data_2JAV
# 
_entry.id   2JAV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JAV         
PDBE  EBI-30685    
WWPDB D_1290030685 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2006-12-04 
_pdbx_database_PDB_obs_spr.pdb_id           2JAV 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2CL1 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2CL1 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'HUMAN KINASE WITH PYRROLE-INDOLINONE LIGAND' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JAV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pike, A.C.W.'      1  
'Rellos, P.'        2  
'Das, S.'           3  
'Fedorov, O.'       4  
'Papagrigoriou, E.' 5  
'Debreczeni, J.E.'  6  
'Turnbull, A.P.'    7  
'Gorrec, F.'        8  
'Bray, J.'          9  
'Sundstrom, M.'     10 
'Arrowsmith, C.H.'  11 
'Edwards, A.'       12 
'Weigelt, J.'       13 
'von Delft, F.'     14 
'Knapp, S.'         15 
# 
_citation.id                        primary 
_citation.title                     'Structure and Regulation of the Human Nek2 Centrosomal Kinase' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                6833 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17197699 
_citation.pdbx_database_id_DOI      10.1074/JBC.M609721200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rellos, P.'       1  ? 
primary 'Ivins, F.J.'      2  ? 
primary 'Baxter, J.E.'     3  ? 
primary 'Pike, A.C.W.'     4  ? 
primary 'Nott, T.J.'       5  ? 
primary 'Parkinson, D.-M.' 6  ? 
primary 'Das, S.'          7  ? 
primary 'Howell, S.'       8  ? 
primary 'Fedorov, O.'      9  ? 
primary 'Shen, Q.Y.'       10 ? 
primary 'Fry, A.M.'        11 ? 
primary 'Knapp, S.'        12 ? 
primary 'Smerdon, S.J.'    13 ? 
# 
_cell.entry_id           2JAV 
_cell.length_a           41.634 
_cell.length_b           56.924 
_cell.length_c           66.012 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.98 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JAV 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN KINASE NEK2' 32632.451 1   ? YES 'KINASE DOMAIN, RESIDUES 1-271' ? 
2 non-polymer syn 
'5-[(Z)-(5-CHLORO-2-OXO-1,2-DIHYDRO-3H-INDOL-3-YLIDENE)METHYL]-N-(DIETHYLAMINO)ETHYL]-2,4-DIMETHYL-1H-PYRROLE-3-CARBOXAMIDE' 
329.781   1   ? ?   ?                               ? 
3 water       nat water 18.015    107 ? ?   ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'NIMA-RELATED PROTEIN KINASE 2, NIMA-LIKE PROTEIN KINASE 1, HSPK 21, NEVER IN MITOSIS GENE A-RELATED KINASE 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   ARG n 
1 5   ALA n 
1 6   GLU n 
1 7   ASP n 
1 8   TYR n 
1 9   GLU n 
1 10  VAL n 
1 11  LEU n 
1 12  TYR n 
1 13  THR n 
1 14  ILE n 
1 15  GLY n 
1 16  THR n 
1 17  GLY n 
1 18  SER n 
1 19  TYR n 
1 20  GLY n 
1 21  ARG n 
1 22  CYS n 
1 23  GLN n 
1 24  LYS n 
1 25  ILE n 
1 26  ARG n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ASP n 
1 31  GLY n 
1 32  LYS n 
1 33  ILE n 
1 34  LEU n 
1 35  VAL n 
1 36  TRP n 
1 37  LYS n 
1 38  GLU n 
1 39  LEU n 
1 40  ASP n 
1 41  TYR n 
1 42  GLY n 
1 43  SER n 
1 44  MET n 
1 45  THR n 
1 46  GLU n 
1 47  ALA n 
1 48  GLU n 
1 49  LYS n 
1 50  GLN n 
1 51  MET n 
1 52  LEU n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  VAL n 
1 57  ASN n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  GLU n 
1 62  LEU n 
1 63  LYS n 
1 64  HIS n 
1 65  PRO n 
1 66  ASN n 
1 67  ILE n 
1 68  VAL n 
1 69  ARG n 
1 70  TYR n 
1 71  TYR n 
1 72  ASP n 
1 73  ARG n 
1 74  ILE n 
1 75  ILE n 
1 76  ASP n 
1 77  ARG n 
1 78  THR n 
1 79  ASN n 
1 80  THR n 
1 81  THR n 
1 82  LEU n 
1 83  TYR n 
1 84  ILE n 
1 85  VAL n 
1 86  MET n 
1 87  GLU n 
1 88  TYR n 
1 89  CYS n 
1 90  GLU n 
1 91  GLY n 
1 92  GLY n 
1 93  ASP n 
1 94  LEU n 
1 95  ALA n 
1 96  SER n 
1 97  VAL n 
1 98  ILE n 
1 99  THR n 
1 100 LYS n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 GLU n 
1 105 ARG n 
1 106 GLN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 GLU n 
1 111 GLU n 
1 112 PHE n 
1 113 VAL n 
1 114 LEU n 
1 115 ARG n 
1 116 VAL n 
1 117 MET n 
1 118 THR n 
1 119 GLN n 
1 120 LEU n 
1 121 THR n 
1 122 LEU n 
1 123 ALA n 
1 124 LEU n 
1 125 LYS n 
1 126 GLU n 
1 127 CYS n 
1 128 HIS n 
1 129 ARG n 
1 130 ARG n 
1 131 SER n 
1 132 ASP n 
1 133 GLY n 
1 134 GLY n 
1 135 HIS n 
1 136 THR n 
1 137 VAL n 
1 138 LEU n 
1 139 HIS n 
1 140 ARG n 
1 141 ASP n 
1 142 LEU n 
1 143 LYS n 
1 144 PRO n 
1 145 ALA n 
1 146 ASN n 
1 147 VAL n 
1 148 PHE n 
1 149 LEU n 
1 150 ASP n 
1 151 GLY n 
1 152 LYS n 
1 153 GLN n 
1 154 ASN n 
1 155 VAL n 
1 156 LYS n 
1 157 LEU n 
1 158 GLY n 
1 159 ASP n 
1 160 PHE n 
1 161 GLY n 
1 162 LEU n 
1 163 ALA n 
1 164 ARG n 
1 165 ILE n 
1 166 LEU n 
1 167 ASN n 
1 168 HIS n 
1 169 ASP n 
1 170 THR n 
1 171 SER n 
1 172 PHE n 
1 173 ALA n 
1 174 LYS n 
1 175 ALA n 
1 176 PHE n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 TYR n 
1 182 TYR n 
1 183 MET n 
1 184 SER n 
1 185 PRO n 
1 186 GLU n 
1 187 GLN n 
1 188 MET n 
1 189 ASN n 
1 190 ARG n 
1 191 MET n 
1 192 SER n 
1 193 TYR n 
1 194 ASN n 
1 195 GLU n 
1 196 LYS n 
1 197 SER n 
1 198 ASP n 
1 199 ILE n 
1 200 TRP n 
1 201 SER n 
1 202 LEU n 
1 203 GLY n 
1 204 CYS n 
1 205 LEU n 
1 206 LEU n 
1 207 TYR n 
1 208 GLU n 
1 209 LEU n 
1 210 CYS n 
1 211 ALA n 
1 212 LEU n 
1 213 MET n 
1 214 PRO n 
1 215 PRO n 
1 216 PHE n 
1 217 THR n 
1 218 ALA n 
1 219 PHE n 
1 220 SER n 
1 221 GLN n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 ALA n 
1 226 GLY n 
1 227 LYS n 
1 228 ILE n 
1 229 ARG n 
1 230 GLU n 
1 231 GLY n 
1 232 LYS n 
1 233 PHE n 
1 234 ARG n 
1 235 ARG n 
1 236 ILE n 
1 237 PRO n 
1 238 TYR n 
1 239 ARG n 
1 240 TYR n 
1 241 SER n 
1 242 ASP n 
1 243 GLU n 
1 244 LEU n 
1 245 ASN n 
1 246 GLU n 
1 247 ILE n 
1 248 ILE n 
1 249 THR n 
1 250 ARG n 
1 251 MET n 
1 252 LEU n 
1 253 ASN n 
1 254 LEU n 
1 255 LYS n 
1 256 ASP n 
1 257 TYR n 
1 258 HIS n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 VAL n 
1 263 GLU n 
1 264 GLU n 
1 265 ILE n 
1 266 LEU n 
1 267 GLU n 
1 268 ASN n 
1 269 PRO n 
1 270 LEU n 
1 271 ILE n 
1 272 LEU n 
1 273 GLU n 
1 274 HIS n 
1 275 HIS n 
1 276 HIS n 
1 277 HIS n 
1 278 HIS n 
1 279 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP NEK2_HUMAN 1 ? ? P51955 ? 
2 PDB 2JAV       1 ? ? 2JAV   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JAV A 1   ? 271 ? P51955 1   ? 271 ? 1   271 
2 2 2JAV A 272 ? 279 ? 2JAV   272 ? 279 ? 272 279 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2JAV 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      175 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P51955 
_struct_ref_seq_dif.db_mon_id                    THR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          175 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            175 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5Z5 non-polymer         . 
'5-[(Z)-(5-CHLORO-2-OXO-1,2-DIHYDRO-3H-INDOL-3-YLIDENE)METHYL]-N-(DIETHYLAMINO)ETHYL]-2,4-DIMETHYL-1H-PYRROLE-3-CARBOXAMIDE' ? 
'C17 H16 Cl N3 O2' 329.781 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2JAV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.52 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10% PEG6000, 200 MM MGCL2. SITTING DROPS, 150NL AND 50NL PROTEIN AND RESERVOIR MIX.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-03-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.95 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JAV 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             65.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   15620 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.09000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.8000 
_reflns.B_iso_Wilson_estimate        32.55 
_reflns.pdbx_redundancy              8.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   98.1 
_reflns_shell.Rmerge_I_obs           0.48000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.400 
_reflns_shell.pdbx_redundancy        6.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JAV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     14883 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.217 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.277 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  796 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.928 
_refine.correlation_coeff_Fo_to_Fc_free          0.883 
_refine.B_iso_mean                               33.55 
_refine.aniso_B[1][1]                            0.93000 
_refine.aniso_B[2][2]                            -1.95000 
_refine.aniso_B[3][3]                            0.65000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -1.77000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.DIETHYLAMINO TAIL OF LIGAND IS DISORDERED AND HAS NOT BEEN INCLUDED IN THE FINAL MODEL.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1OL7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.286 
_refine.pdbx_overall_ESU_R_Free                  0.237 
_refine.overall_SU_ML                            0.164 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.818 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2014 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             107 
_refine_hist.number_atoms_total               2144 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.021  ? 2119 'X-RAY DIFFRACTION' ? 
r_bond_other_d               1.225  1.980  ? 2858 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.514  5.000  ? 249  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.673 23.204 ? 103  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.232 15.000 ? 380  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.300 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 304  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1604 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.187  0.200  ? 932  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.295  0.200  ? 1423 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.136  0.200  ? 117  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.168  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.177  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.552  1.500  ? 1297 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.895  2.000  ? 2019 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.238  3.000  ? 970  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.922  4.500  ? 839  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             1019 
_refine_ls_shell.R_factor_R_work                  0.2370 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2630 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2JAV 
_struct.title                     'Human Kinase with pyrrole-indolinone ligand' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE NEK2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JAV 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;TRANSFERASE, PHOSPHORYLATION, NUCLEOTIDE-BINDING, ATP-BINDING, CELL DIVISION, METAL-BINDING, NUCLEAR PROTEIN, SERINE/THREONINE-PROTEIN KINASE, SERINE/THREONINE PROTEIN KINASE, KINASE, MEIOSIS, MITOSIS, MAGNESIUM, CELL CYCLE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 4   ? GLU A 6   ? ARG A 4   GLU A 6   5 ? 3  
HELX_P HELX_P2  2  THR A 45  ? LEU A 59  ? THR A 45  LEU A 59  1 ? 15 
HELX_P HELX_P3  3  LEU A 94  ? ARG A 105 ? LEU A 94  ARG A 105 1 ? 12 
HELX_P HELX_P4  4  ASP A 109 ? SER A 131 ? ASP A 109 SER A 131 1 ? 23 
HELX_P HELX_P5  5  LYS A 143 ? ALA A 145 ? LYS A 143 ALA A 145 5 ? 3  
HELX_P HELX_P6  6  ASP A 159 ? LEU A 166 ? ASP A 159 LEU A 166 1 ? 8  
HELX_P HELX_P7  7  SER A 184 ? ASN A 189 ? SER A 184 ASN A 189 1 ? 6  
HELX_P HELX_P8  8  ASN A 194 ? LEU A 212 ? ASN A 194 LEU A 212 1 ? 19 
HELX_P HELX_P9  9  SER A 220 ? GLY A 231 ? SER A 220 GLY A 231 1 ? 12 
HELX_P HELX_P10 10 SER A 241 ? LEU A 252 ? SER A 241 LEU A 252 1 ? 12 
HELX_P HELX_P11 11 LYS A 255 ? ARG A 259 ? LYS A 255 ARG A 259 5 ? 5  
HELX_P HELX_P12 12 SER A 261 ? GLU A 267 ? SER A 261 GLU A 267 1 ? 7  
HELX_P HELX_P13 13 LEU A 272 ? HIS A 276 ? LEU A 272 HIS A 276 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 8   ? THR A 16  ? TYR A 8   THR A 16  
AA 2 GLY A 20  ? ARG A 27  ? GLY A 20  ARG A 27  
AA 3 ILE A 33  ? LEU A 39  ? ILE A 33  LEU A 39  
AA 4 LEU A 82  ? GLU A 87  ? LEU A 82  GLU A 87  
AA 5 TYR A 70  ? ILE A 75  ? TYR A 70  ILE A 75  
AB 1 GLY A 92  ? ASP A 93  ? GLY A 92  ASP A 93  
AB 2 VAL A 147 ? LEU A 149 ? VAL A 147 LEU A 149 
AB 3 VAL A 155 ? LEU A 157 ? VAL A 155 LEU A 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 14  ? N ILE A 14  O CYS A 22  ? O CYS A 22  
AA 2 3 N ILE A 25  ? N ILE A 25  O LEU A 34  ? O LEU A 34  
AA 3 4 N LEU A 39  ? N LEU A 39  O LEU A 82  ? O LEU A 82  
AA 4 5 O VAL A 85  ? O VAL A 85  N TYR A 71  ? N TYR A 71  
AB 1 2 O GLY A 92  ? O GLY A 92  N LEU A 149 ? N LEU A 149 
AB 2 3 N PHE A 148 ? N PHE A 148 O LYS A 156 ? O LYS A 156 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'BINDING SITE FOR RESIDUE 5Z5 A1280' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ILE A 14  ? ILE A 14  . ? 1_555 ? 
