASN B CB  1 
ATOM   2898 C CG  . ASN B 1 119 ? -3.870  29.049  34.070  1.00 55.10 ? 114  ASN B CG  1 
ATOM   2899 O OD1 . ASN B 1 119 ? -5.084  29.184  34.316  1.00 54.68 ? 114  ASN B OD1 1 
ATOM   2900 N ND2 . ASN B 1 119 ? -3.068  28.302  34.818  1.00 55.43 ? 114  ASN B ND2 1 
ATOM   2901 N N   . ILE B 1 120 ? -4.521  30.863  29.889  1.00 53.94 ? 115  ILE B N   1 
ATOM   2902 C CA  . ILE B 1 120 ? -4.481  31.514  28.585  1.00 54.14 ? 115  ILE B CA  1 
ATOM   2903 C C   . ILE B 1 120 ? -4.227  33.011  28.672  1.00 54.21 ? 115  ILE B C   1 
ATOM   2904 O O   . ILE B 1 120 ? -5.010  33.776  29.261  1.00 54.53 ? 115  ILE B O   1 
ATOM   2905 C CB  . ILE B 1 120 ? -5.731  31.124  27.727  1.00 54.41 ? 115  ILE B CB  1 
ATOM   2906 C CG1 . ILE B 1 120 ? -5.500  29.743  27.104  1.00 53.65 ? 115  ILE B CG1 1 
ATOM   2907 C CG2 . ILE B 1 120 ? -6.042  32.169  26.640  1.00 54.49 ? 115  ILE B CG2 1 
ATOM   2908 C CD1 . ILE B 1 120 ? -6.753  29.044  26.647  1.00 53.22 ? 115  ILE B CD1 1 
ATOM   2909 N N   . VAL B 1 121 ? -3.090  33.395  28.104  1.00 54.21 ? 116  VAL B N   1 
ATOM   2910 C CA  . VAL B 1 121 ? -2.737  34.789  27.882  1.00 54.39 ? 116  VAL B CA  1 
ATOM   2911 C C   . VAL B 1 121 ? -2.922  35.149  26.387  1.00 54.66 ? 116  VAL B C   1 
ATOM   2912 O O   . VAL B 1 121 ? -2.344  34.504  25.492  1.00 54.49 ? 116  VAL B O   1 
ATOM   2913 C CB  . VAL B 1 121 ? -1.290  35.073  28.379  1.00 54.45 ? 116  VAL B CB  1 
ATOM   2914 C CG1 . VAL B 1 121 ? -0.794  36.441  27.936  1.00 53.71 ? 116  VAL B CG1 1 
ATOM   2915 C CG2 . VAL B 1 121 ? -1.223  34.939  29.901  1.00 54.19 ? 116  VAL B CG2 1 
ATOM   2916 N N   . GLU B 1 122 ? -3.733  36.180  26.140  1.00 54.86 ? 117  GLU B N   1 
ATOM   2917 C CA  . GLU B 1 122 ? -4.022  36.662  24.784  1.00 54.89 ? 117  GLU B CA  1 
ATOM   2918 C C   . GLU B 1 122 ? -3.302  37.944  24.396  1.00 54.53 ? 117  GLU B C   1 
ATOM   2919 O O   . GLU B 1 122 ? -3.391  38.958  25.104  1.00 54.83 ? 117  GLU B O   1 
ATOM   2920 C CB  . GLU B 1 122 ? -5.519  36.863  24.607  1.00 54.91 ? 117  GLU B CB  1 
ATOM   2921 C CG  . GLU B 1 122 ? -6.158  35.744  23.858  1.00 56.30 ? 117  GLU B CG  1 
ATOM   2922 C CD  . GLU B 1 122 ? -7.637  35.668  24.092  1.00 60.07 ? 117  GLU B CD  1 
ATOM   2923 O OE1 . GLU B 1 122 ? -8.365  35.351  23.125  1.00 61.15 ? 117  GLU B OE1 1 
ATOM   2924 O OE2 . GLU B 1 122 ? -8.076  35.921  25.243  1.00 61.31 ? 117  GLU B OE2 1 
ATOM   2925 N N   . MET B 1 123 ? -2.606  37.893  23.258  1.00 53.81 ? 118  MET B N   1 
ATOM   2926 C CA  . MET B 1 123 ? -2.057  39.087  22.609  1.00 52.21 ? 118  MET B CA  1 
ATOM   2927 C C   . MET B 1 123 ? -3.195  39.815  21.893  1.00 53.31 ? 118  MET B C   1 
ATOM   2928 O O   . MET B 1 123 ? -3.689  39.353  20.851  1.00 53.17 ? 118  MET B O   1 
ATOM   2929 C CB  . MET B 1 123 ? -0.953  38.694  21.628  1.00 52.61 ? 118  MET B CB  1 
ATOM   2930 C CG  . MET B 1 123 ? -0.104  39.828  21.105  1.00 50.27 ? 118  MET B CG  1 
ATOM   2931 S SD  . MET B 1 123 ? 1.520   39.226  20.573  1.00 47.71 ? 118  MET B SD  1 
ATOM   2932 C CE  . MET B 1 123 ? 1.966   38.206  21.989  1.00 45.70 ? 118  MET B CE  1 
ATOM   2933 N N   . LYS B 1 124 ? -3.622  40.944  22.457  1.00 53.31 ? 119  LYS B N   1 
ATOM   2934 C CA  . LYS B 1 124 ? -4.762  41.689  21.901  1.00 53.55 ? 119  LYS B CA  1 
ATOM   2935 C C   . LYS B 1 124 ? -4.425  43.140  21.534  1.00 53.76 ? 119  LYS B C   1 
ATOM   2936 O O   . LYS B 1 124 ? -5.232  43.843  20.892  1.00 54.00 ? 119  LYS B O   1 
ATOM   2937 C CB  . LYS B 1 124 ? -5.970  41.626  22.842  1.00 53.64 ? 119  LYS B CB  1 
ATOM   2938 C CG  . LYS B 1 124 ? -6.690  40.285  22.856  1.00 53.89 ? 119  LYS B CG  1 
ATOM   2939 N N   . ASP B 1 125 ? -3.230  43.579  21.930  1.00 53.51 ? 120  ASP B N   1 
ATOM   2940 C CA  . ASP B 1 125 ? -2.769  44.927  21.646  1.00 53.67 ? 120  ASP B CA  1 
ATOM   2941 C C   . ASP B 1 125 ? -2.732  45.133  20.122  1.00 53.07 ? 120  ASP B C   1 
ATOM   2942 O O   . ASP B 1 125 ? -1.842  44.600  19.445  1.00 52.94 ? 120  ASP B O   1 
ATOM   2943 C CB  . ASP B 1 125 ? -1.372  45.159  22.261  1.00 53.79 ? 120  ASP B CB  1 
ATOM   2944 C CG  . ASP B 1 125 ? -1.071  46.643  22.527  1.00 56.64 ? 120  ASP B CG  1 
ATOM   2945 O OD1 . ASP B 1 125 ? -1.564  47.520  21.757  1.00 57.41 ? 120  ASP B OD1 1 
ATOM   2946 O OD2 . ASP B 1 125 ? -0.334  46.929  23.511  1.00 58.44 ? 120  ASP B OD2 1 
ATOM   2947 N N   . GLU B 1 126 ? -3.708  45.898  19.606  1.00 52.18 ? 121  GLU B N   1 
ATOM   2948 C CA  . GLU B 1 126 ? -3.748  46.348  18.201  1.00 51.26 ? 121  GLU B CA  1 
ATOM   2949 C C   . GLU B 1 126 ? -2.433  46.913  17.643  1.00 50.45 ? 121  GLU B C   1 
ATOM   2950 O O   . GLU B 1 126 ? -2.357  47.258  16.468  1.00 50.72 ? 121  GLU B O   1 
ATOM   2951 C CB  . GLU B 1 126 ? -4.862  47.383  17.985  1.00 51.57 ? 121  GLU B CB  1 
ATOM   2952 C CG  . GLU B 1 126 ? -6.253  46.789  17.827  1.00 52.90 ? 121  GLU B CG  1 
ATOM   2953 C CD  . GLU B 1 126 ? -7.173  47.669  16.999  1.00 55.36 ? 121  GLU B CD  1 
ATOM   2954 N N   . ASN B 1 127 ? -1.399  47.016  18.466  1.00 49.07 ? 122  ASN B N   1 
ATOM   2955 C CA  . ASN B 1 127 ? -0.126  47.553  17.995  1.00 47.76 ? 122  ASN B CA  1 
ATOM   2956 C C   . ASN B 1 127 ? 1.009   46.540  18.165  1.00 46.36 ? 122  ASN B C   1 
ATOM   2957 O O   . ASN B 1 127 ? 2.178   46.838  17.869  1.00 46.71 ? 122  ASN B O   1 
ATOM   2958 C CB  . ASN B 1 127 ? 0.178   48.920  18.664  1.00 48.31 ? 122  ASN B CB  1 
ATOM   2959 C CG  . ASN B 1 127 ? -0.978  49.947  18.502  1.00 49.95 ? 122  ASN B CG  1 
ATOM   2960 O OD1 . ASN B 1 127 ? -1.623  50.014  17.454  1.00 53.09 ? 122  ASN B OD1 1 
ATOM   2961 N ND2 . ASN B 1 127 ? -1.227  50.753  19.551  1.00 50.06 ? 122  ASN B ND2 1 
ATOM   2962 N N   . ALA B 1 128 ? 0.645   45.322  18.595  1.00 45.07 ? 123  ALA B N   1 
ATOM   2963 C CA  . ALA B 1 128 ? 1.604   44.205  18.759  1.00 43.80 ? 123  ALA B CA  1 
ATOM   2964 C C   . ALA B 1 128 ? 1.455   43.058  17.728  1.00 42.54 ? 123  ALA B C   1 
ATOM   2965 O O   . ALA B 1 128 ? 0.339   42.704  17.346  1.00 42.58 ? 123  ALA B O   1 
ATOM   2966 C CB  . ALA B 1 128 ? 1.531   43.642  20.205  1.00 43.61 ? 123  ALA B CB  1 
ATOM   2967 N N   . THR B 1 129 ? 2.579   42.488  17.287  1.00 41.43 ? 124  THR B N   1 
ATOM   2968 C CA  . THR B 1 129 ? 2.554   41.227  16.524  1.00 40.60 ? 124  THR B CA  1 
ATOM   2969 C C   . THR B 1 129 ? 3.662   40.245  16.907  1.00 39.64 ? 124  THR B C   1 
ATOM   2970 O O   . THR B 1 129 ? 4.819   40.635  17.098  1.00 40.55 ? 124  THR B O   1 
ATOM   2971 C CB  . THR B 1 129 ? 2.612   41.384  14.942  1.00 39.71 ? 124  THR B CB  1 
ATOM   2972 O OG1 . THR B 1 129 ? 3.965   41.398  14.499  1.00 41.41 ? 124  THR B OG1 1 
ATOM   2973 C CG2 . THR B 1 129 ? 1.893   42.596  14.425  1.00 40.19 ? 124  THR B CG2 1 
ATOM   2974 N N   . LEU B 1 130 ? 3.305   38.960  16.959  1.00 38.05 ? 125  LEU B N   1 
ATOM   2975 C CA  . LEU B 1 130 ? 4.292   37.877  17.151  1.00 36.87 ? 125  LEU B CA  1 
ATOM   2976 C C   . LEU B 1 130 ? 3.832   36.565  16.522  1.00 35.24 ? 125  LEU B C   1 
ATOM   2977 O O   . LEU B 1 130 ? 2.660   36.232  16.596  1.00 35.33 ? 125  LEU B O   1 
ATOM   2978 C CB  . LEU B 1 130 ? 4.586   37.643  18.645  1.00 36.55 ? 125  LEU B CB  1 
ATOM   2979 C CG  . LEU B 1 130 ? 5.810   36.763  18.894  1.00 37.67 ? 125  LEU B CG  1 
ATOM   2980 C CD1 . LEU B 1 130 ? 6.743   37.402  19.936  1.00 39.22 ? 125  LEU B CD1 1 
ATOM   2981 C CD2 . LEU B 1 130 ? 5.386   35.359  19.293  1.00 37.76 ? 125  LEU B CD2 1 
ATOM   2982 N N   . ASP B 1 131 ? 4.791   35.833  15.970  1.00 34.89 ? 126  ASP B N   1 
ATOM   2983 C CA  . ASP B 1 131 ? 4.605   34.534  15.337  1.00 35.86 ? 126  ASP B CA  1 
ATOM   2984 C C   . ASP B 1 131 ? 5.410   33.493  16.140  1.00 35.91 ? 126  ASP B C   1 
ATOM   2985 O O   . ASP B 1 131 ? 6.666   33.568  16.176  1.00 35.79 ? 126  ASP B O   1 
ATOM   2986 C CB  . ASP B 1 131 ? 5.187   34.547  13.911  1.00 35.79 ? 126  ASP B CB  1 
ATOM   2987 C CG  . ASP B 1 131 ? 4.153   34.826  12.816  1.00 35.44 ? 126  ASP B CG  1 
ATOM   2988 O OD1 . ASP B 1 131 ? 3.001   35.229  13.094  1.00 38.02 ? 126  ASP B OD1 1 
ATOM   2989 O OD2 . ASP B 1 131 ? 4.524   34.624  11.640  1.00 35.88 ? 126  ASP B OD2 1 
ATOM   2990 N N   . GLY B 1 132 ? 4.721   32.496  16.715  1.00 35.48 ? 127  GLY B N   1 
ATOM   2991 C CA  . GLY B 1 132 ? 5.416   31.440  17.499  1.00 35.51 ? 127  GLY B CA  1 
ATOM   2992 C C   . GLY B 1 132 ? 6.670   30.837  16.864  1.00 36.22 ? 127  GLY B C   1 
ATOM   2993 O O   . GLY B 1 132 ? 7.552   30.290  17.542  1.00 35.38 ? 127  GLY B O   1 
ATOM   2994 N N   . GLY B 1 133 ? 6.762   30.903  15.544  1.00 35.85 ? 128  GLY B N   1 
ATOM   2995 C CA  . GLY B 1 133 ? 7.933   30.355  14.861  1.00 36.82 ? 128  GLY B CA  1 
ATOM   2996 C C   . GLY B 1 133 ? 9.135   31.271  15.061  1.00 37.23 ? 128  GLY B C   1 
ATOM   2997 O O   . GLY B 1 133 ? 10.253  30.899  14.741  1.00 37.60 ? 128  GLY B O   1 
ATOM   2998 N N   . ASP B 1 134 ? 8.899   32.475  15.592  1.00 38.56 ? 129  ASP B N   1 
ATOM   2999 C CA  . ASP B 1 134 ? 10.016  33.352  15.968  1.00 39.28 ? 129  ASP B CA  1 
ATOM   3000 C C   . ASP B 1 134 ? 10.648  32.991  17.313  1.00 40.64 ? 129  ASP B C   1 
ATOM   3001 O O   . ASP B 1 134 ? 11.790  33.394  17.601  1.00 41.06 ? 129  ASP B O   1 
ATOM   3002 C CB  . ASP B 1 134 ? 9.584   34.817  15.969  1.00 39.55 ? 129  ASP B CB  1 
ATOM   3003 C CG  . ASP B 1 134 ? 9.658   35.454  14.587  1.00 38.42 ? 129  ASP B CG  1 
ATOM   3004 O OD1 . ASP B 1 134 ? 10.571  35.130  13.805  1.00 36.21 ? 129  ASP B OD1 1 
ATOM   3005 O OD2 . ASP B 1 134 ? 8.774   36.278  14.300  1.00 39.35 ? 129  ASP B OD2 1 
ATOM   3006 N N   . VAL B 1 135 ? 9.939   32.189  18.108  1.00 41.56 ? 130  VAL B N   1 
ATOM   3007 C CA  . VAL B 1 135 ? 10.370  31.889  19.498  1.00 42.24 ? 130  VAL B CA  1 
ATOM   3008 C C   . VAL B 1 135 ? 11.178  30.597  19.690  1.00 43.28 ? 130  VAL B C   1 
ATOM   3009 O O   . VAL B 1 135 ? 10.718  29.498  19.345  1.00 43.15 ? 130  VAL B O   1 
ATOM   3010 C CB  . VAL B 1 135 ? 9.177   31.827  20.410  1.00 41.84 ? 130  VAL B CB  1 
ATOM   3011 C CG1 . VAL B 1 135 ? 9.624   31.565  21.842  1.00 41.54 ? 130  VAL B CG1 1 
ATOM   3012 C CG2 . VAL B 1 135 ? 8.379   33.111  20.287  1.00 39.30 ? 130  VAL B CG2 1 
ATOM   3013 N N   . LEU B 1 136 ? 12.373  30.724  20.260  1.00 43.66 ? 131  LEU B N   1 
ATOM   3014 C CA  . LEU B 1 136 ? 13.136  29.564  20.668  1.00 44.82 ? 131  LEU B CA  1 
ATOM   3015 C C   . LEU B 1 136 ? 13.200  29.480  22.192  1.00 45.99 ? 131  LEU B C   1 
ATOM   3016 O O   . LEU B 1 136 ? 13.794  30.346  22.845  1.00 45.75 ? 131  LEU B O   1 
ATOM   3017 C CB  . LEU B 1 136 ? 14.535  29.592  20.089  1.00 45.03 ? 131  LEU B CB  1 
ATOM   3018 C CG  . LEU B 1 136 ? 15.370  28.345  20.401  1.00 44.94 ? 131  LEU B CG  1 
ATOM   3019 C CD1 . LEU B 1 136 ? 14.789  27.106  19.709  1.00 44.34 ? 131  LEU B CD1 1 
ATOM   3020 C CD2 . LEU B 1 136 ? 16.855  28.565  20.019  1.00 45.14 ? 131  LEU B CD2 1 
ATOM   3021 N N   . PHE B 1 137 ? 12.566  28.443  22.750  1.00 47.22 ? 132  PHE B N   1 
ATOM   3022 C CA  . PHE B 1 137 ? 12.622  28.161  24.200  1.00 47.98 ? 132  PHE B CA  1 
ATOM   3023 C C   . PHE B 1 137 ? 13.652  27.079  24.436  1.00 47.73 ? 132  PHE B C   1 
ATOM   3024 O O   . PHE B 1 137 ? 13.561  25.967  23.895  1.00 48.41 ? 132  PHE B O   1 
ATOM   3025 C CB  . PHE B 1 137 ? 11.261  27.748  24.754  1.00 48.35 ? 132  PHE B CB  1 
ATOM   3026 C CG  . PHE B 1 137 ? 11.264  27.490  26.241  1.00 50.76 ? 132  PHE B CG  1 
ATOM   3027 C CD1 . PHE B 1 137 ? 11.792  28.432  27.133  1.00 51.64 ? 132  PHE B CD1 1 
ATOM   3028 C CD2 . PHE B 1 137 ? 10.716  26.305  26.759  1.00 52.44 ? 132  PHE B CD2 1 
ATOM   3029 C CE1 . PHE B 1 137 ? 11.795  28.195  28.523  1.00 52.80 ? 132  PHE B CE1 1 
ATOM   3030 C CE2 . PHE B 1 137 ? 10.711  26.057  28.144  1.00 52.82 ? 132  PHE B CE2 1 
ATOM   3031 C CZ  . PHE B 1 137 ? 11.252  27.006  29.026  1.00 51.64 ? 132  PHE B CZ  1 
ATOM   3032 N N   . THR B 1 138 ? 14.659  27.427  25.224  1.00 47.40 ? 133  THR B N   1 
ATOM   3033 C CA  . THR B 1 138 ? 15.824  26.580  25.393  1.00 46.98 ? 133  THR B CA  1 
ATOM   3034 C C   . THR B 1 138 ? 15.623  25.568  26.518  1.00 46.65 ? 133  THR B C   1 
ATOM   3035 O O   . THR B 1 138 ? 16.389  24.603  26.630  1.00 46.05 ? 133  THR B O   1 
ATOM   3036 C CB  . THR B 1 138 ? 17.000  27.430  25.787  1.00 47.22 ? 133  THR B CB  1 
ATOM   3037 O OG1 . THR B 1 138 ? 16.566  28.301  26.845  1.00 48.21 ? 133  THR B OG1 1 
ATOM   3038 C CG2 . THR B 1 138 ? 17.489  28.267  24.585  1.00 46.68 ? 133  THR B CG2 1 
ATOM   3039 N N   . GLY B 1 139 ? 14.605  25.817  27.342  1.00 46.25 ? 134  GLY B N   1 
ATOM   3040 C CA  . GLY B 1 139 ? 14.434  25.139  28.625  1.00 46.00 ? 134  GLY B CA  1 
ATOM   3041 C C   . GLY B 1 139 ? 15.013  26.033  29.714  1.00 46.28 ? 134  GLY B C   1 
ATOM   3042 O O   . GLY B 1 139 ? 14.431  26.143  30.805  1.00 44.68 ? 134  GLY B O   1 
ATOM   3043 N N   . ARG B 1 140 ? 16.145  26.678  29.369  1.00 46.21 ? 135  ARG B N   1 
ATOM   3044 C CA  . ARG B 1 140 ? 16.867  27.662  30.196  1.00 47.06 ? 135  ARG B CA  1 
ATOM   3045 C C   . ARG B 1 140 ? 16.465  29.137  30.026  1.00 47.83 ? 135  ARG B C   1 
ATOM   3046 O O   . ARG B 1 140 ? 16.866  29.958  30.847  1.00 47.55 ? 135  ARG B O   1 
ATOM   3047 C CB  . ARG B 1 140 ? 18.388  27.566  29.939  1.00 47.11 ? 135  ARG B CB  1 
ATOM   3048 C CG  . ARG B 1 140 ? 18.965  26.154  29.951  1.00 46.08 ? 135  ARG B CG  1 
ATOM   3049 C CD  . ARG B 1 140 ? 20.356  26.117  30.581  1.00 48.73 ? 135  ARG B CD  1 
ATOM   3050 N N   . GLU B 1 141 ? 15.705  29.470  28.968  1.00 48.28 ? 136  GLU B N   1 
ATOM   3051 C CA  . GLU B 1 141 ? 15.358  30.866  28.598  1.00 49.06 ? 136  GLU B CA  1 
ATOM   3052 C C   . GLU B 1 141 ? 14.677  30.953  27.211  1.00 49.25 ? 136  GLU B C   1 
ATOM   3053 O O   . GLU B 1 141 ? 14.826  30.041  26.409  1.00 49.67 ? 136  GLU B O   1 
ATOM   3054 C CB  . GLU B 1 141 ? 16.641  31.718  28.542  1.00 48.65 ? 136  GLU B CB  1 
ATOM   3055 C CG  . GLU B 1 141 ? 17.788  31.073  27.744  1.00 48.61 ? 136  GLU B CG  1 
ATOM   3056 C CD  . GLU B 1 141 ? 19.049  31.922  27.688  1.00 49.45 ? 136  GLU B CD  1 
ATOM   3057 O OE1 . GLU B 1 141 ? 18.971  33.122  28.025  1.00 49.39 ? 136  GLU B OE1 1 
ATOM   3058 O OE2 . GLU B 1 141 ? 20.117  31.388  27.288  1.00 50.94 ? 136  GLU B OE2 1 
ATOM   3059 N N   . PHE B 1 142 ? 13.981  32.058  26.924  1.00 49.84 ? 137  PHE B N   1 
ATOM   3060 C CA  . PHE B 1 142 ? 13.481  32.353  25.560  1.00 50.34 ? 137  PHE B CA  1 
ATOM   3061 C C   . PHE B 1 142 ? 14.473  33.121  24.666  1.00 51.48 ? 137  PHE B C   1 
ATOM   3062 O O   . PHE B 1 142 ? 15.298  33.892  25.154  1.00 51.95 ? 137  PHE B O   1 
ATOM   3063 C CB  . PHE B 1 142 ? 12.166  33.145  25.624  1.00 49.45 ? 137  PHE B CB  1 
ATOM   3064 C CG  . PHE B 1 142 ? 11.019  32.357  26.157  1.00 48.73 ? 137  PHE B CG  1 
ATOM   3065 C CD1 . PHE B 1 142 ? 10.757  32.330  27.520  1.00 47.50 ? 137  PHE B CD1 1 
ATOM   3066 C CD2 . PHE B 1 142 ? 10.214  31.599  25.297  1.00 47.62 ? 137  PHE B CD2 1 
ATOM   3067 C CE1 . PHE B 1 142 ? 9.713   31.593  28.019  1.00 47.41 ? 137  PHE B CE1 1 
ATOM   3068 C CE2 . PHE B 1 142 ? 9.158   30.858  25.783  1.00 45.18 ? 137  PHE B CE2 1 
ATOM   3069 C CZ  . PHE B 1 142 ? 8.902   30.845  27.153  1.00 47.68 ? 137  PHE B CZ  1 
ATOM   3070 N N   . PHE B 1 143 ? 14.399  32.883  23.358  1.00 52.17 ? 138  PHE B N   1 
ATOM   3071 C CA  . PHE B 1 143 ? 14.953  33.803  22.348  1.00 52.39 ? 138  PHE B CA  1 
ATOM   3072 C C   . PHE B 1 143 ? 13.807  34.144  21.402  1.00 52.67 ? 138  PHE B C   1 
ATOM   3073 O O   . PHE B 1 143 ? 12.930  33.301  21.138  1.00 52.16 ? 138  PHE B O   1 
ATOM   3074 C CB  . PHE B 1 143 ? 16.100  33.170  21.572  1.00 52.47 ? 138  PHE B CB  1 
ATOM   3075 C CG  . PHE B 1 143 ? 17.350  32.959  22.389  1.00 53.66 ? 138  PHE B CG  1 
ATOM   3076 C CD1 . PHE B 1 143 ? 17.592  31.742  23.023  1.00 54.54 ? 138  PHE B CD1 1 
ATOM   3077 C CD2 . PHE B 1 143 ? 18.294  33.983  22.533  1.00 53.75 ? 138  PHE B CD2 1 
ATOM   3078 C CE1 . PHE B 1 143 ? 18.777  31.546  23.782  1.00 54.34 ? 138  PHE B CE1 1 
ATOM   3079 C CE2 . PHE B 1 143 ? 19.462  33.786  23.295  1.00 53.24 ? 138  PHE B CE2 1 
ATOM   3080 C CZ  . PHE B 1 143 ? 19.697  32.570  23.917  1.00 51.68 ? 138  PHE B CZ  1 
ATOM   3081 N N   . VAL B 1 144 ? 13.783  35.378  20.911  1.00 52.23 ? 139  VAL B N   1 
ATOM   3082 C CA  . VAL B 1 144 ? 12.662  35.829  20.093  1.00 52.27 ? 139  VAL B CA  1 
ATOM   3083 C C   . VAL B 1 144 ? 13.168  36.625  18.897  1.00 52.18 ? 139  VAL B C   1 
ATOM   3084 O O   . VAL B 1 144 ? 13.864  37.632  19.040  1.00 51.90 ? 139  VAL B O   1 
ATOM   3085 C CB  . VAL B 1 144 ? 11.665  36.681  20.899  1.00 52.28 ? 139  VAL B CB  1 
ATOM   3086 C CG1 . VAL B 1 144 ? 10.453  37.020  20.067  1.00 51.93 ? 139  VAL B CG1 1 
ATOM   3087 C CG2 . VAL B 1 144 ? 11.242  35.967  22.178  1.00 53.31 ? 139  VAL B CG2 1 
ATOM   3088 N N   . GLY B 1 145 ? 12.827  36.139  17.715  1.00 52.14 ? 140  GLY B N   1 
ATOM   3089 C CA  . GLY B 1 145 ? 13.170  36.808  16.473  1.00 51.21 ? 140  GLY B CA  1 
ATOM   3090 C C   . GLY B 1 145 ? 12.436  38.125  16.316  1.00 50.57 ? 140  GLY B C   1 
ATOM   3091 O O   . GLY B 1 145 ? 11.220  38.224  16.524  1.00 50.26 ? 140  GLY B O   1 
ATOM   3092 N N   . LEU B 1 146 ? 13.211  39.149  15.986  1.00 50.28 ? 141  LEU B N   1 
ATOM   3093 C CA  . LEU B 1 146 ? 12.677  40.424  15.555  1.00 49.50 ? 141  LEU B CA  1 
ATOM   3094 C C   . LEU B 1 146 ? 12.560  40.276  14.040  1.00 48.20 ? 141  LEU B C   1 
ATOM   3095 O O   . LEU B 1 146 ? 13.572  40.020  13.356  1.00 47.62 ? 141  LEU B O   1 
ATOM   3096 C CB  . LEU B 1 146 ? 13.638  41.551  15.952  1.00 49.89 ? 141  LEU B CB  1 
ATOM   3097 N N   . SER B 1 147 ? 11.334  40.397  13.524  1.00 46.70 ? 142  SER B N   1 
ATOM   3098 C CA  . SER B 1 147 ? 11.051  39.928  12.159  1.00 45.58 ? 142  SER B CA  1 
ATOM   3099 C C   . SER B 1 147 ? 10.015  40.732  11.359  1.00 45.58 ? 142  SER B C   1 
ATOM   3100 O O   . SER B 1 147 ? 9.395   41.678  11.872  1.00 45.87 ? 142  SER B O   1 
ATOM   3101 C CB  . SER B 1 147 ? 10.507  38.490  12.261  1.00 45.53 ? 142  SER B CB  1 
ATOM   3102 O OG  . SER B 1 147 ? 9.194   38.513  12.816  1.00 41.12 ? 142  SER B OG  1 
ATOM   3103 N N   . LYS B 1 148 ? 9.774   40.292  10.118  1.00 45.37 ? 143  LYS B N   1 
ATOM   3104 C CA  . LYS B 1 148 ? 8.622   40.754  9.340   1.00 44.77 ? 143  LYS B CA  1 
ATOM   3105 C C   . LYS B 1 148 ? 7.331   40.507  10.109  1.00 45.26 ? 143  LYS B C   1 
ATOM   3106 O O   . LYS B 1 148 ? 6.362   41.272  9.985   1.00 44.92 ? 143  LYS B O   1 
ATOM   3107 C CB  . LYS B 1 148 ? 8.554   40.014  7.998   1.00 45.14 ? 143  LYS B CB  1 
ATOM   3108 N N   . ARG B 1 149 ? 7.330   39.444  10.922  1.00 45.13 ? 144  ARG B N   1 
ATOM   3109 C CA  . ARG B 1 149 ? 6.118   38.994  11.617  1.00 45.54 ? 144  ARG B CA  1 
ATOM   3110 C C   . ARG B 1 149 ? 6.102   39.320  13.104  1.00 45.21 ? 144  ARG B C   1 
ATOM   3111 O O   . ARG B 1 149 ? 5.043   39.511  13.687  1.00 45.01 ? 144  ARG B O   1 
ATOM   3112 C CB  . ARG B 1 149 ? 5.896   37.486  11.392  1.00 46.05 ? 144  ARG B CB  1 
ATOM   3113 N N   . THR B 1 150 ? 7.278   39.422  13.701  1.00 45.58 ? 145  THR B N   1 
ATOM   3114 C CA  . THR B 1 150 ? 7.374   39.701  15.143  1.00 46.30 ? 145  THR B CA  1 
ATOM   3115 C C   . THR B 1 150 ? 8.054   41.030  15.500  1.00 45.90 ? 145  THR B C   1 
ATOM   3116 O O   . THR B 1 150 ? 9.246   41.225  15.250  1.00 45.84 ? 145  THR B O   1 
ATOM   3117 C CB  . THR B 1 150 ? 7.973   38.474  15.885  1.00 46.03 ? 145  THR B CB  1 
ATOM   3118 O OG1 . THR B 1 150 ? 7.009   37.414  15.830  1.00 46.89 ? 145  THR B OG1 1 
ATOM   3119 C CG2 . THR B 1 150 ? 8.281   38.779  17.336  1.00 45.86 ? 145  THR B CG2 1 
ATOM   3120 N N   . ASN B 1 151 ? 7.247   41.926  16.071  1.00 46.23 ? 146  ASN B N   1 
ATOM   3121 C CA  . ASN B 1 151 ? 7.667   43.275  16.430  1.00 46.94 ? 146  ASN B CA  1 
ATOM   3122 C C   . ASN B 1 151 ? 8.151   43.326  17.889  1.00 47.30 ? 146  ASN B C   1 
ATOM   3123 O O   . ASN B 1 151 ? 8.439   42.271  18.485  1.00 46.99 ? 146  ASN B O   1 
ATOM   3124 C CB  . ASN B 1 151 ? 6.599   44.352  16.052  1.00 46.45 ? 146  ASN B CB  1 
ATOM   3125 C CG  . ASN B 1 151 ? 5.352   44.323  16.932  1.00 48.69 ? 146  ASN B CG  1 
ATOM   3126 O OD1 . ASN B 1 151 ? 5.215   43.476  17.819  1.00 51.91 ? 146  ASN B OD1 1 
ATOM   3127 N ND2 . ASN B 1 151 ? 4.426   45.266  16.690  1.00 45.67 ? 146  ASN B ND2 1 
ATOM   3128 N N   . GLN B 1 152 ? 8.283   44.532  18.449  1.00 47.89 ? 147  GLN B N   1 
ATOM   3129 C CA  . GLN B 1 152 ? 8.835   44.700  19.794  1.00 47.38 ? 147  GLN B CA  1 
ATOM   3130 C C   . GLN B 1 152 ? 7.698   44.679  20.789  1.00 47.71 ? 147  GLN B C   1 
ATOM   3131 O O   . GLN B 1 152 ? 7.793   43.996  21.789  1.00 48.22 ? 147  GLN B O   1 
ATOM   3132 C CB  . GLN B 1 152 ? 9.691   45.980  19.886  1.00 48.29 ? 147  GLN B CB  1 
ATOM   3133 C CG  . GLN B 1 152 ? 10.074  46.469  21.327  1.00 47.68 ? 147  GLN B CG  1 
ATOM   3134 C CD  . GLN B 1 152 ? 11.332  45.804  21.921  1.00 47.84 ? 147  GLN B CD  1 
ATOM   3135 O OE1 . GLN B 1 152 ? 12.090  45.100  21.232  1.00 46.09 ? 147  GLN B OE1 1 
ATOM   3136 N NE2 . GLN B 1 152 ? 11.556  46.041  23.221  1.00 48.76 ? 147  GLN B NE2 1 
ATOM   3137 N N   . ARG B 1 153 ? 6.601   45.379  20.512  1.00 48.24 ? 148  ARG B N   1 
ATOM   3138 C CA  . ARG B 1 153 ? 5.431   45.333  21.411  1.00 48.93 ? 148  ARG B CA  1 
ATOM   3139 C C   . ARG B 1 153 ? 4.947   43.897  21.633  1.00 49.86 ? 148  ARG B C   1 
ATOM   3140 O O   . ARG B 1 153 ? 4.339   43.581  22.674  1.00 49.73 ? 148  ARG B O   1 
ATOM   3141 C CB  . ARG B 1 153 ? 4.286   46.222  20.893  1.00 49.29 ? 148  ARG B CB  1 
ATOM   3142 C CG  . ARG B 1 153 ? 3.067   46.393  21.838  1.00 48.47 ? 148  ARG B CG  1 
ATOM   3143 N N   . GLY B 1 154 ? 5.238   43.026  20.659  1.00 50.55 ? 149  GLY B N   1 
ATOM   3144 C CA  . GLY B 1 154 ? 4.838   41.616  20.716  1.00 50.35 ? 149  GLY B CA  1 
ATOM   3145 C C   . GLY B 1 154 ? 5.743   40.778  21.597  1.00 50.54 ? 149  GLY B C   1 
ATOM   3146 O O   . GLY B 1 154 ? 5.258   40.068  22.484  1.00 49.96 ? 149  GLY B O   1 
ATOM   3147 N N   . ALA B 1 155 ? 7.054   40.853  21.342  1.00 51.05 ? 150  ALA B N   1 