2  AC1 12 VAL A 35  ? VAL A 35  . ? 1_555 ? 
3  AC1 12 LYS A 37  ? LYS A 37  . ? 1_555 ? 
4  AC1 12 VAL A 68  ? VAL A 68  . ? 1_555 ? 
5  AC1 12 MET A 86  ? MET A 86  . ? 1_555 ? 
6  AC1 12 GLU A 87  ? GLU A 87  . ? 1_555 ? 
7  AC1 12 TYR A 88  ? TYR A 88  . ? 1_555 ? 
8  AC1 12 CYS A 89  ? CYS A 89  . ? 1_555 ? 
9  AC1 12 GLU A 90  ? GLU A 90  . ? 1_555 ? 
10 AC1 12 GLY A 92  ? GLY A 92  . ? 1_555 ? 
11 AC1 12 PHE A 148 ? PHE A 148 . ? 1_555 ? 
12 AC1 12 LEU A 162 ? LEU A 162 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JAV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JAV 
_atom_sites.fract_transf_matrix[1][1]   0.024019 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002516 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017567 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015232 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 3   ? -5.101  -6.884  7.698   1.00 38.66 ? 3    SER A N   1 
ATOM   2    C  CA  . SER A 1 3   ? -5.498  -7.570  6.327   1.00 38.57 ? 3    SER A CA  1 
ATOM   3    C  C   . SER A 1 3   ? -6.884  -7.169  5.960   1.00 38.61 ? 3    SER A C   1 
ATOM   4    O  O   . SER A 1 3   ? -7.103  -6.688  4.839   1.00 38.68 ? 3    SER A O   1 
ATOM   5    C  CB  . SER A 1 3   ? -5.497  -9.112  6.504   1.00 38.71 ? 3    SER A CB  1 
ATOM   6    N  N   . ARG A 1 4   ? -7.947  -7.377  6.776   1.00 38.54 ? 4    ARG A N   1 
ATOM   7    C  CA  . ARG A 1 4   ? -9.341  -7.048  6.371   1.00 38.59 ? 4    ARG A CA  1 
ATOM   8    C  C   . ARG A 1 4   ? -10.045 -6.202  7.469   1.00 38.37 ? 4    ARG A C   1 
ATOM   9    O  O   . ARG A 1 4   ? -9.862  -6.440  8.673   1.00 38.23 ? 4    ARG A O   1 
ATOM   10   N  N   . ALA A 1 5   ? -10.863 -5.231  7.046   1.00 38.40 ? 5    ALA A N   1 
ATOM   11   C  CA  . ALA A 1 5   ? -11.501 -4.271  7.984   1.00 38.57 ? 5    ALA A CA  1 
ATOM   12   C  C   . ALA A 1 5   ? -12.601 -4.906  8.852   1.00 38.58 ? 5    ALA A C   1 
ATOM   13   O  O   . ALA A 1 5   ? -13.011 -4.324  9.874   1.00 38.56 ? 5    ALA A O   1 
ATOM   14   C  CB  . ALA A 1 5   ? -12.065 -3.060  7.222   1.00 38.56 ? 5    ALA A CB  1 
ATOM   15   N  N   . GLU A 1 6   ? -13.057 -6.099  8.441   1.00 38.48 ? 6    GLU A N   1 
ATOM   16   C  CA  . GLU A 1 6   ? -14.058 -6.886  9.177   1.00 38.43 ? 6    GLU A CA  1 
ATOM   17   C  C   . GLU A 1 6   ? -13.469 -7.580  10.412  1.00 38.47 ? 6    GLU A C   1 
ATOM   18   O  O   . GLU A 1 6   ? -14.280 -7.995  11.262  1.00 38.51 ? 6    GLU A O   1 
ATOM   19   C  CB  . GLU A 1 6   ? -14.695 -7.938  8.256   1.00 38.45 ? 6    GLU A CB  1 
ATOM   20   C  CG  . GLU A 1 6   ? -15.516 -7.364  7.105   1.00 38.25 ? 6    GLU A CG  1 
ATOM   21   C  CD  . GLU A 1 6   ? -16.043 -8.456  6.185   1.00 38.45 ? 6    GLU A CD  1 
ATOM   22   N  N   . ASP A 1 7   ? -12.108 -7.527  10.538  1.00 38.41 ? 7    ASP A N   1 
ATOM   23   C  CA  . ASP A 1 7   ? -11.411 -8.111  11.688  1.00 38.28 ? 7    ASP A CA  1 
ATOM   24   C  C   . ASP A 1 7   ? -11.337 -7.104  12.832  1.00 38.17 ? 7    ASP A C   1 
ATOM   25   O  O   . ASP A 1 7   ? -10.960 -7.450  13.958  1.00 38.26 ? 7    ASP A O   1 
ATOM   26   C  CB  . ASP A 1 7   ? -9.987  -8.542  11.307  1.00 38.29 ? 7    ASP A CB  1 
ATOM   27   C  CG  . ASP A 1 7   ? -9.925  -9.320  9.992   1.00 38.66 ? 7    ASP A CG  1 
ATOM   28   O  OD1 . ASP A 1 7   ? -10.918 -9.992  9.612   1.00 38.41 ? 7    ASP A OD1 1 
ATOM   29   O  OD2 . ASP A 1 7   ? -8.858  -9.254  9.338   1.00 38.98 ? 7    ASP A OD2 1 
ATOM   30   N  N   . TYR A 1 8   ? -11.685 -5.856  12.531  1.00 37.86 ? 8    TYR A N   1 
ATOM   31   C  CA  . TYR A 1 8   ? -11.595 -4.771  13.494  1.00 37.52 ? 8    TYR A CA  1 
ATOM   32   C  C   . TYR A 1 8   ? -12.953 -4.137  13.755  1.00 37.43 ? 8    TYR A C   1 
ATOM   33   O  O   . TYR A 1 8   ? -13.711 -3.839  12.822  1.00 37.37 ? 8    TYR A O   1 
ATOM   34   C  CB  . TYR A 1 8   ? -10.606 -3.709  13.011  1.00 37.42 ? 8    TYR A CB  1 
ATOM   35   C  CG  . TYR A 1 8   ? -9.211  -4.235  12.769  1.00 37.19 ? 8    TYR A CG  1 
ATOM   36   C  CD1 . TYR A 1 8   ? -8.827  -4.695  11.507  1.00 36.88 ? 8    TYR A CD1 1 
ATOM   37   C  CD2 . TYR A 1 8   ? -8.275  -4.282  13.804  1.00 36.40 ? 8    TYR A CD2 1 
ATOM   38   C  CE1 . TYR A 1 8   ? -7.542  -5.186  11.282  1.00 36.95 ? 8    TYR A CE1 1 
ATOM   39   C  CE2 . TYR A 1 8   ? -6.986  -4.763  13.590  1.00 36.56 ? 8    TYR A CE2 1 
ATOM   40   C  CZ  . TYR A 1 8   ? -6.627  -5.213  12.329  1.00 37.35 ? 8    TYR A CZ  1 
ATOM   41   O  OH  . TYR A 1 8   ? -5.357  -5.692  12.113  1.00 37.75 ? 8    TYR A OH  1 
ATOM   42   N  N   . GLU A 1 9   ? -13.251 -3.949  15.039  1.00 37.26 ? 9    GLU A N   1 
ATOM   43   C  CA  . GLU A 1 9   ? -14.450 -3.252  15.459  1.00 37.13 ? 9    GLU A CA  1 
ATOM   44   C  C   . GLU A 1 9   ? -14.097 -1.785  15.687  1.00 36.75 ? 9    GLU A C   1 
ATOM   45   O  O   . GLU A 1 9   ? -13.235 -1.467  16.507  1.00 36.66 ? 9    GLU A O   1 
ATOM   46   C  CB  . GLU A 1 9   ? -14.995 -3.872  16.744  1.00 37.37 ? 9    GLU A CB  1 
ATOM   47   C  CG  . GLU A 1 9   ? -16.358 -3.345  17.172  1.00 38.82 ? 9    GLU A CG  1 
ATOM   48   C  CD  . GLU A 1 9   ? -16.640 -3.593  18.642  1.00 40.86 ? 9    GLU A CD  1 
ATOM   49   O  OE1 . GLU A 1 9   ? -16.437 -4.738  19.112  1.00 42.02 ? 9    GLU A OE1 1 
ATOM   50   O  OE2 . GLU A 1 9   ? -17.071 -2.640  19.328  1.00 41.51 ? 9    GLU A OE2 1 
ATOM   51   N  N   . VAL A 1 10  ? -14.754 -0.898  14.945  1.00 36.12 ? 10   VAL A N   1 
ATOM   52   C  CA  . VAL A 1 10  ? -14.559 0.529   15.124  1.00 35.43 ? 10   VAL A CA  1 
ATOM   53   C  C   . VAL A 1 10  ? -15.257 0.962   16.405  1.00 35.21 ? 10   VAL A C   1 
ATOM   54   O  O   . VAL A 1 10  ? -16.455 0.733   16.585  1.00 35.02 ? 10   VAL A O   1 
ATOM   55   C  CB  . VAL A 1 10  ? -15.067 1.349   13.927  1.00 35.34 ? 10   VAL A CB  1 
ATOM   56   C  CG1 . VAL A 1 10  ? -14.659 2.806   14.075  1.00 34.96 ? 10   VAL A CG1 1 
ATOM   57   C  CG2 . VAL A 1 10  ? -14.519 0.789   12.635  1.00 35.20 ? 10   VAL A CG2 1 
ATOM   58   N  N   . LEU A 1 11  ? -14.484 1.570   17.300  1.00 34.86 ? 11   LEU A N   1 
ATOM   59   C  CA  . LEU A 1 11  ? -14.995 2.007   18.590  1.00 34.54 ? 11   LEU A CA  1 
ATOM   60   C  C   . LEU A 1 11  ? -15.426 3.461   18.521  1.00 34.47 ? 11   LEU A C   1 
ATOM   61   O  O   . LEU A 1 11  ? -16.576 3.776   18.836  1.00 34.31 ? 11   LEU A O   1 
ATOM   62   C  CB  . LEU A 1 11  ? -13.958 1.766   19.694  1.00 34.44 ? 11   LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 11  ? -13.677 0.288   19.996  1.00 33.90 ? 11   LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 11  ? -12.533 0.132   20.990  1.00 32.87 ? 11   LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 11  ? -14.938 -0.417  20.500  1.00 32.93 ? 11   LEU A CD2 1 
ATOM   66   N  N   . TYR A 1 12  ? -14.507 4.334   18.097  1.00 34.30 ? 12   TYR A N   1 
ATOM   67   C  CA  . TYR A 1 12  ? -14.825 5.739   17.836  1.00 34.25 ? 12   TYR A CA  1 
ATOM   68   C  C   . TYR A 1 12  ? -13.779 6.503   17.038  1.00 34.29 ? 12   TYR A C   1 
ATOM   69   O  O   . TYR A 1 12  ? -12.646 6.054   16.872  1.00 34.13 ? 12   TYR A O   1 
ATOM   70   C  CB  . TYR A 1 12  ? -15.110 6.492   19.131  1.00 34.15 ? 12   TYR A CB  1 
ATOM   71   C  CG  . TYR A 1 12  ? -14.042 6.392   20.191  1.00 34.42 ? 12   TYR A CG  1 
ATOM   72   C  CD1 . TYR A 1 12  ? -12.975 7.295   20.219  1.00 34.13 ? 12   TYR A CD1 1 
ATOM   73   C  CD2 . TYR A 1 12  ? -14.110 5.413   21.184  1.00 34.76 ? 12   TYR A CD2 1 
ATOM   74   C  CE1 . TYR A 1 12  ? -11.997 7.222   21.198  1.00 34.56 ? 12   TYR A CE1 1 
ATOM   75   C  CE2 . TYR A 1 12  ? -13.137 5.330   22.174  1.00 35.02 ? 12   TYR A CE2 1 
ATOM   76   C  CZ  . TYR A 1 12  ? -12.084 6.240   22.174  1.00 34.66 ? 12   TYR A CZ  1 
ATOM   77   O  OH  . TYR A 1 12  ? -11.114 6.164   23.148  1.00 35.38 ? 12   TYR A OH  1 
ATOM   78   N  N   . THR A 1 13  ? -14.188 7.672   16.556  1.00 34.47 ? 13   THR A N   1 
ATOM   79   C  CA  . THR A 1 13  ? -13.308 8.596   15.866  1.00 34.59 ? 13   THR A CA  1 
ATOM   80   C  C   . THR A 1 13  ? -12.547 9.430   16.893  1.00 34.82 ? 13   THR A C   1 
ATOM   81   O  O   . THR A 1 13  ? -13.152 10.063  17.757  1.00 35.28 ? 13   THR A O   1 
ATOM   82   C  CB  . THR A 1 13  ? -14.117 9.528   14.937  1.00 34.55 ? 13   THR A CB  1 
ATOM   83   O  OG1 . THR A 1 13  ? -14.867 8.741   14.002  1.00 34.45 ? 13   THR A OG1 1 
ATOM   84   C  CG2 . THR A 1 13  ? -13.197 10.480  14.181  1.00 33.84 ? 13   THR A CG2 1 
ATOM   85   N  N   . ILE A 1 14  ? -11.222 9.418   16.790  1.00 35.08 ? 14   ILE A N   1 
ATOM   86   C  CA  . ILE A 1 14  ? -10.340 10.198  17.671  1.00 35.51 ? 14   ILE A CA  1 
ATOM   87   C  C   . ILE A 1 14  ? -10.119 11.605  17.116  1.00 35.90 ? 14   ILE A C   1 
ATOM   88   O  O   . ILE A 1 14  ? -10.158 12.587  17.854  1.00 36.19 ? 14   ILE A O   1 
ATOM   89   C  CB  . ILE A 1 14  ? -8.978  9.484   17.853  1.00 35.16 ? 14   ILE A CB  1 
ATOM   90   C  CG1 . ILE A 1 14  ? -9.139  8.251   18.747  1.00 34.94 ? 14   ILE A CG1 1 
ATOM   91   C  CG2 . ILE A 1 14  ? -7.909  10.426  18.414  1.00 35.48 ? 14   ILE A CG2 1 
ATOM   92   C  CD1 . ILE A 1 14  ? -7.935  7.331   18.735  1.00 34.87 ? 14   ILE A CD1 1 
ATOM   93   N  N   . GLY A 1 15  ? -9.873  11.684  15.813  1.00 36.48 ? 15   GLY A N   1 
ATOM   94   C  CA  . GLY A 1 15  ? -9.653  12.953  15.136  1.00 37.07 ? 15   GLY A CA  1 
ATOM   95   C  C   . GLY A 1 15  ? -9.912  12.850  13.650  1.00 37.66 ? 15   GLY A C   1 
ATOM   96   O  O   . GLY A 1 15  ? -10.227 11.778  13.133  1.00 37.76 ? 15   GLY A O   1 
ATOM   97   N  N   . THR A 1 16  ? -9.774  13.979  12.964  1.00 38.47 ? 16   THR A N   1 
ATOM   98   C  CA  . THR A 1 16  ? -9.997  14.062  11.522  1.00 39.25 ? 16   THR A CA  1 
ATOM   99   C  C   . THR A 1 16  ? -9.076  15.125  10.907  1.00 39.48 ? 16   THR A C   1 
ATOM   100  O  O   . THR A 1 16  ? -8.557  15.991  11.613  1.00 39.75 ? 16   THR A O   1 
ATOM   101  C  CB  . THR A 1 16  ? -11.487 14.344  11.195  1.00 39.14 ? 16   THR A CB  1 
ATOM   102  O  OG1 . THR A 1 16  ? -11.710 14.187  9.790   1.00 40.18 ? 16   THR A OG1 1 
ATOM   103  C  CG2 . THR A 1 16  ? -11.891 15.754  11.622  1.00 39.56 ? 16   THR A CG2 1 
ATOM   104  N  N   . GLY A 1 17  ? -8.863  15.048  9.597   1.00 39.75 ? 17   GLY A N   1 
ATOM   105  C  CA  . GLY A 1 17  ? -7.960  15.976  8.922   1.00 39.81 ? 17   GLY A CA  1 
ATOM   106  C  C   . GLY A 1 17  ? -8.079  15.944  7.415   1.00 39.86 ? 17   GLY A C   1 
ATOM   107  O  O   . GLY A 1 17  ? -8.986  15.305  6.866   1.00 39.89 ? 17   GLY A O   1 
ATOM   108  N  N   . SER A 1 18  ? -7.158  16.643  6.750   1.00 39.87 ? 18   SER A N   1 
ATOM   109  C  CA  . SER A 1 18  ? -7.133  16.722  5.286   1.00 39.78 ? 18   SER A CA  1 
ATOM   110  C  C   . SER A 1 18  ? -6.688  15.401  4.655   1.00 39.64 ? 18   SER A C   1 
ATOM   111  O  O   . SER A 1 18  ? -6.911  15.168  3.463   1.00 39.66 ? 18   SER A O   1 
ATOM   112  C  CB  . SER A 1 18  ? -6.233  17.871  4.819   1.00 39.86 ? 18   SER A CB  1 
ATOM   113  N  N   . TYR A 1 19  ? -6.060  14.548  5.463   1.00 39.35 ? 19   TYR A N   1 
ATOM   114  C  CA  . TYR A 1 19  ? -5.678  13.203  5.043   1.00 39.09 ? 19   TYR A CA  1 
ATOM   115  C  C   . TYR A 1 19  ? -6.886  12.266  5.089   1.00 38.86 ? 19   TYR A C   1 
ATOM   116  O  O   . TYR A 1 19  ? -7.115  11.482  4.164   1.00 39.22 ? 19   TYR A O   1 
ATOM   117  C  CB  . TYR A 1 19  ? -4.538  12.665  5.922   1.00 39.00 ? 19   TYR A CB  1 
ATOM   118  C  CG  . TYR A 1 19  ? -4.916  12.433  7.375   1.00 39.00 ? 19   TYR A CG  1 
ATOM   119  C  CD1 . TYR A 1 19  ? -5.337  11.173  7.814   1.00 38.89 ? 19   TYR A CD1 1 
ATOM   120  C  CD2 . TYR A 1 19  ? -4.861  13.472  8.307   1.00 39.02 ? 19   TYR A CD2 1 
ATOM   121  C  CE1 . TYR A 1 19  ? -5.686  10.950  9.143   1.00 39.39 ? 19   TYR A CE1 1 
ATOM   122  C  CE2 . TYR A 1 19  ? -5.210  13.262  9.638   1.00 39.38 ? 19   TYR A CE2 1 
ATOM   123  C  CZ  . TYR A 1 19  ? -5.619  11.997  10.051  1.00 39.28 ? 19   TYR A CZ  1 
ATOM   124  O  OH  . TYR A 1 19  ? -5.966  11.782  11.366  1.00 38.39 ? 19   TYR A OH  1 
ATOM   125  N  N   . GLY A 1 20  ? -7.662  12.380  6.163   1.00 38.42 ? 20   GLY A N   1 
ATOM   126  C  CA  . GLY A 1 20  ? -8.780  11.490  6.437   1.00 37.89 ? 20   GLY A CA  1 
ATOM   127  C  C   . GLY A 1 20  ? -9.131  11.486  7.916   1.00 37.69 ? 20   GLY A C   1 
ATOM   128  O  O   . GLY A 1 20  ? -9.273  12.546  8.528   1.00 37.65 ? 20   GLY A O   1 
ATOM   129  N  N   . ARG A 1 21  ? -9.228  10.290  8.494   1.00 37.33 ? 21   ARG A N   1 
ATOM   130  C  CA  . ARG A 1 21  ? -9.822  10.100  9.818   1.00 36.86 ? 21   ARG A CA  1 
ATOM   131  C  C   . ARG A 1 21  ? -8.968  9.173   10.684  1.00 36.58 ? 21   ARG A C   1 
ATOM   132  O  O   . ARG A 1 21  ? -8.423  8.183   10.188  1.00 36.64 ? 21   ARG A O   1 
ATOM   133  C  CB  . ARG A 1 21  ? -11.236 9.518   9.646   1.00 37.02 ? 21   ARG A CB  1 
ATOM   134  C  CG  . ARG A 1 21  ? -12.143 9.573   10.875  1.00 36.61 ? 21   ARG A CG  1 
ATOM   135  C  CD  . ARG A 1 21  ? -13.638 9.495   10.513  1.00 36.55 ? 21   ARG A CD  1 
ATOM   136  N  NE  . ARG A 1 21  ? -13.973 8.338   9.675   1.00 35.71 ? 21   ARG A NE  1 
ATOM   137  C  CZ  . ARG A 1 21  ? -15.157 7.727   9.653   1.00 34.17 ? 21   ARG A CZ  1 
ATOM   138  N  NH1 . ARG A 1 21  ? -15.344 6.684   8.864   1.00 34.13 ? 21   ARG A NH1 1 
ATOM   139  N  NH2 . ARG A 1 21  ? -16.150 8.140   10.424  1.00 33.92 ? 21   ARG A NH2 1 
ATOM   140  N  N   . CYS A 1 22  ? -8.854  9.504   11.970  1.00 36.02 ? 22   CYS A N   1 
ATOM   141  C  CA  . CYS A 1 22  ? -8.190  8.635   12.947  1.00 35.16 ? 22   CYS A CA  1 
ATOM   142  C  C   . CYS A 1 22  ? -9.230  8.023   13.885  1.00 34.43 ? 22   CYS A C   1 
ATOM   143  O  O   . CYS A 1 22  ? -9.998  8.740   14.528  1.00 34.19 ? 22   CYS A O   1 