ATOM   3148 C CA  . ALA B 1 155 ? 8.073   40.185  22.156  1.00 51.53 ? 150  ALA B CA  1 
ATOM   3149 C C   . ALA B 1 155 ? 8.083   40.662  23.614  1.00 52.34 ? 150  ALA B C   1 
ATOM   3150 O O   . ALA B 1 155 ? 8.369   39.886  24.535  1.00 52.47 ? 150  ALA B O   1 
ATOM   3151 C CB  . ALA B 1 155 ? 9.428   40.386  21.540  1.00 51.61 ? 150  ALA B CB  1 
ATOM   3152 N N   . GLU B 1 156 ? 7.784   41.943  23.819  1.00 52.71 ? 151  GLU B N   1 
ATOM   3153 C CA  . GLU B 1 156 ? 7.582   42.477  25.157  1.00 53.39 ? 151  GLU B CA  1 
ATOM   3154 C C   . GLU B 1 156 ? 6.316   41.916  25.799  1.00 53.30 ? 151  GLU B C   1 
ATOM   3155 O O   . GLU B 1 156 ? 6.285   41.691  27.025  1.00 53.14 ? 151  GLU B O   1 
ATOM   3156 C CB  . GLU B 1 156 ? 7.453   44.001  25.134  1.00 53.55 ? 151  GLU B CB  1 
ATOM   3157 C CG  . GLU B 1 156 ? 8.708   44.773  24.773  1.00 53.28 ? 151  GLU B CG  1 
ATOM   3158 C CD  . GLU B 1 156 ? 8.411   46.256  24.647  1.00 53.85 ? 151  GLU B CD  1 
ATOM   3159 O OE1 . GLU B 1 156 ? 7.234   46.649  24.877  1.00 54.56 ? 151  GLU B OE1 1 
ATOM   3160 O OE2 . GLU B 1 156 ? 9.341   47.022  24.310  1.00 53.56 ? 151  GLU B OE2 1 
ATOM   3161 N N   . ILE B 1 157 ? 5.271   41.728  24.988  1.00 52.53 ? 152  ILE B N   1 
ATOM   3162 C CA  . ILE B 1 157 ? 3.978   41.283  25.500  1.00 51.99 ? 152  ILE B CA  1 
ATOM   3163 C C   . ILE B 1 157 ? 4.101   39.847  26.004  1.00 51.62 ? 152  ILE B C   1 
ATOM   3164 O O   . ILE B 1 157 ? 3.318   39.390  26.851  1.00 50.99 ? 152  ILE B O   1 
ATOM   3165 C CB  . ILE B 1 157 ? 2.892   41.340  24.429  1.00 52.37 ? 152  ILE B CB  1 
ATOM   3166 N N   . LEU B 1 158 ? 5.103   39.156  25.477  1.00 50.63 ? 153  LEU B N   1 
ATOM   3167 C CA  . LEU B 1 158 ? 5.398   37.794  25.859  1.00 50.55 ? 153  LEU B CA  1 
ATOM   3168 C C   . LEU B 1 158 ? 6.041   37.839  27.234  1.00 50.46 ? 153  LEU B C   1 
ATOM   3169 O O   . LEU B 1 158 ? 5.680   37.065  28.140  1.00 49.71 ? 153  LEU B O   1 
ATOM   3170 C CB  . LEU B 1 158 ? 6.341   37.170  24.824  1.00 50.14 ? 153  LEU B CB  1 
ATOM   3171 C CG  . LEU B 1 158 ? 6.754   35.694  24.873  1.00 49.85 ? 153  LEU B CG  1 
ATOM   3172 C CD1 . LEU B 1 158 ? 6.623   35.051  23.498  1.00 50.83 ? 153  LEU B CD1 1 
ATOM   3173 C CD2 . LEU B 1 158 ? 8.166   35.564  25.362  1.00 50.50 ? 153  LEU B CD2 1 
ATOM   3174 N N   . ALA B 1 159 ? 7.000   38.762  27.363  1.00 50.87 ? 154  ALA B N   1 
ATOM   3175 C CA  . ALA B 1 159 ? 7.758   38.994  28.596  1.00 50.76 ? 154  ALA B CA  1 
ATOM   3176 C C   . ALA B 1 159 ? 6.853   39.192  29.803  1.00 50.95 ? 154  ALA B C   1 
ATOM   3177 O O   . ALA B 1 159 ? 7.075   38.560  30.827  1.00 51.68 ? 154  ALA B O   1 
ATOM   3178 C CB  . ALA B 1 159 ? 8.666   40.161  28.419  1.00 51.01 ? 154  ALA B CB  1 
ATOM   3179 N N   . ASP B 1 160 ? 5.831   40.045  29.684  1.00 50.75 ? 155  ASP B N   1 
ATOM   3180 C CA  . ASP B 1 160 ? 4.792   40.170  30.732  1.00 51.10 ? 155  ASP B CA  1 
ATOM   3181 C C   . ASP B 1 160 ? 4.131   38.822  31.029  1.00 51.12 ? 155  ASP B C   1 
ATOM   3182 O O   . ASP B 1 160 ? 3.772   38.534  32.162  1.00 51.40 ? 155  ASP B O   1 
ATOM   3183 C CB  . ASP B 1 160 ? 3.724   41.201  30.358  1.00 50.83 ? 155  ASP B CB  1 
ATOM   3184 N N   . THR B 1 161 ? 3.990   37.994  29.995  1.00 51.28 ? 156  THR B N   1 
ATOM   3185 C CA  . THR B 1 161 ? 3.361   36.669  30.108  1.00 50.30 ? 156  THR B CA  1 
ATOM   3186 C C   . THR B 1 161 ? 4.227   35.610  30.842  1.00 49.66 ? 156  THR B C   1 
ATOM   3187 O O   . THR B 1 161 ? 3.710   34.907  31.711  1.00 49.38 ? 156  THR B O   1 
ATOM   3188 C CB  . THR B 1 161 ? 2.936   36.173  28.692  1.00 50.38 ? 156  THR B CB  1 
ATOM   3189 O OG1 . THR B 1 161 ? 1.942   37.066  28.159  1.00 50.48 ? 156  THR B OG1 1 
ATOM   3190 C CG2 . THR B 1 161 ? 2.383   34.750  28.747  1.00 49.94 ? 156  THR B CG2 1 
ATOM   3191 N N   . PHE B 1 162 ? 5.515   35.515  30.488  1.00 49.06 ? 157  PHE B N   1 
ATOM   3192 C CA  . PHE B 1 162 ? 6.439   34.492  31.008  1.00 49.11 ? 157  PHE B CA  1 
ATOM   3193 C C   . PHE B 1 162 ? 7.522   35.094  31.914  1.00 49.35 ? 157  PHE B C   1 
ATOM   3194 O O   . PHE B 1 162 ? 8.726   34.845  31.736  1.00 48.32 ? 157  PHE B O   1 
ATOM   3195 C CB  . PHE B 1 162 ? 7.136   33.718  29.867  1.00 48.88 ? 157  PHE B CB  1 
ATOM   3196 C CG  . PHE B 1 162 ? 6.201   32.950  28.980  1.00 49.29 ? 157  PHE B CG  1 
ATOM   3197 C CD1 . PHE B 1 162 ? 6.263   33.092  27.596  1.00 48.68 ? 157  PHE B CD1 1 
ATOM   3198 C CD2 . PHE B 1 162 ? 5.243   32.100  29.520  1.00 48.35 ? 157  PHE B CD2 1 
ATOM   3199 C CE1 . PHE B 1 162 ? 5.381   32.400  26.773  1.00 46.85 ? 157  PHE B CE1 1 
ATOM   3200 C CE2 . PHE B 1 162 ? 4.376   31.397  28.693  1.00 49.90 ? 157  PHE B CE2 1 
ATOM   3201 C CZ  . PHE B 1 162 ? 4.448   31.554  27.321  1.00 47.63 ? 157  PHE B CZ  1 
ATOM   3202 N N   . LYS B 1 163 ? 7.084   35.880  32.889  1.00 50.47 ? 158  LYS B N   1 
ATOM   3203 C CA  . LYS B 1 163 ? 7.992   36.608  33.804  1.00 51.38 ? 158  LYS B CA  1 
ATOM   3204 C C   . LYS B 1 163 ? 9.179   35.828  34.386  1.00 51.91 ? 158  LYS B C   1 
ATOM   3205 O O   . LYS B 1 163 ? 10.255  36.401  34.619  1.00 51.85 ? 158  LYS B O   1 
ATOM   3206 C CB  . LYS B 1 163 ? 7.212   37.291  34.941  1.00 51.45 ? 158  LYS B CB  1 
ATOM   3207 C CG  . LYS B 1 163 ? 5.834   36.724  35.255  1.00 51.36 ? 158  LYS B CG  1 
ATOM   3208 C CD  . LYS B 1 163 ? 4.918   37.861  35.683  1.00 52.47 ? 158  LYS B CD  1 
ATOM   3209 C CE  . LYS B 1 163 ? 3.452   37.491  35.591  1.00 53.64 ? 158  LYS B CE  1 
ATOM   3210 N NZ  . LYS B 1 163 ? 2.579   38.705  35.453  1.00 54.05 ? 158  LYS B NZ  1 
ATOM   3211 N N   . ASP B 1 164 ? 8.996   34.530  34.613  1.00 52.39 ? 159  ASP B N   1 
ATOM   3212 C CA  . ASP B 1 164 ? 10.032  33.736  35.281  1.00 52.49 ? 159  ASP B CA  1 
ATOM   3213 C C   . ASP B 1 164 ? 11.215  33.335  34.379  1.00 52.33 ? 159  ASP B C   1 
ATOM   3214 O O   . ASP B 1 164 ? 12.093  32.559  34.806  1.00 52.43 ? 159  ASP B O   1 
ATOM   3215 C CB  . ASP B 1 164 ? 9.417   32.501  35.961  1.00 52.94 ? 159  ASP B CB  1 
ATOM   3216 C CG  . ASP B 1 164 ? 8.258   32.845  36.917  1.00 53.85 ? 159  ASP B CG  1 
ATOM   3217 O OD1 . ASP B 1 164 ? 8.275   33.931  37.564  1.00 53.02 ? 159  ASP B OD1 1 
ATOM   3218 O OD2 . ASP B 1 164 ? 7.332   31.992  37.028  1.00 54.91 ? 159  ASP B OD2 1 
ATOM   3219 N N   . TYR B 1 165 ? 11.270  33.888  33.162  1.00 51.86 ? 160  TYR B N   1 
ATOM   3220 C CA  . TYR B 1 165 ? 12.321  33.524  32.193  1.00 51.39 ? 160  TYR B CA  1 
ATOM   3221 C C   . TYR B 1 165 ? 13.091  34.675  31.524  1.00 51.80 ? 160  TYR B C   1 
ATOM   3222 O O   . TYR B 1 165 ? 12.506  35.711  31.200  1.00 51.57 ? 160  TYR B O   1 
ATOM   3223 C CB  . TYR B 1 165 ? 11.714  32.636  31.096  1.00 50.43 ? 160  TYR B CB  1 
ATOM   3224 C CG  . TYR B 1 165 ? 11.331  31.262  31.579  1.00 48.87 ? 160  TYR B CG  1 
ATOM   3225 C CD1 . TYR B 1 165 ? 10.037  30.994  32.017  1.00 46.04 ? 160  TYR B CD1 1 
ATOM   3226 C CD2 . TYR B 1 165 ? 12.274  30.225  31.603  1.00 47.01 ? 160  TYR B CD2 1 
ATOM   3227 C CE1 . TYR B 1 165 ? 9.694   29.725  32.461  1.00 46.97 ? 160  TYR B CE1 1 
ATOM   3228 C CE2 . TYR B 1 165 ? 11.935  28.953  32.051  1.00 46.05 ? 160  TYR B CE2 1 
ATOM   3229 C CZ  . TYR B 1 165 ? 10.652  28.713  32.468  1.00 46.68 ? 160  TYR B CZ  1 
ATOM   3230 O OH  . TYR B 1 165 ? 10.326  27.454  32.913  1.00 47.82 ? 160  TYR B OH  1 
ATOM   3231 N N   . ALA B 1 166 ? 14.400  34.458  31.312  1.00 52.50 ? 161  ALA B N   1 
ATOM   3232 C CA  . ALA B 1 166 ? 15.247  35.329  30.468  1.00 52.96 ? 161  ALA B CA  1 
ATOM   3233 C C   . ALA B 1 166 ? 14.823  35.230  28.997  1.00 53.74 ? 161  ALA B C   1 
ATOM   3234 O O   . ALA B 1 166 ? 14.646  34.134  28.463  1.00 53.41 ? 161  ALA B O   1 
ATOM   3235 C CB  . ALA B 1 166 ? 16.703  34.950  30.598  1.00 52.86 ? 161  ALA B CB  1 
ATOM   3236 N N   . VAL B 1 167 ? 14.674  36.392  28.365  1.00 54.03 ? 162  VAL B N   1 
ATOM   3237 C CA  . VAL B 1 167 ? 14.148  36.533  27.012  1.00 54.45 ? 162  VAL B CA  1 
ATOM   3238 C C   . VAL B 1 167 ? 15.058  37.511  26.289  1.00 54.74 ? 162  VAL B C   1 
ATOM   3239 O O   . VAL B 1 167 ? 15.172  38.665  26.688  1.00 54.91 ? 162  VAL B O   1 
ATOM   3240 C CB  . VAL B 1 167 ? 12.733  37.152  27.033  1.00 54.45 ? 162  VAL B CB  1 
ATOM   3241 C CG1 . VAL B 1 167 ? 12.190  37.318  25.615  1.00 54.85 ? 162  VAL B CG1 1 
ATOM   3242 C CG2 . VAL B 1 167 ? 11.784  36.330  27.898  1.00 54.03 ? 162  VAL B CG2 1 
ATOM   3243 N N   . SER B 1 168 ? 15.718  37.034  25.246  1.00 54.96 ? 163  SER B N   1 
ATOM   3244 C CA  . SER B 1 168 ? 16.621  37.848  24.454  1.00 55.58 ? 163  SER B CA  1 
ATOM   3245 C C   . SER B 1 168 ? 16.051  37.976  23.037  1.00 56.06 ? 163  SER B C   1 
ATOM   3246 O O   . SER B 1 168 ? 15.513  37.002  22.494  1.00 56.07 ? 163  SER B O   1 
ATOM   3247 C CB  . SER B 1 168 ? 17.991  37.170  24.386  1.00 55.65 ? 163  SER B CB  1 
ATOM   3248 O OG  . SER B 1 168 ? 18.469  36.814  25.672  1.00 56.45 ? 163  SER B OG  1 
ATOM   3249 N N   . THR B 1 169 ? 16.150  39.162  22.438  1.00 56.16 ? 164  THR B N   1 
ATOM   3250 C CA  . THR B 1 169 ? 15.701  39.329  21.062  1.00 56.71 ? 164  THR B CA  1 
ATOM   3251 C C   . THR B 1 169 ? 16.840  39.140  20.085  1.00 57.17 ? 164  THR B C   1 
ATOM   3252 O O   . THR B 1 169 ? 18.007  39.414  20.394  1.00 57.66 ? 164  THR B O   1 
ATOM   3253 C CB  . THR B 1 169 ? 14.922  40.630  20.802  1.00 56.83 ? 164  THR B CB  1 
ATOM   3254 O OG1 . THR B 1 169 ? 15.555  41.741  21.457  1.00 57.99 ? 164  THR B OG1 1 
ATOM   3255 C CG2 . THR B 1 169 ? 13.494  40.493  21.299  1.00 56.62 ? 164  THR B CG2 1 
ATOM   3256 N N   . VAL B 1 170 ? 16.496  38.638  18.912  1.00 57.43 ? 165  VAL B N   1 
ATOM   3257 C CA  . VAL B 1 170 ? 17.464  38.385  17.866  1.00 57.81 ? 165  VAL B CA  1 
ATOM   3258 C C   . VAL B 1 170 ? 16.931  39.020  16.584  1.00 57.97 ? 165  VAL B C   1 
ATOM   3259 O O   . VAL B 1 170 ? 15.728  38.902  16.284  1.00 58.17 ? 165  VAL B O   1 
ATOM   3260 C CB  . VAL B 1 170 ? 17.666  36.878  17.622  1.00 57.80 ? 165  VAL B CB  1 
ATOM   3261 C CG1 . VAL B 1 170 ? 19.015  36.616  16.960  1.00 58.48 ? 165  VAL B CG1 1 
ATOM   3262 C CG2 . VAL B 1 170 ? 17.542  36.089  18.923  1.00 58.48 ? 165  VAL B CG2 1 
ATOM   3263 N N   . PRO B 1 171 ? 17.808  39.740  15.850  1.00 57.71 ? 166  PRO B N   1 
ATOM   3264 C CA  . PRO B 1 171 ? 17.460  40.237  14.530  1.00 57.30 ? 166  PRO B CA  1 
ATOM   3265 C C   . PRO B 1 171 ? 17.432  39.099  13.513  1.00 56.87 ? 166  PRO B C   1 
ATOM   3266 O O   . PRO B 1 171 ? 18.420  38.363  13.347  1.00 56.85 ? 166  PRO B O   1 
ATOM   3267 C CB  . PRO B 1 171 ? 18.595  41.235  14.211  1.00 57.38 ? 166  PRO B CB  1 
ATOM   3268 C CG  . PRO B 1 171 ? 19.319  41.445  15.507  1.00 57.67 ? 166  PRO B CG  1 
ATOM   3269 C CD  . PRO B 1 171 ? 19.163  40.170  16.247  1.00 57.70 ? 166  PRO B CD  1 
ATOM   3270 N N   . VAL B 1 172 ? 16.299  38.951  12.840  1.00 56.46 ? 167  VAL B N   1 
ATOM   3271 C CA  . VAL B 1 172 ? 16.140  37.863  11.889  1.00 56.47 ? 167  VAL B CA  1 
ATOM   3272 C C   . VAL B 1 172 ? 16.387  38.346  10.457  1.00 56.37 ? 167  VAL B C   1 
ATOM   3273 O O   . VAL B 1 172 ? 15.932  39.424  10.078  1.00 56.58 ? 167  VAL B O   1 
ATOM   3274 C CB  . VAL B 1 172 ? 14.750  37.200  12.034  1.00 56.55 ? 167  VAL B CB  1 
ATOM   3275 C CG1 . VAL B 1 172 ? 14.643  35.986  11.131  1.00 56.84 ? 167  VAL B CG1 1 
ATOM   3276 C CG2 . VAL B 1 172 ? 14.500  36.807  13.484  1.00 55.76 ? 167  VAL B CG2 1 
ATOM   3277 N N   . LEU B 1 176 ? 12.742  35.317  6.867   1.00 46.91 ? 171  LEU B N   1 
ATOM   3278 C CA  . LEU B 1 176 ? 12.965  34.183  7.791   1.00 46.84 ? 171  LEU B CA  1 
ATOM   3279 C C   . LEU B 1 176 ? 12.321  34.389  9.171   1.00 46.54 ? 171  LEU B C   1 
ATOM   3280 O O   . LEU B 1 176 ? 11.984  35.505  9.569   1.00 47.12 ? 171  LEU B O   1 
ATOM   3281 C CB  . LEU B 1 176 ? 14.466  33.903  7.988   1.00 47.10 ? 171  LEU B CB  1 
ATOM   3282 C CG  . LEU B 1 176 ? 15.436  33.572  6.854   1.00 46.59 ? 171  LEU B CG  1 
ATOM   3283 C CD1 . LEU B 1 176 ? 16.854  33.467  7.429   1.00 47.45 ? 171  LEU B CD1 1 
ATOM   3284 C CD2 . LEU B 1 176 ? 15.083  32.293  6.079   1.00 47.74 ? 171  LEU B CD2 1 
ATOM   3285 N N   . HIS B 1 177 ? 12.112  33.285  9.878   1.00 46.39 ? 172  HIS B N   1 
ATOM   3286 C CA  . HIS B 1 177 ? 11.749  33.309  11.290  1.00 45.62 ? 172  HIS B CA  1 
ATOM   3287 C C   . HIS B 1 177 ? 12.983  32.783  12.003  1.00 45.32 ? 172  HIS B C   1 
ATOM   3288 O O   . HIS B 1 177 ? 13.826  32.136  11.382  1.00 45.93 ? 172  HIS B O   1 
ATOM   3289 C CB  . HIS B 1 177 ? 10.584  32.359  11.566  1.00 45.32 ? 172  HIS B CB  1 
ATOM   3290 C CG  . HIS B 1 177 ? 9.246   32.900  11.173  1.00 43.72 ? 172  HIS B CG  1 
ATOM   3291 N ND1 . HIS B 1 177 ? 8.864   33.055  9.860   1.00 40.84 ? 172  HIS B ND1 1 
ATOM   3292 C CD2 . HIS B 1 177 ? 8.186   33.294  11.925  1.00 41.80 ? 172  HIS B CD2 1 
ATOM   3293 C CE1 . HIS B 1 177 ? 7.627   33.520  9.820   1.00 40.65 ? 172  HIS B CE1 1 
ATOM   3294 N NE2 . HIS B 1 177 ? 7.199   33.689  11.059  1.00 38.86 ? 172  HIS B NE2 1 
ATOM   3295 N N   . LEU B 1 178 ? 13.101  33.032  13.297  1.00 44.90 ? 173  LEU B N   1 
ATOM   3296 C CA  . LEU B 1 178 ? 14.279  32.527  14.025  1.00 44.43 ? 173  LEU B CA  1 
ATOM   3297 C C   . LEU B 1 178 ? 14.522  31.032  13.839  1.00 44.64 ? 173  LEU B C   1 
ATOM   3298 O O   . LEU B 1 178 ? 15.668  30.594  13.611  1.00 44.72 ? 173  LEU B O   1 
ATOM   3299 C CB  . LEU B 1 178 ? 14.164  32.868  15.505  1.00 44.83 ? 173  LEU B CB  1 
ATOM   3300 C CG  . LEU B 1 178 ? 15.288  32.544  16.496  1.00 44.77 ? 173  LEU B CG  1 
ATOM   3301 C CD1 . LEU B 1 178 ? 16.711  32.849  15.945  1.00 45.79 ? 173  LEU B CD1 1 
ATOM   3302 C CD2 . LEU B 1 178 ? 14.976  33.344  17.753  1.00 44.44 ? 173  LEU B CD2 1 
ATOM   3303 N N   . LYS B 1 179 ? 13.446  30.248  13.921  1.00 44.47 ? 174  LYS B N   1 
ATOM   3304 C CA  . LYS B 1 179 ? 13.565  28.797  13.868  1.00 44.78 ? 174  LYS B CA  1 
ATOM   3305 C C   . LYS B 1 179 ? 13.579  28.251  12.437  1.00 45.47 ? 174  LYS B C   1 
ATOM   3306 O O   . LYS B 1 179 ? 13.451  27.048  12.232  1.00 45.24 ? 174  LYS B O   1 
ATOM   3307 C CB  . LYS B 1 179 ? 12.482  28.123  14.727  1.00 44.40 ? 174  LYS B CB  1 
ATOM   3308 C CG  . LYS B 1 179 ? 12.694  28.199  16.263  1.00 43.05 ? 174  LYS B CG  1 
ATOM   3309 C CD  . LYS B 1 179 ? 12.156  26.929  16.942  1.00 37.32 ? 174  LYS B CD  1 
ATOM   3310 C CE  . LYS B 1 179 ? 10.625  26.872  16.953  1.00 36.93 ? 174  LYS B CE  1 
ATOM   3311 N NZ  . LYS B 1 179 ? 9.952   27.454  18.152  1.00 39.63 ? 174  LYS B NZ  1 
ATOM   3312 N N   . SER B 1 180 ? 13.769  29.137  11.450  1.00 46.76 ? 175  SER B N   1 
ATOM   3313 C CA  . SER B 1 180 ? 14.066  28.710  10.068  1.00 47.53 ? 175  SER B CA  1 
ATOM   3314 C C   . SER B 1 180 ? 15.447  28.032  9.910   1.00 48.01 ? 175  SER B C   1 
ATOM   3315 O O   . SER B 1 180 ? 15.675  27.313  8.923   1.00 48.42 ? 175  SER B O   1 
ATOM   3316 C CB  . SER B 1 180 ? 13.919  29.876  9.058   1.00 47.41 ? 175  SER B CB  1 
ATOM   3317 O OG  . SER B 1 180 ? 12.710  30.619  9.247   1.00 47.96 ? 175  SER B OG  1 
ATOM   3318 N N   . PHE B 1 181 ? 16.355  28.246  10.871  1.00 48.17 ? 176  PHE B N   1 
ATOM   3319 C CA  . PHE B 1 181 ? 17.734  27.689  10.786  1.00 48.46 ? 176  PHE B CA  1 
ATOM   3320 C C   . PHE B 1 181 ? 18.256  26.969  12.055  1.00 48.74 ? 176  PHE B C   1 
ATOM   3321 O O   . PHE B 1 181 ? 19.408  26.519  12.091  1.00 49.05 ? 176  PHE B O   1 
ATOM   3322 C CB  . PHE B 1 181 ? 18.743  28.767  10.330  1.00 48.28 ? 176  PHE B CB  1 
ATOM   3323 C CG  . PHE B 1 181 ? 18.622  30.049  11.080  1.00 47.14 ? 176  PHE B CG  1 
ATOM   3324 C CD1 . PHE B 1 181 ? 19.292  30.231  12.286  1.00 47.65 ? 176  PHE B CD1 1 
ATOM   3325 C CD2 . PHE B 1 181 ? 17.811  31.063  10.608  1.00 46.82 ? 176  PHE B CD2 1 
ATOM   3326 C CE1 . PHE B 1 181 ? 19.159  31.404  13.008  1.00 47.58 ? 176  PHE B CE1 1 
ATOM   3327 C CE2 . PHE B 1 181 ? 17.679  32.251  11.318  1.00 48.23 ? 176  PHE B CE2 1 
ATOM   3328 C CZ  . PHE B 1 181 ? 18.355  32.420  12.524  1.00 48.75 ? 176  PHE B CZ  1 
ATOM   3329 N N   . CYS B 1 182 ? 17.407  26.857  13.078  1.00 48.80 ? 177  CYS B N   1 
ATOM   3330 C CA  . CYS B 1 182 ? 17.777  26.228  14.340  1.00 48.11 ? 177  CYS B CA  1 
ATOM   3331 C C   . CYS B 1 182 ? 16.559  25.735  15.123  1.00 47.77 ? 177  CYS B C   1 
ATOM   3332 O O   . CYS B 1 182 ? 15.409  26.056  14.794  1.00 48.21 ? 177  CYS B O   1 
ATOM   3333 C CB  . CYS B 1 182 ? 18.513  27.234  15.216  1.00 47.81 ? 177  CYS B CB  1 
ATOM   3334 S SG  . CYS B 1 182 ? 17.441  28.501  15.891  1.00 48.90 ? 177  CYS B SG  1 
ATOM   3335 N N   . SER B 1 183 ? 16.829  25.008  16.205  1.00 47.01 ? 178  SER B N   1 
ATOM   3336 C CA  . SER B 1 183 ? 15.803  24.645  17.190  1.00 46.25 ? 178  SER B CA  1 
ATOM   3337 C C   . SER B 1 183 ? 16.518  24.030  18.409  1.00 46.34 ? 178  SER B C   1 
ATOM   3338 O O   . SER B 1 183 ? 17.698  24.301  18.607  1.00 46.20 ? 178  SER B O   1 
ATOM   3339 C CB  . SER B 1 183 ? 14.825  23.671  16.556  1.00 45.56 ? 178  SER B CB  1 
ATOM   3340 O OG  . SER B 1 183 ? 15.539  22.760  15.749  1.00 46.57 ? 178  SER B OG  1 
ATOM   3341 N N   . MET B 1 184 ? 15.824  23.223  19.222  1.00 45.89 ? 179  MET B N   1 
ATOM   3342 C CA  . MET B 1 184 ? 16.489  22.446  20.282  1.00 44.95 ? 179  MET B CA  1 
ATOM   3343 C C   . MET B 1 184 ? 16.647  21.002  19.845  1.00 44.86 ? 179  MET B C   1 
ATOM   3344 O O   . MET B 1 184 ? 15.681  20.370  19.429  1.00 44.60 ? 179  MET B O   1 
ATOM   3345 C CB  . MET B 1 184 ? 15.708  22.517  21.601  1.00 45.10 ? 179  MET B CB  1 
ATOM   3346 C CG  . MET B 1 184 ? 15.456  23.916  22.169  1.00 45.00 ? 179  MET B CG  1 
ATOM   3347 S SD  . MET B 1 184 ? 16.876  25.043  22.366  1.00 48.86 ? 179  MET B SD  1 
ATOM   3348 C CE  . MET B 1 184 ? 17.856  24.115  23.548  1.00 49.94 ? 179  MET B CE  1 
ATOM   3349 N N   . ALA B 1 185 ? 17.873  20.481  19.902  1.00 44.70 ? 180  ALA B N   1 
ATOM   3350 C CA  . ALA B 1 185 ? 18.117  19.088  19.559  1.00 45.29 ? 180  ALA B CA  1 
ATOM   3351 C C   . ALA B 1 185 ? 18.293  18.192  20.796  1.00 45.68 ? 180  ALA B C   1 
ATOM   3352 O O   . ALA B 1 185 ? 18.531  16.993  20.665  1.00 46.45 ? 180  ALA B O   1 
ATOM   3353 C CB  . ALA B 1 185 ? 19.312  18.952  18.620  1.00 45.49 ? 180  ALA B CB  1 
ATOM   3354 N N   . GLY B 1 186 ? 18.166  18.772  21.984  1.00 45.50 ? 181  GLY B N   1 
ATOM   3355 C CA  . GLY B 1 186 ? 18.281  18.008  23.226  1.00 45.79 ? 181  GLY B CA  1 
ATOM   3356 C C   . GLY B 1 186 ? 18.426  18.940  24.398  1.00 45.81 ? 181  GLY B C   1 
ATOM   3357 O O   . GLY B 1 186 ? 18.338  20.150  24.233  1.00 45.60 ? 181  GLY B O   1 
ATOM   3358 N N   . PRO B 1 187 ? 18.648  18.385  25.607  1.00 46.90 ? 182  PRO B N   1 
ATOM   3359 C CA  . PRO B 1 187 ? 18.994  19.256  26.742  1.00 47.80 ? 182  PRO B CA  1 
ATOM   3360 C C   . PRO B 1 187 ? 20.326  19.947  26.467  1.00 48.54 ? 182  PRO B C   1 
ATOM   3361 O O   . PRO B 1 187 ? 21.349  19.275  26.234  1.00 48.53 ? 182  PRO B O   1 
ATOM   3362 C CB  . PRO B 1 187 ? 19.115  18.274  27.917  1.00 47.69 ? 182  PRO B CB  1 
ATOM   3363 C CG  . PRO B 1 187 ? 18.304  17.072  27.477  1.00 47.45 ? 182  PRO B CG  1 
ATOM   3364 C CD  . PRO B 1 187 ? 18.584  16.971  26.007  1.00 46.37 ? 182  PRO B CD  1 
ATOM   3365 N N   . ASN B 1 188 ? 20.297  21.272  26.477  1.00 49.95 ? 183  ASN B N   1 
ATOM   3366 C CA  . ASN B 1 188 ? 21.431  22.104  26.020  1.00 51.47 ? 183  ASN B CA  1 
ATOM   3367 C C   . ASN B 1 188 ? 22.122  21.648  24.717  1.00 51.95 ? 183  ASN B C   1 
ATOM   3368 O O   . ASN B 1 188 ? 23.365  21.631  24.608  1.00 51.62 ? 183  ASN B O   1 
ATOM   3369 C CB  . ASN B 1 188 ? 22.436  22.360  27.165  1.00 51.96 ? 183  ASN B CB  1 
ATOM   3370 C CG  . ASN B 1 188 ? 21.951  23.440  28.134  1.00 53.57 ? 183  ASN B CG  1 
ATOM   3371 O OD1 . ASN B 1 188 ? 20.879  23.314  28.749  1.00 55.21 ? 183  ASN B OD1 1 
ATOM   3372 N ND2 . ASN B 1 188 ? 22.729  24.509  28.265  1.00 53.69 ? 183  ASN B ND2 1 
ATOM   3373 N N   . LEU B 1 189 ? 21.312  21.267  23.732  1.00 52.02 ? 184  LEU B N   1 
ATOM   3374 C CA  . LEU B 1 189 ? 21.844  20.906  22.427  1.00 52.73 ? 184  LEU B CA  1 
ATOM   3375 C C   . LEU B 1 189 ? 21.020  21.636  21.402  1.00 53.58 ? 184  LEU B C   1 
ATOM   3376 O O   . LEU B 1 189 ? 19.807  21.449  21.326  1.00 53.83 ? 184  LEU B O   1 
ATOM   3377 C CB  . LEU B 1 189 ? 21.816  19.395  22.177  1.00 52.36 ? 184  LEU B CB  1 
ATOM   3378 C CG  . LEU B 1 189 ? 22.583  18.902  20.939  1.00 51.83 ? 184  LEU B CG  1 
ATOM   3379 C CD1 . LEU B 1 189 ? 24.094  19.067  21.088  1.00 50.38 ? 184  LEU B CD1 1 
ATOM   3380 C CD2 . LEU B 1 189 ? 22.243  17.465  20.588  1.00 52.49 ? 184  LEU B CD2 1 
ATOM   3381 N N   . ILE B 1 190 ? 21.677  22.514  20.655  1.00 54.68 ? 185  ILE B N   1 
ATOM   3382 C CA  . ILE B 1 190 ? 21.004  23.292  19.617  1.00 55.83 ? 185  ILE B CA  1 
ATOM   3383 C C   . ILE B 1 190 ? 21.445  22.796  18.249  1.00 56.49 ? 185  ILE B C   1 
ATOM   3384 O O   . ILE B 1 190 ? 22.647  22.609  17.989  1.00 56.05 ? 185  ILE B O   1 
ATOM   3385 C CB  . ILE B 1 190 ? 21.271  24.800  19.738  1.00 55.56 ? 185  ILE B CB  1 
ATOM   3386 C CG1 . ILE B 1 190 ? 20.817  25.314  21.108  1.00 55.07 ? 185  ILE B CG1 1 
ATOM   3387 C CG2 . ILE B 1 190 ? 20.553  25.543  18.620  1.00 56.46 ? 185  ILE B CG2 1 
ATOM   3388 C CD1 . ILE B 1 190 ? 21.277  26.722  21.436  1.00 54.95 ? 185  ILE B CD1 1 
ATOM   3389 N N   . ALA B 1 191 ? 20.456  22.536  17.400  1.00 57.77 ? 186  ALA B N   1 
ATOM   3390 C CA  . ALA B 1 191 ? 20.712  22.285  15.991  1.00 59.05 ? 186  ALA B CA  1 
ATOM   3391 C C   . ALA B 1 191 ? 20.941  23.640  15.318  1.00 60.03 ? 186  ALA B C   1 
ATOM   3392 O O   . ALA B 1 191 ? 20.302  24.638  15.670  1.00 59.54 ? 186  ALA B O   1 
ATOM   3393 C CB  . ALA B 1 191 ? 19.552  21.537  15.363  1.00 59.09 ? 186  ALA B CB  1 
ATOM   3394 N N   . ILE B 1 192 ? 21.896  23.680  14.389  1.00 61.59 ? 187  ILE B N   1 
ATOM   3395 C CA  . ILE B 1 192 ? 22.202  24.912  13.657  1.00 62.99 ? 187  ILE B CA  1 
ATOM   3396 C C   . ILE B 1 192 ? 22.759  24.649  12.249  1.00 63.97 ? 187  ILE B C   1 
ATOM   3397 O O   . ILE B 1 192 ? 23.500  23.683  12.015  1.00 64.17 ? 187  ILE B O   1 
ATOM   3398 C CB  . ILE B 1 192 ? 23.122  25.880  14.470  1.00 62.95 ? 187  ILE B CB  1 
ATOM   3399 C CG1 . ILE B 1 192 ? 23.135  27.279  13.837  1.00 62.86 ? 187  ILE B CG1 1 
ATOM   3400 C CG2 . ILE B 1 192 ? 24.554  25.300  14.655  1.00 63.15 ? 187  ILE B CG2 1 
ATOM   3401 C CD1 . ILE B 1 192 ? 21.981  28.182  14.266  1.00 62.42 ? 187  ILE B CD1 1 
ATOM   3402 N N   . GLY B 1 193 ? 22.375  25.509  11.311  1.00 65.15 ? 188  GLY B N   1 
ATOM   3403 C CA  . GLY B 1 193 ? 22.823  25.377  9.932   1.00 66.39 ? 188  GLY B CA  1 
ATOM   3404 C C   . GLY B 1 193 ? 24.216  25.930  9.715   1.00 67.36 ? 188  GLY B C   1 
ATOM   3405 O O   . GLY B 1 193 ? 24.726  26.716  10.524  1.00 67.24 ? 188  GLY B O   1 
ATOM   3406 N N   . SER B 1 194 ? 24.826  25.522  8.606   1.00 68.52 ? 189  SER B N   1 
ATOM   3407 C CA  . SER B 1 194 ? 26.165  25.978  8.239   1.00 69.40 ? 189  SER B CA  1 
ATOM   3408 C C   . SER B 1 194 ? 26.217  27.459  7.833   1.00 69.72 ? 189  SER B C   1 
ATOM   3409 O O   . SER B 1 194 ? 27.101  28.182  8.288   1.00 70.01 ? 189  SER B O   1 
ATOM   3410 C CB  . SER B 1 194 ? 26.752  25.089  7.138   1.00 69.71 ? 189  SER B CB  1 
ATOM   3411 O OG  . SER B 1 194 ? 26.977  23.765  7.605   1.00 70.26 ? 189  SER B OG  1 
ATOM   3412 N N   . SER B 1 195 ? 25.259  27.905  7.012   1.00 70.18 ? 190  SER B N   1 
ATOM   3413 C CA  . SER B 1 195 ? 25.246  29.272  6.435   1.00 70.45 ? 190  SER B CA  1 
ATOM   3414 C C   . SER B 1 195 ? 25.572  30.427  7.403   1.00 70.60 ? 190  SER B C   1 
ATOM   3415 O O   . SER B 1 195 ? 25.349  30.330  8.612   1.00 70.42 ? 190  SER B O   1 
ATOM   3416 C CB  . SER B 1 195 ? 23.913  29.549  5.721   1.00 70.49 ? 190  SER B CB  1 
ATOM   3417 O OG  . SER B 1 195 ? 22.948  30.110  6.603   1.00 70.81 ? 190  SER B OG  1 
ATOM   3418 N N   . GLU B 1 196 ? 26.085  31.523  6.841   1.00 70.87 ? 191  GLU B N   1 
ATOM   3419 C CA  . GLU B 1 196 ? 26.489  32.713  7.606   1.00 70.94 ? 191  GLU B CA  1 
ATOM   3420 C C   . GLU B 1 196 ? 25.319  33.462  8.262   1.00 70.87 ? 191  GLU B C   1 
ATOM   3421 O O   . GLU B 1 196 ? 25.514  34.248  9.184   1.00 70.66 ? 191  GLU B O   1 
ATOM   3422 C CB  . GLU B 1 196 ? 27.304  33.665  6.716   1.00 71.03 ? 191  GLU B CB  1 
ATOM   3423 N N   . SER B 1 197 ? 24.106  33.227  7.777   1.00 71.25 ? 192  SER B N   1 
ATOM   3424 C CA  . SER B 1 197 ? 22.914  33.792  8.411   1.00 71.60 ? 192  SER B CA  1 
ATOM   3425 C C   . SER B 1 197 ? 22.482  32.962  9.624   1.00 71.46 ? 192  SER B C   1 
ATOM   3426 O O   . SER B 1 197 ? 21.774  33.467  10.503  1.00 71.68 ? 192  SER B O   1 
ATOM   3427 C CB  . SER B 1 197 ? 21.766  33.938  7.408   1.00 71.65 ? 192  SER B CB  1 
ATOM   3428 O OG  . SER B 1 197 ? 22.117  34.840  6.368   1.00 72.64 ? 192  SER B OG  1 
ATOM   3429 N N   . ALA B 1 198 ? 22.916  31.701  9.672   1.00 71.34 ? 193  ALA B N   1 
ATOM   3430 C CA  . ALA B 1 198 ? 22.702  30.851  10.855  1.00 71.14 ? 193  ALA B CA  1 
ATOM   3431 C C   . ALA B 1 198 ? 23.677  31.237  11.968  1.00 70.91 ? 193  ALA B C   1 
ATOM   3432 O O   . ALA B 1 198 ? 23.325  32.016  12.858  1.00 70.90 ? 193  ALA B O   1 
ATOM   3433 C CB  . ALA B 1 198 ? 22.830  29.360  10.507  1.00 71.01 ? 193  ALA B CB  1 
ATOM   3434 N N   . GLN B 1 199 ? 24.906  30.722  11.879  1.00 70.61 ? 194  GLN B N   1 
ATOM   3435 C CA  . GLN B 1 199 ? 25.947  30.892  12.906  1.00 70.32 ? 194  GLN B CA  1 
ATOM   3436 C C   . GLN B 1 199 ? 26.128  32.322  13.409  1.00 69.86 ? 194  GLN B C   1 
ATOM   3437 C CB  . GLN B 1 199 ? 27.284  30.326  12.417  1.00 70.30 ? 194  GLN B CB  1 
ATOM   3438 C CG  . GLN B 1 199 ? 27.307  28.803  12.309  1.00 70.86 ? 194  GLN B CG  1 
ATOM   3439 N N   . LYS B 1 200 ? 25.848  33.304  12.559  1.00 69.39 ? 195  LYS B N   1 
ATOM   3440 C CA  . LYS B 1 200 ? 25.917  34.699  12.968  1.00 69.16 ? 195  LYS B CA  1 
ATOM   3441 C C   . LYS B 1 200 ? 24.901  34.928  14.068  1.00 68.97 ? 195  LYS B C   1 
ATOM   3442 O O   . LYS B 1 200 ? 25.241  35.433  15.135  1.00 68.66 ? 195  LYS B O   1 
ATOM   3443 C CB  . LYS B 1 200 ? 25.651  35.642  11.787  1.00 69.11 ? 195  LYS B CB  1 
ATOM   3444 N N   . ALA B 1 201 ? 23.658  34.524  13.801  1.00 69.16 ? 196  ALA B N   1 
ATOM   3445 C CA  . ALA B 1 201 ? 22.560  34.638  14.762  1.00 69.17 ? 196  ALA B CA  1 
ATOM   3446 C C   . ALA B 1 201 ? 22.786  33.799  16.023  1.00 69.19 ? 196  ALA B C   1 
ATOM   3447 O O   . ALA B 1 201 ? 22.394  34.208  17.118  1.00 69.04 ? 196  ALA B O   1 
ATOM   3448 C CB  . ALA B 1 201 ? 21.250  34.268  14.103  1.00 69.26 ? 196  ALA B CB  1 
ATOM   3449 N N   . LEU B 1 202 ? 23.406  32.631  15.854  1.00 69.38 ? 197  LEU B N   1 
ATOM   3450 C CA  . LEU B 1 202 ? 23.830  31.777  16.965  1.00 69.74 ? 197  LEU B CA  1 
ATOM   3451 C C   . LEU B 1 202 ? 24.709  32.574  17.919  1.00 69.94 ? 197  LEU B C   1 
ATOM   3452 O O   . LEU B 1 202 ? 24.375  32.728  19.092  1.00 69.87 ? 197  LEU B O   1 
ATOM   3453 C CB  . LEU B 1 202 ? 24.612  30.568  16.439  1.00 69.71 ? 197  LEU B CB  1 
ATOM   3454 C CG  . LEU B 1 202 ? 25.027  29.470  17.426  1.00 70.00 ? 197  LEU B CG  1 
ATOM   3455 C CD1 . LEU B 1 202 ? 24.049  28.301  17.394  1.00 69.62 ? 197  LEU B CD1 1 
ATOM   3456 C CD2 . LEU B 1 202 ? 26.440  28.978  17.123  1.00 70.34 ? 197  LEU B CD2 1 
ATOM   3457 N N   . LYS B 1 203 ? 25.822  33.092  17.391  1.00 70.08 ? 198  LYS B N   1 
ATOM   3458 C CA  . LYS B 1 203 ? 26.805  33.840  18.180  1.00 70.21 ? 198  LYS B CA  1 
ATOM   3459 C C   . LYS B 1 203 ? 26.202  35.047  18.892  1.00 70.24 ? 198  LYS B C   1 
ATOM   3460 O O   . LYS B 1 203 ? 26.620  35.373  19.997  1.00 70.64 ? 198  LYS B O   1 
ATOM   3461 C CB  . LYS B 1 203 ? 27.999  34.273  17.318  1.00 70.00 ? 198  LYS B CB  1 
ATOM   3462 C CG  . LYS B 1 203 ? 28.828  33.120  16.788  1.00 70.27 ? 198  LYS B CG  1 
ATOM   3463 N N   . ILE B 1 204 ? 25.229  35.705  18.265  1.00 70.13 ? 199  ILE B N   1 
ATOM   3464 C CA  . ILE B 1 204 ? 24.535  36.821  18.901  1.00 70.19 ? 199  ILE B CA  1 
ATOM   3465 C C   . ILE B 1 204 ? 23.735  36.311  20.099  1.00 70.36 ? 199  ILE B C   1 
ATOM   3466 O O   . ILE B 1 204 ? 23.702  36.955  21.153  1.00 70.32 ? 199  ILE B O   1 
ATOM   3467 C CB  . ILE B 1 204 ? 23.612  37.565  17.912  1.00 70.16 ? 199  ILE B CB  1 
ATOM   3468 N N   . MET B 1 205 ? 23.104  35.148  19.919  1.00 70.57 ? 200  MET B N   1 
ATOM   3469 C CA  . MET B 1 205 ? 22.395  34.442  20.982  1.00 70.59 ? 200  MET B CA  1 
ATOM   3470 C C   . MET B 1 205 ? 23.410  33.921  22.003  1.00 70.49 ? 200  MET B C   1 
ATOM   3471 O O   . MET B 1 205 ? 23.194  34.026  23.210  1.00 70.42 ? 200  MET B O   1 
ATOM   3472 C CB  . MET B 1 205 ? 21.567  33.267  20.414  1.00 70.64 ? 200  MET B CB  1 
ATOM   3473 C CG  . MET B 1 205 ? 20.374  33.646  19.502  1.00 70.75 ? 200  MET B CG  1 
ATOM   3474 S SD  . MET B 1 205 ? 19.163  32.316  19.155  1.00 70.76 ? 200  MET B SD  1 
ATOM   3475 C CE  . MET B 1 205 ? 20.138  31.135  18.215  1.00 69.48 ? 200  MET B CE  1 
ATOM   3476 N N   . GLN B 1 206 ? 24.521  33.380  21.503  1.00 70.53 ? 201  GLN B N   1 
ATOM   3477 C CA  . GLN B 1 206 ? 25.556  32.764  22.337  1.00 70.65 ? 201  GLN B CA  1 
ATOM   3478 C C   . GLN B 1 206 ? 26.294  33.756  23.240  1.00 70.89 ? 201  GLN B C   1 
ATOM   3479 O O   . GLN B 1 206 ? 26.608  33.426  24.387  1.00 71.12 ? 201  GLN B O   1 
ATOM   3480 C CB  . GLN B 1 206 ? 26.549  31.979  21.476  1.00 70.55 ? 201  GLN B CB  1 
ATOM   3481 N N   . GLN B 1 207 ? 26.571  34.955  22.722  1.00 71.08 ? 202  GLN B N   1 
ATOM   3482 C CA  . GLN B 1 207 ? 27.131  36.061  23.524  1.00 71.19 ? 202  GLN B CA  1 
ATOM   3483 C C   . GLN B 1 207 ? 26.151  36.476  24.618  1.00 71.21 ? 202  GLN B C   1 
ATOM   3484 O O   . GLN B 1 207 ? 26.486  36.453  25.805  1.00 71.20 ? 202  GLN B O   1 
ATOM   3485 C CB  . GLN B 1 207 ? 27.460  37.288  22.653  1.00 71.28 ? 202  GLN B CB  1 
ATOM   3486 C CG  . GLN B 1 207 ? 28.727  37.179  21.799  1.00 71.21 ? 202  GLN B CG  1 
ATOM   3487 C CD  . GLN B 1 207 ? 28.897  38.348  20.816  1.00 71.29 ? 202  GLN B CD  1 
ATOM   3488 O OE1 . GLN B 1 207 ? 27.915  38.889  20.285  1.00 70.01 ? 202  GLN B OE1 1 
ATOM   3489 N NE2 . GLN B 1 207 ? 30.153  38.730  20.565  1.00 70.14 ? 202  GLN B NE2 1 
ATOM   3490 N N   . MET B 1 208 ? 24.936  36.838  24.203  1.00 71.08 ? 203  MET B N   1 
ATOM   3491 C CA  . MET B 1 208 ? 23.880  37.296  25.109  1.00 71.11 ? 203  MET B CA  1 
ATOM   3492 C C   . MET B 1 208 ? 23.559  36.300  26.240  1.00 71.02 ? 203  MET B C   1 
ATOM   3493 O O   . MET B 1 208 ? 22.885  36.649  27.228  1.00 70.91 ? 203  MET B O   1 
ATOM   3494 C CB  . MET B 1 208 ? 22.611  37.631  24.306  1.00 71.05 ? 203  MET B CB  1 
ATOM   3495 N N   . SER B 1 209 ? 24.060  35.074  26.098  1.00 70.90 ? 204  SER B N   1 
ATOM   3496 C CA  . SER B 1 209 ? 23.723  33.988  27.019  1.00 70.91 ? 204  SER B CA  1 
ATOM   3497 C C   . SER B 1 209 ? 24.682  33.861  28.211  1.00 70.91 ? 204  SER B C   1 
ATOM   3498 O O   . SER B 1 209 ? 25.916  33.877  28.054  1.00 70.44 ? 204  SER B O   1 
ATOM   3499 C CB  . SER B 1 209 ? 23.628  32.653  26.267  1.00 70.87 ? 204  SER B CB  1 
ATOM   3500 O OG  . SER B 1 209 ? 22.815  31.731  26.974  1.00 70.49 ? 204  SER B OG  1 
ATOM   3501 N N   . ASP B 1 210 ? 24.089  33.742  29.401  1.00 70.92 ? 205  ASP B N   1 
ATOM   3502 C CA  . ASP B 1 210 ? 24.823  33.400  30.615  1.00 70.84 ? 205  ASP B CA  1 
ATOM   3503 C C   . ASP B 1 210 ? 25.439  31.995  30.499  1.00 70.72 ? 205  ASP B C   1 
ATOM   3504 O O   . ASP B 1 210 ? 26.630  31.810  30.799  1.00 70.77 ? 205  ASP B O   1 
ATOM   3505 C CB  . ASP B 1 210 ? 23.904  33.499  31.835  1.00 70.93 ? 205  ASP B CB  1 
ATOM   3506 N N   . HIS B 1 211 ? 24.628  31.032  30.039  1.00 70.28 ? 206  HIS B N   1 
ATOM   3507 C CA  . HIS B 1 211 ? 25.041  29.628  29.843  1.00 69.99 ? 206  HIS B CA  1 
ATOM   3508 C C   . HIS B 1 211 ? 25.783  29.416  28.529  1.00 69.16 ? 206  HIS B C   1 
ATOM   3509 O O   . HIS B 1 211 ? 25.647  30.201  27.596  1.00 69.18 ? 206  HIS B O   1 
ATOM   3510 C CB  . HIS B 1 211 ? 23.827  28.683  29.838  1.00 70.38 ? 206  HIS B CB  1 
ATOM   3511 C CG  . HIS B 1 211 ? 22.707  29.115  30.732  1.00 71.74 ? 206  HIS B CG  1 
ATOM   3512 N ND1 . HIS B 1 211 ? 21.509  29.590  30.243  1.00 72.77 ? 206  HIS B ND1 1 
ATOM   3513 C CD2 . HIS B 1 211 ? 22.599  29.142  32.083  1.00 73.16 ? 206  HIS B CD2 1 
ATOM   3514 C CE1 . HIS B 1 211 ? 20.711  29.891  31.252  1.00 73.37 ? 206  HIS B CE1 1 
ATOM   3515 N NE2 . HIS B 1 211 ? 21.348  29.628  32.379  1.00 74.05 ? 206  HIS B NE2 1 
ATOM   3516 N N   . ARG B 1 212 ? 26.550  28.332  28.458  1.00 68.52 ? 207  ARG B N   1 
ATOM   3517 C CA  . ARG B 1 212 ? 27.206  27.916  27.216  1.00 67.78 ? 207  ARG B CA  1 
ATOM   3518 C C   . ARG B 1 212 ? 26.616  26.594  26.735  1.00 67.24 ? 207  ARG B C   1 
ATOM   3519 O O   . ARG B 1 212 ? 26.994  25.523  27.226  1.00 67.22 ? 207  ARG B O   1 
ATOM   3520 C CB  . ARG B 1 212 ? 28.725  27.794  27.396  1.00 67.78 ? 207  ARG B CB  1 
ATOM   3521 N N   . TYR B 1 213 ? 25.687  26.688  25.777  1.00 66.32 ? 208  TYR B N   1 
ATOM   3522 C CA  . TYR B 1 213 ? 24.987  25.533  25.206  1.00 65.36 ? 208  TYR B CA  1 
ATOM   3523 C C   . TYR B 1 213 ? 25.921  24.721  24.322  1.00 66.08 ? 208  TYR B C   1 
ATOM   3524 O O   . TYR B 1 213 ? 26.998  25.184  23.970  1.00 66.39 ? 208  TYR B O   1 
ATOM   3525 C CB  . TYR B 1 213 ? 23.800  26.001  24.360  1.00 63.78 ? 208  TYR B CB  1 
ATOM   3526 C CG  . TYR B 1 213 ? 22.727  26.800  25.096  1.00 61.76 ? 208  TYR B CG  1 
ATOM   3527 C CD1 . TYR B 1 213 ? 22.761  28.196  25.132  1.00 58.62 ? 208  TYR B CD1 1 
ATOM   3528 C CD2 . TYR B 1 213 ? 21.656  26.157  25.721  1.00 58.68 ? 208  TYR B CD2 1 
ATOM   3529 C CE1 . TYR B 1 213 ? 21.770  28.917  25.793  1.00 57.63 ? 208  TYR B CE1 1 
ATOM   3530 C CE2 . TYR B 1 213 ? 20.674  26.874  26.379  1.00 57.23 ? 208  TYR B CE2 1 
ATOM   3531 C CZ  . TYR B 1 213 ? 20.734  28.241  26.411  1.00 57.97 ? 208  TYR B CZ  1 
ATOM   3532 O OH  . TYR B 1 213 ? 19.744  28.932  27.058  1.00 59.07 ? 208  TYR B OH  1 
ATOM   3533 N N   . ASP B 1 214 ? 25.512  23.508  23.963  1.00 66.91 ? 209  ASP B N   1 
ATOM   3534 C CA  . ASP B 1 214 ? 26.228  22.726  22.953  1.00 67.82 ? 209  ASP B CA  1 
ATOM   3535 C C   . ASP B 1 214 ? 25.464  22.784  21.617  1.00 67.94 ? 209  ASP B C   1 
ATOM   3536 O O   . ASP B 1 214 ? 24.235  22.922  21.602  1.00 68.03 ? 209  ASP B O   1 
ATOM   3537 C CB  . ASP B 1 214 ? 26.407  21.272  23.406  1.00 68.25 ? 209  ASP B CB  1 
ATOM   3538 C CG  . ASP B 1 214 ? 27.521  21.103  24.439  1.00 69.91 ? 209  ASP B CG  1 
ATOM   3539 O OD1 . ASP B 1 214 ? 28.702  21.354  24.102  1.00 70.93 ? 209  ASP B OD1 1 
ATOM   3540 O OD2 . ASP B 1 214 ? 27.217  20.693  25.585  1.00 71.73 ? 209  ASP B OD2 1 
ATOM   3541 N N   . LYS B 1 215 ? 26.184  22.678  20.503  1.00 67.84 ? 210  LYS B N   1 
ATOM   3542 C CA  . LYS B 1 215 ? 25.563  22.838  19.190  1.00 67.81 ? 210  LYS B CA  1 
ATOM   3543 C C   . LYS B 1 215 ? 25.668  21.585  18.298  1.00 67.64 ? 210  LYS B C   1 
ATOM   3544 O O   . LYS B 1 215 ? 26.556  20.744  18.493  1.00 67.23 ? 210  LYS B O   1 
ATOM   3545 C CB  . LYS B 1 215 ? 26.143  24.072  18.485  1.00 68.14 ? 210  LYS B CB  1 
ATOM   3546 N N   . LEU B 1 216 ? 24.743  21.469  17.338  1.00 67.31 ? 211  LEU B N   1 
ATOM   3547 C CA  . LEU B 1 216 ? 24.756  20.377  16.344  1.00 66.90 ? 211  LEU B CA  1 
ATOM   3548 C C   . LEU B 1 216 ? 24.650  20.902  14.891  1.00 66.89 ? 211  LEU B C   1 
ATOM   3549 O O   . LEU B 1 216 ? 23.551  21.111  14.363  1.00 66.61 ? 211  LEU B O   1 
ATOM   3550 C CB  . LEU B 1 216 ? 23.656  19.358  16.647  1.00 66.35 ? 211  LEU B CB  1 
ATOM   3551 C CG  . LEU B 1 216 ? 23.612  18.148  15.714  1.00 66.08 ? 211  LEU B CG  1 
ATOM   3552 C CD1 . LEU B 1 216 ? 24.788  17.211  15.966  1.00 66.01 ? 211  LEU B CD1 1 
ATOM   3553 C CD2 . LEU B 1 216 ? 22.297  17.425  15.856  1.00 65.69 ? 211  LEU B CD2 1 
ATOM   3554 N N   . THR B 1 217 ? 25.798  21.105  14.249  1.00 66.90 ? 212  THR B N   1 
ATOM   3555 C CA  . THR B 1 217 ? 25.826  21.852  12.991  1.00 67.04 ? 212  THR B CA  1 
ATOM   3556 C C   . THR B 1 217 ? 25.631  20.964  11.754  1.00 67.14 ? 212  THR B C   1 
ATOM   3557 O O   . THR B 1 217 ? 26.517  20.194  11.365  1.00 67.21 ? 212  THR B O   1 
ATOM   3558 C CB  . THR B 1 217 ? 27.078  22.769  12.869  1.00 67.15 ? 212  THR B CB  1 
ATOM   3559 O OG1 . THR B 1 217 ? 27.433  23.287  14.160  1.00 66.79 ? 212  THR B OG1 1 
ATOM   3560 C CG2 . THR B 1 217 ? 26.802  23.949  11.911  1.00 67.19 ? 212  THR B CG2 1 
ATOM   3561 N N   . VAL B 1 218 ? 24.439  21.074  11.168  1.00 67.11 ? 213  VAL B N   1 
ATOM   3562 C CA  . VAL B 1 218 ? 24.079  20.383  9.926   1.00 67.07 ? 213  VAL B CA  1 
ATOM   3563 C C   . VAL B 1 218 ? 24.501  21.208  8.690   1.00 67.05 ? 213  VAL B C   1 
ATOM   3564 O O   . VAL B 1 218 ? 24.502  22.449  8.743   1.00 67.15 ? 213  VAL B O   1 
ATOM   3565 C CB  . VAL B 1 218 ? 22.553  20.059  9.864   1.00 67.04 ? 213  VAL B CB  1 
ATOM   3566 C CG1 . VAL B 1 218 ? 22.273  18.675  10.444  1.00 67.14 ? 213  VAL B CG1 1 
ATOM   3567 C CG2 . VAL B 1 218 ? 21.731  21.131  10.574  1.00 66.05 ? 213  VAL B CG2 1 
ATOM   3568 N N   . PRO B 1 219 ? 24.874  20.527  7.580   1.00 66.90 ? 214  PRO B N   1 
ATOM   3569 C CA  . PRO B 1 219 ? 25.244  21.283  6.380   1.00 66.59 ? 214  PRO B CA  1 
ATOM   3570 C C   . PRO B 1 219 ? 24.133  22.245  5.929   1.00 66.29 ? 214  PRO B C   1 
ATOM   3571 O O   . PRO B 1 219 ? 24.402  23.414  5.646   1.00 66.31 ? 214  PRO B O   1 
ATOM   3572 C CB  . PRO B 1 219 ? 25.481  20.182  5.332   1.00 66.70 ? 214  PRO B CB  1 
ATOM   3573 C CG  . PRO B 1 219 ? 25.839  18.972  6.131   1.00 66.55 ? 214  PRO B CG  1 
ATOM   3574 C CD  . PRO B 1 219 ? 24.991  19.068  7.364   1.00 66.75 ? 214  PRO B CD  1 
ATOM   3575 N N   . ASP B 1 220 ? 22.896  21.748  5.921   1.00 65.90 ? 215  ASP B N   1 
ATOM   3576 C CA  . ASP B 1 220 ? 21.736  22.438  5.347   1.00 65.16 ? 215  ASP B CA  1 
ATOM   3577 C C   . ASP B 1 220 ? 20.846  23.130  6.405   1.00 64.39 ? 215  ASP B C   1 
ATOM   3578 O O   . ASP B 1 220 ? 20.294  22.466  7.292   1.00 64.69 ? 215  ASP B O   1 
ATOM   3579 C CB  . ASP B 1 220 ? 20.932  21.417  4.536   1.00 65.29 ? 215  ASP B CB  1 
ATOM   3580 C CG  . ASP B 1 220 ? 21.829  20.469  3.711   1.00 66.32 ? 215  ASP B CG  1 
ATOM   3581 O OD1 . ASP B 1 220 ? 22.818  20.942  3.099   1.00 67.35 ? 215  ASP B OD1 1 
ATOM   3582 O OD2 . ASP B 1 220 ? 21.544  19.248  3.666   1.00 66.54 ? 215  ASP B OD2 1 
ATOM   3583 N N   . ASP B 1 221 ? 20.690  24.451  6.285   1.00 63.19 ? 216  ASP B N   1 
ATOM   3584 C CA  . ASP B 1 221 ? 20.044  25.303  7.308   1.00 62.16 ? 216  ASP B CA  1 
ATOM   3585 C C   . ASP B 1 221 ? 18.601  24.998  7.700   1.00 61.52 ? 216  ASP B C   1 
ATOM   3586 O O   . ASP B 1 221 ? 18.165  25.363  8.799   1.00 61.54 ? 216  ASP B O   1 
ATOM   3587 C CB  . ASP B 1 221 ? 20.083  26.773  6.887   1.00 62.51 ? 216  ASP B CB  1 
ATOM   3588 C CG  . ASP B 1 221 ? 21.356  27.470  7.292   1.00 62.40 ? 216  ASP B CG  1 
ATOM   3589 O OD1 . ASP B 1 221 ? 22.435  26.866  7.134   1.00 63.35 ? 216  ASP B OD1 1 
ATOM   3590 O OD2 . ASP B 1 221 ? 21.277  28.639  7.743   1.00 62.50 ? 216  ASP B OD2 1 
ATOM   3591 N N   . ILE B 1 222 ? 17.845  24.381  6.799   1.00 60.35 ? 217  ILE B N   1 
ATOM   3592 C CA  . ILE B 1 222 ? 16.432  24.085  7.061   1.00 59.04 ? 217  ILE B CA  1 
ATOM   3593 C C   . ILE B 1 222 ? 16.302  22.754  7.812   1.00 58.06 ? 217  ILE B C   1 
ATOM   3594 O O   . ILE B 1 222 ? 15.282  22.483  8.453   1.00 58.30 ? 217  ILE B O   1 
ATOM   3595 C CB  . ILE B 1 222 ? 15.599  24.050  5.745   1.00 58.94 ? 217  ILE B CB  1 
ATOM   3596 C CG1 . ILE B 1 222 ? 15.768  25.347  4.937   1.00 58.28 ? 217  ILE B CG1 1 
ATOM   3597 C CG2 . ILE B 1 222 ? 14.129  23.780  6.025   1.00 59.27 ? 217  ILE B CG2 1 
ATOM   3598 C CD1 . ILE B 1 222 ? 15.028  26.554  5.486   1.00 57.19 ? 217  ILE B CD1 1 
ATOM   3599 N N   . ALA B 1 223 ? 17.342  21.931  7.723   1.00 56.49 ? 218  ALA B N   1 
ATOM   3600 C CA  . ALA B 1 223 ? 17.366  20.642  8.391   1.00 55.32 ? 218  ALA B CA  1 
ATOM   3601 C C   . ALA B 1 223 ? 17.850  20.797  9.833   1.00 54.32 ? 218  ALA B C   1 
ATOM   3602 O O   . ALA B 1 223 ? 18.015  19.816  10.550  1.00 54.45 ? 218  ALA B O   1 
ATOM   3603 C CB  . ALA B 1 223 ? 18.234  19.662  7.619   1.00 55.29 ? 218  ALA B CB  1 
ATOM   3604 N N   . ALA B 1 224 ? 18.069  22.043  10.241  1.00 52.96 ? 219  ALA B N   1 
ATOM   3605 C CA  . ALA B 1 224 ? 18.382  22.376  11.616  1.00 51.43 ? 219  ALA B CA  1 
ATOM   3606 C C   . ALA B 1 224 ? 17.109  22.601  12.402  1.00 50.16 ? 219  ALA B C   1 
ATOM   3607 O O   . ALA B 1 224 ? 17.145  22.777  13.619  1.00 50.35 ? 219  ALA B O   1 
ATOM   3608 C CB  . ALA B 1 224 ? 19.253  23.609  11.676  1.00 51.53 ? 219  ALA B CB  1 
ATOM   3609 N N   . ASN B 1 225 ? 15.980  22.623  11.705  1.00 48.49 ? 220  ASN B N   1 
ATOM   3610 C CA  . ASN B 1 225 ? 14.696  22.682  12.364  1.00 46.57 ? 220  ASN B CA  1 
ATOM   3611 C C   . ASN B 1 225 ? 14.215  21.253  12.522  1.00 46.39 ? 220  ASN B C   1 
ATOM   3612 O O   . ASN B 1 225 ? 13.856  20.581  11.546  1.00 45.80 ? 220  ASN B O   1 
ATOM   3613 C CB  . ASN B 1 225 ? 13.725  23.540  11.550  1.00 46.70 ? 220  ASN B CB  1 
ATOM   3614 C CG  . ASN B 1 225 ? 12.341  23.631  12.167  1.00 43.59 ? 220  ASN B CG  1 
ATOM   3615 O OD1 . ASN B 1 225 ? 11.522  22.721  12.008  1.00 42.01 ? 220  ASN B OD1 1 
ATOM   3616 N ND2 . ASN B 1 225 ? 12.049  24.754  12.814  1.00 38.65 ? 220  ASN B ND2 1 
ATOM   3617 N N   . CYS B 1 226 ? 14.262  20.784  13.767  1.00 45.63 ? 221  CYS B N   1 
ATOM   3618 C CA  . CYS B 1 226 ? 13.936  19.414  14.132  1.00 45.00 ? 221  CYS B CA  1 
ATOM   3619 C C   . CYS B 1 226 ? 13.039  19.425  15.373  1.00 42.67 ? 221  CYS B C   1 
ATOM   3620 O O   . CYS B 1 226 ? 12.819  20.479  15.951  1.00 41.60 ? 221  CYS B O   1 
ATOM   3621 C CB  . CYS B 1 226 ? 15.235  18.656  14.434  1.00 45.78 ? 221  CYS B CB  1 
ATOM   3622 S SG  . CYS B 1 226 ? 16.196  19.411  15.782  1.00 51.36 ? 221  CYS B SG  1 
ATOM   3623 N N   . ILE B 1 227 ? 12.487  18.268  15.757  1.00 41.42 ? 222  ILE B N   1 
ATOM   3624 C CA  . ILE B 1 227 ? 11.683  18.186  17.010  1.00 40.09 ? 222  ILE B CA  1 
ATOM   3625 C C   . ILE B 1 227 ? 12.311  17.241  18.028  1.00 39.58 ? 222  ILE B C   1 
ATOM   3626 O O   . ILE B 1 227 ? 12.480  16.055  17.766  1.00 40.43 ? 222  ILE B O   1 
ATOM   3627 C CB  . ILE B 1 227 ? 10.200  17.816  16.792  1.00 39.58 ? 222  ILE B CB  1 
ATOM   3628 C CG1 . ILE B 1 227 ? 9.485   18.896  15.981  1.00 39.41 ? 222  ILE B CG1 1 
ATOM   3629 C CG2 . ILE B 1 227 ? 9.483   17.649  18.135  1.00 39.69 ? 222  ILE B CG2 1 
ATOM   3630 C CD1 . ILE B 1 227 ? 7.978   18.684  15.847  1.00 39.42 ? 222  ILE B CD1 1 
ATOM   3631 N N   . TYR B 1 228 ? 12.681  17.782  19.178  1.00 39.44 ? 223  TYR B N   1 
ATOM   3632 C CA  . TYR B 1 228 ? 13.260  16.976  20.254  1.00 38.46 ? 223  TYR B CA  1 
ATOM   3633 C C   . TYR B 1 228 ? 12.177  16.660  21.266  1.00 37.76 ? 223  TYR B C   1 
ATOM   3634 O O   . TYR B 1 228 ? 11.472  17.569  21.721  1.00 37.56 ? 223  TYR B O   1 
ATOM   3635 C CB  . TYR B 1 228 ? 14.424  17.688  20.963  1.00 39.17 ? 223  TYR B CB  1 
ATOM   3636 C CG  . TYR B 1 228 ? 14.780  16.921  22.221  1.00 40.45 ? 223  TYR B CG  1 
ATOM   3637 C CD1 . TYR B 1 228 ? 15.547  15.753  22.155  1.00 40.00 ? 223  TYR B CD1 1 
ATOM   3638 C CD2 . TYR B 1 228 ? 14.264  17.306  23.464  1.00 40.17 ? 223  TYR B CD2 1 
ATOM   3639 C CE1 . TYR B 1 228 ? 15.815  14.996  23.312  1.00 40.25 ? 223  TYR B CE1 1 
ATOM   3640 C CE2 . TYR B 1 228 ? 14.536  16.554  24.624  1.00 39.32 ? 223  TYR B CE2 1 
ATOM   3641 C CZ  . TYR B 1 228 ? 15.319  15.415  24.532  1.00 40.02 ? 223  TYR B CZ  1 
ATOM   3642 O OH  . TYR B 1 228 ? 15.566  14.671  25.671  1.00 42.77 ? 223  TYR B OH  1 
ATOM   3643 N N   . LEU B 1 229 ? 12.039  15.375  21.594  1.00 36.96 ? 224  LEU B N   1 
ATOM   3644 C CA  . LEU B 1 229 ? 11.175  14.933  22.683  1.00 36.23 ? 224  LEU B CA  1 
ATOM   3645 C C   . LEU B 1 229 ? 11.931  14.027  23.675  1.00 35.95 ? 224  LEU B C   1 
ATOM   3646 O O   . LEU B 1 229 ? 12.695  13.138  23.286  1.00 36.13 ? 224  LEU B O   1 
ATOM   3647 C CB  . LEU B 1 229 ? 9.923   14.221  22.146  1.00 35.94 ? 224  LEU B CB  1 