ATOM   144  C  CB  . CYS A 1 22  ? -7.131  9.403   13.744  1.00 35.33 ? 22   CYS A CB  1 
ATOM   145  S  SG  . CYS A 1 22  ? -6.136  8.368   14.884  1.00 36.67 ? 22   CYS A SG  1 
ATOM   146  N  N   . GLN A 1 23  ? -9.259  6.695   13.948  1.00 33.62 ? 23   GLN A N   1 
ATOM   147  C  CA  . GLN A 1 23  ? -10.273 5.987   14.728  1.00 33.05 ? 23   GLN A CA  1 
ATOM   148  C  C   . GLN A 1 23  ? -9.663  5.009   15.722  1.00 33.01 ? 23   GLN A C   1 
ATOM   149  O  O   . GLN A 1 23  ? -8.675  4.353   15.420  1.00 32.94 ? 23   GLN A O   1 
ATOM   150  C  CB  . GLN A 1 23  ? -11.251 5.241   13.805  1.00 32.99 ? 23   GLN A CB  1 
ATOM   151  C  CG  . GLN A 1 23  ? -12.104 6.155   12.918  1.00 32.52 ? 23   GLN A CG  1 
ATOM   152  C  CD  . GLN A 1 23  ? -13.192 5.401   12.186  1.00 32.58 ? 23   GLN A CD  1 
ATOM   153  O  OE1 . GLN A 1 23  ? -12.926 4.418   11.497  1.00 30.87 ? 23   GLN A OE1 1 
ATOM   154  N  NE2 . GLN A 1 23  ? -14.431 5.857   12.334  1.00 31.51 ? 23   GLN A NE2 1 
ATOM   155  N  N   . LYS A 1 24  ? -10.264 4.919   16.903  1.00 33.01 ? 24   LYS A N   1 
ATOM   156  C  CA  . LYS A 1 24  ? -9.913  3.892   17.870  1.00 33.39 ? 24   LYS A CA  1 
ATOM   157  C  C   . LYS A 1 24  ? -10.644 2.607   17.509  1.00 33.73 ? 24   LYS A C   1 
ATOM   158  O  O   . LYS A 1 24  ? -11.861 2.618   17.311  1.00 33.99 ? 24   LYS A O   1 
ATOM   159  C  CB  . LYS A 1 24  ? -10.268 4.336   19.289  1.00 33.15 ? 24   LYS A CB  1 
ATOM   160  C  CG  . LYS A 1 24  ? -10.134 3.241   20.335  1.00 33.12 ? 24   LYS A CG  1 
ATOM   161  C  CD  . LYS A 1 24  ? -9.881  3.823   21.684  1.00 32.33 ? 24   LYS A CD  1 
ATOM   162  C  CE  . LYS A 1 24  ? -10.460 2.979   22.790  1.00 32.88 ? 24   LYS A CE  1 
ATOM   163  N  NZ  . LYS A 1 24  ? -10.358 3.725   24.075  1.00 32.29 ? 24   LYS A NZ  1 
ATOM   164  N  N   . ILE A 1 25  ? -9.894  1.510   17.419  1.00 34.07 ? 25   ILE A N   1 
ATOM   165  C  CA  . ILE A 1 25  ? -10.431 0.217   16.981  1.00 34.20 ? 25   ILE A CA  1 
ATOM   166  C  C   . ILE A 1 25  ? -10.071 -0.932  17.937  1.00 34.93 ? 25   ILE A C   1 
ATOM   167  O  O   . ILE A 1 25  ? -8.985  -0.948  18.521  1.00 34.47 ? 25   ILE A O   1 
ATOM   168  C  CB  . ILE A 1 25  ? -9.974  -0.140  15.533  1.00 34.15 ? 25   ILE A CB  1 
ATOM   169  C  CG1 . ILE A 1 25  ? -8.450  -0.311  15.457  1.00 33.62 ? 25   ILE A CG1 1 
ATOM   170  C  CG2 . ILE A 1 25  ? -10.499 0.898   14.527  1.00 34.04 ? 25   ILE A CG2 1 
ATOM   171  C  CD1 . ILE A 1 25  ? -7.917  -0.822  14.145  1.00 33.37 ? 25   ILE A CD1 1 
ATOM   172  N  N   . ARG A 1 26  ? -10.998 -1.879  18.095  1.00 35.62 ? 26   ARG A N   1 
ATOM   173  C  CA  . ARG A 1 26  ? -10.725 -3.111  18.839  1.00 36.54 ? 26   ARG A CA  1 
ATOM   174  C  C   . ARG A 1 26  ? -10.585 -4.280  17.868  1.00 36.77 ? 26   ARG A C   1 
ATOM   175  O  O   . ARG A 1 26  ? -11.459 -4.512  17.024  1.00 36.83 ? 26   ARG A O   1 
ATOM   176  C  CB  . ARG A 1 26  ? -11.814 -3.394  19.888  1.00 36.58 ? 26   ARG A CB  1 
ATOM   177  C  CG  . ARG A 1 26  ? -11.780 -4.819  20.487  1.00 37.45 ? 26   ARG A CG  1 
ATOM   178  C  CD  . ARG A 1 26  ? -12.681 -4.991  21.719  1.00 37.26 ? 26   ARG A CD  1 
ATOM   179  N  NE  . ARG A 1 26  ? -12.231 -4.176  22.851  1.00 39.31 ? 26   ARG A NE  1 
ATOM   180  C  CZ  . ARG A 1 26  ? -12.921 -3.163  23.375  1.00 39.79 ? 26   ARG A CZ  1 
ATOM   181  N  NH1 . ARG A 1 26  ? -14.119 -2.841  22.894  1.00 40.62 ? 26   ARG A NH1 1 
ATOM   182  N  NH2 . ARG A 1 26  ? -12.421 -2.482  24.399  1.00 39.08 ? 26   ARG A NH2 1 
ATOM   183  N  N   . ARG A 1 27  ? -9.474  -5.002  17.993  1.00 37.08 ? 27   ARG A N   1 
ATOM   184  C  CA  . ARG A 1 27  ? -9.207  -6.181  17.179  1.00 37.44 ? 27   ARG A CA  1 
ATOM   185  C  C   . ARG A 1 27  ? -10.012 -7.366  17.706  1.00 37.68 ? 27   ARG A C   1 
ATOM   186  O  O   . ARG A 1 27  ? -10.061 -7.604  18.914  1.00 37.57 ? 27   ARG A O   1 
ATOM   187  C  CB  . ARG A 1 27  ? -7.709  -6.489  17.189  1.00 37.42 ? 27   ARG A CB  1 
ATOM   188  C  CG  . ARG A 1 27  ? -7.265  -7.591  16.250  1.00 37.63 ? 27   ARG A CG  1 
ATOM   189  C  CD  . ARG A 1 27  ? -5.797  -7.936  16.494  1.00 38.84 ? 27   ARG A CD  1 
ATOM   190  N  NE  . ARG A 1 27  ? -4.903  -7.239  15.573  1.00 39.83 ? 27   ARG A NE  1 
ATOM   191  C  CZ  . ARG A 1 27  ? -3.578  -7.209  15.680  1.00 40.31 ? 27   ARG A CZ  1 
ATOM   192  N  NH1 . ARG A 1 27  ? -2.964  -7.828  16.681  1.00 40.24 ? 27   ARG A NH1 1 
ATOM   193  N  NH2 . ARG A 1 27  ? -2.863  -6.545  14.782  1.00 40.58 ? 27   ARG A NH2 1 
ATOM   194  N  N   . LYS A 1 28  ? -10.648 -8.095  16.791  1.00 38.13 ? 28   LYS A N   1 
ATOM   195  C  CA  . LYS A 1 28  ? -11.477 -9.253  17.143  1.00 38.56 ? 28   LYS A CA  1 
ATOM   196  C  C   . LYS A 1 28  ? -10.668 -10.466 17.623  1.00 38.84 ? 28   LYS A C   1 
ATOM   197  O  O   . LYS A 1 28  ? -11.201 -11.329 18.320  1.00 38.80 ? 28   LYS A O   1 
ATOM   198  C  CB  . LYS A 1 28  ? -12.376 -9.641  15.967  1.00 38.63 ? 28   LYS A CB  1 
ATOM   199  N  N   . SER A 1 29  ? -9.386  -10.516 17.257  1.00 39.37 ? 29   SER A N   1 
ATOM   200  C  CA  . SER A 1 29  ? -8.470  -11.591 17.667  1.00 39.72 ? 29   SER A CA  1 
ATOM   201  C  C   . SER A 1 29  ? -8.461  -11.800 19.184  1.00 39.78 ? 29   SER A C   1 
ATOM   202  O  O   . SER A 1 29  ? -8.934  -12.826 19.676  1.00 39.67 ? 29   SER A O   1 
ATOM   203  C  CB  . SER A 1 29  ? -7.037  -11.300 17.192  1.00 39.83 ? 29   SER A CB  1 
ATOM   204  O  OG  . SER A 1 29  ? -7.002  -10.828 15.856  1.00 40.35 ? 29   SER A OG  1 
ATOM   205  N  N   . ASP A 1 30  ? -7.930  -10.817 19.914  1.00 39.91 ? 30   ASP A N   1 
ATOM   206  C  CA  . ASP A 1 30  ? -7.764  -10.921 21.365  1.00 39.98 ? 30   ASP A CA  1 
ATOM   207  C  C   . ASP A 1 30  ? -8.161  -9.647  22.116  1.00 40.03 ? 30   ASP A C   1 
ATOM   208  O  O   . ASP A 1 30  ? -7.596  -9.338  23.172  1.00 40.13 ? 30   ASP A O   1 
ATOM   209  C  CB  . ASP A 1 30  ? -6.320  -11.311 21.706  1.00 40.07 ? 30   ASP A CB  1 
ATOM   210  N  N   . GLY A 1 31  ? -9.128  -8.912  21.566  1.00 39.95 ? 31   GLY A N   1 
ATOM   211  C  CA  . GLY A 1 31  ? -9.641  -7.687  22.186  1.00 39.74 ? 31   GLY A CA  1 
ATOM   212  C  C   . GLY A 1 31  ? -8.631  -6.560  22.305  1.00 39.76 ? 31   GLY A C   1 
ATOM   213  O  O   . GLY A 1 31  ? -8.744  -5.710  23.194  1.00 39.94 ? 31   GLY A O   1 
ATOM   214  N  N   . LYS A 1 32  ? -7.647  -6.551  21.406  1.00 39.42 ? 32   LYS A N   1 
ATOM   215  C  CA  . LYS A 1 32  ? -6.577  -5.561  21.426  1.00 39.02 ? 32   LYS A CA  1 
ATOM   216  C  C   . LYS A 1 32  ? -7.063  -4.200  20.934  1.00 38.65 ? 32   LYS A C   1 
ATOM   217  O  O   . LYS A 1 32  ? -7.548  -4.074  19.806  1.00 38.63 ? 32   LYS A O   1 
ATOM   218  C  CB  . LYS A 1 32  ? -5.385  -6.049  20.591  1.00 39.09 ? 32   LYS A CB  1 
ATOM   219  C  CG  . LYS A 1 32  ? -4.205  -5.077  20.499  1.00 39.48 ? 32   LYS A CG  1 
ATOM   220  C  CD  . LYS A 1 32  ? -3.254  -5.146  21.688  1.00 39.92 ? 32   LYS A CD  1 
ATOM   221  C  CE  . LYS A 1 32  ? -3.677  -4.223  22.820  1.00 40.80 ? 32   LYS A CE  1 
ATOM   222  N  NZ  . LYS A 1 32  ? -2.484  -3.726  23.573  1.00 42.58 ? 32   LYS A NZ  1 
ATOM   223  N  N   . ILE A 1 33  ? -6.933  -3.191  21.794  1.00 38.14 ? 33   ILE A N   1 
ATOM   224  C  CA  . ILE A 1 33  ? -7.297  -1.817  21.441  1.00 37.74 ? 33   ILE A CA  1 
ATOM   225  C  C   . ILE A 1 33  ? -6.163  -1.146  20.667  1.00 36.89 ? 33   ILE A C   1 
ATOM   226  O  O   . ILE A 1 33  ? -5.048  -1.014  21.173  1.00 37.54 ? 33   ILE A O   1 
ATOM   227  C  CB  . ILE A 1 33  ? -7.695  -0.976  22.684  1.00 37.75 ? 33   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 33  ? -8.964  -1.551  23.331  1.00 38.28 ? 33   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 33  ? -7.921  0.489   22.297  1.00 37.33 ? 33   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 33  ? -9.260  -1.001  24.724  1.00 38.22 ? 33   ILE A CD1 1 
ATOM   231  N  N   . LEU A 1 34  ? -6.462  -0.749  19.433  1.00 35.90 ? 34   LEU A N   1 
ATOM   232  C  CA  . LEU A 1 34  ? -5.511  -0.076  18.546  1.00 34.93 ? 34   LEU A CA  1 
ATOM   233  C  C   . LEU A 1 34  ? -6.169  1.150   17.903  1.00 34.06 ? 34   LEU A C   1 
ATOM   234  O  O   . LEU A 1 34  ? -7.289  1.525   18.262  1.00 33.80 ? 34   LEU A O   1 
ATOM   235  C  CB  . LEU A 1 34  ? -5.033  -1.038  17.452  1.00 34.81 ? 34   LEU A CB  1 
ATOM   236  C  CG  . LEU A 1 34  ? -4.453  -2.396  17.866  1.00 35.22 ? 34   LEU A CG  1 
ATOM   237  C  CD1 . LEU A 1 34  ? -4.521  -3.389  16.722  1.00 33.79 ? 34   LEU A CD1 1 
ATOM   238  C  CD2 . LEU A 1 34  ? -3.026  -2.250  18.382  1.00 35.08 ? 34   LEU A CD2 1 
ATOM   239  N  N   . VAL A 1 35  ? -5.467  1.786   16.971  1.00 33.17 ? 35   VAL A N   1 
ATOM   240  C  CA  . VAL A 1 35  ? -6.093  2.795   16.109  1.00 32.35 ? 35   VAL A CA  1 
ATOM   241  C  C   . VAL A 1 35  ? -5.866  2.485   14.634  1.00 31.96 ? 35   VAL A C   1 
ATOM   242  O  O   . VAL A 1 35  ? -4.960  1.728   14.283  1.00 31.69 ? 35   VAL A O   1 
ATOM   243  C  CB  . VAL A 1 35  ? -5.603  4.252   16.391  1.00 32.23 ? 35   VAL A CB  1 
ATOM   244  C  CG1 . VAL A 1 35  ? -5.707  4.593   17.866  1.00 31.83 ? 35   VAL A CG1 1 
ATOM   245  C  CG2 . VAL A 1 35  ? -4.186  4.487   15.855  1.00 31.81 ? 35   VAL A CG2 1 
ATOM   246  N  N   . TRP A 1 36  ? -6.693  3.071   13.772  1.00 31.30 ? 36   TRP A N   1 
ATOM   247  C  CA  . TRP A 1 36  ? -6.309  3.174   12.375  1.00 31.08 ? 36   TRP A CA  1 
ATOM   248  C  C   . TRP A 1 36  ? -6.460  4.582   11.809  1.00 31.11 ? 36   TRP A C   1 
ATOM   249  O  O   . TRP A 1 36  ? -7.310  5.359   12.250  1.00 30.97 ? 36   TRP A O   1 
ATOM   250  C  CB  . TRP A 1 36  ? -6.982  2.110   11.479  1.00 30.50 ? 36   TRP A CB  1 
ATOM   251  C  CG  . TRP A 1 36  ? -8.480  2.181   11.317  1.00 30.46 ? 36   TRP A CG  1 
ATOM   252  C  CD1 . TRP A 1 36  ? -9.276  3.290   11.392  1.00 30.26 ? 36   TRP A CD1 1 
ATOM   253  C  CD2 . TRP A 1 36  ? -9.350  1.091   10.987  1.00 30.47 ? 36   TRP A CD2 1 
ATOM   254  N  NE1 . TRP A 1 36  ? -10.585 2.953   11.162  1.00 30.19 ? 36   TRP A NE1 1 
ATOM   255  C  CE2 . TRP A 1 36  ? -10.660 1.609   10.909  1.00 30.69 ? 36   TRP A CE2 1 
ATOM   256  C  CE3 . TRP A 1 36  ? -9.150  -0.279  10.762  1.00 29.94 ? 36   TRP A CE3 1 
ATOM   257  C  CZ2 . TRP A 1 36  ? -11.770 0.805   10.611  1.00 30.28 ? 36   TRP A CZ2 1 
ATOM   258  C  CZ3 . TRP A 1 36  ? -10.252 -1.077  10.472  1.00 30.19 ? 36   TRP A CZ3 1 
ATOM   259  C  CH2 . TRP A 1 36  ? -11.546 -0.530  10.402  1.00 29.97 ? 36   TRP A CH2 1 
ATOM   260  N  N   . LYS A 1 37  ? -5.600  4.892   10.845  1.00 31.29 ? 37   LYS A N   1 
ATOM   261  C  CA  . LYS A 1 37  ? -5.747  6.070   10.008  1.00 31.44 ? 37   LYS A CA  1 
ATOM   262  C  C   . LYS A 1 37  ? -6.505  5.653   8.751   1.00 31.77 ? 37   LYS A C   1 
ATOM   263  O  O   . LYS A 1 37  ? -6.076  4.752   8.030   1.00 31.52 ? 37   LYS A O   1 
ATOM   264  C  CB  . LYS A 1 37  ? -4.377  6.649   9.647   1.00 31.30 ? 37   LYS A CB  1 
ATOM   265  C  CG  . LYS A 1 37  ? -3.489  6.940   10.853  1.00 31.17 ? 37   LYS A CG  1 
ATOM   266  C  CD  . LYS A 1 37  ? -3.973  8.156   11.649  1.00 31.01 ? 37   LYS A CD  1 
ATOM   267  C  CE  . LYS A 1 37  ? -3.295  8.225   13.017  1.00 29.10 ? 37   LYS A CE  1 
ATOM   268  N  NZ  . LYS A 1 37  ? -3.785  9.411   13.768  1.00 30.46 ? 37   LYS A NZ  1 
ATOM   269  N  N   . GLU A 1 38  ? -7.639  6.311   8.513   1.00 32.15 ? 38   GLU A N   1 
ATOM   270  C  CA  . GLU A 1 38  ? -8.526  6.016   7.392   1.00 32.58 ? 38   GLU A CA  1 
ATOM   271  C  C   . GLU A 1 38  ? -8.247  6.994   6.246   1.00 32.34 ? 38   GLU A C   1 
ATOM   272  O  O   . GLU A 1 38  ? -8.518  8.190   6.360   1.00 32.48 ? 38   GLU A O   1 
ATOM   273  C  CB  . GLU A 1 38  ? -9.978  6.124   7.861   1.00 32.60 ? 38   GLU A CB  1 
ATOM   274  C  CG  . GLU A 1 38  ? -11.029 5.712   6.848   1.00 33.48 ? 38   GLU A CG  1 
ATOM   275  C  CD  . GLU A 1 38  ? -12.432 6.105   7.282   1.00 33.76 ? 38   GLU A CD  1 
ATOM   276  O  OE1 . GLU A 1 38  ? -12.689 7.315   7.479   1.00 35.33 ? 38   GLU A OE1 1 
ATOM   277  O  OE2 . GLU A 1 38  ? -13.282 5.203   7.424   1.00 35.56 ? 38   GLU A OE2 1 
ATOM   278  N  N   . LEU A 1 39  ? -7.708  6.477   5.146   1.00 32.14 ? 39   LEU A N   1 
ATOM   279  C  CA  . LEU A 1 39  ? -7.216  7.318   4.056   1.00 31.98 ? 39   LEU A CA  1 
ATOM   280  C  C   . LEU A 1 39  ? -7.861  6.966   2.715   1.00 31.87 ? 39   LEU A C   1 
ATOM   281  O  O   . LEU A 1 39  ? -7.740  5.836   2.239   1.00 32.05 ? 39   LEU A O   1 
ATOM   282  C  CB  . LEU A 1 39  ? -5.693  7.188   3.965   1.00 32.04 ? 39   LEU A CB  1 
ATOM   283  C  CG  . LEU A 1 39  ? -4.850  8.400   3.566   1.00 32.11 ? 39   LEU A CG  1 
ATOM   284  C  CD1 . LEU A 1 39  ? -3.560  8.437   4.387   1.00 31.57 ? 39   LEU A CD1 1 
ATOM   285  C  CD2 . LEU A 1 39  ? -4.556  8.400   2.070   1.00 32.02 ? 39   LEU A CD2 1 
ATOM   286  N  N   . ASP A 1 40  ? -8.549  7.936   2.112   1.00 31.56 ? 40   ASP A N   1 
ATOM   287  C  CA  . ASP A 1 40  ? -9.155  7.741   0.794   1.00 31.23 ? 40   ASP A CA  1 
ATOM   288  C  C   . ASP A 1 40  ? -8.121  8.031   -0.295  1.00 31.15 ? 40   ASP A C   1 
ATOM   289  O  O   . ASP A 1 40  ? -7.643  9.161   -0.429  1.00 31.14 ? 40   ASP A O   1 
ATOM   290  C  CB  . ASP A 1 40  ? -10.414 8.614   0.627   1.00 31.12 ? 40   ASP A CB  1 
ATOM   291  C  CG  . ASP A 1 40  ? -11.241 8.242   -0.615  1.00 31.38 ? 40   ASP A CG  1 
ATOM   292  O  OD1 . ASP A 1 40  ? -12.457 7.976   -0.478  1.00 30.96 ? 40   ASP A OD1 1 
ATOM   293  O  OD2 . ASP A 1 40  ? -10.685 8.219   -1.733  1.00 31.35 ? 40   ASP A OD2 1 
ATOM   294  N  N   . TYR A 1 41  ? -7.777  6.998   -1.062  1.00 31.07 ? 41   TYR A N   1 
ATOM   295  C  CA  . TYR A 1 41  ? -6.792  7.106   -2.141  1.00 30.90 ? 41   TYR A CA  1 