ATOM   3648 C CG  . LEU B 1 229 ? 8.883   15.116  21.432  1.00 37.44 ? 224  LEU B CG  1 
ATOM   3649 C CD1 . LEU B 1 229 ? 8.251   14.387  20.291  1.00 37.36 ? 224  LEU B CD1 1 
ATOM   3650 C CD2 . LEU B 1 229 ? 7.812   15.658  22.370  1.00 38.98 ? 224  LEU B CD2 1 
ATOM   3651 N N   . ASN B 1 230 ? 11.744  14.291  24.956  1.00 35.98 ? 225  ASN B N   1 
ATOM   3652 C CA  . ASN B 1 230 ? 12.045  13.275  25.996  1.00 34.53 ? 225  ASN B CA  1 
ATOM   3653 C C   . ASN B 1 230 ? 10.841  12.369  26.206  1.00 34.15 ? 225  ASN B C   1 
ATOM   3654 O O   . ASN B 1 230 ? 9.764   12.801  26.647  1.00 33.43 ? 225  ASN B O   1 
ATOM   3655 C CB  . ASN B 1 230 ? 12.480  13.925  27.302  1.00 34.79 ? 225  ASN B CB  1 
ATOM   3656 C CG  . ASN B 1 230 ? 13.121  12.923  28.250  1.00 33.76 ? 225  ASN B CG  1 
ATOM   3657 O OD1 . ASN B 1 230 ? 12.446  12.051  28.755  1.00 34.29 ? 225  ASN B OD1 1 
ATOM   3658 N ND2 . ASN B 1 230 ? 14.431  13.041  28.471  1.00 32.24 ? 225  ASN B ND2 1 
ATOM   3659 N N   . ILE B 1 231 ? 11.000  11.118  25.804  1.00 34.37 ? 226  ILE B N   1 
ATOM   3660 C CA  . ILE B 1 231 ? 9.863   10.172  25.770  1.00 35.30 ? 226  ILE B CA  1 
ATOM   3661 C C   . ILE B 1 231 ? 9.976   9.152   26.925  1.00 34.75 ? 226  ILE B C   1 
ATOM   3662 O O   . ILE B 1 231 ? 11.052  8.590   27.115  1.00 36.35 ? 226  ILE B O   1 
ATOM   3663 C CB  . ILE B 1 231 ? 9.801   9.449   24.368  1.00 34.75 ? 226  ILE B CB  1 
ATOM   3664 C CG1 . ILE B 1 231 ? 9.298   10.434  23.279  1.00 33.42 ? 226  ILE B CG1 1 
ATOM   3665 C CG2 . ILE B 1 231 ? 8.975   8.167   24.434  1.00 35.05 ? 226  ILE B CG2 1 
ATOM   3666 C CD1 . ILE B 1 231 ? 7.937   11.171  23.605  1.00 30.46 ? 226  ILE B CD1 1 
ATOM   3667 N N   . PRO B 1 232 ? 8.899   8.936   27.700  1.00 35.70 ? 227  PRO B N   1 
ATOM   3668 C CA  . PRO B 1 232 ? 8.983   7.978   28.838  1.00 37.24 ? 227  PRO B CA  1 
ATOM   3669 C C   . PRO B 1 232 ? 9.637   6.645   28.457  1.00 39.08 ? 227  PRO B C   1 
ATOM   3670 O O   . PRO B 1 232 ? 9.276   6.028   27.428  1.00 39.65 ? 227  PRO B O   1 
ATOM   3671 C CB  . PRO B 1 232 ? 7.534   7.765   29.245  1.00 36.03 ? 227  PRO B CB  1 
ATOM   3672 C CG  . PRO B 1 232 ? 6.817   8.919   28.746  1.00 37.67 ? 227  PRO B CG  1 
ATOM   3673 C CD  . PRO B 1 232 ? 7.582   9.571   27.630  1.00 34.66 ? 227  PRO B CD  1 
ATOM   3674 N N   . ASN B 1 233 ? 10.641  6.256   29.250  1.00 40.87 ? 228  ASN B N   1 
ATOM   3675 C CA  . ASN B 1 233 ? 11.332  4.972   29.135  1.00 42.15 ? 228  ASN B CA  1 
ATOM   3676 C C   . ASN B 1 233 ? 12.297  4.797   27.928  1.00 43.08 ? 228  ASN B C   1 
ATOM   3677 O O   . ASN B 1 233 ? 13.011  3.786   27.832  1.00 42.87 ? 228  ASN B O   1 
ATOM   3678 C CB  . ASN B 1 233 ? 10.318  3.813   29.307  1.00 43.10 ? 228  ASN B CB  1 
ATOM   3679 C CG  . ASN B 1 233 ? 9.440   3.990   30.576  1.00 43.64 ? 228  ASN B CG  1 
ATOM   3680 O OD1 . ASN B 1 233 ? 9.972   4.225   31.661  1.00 48.19 ? 228  ASN B OD1 1 
ATOM   3681 N ND2 . ASN B 1 233 ? 8.115   3.911   30.430  1.00 42.83 ? 228  ASN B ND2 1 
ATOM   3682 N N   . LYS B 1 234 ? 12.356  5.808   27.050  1.00 44.18 ? 229  LYS B N   1 
ATOM   3683 C CA  . LYS B 1 234 ? 13.259  5.797   25.883  1.00 44.51 ? 229  LYS B CA  1 
ATOM   3684 C C   . LYS B 1 234 ? 14.343  6.879   25.939  1.00 45.16 ? 229  LYS B C   1 
ATOM   3685 O O   . LYS B 1 234 ? 15.450  6.700   25.424  1.00 45.38 ? 229  LYS B O   1 
ATOM   3686 C CB  . LYS B 1 234 ? 12.463  5.899   24.590  1.00 44.25 ? 229  LYS B CB  1 
ATOM   3687 N N   . GLY B 1 235 ? 14.046  7.997   26.589  1.00 45.94 ? 230  GLY B N   1 
ATOM   3688 C CA  . GLY B 1 235 ? 15.027  9.068   26.676  1.00 46.75 ? 230  GLY B CA  1 
ATOM   3689 C C   . GLY B 1 235 ? 14.917  9.967   25.454  1.00 47.74 ? 230  GLY B C   1 
ATOM   3690 O O   . GLY B 1 235 ? 13.815  10.387  25.063  1.00 48.00 ? 230  GLY B O   1 
ATOM   3691 N N   . HIS B 1 236 ? 16.061  10.255  24.850  1.00 48.56 ? 231  HIS B N   1 
ATOM   3692 C CA  . HIS B 1 236 ? 16.136  11.239  23.770  1.00 49.38 ? 231  HIS B CA  1 
ATOM   3693 C C   . HIS B 1 236 ? 15.506  10.717  22.494  1.00 49.80 ? 231  HIS B C   1 
ATOM   3694 O O   . HIS B 1 236 ? 15.871  9.640   22.012  1.00 49.62 ? 231  HIS B O   1 
ATOM   3695 C CB  . HIS B 1 236 ? 17.581  11.609  23.480  1.00 49.62 ? 231  HIS B CB  1 
ATOM   3696 C CG  . HIS B 1 236 ? 18.307  12.221  24.639  1.00 49.76 ? 231  HIS B CG  1 
ATOM   3697 N ND1 . HIS B 1 236 ? 17.734  13.162  25.465  1.00 48.56 ? 231  HIS B ND1 1 
ATOM   3698 C CD2 . HIS B 1 236 ? 19.581  12.059  25.074  1.00 49.24 ? 231  HIS B CD2 1 
ATOM   3699 C CE1 . HIS B 1 236 ? 18.616  13.537  26.375  1.00 50.76 ? 231  HIS B CE1 1 
ATOM   3700 N NE2 . HIS B 1 236 ? 19.745  12.882  26.161  1.00 50.25 ? 231  HIS B NE2 1 
ATOM   3701 N N   . VAL B 1 237 ? 14.556  11.490  21.967  1.00 50.51 ? 232  VAL B N   1 
ATOM   3702 C CA  . VAL B 1 237 ? 13.914  11.197  20.688  1.00 50.84 ? 232  VAL B CA  1 
ATOM   3703 C C   . VAL B 1 237 ? 13.825  12.468  19.812  1.00 51.33 ? 232  VAL B C   1 
ATOM   3704 O O   . VAL B 1 237 ? 13.309  13.514  20.249  1.00 50.93 ? 232  VAL B O   1 
ATOM   3705 C CB  . VAL B 1 237 ? 12.514  10.592  20.889  1.00 51.14 ? 232  VAL B CB  1 
ATOM   3706 C CG1 . VAL B 1 237 ? 11.893  10.218  19.546  1.00 51.07 ? 232  VAL B CG1 1 
ATOM   3707 C CG2 . VAL B 1 237 ? 12.582  9.372   21.792  1.00 50.60 ? 232  VAL B CG2 1 
ATOM   3708 N N   . LEU B 1 238 ? 14.314  12.359  18.577  1.00 51.09 ? 233  LEU B N   1 
ATOM   3709 C CA  . LEU B 1 238 ? 14.390  13.503  17.676  1.00 51.54 ? 233  LEU B CA  1 
ATOM   3710 C C   . LEU B 1 238 ? 13.784  13.241  16.294  1.00 51.66 ? 233  LEU B C   1 
ATOM   3711 O O   . LEU B 1 238 ? 14.172  12.290  15.619  1.00 51.54 ? 233  LEU B O   1 
ATOM   3712 C CB  . LEU B 1 238 ? 15.850  13.915  17.521  1.00 51.52 ? 233  LEU B CB  1 
ATOM   3713 C CG  . LEU B 1 238 ? 16.130  15.279  16.927  1.00 51.51 ? 233  LEU B CG  1 
ATOM   3714 C CD1 . LEU B 1 238 ? 15.799  16.336  17.936  1.00 50.85 ? 233  LEU B CD1 1 
ATOM   3715 C CD2 . LEU B 1 238 ? 17.576  15.348  16.555  1.00 52.22 ? 233  LEU B CD2 1 
ATOM   3716 N N   . LEU B 1 239 ? 12.831  14.086  15.891  1.00 52.22 ? 234  LEU B N   1 
ATOM   3717 C CA  . LEU B 1 239 ? 12.318  14.104  14.503  1.00 52.34 ? 234  LEU B CA  1 
ATOM   3718 C C   . LEU B 1 239 ? 13.203  15.002  13.629  1.00 53.00 ? 234  LEU B C   1 
ATOM   3719 O O   . LEU B 1 239 ? 13.460  16.162  13.957  1.00 52.17 ? 234  LEU B O   1 
ATOM   3720 C CB  . LEU B 1 239 ? 10.869  14.605  14.425  1.00 51.57 ? 234  LEU B CB  1 
ATOM   3721 C CG  . LEU B 1 239 ? 9.775   14.169  15.401  1.00 51.28 ? 234  LEU B CG  1 
ATOM   3722 C CD1 . LEU B 1 239 ? 8.389   14.343  14.824  1.00 47.30 ? 234  LEU B CD1 1 
ATOM   3723 C CD2 . LEU B 1 239 ? 9.970   12.742  15.891  1.00 51.83 ? 234  LEU B CD2 1 
ATOM   3724 N N   . HIS B 1 240 ? 13.676  14.451  12.518  1.00 54.39 ? 235  HIS B N   1 
ATOM   3725 C CA  . HIS B 1 240 ? 14.454  15.233  11.564  1.00 55.78 ? 235  HIS B CA  1 
ATOM   3726 C C   . HIS B 1 240 ? 14.081  14.886  10.107  1.00 56.42 ? 235  HIS B C   1 
ATOM   3727 O O   . HIS B 1 240 ? 13.332  13.936  9.827   1.00 56.04 ? 235  HIS B O   1 
ATOM   3728 C CB  . HIS B 1 240 ? 15.951  15.037  11.823  1.00 56.05 ? 235  HIS B CB  1 
ATOM   3729 C CG  . HIS B 1 240 ? 16.386  13.607  11.741  1.00 57.75 ? 235  HIS B CG  1 
ATOM   3730 N ND1 . HIS B 1 240 ? 17.355  13.171  10.860  1.00 59.46 ? 235  HIS B ND1 1 
ATOM   3731 C CD2 . HIS B 1 240 ? 15.953  12.505  12.400  1.00 57.72 ? 235  HIS B CD2 1 
ATOM   3732 C CE1 . HIS B 1 240 ? 17.516  11.866  10.998  1.00 59.33 ? 235  HIS B CE1 1 
ATOM   3733 N NE2 . HIS B 1 240 ? 16.674  11.439  11.923  1.00 58.60 ? 235  HIS B NE2 1 
ATOM   3734 N N   . ARG B 1 241 ? 14.617  15.676  9.188   1.00 58.02 ? 236  ARG B N   1 
ATOM   3735 C CA  . ARG B 1 241 ? 14.331  15.554  7.756   1.00 58.83 ? 236  ARG B CA  1 
ATOM   3736 C C   . ARG B 1 241 ? 15.051  14.356  7.160   1.00 59.68 ? 236  ARG B C   1 
ATOM   3737 O O   . ARG B 1 241 ? 16.204  14.093  7.502   1.00 59.90 ? 236  ARG B O   1 
ATOM   3738 C CB  . ARG B 1 241 ? 14.761  16.836  7.046   1.00 58.58 ? 236  ARG B CB  1 
ATOM   3739 C CG  . ARG B 1 241 ? 14.304  18.122  7.749   1.00 58.39 ? 236  ARG B CG  1 
ATOM   3740 C CD  . ARG B 1 241 ? 12.781  18.298  7.733   1.00 56.61 ? 236  ARG B CD  1 
ATOM   3741 N NE  . ARG B 1 241 ? 12.283  18.386  6.361   1.00 56.45 ? 236  ARG B NE  1 
ATOM   3742 C CZ  . ARG B 1 241 ? 12.201  19.507  5.640   1.00 54.38 ? 236  ARG B CZ  1 
ATOM   3743 N NH1 . ARG B 1 241 ? 12.558  20.684  6.147   1.00 53.31 ? 236  ARG B NH1 1 
ATOM   3744 N NH2 . ARG B 1 241 ? 11.754  19.437  4.396   1.00 54.98 ? 236  ARG B NH2 1 
ATOM   3745 N N   . THR B 1 242 ? 14.369  13.647  6.258   1.00 60.99 ? 237  THR B N   1 
ATOM   3746 C CA  . THR B 1 242 ? 14.868  12.396  5.679   1.00 61.94 ? 237  THR B CA  1 
ATOM   3747 C C   . THR B 1 242 ? 16.195  12.534  4.914   1.00 63.04 ? 237  THR B C   1 
ATOM   3748 O O   . THR B 1 242 ? 16.638  13.651  4.625   1.00 62.78 ? 237  THR B O   1 
ATOM   3749 C CB  . THR B 1 242 ? 13.828  11.728  4.755   1.00 62.03 ? 237  THR B CB  1 
ATOM   3750 O OG1 . THR B 1 242 ? 13.823  12.387  3.482   1.00 62.97 ? 237  THR B OG1 1 
ATOM   3751 C CG2 . THR B 1 242 ? 12.434  11.746  5.374   1.00 61.50 ? 237  THR B CG2 1 
ATOM   3752 N N   . PRO B 1 243 ? 16.840  11.387  4.586   1.00 64.24 ? 238  PRO B N   1 
ATOM   3753 C CA  . PRO B 1 243 ? 18.101  11.470  3.845   1.00 65.02 ? 238  PRO B CA  1 
ATOM   3754 C C   . PRO B 1 243 ? 17.864  11.703  2.349   1.00 65.40 ? 238  PRO B C   1 
ATOM   3755 O O   . PRO B 1 243 ? 18.813  11.751  1.568   1.00 65.40 ? 238  PRO B O   1 
ATOM   3756 C CB  . PRO B 1 243 ? 18.764  10.115  4.113   1.00 65.21 ? 238  PRO B CB  1 
ATOM   3757 C CG  . PRO B 1 243 ? 17.637  9.173   4.492   1.00 65.00 ? 238  PRO B CG  1 
ATOM   3758 C CD  . PRO B 1 243 ? 16.431  9.989   4.853   1.00 64.31 ? 238  PRO B CD  1 
ATOM   3759 N N   . GLU B 1 244 ? 16.596  11.834  1.971   1.00 65.94 ? 239  GLU B N   1 
ATOM   3760 C CA  . GLU B 1 244 ? 16.219  12.346  0.665   1.00 66.35 ? 239  GLU B CA  1 
ATOM   3761 C C   . GLU B 1 244 ? 16.425  13.865  0.675   1.00 66.90 ? 239  GLU B C   1 
ATOM   3762 O O   . GLU B 1 244 ? 17.283  14.398  -0.047  1.00 67.02 ? 239  GLU B O   1 
ATOM   3763 C CB  . GLU B 1 244 ? 14.753  12.028  0.362   1.00 66.28 ? 239  GLU B CB  1 
ATOM   3764 C CG  . GLU B 1 244 ? 14.346  10.584  0.578   1.00 66.38 ? 239  GLU B CG  1 
ATOM   3765 N N   . GLU B 1 245 ? 15.662  14.545  1.534   1.00 67.11 ? 240  GLU B N   1 
ATOM   3766 C CA  . GLU B 1 245 ? 15.537  16.005  1.510   1.00 67.62 ? 240  GLU B CA  1 
ATOM   3767 C C   . GLU B 1 245 ? 16.823  16.741  1.803   1.00 68.36 ? 240  GLU B C   1 
ATOM   3768 O O   . GLU B 1 245 ? 17.195  17.685  1.103   1.00 68.61 ? 240  GLU B O   1 
ATOM   3769 C CB  . GLU B 1 245 ? 14.476  16.455  2.504   1.00 67.14 ? 240  GLU B CB  1 
ATOM   3770 C CG  . GLU B 1 245 ? 13.133  15.804  2.280   1.00 66.69 ? 240  GLU B CG  1 
ATOM   3771 C CD  . GLU B 1 245 ? 12.257  15.877  3.499   1.00 65.77 ? 240  GLU B CD  1 
ATOM   3772 O OE1 . GLU B 1 245 ? 12.786  16.227  4.574   1.00 65.75 ? 240  GLU B OE1 1 
ATOM   3773 O OE2 . GLU B 1 245 ? 11.050  15.587  3.381   1.00 64.21 ? 240  GLU B OE2 1 
ATOM   3774 N N   . TYR B 1 246 ? 17.486  16.325  2.865   1.00 69.32 ? 241  TYR B N   1 
ATOM   3775 C CA  . TYR B 1 246 ? 18.724  16.951  3.266   1.00 70.24 ? 241  TYR B CA  1 
ATOM   3776 C C   . TYR B 1 246 ? 19.674  15.824  3.677   1.00 70.94 ? 241  TYR B C   1 
ATOM   3777 O O   . TYR B 1 246 ? 19.827  15.541  4.869   1.00 70.87 ? 241  TYR B O   1 
ATOM   3778 C CB  . TYR B 1 246 ? 18.451  17.954  4.389   1.00 70.29 ? 241  TYR B CB  1 
ATOM   3779 C CG  . TYR B 1 246 ? 17.729  19.214  3.931   1.00 70.40 ? 241  TYR B CG  1 
ATOM   3780 C CD1 . TYR B 1 246 ? 16.334  19.324  3.992   1.00 70.00 ? 241  TYR B CD1 1 
ATOM   3781 C CD2 . TYR B 1 246 ? 18.449  20.297  3.428   1.00 70.67 ? 241  TYR B CD2 1 
ATOM   3782 C CE1 . TYR B 1 246 ? 15.683  20.500  3.562   1.00 69.93 ? 241  TYR B CE1 1 
ATOM   3783 C CE2 . TYR B 1 246 ? 17.816  21.465  3.005   1.00 70.07 ? 241  TYR B CE2 1 
ATOM   3784 C CZ  . TYR B 1 246 ? 16.443  21.562  3.072   1.00 69.99 ? 241  TYR B CZ  1 
ATOM   3785 O OH  . TYR B 1 246 ? 15.863  22.729  2.639   1.00 69.93 ? 241  TYR B OH  1 
ATOM   3786 N N   . PRO B 1 247 ? 20.294  15.160  2.673   1.00 71.52 ? 242  PRO B N   1 
ATOM   3787 C CA  . PRO B 1 247 ? 21.050  13.924  2.874   1.00 71.81 ? 242  PRO B CA  1 
ATOM   3788 C C   . PRO B 1 247 ? 22.355  14.150  3.619   1.00 72.08 ? 242  PRO B C   1 
ATOM   3789 O O   . PRO B 1 247 ? 22.681  13.366  4.512   1.00 72.38 ? 242  PRO B O   1 
ATOM   3790 C CB  . PRO B 1 247 ? 21.328  13.429  1.443   1.00 71.89 ? 242  PRO B CB  1 
ATOM   3791 C CG  . PRO B 1 247 ? 20.459  14.261  0.544   1.00 71.73 ? 242  PRO B CG  1 
ATOM   3792 C CD  . PRO B 1 247 ? 20.315  15.570  1.256   1.00 71.70 ? 242  PRO B CD  1 
ATOM   3793 N N   . GLU B 1 248 ? 23.093  15.204  3.271   1.00 72.23 ? 243  GLU B N   1 
ATOM   3794 C CA  . GLU B 1 248 ? 24.323  15.530  3.997   1.00 72.45 ? 243  GLU B CA  1 
ATOM   3795 C C   . GLU B 1 248 ? 24.013  15.874  5.449   1.00 72.26 ? 243  GLU B C   1 
ATOM   3796 O O   . GLU B 1 248 ? 24.911  15.894  6.292   1.00 72.49 ? 243  GLU B O   1 
ATOM   3797 C CB  . GLU B 1 248 ? 25.079  16.683  3.334   1.00 72.57 ? 243  GLU B CB  1 
ATOM   3798 C CG  . GLU B 1 248 ? 25.957  16.267  2.152   1.00 73.81 ? 243  GLU B CG  1 
ATOM   3799 C CD  . GLU B 1 248 ? 27.430  16.016  2.513   1.00 74.97 ? 243  GLU B CD  1 
ATOM   3800 O OE1 . GLU B 1 248 ? 27.740  15.684  3.685   1.00 74.76 ? 243  GLU B OE1 1 
ATOM   3801 O OE2 . GLU B 1 248 ? 28.282  16.149  1.601   1.00 75.06 ? 243  GLU B OE2 1 
ATOM   3802 N N   . SER B 1 249 ? 22.738  16.131  5.738   1.00 71.96 ? 244  SER B N   1 
ATOM   3803 C CA  . SER B 1 249 ? 22.314  16.503  7.089   1.00 71.56 ? 244  SER B CA  1 
ATOM   3804 C C   . SER B 1 249 ? 21.838  15.307  7.911   1.00 71.48 ? 244  SER B C   1 
ATOM   3805 O O   . SER B 1 249 ? 22.011  15.281  9.130   1.00 71.39 ? 244  SER B O   1 
ATOM   3806 C CB  . SER B 1 249 ? 21.241  17.585  7.030   1.00 71.43 ? 244  SER B CB  1 
ATOM   3807 O OG  . SER B 1 249 ? 21.817  18.857  6.795   1.00 70.92 ? 244  SER B OG  1 
ATOM   3808 N N   . ALA B 1 250 ? 21.253  14.318  7.234   1.00 71.21 ? 245  ALA B N   1 
ATOM   3809 C CA  . ALA B 1 250 ? 20.810  13.072  7.863   1.00 71.02 ? 245  ALA B CA  1 
ATOM   3810 C C   . ALA B 1 250 ? 21.988  12.147  8.208   1.00 71.07 ? 245  ALA B C   1 
ATOM   3811 O O   . ALA B 1 250 ? 21.811  11.099  8.845   1.00 71.00 ? 245  ALA B O   1 
ATOM   3812 C CB  . ALA B 1 250 ? 19.809  12.356  6.969   1.00 70.88 ? 245  ALA B CB  1 
ATOM   3813 N N   . LYS B 1 251 ? 23.185  12.535  7.773   1.00 71.12 ? 246  LYS B N   1 
ATOM   3814 C CA  . LYS B 1 251 ? 24.411  11.847  8.160   1.00 71.07 ? 246  LYS B CA  1 
ATOM   3815 C C   . LYS B 1 251 ? 24.855  12.357  9.527   1.00 71.03 ? 246  LYS B C   1 
ATOM   3816 O O   . LYS B 1 251 ? 25.320  11.577  10.365  1.00 71.15 ? 246  LYS B O   1 
ATOM   3817 C CB  . LYS B 1 251 ? 25.515  12.068  7.119   1.00 71.14 ? 246  LYS B CB  1 
ATOM   3818 N N   . VAL B 1 252 ? 24.694  13.668  9.735   1.00 70.67 ? 247  VAL B N   1 
ATOM   3819 C CA  . VAL B 1 252 ? 25.005  14.340  10.999  1.00 70.30 ? 247  VAL B CA  1 
ATOM   3820 C C   . VAL B 1 252 ? 24.145  13.831  12.160  1.00 70.30 ? 247  VAL B C   1 
ATOM   3821 O O   . VAL B 1 252 ? 24.606  13.724  13.305  1.00 70.48 ? 247  VAL B O   1 
ATOM   3822 C CB  . VAL B 1 252 ? 24.798  15.859  10.865  1.00 70.13 ? 247  VAL B CB  1 
ATOM   3823 C CG1 . VAL B 1 252 ? 24.783  16.543  12.236  1.00 69.72 ? 247  VAL B CG1 1 
ATOM   3824 C CG2 . VAL B 1 252 ? 25.860  16.454  9.970   1.00 70.27 ? 247  VAL B CG2 1 
ATOM   3825 N N   . TYR B 1 253 ? 22.887  13.534  11.861  1.00 69.89 ? 248  TYR B N   1 
ATOM   3826 C CA  . TYR B 1 253 ? 21.951  13.160  12.897  1.00 69.58 ? 248  TYR B CA  1 
ATOM   3827 C C   . TYR B 1 253 ? 22.207  11.735  13.349  1.00 69.48 ? 248  TYR B C   1 
ATOM   3828 O O   . TYR B 1 253 ? 22.193  11.459  14.545  1.00 69.43 ? 248  TYR B O   1 
ATOM   3829 C CB  . TYR B 1 253 ? 20.500  13.395  12.452  1.00 69.20 ? 248  TYR B CB  1 
ATOM   3830 C CG  . TYR B 1 253 ? 20.039  14.847  12.572  1.00 69.05 ? 248  TYR B CG  1 
ATOM   3831 C CD1 . TYR B 1 253 ? 19.624  15.562  11.448  1.00 69.28 ? 248  TYR B CD1 1 
ATOM   3832 C CD2 . TYR B 1 253 ? 20.016  15.504  13.811  1.00 68.54 ? 248  TYR B CD2 1 
ATOM   3833 C CE1 . TYR B 1 253 ? 19.190  16.889  11.545  1.00 68.75 ? 248  TYR B CE1 1 
ATOM   3834 C CE2 . TYR B 1 253 ? 19.583  16.832  13.918  1.00 68.12 ? 248  TYR B CE2 1 
ATOM   3835 C CZ  . TYR B 1 253 ? 19.172  17.521  12.780  1.00 69.08 ? 248  TYR B CZ  1 
ATOM   3836 O OH  . TYR B 1 253 ? 18.745  18.836  12.864  1.00 67.35 ? 248  TYR B OH  1 
ATOM   3837 N N   . GLU B 1 254 ? 22.483  10.848  12.394  1.00 69.62 ? 249  GLU B N   1 
ATOM   3838 C CA  . GLU B 1 254 ? 22.886  9.464   12.689  1.00 69.50 ? 249  GLU B CA  1 
ATOM   3839 C C   . GLU B 1 254 ? 24.095  9.399   13.645  1.00 69.39 ? 249  GLU B C   1 
ATOM   3840 O O   . GLU B 1 254 ? 24.335  8.365   14.286  1.00 69.50 ? 249  GLU B O   1 
ATOM   3841 C CB  . GLU B 1 254 ? 23.164  8.691   11.394  1.00 69.69 ? 249  GLU B CB  1 
ATOM   3842 N N   . LYS B 1 255 ? 24.830  10.512  13.748  1.00 68.87 ? 250  LYS B N   1 
ATOM   3843 C CA  . LYS B 1 255 ? 25.902  10.659  14.732  1.00 68.42 ? 250  LYS B CA  1 
ATOM   3844 C C   . LYS B 1 255 ? 25.393  11.018  16.145  1.00 68.24 ? 250  LYS B C   1 
ATOM   3845 O O   . LYS B 1 255 ? 26.194  11.358  17.035  1.00 68.39 ? 250  LYS B O   1 
ATOM   3846 C CB  . LYS B 1 255 ? 26.954  11.667  14.257  1.00 68.39 ? 250  LYS B CB  1 
ATOM   3847 N N   . LEU B 1 256 ? 24.073  10.943  16.352  1.00 67.47 ? 251  LEU B N   1 
ATOM   3848 C CA  . LEU B 1 256 ? 23.515  10.994  17.709  1.00 66.58 ? 251  LEU B CA  1 
ATOM   3849 C C   . LEU B 1 256 ? 23.323  9.563   18.225  1.00 66.07 ? 251  LEU B C   1 
ATOM   3850 O O   . LEU B 1 256 ? 22.319  8.887   17.931  1.00 65.74 ? 251  LEU B O   1 
ATOM   3851 C CB  . LEU B 1 256 ? 22.239  11.844  17.788  1.00 66.50 ? 251  LEU B CB  1 
ATOM   3852 C CG  . LEU B 1 256 ? 22.376  13.371  17.602  1.00 66.53 ? 251  LEU B CG  1 
ATOM   3853 C CD1 . LEU B 1 256 ? 21.023  14.060  17.718  1.00 65.98 ? 251  LEU B CD1 1 
ATOM   3854 C CD2 . LEU B 1 256 ? 23.376  14.027  18.565  1.00 66.50 ? 251  LEU B CD2 1 
ATOM   3855 N N   . LYS B 1 257 ? 24.338  9.111   18.966  1.00 65.17 ? 252  LYS B N   1 
ATOM   3856 C CA  . LYS B 1 257 ? 24.464  7.721   19.430  1.00 64.08 ? 252  LYS B CA  1 
ATOM   3857 C C   . LYS B 1 257 ? 23.355  7.302   20.402  1.00 62.98 ? 252  LYS B C   1 
ATOM   3858 O O   . LYS B 1 257 ? 22.820  6.180   20.327  1.00 62.95 ? 252  LYS B O   1 
ATOM   3859 C CB  . LYS B 1 257 ? 25.851  7.512   20.069  1.00 64.16 ? 252  LYS B CB  1 
ATOM   3860 N N   . ASP B 1 258 ? 23.006  8.226   21.292  1.00 61.64 ? 253  ASP B N   1 
ATOM   3861 C CA  . ASP B 1 258 ? 22.035  7.985   22.357  1.00 60.42 ? 253  ASP B CA  1 
ATOM   3862 C C   . ASP B 1 258 ? 20.615  8.413   21.997  1.00 59.74 ? 253  ASP B C   1 
ATOM   3863 O O   . ASP B 1 258 ? 19.691  8.304   22.817  1.00 59.27 ? 253  ASP B O   1 
ATOM   3864 C CB  . ASP B 1 258 ? 22.495  8.731   23.599  1.00 60.42 ? 253  ASP B CB  1 
ATOM   3865 C CG  . ASP B 1 258 ? 23.755  8.157   24.162  1.00 60.00 ? 253  ASP B CG  1 
ATOM   3866 O OD1 . ASP B 1 258 ? 23.779  6.920   24.381  1.00 59.54 ? 253  ASP B OD1 1 
ATOM   3867 O OD2 . ASP B 1 258 ? 24.717  8.931   24.367  1.00 59.52 ? 253  ASP B OD2 1 
ATOM   3868 N N   . HIS B 1 259 ? 20.453  8.897   20.767  1.00 58.44 ? 254  HIS B N   1 
ATOM   3869 C CA  . HIS B 1 259 ? 19.187  9.433   20.315  1.00 56.92 ? 254  HIS B CA  1 
ATOM   3870 C C   . HIS B 1 259 ? 18.372  8.432   19.536  1.00 56.62 ? 254  HIS B C   1 
ATOM   3871 O O   . HIS B 1 259 ? 18.914  7.619   18.779  1.00 56.79 ? 254  HIS B O   1 
ATOM   3872 C CB  . HIS B 1 259 ? 19.421  10.666  19.468  1.00 56.47 ? 254  HIS B CB  1 
ATOM   3873 C CG  . HIS B 1 259 ? 19.321  11.942  20.232  1.00 54.57 ? 254  HIS B CG  1 
ATOM   3874 N ND1 . HIS B 1 259 ? 20.384  12.480  20.923  1.00 53.40 ? 254  HIS B ND1 1 
ATOM   3875 C CD2 . HIS B 1 259 ? 18.281  12.790  20.418  1.00 52.78 ? 254  HIS B CD2 1 
ATOM   3876 C CE1 . HIS B 1 259 ? 20.009  13.614  21.487  1.00 52.14 ? 254  HIS B CE1 1 
ATOM   3877 N NE2 . HIS B 1 259 ? 18.736  13.821  21.200  1.00 53.79 ? 254  HIS B NE2 1 
ATOM   3878 N N   . MET B 1 260 ? 17.061  8.492   19.734  1.00 56.08 ? 255  MET B N   1 
ATOM   3879 C CA  . MET B 1 260 ? 16.151  7.750   18.890  1.00 56.20 ? 255  MET B CA  1 
ATOM   3880 C C   . MET B 1 260 ? 15.673  8.668   17.763  1.00 55.90 ? 255  MET B C   1 
ATOM   3881 O O   . MET B 1 260 ? 14.569  9.235   17.826  1.00 55.49 ? 255  MET B O   1 
ATOM   3882 C CB  . MET B 1 260 ? 14.972  7.190   19.676  1.00 56.21 ? 255  MET B CB  1 
ATOM   3883 C CG  . MET B 1 260 ? 14.366  5.985   19.008  1.00 55.64 ? 255  MET B CG  1 
ATOM   3884 S SD  . MET B 1 260 ? 12.578  6.104   19.012  1.00 56.95 ? 255  MET B SD  1 
ATOM   3885 N N   . LEU B 1 261 ? 16.525  8.799   16.740  1.00 55.49 ? 256  LEU B N   1 
ATOM   3886 C CA  . LEU B 1 261 ? 16.276  9.673   15.581  1.00 54.74 ? 256  LEU B CA  1 
ATOM   3887 C C   . LEU B 1 261 ? 15.229  9.071   14.661  1.00 53.86 ? 256  LEU B C   1 
ATOM   3888 O O   . LEU B 1 261 ? 15.386  7.937   14.204  1.00 53.45 ? 256  LEU B O   1 
ATOM   3889 C CB  . LEU B 1 261 ? 17.557  9.876   14.783  1.00 54.74 ? 256  LEU B CB  1 
ATOM   3890 C CG  . LEU B 1 261 ? 18.861  9.977   15.553  1.00 55.28 ? 256  LEU B CG  1 
ATOM   3891 C CD1 . LEU B 1 261 ? 19.927  9.281   14.763  1.00 55.86 ? 256  LEU B CD1 1 
ATOM   3892 C CD2 . LEU B 1 261 ? 19.218  11.417  15.812  1.00 56.58 ? 256  LEU B CD2 1 
ATOM   3893 N N   . ILE B 1 262 ? 14.170  9.839   14.401  1.00 52.89 ? 257  ILE B N   1 
ATOM   3894 C CA  . ILE B 1 262 ? 13.138  9.457   13.427  1.00 51.92 ? 257  ILE B CA  1 
ATOM   3895 C C   . ILE B 1 262 ? 13.129  10.379  12.188  1.00 51.61 ? 257  ILE B C   1 
ATOM   3896 O O   . ILE B 1 262 ? 12.951  11.601  12.315  1.00 51.22 ? 257  ILE B O   1 
ATOM   3897 C CB  . ILE B 1 262 ? 11.727  9.429   14.061  1.00 51.67 ? 257  ILE B CB  1 