ATOM   296  C  C   . TYR A 1 41  ? -7.462  7.248   -3.505  1.00 31.03 ? 41   TYR A C   1 
ATOM   297  O  O   . TYR A 1 41  ? -6.788  7.480   -4.510  1.00 30.98 ? 41   TYR A O   1 
ATOM   298  C  CB  . TYR A 1 41  ? -5.853  5.891   -2.144  1.00 30.71 ? 41   TYR A CB  1 
ATOM   299  C  CG  . TYR A 1 41  ? -6.558  4.564   -2.331  1.00 30.45 ? 41   TYR A CG  1 
ATOM   300  C  CD1 . TYR A 1 41  ? -6.845  4.070   -3.607  1.00 29.86 ? 41   TYR A CD1 1 
ATOM   301  C  CD2 . TYR A 1 41  ? -6.937  3.799   -1.232  1.00 30.32 ? 41   TYR A CD2 1 
ATOM   302  C  CE1 . TYR A 1 41  ? -7.496  2.855   -3.774  1.00 29.76 ? 41   TYR A CE1 1 
ATOM   303  C  CE2 . TYR A 1 41  ? -7.583  2.583   -1.392  1.00 30.18 ? 41   TYR A CE2 1 
ATOM   304  C  CZ  . TYR A 1 41  ? -7.860  2.117   -2.661  1.00 30.11 ? 41   TYR A CZ  1 
ATOM   305  O  OH  . TYR A 1 41  ? -8.503  0.912   -2.804  1.00 30.36 ? 41   TYR A OH  1 
ATOM   306  N  N   . GLY A 1 42  ? -8.786  7.102   -3.523  1.00 31.13 ? 42   GLY A N   1 
ATOM   307  C  CA  . GLY A 1 42  ? -9.581  7.160   -4.743  1.00 31.39 ? 42   GLY A CA  1 
ATOM   308  C  C   . GLY A 1 42  ? -9.469  8.449   -5.538  1.00 31.57 ? 42   GLY A C   1 
ATOM   309  O  O   . GLY A 1 42  ? -9.710  8.451   -6.744  1.00 31.41 ? 42   GLY A O   1 
ATOM   310  N  N   . SER A 1 43  ? -9.095  9.539   -4.867  1.00 31.73 ? 43   SER A N   1 
ATOM   311  C  CA  . SER A 1 43  ? -8.996  10.855  -5.507  1.00 32.01 ? 43   SER A CA  1 
ATOM   312  C  C   . SER A 1 43  ? -7.583  11.185  -6.012  1.00 32.15 ? 43   SER A C   1 
ATOM   313  O  O   . SER A 1 43  ? -7.391  12.171  -6.734  1.00 32.08 ? 43   SER A O   1 
ATOM   314  C  CB  . SER A 1 43  ? -9.497  11.953  -4.561  1.00 31.99 ? 43   SER A CB  1 
ATOM   315  O  OG  . SER A 1 43  ? -9.689  13.174  -5.256  1.00 31.95 ? 43   SER A OG  1 
ATOM   316  N  N   . MET A 1 44  ? -6.610  10.349  -5.649  1.00 32.28 ? 44   MET A N   1 
ATOM   317  C  CA  . MET A 1 44  ? -5.202  10.587  -5.978  1.00 32.62 ? 44   MET A CA  1 
ATOM   318  C  C   . MET A 1 44  ? -4.763  9.981   -7.315  1.00 32.90 ? 44   MET A C   1 
ATOM   319  O  O   . MET A 1 44  ? -5.424  9.090   -7.857  1.00 32.87 ? 44   MET A O   1 
ATOM   320  C  CB  . MET A 1 44  ? -4.300  10.068  -4.853  1.00 32.60 ? 44   MET A CB  1 
ATOM   321  N  N   . THR A 1 45  ? -3.643  10.483  -7.832  1.00 33.24 ? 45   THR A N   1 
ATOM   322  C  CA  . THR A 1 45  ? -3.004  9.936   -9.028  1.00 33.62 ? 45   THR A CA  1 
ATOM   323  C  C   . THR A 1 45  ? -2.084  8.775   -8.630  1.00 33.88 ? 45   THR A C   1 
ATOM   324  O  O   . THR A 1 45  ? -1.847  8.541   -7.440  1.00 33.74 ? 45   THR A O   1 
ATOM   325  C  CB  . THR A 1 45  ? -2.190  11.022  -9.784  1.00 33.62 ? 45   THR A CB  1 
ATOM   326  O  OG1 . THR A 1 45  ? -2.809  12.303  -9.610  1.00 33.81 ? 45   THR A OG1 1 
ATOM   327  C  CG2 . THR A 1 45  ? -2.101  10.706  -11.281 1.00 33.73 ? 45   THR A CG2 1 
ATOM   328  N  N   . GLU A 1 46  ? -1.579  8.050   -9.627  1.00 34.22 ? 46   GLU A N   1 
ATOM   329  C  CA  . GLU A 1 46  ? -0.657  6.934   -9.406  1.00 34.61 ? 46   GLU A CA  1 
ATOM   330  C  C   . GLU A 1 46  ? 0.725   7.402   -8.936  1.00 34.90 ? 46   GLU A C   1 
ATOM   331  O  O   . GLU A 1 46  ? 1.426   6.674   -8.227  1.00 34.84 ? 46   GLU A O   1 
ATOM   332  C  CB  . GLU A 1 46  ? -0.534  6.075   -10.672 1.00 34.57 ? 46   GLU A CB  1 
ATOM   333  C  CG  . GLU A 1 46  ? -0.016  6.815   -11.901 1.00 34.56 ? 46   GLU A CG  1 
ATOM   334  C  CD  . GLU A 1 46  ? 0.194   5.899   -13.085 1.00 34.63 ? 46   GLU A CD  1 
ATOM   335  O  OE1 . GLU A 1 46  ? -0.804  5.534   -13.744 1.00 34.73 ? 46   GLU A OE1 1 
ATOM   336  O  OE2 . GLU A 1 46  ? 1.360   5.552   -13.363 1.00 34.69 ? 46   GLU A OE2 1 
ATOM   337  N  N   . ALA A 1 47  ? 1.100   8.617   -9.338  1.00 35.31 ? 47   ALA A N   1 
ATOM   338  C  CA  . ALA A 1 47  ? 2.392   9.211   -8.988  1.00 35.63 ? 47   ALA A CA  1 
ATOM   339  C  C   . ALA A 1 47  ? 2.507   9.494   -7.492  1.00 35.81 ? 47   ALA A C   1 
ATOM   340  O  O   . ALA A 1 47  ? 3.593   9.385   -6.918  1.00 35.91 ? 47   ALA A O   1 
ATOM   341  C  CB  . ALA A 1 47  ? 2.628   10.484  -9.798  1.00 35.62 ? 47   ALA A CB  1 
ATOM   342  N  N   . GLU A 1 48  ? 1.385   9.861   -6.874  1.00 36.11 ? 48   GLU A N   1 
ATOM   343  C  CA  . GLU A 1 48  ? 1.302   10.041  -5.423  1.00 36.32 ? 48   GLU A CA  1 
ATOM   344  C  C   . GLU A 1 48  ? 1.087   8.701   -4.721  1.00 36.54 ? 48   GLU A C   1 
ATOM   345  O  O   . GLU A 1 48  ? 1.441   8.537   -3.548  1.00 36.63 ? 48   GLU A O   1 
ATOM   346  C  CB  . GLU A 1 48  ? 0.164   10.998  -5.066  1.00 36.29 ? 48   GLU A CB  1 
ATOM   347  C  CG  . GLU A 1 48  ? 0.409   12.441  -5.474  1.00 36.56 ? 48   GLU A CG  1 
ATOM   348  C  CD  . GLU A 1 48  ? -0.860  13.272  -5.479  1.00 36.83 ? 48   GLU A CD  1 
ATOM   349  O  OE1 . GLU A 1 48  ? -1.603  13.246  -4.475  1.00 37.09 ? 48   GLU A OE1 1 
ATOM   350  O  OE2 . GLU A 1 48  ? -1.111  13.960  -6.491  1.00 37.06 ? 48   GLU A OE2 1 
ATOM   351  N  N   . LYS A 1 49  ? 0.495   7.755   -5.447  1.00 36.75 ? 49   LYS A N   1 
ATOM   352  C  CA  . LYS A 1 49  ? 0.254   6.403   -4.946  1.00 36.98 ? 49   LYS A CA  1 
ATOM   353  C  C   . LYS A 1 49  ? 1.542   5.581   -4.916  1.00 37.14 ? 49   LYS A C   1 
ATOM   354  O  O   . LYS A 1 49  ? 1.650   4.618   -4.155  1.00 37.05 ? 49   LYS A O   1 
ATOM   355  C  CB  . LYS A 1 49  ? -0.805  5.697   -5.799  1.00 36.98 ? 49   LYS A CB  1 
ATOM   356  N  N   . GLN A 1 50  ? 2.506   5.962   -5.753  1.00 37.44 ? 50   GLN A N   1 
ATOM   357  C  CA  . GLN A 1 50  ? 3.821   5.325   -5.782  1.00 37.72 ? 50   GLN A CA  1 
ATOM   358  C  C   . GLN A 1 50  ? 4.628   5.706   -4.545  1.00 37.93 ? 50   GLN A C   1 
ATOM   359  O  O   . GLN A 1 50  ? 5.395   4.895   -4.021  1.00 38.01 ? 50   GLN A O   1 
ATOM   360  C  CB  . GLN A 1 50  ? 4.583   5.710   -7.052  1.00 37.72 ? 50   GLN A CB  1 
ATOM   361  N  N   . MET A 1 51  ? 4.444   6.943   -4.086  1.00 38.18 ? 51   MET A N   1 
ATOM   362  C  CA  . MET A 1 51  ? 5.074   7.424   -2.858  1.00 38.36 ? 51   MET A CA  1 
ATOM   363  C  C   . MET A 1 51  ? 4.433   6.792   -1.627  1.00 38.53 ? 51   MET A C   1 
ATOM   364  O  O   . MET A 1 51  ? 5.138   6.298   -0.747  1.00 38.62 ? 51   MET A O   1 
ATOM   365  C  CB  . MET A 1 51  ? 4.988   8.951   -2.769  1.00 38.37 ? 51   MET A CB  1 
ATOM   366  N  N   . LEU A 1 52  ? 3.099   6.805   -1.583  1.00 38.68 ? 52   LEU A N   1 
ATOM   367  C  CA  . LEU A 1 52  ? 2.332   6.308   -0.435  1.00 38.79 ? 52   LEU A CA  1 
ATOM   368  C  C   . LEU A 1 52  ? 2.589   4.833   -0.117  1.00 38.92 ? 52   LEU A C   1 
ATOM   369  O  O   . LEU A 1 52  ? 2.753   4.474   1.049   1.00 38.81 ? 52   LEU A O   1 
ATOM   370  C  CB  . LEU A 1 52  ? 0.835   6.558   -0.637  1.00 38.70 ? 52   LEU A CB  1 
ATOM   371  N  N   . VAL A 1 53  ? 2.631   3.991   -1.153  1.00 39.13 ? 53   VAL A N   1 
ATOM   372  C  CA  . VAL A 1 53  ? 2.904   2.556   -0.985  1.00 39.37 ? 53   VAL A CA  1 
ATOM   373  C  C   . VAL A 1 53  ? 4.331   2.319   -0.468  1.00 39.51 ? 53   VAL A C   1 
ATOM   374  O  O   . VAL A 1 53  ? 4.543   1.490   0.425   1.00 39.53 ? 53   VAL A O   1 
ATOM   375  C  CB  . VAL A 1 53  ? 2.613   1.746   -2.282  1.00 39.42 ? 53   VAL A CB  1 
ATOM   376  C  CG1 . VAL A 1 53  ? 3.127   0.309   -2.172  1.00 39.53 ? 53   VAL A CG1 1 
ATOM   377  C  CG2 . VAL A 1 53  ? 1.118   1.736   -2.578  1.00 39.49 ? 53   VAL A CG2 1 
ATOM   378  N  N   . SER A 1 54  ? 5.292   3.067   -1.012  1.00 39.63 ? 54   SER A N   1 
ATOM   379  C  CA  . SER A 1 54  ? 6.682   3.034   -0.538  1.00 39.83 ? 54   SER A CA  1 
ATOM   380  C  C   . SER A 1 54  ? 6.831   3.472   0.922   1.00 39.95 ? 54   SER A C   1 
ATOM   381  O  O   . SER A 1 54  ? 7.804   3.108   1.590   1.00 40.02 ? 54   SER A O   1 
ATOM   382  C  CB  . SER A 1 54  ? 7.571   3.906   -1.426  1.00 39.80 ? 54   SER A CB  1 
ATOM   383  O  OG  . SER A 1 54  ? 7.847   3.265   -2.656  1.00 39.85 ? 54   SER A OG  1 
ATOM   384  N  N   . GLU A 1 55  ? 5.860   4.247   1.405   1.00 40.07 ? 55   GLU A N   1 
ATOM   385  C  CA  . GLU A 1 55  ? 5.893   4.811   2.754   1.00 40.18 ? 55   GLU A CA  1 
ATOM   386  C  C   . GLU A 1 55  ? 5.256   3.904   3.808   1.00 40.31 ? 55   GLU A C   1 
ATOM   387  O  O   . GLU A 1 55  ? 5.689   3.896   4.967   1.00 40.40 ? 55   GLU A O   1 
ATOM   388  C  CB  . GLU A 1 55  ? 5.216   6.185   2.771   1.00 40.19 ? 55   GLU A CB  1 
ATOM   389  C  CG  . GLU A 1 55  ? 6.024   7.310   2.119   1.00 40.22 ? 55   GLU A CG  1 
ATOM   390  C  CD  . GLU A 1 55  ? 6.982   8.013   3.077   1.00 40.46 ? 55   GLU A CD  1 
ATOM   391  O  OE1 . GLU A 1 55  ? 7.291   7.464   4.160   1.00 39.88 ? 55   GLU A OE1 1 
ATOM   392  O  OE2 . GLU A 1 55  ? 7.429   9.131   2.738   1.00 40.61 ? 55   GLU A OE2 1 
ATOM   393  N  N   . VAL A 1 56  ? 4.230   3.151   3.411   1.00 40.39 ? 56   VAL A N   1 
ATOM   394  C  CA  . VAL A 1 56  ? 3.538   2.236   4.329   1.00 40.46 ? 56   VAL A CA  1 
ATOM   395  C  C   . VAL A 1 56  ? 4.467   1.083   4.735   1.00 40.58 ? 56   VAL A C   1 
ATOM   396  O  O   . VAL A 1 56  ? 4.542   0.718   5.916   1.00 40.51 ? 56   VAL A O   1 
ATOM   397  C  CB  . VAL A 1 56  ? 2.205   1.691   3.731   1.00 40.50 ? 56   VAL A CB  1 
ATOM   398  C  CG1 . VAL A 1 56  ? 1.479   0.802   4.736   1.00 40.37 ? 56   VAL A CG1 1 
ATOM   399  C  CG2 . VAL A 1 56  ? 1.289   2.835   3.298   1.00 40.37 ? 56   VAL A CG2 1 
ATOM   400  N  N   . ASN A 1 57  ? 5.183   0.537   3.751   1.00 40.61 ? 57   ASN A N   1 
ATOM   401  C  CA  . ASN A 1 57  ? 6.143   -0.545  3.975   1.00 40.69 ? 57   ASN A CA  1 
ATOM   402  C  C   . ASN A 1 57  ? 7.390   -0.100  4.742   1.00 40.77 ? 57   ASN A C   1 
ATOM   403  O  O   . ASN A 1 57  ? 7.994   -0.898  5.461   1.00 40.83 ? 57   ASN A O   1 
ATOM   404  C  CB  . ASN A 1 57  ? 6.541   -1.196  2.646   1.00 40.68 ? 57   ASN A CB  1 
ATOM   405  N  N   . LEU A 1 58  ? 7.768   1.169   4.587   1.00 40.81 ? 58   LEU A N   1 
ATOM   406  C  CA  . LEU A 1 58  ? 8.916   1.735   5.302   1.00 40.83 ? 58   LEU A CA  1 
ATOM   407  C  C   . LEU A 1 58  ? 8.621   1.880   6.792   1.00 40.88 ? 58   LEU A C   1 
ATOM   408  O  O   . LEU A 1 58  ? 9.537   1.909   7.619   1.00 40.89 ? 58   LEU A O   1 
ATOM   409  C  CB  . LEU A 1 58  ? 9.307   3.091   4.711   1.00 40.88 ? 58   LEU A CB  1 
ATOM   410  N  N   . LEU A 1 59  ? 7.332   1.967   7.118   1.00 40.92 ? 59   LEU A N   1 
ATOM   411  C  CA  . LEU A 1 59  ? 6.868   2.069   8.497   1.00 40.85 ? 59   LEU A CA  1 
ATOM   412  C  C   . LEU A 1 59  ? 6.943   0.725   9.233   1.00 40.77 ? 59   LEU A C   1 
ATOM   413  O  O   . LEU A 1 59  ? 6.870   0.684   10.463  1.00 40.83 ? 59   LEU A O   1 
ATOM   414  C  CB  . LEU A 1 59  ? 5.439   2.627   8.534   1.00 40.89 ? 59   LEU A CB  1 
ATOM   415  N  N   . ARG A 1 60  ? 7.099   -0.365  8.478   1.00 40.53 ? 60   ARG A N   1 
ATOM   416  C  CA  . ARG A 1 60  ? 7.172   -1.713  9.053   1.00 40.30 ? 60   ARG A CA  1 
ATOM   417  C  C   . ARG A 1 60  ? 8.494   -1.988  9.770   1.00 40.05 ? 60   ARG A C   1 
ATOM   418  O  O   . ARG A 1 60  ? 8.588   -2.932  10.558  1.00 40.22 ? 60   ARG A O   1 
ATOM   419  C  CB  . ARG A 1 60  ? 6.967   -2.790  7.980   1.00 40.44 ? 60   ARG A CB  1 
ATOM   420  C  CG  . ARG A 1 60  ? 5.702   -2.671  7.136   1.00 40.75 ? 60   ARG A CG  1 
ATOM   421  C  CD  . ARG A 1 60  ? 5.287   -4.026  6.557   1.00 41.26 ? 60   ARG A CD  1 
ATOM   422  N  NE  . ARG A 1 60  ? 6.437   -4.834  6.151   1.00 41.87 ? 60   ARG A NE  1 
ATOM   423  C  CZ  . ARG A 1 60  ? 6.382   -6.120  5.811   1.00 42.45 ? 60   ARG A CZ  1 
ATOM   424  N  NH1 . ARG A 1 60  ? 7.493   -6.757  5.463   1.00 42.58 ? 60   ARG A NH1 1 
ATOM   425  N  NH2 . ARG A 1 60  ? 5.226   -6.775  5.815   1.00 42.78 ? 60   ARG A NH2 1 
ATOM   426  N  N   . GLU A 1 61  ? 9.504   -1.161  9.498   1.00 39.53 ? 61   GLU A N   1 
ATOM   427  C  CA  . GLU A 1 61  ? 10.879  -1.417  9.942   1.00 38.87 ? 61   GLU A CA  1 
ATOM   428  C  C   . GLU A 1 61  ? 11.106  -1.298  11.456  1.00 38.29 ? 61   GLU A C   1 
ATOM   429  O  O   . GLU A 1 61  ? 11.682  -2.201  12.071  1.00 38.28 ? 61   GLU A O   1 
ATOM   430  C  CB  . GLU A 1 61  ? 11.866  -0.517  9.185   1.00 38.97 ? 61   GLU A CB  1 
ATOM   431  C  CG  . GLU A 1 61  ? 13.335  -0.902  9.368   1.00 39.02 ? 61   GLU A CG  1 
ATOM   432  C  CD  . GLU A 1 61  ? 14.285  0.140   8.817   1.00 38.92 ? 61   GLU A CD  1 
ATOM   433  N  N   . LEU A 1 62  ? 10.661  -0.193  12.049  1.00 37.54 ? 62   LEU A N   1 
ATOM   434  C  CA  . LEU A 1 62  ? 11.009  0.114   13.444  1.00 36.73 ? 62   LEU A CA  1 
ATOM   435  C  C   . LEU A 1 62  ? 10.022  -0.400  14.492  1.00 35.86 ? 62   LEU A C   1 
ATOM   436  O  O   . LEU A 1 62  ? 8.929   0.157   14.660  1.00 36.37 ? 62   LEU A O   1 
ATOM   437  C  CB  . LEU A 1 62  ? 11.245  1.623   13.638  1.00 36.80 ? 62   LEU A CB  1 
ATOM   438  C  CG  . LEU A 1 62  ? 12.439  2.272   12.931  1.00 37.02 ? 62   LEU A CG  1 
ATOM   439  C  CD1 . LEU A 1 62  ? 12.282  3.789   12.923  1.00 37.48 ? 62   LEU A CD1 1 
ATOM   440  C  CD2 . LEU A 1 62  ? 13.772  1.857   13.554  1.00 36.93 ? 62   LEU A CD2 1 
ATOM   441  N  N   . LYS A 1 63  ? 10.427  -1.466  15.182  1.00 34.36 ? 63   LYS A N   1 
ATOM   442  C  CA  . LYS A 1 63  ? 9.794   -1.900  16.425  1.00 32.88 ? 63   LYS A CA  1 
ATOM   443  C  C   . LYS A 1 63  ? 10.632  -1.383  17.604  1.00 31.70 ? 63   LYS A C   1 
ATOM   444  O  O   . LYS A 1 63  ? 11.734  -1.874  17.866  1.00 31.74 ? 63   LYS A O   1 
ATOM   445  C  CB  . LYS A 1 63  ? 9.664   -3.426  16.483  1.00 33.18 ? 63   LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 63  ? 8.565   -3.998  15.603  1.00 33.38 ? 63   LYS A CG  1 
ATOM   447  N  N   . HIS A 1 64  ? 10.109  -0.376  18.295  1.00 29.77 ? 64   HIS A N   1 
ATOM   448  C  CA  . HIS A 1 64  ? 10.813  0.247   19.408  1.00 28.09 ? 64   HIS A CA  1 