ATOM   3898 C CG1 . ILE B 1 262 ? 11.675  8.413   15.221  1.00 50.41 ? 257  ILE B CG1 1 
ATOM   3899 C CG2 . ILE B 1 262 ? 10.677  9.126   12.993  1.00 50.95 ? 257  ILE B CG2 1 
ATOM   3900 C CD1 . ILE B 1 262 ? 10.684  8.779   16.291  1.00 45.03 ? 257  ILE B CD1 1 
ATOM   3901 N N   . PRO B 1 263 ? 13.332  9.798   10.989  1.00 51.10 ? 258  PRO B N   1 
ATOM   3902 C CA  . PRO B 1 263 ? 13.260  10.582  9.744   1.00 50.54 ? 258  PRO B CA  1 
ATOM   3903 C C   . PRO B 1 263 ? 11.825  10.900  9.368   1.00 49.65 ? 258  PRO B C   1 
ATOM   3904 O O   . PRO B 1 263 ? 10.965  10.027  9.334   1.00 49.14 ? 258  PRO B O   1 
ATOM   3905 C CB  . PRO B 1 263 ? 13.932  9.666   8.703   1.00 50.67 ? 258  PRO B CB  1 
ATOM   3906 C CG  . PRO B 1 263 ? 14.642  8.577   9.532   1.00 51.26 ? 258  PRO B CG  1 
ATOM   3907 C CD  . PRO B 1 263 ? 13.700  8.402   10.707  1.00 51.50 ? 258  PRO B CD  1 
ATOM   3908 N N   . VAL B 1 264 ? 11.570  12.176  9.138   1.00 49.70 ? 259  VAL B N   1 
ATOM   3909 C CA  . VAL B 1 264 ? 10.217  12.669  8.876   1.00 49.21 ? 259  VAL B CA  1 
ATOM   3910 C C   . VAL B 1 264 ? 10.315  13.570  7.633   1.00 48.67 ? 259  VAL B C   1 
ATOM   3911 O O   . VAL B 1 264 ? 11.254  14.368  7.509   1.00 48.10 ? 259  VAL B O   1 
ATOM   3912 C CB  . VAL B 1 264 ? 9.626   13.445  10.111  1.00 49.10 ? 259  VAL B CB  1 
ATOM   3913 C CG1 . VAL B 1 264 ? 8.385   14.209  9.749   1.00 49.13 ? 259  VAL B CG1 1 
ATOM   3914 C CG2 . VAL B 1 264 ? 9.296   12.492  11.255  1.00 49.27 ? 259  VAL B CG2 1 
ATOM   3915 N N   . SER B 1 265 ? 9.360   13.391  6.716   1.00 47.89 ? 260  SER B N   1 
ATOM   3916 C CA  . SER B 1 265 ? 9.297   14.138  5.470   1.00 47.49 ? 260  SER B CA  1 
ATOM   3917 C C   . SER B 1 265 ? 8.408   15.371  5.591   1.00 46.62 ? 260  SER B C   1 
ATOM   3918 O O   . SER B 1 265 ? 7.306   15.282  6.135   1.00 46.05 ? 260  SER B O   1 
ATOM   3919 C CB  . SER B 1 265 ? 8.758   13.229  4.360   1.00 47.49 ? 260  SER B CB  1 
ATOM   3920 O OG  . SER B 1 265 ? 9.796   12.422  3.830   1.00 49.63 ? 260  SER B OG  1 
ATOM   3921 N N   . MET B 1 266 ? 8.872   16.503  5.051   1.00 46.38 ? 261  MET B N   1 
ATOM   3922 C CA  . MET B 1 266 ? 8.098   17.758  5.070   1.00 45.96 ? 261  MET B CA  1 
ATOM   3923 C C   . MET B 1 266 ? 8.310   18.609  3.781   1.00 45.67 ? 261  MET B C   1 
ATOM   3924 O O   . MET B 1 266 ? 8.050   19.821  3.746   1.00 44.28 ? 261  MET B O   1 
ATOM   3925 C CB  . MET B 1 266 ? 8.435   18.548  6.351   1.00 46.80 ? 261  MET B CB  1 
ATOM   3926 C CG  . MET B 1 266 ? 7.350   19.523  6.853   1.00 47.09 ? 261  MET B CG  1 
ATOM   3927 S SD  . MET B 1 266 ? 5.633   18.952  7.003   1.00 52.42 ? 261  MET B SD  1 
ATOM   3928 C CE  . MET B 1 266 ? 5.684   17.958  8.488   1.00 47.01 ? 261  MET B CE  1 
ATOM   3929 N N   . SER B 1 267 ? 8.747   17.934  2.722   1.00 44.98 ? 262  SER B N   1 
ATOM   3930 C CA  . SER B 1 267 ? 9.201   18.592  1.495   1.00 45.01 ? 262  SER B CA  1 
ATOM   3931 C C   . SER B 1 267 ? 8.113   19.388  0.760   1.00 43.97 ? 262  SER B C   1 
ATOM   3932 O O   . SER B 1 267 ? 8.415   20.389  0.126   1.00 44.45 ? 262  SER B O   1 
ATOM   3933 C CB  . SER B 1 267 ? 9.857   17.570  0.557   1.00 45.04 ? 262  SER B CB  1 
ATOM   3934 O OG  . SER B 1 267 ? 8.962   16.513  0.270   1.00 43.93 ? 262  SER B OG  1 
ATOM   3935 N N   . GLU B 1 268 ? 6.866   18.941  0.848   1.00 43.39 ? 263  GLU B N   1 
ATOM   3936 C CA  . GLU B 1 268 ? 5.758   19.683  0.254   1.00 43.10 ? 263  GLU B CA  1 
ATOM   3937 C C   . GLU B 1 268 ? 5.409   20.960  1.014   1.00 42.90 ? 263  GLU B C   1 
ATOM   3938 O O   . GLU B 1 268 ? 5.264   22.025  0.422   1.00 42.71 ? 263  GLU B O   1 
ATOM   3939 C CB  . GLU B 1 268 ? 4.528   18.790  0.071   1.00 43.16 ? 263  GLU B CB  1 
ATOM   3940 C CG  . GLU B 1 268 ? 4.617   17.878  -1.163  1.00 45.34 ? 263  GLU B CG  1 
ATOM   3941 C CD  . GLU B 1 268 ? 4.926   18.660  -2.423  1.00 47.67 ? 263  GLU B CD  1 
ATOM   3942 O OE1 . GLU B 1 268 ? 4.166   19.598  -2.760  1.00 48.80 ? 263  GLU B OE1 1 
ATOM   3943 O OE2 . GLU B 1 268 ? 5.941   18.353  -3.079  1.00 50.05 ? 263  GLU B OE2 1 
ATOM   3944 N N   . LEU B 1 269 ? 5.295   20.869  2.336   1.00 42.16 ? 264  LEU B N   1 
ATOM   3945 C CA  . LEU B 1 269 ? 5.029   22.061  3.129   1.00 40.67 ? 264  LEU B CA  1 
ATOM   3946 C C   . LEU B 1 269 ? 6.213   23.016  3.180   1.00 40.13 ? 264  LEU B C   1 
ATOM   3947 O O   . LEU B 1 269 ? 6.015   24.210  3.376   1.00 40.43 ? 264  LEU B O   1 
ATOM   3948 C CB  . LEU B 1 269 ? 4.517   21.697  4.529   1.00 40.66 ? 264  LEU B CB  1 
ATOM   3949 C CG  . LEU B 1 269 ? 3.116   21.067  4.514   1.00 39.90 ? 264  LEU B CG  1 
ATOM   3950 C CD1 . LEU B 1 269 ? 2.622   20.854  5.900   1.00 41.06 ? 264  LEU B CD1 1 
ATOM   3951 C CD2 . LEU B 1 269 ? 2.146   21.948  3.742   1.00 41.29 ? 264  LEU B CD2 1 
ATOM   3952 N N   . GLU B 1 270 ? 7.433   22.521  3.001   1.00 39.92 ? 265  GLU B N   1 
ATOM   3953 C CA  . GLU B 1 270 ? 8.592   23.423  2.964   1.00 40.85 ? 265  GLU B CA  1 
ATOM   3954 C C   . GLU B 1 270 ? 8.491   24.501  1.844   1.00 41.69 ? 265  GLU B C   1 
ATOM   3955 O O   . GLU B 1 270 ? 9.053   25.609  1.940   1.00 41.99 ? 265  GLU B O   1 
ATOM   3956 C CB  . GLU B 1 270 ? 9.874   22.632  2.794   1.00 40.68 ? 265  GLU B CB  1 
ATOM   3957 C CG  . GLU B 1 270 ? 11.093  23.512  2.897   1.00 42.94 ? 265  GLU B CG  1 
ATOM   3958 C CD  . GLU B 1 270 ? 12.393  22.773  2.692   1.00 45.92 ? 265  GLU B CD  1 
ATOM   3959 O OE1 . GLU B 1 270 ? 12.447  21.542  2.933   1.00 48.66 ? 265  GLU B OE1 1 
ATOM   3960 O OE2 . GLU B 1 270 ? 13.365  23.442  2.276   1.00 45.81 ? 265  GLU B OE2 1 
ATOM   3961 N N   . LYS B 1 271 ? 7.768   24.157  0.788   1.00 42.22 ? 266  LYS B N   1 
ATOM   3962 C CA  . LYS B 1 271 ? 7.482   25.076  -0.314  1.00 42.41 ? 266  LYS B CA  1 
ATOM   3963 C C   . LYS B 1 271 ? 6.662   26.289  0.143   1.00 42.67 ? 266  LYS B C   1 
ATOM   3964 O O   . LYS B 1 271 ? 6.673   27.349  -0.513  1.00 43.05 ? 266  LYS B O   1 
ATOM   3965 C CB  . LYS B 1 271 ? 6.728   24.327  -1.399  1.00 42.17 ? 266  LYS B CB  1 
ATOM   3966 C CG  . LYS B 1 271 ? 7.556   23.293  -2.149  1.00 42.20 ? 266  LYS B CG  1 
ATOM   3967 C CD  . LYS B 1 271 ? 6.610   22.298  -2.831  1.00 44.41 ? 266  LYS B CD  1 
ATOM   3968 N N   . VAL B 1 272 ? 5.927   26.136  1.240   1.00 41.36 ? 267  VAL B N   1 
ATOM   3969 C CA  . VAL B 1 272 ? 5.213   27.266  1.821   1.00 41.13 ? 267  VAL B CA  1 
ATOM   3970 C C   . VAL B 1 272 ? 5.812   27.664  3.199   1.00 41.62 ? 267  VAL B C   1 
ATOM   3971 O O   . VAL B 1 272 ? 5.139   28.263  4.058   1.00 41.35 ? 267  VAL B O   1 
ATOM   3972 C CB  . VAL B 1 272 ? 3.656   27.065  1.842   1.00 40.88 ? 267  VAL B CB  1 
ATOM   3973 C CG1 . VAL B 1 272 ? 3.080   27.109  0.412   1.00 40.95 ? 267  VAL B CG1 1 
ATOM   3974 C CG2 . VAL B 1 272 ? 3.262   25.783  2.544   1.00 39.95 ? 267  VAL B CG2 1 
ATOM   3975 N N   . ASP B 1 273 ? 7.096   27.341  3.362   1.00 41.92 ? 268  ASP B N   1 
ATOM   3976 C CA  . ASP B 1 273 ? 7.871   27.705  4.540   1.00 43.07 ? 268  ASP B CA  1 
ATOM   3977 C C   . ASP B 1 273 ? 7.414   26.969  5.807   1.00 42.43 ? 268  ASP B C   1 
ATOM   3978 O O   . ASP B 1 273 ? 7.644   27.453  6.910   1.00 42.76 ? 268  ASP B O   1 
ATOM   3979 C CB  . ASP B 1 273 ? 7.854   29.230  4.753   1.00 43.30 ? 268  ASP B CB  1 
ATOM   3980 C CG  . ASP B 1 273 ? 8.191   29.995  3.490   1.00 47.17 ? 268  ASP B CG  1 
ATOM   3981 O OD1 . ASP B 1 273 ? 9.168   29.609  2.796   1.00 47.65 ? 268  ASP B OD1 1 
ATOM   3982 O OD2 . ASP B 1 273 ? 7.453   30.975  3.181   1.00 51.61 ? 268  ASP B OD2 1 
ATOM   3983 N N   . GLY B 1 274 ? 6.766   25.812  5.634   1.00 42.02 ? 269  GLY B N   1 
ATOM   3984 C CA  . GLY B 1 274 ? 6.388   24.949  6.758   1.00 42.51 ? 269  GLY B CA  1 
ATOM   3985 C C   . GLY B 1 274 ? 7.455   23.900  7.019   1.00 42.01 ? 269  GLY B C   1 
ATOM   3986 O O   . GLY B 1 274 ? 7.746   23.063  6.160   1.00 41.89 ? 269  GLY B O   1 
ATOM   3987 N N   . LEU B 1 275 ? 8.032   23.943  8.214   1.00 42.02 ? 270  LEU B N   1 
ATOM   3988 C CA  . LEU B 1 275 ? 9.082   22.998  8.607   1.00 41.42 ? 270  LEU B CA  1 
ATOM   3989 C C   . LEU B 1 275 ? 8.581   22.106  9.758   1.00 40.96 ? 270  LEU B C   1 
ATOM   3990 O O   . LEU B 1 275 ? 7.403   22.144  10.100  1.00 40.84 ? 270  LEU B O   1 
ATOM   3991 C CB  . LEU B 1 275 ? 10.365  23.750  8.980   1.00 41.81 ? 270  LEU B CB  1 
ATOM   3992 C CG  . LEU B 1 275 ? 10.738  24.988  8.145   1.00 41.46 ? 270  LEU B CG  1 
ATOM   3993 C CD1 . LEU B 1 275 ? 12.020  25.630  8.645   1.00 38.94 ? 270  LEU B CD1 1 
ATOM   3994 C CD2 . LEU B 1 275 ? 10.869  24.604  6.696   1.00 40.98 ? 270  LEU B CD2 1 
ATOM   3995 N N   . LEU B 1 276 ? 9.456   21.282  10.327  1.00 40.92 ? 271  LEU B N   1 
ATOM   3996 C CA  . LEU B 1 276 ? 8.994   20.342  11.363  1.00 39.69 ? 271  LEU B CA  1 
ATOM   3997 C C   . LEU B 1 276 ? 8.335   21.037  12.546  1.00 38.43 ? 271  LEU B C   1 
ATOM   3998 O O   . LEU B 1 276 ? 7.170   20.800  12.802  1.00 38.91 ? 271  LEU B O   1 
ATOM   3999 C CB  . LEU B 1 276 ? 10.065  19.326  11.762  1.00 39.59 ? 271  LEU B CB  1 
ATOM   4000 C CG  . LEU B 1 276 ? 10.351  18.285  10.661  1.00 39.70 ? 271  LEU B CG  1 
ATOM   4001 C CD1 . LEU B 1 276 ? 11.579  17.397  10.957  1.00 38.96 ? 271  LEU B CD1 1 
ATOM   4002 C CD2 . LEU B 1 276 ? 9.132   17.430  10.420  1.00 41.34 ? 271  LEU B CD2 1 
ATOM   4003 N N   . THR B 1 277 ? 9.014   21.983  13.186  1.00 37.41 ? 272  THR B N   1 
ATOM   4004 C CA  . THR B 1 277 ? 8.419   22.628  14.374  1.00 35.80 ? 272  THR B CA  1 
ATOM   4005 C C   . THR B 1 277 ? 7.106   23.331  14.149  1.00 34.32 ? 272  THR B C   1 
ATOM   4006 O O   . THR B 1 277 ? 6.324   23.459  15.080  1.00 32.07 ? 272  THR B O   1 
ATOM   4007 C CB  . THR B 1 277 ? 9.350   23.648  15.052  1.00 36.32 ? 272  THR B CB  1 
ATOM   4008 O OG1 . THR B 1 277 ? 9.513   24.808  14.210  1.00 37.42 ? 272  THR B OG1 1 
ATOM   4009 C CG2 . THR B 1 277 ? 10.669  23.014  15.415  1.00 36.85 ? 272  THR B CG2 1 
ATOM   4010 N N   . CYS B 1 278 ? 6.881   23.826  12.925  1.00 33.81 ? 273  CYS B N   1 
ATOM   4011 C CA  . CYS B 1 278 ? 5.670   24.596  12.603  1.00 33.86 ? 273  CYS B CA  1 
ATOM   4012 C C   . CYS B 1 278 ? 4.371   23.850  12.742  1.00 32.57 ? 273  CYS B C   1 
ATOM   4013 O O   . CYS B 1 278 ? 3.336   24.455  12.944  1.00 31.91 ? 273  CYS B O   1 
ATOM   4014 C CB  . CYS B 1 278 ? 5.732   25.196  11.168  1.00 34.20 ? 273  CYS B CB  1 
ATOM   4015 S SG  . CYS B 1 278 ? 7.284   25.961  10.736  1.00 39.03 ? 273  CYS B SG  1 
ATOM   4016 N N   . CYS B 1 279 ? 4.398   22.535  12.582  1.00 33.02 ? 274  CYS B N   1 
ATOM   4017 C CA  . CYS B 1 279 ? 3.138   21.815  12.526  1.00 33.20 ? 274  CYS B CA  1 
ATOM   4018 C C   . CYS B 1 279 ? 2.613   21.258  13.855  1.00 33.31 ? 274  CYS B C   1 
ATOM   4019 O O   . CYS B 1 279 ? 1.614   20.543  13.848  1.00 34.20 ? 274  CYS B O   1 
ATOM   4020 C CB  . CYS B 1 279 ? 3.191   20.707  11.473  1.00 33.48 ? 274  CYS B CB  1 
ATOM   4021 S SG  . CYS B 1 279 ? 3.517   21.370  9.824   1.00 36.36 ? 274  CYS B SG  1 
ATOM   4022 N N   . SER B 1 280 ? 3.234   21.607  14.988  1.00 32.16 ? 275  SER B N   1 
ATOM   4023 C CA  . SER B 1 280 ? 2.667   21.215  16.283  1.00 31.47 ? 275  SER B CA  1 
ATOM   4024 C C   . SER B 1 280 ? 2.940   22.230  17.410  1.00 31.37 ? 275  SER B C   1 
ATOM   4025 O O   . SER B 1 280 ? 3.907   23.019  17.334  1.00 30.22 ? 275  SER B O   1 
ATOM   4026 C CB  . SER B 1 280 ? 3.176   19.852  16.678  1.00 30.85 ? 275  SER B CB  1 
ATOM   4027 O OG  . SER B 1 280 ? 4.585   19.857  16.737  1.00 29.77 ? 275  SER B OG  1 
ATOM   4028 N N   . VAL B 1 281 ? 2.029   22.249  18.387  1.00 29.92 ? 276  VAL B N   1 
ATOM   4029 C CA  . VAL B 1 281 ? 2.249   22.949  19.644  1.00 29.48 ? 276  VAL B CA  1 
ATOM   4030 C C   . VAL B 1 281 ? 2.351   21.782  20.654  1.00 30.01 ? 276  VAL B C   1 
ATOM   4031 O O   . VAL B 1 281 ? 1.429   20.965  20.749  1.00 29.03 ? 276  VAL B O   1 
ATOM   4032 C CB  . VAL B 1 281 ? 1.074   23.957  19.974  1.00 28.86 ? 276  VAL B CB  1 
ATOM   4033 C CG1 . VAL B 1 281 ? 1.123   24.426  21.438  1.00 29.14 ? 276  VAL B CG1 1 
ATOM   4034 C CG2 . VAL B 1 281 ? 1.131   25.234  19.090  1.00 27.89 ? 276  VAL B CG2 1 
ATOM   4035 N N   . LEU B 1 282 ? 3.477   21.668  21.347  1.00 30.33 ? 277  LEU B N   1 
ATOM   4036 C CA  . LEU B 1 282 ? 3.694   20.561  22.294  1.00 31.41 ? 277  LEU B CA  1 
ATOM   4037 C C   . LEU B 1 282 ? 3.427   21.063  23.707  1.00 32.25 ? 277  LEU B C   1 
ATOM   4038 O O   . LEU B 1 282 ? 3.743   22.215  24.031  1.00 33.15 ? 277  LEU B O   1 
ATOM   4039 C CB  . LEU B 1 282 ? 5.124   20.024  22.182  1.00 30.92 ? 277  LEU B CB  1 
ATOM   4040 C CG  . LEU B 1 282 ? 5.516   19.463  20.815  1.00 30.82 ? 277  LEU B CG  1 
ATOM   4041 C CD1 . LEU B 1 282 ? 6.933   19.057  20.789  1.00 30.47 ? 277  LEU B CD1 1 
ATOM   4042 C CD2 . LEU B 1 282 ? 4.629   18.285  20.344  1.00 34.03 ? 277  LEU B CD2 1 
ATOM   4043 N N   . ILE B 1 283 ? 2.883   20.189  24.559  1.00 32.92 ? 278  ILE B N   1 
ATOM   4044 C CA  . ILE B 1 283 ? 2.383   20.580  25.865  1.00 33.18 ? 278  ILE B CA  1 
ATOM   4045 C C   . ILE B 1 283 ? 2.617   19.489  26.887  1.00 34.28 ? 278  ILE B C   1 
ATOM   4046 O O   . ILE B 1 283 ? 2.295   18.313  26.634  1.00 33.44 ? 278  ILE B O   1 
ATOM   4047 C CB  . ILE B 1 283 ? 0.873   20.817  25.785  1.00 33.43 ? 278  ILE B CB  1 
ATOM   4048 C CG1 . ILE B 1 283 ? 0.608   21.994  24.846  1.00 32.93 ? 278  ILE B CG1 1 
ATOM   4049 C CG2 . ILE B 1 283 ? 0.261   21.044  27.180  1.00 33.81 ? 278  ILE B CG2 1 
ATOM   4050 C CD1 . ILE B 1 283 ? -0.623  21.841  24.000  1.00 33.19 ? 278  ILE B CD1 1 
ATOM   4051 N N   . ASN B 1 284 ? 3.124   19.889  28.061  1.00 35.24 ? 279  ASN B N   1 
ATOM   4052 C CA  . ASN B 1 284 ? 3.290   18.945  29.181  1.00 36.10 ? 279  ASN B CA  1 
ATOM   4053 C C   . ASN B 1 284 ? 2.233   19.230  30.213  1.00 36.76 ? 279  ASN B C   1 
ATOM   4054 O O   . ASN B 1 284 ? 2.358   20.182  30.978  1.00 37.55 ? 279  ASN B O   1 
ATOM   4055 C CB  . ASN B 1 284 ? 4.680   19.072  29.790  1.00 34.78 ? 279  ASN B CB  1 
ATOM   4056 C CG  . ASN B 1 284 ? 5.097   17.837  30.597  1.00 35.97 ? 279  ASN B CG  1 
ATOM   4057 O OD1 . ASN B 1 284 ? 4.416   16.783  30.596  1.00 33.56 ? 279  ASN B OD1 1 
ATOM   4058 N ND2 . ASN B 1 284 ? 6.235   17.960  31.284  1.00 32.17 ? 279  ASN B ND2 1 
ATOM   4059 N N   . LYS B 1 285 ? 1.169   18.440  30.208  1.00 37.50 ? 280  LYS B N   1 
ATOM   4060 C CA  . LYS B 1 285 ? 0.084   18.642  31.133  1.00 38.81 ? 280  LYS B CA  1 
ATOM   4061 C C   . LYS B 1 285 ? 0.282   17.638  32.284  1.00 39.84 ? 280  LYS B C   1 
ATOM   4062 O O   . LYS B 1 285 ? 0.415   16.428  32.068  1.00 39.11 ? 280  LYS B O   1 
ATOM   4063 C CB  . LYS B 1 285 ? -1.272  18.484  30.443  1.00 39.00 ? 280  LYS B CB  1 
ATOM   4064 N N   . LYS B 1 286 ? 0.347   18.175  33.498  1.00 41.23 ? 281  LYS B N   1 
ATOM   4065 C CA  . LYS B 1 286 ? 0.772   17.413  34.675  1.00 42.21 ? 281  LYS B CA  1 
ATOM   4066 C C   . LYS B 1 286 ? -0.415  17.099  35.547  1.00 42.25 ? 281  LYS B C   1 
ATOM   4067 O O   . LYS B 1 286 ? -1.304  16.351  35.122  1.00 43.14 ? 281  LYS B O   1 
ATOM   4068 C CB  . LYS B 1 286 ? 1.820   18.200  35.449  1.00 42.59 ? 281  LYS B CB  1 
HETATM 4069 N N   . D20 C 2 .   ? 15.962  4.316   67.613  1.00 30.06 ? 500  D20 A N   1 
HETATM 4070 C C1  . D20 C 2 .   ? 16.244  5.258   66.518  1.00 32.14 ? 500  D20 A C1  1 
HETATM 4071 C C   . D20 C 2 .   ? 15.088  6.212   66.179  1.00 34.83 ? 500  D20 A C   1 
HETATM 4072 O O   . D20 C 2 .   ? 14.011  6.072   66.811  1.00 36.03 ? 500  D20 A O   1 
HETATM 4073 C C2  . D20 C 2 .   ? 16.685  4.449   65.276  1.00 31.50 ? 500  D20 A C2  1 
HETATM 4074 C C3  . D20 C 2 .   ? 15.621  3.416   64.924  1.00 28.46 ? 500  D20 A C3  1 
HETATM 4075 C C4  . D20 C 2 .   ? 16.034  2.629   63.639  1.00 30.22 ? 500  D20 A C4  1 
HETATM 4076 N N5  . D20 C 2 .   ? 16.227  3.468   62.415  1.00 30.04 ? 500  D20 A N5  1 
HETATM 4077 C C6  . D20 C 2 .   ? 15.228  3.801   61.582  1.00 33.57 ? 500  D20 A C6  1 
HETATM 4078 N N61 . D20 C 2 .   ? 13.957  3.355   61.871  1.00 32.17 ? 500  D20 A N61 1 
HETATM 4079 N N62 . D20 C 2 .   ? 15.539  4.533   60.484  1.00 32.73 ? 500  D20 A N62 1 
HETATM 4080 C C7  . D20 C 2 .   ? 12.784  3.654   61.054  1.00 33.65 ? 500  D20 A C7  1 
HETATM 4081 C C8  . D20 C 2 .   ? 13.533  1.750   58.059  1.00 33.55 ? 500  D20 A C8  1 
HETATM 4082 O O9  . D20 C 2 .   ? 15.317  7.069   65.279  1.00 36.88 ? 500  D20 A O9  1 
HETATM 4083 O O10 . D20 C 2 .   ? 13.538  2.915   58.932  1.00 35.72 ? 500  D20 A O10 1 
HETATM 4084 C C10 . D20 C 2 .   ? 12.560  2.634   59.950  1.00 32.69 ? 500  D20 A C10 1 
HETATM 4085 N N   . D20 D 2 .   ? 2.929   30.095  4.932   1.00 41.59 ? 500  D20 B N   1 
HETATM 4086 C C1  . D20 D 2 .   ? 3.089   30.991  6.121   1.00 42.91 ? 500  D20 B C1  1 
HETATM 4087 C C   . D20 D 2 .   ? 4.216   32.036  5.938   1.00 42.88 ? 500  D20 B C   1 
HETATM 4088 O O   . D20 D 2 .   ? 5.098   31.820  5.074   1.00 42.96 ? 500  D20 B O   1 
HETATM 4089 C C2  . D20 D 2 .   ? 3.316   30.166  7.440   1.00 41.92 ? 500  D20 B C2  1 
HETATM 4090 C C3  . D20 D 2 .   ? 4.596   29.319  7.455   1.00 42.94 ? 500  D20 B C3  1 
HETATM 4091 C C4  . D20 D 2 .   ? 4.761   28.494  8.782   1.00 40.78 ? 500  D20 B C4  1 
HETATM 4092 N N5  . D20 D 2 .   ? 5.353   29.301  9.880   1.00 41.39 ? 500  D20 B N5  1 
HETATM 4093 C C6  . D20 D 2 .   ? 6.689   29.610  9.901   1.00 40.75 ? 500  D20 B C6  1 
HETATM 4094 N N61 . D20 D 2 .   ? 7.526   29.178  8.952   1.00 40.75 ? 500  D20 B N61 1 
HETATM 4095 N N62 . D20 D 2 .   ? 7.188   30.339  10.901  1.00 39.51 ? 500  D20 B N62 1 
HETATM 4096 C C7  . D20 D 2 .   ? 8.968   29.488  8.935   1.00 41.58 ? 500  D20 B C7  1 
HETATM 4097 C C8  . D20 D 2 .   ? 9.996   27.721  11.985  1.00 47.69 ? 500  D20 B C8  1 
HETATM 4098 O O9  . D20 D 2 .   ? 4.169   33.039  6.686   1.00 43.66 ? 500  D20 B O9  1 
HETATM 4099 O O10 . D20 D 2 .   ? 9.424   28.752  11.156  1.00 47.32 ? 500  D20 B O10 1 
HETATM 4100 C C10 . D20 D 2 .   ? 9.748   28.465  9.766   1.00 45.03 ? 500  D20 B C10 1 
HETATM 4101 O O   . HOH E 3 .   ? 20.947  -4.480  43.870  1.00 24.97 ? 2001 HOH A O   1 
HETATM 4102 O O   . HOH E 3 .   ? 20.114  -7.395  48.516  1.00 43.21 ? 2002 HOH A O   1 
HETATM 4103 O O   . HOH E 3 .   ? 23.430  -5.492  47.702  1.00 44.16 ? 2003 HOH A O   1 
HETATM 4104 O O   . HOH E 3 .   ? 23.240  -5.603  43.988  1.00 25.47 ? 2004 HOH A O   1 
HETATM 4105 O O   . HOH E 3 .   ? 20.331  -3.174  46.127  1.00 32.71 ? 2005 HOH A O   1 
HETATM 4106 O O   . HOH E 3 .   ? 20.985  -2.899  41.549  1.00 38.40 ? 2006 HOH A O   1 
HETATM 4107 O O   . HOH E 3 .   ? 21.081  -4.964  48.467  1.00 42.55 ? 2007 HOH A O   1 
HETATM 4108 O O   . HOH E 3 .   ? 30.477  -13.658 50.033  1.00 47.09 ? 2008 HOH A O   1 
HETATM 4109 O O   . HOH E 3 .   ? 25.503  -3.629  43.798  1.00 43.02 ? 2009 HOH A O   1 
HETATM 4110 O O   . HOH E 3 .   ? 20.168  -3.698  39.160  1.00 48.72 ? 2010 HOH A O   1 
HETATM 4111 O O   . HOH E 3 .   ? 36.222  3.327   65.248  1.00 44.50 ? 2011 HOH A O   1 
HETATM 4112 O O   . HOH E 3 .   ? 34.572  4.318   67.775  1.00 51.00 ? 2012 HOH A O   1 
HETATM 4113 O O   . HOH E 3 .   ? 17.455  -2.230  80.151  1.00 35.81 ? 2013 HOH A O   1 
HETATM 4114 O O   . HOH E 3 .   ? 20.885  1.149   81.050  1.00 30.41 ? 2014 HOH A O   1 
HETATM 4115 O O   . HOH E 3 .   ? 32.244  3.267   68.343  1.00 37.86 ? 2015 HOH A O   1 
HETATM 4116 O O   . HOH E 3 .   ? 23.455  -7.694  69.295  1.00 32.35 ? 2016 HOH A O   1 
HETATM 4117 O O   . HOH E 3 .   ? 19.415  -0.265  79.027  1.00 25.27 ? 2017 HOH A O   1 
HETATM 4118 O O   . HOH E 3 .   ? 18.534  -4.554  80.593  1.00 35.49 ? 2018 HOH A O   1 
HETATM 4119 O O   . HOH E 3 .   ? 5.683   -6.398  70.409  1.00 44.64 ? 2019 HOH A O   1 
HETATM 4120 O O   . HOH E 3 .   ? 7.228   -12.752 74.542  1.00 33.90 ? 2020 HOH A O   1 
HETATM 4121 O O   . HOH E 3 .   ? 25.954  -16.136 63.362  1.00 40.25 ? 2021 HOH A O   1 
HETATM 4122 O O   . HOH E 3 .   ? 19.244  -19.346 60.164  1.00 49.99 ? 2022 HOH A O   1 
HETATM 4123 O O   . HOH E 3 .   ? 16.807  -18.260 62.145  1.00 48.14 ? 2023 HOH A O   1 
HETATM 4124 O O   . HOH E 3 .   ? 20.174  8.988   76.927  1.00 34.06 ? 2024 HOH A O   1 
HETATM 4125 O O   . HOH E 3 .   ? 19.601  8.631   74.288  1.00 33.93 ? 2025 HOH A O   1 
HETATM 4126 O O   . HOH E 3 .   ? 20.508  4.579   82.599  1.00 37.05 ? 2026 HOH A O   1 
HETATM 4127 O O   . HOH E 3 .   ? 28.274  -15.115 60.124  1.00 37.35 ? 2027 HOH A O   1 
HETATM 4128 O O   . HOH E 3 .   ? 27.629  -7.396  72.375  1.00 42.84 ? 2028 HOH A O   1 
HETATM 4129 O O   . HOH E 3 .   ? 27.344  3.024   80.080  1.00 50.09 ? 2029 HOH A O   1 
HETATM 4130 O O   . HOH E 3 .   ? 28.382  10.359  71.059  1.00 38.67 ? 2030 HOH A O   1 
HETATM 4131 O O   . HOH E 3 .   ? 8.507   -6.218  77.180  1.00 29.53 ? 2031 HOH A O   1 
HETATM 4132 O O   . HOH E 3 .   ? 14.221  -4.724  81.029  1.00 38.94 ? 2032 HOH A O   1 
HETATM 4133 O O   . HOH E 3 .   ? 14.953  -1.987  79.014  1.00 32.35 ? 2033 HOH A O   1 
HETATM 4134 O O   . HOH E 3 .   ? 12.529  -0.098  77.613  1.00 26.46 ? 2034 HOH A O   1 
HETATM 4135 O O   . HOH E 3 .   ? 16.287  -8.607  79.286  1.00 31.23 ? 2035 HOH A O   1 
HETATM 4136 O O   . HOH E 3 .   ? 16.006  -6.112  79.671  1.00 27.74 ? 2036 HOH A O   1 
HETATM 4137 O O   . HOH E 3 .   ? 19.545  -13.641 74.922  1.00 24.23 ? 2037 HOH A O   1 
HETATM 4138 O O   . HOH E 3 .   ? 22.377  -1.685  46.282  1.00 36.44 ? 2038 HOH A O   1 
HETATM 4139 O O   . HOH E 3 .   ? 6.517   -10.511 70.519  1.00 41.19 ? 2039 HOH A O   1 
HETATM 4140 O O   . HOH E 3 .   ? 7.169   -8.126  71.791  1.00 39.94 ? 2040 HOH A O   1 
HETATM 4141 O O   . HOH E 3 .   ? 6.845   -12.892 68.202  1.00 39.45 ? 2041 HOH A O   1 
HETATM 4142 O O   . HOH E 3 .   ? 9.856   -14.520 73.837  1.00 41.37 ? 2042 HOH A O   1 
HETATM 4143 O O   . HOH E 3 .   ? 9.797   -15.575 71.379  1.00 49.88 ? 2043 HOH A O   1 
HETATM 4144 O O   . HOH E 3 .   ? 28.562  13.116  61.178  1.00 43.68 ? 2044 HOH A O   1 
HETATM 4145 O O   . HOH E 3 .   ? 15.255  -12.505 64.750  1.00 21.74 ? 2045 HOH A O   1 
HETATM 4146 O O   . HOH E 3 .   ? 14.501  -7.414  67.942  1.00 27.14 ? 2046 HOH A O   1 
HETATM 4147 O O   . HOH E 3 .   ? 11.085  -13.887 69.018  1.00 50.26 ? 2047 HOH A O   1 