ATOM   449  C  C   . HIS A 1 64  ? 9.806   0.744   20.450  1.00 27.28 ? 64   HIS A C   1 
ATOM   450  O  O   . HIS A 1 64  ? 8.786   1.329   20.087  1.00 26.87 ? 64   HIS A O   1 
ATOM   451  C  CB  . HIS A 1 64  ? 11.687  1.398   18.897  1.00 27.62 ? 64   HIS A CB  1 
ATOM   452  C  CG  . HIS A 1 64  ? 12.731  1.835   19.872  1.00 26.29 ? 64   HIS A CG  1 
ATOM   453  N  ND1 . HIS A 1 64  ? 12.531  2.868   20.762  1.00 24.42 ? 64   HIS A ND1 1 
ATOM   454  C  CD2 . HIS A 1 64  ? 13.975  1.360   20.118  1.00 25.53 ? 64   HIS A CD2 1 
ATOM   455  C  CE1 . HIS A 1 64  ? 13.613  3.019   21.504  1.00 25.21 ? 64   HIS A CE1 1 
ATOM   456  N  NE2 . HIS A 1 64  ? 14.502  2.114   21.137  1.00 24.60 ? 64   HIS A NE2 1 
ATOM   457  N  N   . PRO A 1 65  ? 10.075  0.497   21.748  1.00 26.73 ? 65   PRO A N   1 
ATOM   458  C  CA  . PRO A 1 65  ? 9.162   0.931   22.819  1.00 26.12 ? 65   PRO A CA  1 
ATOM   459  C  C   . PRO A 1 65  ? 8.834   2.427   22.810  1.00 25.37 ? 65   PRO A C   1 
ATOM   460  O  O   . PRO A 1 65  ? 7.746   2.806   23.238  1.00 25.21 ? 65   PRO A O   1 
ATOM   461  C  CB  . PRO A 1 65  ? 9.911   0.548   24.107  1.00 26.32 ? 65   PRO A CB  1 
ATOM   462  C  CG  . PRO A 1 65  ? 11.317  0.301   23.687  1.00 26.39 ? 65   PRO A CG  1 
ATOM   463  C  CD  . PRO A 1 65  ? 11.233  -0.228  22.297  1.00 26.58 ? 65   PRO A CD  1 
ATOM   464  N  N   . ASN A 1 66  ? 9.738   3.259   22.294  1.00 24.60 ? 66   ASN A N   1 
ATOM   465  C  CA  . ASN A 1 66  ? 9.521   4.703   22.264  1.00 24.09 ? 66   ASN A CA  1 
ATOM   466  C  C   . ASN A 1 66  ? 9.194   5.286   20.887  1.00 23.92 ? 66   ASN A C   1 
ATOM   467  O  O   . ASN A 1 66  ? 9.304   6.496   20.668  1.00 23.76 ? 66   ASN A O   1 
ATOM   468  C  CB  . ASN A 1 66  ? 10.698  5.438   22.920  1.00 24.17 ? 66   ASN A CB  1 
ATOM   469  C  CG  . ASN A 1 66  ? 10.826  5.122   24.405  1.00 23.92 ? 66   ASN A CG  1 
ATOM   470  O  OD1 . ASN A 1 66  ? 11.895  4.743   24.873  1.00 23.23 ? 66   ASN A OD1 1 
ATOM   471  N  ND2 . ASN A 1 66  ? 9.730   5.265   25.144  1.00 23.23 ? 66   ASN A ND2 1 
ATOM   472  N  N   . ILE A 1 67  ? 8.785   4.418   19.967  1.00 23.96 ? 67   ILE A N   1 
ATOM   473  C  CA  . ILE A 1 67  ? 8.317   4.838   18.648  1.00 24.01 ? 67   ILE A CA  1 
ATOM   474  C  C   . ILE A 1 67  ? 6.963   4.183   18.450  1.00 24.76 ? 67   ILE A C   1 
ATOM   475  O  O   . ILE A 1 67  ? 6.820   2.995   18.675  1.00 25.07 ? 67   ILE A O   1 
ATOM   476  C  CB  . ILE A 1 67  ? 9.331   4.449   17.522  1.00 23.91 ? 67   ILE A CB  1 
ATOM   477  C  CG1 . ILE A 1 67  ? 10.605  5.301   17.642  1.00 22.70 ? 67   ILE A CG1 1 
ATOM   478  C  CG2 . ILE A 1 67  ? 8.700   4.583   16.119  1.00 23.03 ? 67   ILE A CG2 1 
ATOM   479  C  CD1 . ILE A 1 67  ? 11.819  4.753   16.924  1.00 23.34 ? 67   ILE A CD1 1 
ATOM   480  N  N   . VAL A 1 68  ? 5.963   4.964   18.059  1.00 25.83 ? 68   VAL A N   1 
ATOM   481  C  CA  . VAL A 1 68  ? 4.639   4.411   17.753  1.00 26.98 ? 68   VAL A CA  1 
ATOM   482  C  C   . VAL A 1 68  ? 4.733   3.215   16.806  1.00 27.36 ? 68   VAL A C   1 
ATOM   483  O  O   . VAL A 1 68  ? 5.359   3.293   15.748  1.00 27.15 ? 68   VAL A O   1 
ATOM   484  C  CB  . VAL A 1 68  ? 3.687   5.456   17.135  1.00 26.81 ? 68   VAL A CB  1 
ATOM   485  C  CG1 . VAL A 1 68  ? 2.289   4.866   17.012  1.00 26.63 ? 68   VAL A CG1 1 
ATOM   486  C  CG2 . VAL A 1 68  ? 3.640   6.696   17.985  1.00 27.44 ? 68   VAL A CG2 1 
ATOM   487  N  N   . ARG A 1 69  ? 4.086   2.122   17.200  1.00 28.66 ? 69   ARG A N   1 
ATOM   488  C  CA  . ARG A 1 69  ? 4.213   0.839   16.525  1.00 29.73 ? 69   ARG A CA  1 
ATOM   489  C  C   . ARG A 1 69  ? 3.169   0.639   15.425  1.00 30.33 ? 69   ARG A C   1 
ATOM   490  O  O   . ARG A 1 69  ? 1.997   0.961   15.600  1.00 30.43 ? 69   ARG A O   1 
ATOM   491  C  CB  . ARG A 1 69  ? 4.155   -0.287  17.559  1.00 29.80 ? 69   ARG A CB  1 
ATOM   492  C  CG  A ARG A 1 69  ? 4.369   -1.695  17.018  0.50 30.03 ? 69   ARG A CG  1 
ATOM   493  C  CG  B ARG A 1 69  ? 5.245   -1.334  17.364  0.50 30.15 ? 69   ARG A CG  1 
ATOM   494  C  CD  A ARG A 1 69  ? 4.696   -2.679  18.141  0.50 30.59 ? 69   ARG A CD  1 
ATOM   495  C  CD  B ARG A 1 69  ? 4.727   -2.617  16.735  0.50 30.78 ? 69   ARG A CD  1 
ATOM   496  N  NE  A ARG A 1 69  ? 6.137   -2.781  18.388  0.50 31.96 ? 69   ARG A NE  1 
ATOM   497  N  NE  B ARG A 1 69  ? 4.583   -3.680  17.730  0.50 30.87 ? 69   ARG A NE  1 
ATOM   498  C  CZ  A ARG A 1 69  ? 6.804   -2.114  19.327  0.50 31.91 ? 69   ARG A CZ  1 
ATOM   499  C  CZ  B ARG A 1 69  ? 4.074   -4.882  17.485  0.50 31.50 ? 69   ARG A CZ  1 
ATOM   500  N  NH1 A ARG A 1 69  ? 6.183   -1.283  20.154  0.50 32.28 ? 69   ARG A NH1 1 
ATOM   501  N  NH1 B ARG A 1 69  ? 3.641   -5.200  16.268  0.50 31.80 ? 69   ARG A NH1 1 
ATOM   502  N  NH2 A ARG A 1 69  ? 8.107   -2.291  19.449  0.50 32.33 ? 69   ARG A NH2 1 
ATOM   503  N  NH2 B ARG A 1 69  ? 3.993   -5.770  18.466  0.50 31.85 ? 69   ARG A NH2 1 
ATOM   504  N  N   . TYR A 1 70  ? 3.633   0.125   14.287  1.00 31.08 ? 70   TYR A N   1 
ATOM   505  C  CA  . TYR A 1 70  ? 2.783   -0.292  13.171  1.00 31.94 ? 70   TYR A CA  1 
ATOM   506  C  C   . TYR A 1 70  ? 2.331   -1.734  13.392  1.00 32.38 ? 70   TYR A C   1 
ATOM   507  O  O   . TYR A 1 70  ? 3.118   -2.577  13.838  1.00 32.65 ? 70   TYR A O   1 
ATOM   508  C  CB  . TYR A 1 70  ? 3.564   -0.160  11.859  1.00 31.80 ? 70   TYR A CB  1 
ATOM   509  C  CG  . TYR A 1 70  ? 2.978   -0.894  10.673  1.00 32.44 ? 70   TYR A CG  1 
ATOM   510  C  CD1 . TYR A 1 70  ? 3.473   -2.144  10.293  1.00 32.32 ? 70   TYR A CD1 1 
ATOM   511  C  CD2 . TYR A 1 70  ? 1.943   -0.338  9.921   1.00 32.03 ? 70   TYR A CD2 1 
ATOM   512  C  CE1 . TYR A 1 70  ? 2.947   -2.824  9.207   1.00 32.64 ? 70   TYR A CE1 1 
ATOM   513  C  CE2 . TYR A 1 70  ? 1.414   -1.013  8.828   1.00 32.63 ? 70   TYR A CE2 1 
ATOM   514  C  CZ  . TYR A 1 70  ? 1.921   -2.256  8.480   1.00 32.28 ? 70   TYR A CZ  1 
ATOM   515  O  OH  . TYR A 1 70  ? 1.411   -2.936  7.406   1.00 32.61 ? 70   TYR A OH  1 
ATOM   516  N  N   . TYR A 1 71  ? 1.067   -2.016  13.089  1.00 32.94 ? 71   TYR A N   1 
ATOM   517  C  CA  . TYR A 1 71  ? 0.538   -3.372  13.233  1.00 33.56 ? 71   TYR A CA  1 
ATOM   518  C  C   . TYR A 1 71  ? 0.118   -4.006  11.916  1.00 33.61 ? 71   TYR A C   1 
ATOM   519  O  O   . TYR A 1 71  ? 0.384   -5.193  11.670  1.00 33.66 ? 71   TYR A O   1 
ATOM   520  C  CB  . TYR A 1 71  ? -0.652  -3.390  14.197  1.00 33.90 ? 71   TYR A CB  1 
ATOM   521  C  CG  . TYR A 1 71  ? -0.264  -3.372  15.656  1.00 34.13 ? 71   TYR A CG  1 
ATOM   522  C  CD1 . TYR A 1 71  ? 0.082   -2.181  16.281  1.00 33.68 ? 71   TYR A CD1 1 
ATOM   523  C  CD2 . TYR A 1 71  ? -0.252  -4.551  16.413  1.00 34.56 ? 71   TYR A CD2 1 
ATOM   524  C  CE1 . TYR A 1 71  ? 0.441   -2.150  17.620  1.00 34.32 ? 71   TYR A CE1 1 
ATOM   525  C  CE2 . TYR A 1 71  ? 0.104   -4.533  17.766  1.00 34.90 ? 71   TYR A CE2 1 
ATOM   526  C  CZ  . TYR A 1 71  ? 0.451   -3.319  18.359  1.00 34.74 ? 71   TYR A CZ  1 
ATOM   527  O  OH  . TYR A 1 71  ? 0.803   -3.262  19.687  1.00 34.88 ? 71   TYR A OH  1 
ATOM   528  N  N   . ASP A 1 72  ? -0.545  -3.214  11.071  1.00 33.69 ? 72   ASP A N   1 
ATOM   529  C  CA  . ASP A 1 72  ? -1.309  -3.783  9.965   1.00 33.54 ? 72   ASP A CA  1 
ATOM   530  C  C   . ASP A 1 72  ? -1.672  -2.738  8.914   1.00 33.49 ? 72   ASP A C   1 
ATOM   531  O  O   . ASP A 1 72  ? -1.709  -1.542  9.204   1.00 33.49 ? 72   ASP A O   1 
ATOM   532  C  CB  . ASP A 1 72  ? -2.587  -4.410  10.538  1.00 33.54 ? 72   ASP A CB  1 
ATOM   533  C  CG  . ASP A 1 72  ? -3.196  -5.461  9.628   1.00 33.37 ? 72   ASP A CG  1 
ATOM   534  O  OD1 . ASP A 1 72  ? -2.448  -6.250  8.995   1.00 33.29 ? 72   ASP A OD1 1 
ATOM   535  O  OD2 . ASP A 1 72  ? -4.445  -5.504  9.575   1.00 33.32 ? 72   ASP A OD2 1 
ATOM   536  N  N   . ARG A 1 73  ? -1.928  -3.204  7.693   1.00 33.32 ? 73   ARG A N   1 
ATOM   537  C  CA  . ARG A 1 73  ? -2.438  -2.358  6.614   1.00 33.20 ? 73   ARG A CA  1 
ATOM   538  C  C   . ARG A 1 73  ? -3.608  -3.050  5.906   1.00 33.09 ? 73   ARG A C   1 
ATOM   539  O  O   . ARG A 1 73  ? -3.567  -4.255  5.657   1.00 33.04 ? 73   ARG A O   1 
ATOM   540  C  CB  . ARG A 1 73  ? -1.327  -1.987  5.620   1.00 33.15 ? 73   ARG A CB  1 
ATOM   541  C  CG  . ARG A 1 73  ? -0.674  -3.169  4.907   1.00 33.31 ? 73   ARG A CG  1 
ATOM   542  C  CD  . ARG A 1 73  ? 0.440   -2.718  3.976   1.00 33.34 ? 73   ARG A CD  1 
ATOM   543  N  N   . ILE A 1 74  ? -4.655  -2.283  5.609   1.00 32.93 ? 74   ILE A N   1 
ATOM   544  C  CA  . ILE A 1 74  ? -5.838  -2.806  4.930   1.00 32.74 ? 74   ILE A CA  1 
ATOM   545  C  C   . ILE A 1 74  ? -6.171  -1.934  3.726   1.00 32.66 ? 74   ILE A C   1 
ATOM   546  O  O   . ILE A 1 74  ? -6.135  -0.704  3.815   1.00 32.44 ? 74   ILE A O   1 
ATOM   547  C  CB  . ILE A 1 74  ? -7.079  -2.854  5.861   1.00 32.76 ? 74   ILE A CB  1 
ATOM   548  C  CG1 . ILE A 1 74  ? -6.758  -3.540  7.192   1.00 32.86 ? 74   ILE A CG1 1 
ATOM   549  C  CG2 . ILE A 1 74  ? -8.257  -3.550  5.168   1.00 32.89 ? 74   ILE A CG2 1 
ATOM   550  C  CD1 . ILE A 1 74  ? -7.547  -2.984  8.372   1.00 33.38 ? 74   ILE A CD1 1 
ATOM   551  N  N   . ILE A 1 75  ? -6.485  -2.582  2.606   1.00 32.51 ? 75   ILE A N   1 
ATOM   552  C  CA  . ILE A 1 75  ? -7.017  -1.904  1.424   1.00 32.49 ? 75   ILE A CA  1 
ATOM   553  C  C   . ILE A 1 75  ? -8.452  -2.388  1.182   1.00 32.64 ? 75   ILE A C   1 
ATOM   554  O  O   . ILE A 1 75  ? -8.706  -3.594  1.096   1.00 32.46 ? 75   ILE A O   1 
ATOM   555  C  CB  . ILE A 1 75  ? -6.115  -2.122  0.173   1.00 32.53 ? 75   ILE A CB  1 
ATOM   556  C  CG1 . ILE A 1 75  ? -4.817  -1.315  0.309   1.00 32.26 ? 75   ILE A CG1 1 
ATOM   557  C  CG2 . ILE A 1 75  ? -6.853  -1.734  -1.115  1.00 32.32 ? 75   ILE A CG2 1 
ATOM   558  C  CD1 . ILE A 1 75  ? -3.744  -1.648  -0.719  1.00 32.39 ? 75   ILE A CD1 1 
ATOM   559  N  N   . ASP A 1 76  ? -9.378  -1.433  1.091   1.00 32.81 ? 76   ASP A N   1 
ATOM   560  C  CA  . ASP A 1 76  ? -10.804 -1.718  0.950   1.00 33.01 ? 76   ASP A CA  1 
ATOM   561  C  C   . ASP A 1 76  ? -11.333 -1.230  -0.409  1.00 33.08 ? 76   ASP A C   1 
ATOM   562  O  O   . ASP A 1 76  ? -11.331 -0.024  -0.708  1.00 33.10 ? 76   ASP A O   1 
ATOM   563  C  CB  . ASP A 1 76  ? -11.585 -1.070  2.107   1.00 33.16 ? 76   ASP A CB  1 
ATOM   564  C  CG  . ASP A 1 76  ? -13.063 -1.479  2.153   1.00 33.56 ? 76   ASP A CG  1 
ATOM   565  O  OD1 . ASP A 1 76  ? -13.849 -1.269  1.112   1.00 33.92 ? 76   ASP A OD1 1 
ATOM   566  O  OD2 . ASP A 1 76  ? -13.455 -2.016  3.336   1.00 34.64 ? 76   ASP A OD2 1 
ATOM   567  N  N   . THR A 1 81  ? -10.388 3.251   0.064   1.00 29.02 ? 81   THR A N   1 
ATOM   568  C  CA  . THR A 1 81  ? -9.929  3.492   1.434   1.00 29.47 ? 81   THR A CA  1 
ATOM   569  C  C   . THR A 1 81  ? -8.722  2.624   1.809   1.00 29.43 ? 81   THR A C   1 
ATOM   570  O  O   . THR A 1 81  ? -8.677  1.431   1.493   1.00 29.36 ? 81   THR A O   1 
ATOM   571  C  CB  . THR A 1 81  ? -11.075 3.281   2.458   1.00 29.41 ? 81   THR A CB  1 
ATOM   572  O  OG1 . THR A 1 81  ? -12.189 4.111   2.108   1.00 29.83 ? 81   THR A OG1 1 
ATOM   573  C  CG2 . THR A 1 81  ? -10.627 3.639   3.864   1.00 29.67 ? 81   THR A CG2 1 
ATOM   574  N  N   . LEU A 1 82  ? -7.748  3.245   2.477   1.00 29.69 ? 82   LEU A N   1 
ATOM   575  C  CA  . LEU A 1 82  ? -6.578  2.560   3.023   1.00 29.68 ? 82   LEU A CA  1 
ATOM   576  C  C   . LEU A 1 82  ? -6.541  2.743   4.536   1.00 29.77 ? 82   LEU A C   1 
ATOM   577  O  O   . LEU A 1 82  ? -6.643  3.863   5.042   1.00 29.71 ? 82   LEU A O   1 
ATOM   578  C  CB  . LEU A 1 82  ? -5.285  3.092   2.384   1.00 29.69 ? 82   LEU A CB  1 
ATOM   579  C  CG  . LEU A 1 82  ? -3.917  2.800   3.024   1.00 30.01 ? 82   LEU A CG  1 
ATOM   580  C  CD1 . LEU A 1 82  ? -3.513  1.330   2.895   1.00 30.09 ? 82   LEU A CD1 1 
ATOM   581  C  CD2 . LEU A 1 82  ? -2.844  3.697   2.418   1.00 29.83 ? 82   LEU A CD2 1 
ATOM   582  N  N   . TYR A 1 83  ? -6.398  1.634   5.253   1.00 29.84 ? 83   TYR A N   1 
ATOM   583  C  CA  . TYR A 1 83  ? -6.327  1.658   6.705   1.00 29.79 ? 83   TYR A CA  1 
ATOM   584  C  C   . TYR A 1 83  ? -4.915  1.316   7.174   1.00 29.83 ? 83   TYR A C   1 
ATOM   585  O  O   . TYR A 1 83  ? -4.388  0.247   6.857   1.00 29.74 ? 83   TYR A O   1 
ATOM   586  C  CB  . TYR A 1 83  ? -7.324  0.670   7.316   1.00 29.99 ? 83   TYR A CB  1 
ATOM   587  C  CG  . TYR A 1 83  ? -8.775  0.870   6.918   1.00 30.13 ? 83   TYR A CG  1 
ATOM   588  C  CD1 . TYR A 1 83  ? -9.360  0.104   5.903   1.00 30.43 ? 83   TYR A CD1 1 
ATOM   589  C  CD2 . TYR A 1 83  ? -9.567  1.807   7.573   1.00 30.16 ? 83   TYR A CD2 1 
ATOM   590  C  CE1 . TYR A 1 83  ? -10.703 0.283   5.548   1.00 29.90 ? 83   TYR A CE1 1 
ATOM   591  C  CE2 . TYR A 1 83  ? -10.896 1.992   7.231   1.00 29.98 ? 83   TYR A CE2 1 
ATOM   592  C  CZ  . TYR A 1 83  ? -11.459 1.233   6.225   1.00 30.22 ? 83   TYR A CZ  1 
ATOM   593  O  OH  . TYR A 1 83  ? -12.777 1.444   5.911   1.00 30.80 ? 83   TYR A OH  1 
ATOM   594  N  N   . ILE A 1 84  ? -4.307  2.236   7.918   1.00 29.64 ? 84   ILE A N   1 
ATOM   595  C  CA  . ILE A 1 84  ? -3.005  2.000   8.540   1.00 29.56 ? 84   ILE A CA  1 
ATOM   596  C  C   . ILE A 1 84  ? -3.234  1.814   10.036  1.00 29.57 ? 84   ILE A C   1 
ATOM   597  O  O   . ILE A 1 84  ? -3.635  2.749   10.732  1.00 29.41 ? 84   ILE A O   1 
ATOM   598  C  CB  . ILE A 1 84  ? -2.007  3.159   8.282   1.00 29.56 ? 84   ILE A CB  1 
ATOM   599  C  CG1 . ILE A 1 84  ? -1.913  3.469   6.781   1.00 29.09 ? 84   ILE A CG1 1 
ATOM   600  C  CG2 . ILE A 1 84  ? -0.626  2.825   8.875   1.00 29.29 ? 84   ILE A CG2 1 
ATOM   601  C  CD1 . ILE A 1 84  ? -1.308  4.824   6.457   1.00 28.31 ? 84   ILE A CD1 1 
ATOM   602  N  N   . VAL A 1 85  ? -2.987  0.597   10.510  1.00 29.69 ? 85   VAL A N   1 
ATOM   603  C  CA  . VAL A 1 85  ? -3.327  0.190   11.869  1.00 29.94 ? 85   VAL A CA  1 
ATOM   604  C  C   . VAL A 1 85  ? -2.121  0.387   12.781  1.00 30.48 ? 85   VAL A C   1 
ATOM   605  O  O   . VAL A 1 85  ? -1.081  -0.250  12.595  1.00 30.19 ? 85   VAL A O   1 
ATOM   606  C  CB  . VAL A 1 85  ? -3.835  -1.284  11.906  1.00 30.01 ? 85   VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 85  ? -3.960  -1.810  13.338  1.00 29.40 ? 85   VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 85  ? -5.167  -1.416  11.158  1.00 29.60 ? 85   VAL A CG2 1 
ATOM   609  N  N   . MET A 1 86  ? -2.278  1.291   13.751  1.00 31.15 ? 86   MET A N   1 
ATOM   610  C  CA  . MET A 1 86  ? -1.203  1.679   14.663  1.00 31.61 ? 86   MET A CA  1 
ATOM   611  C  C   . MET A 1 86  ? -1.527  1.375   16.117  1.00 31.60 ? 86   MET A C   1 
ATOM   612  O  O   . MET A 1 86  ? -2.662  1.089   16.482  1.00 31.37 ? 86   MET A O   1 
ATOM   613  C  CB  . MET A 1 86  ? -0.902  3.188   14.566  1.00 31.98 ? 86   MET A CB  1 
ATOM   614  C  CG  . MET A 1 86  ? -0.582  3.744   13.181  1.00 33.53 ? 86   MET A CG  1 
ATOM   615  S  SD  . MET A 1 86  ? 0.898   3.027   12.463  1.00 37.31 ? 86   MET A SD  1 
ATOM   616  C  CE  . MET A 1 86  ? 2.205   3.786   13.434  1.00 37.67 ? 86   MET A CE  1 
ATOM   617  N  N   . GLU A 1 87  ? -0.494  1.481   16.942  1.00 31.96 ? 87   GLU A N   1 
ATOM   618  C  CA  . GLU A 1 87  ? -0.610  1.511   18.381  1.00 32.36 ? 87   GLU A CA  1 
ATOM   619  C  C   . GLU A 1 87  ? -1.567  2.626   18.823  1.00 31.67 ? 87   GLU A C   1 
ATOM   620  O  O   . GLU A 1 87  ? -1.553  3.721   18.263  1.00 30.98 ? 87   GLU A O   1 
ATOM   621  C  CB  . GLU A 1 87  ? 0.777   1.810   18.938  1.00 32.92 ? 87   GLU A CB  1 
ATOM   622  C  CG  . GLU A 1 87  ? 0.970   1.527   20.388  1.00 35.41 ? 87   GLU A CG  1 
ATOM   623  C  CD  . GLU A 1 87  ? 2.255   2.114   20.895  1.00 38.80 ? 87   GLU A CD  1 
ATOM   624  O  OE1 . GLU A 1 87  ? 3.227   2.210   20.110  1.00 39.58 ? 87   GLU A OE1 1 
ATOM   625  O  OE2 . GLU A 1 87  ? 2.287   2.491   22.081  1.00 41.22 ? 87   GLU A OE2 1 
ATOM   626  N  N   . TYR A 1 88  ? -2.386  2.320   19.828  1.00 31.34 ? 88   TYR A N   1 
ATOM   627  C  CA  . TYR A 1 88  ? -3.222  3.298   20.511  1.00 31.06 ? 88   TYR A CA  1 
ATOM   628  C  C   . TYR A 1 88  ? -2.460  3.990   21.646  1.00 31.30 ? 88   TYR A C   1 
ATOM   629  O  O   . TYR A 1 88  ? -1.876  3.330   22.515  1.00 31.36 ? 88   TYR A O   1 
ATOM   630  C  CB  . TYR A 1 88  ? -4.477  2.620   21.062  1.00 30.92 ? 88   TYR A CB  1 
ATOM   631  C  CG  . TYR A 1 88  ? -5.385  3.530   21.862  1.00 30.54 ? 88   TYR A CG  1 
ATOM   632  C  CD1 . TYR A 1 88  ? -5.932  4.683   21.293  1.00 30.54 ? 88   TYR A CD1 1 
ATOM   633  C  CD2 . TYR A 1 88  ? -5.711  3.229   23.183  1.00 29.56 ? 88   TYR A CD2 1 
ATOM   634  C  CE1 . TYR A 1 88  ? -6.764  5.523   22.023  1.00 30.27 ? 88   TYR A CE1 1 
ATOM   635  C  CE2 . TYR A 1 88  ? -6.547  4.059   23.920  1.00 30.01 ? 88   TYR A CE2 1 
ATOM   636  C  CZ  . TYR A 1 88  ? -7.071  5.201   23.336  1.00 30.24 ? 88   TYR A CZ  1 
ATOM   637  O  OH  . TYR A 1 88  ? -7.905  6.021   24.063  1.00 29.79 ? 88   TYR A OH  1 
ATOM   638  N  N   . CYS A 1 89  ? -2.488  5.321   21.627  1.00 31.05 ? 89   CYS A N   1 
ATOM   639  C  CA  . CYS A 1 89  ? -1.815  6.155   22.615  1.00 30.81 ? 89   CYS A CA  1 
ATOM   640  C  C   . CYS A 1 89  ? -2.853  6.938   23.413  1.00 30.55 ? 89   CYS A C   1 
ATOM   641  O  O   . CYS A 1 89  ? -3.214  8.060   23.060  1.00 30.74 ? 89   CYS A O   1 
ATOM   642  C  CB  . CYS A 1 89  ? -0.832  7.101   21.920  1.00 30.83 ? 89   CYS A CB  1 
ATOM   643  S  SG  . CYS A 1 89  ? 0.448   6.236   20.988  1.00 32.60 ? 89   CYS A SG  1 
ATOM   644  N  N   . GLU A 1 90  ? -3.326  6.317   24.489  1.00 30.41 ? 90   GLU A N   1 
ATOM   645  C  CA  . GLU A 1 90  ? -4.402  6.827   25.342  1.00 30.41 ? 90   GLU A CA  1 
ATOM   646  C  C   . GLU A 1 90  ? -4.229  8.294   25.771  1.00 29.61 ? 90   GLU A C   1 
ATOM   647  O  O   . GLU A 1 90  ? -5.184  9.064   25.764  1.00 29.57 ? 90   GLU A O   1 
ATOM   648  C  CB  . GLU A 1 90  ? -4.501  5.936   26.582  1.00 30.12 ? 90   GLU A CB  1 
ATOM   649  C  CG  . GLU A 1 90  ? -5.814  6.003   27.314  1.00 31.20 ? 90   GLU A CG  1 
ATOM   650  C  CD  . GLU A 1 90  ? -5.781  5.259   28.638  1.00 31.91 ? 90   GLU A CD  1 
ATOM   651  O  OE1 . GLU A 1 90  ? -4.852  4.448   28.873  1.00 33.57 ? 90   GLU A OE1 1 
ATOM   652  O  OE2 . GLU A 1 90  ? -6.691  5.489   29.457  1.00 34.85 ? 90   GLU A OE2 1 
ATOM   653  N  N   . GLY A 1 91  ? -3.010  8.666   26.148  1.00 29.05 ? 91   GLY A N   1 
ATOM   654  C  CA  . GLY A 1 91  ? -2.727  10.020  26.636  1.00 28.87 ? 91   GLY A CA  1 
ATOM   655  C  C   . GLY A 1 91  ? -2.689  11.107  25.567  1.00 28.26 ? 91   GLY A C   1 
ATOM   656  O  O   . GLY A 1 91  ? -2.514  12.281  25.891  1.00 28.27 ? 91   GLY A O   1 
ATOM   657  N  N   . GLY A 1 92  ? -2.833  10.715  24.300  1.00 27.95 ? 92   GLY A N   1 
ATOM   658  C  CA  . GLY A 1 92  ? -2.871  11.667  23.185  1.00 27.92 ? 92   GLY A CA  1 
ATOM   659  C  C   . GLY A 1 92  ? -1.505  12.274  22.890  1.00 28.03 ? 92   GLY A C   1 
ATOM   660  O  O   . GLY A 1 92  ? -0.474  11.717  23.248  1.00 27.12 ? 92   GLY A O   1 
ATOM   661  N  N   . ASP A 1 93  ? -1.506  13.436  22.253  1.00 28.04 ? 93   ASP A N   1 
ATOM   662  C  CA  . ASP A 1 93  ? -0.269  14.067  21.808  1.00 28.80 ? 93   ASP A CA  1 
ATOM   663  C  C   . ASP A 1 93  ? 0.269   15.110  22.805  1.00 28.80 ? 93   ASP A C   1 
ATOM   664  O  O   . ASP A 1 93  ? -0.453  15.568  23.687  1.00 28.99 ? 93   ASP A O   1 
ATOM   665  C  CB  . ASP A 1 93  ? -0.516  14.726  20.460  1.00 28.72 ? 93   ASP A CB  1 
ATOM   666  C  CG  . ASP A 1 93  ? -1.554  15.821  20.546  1.00 30.23 ? 93   ASP A CG  1 
ATOM   667  O  OD1 . ASP A 1 93  ? -2.766  15.538  20.771  1.00 31.62 ? 93   ASP A OD1 1 
ATOM   668  O  OD2 . ASP A 1 93  ? -1.142  16.976  20.406  1.00 33.11 ? 93   ASP A OD2 1 
ATOM   669  N  N   . LEU A 1 94  ? 1.531   15.492  22.641  1.00 28.89 ? 94   LEU A N   1 
ATOM   670  C  CA  . LEU A 1 94  ? 2.155   16.497  23.498  1.00 29.22 ? 94   LEU A CA  1 
ATOM   671  C  C   . LEU A 1 94  ? 1.675   17.931  23.287  1.00 29.16 ? 94   LEU A C   1 
ATOM   672  O  O   . LEU A 1 94  ? 1.761   18.746  24.207  1.00 29.54 ? 94   LEU A O   1 
ATOM   673  C  CB  . LEU A 1 94  ? 3.670   16.477  23.355  1.00 28.87 ? 94   LEU A CB  1 
ATOM   674  C  CG  . LEU A 1 94  ? 4.532   15.721  24.357  1.00 31.71 ? 94   LEU A CG  1 
ATOM   675  C  CD1 . LEU A 1 94  ? 5.977   16.163  24.151  1.00 31.73 ? 94   LEU A CD1 1 
ATOM   676  C  CD2 . LEU A 1 94  ? 4.097   15.940  25.813  1.00 29.81 ? 94   LEU A CD2 1 
ATOM   677  N  N   . ALA A 1 95  ? 1.214   18.257  22.084  1.00 28.77 ? 95   ALA A N   1 
ATOM   678  C  CA  . ALA A 1 95  ? 0.724   19.604  21.807  1.00 28.81 ? 95   ALA A CA  1 
ATOM   679  C  C   . ALA A 1 95  ? -0.493  19.938  22.679  1.00 28.72 ? 95   ALA A C   1 
ATOM   680  O  O   . ALA A 1 95  ? -0.640  21.072  23.136  1.00 28.57 ? 95   ALA A O   1 
ATOM   681  C  CB  . ALA A 1 95  ? 0.381   19.761  20.319  1.00 29.26 ? 95   ALA A CB  1 
ATOM   682  N  N   . SER A 1 96  ? -1.360  18.941  22.880  1.00 28.04 ? 96   SER A N   1 
ATOM   683  C  CA  . SER A 1 96  ? -2.545  19.070  23.716  1.00 27.77 ? 96   SER A CA  1 
ATOM   684  C  C   . SER A 1 96  ? -2.198  19.213  25.195  1.00 27.81 ? 96   SER A C   1 
ATOM   685  O  O   . SER A 1 96  ? -2.873  19.914  25.918  1.00 27.99 ? 96   SER A O   1 
ATOM   686  C  CB  . SER A 1 96  ? -3.468  17.873  23.506  1.00 27.68 ? 96   SER A CB  1 
ATOM   687  O  OG  . SER A 1 96  ? -3.888  17.797  22.153  1.00 27.73 ? 96   SER A OG  1 
ATOM   688  N  N   . VAL A 1 97  ? -1.148  18.532  25.633  1.00 27.99 ? 97   VAL A N   1 
ATOM   689  C  CA  . VAL A 1 97  ? -0.641  18.642  26.998  1.00 28.83 ? 97   VAL A CA  1 
ATOM   690  C  C   . VAL A 1 97  ? -0.184  20.087  27.293  1.00 29.30 ? 97   VAL A C   1 
ATOM   691  O  O   . VAL A 1 97  ? -0.524  20.650  28.341  1.00 29.31 ? 97   VAL A O   1 
ATOM   692  C  CB  . VAL A 1 97  ? 0.509   17.602  27.227  1.00 29.50 ? 97   VAL A CB  1 
ATOM   693  C  CG1 . VAL A 1 97  ? 1.340   17.917  28.448  1.00 28.48 ? 97   VAL A CG1 1 
ATOM   694  C  CG2 . VAL A 1 97  ? -0.090  16.167  27.295  1.00 28.60 ? 97   VAL A CG2 1 
ATOM   695  N  N   . ILE A 1 98  ? 0.569   20.666  26.354  1.00 29.21 ? 98   ILE A N   1 
ATOM   696  C  CA  . ILE A 1 98  ? 1.026   22.055  26.407  1.00 29.49 ? 98   ILE A CA  1 
ATOM   697  C  C   . ILE A 1 98  ? -0.146  23.054  26.416  1.00 29.96 ? 98   ILE A C   1 
ATOM   698  O  O   . ILE A 1 98  ? -0.176  23.979  27.238  1.00 29.92 ? 98   ILE A O   1 
ATOM   699  C  CB  . ILE A 1 98  ? 2.017   22.347  25.241  1.00 29.48 ? 98   ILE A CB  1 
ATOM   700  C  CG1 . ILE A 1 98  ? 3.330   21.592  25.486  1.00 30.42 ? 98   ILE A CG1 1 
ATOM   701  C  CG2 . ILE A 1 98  ? 2.252   23.854  25.054  1.00 29.10 ? 98   ILE A CG2 1 
ATOM   702  C  CD1 . ILE A 1 98  ? 4.229   21.446  24.268  1.00 29.20 ? 98   ILE A CD1 1 
ATOM   703  N  N   . THR A 1 99  ? -1.094  22.840  25.503  1.00 29.76 ? 99   THR A N   1 
ATOM   704  C  CA  . THR A 1 99  ? -2.346  23.587  25.416  1.00 30.33 ? 99   THR A CA  1 
ATOM   705  C  C   . THR A 1 99  ? -3.146  23.545  26.724  1.00 30.52 ? 99   THR A C   1 
ATOM   706  O  O   . THR A 1 99  ? -3.665  24.566  27.161  1.00 30.48 ? 99   THR A O   1 
ATOM   707  C  CB  . THR A 1 99  ? -3.222  23.031  24.264  1.00 30.01 ? 99   THR A CB  1 
ATOM   708  O  OG1 . THR A 1 99  ? -2.655  23.418  23.012  1.00 31.31 ? 99   THR A OG1 1 
ATOM   709  C  CG2 . THR A 1 99  ? -4.650  23.554  24.339  1.00 30.83 ? 99   THR A CG2 1 
ATOM   710  N  N   . LYS A 1 100 ? -3.257  22.357  27.320  1.00 30.58 ? 100  LYS A N   1 
ATOM   711  C  CA  . LYS A 1 100 ? -3.898  22.177  28.618  1.00 30.95 ? 100  LYS A CA  1 
ATOM   712  C  C   . LYS A 1 100 ? -3.131  22.870  29.762  1.00 31.00 ? 100  LYS A C   1 
ATOM   713  O  O   . LYS A 1 100 ? -3.745  23.423  30.676  1.00 30.98 ? 100  LYS A O   1 
ATOM   714  C  CB  . LYS A 1 100 ? -4.059  20.688  28.921  1.00 30.99 ? 100  LYS A CB  1 
ATOM   715  C  CG  . LYS A 1 100 ? -4.843  20.381  30.186  1.00 32.01 ? 100  LYS A CG  1 
ATOM   716  C  CD  . LYS A 1 100 ? -4.625  18.940  30.641  1.00 32.69 ? 100  LYS A CD  1 
ATOM   717  C  CE  . LYS A 1 100 ? -5.698  18.521  31.633  1.00 34.66 ? 100  LYS A CE  1 
ATOM   718  N  N   . GLY A 1 101 ? -1.802  22.821  29.711  1.00 30.82 ? 101  GLY A N   1 
ATOM   719  C  CA  . GLY A 1 101 ? -0.962  23.520  30.687  1.00 31.15 ? 101  GLY A CA  1 
ATOM   720  C  C   . GLY A 1 101 ? -1.197  25.023  30.670  1.00 31.35 ? 101  GLY A C   1 
ATOM   721  O  O   . GLY A 1 101 ? -1.396  25.635  31.716  1.00 31.65 ? 101  GLY A O   1 
ATOM   722  N  N   . THR A 1 102 ? -1.185  25.604  29.473  1.00 31.52 ? 102  THR A N   1 
ATOM   723  C  CA  . THR A 1 102 ? -1.494  27.014  29.256  1.00 31.93 ? 102  THR A CA  1 
ATOM   724  C  C   . THR A 1 102 ? -2.890  27.356  29.779  1.00 32.56 ? 102  THR A C   1 
ATOM   725  O  O   . THR A 1 102 ? -3.064  28.351  30.482  1.00 32.50 ? 102  THR A O   1 
ATOM   726  C  CB  . THR A 1 102 ? -1.402  27.381  27.751  1.00 31.69 ? 102  THR A CB  1 
ATOM   727  O  OG1 . THR A 1 102 ? -0.064  27.171  27.285  1.00 31.65 ? 102  THR A OG1 1 
ATOM   728  C  CG2 . THR A 1 102 ? -1.789  28.840  27.503  1.00 30.86 ? 102  THR A CG2 1 
ATOM   729  N  N   . LYS A 1 103 ? -3.867  26.518  29.421  1.00 33.27 ? 103  LYS A N   1 
ATOM   730  C  CA  . LYS A 1 103 ? -5.270  26.684  29.787  1.00 34.11 ? 103  LYS A CA  1 
ATOM   731  C  C   . LYS A 1 103 ? -5.490  26.629  31.301  1.00 34.33 ? 103  LYS A C   1 
ATOM   732  O  O   . LYS A 1 103 ? -6.185  27.468  31.870  1.00 34.23 ? 103  LYS A O   1 
ATOM   733  C  CB  . LYS A 1 103 ? -6.104  25.603  29.088  1.00 34.08 ? 103  LYS A CB  1 
ATOM   734  C  CG  . LYS A 1 103 ? -7.604  25.729  29.257  1.00 34.84 ? 103  LYS A CG  1 
ATOM   735  C  CD  . LYS A 1 103 ? -8.316  24.469  28.767  1.00 35.20 ? 103  LYS A CD  1 
ATOM   736  C  CE  . LYS A 1 103 ? -8.509  23.429  29.884  1.00 36.68 ? 103  LYS A CE  1 
ATOM   737  N  NZ  . LYS A 1 103 ? -9.797  23.665  30.626  1.00 36.28 ? 103  LYS A NZ  1 
ATOM   738  N  N   . GLU A 1 104 ? -4.891  25.641  31.951  1.00 34.85 ? 104  GLU A N   1 
ATOM   739  C  CA  . GLU A 1 104 ? -5.061  25.484  33.388  1.00 35.73 ? 104  GLU A CA  1 
ATOM   740  C  C   . GLU A 1 104 ? -4.081  26.294  34.246  1.00 35.90 ? 104  GLU A C   1 
ATOM   741  O  O   . GLU A 1 104 ? -4.166  26.274  35.474  1.00 36.18 ? 104  GLU A O   1 
ATOM   742  C  CB  . GLU A 1 104 ? -5.083  24.000  33.755  1.00 35.70 ? 104  GLU A CB  1 
ATOM   743  C  CG  . GLU A 1 104 ? -6.514  23.440  33.641  1.00 38.27 ? 104  GLU A CG  1 
ATOM   744  C  CD  . GLU A 1 104 ? -6.579  21.950  33.372  1.00 40.20 ? 104  GLU A CD  1 
ATOM   745  O  OE1 . GLU A 1 104 ? -5.574  21.251  33.615  1.00 41.01 ? 104  GLU A OE1 1 
ATOM   746  O  OE2 . GLU A 1 104 ? -7.649  21.484  32.914  1.00 40.92 ? 104  GLU A OE2 1 
ATOM   747  N  N   . ARG A 1 105 ? -3.196  27.044  33.587  1.00 35.95 ? 105  ARG A N   1 
ATOM   748  C  CA  . ARG A 1 105 ? -2.202  27.899  34.251  1.00 36.26 ? 105  ARG A CA  1 
ATOM   749  C  C   . ARG A 1 105 ? -1.336  27.050  35.170  1.00 35.87 ? 105  ARG A C   1 
ATOM   750  O  O   . ARG A 1 105 ? -1.144  27.365  36.347  1.00 35.86 ? 105  ARG A O   1 
ATOM   751  C  CB  . ARG A 1 105 ? -2.867  29.047  35.028  1.00 36.31 ? 105  ARG A CB  1 
ATOM   752  C  CG  . ARG A 1 105 ? -3.878  29.881  34.236  1.00 37.92 ? 105  ARG A CG  1 
ATOM   753  C  CD  . ARG A 1 105 ? -3.269  30.482  32.979  1.00 40.38 ? 105  ARG A CD  1 
ATOM   754  N  NE  . ARG A 1 105 ? -2.127  31.343  33.272  1.00 42.73 ? 105  ARG A NE  1 