HETATM 4148 O O   . HOH E 3 .   ? 24.588  -10.316 67.135  1.00 28.91 ? 2048 HOH A O   1 
HETATM 4149 O O   . HOH E 3 .   ? 20.941  -14.660 72.781  1.00 28.24 ? 2049 HOH A O   1 
HETATM 4150 O O   . HOH E 3 .   ? 24.184  -15.046 64.916  1.00 36.20 ? 2050 HOH A O   1 
HETATM 4151 O O   . HOH E 3 .   ? 36.148  -6.759  56.208  1.00 38.43 ? 2051 HOH A O   1 
HETATM 4152 O O   . HOH E 3 .   ? 36.139  -4.660  59.844  1.00 32.53 ? 2052 HOH A O   1 
HETATM 4153 O O   . HOH E 3 .   ? 39.029  6.325   51.486  1.00 37.44 ? 2053 HOH A O   1 
HETATM 4154 O O   . HOH E 3 .   ? 19.108  -17.659 62.261  1.00 28.89 ? 2054 HOH A O   1 
HETATM 4155 O O   . HOH E 3 .   ? 25.949  -15.428 60.569  1.00 38.78 ? 2055 HOH A O   1 
HETATM 4156 O O   . HOH E 3 .   ? 22.500  -22.470 53.414  1.00 39.21 ? 2056 HOH A O   1 
HETATM 4157 O O   . HOH E 3 .   ? 16.149  -19.290 59.325  1.00 40.38 ? 2057 HOH A O   1 
HETATM 4158 O O   . HOH E 3 .   ? 25.926  -16.065 49.118  1.00 39.85 ? 2058 HOH A O   1 
HETATM 4159 O O   . HOH E 3 .   ? 16.736  -4.504  48.150  1.00 33.70 ? 2059 HOH A O   1 
HETATM 4160 O O   . HOH E 3 .   ? 29.613  -14.718 57.674  1.00 37.61 ? 2060 HOH A O   1 
HETATM 4161 O O   . HOH E 3 .   ? 26.560  -9.082  65.637  1.00 38.31 ? 2061 HOH A O   1 
HETATM 4162 O O   . HOH E 3 .   ? 25.718  -12.444 65.928  1.00 33.27 ? 2062 HOH A O   1 
HETATM 4163 O O   . HOH E 3 .   ? 33.640  -9.658  61.816  1.00 42.73 ? 2063 HOH A O   1 
HETATM 4164 O O   . HOH E 3 .   ? 15.428  21.489  54.651  1.00 52.28 ? 2064 HOH A O   1 
HETATM 4165 O O   . HOH E 3 .   ? 32.683  -0.515  70.468  1.00 42.01 ? 2065 HOH A O   1 
HETATM 4166 O O   . HOH E 3 .   ? 29.811  -6.389  71.297  1.00 39.82 ? 2066 HOH A O   1 
HETATM 4167 O O   . HOH E 3 .   ? 32.257  7.097   70.008  1.00 44.13 ? 2067 HOH A O   1 
HETATM 4168 O O   . HOH E 3 .   ? 30.991  0.335   75.101  1.00 35.61 ? 2068 HOH A O   1 
HETATM 4169 O O   . HOH E 3 .   ? 25.573  0.342   79.543  1.00 31.52 ? 2069 HOH A O   1 
HETATM 4170 O O   . HOH E 3 .   ? 30.420  8.114   71.784  1.00 41.00 ? 2070 HOH A O   1 
HETATM 4171 O O   . HOH E 3 .   ? 9.099   18.244  49.485  1.00 42.53 ? 2071 HOH A O   1 
HETATM 4172 O O   . HOH E 3 .   ? 20.789  6.923   70.279  1.00 32.90 ? 2072 HOH A O   1 
HETATM 4173 O O   . HOH E 3 .   ? 25.353  2.192   63.653  1.00 18.65 ? 2073 HOH A O   1 
HETATM 4174 O O   . HOH E 3 .   ? 18.163  -3.434  52.779  1.00 26.38 ? 2074 HOH A O   1 
HETATM 4175 O O   . HOH E 3 .   ? 23.019  -4.571  63.281  1.00 17.65 ? 2075 HOH A O   1 
HETATM 4176 O O   . HOH E 3 .   ? 20.795  -0.840  54.690  1.00 23.70 ? 2076 HOH A O   1 
HETATM 4177 O O   . HOH E 3 .   ? 17.069  2.248   59.150  1.00 23.41 ? 2077 HOH A O   1 
HETATM 4178 O O   . HOH E 3 .   ? 21.826  1.556   53.689  1.00 22.27 ? 2078 HOH A O   1 
HETATM 4179 O O   . HOH E 3 .   ? -2.547  10.909  47.497  1.00 35.87 ? 2079 HOH A O   1 
HETATM 4180 O O   . HOH E 3 .   ? 21.942  1.017   47.152  1.00 42.80 ? 2080 HOH A O   1 
HETATM 4181 O O   . HOH E 3 .   ? 22.808  0.728   51.361  1.00 20.10 ? 2081 HOH A O   1 
HETATM 4182 O O   . HOH E 3 .   ? 20.968  1.087   49.087  1.00 29.06 ? 2082 HOH A O   1 
HETATM 4183 O O   . HOH E 3 .   ? 27.204  -2.806  46.698  1.00 25.05 ? 2083 HOH A O   1 
HETATM 4184 O O   . HOH E 3 .   ? 24.049  -1.762  44.272  1.00 50.02 ? 2084 HOH A O   1 
HETATM 4185 O O   . HOH E 3 .   ? -3.365  -8.225  63.055  1.00 44.33 ? 2085 HOH A O   1 
HETATM 4186 O O   . HOH E 3 .   ? -5.268  -6.684  58.728  1.00 45.25 ? 2086 HOH A O   1 
HETATM 4187 O O   . HOH E 3 .   ? 28.870  11.986  58.568  1.00 31.18 ? 2087 HOH A O   1 
HETATM 4188 O O   . HOH E 3 .   ? 28.968  15.987  61.114  1.00 41.22 ? 2088 HOH A O   1 
HETATM 4189 O O   . HOH E 3 .   ? 24.408  20.851  62.781  1.00 37.35 ? 2089 HOH A O   1 
HETATM 4190 O O   . HOH E 3 .   ? 22.046  19.832  60.596  1.00 37.05 ? 2090 HOH A O   1 
HETATM 4191 O O   . HOH E 3 .   ? 13.580  -21.436 46.931  1.00 41.07 ? 2091 HOH A O   1 
HETATM 4192 O O   . HOH E 3 .   ? 20.984  8.769   71.665  1.00 51.06 ? 2092 HOH A O   1 
HETATM 4193 O O   . HOH E 3 .   ? 27.543  10.766  68.634  1.00 30.13 ? 2093 HOH A O   1 
HETATM 4194 O O   . HOH E 3 .   ? 5.469   -18.120 54.078  1.00 47.00 ? 2094 HOH A O   1 
HETATM 4195 O O   . HOH E 3 .   ? 6.046   -17.492 57.653  1.00 33.64 ? 2095 HOH A O   1 
HETATM 4196 O O   . HOH E 3 .   ? 6.368   -19.074 59.723  1.00 42.79 ? 2096 HOH A O   1 
HETATM 4197 O O   . HOH E 3 .   ? 2.239   -4.742  67.012  1.00 52.15 ? 2097 HOH A O   1 
HETATM 4198 O O   . HOH E 3 .   ? 21.122  18.634  62.711  1.00 34.10 ? 2098 HOH A O   1 
HETATM 4199 O O   . HOH E 3 .   ? 31.360  4.210   65.853  1.00 23.92 ? 2099 HOH A O   1 
HETATM 4200 O O   . HOH E 3 .   ? 28.097  2.112   63.308  1.00 23.61 ? 2100 HOH A O   1 
HETATM 4201 O O   . HOH E 3 .   ? 23.391  5.893   69.318  1.00 23.41 ? 2101 HOH A O   1 
HETATM 4202 O O   . HOH E 3 .   ? 5.685   -20.567 52.608  1.00 37.60 ? 2102 HOH A O   1 
HETATM 4203 O O   . HOH E 3 .   ? 32.922  11.193  63.206  1.00 40.14 ? 2103 HOH A O   1 
HETATM 4204 O O   . HOH E 3 .   ? 34.804  10.685  66.917  1.00 47.25 ? 2104 HOH A O   1 
HETATM 4205 O O   . HOH E 3 .   ? 36.653  6.149   61.168  1.00 40.39 ? 2105 HOH A O   1 
HETATM 4206 O O   . HOH E 3 .   ? 7.987   -20.868 52.591  1.00 40.21 ? 2106 HOH A O   1 
HETATM 4207 O O   . HOH E 3 .   ? 11.005  -22.383 50.069  1.00 45.80 ? 2107 HOH A O   1 
HETATM 4208 O O   . HOH E 3 .   ? 5.845   -2.043  69.303  1.00 35.90 ? 2108 HOH A O   1 
HETATM 4209 O O   . HOH E 3 .   ? 6.823   -10.092 75.480  1.00 43.68 ? 2109 HOH A O   1 
HETATM 4210 O O   . HOH E 3 .   ? 35.342  -4.380  57.213  1.00 32.62 ? 2110 HOH A O   1 
HETATM 4211 O O   . HOH E 3 .   ? 40.108  1.331   57.831  1.00 42.05 ? 2111 HOH A O   1 
HETATM 4212 O O   . HOH E 3 .   ? 38.227  6.569   53.647  1.00 49.48 ? 2112 HOH A O   1 
HETATM 4213 O O   . HOH E 3 .   ? 38.898  1.750   50.999  1.00 48.04 ? 2113 HOH A O   1 
HETATM 4214 O O   . HOH E 3 .   ? 40.953  -4.250  52.590  1.00 27.70 ? 2114 HOH A O   1 
HETATM 4215 O O   . HOH E 3 .   ? 20.540  -2.902  50.434  1.00 33.96 ? 2115 HOH A O   1 
HETATM 4216 O O   . HOH E 3 .   ? 41.237  -0.289  47.505  1.00 31.22 ? 2116 HOH A O   1 
HETATM 4217 O O   . HOH E 3 .   ? 37.585  6.539   49.207  1.00 38.38 ? 2117 HOH A O   1 
HETATM 4218 O O   . HOH E 3 .   ? 34.186  12.685  51.382  1.00 38.23 ? 2118 HOH A O   1 
HETATM 4219 O O   . HOH E 3 .   ? 31.606  11.794  58.738  1.00 37.89 ? 2119 HOH A O   1 
HETATM 4220 O O   . HOH E 3 .   ? 30.086  17.709  59.747  1.00 48.77 ? 2120 HOH A O   1 
HETATM 4221 O O   . HOH E 3 .   ? 29.342  16.878  52.696  1.00 35.87 ? 2121 HOH A O   1 
HETATM 4222 O O   . HOH E 3 .   ? 20.455  20.953  59.327  1.00 46.84 ? 2122 HOH A O   1 
HETATM 4223 O O   . HOH E 3 .   ? 19.999  22.421  55.375  1.00 48.44 ? 2123 HOH A O   1 
HETATM 4224 O O   . HOH E 3 .   ? 17.366  17.397  59.669  1.00 34.22 ? 2124 HOH A O   1 
HETATM 4225 O O   . HOH E 3 .   ? 19.547  9.675   63.202  1.00 22.24 ? 2125 HOH A O   1 
HETATM 4226 O O   . HOH E 3 .   ? 17.608  7.857   63.768  1.00 23.17 ? 2126 HOH A O   1 
HETATM 4227 O O   . HOH E 3 .   ? 19.293  2.656   52.829  1.00 24.80 ? 2127 HOH A O   1 
HETATM 4228 O O   . HOH E 3 .   ? 19.293  2.355   49.971  1.00 36.88 ? 2128 HOH A O   1 
HETATM 4229 O O   . HOH E 3 .   ? 17.433  -1.664  47.429  1.00 41.65 ? 2129 HOH A O   1 
HETATM 4230 O O   . HOH E 3 .   ? 16.830  0.600   49.658  1.00 29.23 ? 2130 HOH A O   1 
HETATM 4231 O O   . HOH E 3 .   ? 14.058  -3.381  40.406  1.00 31.82 ? 2131 HOH A O   1 
HETATM 4232 O O   . HOH E 3 .   ? 17.181  -3.802  38.400  1.00 54.16 ? 2132 HOH A O   1 
HETATM 4233 O O   . HOH E 3 .   ? 18.174  6.255   37.391  1.00 28.66 ? 2133 HOH A O   1 
HETATM 4234 O O   . HOH E 3 .   ? 17.899  2.845   35.221  1.00 44.90 ? 2134 HOH A O   1 
HETATM 4235 O O   . HOH E 3 .   ? 13.435  8.634   37.629  1.00 41.45 ? 2135 HOH A O   1 
HETATM 4236 O O   . HOH E 3 .   ? 14.987  17.467  58.914  1.00 40.50 ? 2136 HOH A O   1 
HETATM 4237 O O   . HOH E 3 .   ? 13.490  17.652  55.943  1.00 38.21 ? 2137 HOH A O   1 
HETATM 4238 O O   . HOH E 3 .   ? 16.666  21.105  57.655  1.00 43.89 ? 2138 HOH A O   1 
HETATM 4239 O O   . HOH E 3 .   ? 12.862  20.597  50.048  1.00 39.14 ? 2139 HOH A O   1 
HETATM 4240 O O   . HOH E 3 .   ? 14.051  19.375  53.832  1.00 25.34 ? 2140 HOH A O   1 
HETATM 4241 O O   . HOH E 3 .   ? 13.417  17.831  46.906  1.00 34.12 ? 2141 HOH A O   1 
HETATM 4242 O O   . HOH E 3 .   ? 18.170  21.145  53.592  1.00 29.38 ? 2142 HOH A O   1 
HETATM 4243 O O   . HOH E 3 .   ? 19.491  23.198  49.540  1.00 41.94 ? 2143 HOH A O   1 
HETATM 4244 O O   . HOH E 3 .   ? 22.229  11.460  41.062  1.00 25.92 ? 2144 HOH A O   1 
HETATM 4245 O O   . HOH E 3 .   ? 29.256  13.656  46.646  1.00 39.05 ? 2145 HOH A O   1 
HETATM 4246 O O   . HOH E 3 .   ? 22.582  17.198  44.195  1.00 36.30 ? 2146 HOH A O   1 
HETATM 4247 O O   . HOH E 3 .   ? 29.058  6.902   41.544  1.00 47.15 ? 2147 HOH A O   1 
HETATM 4248 O O   . HOH E 3 .   ? 30.584  9.691   44.112  1.00 36.64 ? 2148 HOH A O   1 
HETATM 4249 O O   . HOH E 3 .   ? 26.534  6.208   40.976  1.00 36.75 ? 2149 HOH A O   1 
HETATM 4250 O O   . HOH E 3 .   ? 20.390  5.925   35.654  1.00 37.75 ? 2150 HOH A O   1 
HETATM 4251 O O   . HOH E 3 .   ? 22.925  -1.618  41.628  1.00 43.84 ? 2151 HOH A O   1 
HETATM 4252 O O   . HOH E 3 .   ? 14.307  8.886   41.329  1.00 30.52 ? 2152 HOH A O   1 
HETATM 4253 O O   . HOH E 3 .   ? 9.672   16.034  48.026  1.00 34.83 ? 2153 HOH A O   1 
HETATM 4254 O O   . HOH E 3 .   ? 7.883   14.728  46.196  1.00 38.50 ? 2154 HOH A O   1 
HETATM 4255 O O   . HOH E 3 .   ? 4.082   11.664  51.056  1.00 30.12 ? 2155 HOH A O   1 
HETATM 4256 O O   . HOH E 3 .   ? 2.042   9.372   59.738  1.00 50.30 ? 2156 HOH A O   1 
HETATM 4257 O O   . HOH E 3 .   ? 11.745  9.531   63.871  1.00 41.41 ? 2157 HOH A O   1 
HETATM 4258 O O   . HOH E 3 .   ? 12.508  10.300  60.119  1.00 35.66 ? 2158 HOH A O   1 
HETATM 4259 O O   . HOH E 3 .   ? 9.400   12.041  59.766  1.00 31.84 ? 2159 HOH A O   1 
HETATM 4260 O O   . HOH E 3 .   ? 16.472  -1.365  51.890  1.00 31.22 ? 2160 HOH A O   1 
HETATM 4261 O O   . HOH E 3 .   ? 5.105   2.402   59.922  1.00 32.92 ? 2161 HOH A O   1 
HETATM 4262 O O   . HOH E 3 .   ? 14.436  -5.047  50.570  1.00 25.56 ? 2162 HOH A O   1 
HETATM 4263 O O   . HOH E 3 .   ? 14.440  -2.243  49.945  1.00 26.38 ? 2163 HOH A O   1 
HETATM 4264 O O   . HOH E 3 .   ? 10.663  -0.379  36.467  1.00 46.35 ? 2164 HOH A O   1 
HETATM 4265 O O   . HOH E 3 .   ? 12.890  -2.511  38.169  1.00 43.80 ? 2165 HOH A O   1 
HETATM 4266 O O   . HOH E 3 .   ? -5.055  3.512   52.099  1.00 33.42 ? 2166 HOH A O   1 
HETATM 4267 O O   . HOH E 3 .   ? -3.622  8.121   50.975  1.00 35.90 ? 2167 HOH A O   1 
HETATM 4268 O O   . HOH E 3 .   ? -1.518  7.129   58.059  1.00 40.67 ? 2168 HOH A O   1 
HETATM 4269 O O   . HOH E 3 .   ? 2.955   10.209  53.121  1.00 30.01 ? 2169 HOH A O   1 
HETATM 4270 O O   . HOH E 3 .   ? -5.028  3.749   47.654  1.00 44.12 ? 2170 HOH A O   1 
HETATM 4271 O O   . HOH E 3 .   ? -4.043  -0.046  49.875  1.00 45.05 ? 2171 HOH A O   1 
HETATM 4272 O O   . HOH E 3 .   ? 0.096   11.520  47.236  1.00 43.61 ? 2172 HOH A O   1 
HETATM 4273 O O   . HOH E 3 .   ? -3.381  8.559   48.310  1.00 41.96 ? 2173 HOH A O   1 
HETATM 4274 O O   . HOH E 3 .   ? 0.554   7.984   41.265  1.00 50.53 ? 2174 HOH A O   1 
HETATM 4275 O O   . HOH E 3 .   ? 5.027   2.976   39.285  1.00 34.32 ? 2175 HOH A O   1 
HETATM 4276 O O   . HOH E 3 .   ? 11.888  11.982  39.072  1.00 40.35 ? 2176 HOH A O   1 
HETATM 4277 O O   . HOH E 3 .   ? 4.935   8.500   36.398  1.00 45.75 ? 2177 HOH A O   1 
HETATM 4278 O O   . HOH E 3 .   ? 11.920  8.210   35.243  1.00 28.00 ? 2178 HOH A O   1 
HETATM 4279 O O   . HOH E 3 .   ? 5.829   8.779   33.253  1.00 41.23 ? 2179 HOH A O   1 
HETATM 4280 O O   . HOH E 3 .   ? 6.231   5.117   38.287  1.00 35.59 ? 2180 HOH A O   1 
HETATM 4281 O O   . HOH E 3 .   ? 16.021  6.675   36.113  1.00 38.84 ? 2181 HOH A O   1 
HETATM 4282 O O   . HOH E 3 .   ? 13.121  6.072   32.971  1.00 47.00 ? 2182 HOH A O   1 
HETATM 4283 O O   . HOH E 3 .   ? 3.462   -2.817  36.165  1.00 52.57 ? 2183 HOH A O   1 
HETATM 4284 O O   . HOH E 3 .   ? -1.080  -0.180  47.116  1.00 28.21 ? 2184 HOH A O   1 
HETATM 4285 O O   . HOH E 3 .   ? 1.615   -4.353  40.981  1.00 36.98 ? 2185 HOH A O   1 
HETATM 4286 O O   . HOH E 3 .   ? -2.993  -6.460  51.573  1.00 37.07 ? 2186 HOH A O   1 
HETATM 4287 O O   . HOH E 3 .   ? -1.728  -7.414  48.552  1.00 35.96 ? 2187 HOH A O   1 
HETATM 4288 O O   . HOH E 3 .   ? -0.707  -4.791  45.695  1.00 32.23 ? 2188 HOH A O   1 
HETATM 4289 O O   . HOH E 3 .   ? -0.362  -6.908  46.450  1.00 43.22 ? 2189 HOH A O   1 
HETATM 4290 O O   . HOH E 3 .   ? -1.099  -2.643  61.559  1.00 42.05 ? 2190 HOH A O   1 
HETATM 4291 O O   . HOH E 3 .   ? -3.620  -5.604  60.062  1.00 30.23 ? 2191 HOH A O   1 
HETATM 4292 O O   . HOH E 3 .   ? -1.369  -8.696  60.903  1.00 27.54 ? 2192 HOH A O   1 
HETATM 4293 O O   . HOH E 3 .   ? -1.222  -5.284  63.261  1.00 40.96 ? 2193 HOH A O   1 
HETATM 4294 O O   . HOH E 3 .   ? -0.464  -0.171  59.363  1.00 36.07 ? 2194 HOH A O   1 
HETATM 4295 O O   . HOH E 3 .   ? 3.917   3.868   58.761  1.00 29.97 ? 2195 HOH A O   1 
HETATM 4296 O O   . HOH E 3 .   ? 0.510   2.352   60.178  1.00 44.45 ? 2196 HOH A O   1 
HETATM 4297 O O   . HOH E 3 .   ? 9.559   -5.011  59.584  1.00 20.27 ? 2197 HOH A O   1 
HETATM 4298 O O   . HOH E 3 .   ? 2.244   -1.384  61.118  1.00 29.30 ? 2198 HOH A O   1 
HETATM 4299 O O   . HOH E 3 .   ? 8.437   -7.800  56.615  1.00 21.51 ? 2199 HOH A O   1 
HETATM 4300 O O   . HOH E 3 .   ? 16.889  -10.152 41.479  1.00 30.33 ? 2200 HOH A O   1 
HETATM 4301 O O   . HOH E 3 .   ? 14.497  -18.814 45.708  1.00 30.92 ? 2201 HOH A O   1 
HETATM 4302 O O   . HOH E 3 .   ? 14.273  -17.888 42.782  1.00 40.00 ? 2202 HOH A O   1 
HETATM 4303 O O   . HOH E 3 .   ? 7.384   -17.479 55.343  1.00 30.86 ? 2203 HOH A O   1 
HETATM 4304 O O   . HOH E 3 .   ? -0.824  -14.974 64.717  1.00 47.97 ? 2204 HOH A O   1 
HETATM 4305 O O   . HOH E 3 .   ? 7.832   -17.706 62.204  1.00 35.32 ? 2205 HOH A O   1 
HETATM 4306 O O   . HOH E 3 .   ? 3.513   -6.994  66.522  1.00 41.08 ? 2206 HOH A O   1 
HETATM 4307 O O   . HOH E 3 .   ? 4.295   -10.224 58.280  1.00 38.70 ? 2207 HOH A O   1 
HETATM 4308 O O   . HOH E 3 .   ? -0.042  -15.423 58.855  1.00 36.64 ? 2208 HOH A O   1 
HETATM 4309 O O   . HOH E 3 .   ? -3.874  -10.529 54.220  1.00 31.75 ? 2209 HOH A O   1 
HETATM 4310 O O   . HOH E 3 .   ? -5.322  -10.231 62.614  1.00 40.68 ? 2210 HOH A O   1 
HETATM 4311 O O   . HOH E 3 .   ? 4.834   -19.685 50.171  1.00 36.19 ? 2211 HOH A O   1 
HETATM 4312 O O   . HOH E 3 .   ? 7.539   -19.433 48.832  1.00 31.51 ? 2212 HOH A O   1 
HETATM 4313 O O   . HOH E 3 .   ? 9.844   -20.516 46.354  1.00 47.91 ? 2213 HOH A O   1 
HETATM 4314 O O   . HOH E 3 .   ? 7.679   -15.177 43.852  1.00 34.04 ? 2214 HOH A O   1 
HETATM 4315 O O   . HOH E 3 .   ? 9.641   -20.170 50.902  1.00 31.66 ? 2215 HOH A O   1 
HETATM 4316 O O   . HOH E 3 .   ? 8.983   -19.676 54.991  1.00 33.13 ? 2216 HOH A O   1 
HETATM 4317 O O   . HOH E 3 .   ? 10.277  -17.450 62.796  1.00 35.88 ? 2217 HOH A O   1 
HETATM 4318 O O   . HOH E 3 .   ? 13.463  -18.212 60.042  1.00 37.35 ? 2218 HOH A O   1 
HETATM 4319 O O   . HOH E 3 .   ? 8.007   -13.889 65.958  1.00 31.34 ? 2219 HOH A O   1 
HETATM 4320 O O   . HOH E 3 .   ? 13.932  -14.788 63.841  1.00 22.84 ? 2220 HOH A O   1 
HETATM 4321 O O   . HOH E 3 .   ? 11.745  -15.990 64.301  1.00 37.38 ? 2221 HOH A O   1 
HETATM 4322 O O   . HOH E 3 .   ? 7.000   -4.762  69.349  1.00 28.25 ? 2222 HOH A O   1 
HETATM 4323 O O   . HOH E 3 .   ? 9.295   -8.439  75.945  1.00 29.95 ? 2223 HOH A O   1 
HETATM 4324 O O   . HOH E 3 .   ? 5.048   -1.589  67.319  1.00 37.52 ? 2224 HOH A O   1 
HETATM 4325 O O   . HOH E 3 .   ? 5.953   -6.806  66.726  1.00 33.26 ? 2225 HOH A O   1 
HETATM 4326 O O   . HOH E 3 .   ? 9.145   3.791   69.443  1.00 31.93 ? 2226 HOH A O   1 
HETATM 4327 O O   . HOH E 3 .   ? 8.356   2.076   72.306  1.00 32.56 ? 2227 HOH A O   1 
HETATM 4328 O O   . HOH E 3 .   ? 10.778  6.508   62.098  1.00 26.97 ? 2228 HOH A O   1 
HETATM 4329 O O   . HOH E 3 .   ? 8.865   4.052   62.053  1.00 29.74 ? 2229 HOH A O   1 
HETATM 4330 O O   . HOH E 3 .   ? 19.186  -3.834  55.092  1.00 24.20 ? 2230 HOH A O   1 
HETATM 4331 O O   . HOH E 3 .   ? 24.726  -2.818  47.683  1.00 37.42 ? 2231 HOH A O   1 
HETATM 4332 O O   . HOH E 3 .   ? 22.030  -1.892  52.483  1.00 27.28 ? 2232 HOH A O   1 
HETATM 4333 O O   . HOH E 3 .   ? 27.137  -4.450  42.437  1.00 33.32 ? 2233 HOH A O   1 
HETATM 4334 O O   . HOH F 3 .   ? 8.808   17.411  44.191  1.00 43.34 ? 2001 HOH B O   1 
HETATM 4335 O O   . HOH F 3 .   ? 16.354  6.307   33.549  1.00 41.27 ? 2002 HOH B O   1 
HETATM 4336 O O   . HOH F 3 .   ? 9.635   14.448  37.938  1.00 40.51 ? 2003 HOH B O   1 
HETATM 4337 O O   . HOH F 3 .   ? 8.944   19.158  31.555  1.00 46.59 ? 2004 HOH B O   1 
HETATM 4338 O O   . HOH F 3 .   ? 15.478  15.719  28.068  1.00 38.72 ? 2005 HOH B O   1 
HETATM 4339 O O   . HOH F 3 .   ? 15.573  17.640  31.791  1.00 40.34 ? 2006 HOH B O   1 
HETATM 4340 O O   . HOH F 3 .   ? 17.406  4.311   33.058  1.00 39.24 ? 2007 HOH B O   1 
HETATM 4341 O O   . HOH F 3 .   ? 10.476  21.180  27.988  1.00 36.38 ? 2008 HOH B O   1 
HETATM 4342 O O   . HOH F 3 .   ? 8.365   19.956  28.877  1.00 37.08 ? 2009 HOH B O   1 
HETATM 4343 O O   . HOH F 3 .   ? 5.306   12.390  31.307  1.00 33.76 ? 2010 HOH B O   1 
HETATM 4344 O O   . HOH F 3 .   ? 16.814  15.812  30.629  1.00 54.35 ? 2011 HOH B O   1 
HETATM 4345 O O   . HOH F 3 .   ? 10.040  22.742  25.915  1.00 38.22 ? 2012 HOH B O   1 
HETATM 4346 O O   . HOH F 3 .   ? 10.432  23.257  30.903  1.00 41.08 ? 2013 HOH B O   1 
HETATM 4347 O O   . HOH F 3 .   ? 0.775   11.316  26.620  1.00 49.88 ? 2014 HOH B O   1 
HETATM 4348 O O   . HOH F 3 .   ? -5.154  25.479  -3.268  1.00 45.04 ? 2015 HOH B O   1 
HETATM 4349 O O   . HOH F 3 .   ? -3.368  15.367  9.388   1.00 50.75 ? 2016 HOH B O   1 
HETATM 4350 O O   . HOH F 3 .   ? -1.847  8.864   20.809  1.00 53.17 ? 2017 HOH B O   1 
HETATM 4351 O O   . HOH F 3 .   ? 5.112   9.118   25.311  1.00 34.74 ? 2018 HOH B O   1 
HETATM 4352 O O   . HOH F 3 .   ? -4.897  16.090  11.507  1.00 55.73 ? 2019 HOH B O   1 
HETATM 4353 O O   . HOH F 3 .   ? 6.180   27.843  12.978  1.00 46.12 ? 2020 HOH B O   1 
HETATM 4354 O O   . HOH F 3 .   ? 5.504   24.910  18.717  1.00 38.21 ? 2021 HOH B O   1 
HETATM 4355 O O   . HOH F 3 .   ? 4.825   27.171  19.645  1.00 39.88 ? 2022 HOH B O   1 
HETATM 4356 O O   . HOH F 3 .   ? 5.261   26.154  22.392  1.00 32.81 ? 2023 HOH B O   1 
HETATM 4357 O O   . HOH F 3 .   ? 8.842   20.761  23.953  1.00 40.25 ? 2024 HOH B O   1 
HETATM 4358 O O   . HOH F 3 .   ? -9.499  29.391  14.251  1.00 51.04 ? 2025 HOH B O   1 
HETATM 4359 O O   . HOH F 3 .   ? -5.252  27.511  14.737  1.00 47.51 ? 2026 HOH B O   1 
HETATM 4360 O O   . HOH F 3 .   ? -4.233  31.315  7.314   1.00 34.98 ? 2027 HOH B O   1 
HETATM 4361 O O   . HOH F 3 .   ? -3.208  27.539  12.893  1.00 33.45 ? 2028 HOH B O   1 
HETATM 4362 O O   . HOH F 3 .   ? 8.716   22.433  19.135  1.00 36.74 ? 2029 HOH B O   1 
HETATM 4363 O O   . HOH F 3 .   ? -7.906  29.784  31.176  1.00 51.76 ? 2030 HOH B O   1 
HETATM 4364 O O   . HOH F 3 .   ? 1.700   35.448  10.488  1.00 38.08 ? 2031 HOH B O   1 
HETATM 4365 O O   . HOH F 3 .   ? 7.120   28.568  19.452  1.00 39.52 ? 2032 HOH B O   1 
HETATM 4366 O O   . HOH F 3 .   ? 10.507  26.932  21.306  1.00 46.48 ? 2033 HOH B O   1 
HETATM 4367 O O   . HOH F 3 .   ? 9.747   38.010  37.652  1.00 42.27 ? 2034 HOH B O   1 
HETATM 4368 O O   . HOH F 3 .   ? 10.088  32.110  7.025   1.00 51.06 ? 2035 HOH B O   1 
HETATM 4369 O O   . HOH F 3 .   ? 13.285  20.801  18.623  1.00 58.71 ? 2036 HOH B O   1 
HETATM 4370 O O   . HOH F 3 .   ? 12.623  23.869  19.692  1.00 49.47 ? 2037 HOH B O   1 
HETATM 4371 O O   . HOH F 3 .   ? 13.303  21.075  8.947   1.00 48.57 ? 2038 HOH B O   1 
HETATM 4372 O O   . HOH F 3 .   ? 10.183  19.626  22.353  1.00 43.50 ? 2039 HOH B O   1 
HETATM 4373 O O   . HOH F 3 .   ? 12.995  9.540   29.196  1.00 37.92 ? 2040 HOH B O   1 
HETATM 4374 O O   . HOH F 3 .   ? 12.234  7.764   31.041  1.00 35.52 ? 2041 HOH B O   1 
HETATM 4375 O O   . HOH F 3 .   ? 7.841   29.957  0.495   1.00 56.61 ? 2042 HOH B O   1 
HETATM 4376 O O   . HOH F 3 .   ? 6.580   21.850  17.226  1.00 29.03 ? 2043 HOH B O   1 
HETATM 4377 O O   . HOH F 3 .   ? -0.326  20.693  12.049  1.00 35.67 ? 2044 HOH B O   1 
HETATM 4378 O O   . HOH F 3 .   ? 5.418   23.763  21.259  1.00 39.39 ? 2045 HOH B O   1 
HETATM 4379 O O   . HOH F 3 .   ? 5.650   22.985  26.411  1.00 44.20 ? 2046 HOH B O   1 
HETATM 4380 O O   . HOH F 3 .   ? 4.730   14.819  32.223  1.00 35.24 ? 2047 HOH B O   1 
HETATM 4381 O O   . HOH F 3 .   ? 4.040   22.570  28.578  1.00 37.08 ? 2048 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  ?   ?   ?   A . n 
A 1 2   PRO 2   -3  ?   ?   ?   A . n 
A 1 3   LEU 3   -2  ?   ?   ?   A . n 
A 1 4   GLY 4   -1  ?   ?   ?   A . n 
A 1 5   MET 5   0   ?   ?   ?   A . n 
A 1 6   ALA 6   1   ?   ?   ?   A . n 
A 1 7   GLY 7   2   ?   ?   ?   A . n 
A 1 8   LEU 8   3   ?   ?   ?   A . n 
A 1 9   GLY 9   4   ?   ?   ?   A . n 
A 1 10  HIS 10  5   ?   ?   ?   A . n 
A 1 11  PRO 11  6   ?   ?   ?   A . n 
A 1 12  ALA 12  7   ?   ?   ?   A . n 
A 1 13  ALA 13  8   8   ALA ALA A . n 
A 1 14  PHE 14  9   9   PHE PHE A . n 
A 1 15  GLY 15  10  10  GLY GLY A . n 
A 1 16  ARG 16  11  11  ARG ARG A . n 
A 1 17  ALA 17  12  12  ALA ALA A . n 
A 1 18  THR 18  13  13  THR THR A . n 
A 1 19  HIS 19  14  14  HIS HIS A . n 
A 1 20  ALA 20  15  15  ALA ALA A . n 
A 1 21  VAL 21  16  16  VAL VAL A . n 
A 1 22  VAL 22  17  17  VAL VAL A . n 
A 1 23  ARG 23  18  18  ARG ARG A . n 
A 1 24  ALA 24  19  19  ALA ALA A . n 
A 1 25  LEU 25  20  20  LEU LEU A . n 
A 1 26  PRO 26  21  21  PRO PRO A . n 
A 1 27  GLU 27  22  22  GLU GLU A . n 
A 1 28  SER 28  23  23  SER SER A . n 
A 1 29  LEU 29  24  24  LEU LEU A . n 
A 1 30  GLY 30  25  25  GLY GLY A . n 
A 1 31  GLN 31  26  26  GLN GLN A . n 
A 1 32  HIS 32  27  27  HIS HIS A . n 
A 1 33  ALA 33  28  28  ALA ALA A . n 
A 1 34  LEU 34  29  29  LEU LEU A . n 
A 1 35  ARG 35  30  30  ARG ARG A . n 
A 1 36  SER 36  31  31  SER SER A . n 
A 1 37  ALA 37  32  ?   ?   ?   A . n 
A 1 38  LYS 38  33  ?   ?   ?   A . n 
A 1 39  GLY 39  34  34  GLY GLY A . n 
A 1 40  GLU 40  35  35  GLU GLU A . n 
A 1 41  GLU 41  36  36  GLU GLU A . n 
A 1 42  VAL 42  37  37  VAL VAL A . n 
A 1 43  ASP 43  38  38  ASP ASP A . n 
A 1 44  VAL 44  39  39  VAL VAL A . n 
A 1 45  ALA 45  40  40  ALA ALA A . n 
A 1 46  ARG 46  41  41  ARG ARG A . n 
A 1 47  ALA 47  42  42  ALA ALA A . n 
A 1 48  GLU 48  43  43  GLU GLU A . n 
A 1 49  ARG 49  44  44  ARG ARG A . n 
A 1 50  GLN 50  45  45  GLN GLN A . n 
A 1 51  HIS 51  46  46  HIS HIS A . n 
A 1 52  GLN 52  47  47  GLN GLN A . n 
A 1 53  LEU 53  48  48  LEU LEU A . n 
A 1 54  TYR 54  49  49  TYR TYR A . n 
A 1 55  VAL 55  50  50  VAL VAL A . n 
A 1 56  GLY 56  51  51  GLY GLY A . n 
A 1 57  VAL 57  52  52  VAL VAL A . n 
A 1 58  LEU 58  53  53  LEU LEU A . n 
A 1 59  GLY 59  54  54  GLY GLY A . n 
A 1 60  SER 60  55  55  SER SER A . n 
A 1 61  LYS 61  56  56  LYS LYS A . n 
A 1 62  LEU 62  57  57  LEU LEU A . n 
A 1 63  GLY 63  58  58  GLY GLY A . n 
A 1 64  LEU 64  59  59  LEU LEU A . n 
A 1 65  GLN 65  60  60  GLN GLN A . n 
A 1 66  VAL 66  61  61  VAL VAL A . n 
A 1 67  VAL 67  62  62  VAL VAL A . n 
A 1 68  GLU 68  63  63  GLU GLU A . n 
A 1 69  LEU 69  64  64  LEU LEU A . n 
A 1 70  PRO 70  65  65  PRO PRO A . n 
A 1 71  ALA 71  66  66  ALA ALA A . n 
A 1 72  ASP 72  67  67  ASP ASP A . n 
A 1 73  GLU 73  68  68  GLU GLU A . n 
A 1 74  SER 74  69  69  SER SER A . n 
A 1 75  LEU 75  70  70  LEU LEU A . n 
A 1 76  PRO 76  71  71  PRO PRO A . n 
A 1 77  ASP 77  72  72  ASP ASP A . n 
A 1 78  CYS 78  73  73  CYS CYS A . n 
A 1 79  VAL 79  74  74  VAL VAL A . n 
A 1 80  PHE 80  75  75  PHE PHE A . n 
A 1 81  VAL 81  76  76  VAL VAL A . n 
A 1 82  GLU 82  77  77  GLU GLU A . n 
A 1 83  ASP 83  78  78  ASP ASP A . n 
A 1 84  VAL 84  79  79  VAL VAL A . n 
A 1 85  ALA 85  80  80  ALA ALA A . n 
A 1 86  VAL 86  81  81  VAL VAL A . n 
A 1 87  VAL 87  82  82  VAL VAL A . n 
A 1 88  CYS 88  83  83  CYS CYS A . n 
A 1 89  GLU 89  84  84  GLU GLU A . n 
A 1 90  GLU 90  85  85  GLU GLU A . n 
A 1 91  THR 91  86  86  THR THR A . n 
A 1 92  ALA 92  87  87  ALA ALA A . n 
A 1 93  LEU 93  88  88  LEU LEU A . n 
A 1 94  ILE 94  89  89  ILE ILE A . n 
A 1 95  THR 95  90  90  THR THR A . n 
A 1 96  ARG 96  91  91  ARG ARG A . n 
A 1 97  PRO 97  92  92  PRO PRO A . n 
A 1 98  GLY 98  93  93  GLY GLY A . n 
A 1 99  ALA 99  94  94  ALA ALA A . n 
A 1 100 PRO 100 95  95  PRO PRO A . n 
A 1 101 SER 101 96  96  SER SER A . n 
A 1 102 ARG 102 97  97  ARG ARG A . n 
A 1 103 ARG 103 98  98  ARG ARG A . n 
A 1 104 LYS 104 99  99  LYS LYS A . n 
A 1 105 GLU 105 100 100 GLU GLU A . n 
A 1 106 VAL 106 101 101 VAL VAL A . n 
A 1 107 ASP 107 102 102 ASP ASP A . n 
A 1 108 MET 108 103 103 MET MET A . n 
A 1 109 MET 109 104 104 MET MET A . n 
A 1 110 LYS 110 105 105 LYS LYS A . n 
A 1 111 GLU 111 106 106 GLU GLU A . n 
A 1 112 ALA 112 107 107 ALA ALA A . n 
A 1 113 LEU 113 108 108 LEU LEU A . n 
A 1 114 GLU 114 109 109 GLU GLU A . n 
A 1 115 LYS 115 110 110 LYS LYS A . n 
A 1 116 LEU 116 111 111 LEU LEU A . n 
A 1 117 GLN 117 112 112 GLN GLN A . n 
A 1 118 LEU 118 113 113 LEU LEU A . n 
A 1 119 ASN 119 114 114 ASN ASN A . n 
A 1 120 ILE 120 115 115 ILE ILE A . n 
A 1 121 VAL 121 116 116 VAL VAL A . n 
A 1 122 GLU 122 117 117 GLU GLU A . n 
A 1 123 MET 123 118 118 MET MET A . n 
A 1 124 LYS 124 119 119 LYS LYS A . n 
A 1 125 ASP 125 120 120 ASP ASP A . n 
A 1 126 GLU 126 121 121 GLU GLU A . n 
A 1 127 ASN 127 122 122 ASN ASN A . n 
A 1 128 ALA 128 123 123 ALA ALA A . n 
A 1 129 THR 129 124 124 THR THR A . n 
A 1 130 LEU 130 125 125 LEU LEU A . n 
A 1 131 ASP 131 126 126 ASP ASP A . n 
A 1 132 GLY 132 127 127 GLY GLY A . n 
A 1 133 GLY 133 128 128 GLY GLY A . n 
A 1 134 ASP 134 129 129 ASP ASP A . n 
A 1 135 VAL 135 130 130 VAL VAL A . n 
A 1 136 LEU 136 131 131 LEU LEU A . n 
A 1 137 PHE 137 132 132 PHE PHE A . n 
A 1 138 THR 138 133 133 THR THR A . n 
A 1 139 GLY 139 134 134 GLY GLY A . n 
A 1 140 ARG 140 135 135 ARG ARG A . n 
A 1 141 GLU 141 136 136 GLU GLU A . n 
A 1 142 PHE 142 137 137 PHE PHE A . n 
A 1 143 PHE 143 138 138 PHE PHE A . n 
A 1 144 VAL 144 139 139 VAL VAL A . n 
A 1 145 GLY 145 140 140 GLY GLY A . n 
A 1 146 LEU 146 141 141 LEU LEU A . n 
A 1 147 SER 147 142 142 SER SER A . n 
A 1 148 LYS 148 143 143 LYS LYS A . n 
A 1 149 ARG 149 144 144 ARG ARG A . n 
A 1 150 THR 150 145 145 THR THR A . n 
A 1 151 ASN 151 146 146 ASN ASN A . n 
A 1 152 GLN 152 147 147 GLN GLN A . n 
A 1 153 ARG 153 148 148 ARG ARG A . n 
A 1 154 GLY 154 149 149 GLY GLY A . n 
A 1 155 ALA 155 150 150 ALA ALA A . n 
A 1 156 GLU 156 151 151 GLU GLU A . n 
A 1 157 ILE 157 152 152 ILE ILE A . n 
A 1 158 LEU 158 153 153 LEU LEU A . n 
A 1 159 ALA 159 154 154 ALA ALA A . n 
A 1 160 ASP 160 155 155 ASP ASP A . n 
A 1 161 THR 161 156 156 THR THR A . n 
A 1 162 PHE 162 157 157 PHE PHE A . n 
A 1 163 LYS 163 158 158 LYS LYS A . n 
A 1 164 ASP 164 159 159 ASP ASP A . n 
A 1 165 TYR 165 160 160 TYR TYR A . n 
A 1 166 ALA 166 161 161 ALA ALA A . n 
A 1 167 VAL 167 162 162 VAL VAL A . n 
A 1 168 SER 168 163 163 SER SER A . n 
A 1 169 THR 169 164 164 THR THR A . n 
A 1 170 VAL 170 165 165 VAL VAL A . n 
A 1 171 PRO 171 166 166 PRO PRO A . n 
A 1 172 VAL 172 167 167 VAL VAL A . n 
A 1 173 ALA 173 168 168 ALA ALA A . n 
A 1 174 ASP 174 169 169 ASP ASP A . n 
A 1 175 GLY 175 170 170 GLY GLY A . n 
A 1 176 LEU 176 171 171 LEU LEU A . n 
A 1 177 HIS 177 172 172 HIS HIS A . n 
A 1 178 LEU 178 173 173 LEU LEU A . n 
A 1 179 LYS 179 174 174 LYS LYS A . n 
A 1 180 SER 180 175 175 SER SER A . n 
A 1 181 PHE 181 176 176 PHE PHE A . n 
A 1 182 CYS 182 177 177 CYS CYS A . n 
A 1 183 SER 183 178 178 SER SER A . n 
A 1 184 MET 184 179 179 MET MET A . n 
A 1 185 ALA 185 180 180 ALA ALA A . n 
A 1 186 GLY 186 181 181 GLY GLY A . n 
A 1 187 PRO 187 182 182 PRO PRO A . n 
A 1 188 ASN 188 183 183 ASN ASN A . n 
A 1 189 LEU 189 184 184 LEU LEU A . n 
A 1 190 ILE 190 185 185 ILE ILE A . n 
A 1 191 ALA 191 186 186 ALA ALA A . n 
A 1 192 ILE 192 187 187 ILE ILE A . n 
A 1 193 GLY 193 188 188 GLY GLY A . n 
A 1 194 SER 194 189 189 SER SER A . n 
A 1 195 SER 195 190 190 SER SER A . n 
A 1 196 GLU 196 191 191 GLU GLU A . n 
A 1 197 SER 197 192 192 SER SER A . n 
A 1 198 ALA 198 193 193 ALA ALA A . n 
A 1 199 GLN 199 194 194 GLN GLN A . n 
A 1 200 LYS 200 195 195 LYS LYS A . n 
A 1 201 ALA 201 196 196 ALA ALA A . n 
A 1 202 LEU 202 197 197 LEU LEU A . n 
A 1 203 LYS 203 198 198 LYS LYS A . n 
A 1 204 ILE 204 199 199 ILE ILE A . n 
A 1 205 MET 205 200 200 MET MET A . n 
A 1 206 GLN 206 201 201 GLN GLN A . n 
A 1 207 GLN 207 202 202 GLN GLN A . n 
A 1 208 MET 208 203 203 MET MET A . n 
A 1 209 SER 209 204 204 SER SER A . n 
A 1 210 ASP 210 205 205 ASP ASP A . n 
A 1 211 HIS 211 206 206 HIS HIS A . n 
A 1 212 ARG 212 207 207 ARG ARG A . n 
A 1 213 TYR 213 208 208 TYR TYR A . n 
A 1 214 ASP 214 209 209 ASP ASP A . n 
A 1 215 LYS 215 210 210 LYS LYS A . n 
A 1 216 LEU 216 211 211 LEU LEU A . n 
A 1 217 THR 217 212 212 THR THR A . n 
A 1 218 VAL 218 213 213 VAL VAL A . n 
A 1 219 PRO 219 214 214 PRO PRO A . n 
A 1 220 ASP 220 215 215 ASP ASP A . n 
A 1 221 ASP 221 216 216 ASP ASP A . n 
A 1 222 ILE 222 217 217 ILE ILE A . n 
A 1 223 ALA 223 218 218 ALA ALA A . n 
A 1 224 ALA 224 219 219 ALA ALA A . n 
A 1 225 ASN 225 220 220 ASN ASN A . n 
A 1 226 CYS 226 221 221 CYS CYS A . n 
A 1 227 ILE 227 222 222 ILE ILE A . n 
A 1 228 TYR 228 223 223 TYR TYR A . n 
A 1 229 LEU 229 224 224 LEU LEU A . n 
A 1 230 ASN 230 225 225 ASN ASN A . n 
A 1 231 ILE 231 226 226 ILE ILE A . n 
A 1 232 PRO 232 227 227 PRO PRO A . n 
A 1 233 ASN 233 228 228 ASN ASN A . n 
A 1 234 LYS 234 229 229 LYS LYS A . n 
A 1 235 GLY 235 230 230 GLY GLY A . n 
A 1 236 HIS 236 231 231 HIS HIS A . n 
A 1 237 VAL 237 232 232 VAL VAL A . n 
A 1 238 LEU 238 233 233 LEU LEU A . n 
A 1 239 LEU 239 234 234 LEU LEU A . n 
A 1 240 HIS 240 235 235 HIS HIS A . n 
A 1 241 ARG 241 236 236 ARG ARG A . n 
A 1 242 THR 242 237 237 THR THR A . n 
A 1 243 PRO 243 238 238 PRO PRO A . n 
A 1 244 GLU 244 239 239 GLU GLU A . n 
A 1 245 GLU 245 240 240 GLU GLU A . n 
A 1 246 TYR 246 241 241 TYR TYR A . n 
A 1 247 PRO 247 242 242 PRO PRO A . n 
A 1 248 GLU 248 243 243 GLU GLU A . n 
A 1 249 SER 249 244 244 SER SER A . n 
A 1 250 ALA 250 245 245 ALA ALA A . n 
A 1 251 LYS 251 246 246 LYS LYS A . n 
A 1 252 VAL 252 247 247 VAL VAL A . n 
A 1 253 TYR 253 248 248 TYR TYR A . n 
A 1 254 GLU 254 249 249 GLU GLU A . n 
A 1 255 LYS 255 250 250 LYS LYS A . n 
A 1 256 LEU 256 251 251 LEU LEU A . n 
A 1 257 LYS 257 252 252 LYS LYS A . n 
A 1 258 ASP 258 253 253 ASP ASP A . n 
A 1 259 HIS 259 254 254 HIS HIS A . n 
A 1 260 MET 260 255 255 MET MET A . n 
A 1 261 LEU 261 256 256 LEU LEU A . n 
A 1 262 ILE 262 257 257 ILE ILE A . n 
A 1 263 PRO 263 258 258 PRO PRO A . n 
A 1 264 VAL 264 259 259 VAL VAL A . n 
A 1 265 SER 265 260 260 SER SER A . n 
A 1 266 MET 266 261 261 MET MET A . n 
A 1 267 SER 267 262 262 SER SER A . n 
A 1 268 GLU 268 263 263 GLU GLU A . n 
A 1 269 LEU 269 264 264 LEU LEU A . n 
A 1 270 GLU 270 265 265 GLU GLU A . n 
A 1 271 LYS 271 266 266 LYS LYS A . n 
A 1 272 VAL 272 267 267 VAL VAL A . n 
A 1 273 ASP 273 268 268 ASP ASP A . n 
A 1 274 GLY 274 269 269 GLY GLY A . n 
A 1 275 LEU 275 270 270 LEU LEU A . n 
A 1 276 LEU 276 271 271 LEU LEU A . n 
A 1 277 THR 277 272 272 THR THR A . n 
A 1 278 CYS 278 273 273 CYS CYS A . n 
A 1 279 CYS 279 274 274 CYS CYS A . n 
A 1 280 SER 280 275 275 SER SER A . n 
A 1 281 VAL 281 276 276 VAL VAL A . n 
A 1 282 LEU 282 277 277 LEU LEU A . n 
A 1 283 ILE 283 278 278 ILE ILE A . n 
A 1 284 ASN 284 279 279 ASN ASN A . n 
A 1 285 LYS 285 280 280 LYS LYS A . n 
A 1 286 LYS 286 281 281 LYS LYS A . n 
A 1 287 VAL 287 282 ?   ?   ?   A . n 
A 1 288 ASP 288 283 ?   ?   ?   A . n 
A 1 289 SER 289 284 ?   ?   ?   A . n 
B 1 1   GLY 1   -4  -4  GLY GLY B . n 
B 1 2   PRO 2   -3  -3  PRO PRO B . n 
B 1 3   LEU 3   -2  -2  LEU LEU B . n 
B 1 4   GLY 4   -1  -1  GLY GLY B . n 
B 1 5   MET 5   0   0   MET MET B . n 
B 1 6   ALA 6   1   1   ALA ALA B . n 
B 1 7   GLY 7   2   2   GLY GLY B . n 
B 1 8   LEU 8   3   3   LEU LEU B . n 
B 1 9   GLY 9   4   4   GLY GLY B . n 
B 1 10  HIS 10  5   5   HIS HIS B . n 
B 1 11  PRO 11  6   6   PRO PRO B . n 
B 1 12  ALA 12  7   7   ALA ALA B . n 
B 1 13  ALA 13  8   8   ALA ALA B . n 
B 1 14  PHE 14  9   9   PHE PHE B . n 
B 1 15  GLY 15  10  10  GLY GLY B . n 
B 1 16  ARG 16  11  11  ARG ARG B . n 
B 1 17  ALA 17  12  12  ALA ALA B . n 
B 1 18  THR 18  13  13  THR THR B . n 
B 1 19  HIS 19  14  14  HIS HIS B . n 
B 1 20  ALA 20  15  15  ALA ALA B . n 
B 1 21  VAL 21  16  16  VAL VAL B . n 
B 1 22  VAL 22  17  17  VAL VAL B . n 
B 1 23  ARG 23  18  18  ARG ARG B . n 
B 1 24  ALA 24  19  19  ALA ALA B . n 
B 1 25  LEU 25  20  20  LEU LEU B . n 
B 1 26  PRO 26  21  21  PRO PRO B . n 
B 1 27  GLU 27  22  22  GLU GLU B . n 
B 1 28  SER 28  23  23  SER SER B . n 
B 1 29  LEU 29  24  24  LEU LEU B . n 
B 1 30  GLY 30  25  25  GLY GLY B . n 
B 1 31  GLN 31  26  26  GLN GLN B . n 
B 1 32  HIS 32  27  27  HIS HIS B . n 
B 1 33  ALA 33  28  28  ALA ALA B . n 
B 1 34  LEU 34  29  29  LEU LEU B . n 
B 1 35  ARG 35  30  30  ARG ARG B . n 
B 1 36  SER 36  31  31  SER SER B . n 
B 1 37  ALA 37  32  32  ALA ALA B . n 
B 1 38  LYS 38  33  33  LYS LYS B . n 
B 1 39  GLY 39  34  ?   ?   ?   B . n 
B 1 40  GLU 40  35  ?   ?   ?   B . n 
B 1 41  GLU 41  36  36  GLU GLU B . n 
B 1 42  VAL 42  37  37  VAL VAL B . n 
B 1 43  ASP 43  38  38  ASP ASP B . n 
B 1 44  VAL 44  39  39  VAL VAL B . n 
B 1 45  ALA 45  40  40  ALA ALA B . n 
B 1 46  ARG 46  41  41  ARG ARG B . n 
B 1 47  ALA 47  42  42  ALA ALA B . n 
B 1 48  GLU 48  43  43  GLU GLU B . n 
B 1 49  ARG 49  44  44  ARG ARG B . n 
B 1 50  GLN 50  45  45  GLN GLN B . n 
B 1 51  HIS 51  46  46  HIS HIS B . n 
B 1 52  GLN 52  47  47  GLN GLN B . n 
B 1 53  LEU 53  48  48  LEU LEU B . n 
B 1 54  TYR 54  49  49  TYR TYR B . n 
B 1 55  VAL 55  50  50  VAL VAL B . n 
B 1 56  GLY 56  51  51  GLY GLY B . n 
B 1 57  VAL 57  52  52  VAL VAL B . n 
B 1 58  LEU 58  53  53  LEU LEU B . n 
B 1 59  GLY 59  54  54  GLY GLY B . n 
B 1 60  SER 60  55  55  SER SER B . n 
B 1 61  LYS 61  56  56  LYS LYS B . n 
B 1 62  LEU 62  57  57  LEU LEU B . n 
B 1 63  GLY 63  58  58  GLY GLY B . n 
B 1 64  LEU 64  59  59  LEU LEU B . n 
B 1 65  GLN 65  60  60  GLN GLN B . n 
B 1 66  VAL 66  61  61  VAL VAL B . n 
B 1 67  VAL 67  62  62  VAL VAL B . n 
B 1 68  GLU 68  63  63  GLU GLU B . n 
B 1 69  LEU 69  64  64  LEU LEU B . n 
B 1 70  PRO 70  65  65  PRO PRO B . n 
B 1 71  ALA 71  66  66  ALA ALA B . n 
B 1 72  ASP 72  67  67  ASP ASP B . n 
B 1 73  GLU 73  68  68  GLU GLU B . n 
B 1 74  SER 74  69  69  SER SER B . n 
B 1 75  LEU 75  70  70  LEU LEU B . n 
B 1 76  PRO 76  71  71  PRO PRO B . n 
B 1 77  ASP 77  72  72  ASP ASP B . n 
B 1 78  CYS 78  73  73  CYS CYS B . n 
B 1 79  VAL 79  74  74  VAL VAL B . n 
B 1 80  PHE 80  75  75  PHE PHE B . n 
B 1 81  VAL 81  76  76  VAL VAL B . n 
B 1 82  GLU 82  77  77  GLU GLU B . n 
B 1 83  ASP 83  78  78  ASP ASP B . n 
B 1 84  VAL 84  79  79  VAL VAL B . n 
B 1 85  ALA 85  80  80  ALA ALA B . n 
B 1 86  VAL 86  81  81  VAL VAL B . n 
B 1 87  VAL 87  82  82  VAL VAL B . n 
B 1 88  CYS 88  83  83  CYS CYS B . n 
B 1 89  GLU 89  84  84  GLU GLU B . n 
B 1 90  GLU 90  85  85  GLU GLU B . n 
B 1 91  THR 91  86  86  THR THR B . n 
B 1 92  ALA 92  87  87  ALA ALA B . n 
B 1 93  LEU 93  88  88  LEU LEU B . n 
B 1 94  ILE 94  89  89  ILE ILE B . n 
B 1 95  THR 95  90  90  THR THR B . n 
B 1 96  ARG 96  91  91  ARG ARG B . n 
B 1 97  PRO 97  92  92  PRO PRO B . n 
B 1 98  GLY 98  93  93  GLY GLY B . n 
B 1 99  ALA 99  94  94  ALA ALA B . n 
B 1 100 PRO 100 95  95  PRO PRO B . n 
B 1 101 SER 101 96  96  SER SER B . n 
B 1 102 ARG 102 97  97  ARG ARG B . n 
B 1 103 ARG 103 98  98  ARG ARG B . n 
B 1 104 LYS 104 99  99  LYS LYS B . n 
B 1 105 GLU 105 100 100 GLU GLU B . n 
B 1 106 VAL 106 101 101 VAL VAL B . n 
B 1 107 ASP 107 102 102 ASP ASP B . n 
B 1 108 MET 108 103 103 MET MET B . n 
B 1 109 MET 109 104 104 MET MET B . n 
B 1 110 LYS 110 105 105 LYS LYS B . n 
B 1 111 GLU 111 106 106 GLU GLU B . n 
B 1 112 ALA 112 107 107 ALA ALA B . n 
B 1 113 LEU 113 108 108 LEU LEU B . n 
B 1 114 GLU 114 109 109 GLU GLU B . n 
B 1 115 LYS 115 110 110 LYS LYS B . n 
B 1 116 LEU 116 111 111 LEU LEU B . n 
B 1 117 GLN 117 112 112 GLN GLN B . n 
B 1 118 LEU 118 113 113 LEU LEU B . n 
B 1 119 ASN 119 114 114 ASN ASN B . n 
B 1 120 ILE 120 115 115 ILE ILE B . n 
B 1 121 VAL 121 116 116 VAL VAL B . n 
B 1 122 GLU 122 117 117 GLU GLU B . n 
B 1 123 MET 123 118 118 MET MET B . n 
B 1 124 LYS 124 119 119 LYS LYS B . n 
B 1 125 ASP 125 120 120 ASP ASP B . n 
B 1 126 GLU 126 121 121 GLU GLU B . n 
B 1 127 ASN 127 122 122 ASN ASN B . n 
B 1 128 ALA 128 123 123 ALA ALA B . n 
B 1 129 THR 129 124 124 THR THR B . n 
B 1 130 LEU 130 125 125 LEU LEU B . n 
B 1 131 ASP 131 126 126 ASP ASP B . n 
B 1 132 GLY 132 127 127 GLY GLY B . n 
B 1 133 GLY 133 128 128 GLY GLY B . n 
B 1 134 ASP 134 129 129 ASP ASP B . n 
B 1 135 VAL 135 130 130 VAL VAL B . n 
B 1 136 LEU 136 131 131 LEU LEU B . n 
B 1 137 PHE 137 132 132 PHE PHE B . n 
B 1 138 THR 138 133 133 THR THR B . n 
B 1 139 GLY 139 134 134 GLY GLY B . n 
B 1 140 ARG 140 135 135 ARG ARG B . n 
B 1 141 GLU 141 136 136 GLU GLU B . n 
B 1 142 PHE 142 137 137 PHE PHE B . n 
B 1 143 PHE 143 138 138 PHE PHE B . n 
B 1 144 VAL 144 139 139 VAL VAL B . n 
B 1 145 GLY 145 140 140 GLY GLY B . n 
B 1 146 LEU 146 141 141 LEU LEU B . n 
B 1 147 SER 147 142 142 SER SER B . n 
B 1 148 LYS 148 143 143 LYS LYS B . n 
B 1 149 ARG 149 144 144 ARG ARG B . n 
B 1 150 THR 150 145 145 THR THR B . n 
B 1 151 ASN 151 146 146 ASN ASN B . n 
B 1 152 GLN 152 147 147 GLN GLN B . n 
B 1 153 ARG 153 148 148 ARG ARG B . n 
B 1 154 GLY 154 149 149 GLY GLY B . n 
B 1 155 ALA 155 150 150 ALA ALA B . n 
B 1 156 GLU 156 151 151 GLU GLU B . n 
B 1 157 ILE 157 152 152 ILE ILE B . n 
B 1 158 LEU 158 153 153 LEU LEU B . n 
B 1 159 ALA 159 154 154 ALA ALA B . n 
B 1 160 ASP 160 155 155 ASP ASP B . n 
B 1 161 THR 161 156 156 THR THR B . n 
B 1 162 PHE 162 157 157 PHE PHE B . n 
B 1 163 LYS 163 158 158 LYS LYS B . n 
B 1 164 ASP 164 159 159 ASP ASP B . n 
B 1 165 TYR 165 160 160 TYR TYR B . n 
B 1 166 ALA 166 161 161 ALA ALA B . n 
B 1 167 VAL 167 162 162 VAL VAL B . n 
B 1 168 SER 168 163 163 SER SER B . n 
B 1 169 THR 169 164 164 THR THR B . n 
B 1 170 VAL 170 165 165 VAL VAL B . n 
B 1 171 PRO 171 166 166 PRO PRO B . n 
B 1 172 VAL 172 167 167 VAL VAL B . n 
B 1 173 ALA 173 168 ?   ?   ?   B . n 
B 1 174 ASP 174 169 ?   ?   ?   B . n 
B 1 175 GLY 175 170 ?   ?   ?   B . n 
B 1 176 LEU 176 171 171 LEU LEU B . n 
B 1 177 HIS 177 172 172 HIS HIS B . n 
B 1 178 LEU 178 173 173 LEU LEU B . n 
B 1 179 LYS 179 174 174 LYS LYS B . n 
B 1 180 SER 180 175 175 SER SER B . n 
B 1 181 PHE 181 176 176 PHE PHE B . n 
B 1 182 CYS 182 177 177 CYS CYS B . n 
B 1 183 SER 183 178 178 SER SER B . n 
B 1 184 MET 184 179 179 MET MET B . n 
B 1 185 ALA 185 180 180 ALA ALA B . n 
B 1 186 GLY 186 181 181 GLY GLY B . n 
B 1 187 PRO 187 182 182 PRO PRO B . n 
B 1 188 ASN 188 183 183 ASN ASN B . n 
B 1 189 LEU 189 184 184 LEU LEU B . n 
B 1 190 ILE 190 185 185 ILE ILE B . n 
B 1 191 ALA 191 186 186 ALA ALA B . n 
B 1 192 ILE 192 187 187 ILE ILE B . n 
B 1 193 GLY 193 188 188 GLY GLY B . n 
B 1 194 SER 194 189 189 SER SER B . n 
B 1 195 SER 195 190 190 SER SER B . n 
B 1 196 GLU 196 191 191 GLU GLU B . n 
B 1 197 SER 197 192 192 SER SER B . n 
B 1 198 ALA 198 193 193 ALA ALA B . n 
B 1 199 GLN 199 194 194 GLN GLN B . n 
B 1 200 LYS 200 195 195 LYS LYS B . n 
B 1 201 ALA 201 196 196 ALA ALA B . n 
B 1 202 LEU 202 197 197 LEU LEU B . n 
B 1 203 LYS 203 198 198 LYS LYS B . n 
B 1 204 ILE 204 199 199 ILE ILE B . n 
B 1 205 MET 205 200 200 MET MET B . n 
B 1 206 GLN 206 201 201 GLN GLN B . n 
B 1 207 GLN 207 202 202 GLN GLN B . n 
B 1 208 MET 208 203 203 MET MET B . n 
B 1 209 SER 209 204 204 SER SER B . n 
B 1 210 ASP 210 205 205 ASP ASP B . n 
B 1 211 HIS 211 206 206 HIS HIS B . n 
B 1 212 ARG 212 207 207 ARG ARG B . n 
B 1 213 TYR 213 208 208 TYR TYR B . n 
B 1 214 ASP 214 209 209 ASP ASP B . n 
B 1 215 LYS 215 210 210 LYS LYS B . n 
B 1 216 LEU 216 211 211 LEU LEU B . n 
B 1 217 THR 217 212 212 THR THR B . n 
B 1 218 VAL 218 213 213 VAL VAL B . n 
B 1 219 PRO 219 214 214 PRO PRO B . n 
B 1 220 ASP 220 215 215 ASP ASP B . n 
B 1 221 ASP 221 216 216 ASP ASP B . n 
B 1 222 ILE 222 217 217 ILE ILE B . n 
B 1 223 ALA 223 218 218 ALA ALA B . n 
B 1 224 ALA 224 219 219 ALA ALA B . n 
B 1 225 ASN 225 220 220 ASN ASN B . n 
B 1 226 CYS 226 221 221 CYS CYS B . n 
B 1 227 ILE 227 222 222 ILE ILE B . n 
B 1 228 TYR 228 223 223 TYR TYR B . n 
B 1 229 LEU 229 224 224 LEU LEU B . n 
B 1 230 ASN 230 225 225 ASN ASN B . n 
B 1 231 ILE 231 226 226 ILE ILE B . n 
B 1 232 PRO 232 227 227 PRO PRO B . n 
B 1 233 ASN 233 228 228 ASN ASN B . n 
B 1 234 LYS 234 229 229 LYS LYS B . n 
B 1 235 GLY 235 230 230 GLY GLY B . n 
B 1 236 HIS 236 231 231 HIS HIS B . n 
B 1 237 VAL 237 232 232 VAL VAL B . n 
B 1 238 LEU 238 233 233 LEU LEU B . n 
B 1 239 LEU 239 234 234 LEU LEU B . n 
B 1 240 HIS 240 235 235 HIS HIS B . n 
B 1 241 ARG 241 236 236 ARG ARG B . n 
B 1 242 THR 242 237 237 THR THR B . n 
B 1 243 PRO 243 238 238 PRO PRO B . n 
B 1 244 GLU 244 239 239 GLU GLU B . n 
B 1 245 GLU 245 240 240 GLU GLU B . n 
B 1 246 TYR 246 241 241 TYR TYR B . n 
B 1 247 PRO 247 242 242 PRO PRO B . n 
B 1 248 GLU 248 243 243 GLU GLU B . n 
B 1 249 SER 249 244 244 SER SER B . n 
B 1 250 ALA 250 245 245 ALA ALA B . n 
B 1 251 LYS 251 246 246 LYS LYS B . n 
B 1 252 VAL 252 247 247 VAL VAL B . n 
B 1 253 TYR 253 248 248 TYR TYR B . n 
B 1 254 GLU 254 249 249 GLU GLU B . n 
B 1 255 LYS 255 250 250 LYS LYS B . n 
B 1 256 LEU 256 251 251 LEU LEU B . n 
B 1 257 LYS 257 252 252 LYS LYS B . n 
B 1 258 ASP 258 253 253 ASP ASP B . n 
B 1 259 HIS 259 254 254 HIS HIS B . n 
B 1 260 MET 260 255 255 MET MET B . n 
B 1 261 LEU 261 256 256 LEU LEU B . n 
B 1 262 ILE 262 257 257 ILE ILE B . n 
B 1 263 PRO 263 258 258 PRO PRO B . n 
B 1 264 VAL 264 259 259 VAL VAL B . n 
B 1 265 SER 265 260 260 SER SER B . n 
B 1 266 MET 266 261 261 MET MET B . n 
B 1 267 SER 267 262 262 SER SER B . n 
B 1 268 GLU 268 263 263 GLU GLU B . n 
B 1 269 LEU 269 264 264 LEU LEU B . n 
B 1 270 GLU 270 265 265 GLU GLU B . n 
B 1 271 LYS 271 266 266 LYS LYS B . n 
B 1 272 VAL 272 267 267 VAL VAL B . n 
B 1 273 ASP 273 268 268 ASP ASP B . n 
B 1 274 GLY 274 269 269 GLY GLY B . n 
B 1 275 LEU 275 270 270 LEU LEU B . n 
B 1 276 LEU 276 271 271 LEU LEU B . n 
B 1 277 THR 277 272 272 THR THR B . n 
B 1 278 CYS 278 273 273 CYS CYS B . n 
B 1 279 CYS 279 274 274 CYS CYS B . n 
B 1 280 SER 280 275 275 SER SER B . n 
B 1 281 VAL 281 276 276 VAL VAL B . n 
B 1 282 LEU 282 277 277 LEU LEU B . n 
B 1 283 ILE 283 278 278 ILE ILE B . n 
B 1 284 ASN 284 279 279 ASN ASN B . n 
B 1 285 LYS 285 280 280 LYS LYS B . n 
B 1 286 LYS 286 281 281 LYS LYS B . n 
B 1 287 VAL 287 282 ?   ?   ?   B . n 
B 1 288 ASP 288 283 ?   ?   ?   B . n 
B 1 289 SER 289 284 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 D20 1   500  500  D20 D20 A . 
D 2 D20 1   500  500  D20 D20 B . 
E 3 HOH 1   2001 2001 HOH HOH A . 
E 3 HOH 2   2002 2002 HOH HOH A . 
E 3 HOH 3   2003 2003 HOH HOH A . 
E 3 HOH 4   2004 2004 HOH HOH A . 
E 3 HOH 5   2005 2005 HOH HOH A . 
E 3 HOH 6   2006 2006 HOH HOH A . 
E 3 HOH 7   2007 2007 HOH HOH A . 
E 3 HOH 8   2008 2008 HOH HOH A . 
E 3 HOH 9   2009 2009 HOH HOH A . 
E 3 HOH 10  2010 2010 HOH HOH A . 
E 3 HOH 11  2011 2011 HOH HOH A . 
E 3 HOH 12  2012 2012 HOH HOH A . 
E 3 HOH 13  2013 2013 HOH HOH A . 
E 3 HOH 14  2014 2014 HOH HOH A . 
E 3 HOH 15  2015 2015 HOH HOH A . 
E 3 HOH 16  2016 2016 HOH HOH A . 
E 3 HOH 17  2017 2017 HOH HOH A . 
E 3 HOH 18  2018 2018 HOH HOH A . 
E 3 HOH 19  2019 2019 HOH HOH A . 
E 3 HOH 20  2020 2020 HOH HOH A . 
E 3 HOH 21  2021 2021 HOH HOH A . 
E 3 HOH 22  2022 2022 HOH HOH A . 
E 3 HOH 23  2023 2023 HOH HOH A . 
E 3 HOH 24  2024 2024 HOH HOH A . 
E 3 HOH 25  2025 2025 HOH HOH A . 
E 3 HOH 26  2026 2026 HOH HOH A . 
E 3 HOH 27  2027 2027 HOH HOH A . 
E 3 HOH 28  2028 2028 HOH HOH A . 
E 3 HOH 29  2029 2029 HOH HOH A . 
E 3 HOH 30  2030 2030 HOH HOH A . 