ATOM   755  C  CZ  . ARG A 1 105 ? -2.121  32.663  33.130  1.00 44.17 ? 105  ARG A CZ  1 
ATOM   756  N  NH1 . ARG A 1 105 ? -3.202  33.298  32.688  1.00 45.13 ? 105  ARG A NH1 1 
ATOM   757  N  NH2 . ARG A 1 105 ? -1.024  33.352  33.422  1.00 45.13 ? 105  ARG A NH2 1 
ATOM   758  N  N   . GLN A 1 106 ? -0.834  25.958  34.613  1.00 35.61 ? 106  GLN A N   1 
ATOM   759  C  CA  . GLN A 1 106 ? -0.120  24.956  35.378  1.00 35.73 ? 106  GLN A CA  1 
ATOM   760  C  C   . GLN A 1 106 ? 1.082   24.440  34.593  1.00 34.93 ? 106  GLN A C   1 
ATOM   761  O  O   . GLN A 1 106 ? 0.913   23.780  33.568  1.00 34.82 ? 106  GLN A O   1 
ATOM   762  C  CB  . GLN A 1 106 ? -1.081  23.812  35.721  1.00 35.95 ? 106  GLN A CB  1 
ATOM   763  C  CG  . GLN A 1 106 ? -0.461  22.679  36.511  1.00 38.77 ? 106  GLN A CG  1 
ATOM   764  C  CD  . GLN A 1 106 ? -0.097  23.085  37.917  1.00 40.43 ? 106  GLN A CD  1 
ATOM   765  O  OE1 . GLN A 1 106 ? -0.970  23.273  38.765  1.00 42.29 ? 106  GLN A OE1 1 
ATOM   766  N  NE2 . GLN A 1 106 ? 1.200   23.218  38.178  1.00 40.68 ? 106  GLN A NE2 1 
ATOM   767  N  N   . TYR A 1 107 ? 2.284   24.764  35.068  1.00 34.24 ? 107  TYR A N   1 
ATOM   768  C  CA  . TYR A 1 107 ? 3.512   24.184  34.527  1.00 34.00 ? 107  TYR A CA  1 
ATOM   769  C  C   . TYR A 1 107 ? 3.597   22.678  34.816  1.00 33.82 ? 107  TYR A C   1 
ATOM   770  O  O   . TYR A 1 107 ? 3.200   22.213  35.895  1.00 34.35 ? 107  TYR A O   1 
ATOM   771  C  CB  . TYR A 1 107 ? 4.764   24.871  35.080  1.00 33.18 ? 107  TYR A CB  1 
ATOM   772  C  CG  . TYR A 1 107 ? 5.019   26.282  34.574  1.00 33.77 ? 107  TYR A CG  1 
ATOM   773  C  CD1 . TYR A 1 107 ? 5.288   27.329  35.474  1.00 31.43 ? 107  TYR A CD1 1 
ATOM   774  C  CD2 . TYR A 1 107 ? 4.990   26.576  33.208  1.00 32.54 ? 107  TYR A CD2 1 
ATOM   775  C  CE1 . TYR A 1 107 ? 5.514   28.620  35.029  1.00 31.55 ? 107  TYR A CE1 1 
ATOM   776  C  CE2 . TYR A 1 107 ? 5.197   27.870  32.752  1.00 33.14 ? 107  TYR A CE2 1 
ATOM   777  C  CZ  . TYR A 1 107 ? 5.465   28.889  33.665  1.00 33.53 ? 107  TYR A CZ  1 
ATOM   778  O  OH  . TYR A 1 107 ? 5.697   30.173  33.207  1.00 32.62 ? 107  TYR A OH  1 
ATOM   779  N  N   . LEU A 1 108 ? 4.117   21.943  33.842  1.00 33.70 ? 108  LEU A N   1 
ATOM   780  C  CA  . LEU A 1 108 ? 4.342   20.494  33.931  1.00 33.93 ? 108  LEU A CA  1 
ATOM   781  C  C   . LEU A 1 108 ? 5.438   20.156  34.939  1.00 33.84 ? 108  LEU A C   1 
ATOM   782  O  O   . LEU A 1 108 ? 6.455   20.854  35.003  1.00 33.41 ? 108  LEU A O   1 
ATOM   783  C  CB  . LEU A 1 108 ? 4.761   19.948  32.553  1.00 34.09 ? 108  LEU A CB  1 
ATOM   784  C  CG  . LEU A 1 108 ? 3.705   19.712  31.463  1.00 34.97 ? 108  LEU A CG  1 
ATOM   785  C  CD1 . LEU A 1 108 ? 2.595   18.813  31.991  1.00 36.57 ? 108  LEU A CD1 1 
ATOM   786  C  CD2 . LEU A 1 108 ? 3.111   20.987  30.951  1.00 35.13 ? 108  LEU A CD2 1 
ATOM   787  N  N   . ASP A 1 109 ? 5.207   19.103  35.724  1.00 33.52 ? 109  ASP A N   1 
ATOM   788  C  CA  . ASP A 1 109 ? 6.209   18.523  36.638  1.00 33.98 ? 109  ASP A CA  1 
ATOM   789  C  C   . ASP A 1 109 ? 7.535   18.301  35.917  1.00 33.20 ? 109  ASP A C   1 
ATOM   790  O  O   . ASP A 1 109 ? 7.540   17.864  34.772  1.00 33.65 ? 109  ASP A O   1 
ATOM   791  C  CB  . ASP A 1 109 ? 5.680   17.178  37.179  1.00 34.36 ? 109  ASP A CB  1 
ATOM   792  C  CG  A ASP A 1 109 ? 4.442   17.339  38.041  0.50 35.70 ? 109  ASP A CG  1 
ATOM   793  C  CG  B ASP A 1 109 ? 6.457   16.648  38.396  0.50 34.83 ? 109  ASP A CG  1 
ATOM   794  O  OD1 A ASP A 1 109 ? 4.033   18.492  38.315  0.50 38.68 ? 109  ASP A OD1 1 
ATOM   795  O  OD1 B ASP A 1 109 ? 7.638   17.000  38.636  0.50 34.61 ? 109  ASP A OD1 1 
ATOM   796  O  OD2 A ASP A 1 109 ? 3.875   16.310  38.452  0.50 38.16 ? 109  ASP A OD2 1 
ATOM   797  O  OD2 B ASP A 1 109 ? 5.864   15.823  39.117  0.50 36.77 ? 109  ASP A OD2 1 
ATOM   798  N  N   . GLU A 1 110 ? 8.648   18.607  36.583  1.00 32.38 ? 110  GLU A N   1 
ATOM   799  C  CA  . GLU A 1 110 ? 9.986   18.315  36.054  1.00 31.92 ? 110  GLU A CA  1 
ATOM   800  C  C   . GLU A 1 110 ? 10.163  16.831  35.729  1.00 31.39 ? 110  GLU A C   1 
ATOM   801  O  O   . GLU A 1 110 ? 10.835  16.485  34.749  1.00 31.32 ? 110  GLU A O   1 
ATOM   802  C  CB  . GLU A 1 110 ? 11.093  18.795  37.015  1.00 31.50 ? 110  GLU A CB  1 
ATOM   803  C  CG  . GLU A 1 110 ? 12.526  18.405  36.572  1.00 32.28 ? 110  GLU A CG  1 
ATOM   804  C  CD  . GLU A 1 110 ? 13.630  19.366  37.042  1.00 32.70 ? 110  GLU A CD  1 
ATOM   805  O  OE1 . GLU A 1 110 ? 13.321  20.507  37.461  1.00 33.20 ? 110  GLU A OE1 1 
ATOM   806  O  OE2 . GLU A 1 110 ? 14.823  18.978  36.975  1.00 32.25 ? 110  GLU A OE2 1 
ATOM   807  N  N   . GLU A 1 111 ? 9.556   15.968  36.543  1.00 30.97 ? 111  GLU A N   1 
ATOM   808  C  CA  . GLU A 1 111 ? 9.613   14.511  36.350  1.00 31.39 ? 111  GLU A CA  1 
ATOM   809  C  C   . GLU A 1 111 ? 9.034   14.071  35.007  1.00 30.75 ? 111  GLU A C   1 
ATOM   810  O  O   . GLU A 1 111 ? 9.575   13.167  34.369  1.00 30.49 ? 111  GLU A O   1 
ATOM   811  C  CB  . GLU A 1 111 ? 8.901   13.776  37.497  1.00 31.63 ? 111  GLU A CB  1 
ATOM   812  C  CG  . GLU A 1 111 ? 9.714   13.725  38.809  1.00 34.71 ? 111  GLU A CG  1 
ATOM   813  C  CD  . GLU A 1 111 ? 10.893  12.755  38.716  1.00 39.08 ? 111  GLU A CD  1 
ATOM   814  O  OE1 . GLU A 1 111 ? 10.682  11.559  39.027  1.00 39.03 ? 111  GLU A OE1 1 
ATOM   815  O  OE2 . GLU A 1 111 ? 12.017  13.185  38.329  1.00 38.15 ? 111  GLU A OE2 1 
ATOM   816  N  N   . PHE A 1 112 ? 7.931   14.700  34.595  1.00 30.21 ? 112  PHE A N   1 
ATOM   817  C  CA  . PHE A 1 112 ? 7.348   14.444  33.278  1.00 29.62 ? 112  PHE A CA  1 
ATOM   818  C  C   . PHE A 1 112 ? 8.281   14.939  32.181  1.00 29.56 ? 112  PHE A C   1 
ATOM   819  O  O   . PHE A 1 112 ? 8.451   14.276  31.171  1.00 29.78 ? 112  PHE A O   1 
ATOM   820  C  CB  . PHE A 1 112 ? 5.976   15.097  33.139  1.00 29.86 ? 112  PHE A CB  1 
ATOM   821  C  CG  . PHE A 1 112 ? 5.363   14.941  31.762  1.00 29.63 ? 112  PHE A CG  1 
ATOM   822  C  CD1 . PHE A 1 112 ? 4.805   13.719  31.365  1.00 29.22 ? 112  PHE A CD1 1 
ATOM   823  C  CD2 . PHE A 1 112 ? 5.359   16.007  30.867  1.00 25.34 ? 112  PHE A CD2 1 
ATOM   824  C  CE1 . PHE A 1 112 ? 4.245   13.574  30.089  1.00 29.85 ? 112  PHE A CE1 1 
ATOM   825  C  CE2 . PHE A 1 112 ? 4.789   15.869  29.598  1.00 27.90 ? 112  PHE A CE2 1 
ATOM   826  C  CZ  . PHE A 1 112 ? 4.238   14.655  29.207  1.00 27.54 ? 112  PHE A CZ  1 
ATOM   827  N  N   . VAL A 1 113 ? 8.896   16.102  32.385  1.00 29.41 ? 113  VAL A N   1 
ATOM   828  C  CA  . VAL A 1 113 ? 9.783   16.645  31.376  1.00 29.21 ? 113  VAL A CA  1 
ATOM   829  C  C   . VAL A 1 113 ? 10.992  15.717  31.218  1.00 28.91 ? 113  VAL A C   1 
ATOM   830  O  O   . VAL A 1 113 ? 11.466  15.523  30.115  1.00 29.46 ? 113  VAL A O   1 
ATOM   831  C  CB  . VAL A 1 113 ? 10.229  18.110  31.676  1.00 28.97 ? 113  VAL A CB  1 
ATOM   832  C  CG1 . VAL A 1 113 ? 11.169  18.618  30.565  1.00 28.91 ? 113  VAL A CG1 1 
ATOM   833  C  CG2 . VAL A 1 113 ? 9.005   19.039  31.823  1.00 28.44 ? 113  VAL A CG2 1 
ATOM   834  N  N   . LEU A 1 114 ? 11.470  15.147  32.321  1.00 28.85 ? 114  LEU A N   1 
ATOM   835  C  CA  . LEU A 1 114 ? 12.608  14.209  32.290  1.00 29.11 ? 114  LEU A CA  1 
ATOM   836  C  C   . LEU A 1 114 ? 12.267  12.901  31.602  1.00 28.90 ? 114  LEU A C   1 
ATOM   837  O  O   . LEU A 1 114 ? 13.101  12.329  30.910  1.00 29.10 ? 114  LEU A O   1 
ATOM   838  C  CB  . LEU A 1 114 ? 13.174  13.961  33.698  1.00 28.77 ? 114  LEU A CB  1 
ATOM   839  C  CG  . LEU A 1 114 ? 13.858  15.151  34.418  1.00 28.94 ? 114  LEU A CG  1 
ATOM   840  C  CD1 . LEU A 1 114 ? 14.290  14.784  35.840  1.00 26.54 ? 114  LEU A CD1 1 
ATOM   841  C  CD2 . LEU A 1 114 ? 15.058  15.706  33.652  1.00 28.92 ? 114  LEU A CD2 1 
ATOM   842  N  N   . ARG A 1 115 ? 11.033  12.436  31.769  1.00 29.47 ? 115  ARG A N   1 
ATOM   843  C  CA  . ARG A 1 115 ? 10.555  11.256  31.029  1.00 29.83 ? 115  ARG A CA  1 
ATOM   844  C  C   . ARG A 1 115 ? 10.553  11.496  29.524  1.00 29.85 ? 115  ARG A C   1 
ATOM   845  O  O   . ARG A 1 115 ? 10.972  10.641  28.764  1.00 29.41 ? 115  ARG A O   1 
ATOM   846  C  CB  . ARG A 1 115 ? 9.150   10.846  31.474  1.00 30.61 ? 115  ARG A CB  1 
ATOM   847  C  CG  . ARG A 1 115 ? 9.061   10.515  32.938  1.00 31.73 ? 115  ARG A CG  1 
ATOM   848  C  CD  A ARG A 1 115 ? 7.815   9.686   33.223  0.50 33.15 ? 115  ARG A CD  1 
ATOM   849  C  CD  B ARG A 1 115 ? 7.908   9.570   33.329  0.50 35.55 ? 115  ARG A CD  1 
ATOM   850  N  NE  A ARG A 1 115 ? 8.039   8.766   34.338  0.50 32.41 ? 115  ARG A NE  1 
ATOM   851  N  NE  B ARG A 1 115 ? 6.626   9.801   32.661  0.50 36.62 ? 115  ARG A NE  1 
ATOM   852  C  CZ  A ARG A 1 115 ? 7.836   9.072   35.613  0.50 32.54 ? 115  ARG A CZ  1 
ATOM   853  C  CZ  B ARG A 1 115 ? 5.611   10.505  33.163  0.50 37.73 ? 115  ARG A CZ  1 
ATOM   854  N  NH1 A ARG A 1 115 ? 7.385   10.272  35.951  0.50 32.98 ? 115  ARG A NH1 1 
ATOM   855  N  NH1 B ARG A 1 115 ? 5.708   11.111  34.346  0.50 38.22 ? 115  ARG A NH1 1 
ATOM   856  N  NH2 A ARG A 1 115 ? 8.070   8.168   36.551  0.50 33.59 ? 115  ARG A NH2 1 
ATOM   857  N  NH2 B ARG A 1 115 ? 4.490   10.619  32.461  0.50 37.55 ? 115  ARG A NH2 1 
ATOM   858  N  N   . VAL A 1 116 ? 10.044  12.654  29.104  1.00 30.04 ? 116  VAL A N   1 
ATOM   859  C  CA  . VAL A 1 116 ? 9.971   12.996  27.688  1.00 30.06 ? 116  VAL A CA  1 
ATOM   860  C  C   . VAL A 1 116 ? 11.371  13.092  27.104  1.00 30.63 ? 116  VAL A C   1 
ATOM   861  O  O   . VAL A 1 116 ? 11.648  12.505  26.057  1.00 31.10 ? 116  VAL A O   1 
ATOM   862  C  CB  . VAL A 1 116 ? 9.176   14.316  27.468  1.00 30.11 ? 116  VAL A CB  1 
ATOM   863  C  CG1 . VAL A 1 116 ? 9.235   14.755  26.011  1.00 29.22 ? 116  VAL A CG1 1 
ATOM   864  C  CG2 . VAL A 1 116 ? 7.725   14.139  27.936  1.00 29.57 ? 116  VAL A CG2 1 
ATOM   865  N  N   . MET A 1 117 ? 12.249  13.825  27.800  1.00 30.72 ? 117  MET A N   1 
ATOM   866  C  CA  . MET A 1 117 ? 13.643  13.947  27.429  1.00 31.51 ? 117  MET A CA  1 
ATOM   867  C  C   . MET A 1 117 ? 14.363  12.598  27.284  1.00 30.68 ? 117  MET A C   1 
ATOM   868  O  O   . MET A 1 117 ? 15.087  12.369  26.302  1.00 29.60 ? 117  MET A O   1 
ATOM   869  C  CB  . MET A 1 117 ? 14.391  14.815  28.450  1.00 31.17 ? 117  MET A CB  1 
ATOM   870  C  CG  . MET A 1 117 ? 15.863  14.915  28.134  1.00 32.40 ? 117  MET A CG  1 
ATOM   871  S  SD  . MET A 1 117 ? 16.798  16.118  29.084  1.00 35.54 ? 117  MET A SD  1 
ATOM   872  C  CE  . MET A 1 117 ? 17.017  15.294  30.651  1.00 38.62 ? 117  MET A CE  1 
ATOM   873  N  N   . THR A 1 118 ? 14.213  11.743  28.297  1.00 29.76 ? 118  THR A N   1 
ATOM   874  C  CA  . THR A 1 118 ? 14.829  10.413  28.282  1.00 28.77 ? 118  THR A CA  1 
ATOM   875  C  C   . THR A 1 118 ? 14.249  9.576   27.150  1.00 28.31 ? 118  THR A C   1 
ATOM   876  O  O   . THR A 1 118 ? 14.988  9.033   26.337  1.00 27.44 ? 118  THR A O   1 
ATOM   877  C  CB  . THR A 1 118 ? 14.625  9.665   29.626  1.00 28.79 ? 118  THR A CB  1 
ATOM   878  O  OG1 . THR A 1 118 ? 15.174  10.441  30.697  1.00 29.09 ? 118  THR A OG1 1 
ATOM   879  C  CG2 . THR A 1 118 ? 15.286  8.303   29.601  1.00 27.21 ? 118  THR A CG2 1 
ATOM   880  N  N   . GLN A 1 119 ? 12.921  9.457   27.107  1.00 28.18 ? 119  GLN A N   1 
ATOM   881  C  CA  . GLN A 1 119 ? 12.273  8.575   26.115  1.00 27.53 ? 119  GLN A CA  1 
ATOM   882  C  C   . GLN A 1 119 ? 12.379  9.031   24.631  1.00 28.30 ? 119  GLN A C   1 
ATOM   883  O  O   . GLN A 1 119 ? 12.504  8.196   23.728  1.00 28.10 ? 119  GLN A O   1 
ATOM   884  C  CB  . GLN A 1 119 ? 10.851  8.236   26.563  1.00 27.81 ? 119  GLN A CB  1 
ATOM   885  C  CG  . GLN A 1 119 ? 10.875  7.472   27.902  1.00 26.44 ? 119  GLN A CG  1 
ATOM   886  C  CD  . GLN A 1 119 ? 9.526   7.018   28.406  1.00 26.78 ? 119  GLN A CD  1 
ATOM   887  O  OE1 . GLN A 1 119 ? 8.716   6.462   27.661  1.00 25.39 ? 119  GLN A OE1 1 
ATOM   888  N  NE2 . GLN A 1 119 ? 9.291   7.218   29.701  1.00 23.41 ? 119  GLN A NE2 1 
ATOM   889  N  N   . LEU A 1 120 ? 12.386  10.345  24.384  1.00 28.44 ? 120  LEU A N   1 
ATOM   890  C  CA  . LEU A 1 120 ? 12.572  10.859  23.025  1.00 28.69 ? 120  LEU A CA  1 
ATOM   891  C  C   . LEU A 1 120 ? 14.008  10.770  22.562  1.00 28.97 ? 120  LEU A C   1 
ATOM   892  O  O   . LEU A 1 120 ? 14.265  10.575  21.379  1.00 29.31 ? 120  LEU A O   1 
ATOM   893  C  CB  . LEU A 1 120 ? 12.060  12.306  22.877  1.00 29.13 ? 120  LEU A CB  1 
ATOM   894  C  CG  . LEU A 1 120 ? 10.543  12.477  22.778  1.00 28.89 ? 120  LEU A CG  1 
ATOM   895  C  CD1 . LEU A 1 120 ? 10.234  13.925  22.499  1.00 28.04 ? 120  LEU A CD1 1 
ATOM   896  C  CD2 . LEU A 1 120 ? 9.924   11.546  21.679  1.00 26.90 ? 120  LEU A CD2 1 
ATOM   897  N  N   . THR A 1 121 ? 14.942  10.943  23.488  1.00 29.19 ? 121  THR A N   1 
ATOM   898  C  CA  . THR A 1 121 ? 16.342  10.778  23.182  1.00 29.69 ? 121  THR A CA  1 
ATOM   899  C  C   . THR A 1 121 ? 16.626  9.332   22.785  1.00 29.61 ? 121  THR A C   1 
ATOM   900  O  O   . THR A 1 121 ? 17.374  9.089   21.845  1.00 29.71 ? 121  THR A O   1 
ATOM   901  C  CB  . THR A 1 121 ? 17.237  11.220  24.361  1.00 29.86 ? 121  THR A CB  1 
ATOM   902  O  OG1 . THR A 1 121 ? 16.926  12.574  24.691  1.00 30.51 ? 121  THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 121 ? 18.693  11.138  23.984  1.00 28.74 ? 121  THR A CG2 1 
ATOM   904  N  N   . LEU A 1 122 ? 16.019  8.375   23.479  1.00 28.93 ? 122  LEU A N   1 
ATOM   905  C  CA  . LEU A 1 122 ? 16.124  6.973   23.065  1.00 29.26 ? 122  LEU A CA  1 
ATOM   906  C  C   . LEU A 1 122 ? 15.429  6.674   21.730  1.00 29.51 ? 122  LEU A C   1 