E 3 HOH 31  2031 2031 HOH HOH A . 
E 3 HOH 32  2032 2032 HOH HOH A . 
E 3 HOH 33  2033 2033 HOH HOH A . 
E 3 HOH 34  2034 2034 HOH HOH A . 
E 3 HOH 35  2035 2035 HOH HOH A . 
E 3 HOH 36  2036 2036 HOH HOH A . 
E 3 HOH 37  2037 2037 HOH HOH A . 
E 3 HOH 38  2038 2038 HOH HOH A . 
E 3 HOH 39  2039 2039 HOH HOH A . 
E 3 HOH 40  2040 2040 HOH HOH A . 
E 3 HOH 41  2041 2041 HOH HOH A . 
E 3 HOH 42  2042 2042 HOH HOH A . 
E 3 HOH 43  2043 2043 HOH HOH A . 
E 3 HOH 44  2044 2044 HOH HOH A . 
E 3 HOH 45  2045 2045 HOH HOH A . 
E 3 HOH 46  2046 2046 HOH HOH A . 
E 3 HOH 47  2047 2047 HOH HOH A . 
E 3 HOH 48  2048 2048 HOH HOH A . 
E 3 HOH 49  2049 2049 HOH HOH A . 
E 3 HOH 50  2050 2050 HOH HOH A . 
E 3 HOH 51  2051 2051 HOH HOH A . 
E 3 HOH 52  2052 2052 HOH HOH A . 
E 3 HOH 53  2053 2053 HOH HOH A . 
E 3 HOH 54  2054 2054 HOH HOH A . 
E 3 HOH 55  2055 2055 HOH HOH A . 
E 3 HOH 56  2056 2056 HOH HOH A . 
E 3 HOH 57  2057 2057 HOH HOH A . 
E 3 HOH 58  2058 2058 HOH HOH A . 
E 3 HOH 59  2059 2059 HOH HOH A . 
E 3 HOH 60  2060 2060 HOH HOH A . 
E 3 HOH 61  2061 2061 HOH HOH A . 
E 3 HOH 62  2062 2062 HOH HOH A . 
E 3 HOH 63  2063 2063 HOH HOH A . 
E 3 HOH 64  2064 2064 HOH HOH A . 
E 3 HOH 65  2065 2065 HOH HOH A . 
E 3 HOH 66  2066 2066 HOH HOH A . 
E 3 HOH 67  2067 2067 HOH HOH A . 
E 3 HOH 68  2068 2068 HOH HOH A . 
E 3 HOH 69  2069 2069 HOH HOH A . 
E 3 HOH 70  2070 2070 HOH HOH A . 
E 3 HOH 71  2071 2071 HOH HOH A . 
E 3 HOH 72  2072 2072 HOH HOH A . 
E 3 HOH 73  2073 2073 HOH HOH A . 
E 3 HOH 74  2074 2074 HOH HOH A . 
E 3 HOH 75  2075 2075 HOH HOH A . 
E 3 HOH 76  2076 2076 HOH HOH A . 
E 3 HOH 77  2077 2077 HOH HOH A . 
E 3 HOH 78  2078 2078 HOH HOH A . 
E 3 HOH 79  2079 2079 HOH HOH A . 
E 3 HOH 80  2080 2080 HOH HOH A . 
E 3 HOH 81  2081 2081 HOH HOH A . 
E 3 HOH 82  2082 2082 HOH HOH A . 
E 3 HOH 83  2083 2083 HOH HOH A . 
E 3 HOH 84  2084 2084 HOH HOH A . 
E 3 HOH 85  2085 2085 HOH HOH A . 
E 3 HOH 86  2086 2086 HOH HOH A . 
E 3 HOH 87  2087 2087 HOH HOH A . 
E 3 HOH 88  2088 2088 HOH HOH A . 
E 3 HOH 89  2089 2089 HOH HOH A . 
E 3 HOH 90  2090 2090 HOH HOH A . 
E 3 HOH 91  2091 2091 HOH HOH A . 
E 3 HOH 92  2092 2092 HOH HOH A . 
E 3 HOH 93  2093 2093 HOH HOH A . 
E 3 HOH 94  2094 2094 HOH HOH A . 
E 3 HOH 95  2095 2095 HOH HOH A . 
E 3 HOH 96  2096 2096 HOH HOH A . 
E 3 HOH 97  2097 2097 HOH HOH A . 
E 3 HOH 98  2098 2098 HOH HOH A . 
E 3 HOH 99  2099 2099 HOH HOH A . 
E 3 HOH 100 2100 2100 HOH HOH A . 
E 3 HOH 101 2101 2101 HOH HOH A . 
E 3 HOH 102 2102 2102 HOH HOH A . 
E 3 HOH 103 2103 2103 HOH HOH A . 
E 3 HOH 104 2104 2104 HOH HOH A . 
E 3 HOH 105 2105 2105 HOH HOH A . 
E 3 HOH 106 2106 2106 HOH HOH A . 
E 3 HOH 107 2107 2107 HOH HOH A . 
E 3 HOH 108 2108 2108 HOH HOH A . 
E 3 HOH 109 2109 2109 HOH HOH A . 
E 3 HOH 110 2110 2110 HOH HOH A . 
E 3 HOH 111 2111 2111 HOH HOH A . 
E 3 HOH 112 2112 2112 HOH HOH A . 
E 3 HOH 113 2113 2113 HOH HOH A . 
E 3 HOH 114 2114 2114 HOH HOH A . 
E 3 HOH 115 2115 2115 HOH HOH A . 
E 3 HOH 116 2116 2116 HOH HOH A . 
E 3 HOH 117 2117 2117 HOH HOH A . 
E 3 HOH 118 2118 2118 HOH HOH A . 
E 3 HOH 119 2119 2119 HOH HOH A . 
E 3 HOH 120 2120 2120 HOH HOH A . 
E 3 HOH 121 2121 2121 HOH HOH A . 
E 3 HOH 122 2122 2122 HOH HOH A . 
E 3 HOH 123 2123 2123 HOH HOH A . 
E 3 HOH 124 2124 2124 HOH HOH A . 
E 3 HOH 125 2125 2125 HOH HOH A . 
E 3 HOH 126 2126 2126 HOH HOH A . 
E 3 HOH 127 2127 2127 HOH HOH A . 
E 3 HOH 128 2128 2128 HOH HOH A . 
E 3 HOH 129 2129 2129 HOH HOH A . 
E 3 HOH 130 2130 2130 HOH HOH A . 
E 3 HOH 131 2131 2131 HOH HOH A . 
E 3 HOH 132 2132 2132 HOH HOH A . 
E 3 HOH 133 2133 2133 HOH HOH A . 
E 3 HOH 134 2134 2134 HOH HOH A . 
E 3 HOH 135 2135 2135 HOH HOH A . 
E 3 HOH 136 2136 2136 HOH HOH A . 
E 3 HOH 137 2137 2137 HOH HOH A . 
E 3 HOH 138 2138 2138 HOH HOH A . 
E 3 HOH 139 2139 2139 HOH HOH A . 
E 3 HOH 140 2140 2140 HOH HOH A . 
E 3 HOH 141 2141 2141 HOH HOH A . 
E 3 HOH 142 2142 2142 HOH HOH A . 
E 3 HOH 143 2143 2143 HOH HOH A . 
E 3 HOH 144 2144 2144 HOH HOH A . 
E 3 HOH 145 2145 2145 HOH HOH A . 
E 3 HOH 146 2146 2146 HOH HOH A . 
E 3 HOH 147 2147 2147 HOH HOH A . 
E 3 HOH 148 2148 2148 HOH HOH A . 
E 3 HOH 149 2149 2149 HOH HOH A . 
E 3 HOH 150 2150 2150 HOH HOH A . 
E 3 HOH 151 2151 2151 HOH HOH A . 
E 3 HOH 152 2152 2152 HOH HOH A . 
E 3 HOH 153 2153 2153 HOH HOH A . 
E 3 HOH 154 2154 2154 HOH HOH A . 
E 3 HOH 155 2155 2155 HOH HOH A . 
E 3 HOH 156 2156 2156 HOH HOH A . 
E 3 HOH 157 2157 2157 HOH HOH A . 
E 3 HOH 158 2158 2158 HOH HOH A . 
E 3 HOH 159 2159 2159 HOH HOH A . 
E 3 HOH 160 2160 2160 HOH HOH A . 
E 3 HOH 161 2161 2161 HOH HOH A . 
E 3 HOH 162 2162 2162 HOH HOH A . 
E 3 HOH 163 2163 2163 HOH HOH A . 
E 3 HOH 164 2164 2164 HOH HOH A . 
E 3 HOH 165 2165 2165 HOH HOH A . 
E 3 HOH 166 2166 2166 HOH HOH A . 
E 3 HOH 167 2167 2167 HOH HOH A . 
E 3 HOH 168 2168 2168 HOH HOH A . 
E 3 HOH 169 2169 2169 HOH HOH A . 
E 3 HOH 170 2170 2170 HOH HOH A . 
E 3 HOH 171 2171 2171 HOH HOH A . 
E 3 HOH 172 2172 2172 HOH HOH A . 
E 3 HOH 173 2173 2173 HOH HOH A . 
E 3 HOH 174 2174 2174 HOH HOH A . 
E 3 HOH 175 2175 2175 HOH HOH A . 
E 3 HOH 176 2176 2176 HOH HOH A . 
E 3 HOH 177 2177 2177 HOH HOH A . 
E 3 HOH 178 2178 2178 HOH HOH A . 
E 3 HOH 179 2179 2179 HOH HOH A . 
E 3 HOH 180 2180 2180 HOH HOH A . 
E 3 HOH 181 2181 2181 HOH HOH A . 
E 3 HOH 182 2182 2182 HOH HOH A . 
E 3 HOH 183 2183 2183 HOH HOH A . 
E 3 HOH 184 2184 2184 HOH HOH A . 
E 3 HOH 185 2185 2185 HOH HOH A . 
E 3 HOH 186 2186 2186 HOH HOH A . 
E 3 HOH 187 2187 2187 HOH HOH A . 
E 3 HOH 188 2188 2188 HOH HOH A . 
E 3 HOH 189 2189 2189 HOH HOH A . 
E 3 HOH 190 2190 2190 HOH HOH A . 
E 3 HOH 191 2191 2191 HOH HOH A . 
E 3 HOH 192 2192 2192 HOH HOH A . 
E 3 HOH 193 2193 2193 HOH HOH A . 
E 3 HOH 194 2194 2194 HOH HOH A . 
E 3 HOH 195 2195 2195 HOH HOH A . 
E 3 HOH 196 2196 2196 HOH HOH A . 
E 3 HOH 197 2197 2197 HOH HOH A . 
E 3 HOH 198 2198 2198 HOH HOH A . 
E 3 HOH 199 2199 2199 HOH HOH A . 
E 3 HOH 200 2200 2200 HOH HOH A . 
E 3 HOH 201 2201 2201 HOH HOH A . 
E 3 HOH 202 2202 2202 HOH HOH A . 
E 3 HOH 203 2203 2203 HOH HOH A . 
E 3 HOH 204 2204 2204 HOH HOH A . 
E 3 HOH 205 2205 2205 HOH HOH A . 
E 3 HOH 206 2206 2206 HOH HOH A . 
E 3 HOH 207 2207 2207 HOH HOH A . 
E 3 HOH 208 2208 2208 HOH HOH A . 
E 3 HOH 209 2209 2209 HOH HOH A . 
E 3 HOH 210 2210 2210 HOH HOH A . 
E 3 HOH 211 2211 2211 HOH HOH A . 
E 3 HOH 212 2212 2212 HOH HOH A . 
E 3 HOH 213 2213 2213 HOH HOH A . 
E 3 HOH 214 2214 2214 HOH HOH A . 
E 3 HOH 215 2215 2215 HOH HOH A . 
E 3 HOH 216 2216 2216 HOH HOH A . 
E 3 HOH 217 2217 2217 HOH HOH A . 
E 3 HOH 218 2218 2218 HOH HOH A . 
E 3 HOH 219 2219 2219 HOH HOH A . 
E 3 HOH 220 2220 2220 HOH HOH A . 
E 3 HOH 221 2221 2221 HOH HOH A . 
E 3 HOH 222 2222 2222 HOH HOH A . 
E 3 HOH 223 2223 2223 HOH HOH A . 
E 3 HOH 224 2224 2224 HOH HOH A . 
E 3 HOH 225 2225 2225 HOH HOH A . 
E 3 HOH 226 2226 2226 HOH HOH A . 
E 3 HOH 227 2227 2227 HOH HOH A . 
E 3 HOH 228 2228 2228 HOH HOH A . 
E 3 HOH 229 2229 2229 HOH HOH A . 
E 3 HOH 230 2230 2230 HOH HOH A . 
E 3 HOH 231 2231 2231 HOH HOH A . 
E 3 HOH 232 2232 2232 HOH HOH A . 
E 3 HOH 233 2233 2233 HOH HOH A . 
F 3 HOH 1   2001 2001 HOH HOH B . 
F 3 HOH 2   2002 2002 HOH HOH B . 
F 3 HOH 3   2003 2003 HOH HOH B . 
F 3 HOH 4   2004 2004 HOH HOH B . 
F 3 HOH 5   2005 2005 HOH HOH B . 
F 3 HOH 6   2006 2006 HOH HOH B . 
F 3 HOH 7   2007 2007 HOH HOH B . 
F 3 HOH 8   2008 2008 HOH HOH B . 
F 3 HOH 9   2009 2009 HOH HOH B . 
F 3 HOH 10  2010 2010 HOH HOH B . 
F 3 HOH 11  2011 2011 HOH HOH B . 
F 3 HOH 12  2012 2012 HOH HOH B . 
F 3 HOH 13  2013 2013 HOH HOH B . 
F 3 HOH 14  2014 2014 HOH HOH B . 
F 3 HOH 15  2015 2015 HOH HOH B . 
F 3 HOH 16  2016 2016 HOH HOH B . 
F 3 HOH 17  2017 2017 HOH HOH B . 
F 3 HOH 18  2018 2018 HOH HOH B . 
F 3 HOH 19  2019 2019 HOH HOH B . 
F 3 HOH 20  2020 2020 HOH HOH B . 
F 3 HOH 21  2021 2021 HOH HOH B . 
F 3 HOH 22  2022 2022 HOH HOH B . 
F 3 HOH 23  2023 2023 HOH HOH B . 
F 3 HOH 24  2024 2024 HOH HOH B . 
F 3 HOH 25  2025 2025 HOH HOH B . 
F 3 HOH 26  2026 2026 HOH HOH B . 
F 3 HOH 27  2027 2027 HOH HOH B . 
F 3 HOH 28  2028 2028 HOH HOH B . 
F 3 HOH 29  2029 2029 HOH HOH B . 
F 3 HOH 30  2030 2030 HOH HOH B . 
F 3 HOH 31  2031 2031 HOH HOH B . 
F 3 HOH 32  2032 2032 HOH HOH B . 
F 3 HOH 33  2033 2033 HOH HOH B . 
F 3 HOH 34  2034 2034 HOH HOH B . 
F 3 HOH 35  2035 2035 HOH HOH B . 
F 3 HOH 36  2036 2036 HOH HOH B . 
F 3 HOH 37  2037 2037 HOH HOH B . 
F 3 HOH 38  2038 2038 HOH HOH B . 
F 3 HOH 39  2039 2039 HOH HOH B . 
F 3 HOH 40  2040 2040 HOH HOH B . 
F 3 HOH 41  2041 2041 HOH HOH B . 
F 3 HOH 42  2042 2042 HOH HOH B . 
F 3 HOH 43  2043 2043 HOH HOH B . 
F 3 HOH 44  2044 2044 HOH HOH B . 
F 3 HOH 45  2045 2045 HOH HOH B . 
F 3 HOH 46  2046 2046 HOH HOH B . 
F 3 HOH 47  2047 2047 HOH HOH B . 
F 3 HOH 48  2048 2048 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-13 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2013-12-04 
4 'Structure model' 1 3 2018-02-28 
5 'Structure model' 1 4 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' Advisory                    
2  2 'Structure model' 'Refinement description'    
3  2 'Structure model' 'Version format compliance' 
4  3 'Structure model' 'Derived calculations'      
5  3 'Structure model' 'Non-polymer description'   
6  3 'Structure model' Other                       
7  3 'Structure model' 'Source and taxonomy'       
8  4 'Structure model' 'Database references'       
9  5 'Structure model' 'Data collection'           
10 5 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation           
2 4 'Structure model' citation_author    
3 5 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_abbrev'       
2 4 'Structure model' '_citation.page_last'            
3 4 'Structure model' '_citation.pdbx_database_id_DOI' 
4 4 'Structure model' '_citation.title'                
5 4 'Structure model' '_citation_author.name'          
6 5 'Structure model' '_exptl_crystal_grow.method'     
7 5 'Structure model' '_exptl_crystal_grow.temp'       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 17.1262 -0.4488 55.8326 -0.1861 -0.1134 -0.0802 0.0146  0.0308 -0.0011 0.9209 1.0515 1.2982 0.1983 
0.1023 -0.0530 0.0132 0.0483 -0.0027 -0.0443 0.0102  -0.0260 0.0081  0.0104 -0.0234 
'X-RAY DIFFRACTION' 2 ? refined 7.7714  25.0655 15.8400 0.0008  0.0491  0.0341  -0.0302 0.0038 0.0254  0.3221 0.8122 0.8035 
-0.1685 0.1563 -0.0943 0.0198 0.0019 0.0204  -0.0265 -0.0320 -0.0581 -0.0077 0.0652 0.0122  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 8 ? ? A 281 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 8 ? ? B 281 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.2.0019 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
MOLREP phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             2JAJ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'N-TERMINAL VECTOR-DERIVED SEQUENCE GPLGM IN CHAIN B' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 2080 ? ? O A HOH 2082 ? ? 2.17 
2 1 O A HOH 2108 ? ? O A HOH 2224 ? ? 2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              203 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SD 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_2              203 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_3              203 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.02 
_pdbx_validate_rmsd_angle.angle_target_value         100.20 
_pdbx_validate_rmsd_angle.angle_deviation            9.82 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 35  ? ? 10.70   101.37  
2  1 GLU A 84  ? ? 64.10   -121.40 
3  1 PHE A 157 ? ? -102.61 68.54   
4  1 PHE A 176 ? ? -142.30 15.32   
5  1 ASN A 183 ? ? 52.56   16.38   
6  1 MET A 261 ? ? -152.18 25.96   
7  1 LEU A 270 ? ? -107.44 -168.63 
8  1 PRO B 6   ? ? -49.34  -9.85   
9  1 GLU B 84  ? ? 45.61   -114.68 
10 1 ASP B 120 ? ? -59.88  105.71  
11 1 GLU B 121 ? ? -46.28  -3.29   
12 1 GLU B 136 ? ? 170.35  161.26  
13 1 PHE B 157 ? ? -111.65 51.18   
14 1 SER B 178 ? ? -170.14 -157.54 
15 1 SER B 190 ? ? -44.60  153.84  
16 1 ALA B 193 ? ? -76.39  -81.98  
17 1 ASN B 228 ? ? 72.88   -3.79   
18 1 MET B 261 ? ? -144.85 21.49   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ALA 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    168 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    169 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            142.07 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 11  ? NE  ? A ARG 16  NE  
2   1 Y 1 A ARG 11  ? CZ  ? A ARG 16  CZ  
3   1 Y 1 A ARG 11  ? NH1 ? A ARG 16  NH1 
4   1 Y 1 A ARG 11  ? NH2 ? A ARG 16  NH2 
5   1 Y 1 A GLU 35  ? CD  ? A GLU 40  CD  
6   1 Y 1 A GLU 35  ? OE1 ? A GLU 40  OE1 
7   1 Y 1 A GLU 35  ? OE2 ? A GLU 40  OE2 
8   1 Y 1 A GLU 43  ? CG  ? A GLU 48  CG  
9   1 Y 1 A GLU 43  ? CD  ? A GLU 48  CD  
10  1 Y 1 A GLU 43  ? OE1 ? A GLU 48  OE1 
11  1 Y 1 A GLU 43  ? OE2 ? A GLU 48  OE2 
12  1 Y 1 A GLU 106 ? CD  ? A GLU 111 CD  
13  1 Y 1 A GLU 106 ? OE1 ? A GLU 111 OE1 
14  1 Y 1 A GLU 106 ? OE2 ? A GLU 111 OE2 
15  1 Y 1 A LYS 119 ? CD  ? A LYS 124 CD  
16  1 Y 1 A LYS 119 ? CE  ? A LYS 124 CE  
17  1 Y 1 A LYS 119 ? NZ  ? A LYS 124 NZ  
18  1 Y 1 A ARG 135 ? CD  ? A ARG 140 CD  
19  1 Y 1 A ARG 135 ? NE  ? A ARG 140 NE  
20  1 Y 1 A ARG 135 ? CZ  ? A ARG 140 CZ  
21  1 Y 1 A ARG 135 ? NH1 ? A ARG 140 NH1 
22  1 Y 1 A ARG 135 ? NH2 ? A ARG 140 NH2 
23  1 Y 1 A LYS 143 ? CG  ? A LYS 148 CG  
24  1 Y 1 A LYS 143 ? CD  ? A LYS 148 CD  
25  1 Y 1 A LYS 143 ? CE  ? A LYS 148 CE  
26  1 Y 1 A LYS 143 ? NZ  ? A LYS 148 NZ  
27  1 Y 1 A LYS 158 ? CD  ? A LYS 163 CD  
28  1 Y 1 A LYS 158 ? CE  ? A LYS 163 CE  
29  1 Y 1 A LYS 158 ? NZ  ? A LYS 163 NZ  
30  1 Y 1 A ARG 207 ? CG  ? A ARG 212 CG  
31  1 Y 1 A ARG 207 ? CD  ? A ARG 212 CD  
32  1 Y 1 A ARG 207 ? NE  ? A ARG 212 NE  
33  1 Y 1 A ARG 207 ? CZ  ? A ARG 212 CZ  
34  1 Y 1 A ARG 207 ? NH1 ? A ARG 212 NH1 
35  1 Y 1 A ARG 207 ? NH2 ? A ARG 212 NH2 
36  1 Y 1 A LYS 250 ? CG  ? A LYS 255 CG  
37  1 Y 1 A LYS 250 ? CD  ? A LYS 255 CD  
38  1 Y 1 A LYS 250 ? CE  ? A LYS 255 CE  
39  1 Y 1 A LYS 250 ? NZ  ? A LYS 255 NZ  
40  1 Y 1 A LYS 252 ? CD  ? A LYS 257 CD  
41  1 Y 1 A LYS 252 ? CE  ? A LYS 257 CE  
42  1 Y 1 A LYS 252 ? NZ  ? A LYS 257 NZ  
43  1 Y 1 A MET 255 ? CE  ? A MET 260 CE  
44  1 Y 1 A LYS 281 ? CG  ? A LYS 286 CG  
45  1 Y 1 A LYS 281 ? CD  ? A LYS 286 CD  
46  1 Y 1 A LYS 281 ? CE  ? A LYS 286 CE  
47  1 Y 1 A LYS 281 ? NZ  ? A LYS 286 NZ  
48  1 Y 1 B MET 0   ? CG  ? B MET 5   CG  
49  1 Y 1 B MET 0   ? SD  ? B MET 5   SD  
50  1 Y 1 B MET 0   ? CE  ? B MET 5   CE  
51  1 Y 1 B GLU 22  ? CG  ? B GLU 27  CG  
52  1 Y 1 B GLU 22  ? CD  ? B GLU 27  CD  
53  1 Y 1 B GLU 22  ? OE1 ? B GLU 27  OE1 
54  1 Y 1 B GLU 22  ? OE2 ? B GLU 27  OE2 
55  1 Y 1 B LYS 33  ? CG  ? B LYS 38  CG  
56  1 Y 1 B LYS 33  ? CD  ? B LYS 38  CD  
57  1 Y 1 B LYS 33  ? CE  ? B LYS 38  CE  
58  1 Y 1 B LYS 33  ? NZ  ? B LYS 38  NZ  
59  1 Y 1 B LYS 56  ? CD  ? B LYS 61  CD  
60  1 Y 1 B LYS 56  ? CE  ? B LYS 61  CE  
61  1 Y 1 B LYS 56  ? NZ  ? B LYS 61  NZ  
62  1 Y 1 B GLU 85  ? CG  ? B GLU 90  CG  
63  1 Y 1 B GLU 85  ? CD  ? B GLU 90  CD  
64  1 Y 1 B GLU 85  ? OE1 ? B GLU 90  OE1 
65  1 Y 1 B GLU 85  ? OE2 ? B GLU 90  OE2 
66  1 Y 1 B LYS 99  ? CG  ? B LYS 104 CG  
67  1 Y 1 B LYS 99  ? CD  ? B LYS 104 CD  
68  1 Y 1 B LYS 99  ? CE  ? B LYS 104 CE  
69  1 Y 1 B LYS 99  ? NZ  ? B LYS 104 NZ  
70  1 Y 1 B MET 103 ? CE  ? B MET 108 CE  
71  1 Y 1 B MET 104 ? CE  ? B MET 109 CE  
72  1 Y 1 B GLU 106 ? CD  ? B GLU 111 CD  
73  1 Y 1 B GLU 106 ? OE1 ? B GLU 111 OE1 
74  1 Y 1 B GLU 106 ? OE2 ? B GLU 111 OE2 
75  1 Y 1 B LYS 110 ? CD  ? B LYS 115 CD  
76  1 Y 1 B LYS 110 ? CE  ? B LYS 115 CE  
77  1 Y 1 B LYS 110 ? NZ  ? B LYS 115 NZ  
78  1 Y 1 B LYS 119 ? CD  ? B LYS 124 CD  
79  1 Y 1 B LYS 119 ? CE  ? B LYS 124 CE  
80  1 Y 1 B LYS 119 ? NZ  ? B LYS 124 NZ  
81  1 Y 1 B GLU 121 ? OE1 ? B GLU 126 OE1 
82  1 Y 1 B GLU 121 ? OE2 ? B GLU 126 OE2 
83  1 Y 1 B ARG 135 ? NE  ? B ARG 140 NE  
84  1 Y 1 B ARG 135 ? CZ  ? B ARG 140 CZ  
85  1 Y 1 B ARG 135 ? NH1 ? B ARG 140 NH1 
86  1 Y 1 B ARG 135 ? NH2 ? B ARG 140 NH2 
87  1 Y 1 B LEU 141 ? CG  ? B LEU 146 CG  
88  1 Y 1 B LEU 141 ? CD1 ? B LEU 146 CD1 
89  1 Y 1 B LEU 141 ? CD2 ? B LEU 146 CD2 
90  1 Y 1 B LYS 143 ? CG  ? B LYS 148 CG  
91  1 Y 1 B LYS 143 ? CD  ? B LYS 148 CD  
92  1 Y 1 B LYS 143 ? CE  ? B LYS 148 CE  
93  1 Y 1 B LYS 143 ? NZ  ? B LYS 148 NZ  
94  1 Y 1 B ARG 144 ? CG  ? B ARG 149 CG  
95  1 Y 1 B ARG 144 ? CD  ? B ARG 149 CD  
96  1 Y 1 B ARG 144 ? NE  ? B ARG 149 NE  
97  1 Y 1 B ARG 144 ? CZ  ? B ARG 149 CZ  
98  1 Y 1 B ARG 144 ? NH1 ? B ARG 149 NH1 
99  1 Y 1 B ARG 144 ? NH2 ? B ARG 149 NH2 
100 1 Y 1 B ARG 148 ? CD  ? B ARG 153 CD  
101 1 Y 1 B ARG 148 ? NE  ? B ARG 153 NE  
102 1 Y 1 B ARG 148 ? CZ  ? B ARG 153 CZ  
103 1 Y 1 B ARG 148 ? NH1 ? B ARG 153 NH1 
104 1 Y 1 B ARG 148 ? NH2 ? B ARG 153 NH2 
105 1 Y 1 B ILE 152 ? CG1 ? B ILE 157 CG1 
106 1 Y 1 B ILE 152 ? CG2 ? B ILE 157 CG2 
107 1 Y 1 B ILE 152 ? CD1 ? B ILE 157 CD1 
108 1 Y 1 B ASP 155 ? CG  ? B ASP 160 CG  
109 1 Y 1 B ASP 155 ? OD1 ? B ASP 160 OD1 
110 1 Y 1 B ASP 155 ? OD2 ? B ASP 160 OD2 
111 1 Y 1 B GLU 191 ? CG  ? B GLU 196 CG  
112 1 Y 1 B GLU 191 ? CD  ? B GLU 196 CD  
113 1 Y 1 B GLU 191 ? OE1 ? B GLU 196 OE1 
114 1 Y 1 B GLU 191 ? OE2 ? B GLU 196 OE2 
115 1 Y 1 B GLN 194 ? O   ? B GLN 199 O   
116 1 Y 1 B GLN 194 ? CD  ? B GLN 199 CD  
117 1 Y 1 B GLN 194 ? OE1 ? B GLN 199 OE1 
118 1 Y 1 B GLN 194 ? NE2 ? B GLN 199 NE2 
119 1 Y 1 B LYS 195 ? CG  ? B LYS 200 CG  
120 1 Y 1 B LYS 195 ? CD  ? B LYS 200 CD  
121 1 Y 1 B LYS 195 ? CE  ? B LYS 200 CE  
122 1 Y 1 B LYS 195 ? NZ  ? B LYS 200 NZ  
123 1 Y 1 B LYS 198 ? CD  ? B LYS 203 CD  
124 1 Y 1 B LYS 198 ? CE  ? B LYS 203 CE  
125 1 Y 1 B LYS 198 ? NZ  ? B LYS 203 NZ  
126 1 Y 1 B ILE 199 ? CG1 ? B ILE 204 CG1 
127 1 Y 1 B ILE 199 ? CG2 ? B ILE 204 CG2 
128 1 Y 1 B ILE 199 ? CD1 ? B ILE 204 CD1 
129 1 Y 1 B GLN 201 ? CG  ? B GLN 206 CG  
130 1 Y 1 B GLN 201 ? CD  ? B GLN 206 CD  
131 1 Y 1 B GLN 201 ? OE1 ? B GLN 206 OE1 
132 1 Y 1 B GLN 201 ? NE2 ? B GLN 206 NE2 
133 1 Y 1 B MET 203 ? CG  ? B MET 208 CG  
134 1 Y 1 B MET 203 ? SD  ? B MET 208 SD  
135 1 Y 1 B MET 203 ? CE  ? B MET 208 CE  
136 1 Y 1 B ASP 205 ? CG  ? B ASP 210 CG  
137 1 Y 1 B ASP 205 ? OD1 ? B ASP 210 OD1 
138 1 Y 1 B ASP 205 ? OD2 ? B ASP 210 OD2 
139 1 Y 1 B ARG 207 ? CG  ? B ARG 212 CG  
140 1 Y 1 B ARG 207 ? CD  ? B ARG 212 CD  
141 1 Y 1 B ARG 207 ? NE  ? B ARG 212 NE  
142 1 Y 1 B ARG 207 ? CZ  ? B ARG 212 CZ  
143 1 Y 1 B ARG 207 ? NH1 ? B ARG 212 NH1 
144 1 Y 1 B ARG 207 ? NH2 ? B ARG 212 NH2 
145 1 Y 1 B LYS 210 ? CG  ? B LYS 215 CG  
146 1 Y 1 B LYS 210 ? CD  ? B LYS 215 CD  
147 1 Y 1 B LYS 210 ? CE  ? B LYS 215 CE  
148 1 Y 1 B LYS 210 ? NZ  ? B LYS 215 NZ  
149 1 Y 1 B LYS 229 ? CG  ? B LYS 234 CG  
150 1 Y 1 B LYS 229 ? CD  ? B LYS 234 CD  
151 1 Y 1 B LYS 229 ? CE  ? B LYS 234 CE  
152 1 Y 1 B LYS 229 ? NZ  ? B LYS 234 NZ  
153 1 Y 1 B GLU 239 ? CD  ? B GLU 244 CD  
154 1 Y 1 B GLU 239 ? OE1 ? B GLU 244 OE1 
155 1 Y 1 B GLU 239 ? OE2 ? B GLU 244 OE2 
156 1 Y 1 B LYS 246 ? CG  ? B LYS 251 CG  
157 1 Y 1 B LYS 246 ? CD  ? B LYS 251 CD  
158 1 Y 1 B LYS 246 ? CE  ? B LYS 251 CE  
159 1 Y 1 B LYS 246 ? NZ  ? B LYS 251 NZ  
160 1 Y 1 B GLU 249 ? CG  ? B GLU 254 CG  
161 1 Y 1 B GLU 249 ? CD  ? B GLU 254 CD  
162 1 Y 1 B GLU 249 ? OE1 ? B GLU 254 OE1 
163 1 Y 1 B GLU 249 ? OE2 ? B GLU 254 OE2 
164 1 Y 1 B LYS 250 ? CG  ? B LYS 255 CG  
165 1 Y 1 B LYS 250 ? CD  ? B LYS 255 CD  
166 1 Y 1 B LYS 250 ? CE  ? B LYS 255 CE  
167 1 Y 1 B LYS 250 ? NZ  ? B LYS 255 NZ  
168 1 Y 1 B LYS 252 ? CG  ? B LYS 257 CG  
169 1 Y 1 B LYS 252 ? CD  ? B LYS 257 CD  
170 1 Y 1 B LYS 252 ? CE  ? B LYS 257 CE  
171 1 Y 1 B LYS 252 ? NZ  ? B LYS 257 NZ  
172 1 Y 1 B MET 255 ? CE  ? B MET 260 CE  
173 1 Y 1 B LYS 266 ? CE  ? B LYS 271 CE  
174 1 Y 1 B LYS 266 ? NZ  ? B LYS 271 NZ  
175 1 Y 1 B LYS 280 ? CG  ? B LYS 285 CG  
176 1 Y 1 B LYS 280 ? CD  ? B LYS 285 CD  
177 1 Y 1 B LYS 280 ? CE  ? B LYS 285 CE  
178 1 Y 1 B LYS 280 ? NZ  ? B LYS 285 NZ  
179 1 Y 1 B LYS 281 ? CG  ? B LYS 286 CG  
180 1 Y 1 B LYS 281 ? CD  ? B LYS 286 CD  
181 1 Y 1 B LYS 281 ? CE  ? B LYS 286 CE  
182 1 Y 1 B LYS 281 ? NZ  ? B LYS 286 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -4  ? A GLY 1   
2  1 Y 1 A PRO -3  ? A PRO 2   
3  1 Y 1 A LEU -2  ? A LEU 3   
4  1 Y 1 A GLY -1  ? A GLY 4   
5  1 Y 1 A MET 0   ? A MET 5   
6  1 Y 1 A ALA 1   ? A ALA 6   
7  1 Y 1 A GLY 2   ? A GLY 7   
8  1 Y 1 A LEU 3   ? A LEU 8   
9  1 Y 1 A GLY 4   ? A GLY 9   
10 1 Y 1 A HIS 5   ? A HIS 10  
11 1 Y 1 A PRO 6   ? A PRO 11  
12 1 Y 1 A ALA 7   ? A ALA 12  
13 1 Y 1 A ALA 32  ? A ALA 37  
14 1 Y 1 A LYS 33  ? A LYS 38  
15 1 Y 1 A VAL 282 ? A VAL 287 
16 1 Y 1 A ASP 283 ? A ASP 288 
17 1 Y 1 A SER 284 ? A SER 289 
18 1 Y 1 B GLY 34  ? B GLY 39  
19 1 Y 1 B GLU 35  ? B GLU 40  
20 1 Y 1 B ALA 168 ? B ALA 173 
21 1 Y 1 B ASP 169 ? B ASP 174 
22 1 Y 1 B GLY 170 ? B GLY 175 
23 1 Y 1 B VAL 282 ? B VAL 287 
24 1 Y 1 B ASP 283 ? B ASP 288 
25 1 Y 1 B SER 284 ? B SER 289 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N~5~-{IMINO[(2-METHOXYETHYL)AMINO]METHYL}-L-ORNITHINE' D20 
3 water                                                   HOH 
#