ATOM   907  O  O   . LEU A 1 122 ? 15.925  5.865   20.956  1.00 29.77 ? 122  LEU A O   1 
ATOM   908  C  CB  . LEU A 1 122 ? 15.635  6.019   24.162  1.00 28.82 ? 122  LEU A CB  1 
ATOM   909  C  CG  . LEU A 1 122 ? 16.528  6.011   25.402  1.00 29.46 ? 122  LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1 122 ? 15.709  5.617   26.637  1.00 28.10 ? 122  LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1 122 ? 17.729  5.082   25.199  1.00 28.49 ? 122  LEU A CD2 1 
ATOM   912  N  N   . ALA A 1 123 ? 14.289  7.315   21.468  1.00 29.95 ? 123  ALA A N   1 
ATOM   913  C  CA  . ALA A 1 123 ? 13.647  7.220   20.143  1.00 30.53 ? 123  ALA A CA  1 
ATOM   914  C  C   . ALA A 1 123 ? 14.607  7.721   19.053  1.00 30.76 ? 123  ALA A C   1 
ATOM   915  O  O   . ALA A 1 123 ? 14.768  7.074   18.023  1.00 30.41 ? 123  ALA A O   1 
ATOM   916  C  CB  . ALA A 1 123 ? 12.332  8.006   20.108  1.00 30.16 ? 123  ALA A CB  1 
ATOM   917  N  N   . LEU A 1 124 ? 15.263  8.853   19.315  1.00 31.31 ? 124  LEU A N   1 
ATOM   918  C  CA  . LEU A 1 124 ? 16.256  9.420   18.400  1.00 31.88 ? 124  LEU A CA  1 
ATOM   919  C  C   . LEU A 1 124 ? 17.492  8.557   18.227  1.00 32.30 ? 124  LEU A C   1 
ATOM   920  O  O   . LEU A 1 124 ? 18.015  8.458   17.125  1.00 32.09 ? 124  LEU A O   1 
ATOM   921  C  CB  . LEU A 1 124 ? 16.698  10.812  18.854  1.00 31.72 ? 124  LEU A CB  1 
ATOM   922  C  CG  . LEU A 1 124 ? 15.780  11.997  18.588  1.00 32.32 ? 124  LEU A CG  1 
ATOM   923  C  CD1 . LEU A 1 124 ? 16.465  13.306  19.055  1.00 31.77 ? 124  LEU A CD1 1 
ATOM   924  C  CD2 . LEU A 1 124 ? 15.393  12.077  17.110  1.00 30.58 ? 124  LEU A CD2 1 
ATOM   925  N  N   . LYS A 1 125 ? 17.989  7.968   19.314  1.00 32.79 ? 125  LYS A N   1 
ATOM   926  C  CA  . LYS A 1 125 ? 19.131  7.064   19.208  1.00 33.19 ? 125  LYS A CA  1 
ATOM   927  C  C   . LYS A 1 125 ? 18.841  5.970   18.169  1.00 33.48 ? 125  LYS A C   1 
ATOM   928  O  O   . LYS A 1 125 ? 19.696  5.653   17.334  1.00 33.24 ? 125  LYS A O   1 
ATOM   929  C  CB  . LYS A 1 125 ? 19.473  6.467   20.572  1.00 33.52 ? 125  LYS A CB  1 
ATOM   930  C  CG  . LYS A 1 125 ? 20.673  5.527   20.595  1.00 33.86 ? 125  LYS A CG  1 
ATOM   931  C  CD  . LYS A 1 125 ? 20.985  5.100   22.022  1.00 35.11 ? 125  LYS A CD  1 
ATOM   932  C  CE  . LYS A 1 125 ? 21.756  3.784   22.036  1.00 38.38 ? 125  LYS A CE  1 
ATOM   933  N  NZ  . LYS A 1 125 ? 22.139  3.329   23.403  1.00 38.70 ? 125  LYS A NZ  1 
ATOM   934  N  N   . GLU A 1 126 ? 17.623  5.429   18.223  1.00 33.75 ? 126  GLU A N   1 
ATOM   935  C  CA  . GLU A 1 126 ? 17.177  4.364   17.335  1.00 34.05 ? 126  GLU A CA  1 
ATOM   936  C  C   . GLU A 1 126 ? 17.022  4.863   15.901  1.00 34.46 ? 126  GLU A C   1 
ATOM   937  O  O   . GLU A 1 126 ? 17.557  4.254   14.974  1.00 33.79 ? 126  GLU A O   1 
ATOM   938  C  CB  . GLU A 1 126 ? 15.866  3.755   17.837  1.00 34.04 ? 126  GLU A CB  1 
ATOM   939  C  CG  . GLU A 1 126 ? 15.320  2.591   16.984  1.00 34.72 ? 126  GLU A CG  1 
ATOM   940  C  CD  . GLU A 1 126 ? 16.289  1.419   16.829  1.00 35.84 ? 126  GLU A CD  1 
ATOM   941  O  OE1 . GLU A 1 126 ? 17.229  1.277   17.639  1.00 36.62 ? 126  GLU A OE1 1 
ATOM   942  O  OE2 . GLU A 1 126 ? 16.101  0.623   15.886  1.00 37.39 ? 126  GLU A OE2 1 
ATOM   943  N  N   . CYS A 1 127 ? 16.298  5.971   15.739  1.00 34.87 ? 127  CYS A N   1 
ATOM   944  C  CA  . CYS A 1 127 ? 16.146  6.633   14.438  1.00 35.72 ? 127  CYS A CA  1 
ATOM   945  C  C   . CYS A 1 127 ? 17.477  6.853   13.729  1.00 35.77 ? 127  CYS A C   1 
ATOM   946  O  O   . CYS A 1 127 ? 17.586  6.618   12.533  1.00 36.09 ? 127  CYS A O   1 
ATOM   947  C  CB  . CYS A 1 127 ? 15.412  7.965   14.594  1.00 35.58 ? 127  CYS A CB  1 
ATOM   948  S  SG  . CYS A 1 127 ? 13.635  7.801   14.825  1.00 36.68 ? 127  CYS A SG  1 
ATOM   949  N  N   . HIS A 1 128 ? 18.481  7.296   14.478  1.00 36.19 ? 128  HIS A N   1 
ATOM   950  C  CA  . HIS A 1 128 ? 19.802  7.564   13.929  1.00 36.86 ? 128  HIS A CA  1 
ATOM   951  C  C   . HIS A 1 128 ? 20.564  6.289   13.557  1.00 37.93 ? 128  HIS A C   1 
ATOM   952  O  O   . HIS A 1 128 ? 21.402  6.306   12.649  1.00 37.78 ? 128  HIS A O   1 
ATOM   953  C  CB  . HIS A 1 128 ? 20.621  8.421   14.899  1.00 36.36 ? 128  HIS A CB  1 
ATOM   954  C  CG  . HIS A 1 128 ? 20.056  9.789   15.123  1.00 35.16 ? 128  HIS A CG  1 
ATOM   955  N  ND1 . HIS A 1 128 ? 20.370  10.551  16.226  1.00 33.93 ? 128  HIS A ND1 1 
ATOM   956  C  CD2 . HIS A 1 128 ? 19.183  10.526  14.394  1.00 33.77 ? 128  HIS A CD2 1 
ATOM   957  C  CE1 . HIS A 1 128 ? 19.725  11.701  16.164  1.00 34.33 ? 128  HIS A CE1 1 
ATOM   958  N  NE2 . HIS A 1 128 ? 18.993  11.709  15.065  1.00 33.46 ? 128  HIS A NE2 1 
ATOM   959  N  N   . ARG A 1 129 ? 20.278  5.197   14.269  1.00 39.33 ? 129  ARG A N   1 
ATOM   960  C  CA  . ARG A 1 129 ? 20.814  3.871   13.938  1.00 41.00 ? 129  ARG A CA  1 
ATOM   961  C  C   . ARG A 1 129 ? 20.273  3.371   12.603  1.00 41.27 ? 129  ARG A C   1 
ATOM   962  O  O   . ARG A 1 129 ? 21.012  2.793   11.813  1.00 41.56 ? 129  ARG A O   1 
ATOM   963  C  CB  . ARG A 1 129 ? 20.490  2.857   15.042  1.00 41.01 ? 129  ARG A CB  1 
ATOM   964  C  CG  . ARG A 1 129 ? 21.525  2.779   16.163  1.00 42.54 ? 129  ARG A CG  1 
ATOM   965  C  CD  . ARG A 1 129 ? 20.998  2.016   17.389  1.00 42.61 ? 129  ARG A CD  1 
ATOM   966  N  NE  . ARG A 1 129 ? 20.436  0.702   17.053  1.00 44.89 ? 129  ARG A NE  1 
ATOM   967  C  CZ  . ARG A 1 129 ? 21.116  -0.446  17.029  1.00 47.30 ? 129  ARG A CZ  1 
ATOM   968  N  NH1 . ARG A 1 129 ? 20.490  -1.575  16.712  1.00 47.67 ? 129  ARG A NH1 1 
ATOM   969  N  NH2 . ARG A 1 129 ? 22.417  -0.481  17.311  1.00 48.44 ? 129  ARG A NH2 1 
ATOM   970  N  N   . ARG A 1 130 ? 18.982  3.597   12.357  1.00 41.97 ? 130  ARG A N   1 
ATOM   971  C  CA  . ARG A 1 130 ? 18.353  3.245   11.081  1.00 42.59 ? 130  ARG A CA  1 
ATOM   972  C  C   . ARG A 1 130 ? 19.105  3.875   9.895   1.00 42.84 ? 130  ARG A C   1 
ATOM   973  O  O   . ARG A 1 130 ? 19.394  3.196   8.906   1.00 43.33 ? 130  ARG A O   1 
ATOM   974  C  CB  . ARG A 1 130 ? 16.878  3.666   11.083  1.00 42.64 ? 130  ARG A CB  1 
ATOM   975  C  CG  . ARG A 1 130 ? 16.040  3.052   9.974   1.00 42.62 ? 130  ARG A CG  1 
ATOM   976  N  N   . SER A 1 131 ? 19.423  5.165   10.011  1.00 43.23 ? 131  SER A N   1 
ATOM   977  C  CA  . SER A 1 131 ? 20.262  5.870   9.038   1.00 43.26 ? 131  SER A CA  1 
ATOM   978  C  C   . SER A 1 131 ? 21.724  5.481   9.229   1.00 43.32 ? 131  SER A C   1 
ATOM   979  O  O   . SER A 1 131 ? 22.478  5.361   8.264   1.00 43.38 ? 131  SER A O   1 
ATOM   980  C  CB  . SER A 1 131 ? 20.122  7.389   9.199   1.00 43.43 ? 131  SER A CB  1 
ATOM   981  O  OG  . SER A 1 131 ? 18.765  7.793   9.297   1.00 43.40 ? 131  SER A OG  1 
ATOM   982  N  N   . ASP A 1 141 ? 11.632  16.070  12.077  1.00 45.72 ? 141  ASP A N   1 
ATOM   983  C  CA  . ASP A 1 141 ? 10.622  17.004  12.579  1.00 45.60 ? 141  ASP A CA  1 
ATOM   984  C  C   . ASP A 1 141 ? 10.010  16.523  13.900  1.00 44.94 ? 141  ASP A C   1 
ATOM   985  O  O   . ASP A 1 141 ? 9.027   15.768  13.908  1.00 45.18 ? 141  ASP A O   1 
ATOM   986  C  CB  . ASP A 1 141 ? 9.532   17.239  11.522  1.00 46.03 ? 141  ASP A CB  1 
ATOM   987  C  CG  . ASP A 1 141 ? 8.741   18.531  11.752  1.00 47.24 ? 141  ASP A CG  1 
ATOM   988  O  OD1 . ASP A 1 141 ? 9.059   19.298  12.695  1.00 49.33 ? 141  ASP A OD1 1 
ATOM   989  O  OD2 . ASP A 1 141 ? 7.792   18.781  10.973  1.00 47.75 ? 141  ASP A OD2 1 
ATOM   990  N  N   . LEU A 1 142 ? 10.613  16.958  15.009  1.00 43.76 ? 142  LEU A N   1 
ATOM   991  C  CA  . LEU A 1 142 ? 10.108  16.669  16.341  1.00 42.51 ? 142  LEU A CA  1 
ATOM   992  C  C   . LEU A 1 142 ? 9.203   17.788  16.792  1.00 41.02 ? 142  LEU A C   1 
ATOM   993  O  O   . LEU A 1 142 ? 9.658   18.732  17.412  1.00 41.99 ? 142  LEU A O   1 
ATOM   994  C  CB  . LEU A 1 142 ? 11.253  16.548  17.352  1.00 42.80 ? 142  LEU A CB  1 
ATOM   995  C  CG  . LEU A 1 142 ? 12.210  15.363  17.380  1.00 43.52 ? 142  LEU A CG  1 
ATOM   996  C  CD1 . LEU A 1 142 ? 13.159  15.385  16.172  1.00 43.86 ? 142  LEU A CD1 1 
ATOM   997  C  CD2 . LEU A 1 142 ? 12.996  15.430  18.670  1.00 43.10 ? 142  LEU A CD2 1 
ATOM   998  N  N   . LYS A 1 143 ? 7.923   17.683  16.488  1.00 39.30 ? 143  LYS A N   1 
ATOM   999  C  CA  . LYS A 1 143 ? 6.937   18.634  16.972  1.00 37.71 ? 143  LYS A CA  1 
ATOM   1000 C  C   . LYS A 1 143 ? 6.179   17.964  18.101  1.00 35.87 ? 143  LYS A C   1 
ATOM   1001 O  O   . LYS A 1 143 ? 6.056   16.744  18.098  1.00 35.75 ? 143  LYS A O   1 
ATOM   1002 C  CB  . LYS A 1 143 ? 5.941   18.969  15.868  1.00 38.10 ? 143  LYS A CB  1 
ATOM   1003 C  CG  . LYS A 1 143 ? 6.440   19.890  14.779  1.00 39.43 ? 143  LYS A CG  1 
ATOM   1004 C  CD  . LYS A 1 143 ? 5.586   19.711  13.517  1.00 41.11 ? 143  LYS A CD  1 
ATOM   1005 C  CE  . LYS A 1 143 ? 4.107   19.465  13.841  1.00 40.94 ? 143  LYS A CE  1 
ATOM   1006 N  NZ  . LYS A 1 143 ? 3.301   19.245  12.606  1.00 42.90 ? 143  LYS A NZ  1 
ATOM   1007 N  N   . PRO A 1 144 ? 5.664   18.754  19.068  1.00 34.05 ? 144  PRO A N   1 
ATOM   1008 C  CA  . PRO A 1 144 ? 4.797   18.175  20.102  1.00 32.67 ? 144  PRO A CA  1 
ATOM   1009 C  C   . PRO A 1 144 ? 3.577   17.433  19.529  1.00 31.32 ? 144  PRO A C   1 
ATOM   1010 O  O   . PRO A 1 144 ? 3.153   16.441  20.104  1.00 30.46 ? 144  PRO A O   1 
ATOM   1011 C  CB  . PRO A 1 144 ? 4.372   19.389  20.938  1.00 32.35 ? 144  PRO A CB  1 
ATOM   1012 C  CG  . PRO A 1 144 ? 5.455   20.410  20.699  1.00 33.25 ? 144  PRO A CG  1 
ATOM   1013 C  CD  . PRO A 1 144 ? 5.888   20.200  19.279  1.00 33.80 ? 144  PRO A CD  1 
ATOM   1014 N  N   . ALA A 1 145 ? 3.041   17.905  18.406  1.00 30.46 ? 145  ALA A N   1 
ATOM   1015 C  CA  . ALA A 1 145 ? 1.943   17.225  17.710  1.00 30.02 ? 145  ALA A CA  1 
ATOM   1016 C  C   . ALA A 1 145 ? 2.294   15.820  17.203  1.00 29.66 ? 145  ALA A C   1 
ATOM   1017 O  O   . ALA A 1 145 ? 1.399   15.019  16.953  1.00 29.68 ? 145  ALA A O   1 
ATOM   1018 C  CB  . ALA A 1 145 ? 1.419   18.085  16.555  1.00 29.69 ? 145  ALA A CB  1 
ATOM   1019 N  N   . ASN A 1 146 ? 3.588   15.537  17.042  1.00 29.44 ? 146  ASN A N   1 
ATOM   1020 C  CA  . ASN A 1 146 ? 4.053   14.227  16.593  1.00 28.99 ? 146  ASN A CA  1 
ATOM   1021 C  C   . ASN A 1 146 ? 4.669   13.401  17.736  1.00 28.72 ? 146  ASN A C   1 
ATOM   1022 O  O   . ASN A 1 146 ? 5.414   12.451  17.504  1.00 28.64 ? 146  ASN A O   1 
ATOM   1023 C  CB  . ASN A 1 146 ? 5.033   14.365  15.412  1.00 28.85 ? 146  ASN A CB  1 
ATOM   1024 C  CG  A ASN A 1 146 ? 4.370   14.915  14.149  0.50 30.12 ? 146  ASN A CG  1 
ATOM   1025 C  CG  B ASN A 1 146 ? 5.345   13.020  14.746  0.50 27.92 ? 146  ASN A CG  1 
ATOM   1026 O  OD1 A ASN A 1 146 ? 3.173   14.727  13.924  0.50 32.13 ? 146  ASN A OD1 1 
ATOM   1027 O  OD1 B ASN A 1 146 ? 4.462   12.184  14.567  0.50 26.66 ? 146  ASN A OD1 1 
ATOM   1028 N  ND2 A ASN A 1 146 ? 5.157   15.585  13.313  0.50 30.55 ? 146  ASN A ND2 1 
ATOM   1029 N  ND2 B ASN A 1 146 ? 6.608   12.811  14.389  0.50 26.10 ? 146  ASN A ND2 1 
ATOM   1030 N  N   . VAL A 1 147 ? 4.353   13.770  18.969  1.00 28.32 ? 147  VAL A N   1 
ATOM   1031 C  CA  . VAL A 1 147 ? 4.805   13.009  20.141  1.00 28.30 ? 147  VAL A CA  1 
ATOM   1032 C  C   . VAL A 1 147 ? 3.584   12.598  20.956  1.00 28.41 ? 147  VAL A C   1 
ATOM   1033 O  O   . VAL A 1 147 ? 2.725   13.429  21.257  1.00 28.14 ? 147  VAL A O   1 
ATOM   1034 C  CB  . VAL A 1 147 ? 5.781   13.811  21.035  1.00 28.22 ? 147  VAL A CB  1 
ATOM   1035 C  CG1 . VAL A 1 147 ? 6.183   12.993  22.259  1.00 27.59 ? 147  VAL A CG1 1 
ATOM   1036 C  CG2 . VAL A 1 147 ? 7.010   14.238  20.254  1.00 27.11 ? 147  VAL A CG2 1 
ATOM   1037 N  N   . PHE A 1 148 ? 3.537   11.315  21.318  1.00 28.37 ? 148  PHE A N   1 
ATOM   1038 C  CA  . PHE A 1 148 ? 2.349   10.697  21.881  1.00 27.94 ? 148  PHE A CA  1 
ATOM   1039 C  C   . PHE A 1 148 ? 2.608   10.052  23.220  1.00 28.55 ? 148  PHE A C   1 
ATOM   1040 O  O   . PHE A 1 148 ? 3.751   9.707   23.546  1.00 29.03 ? 148  PHE A O   1 
ATOM   1041 C  CB  . PHE A 1 148 ? 1.743   9.706   20.876  1.00 27.16 ? 148  PHE A CB  1 
ATOM   1042 C  CG  . PHE A 1 148 ? 1.335   10.364  19.613  1.00 26.04 ? 148  PHE A CG  1 
ATOM   1043 C  CD1 . PHE A 1 148 ? 2.212   10.424  18.531  1.00 24.66 ? 148  PHE A CD1 1 
ATOM   1044 C  CD2 . PHE A 1 148 ? 0.115   11.011  19.528  1.00 24.24 ? 148  PHE A CD2 1 
ATOM   1045 C  CE1 . PHE A 1 148 ? 1.859   11.089  17.381  1.00 22.96 ? 148  PHE A CE1 1 
ATOM   1046 C  CE2 . PHE A 1 148 ? -0.248  11.672  18.370  1.00 25.12 ? 148  PHE A CE2 1 
ATOM   1047 C  CZ  . PHE A 1 148 ? 0.633   11.716  17.298  1.00 24.86 ? 148  PHE A CZ  1 
ATOM   1048 N  N   . LEU A 1 149 ? 1.539   9.938   24.001  1.00 28.26 ? 149  LEU A N   1 
ATOM   1049 C  CA  . LEU A 1 149 ? 1.601   9.392   25.347  1.00 29.19 ? 149  LEU A CA  1 
ATOM   1050 C  C   . LEU A 1 149 ? 0.642   8.222   25.458  1.00 29.21 ? 149  LEU A C   1 
ATOM   1051 O  O   . LEU A 1 149 ? -0.495  8.309   25.004  1.00 28.65 ? 149  LEU A O   1 
ATOM   1052 C  CB  . LEU A 1 149 ? 1.241   10.467  26.390  1.00 28.93 ? 149  LEU A CB  1 
ATOM   1053 C  CG  . LEU A 1 149 ? 2.091   11.747  26.393  1.00 29.48 ? 149  LEU A CG  1 
ATOM   1054 C  CD1 . LEU A 1 149 ? 1.449   12.811  27.259  1.00 29.77 ? 149  LEU A CD1 1 
ATOM   1055 C  CD2 . LEU A 1 149 ? 3.503   11.484  26.851  1.00 29.35 ? 149  LEU A CD2 1 
ATOM   1056 N  N   . ASP A 1 150 ? 1.111   7.126   26.047  1.00 30.14 ? 150  ASP A N   1 
ATOM   1057 C  CA  . ASP A 1 150 ? 0.228   6.002   26.363  1.00 30.96 ? 150  ASP A CA  1 
ATOM   1058 C  C   . ASP A 1 150 ? -0.399  6.209   27.753  1.00 31.85 ? 150  ASP A C   1 
ATOM   1059 O  O   . ASP A 1 150 ? -0.246  7.277   28.338  1.00 32.27 ? 150  ASP A O   1 
ATOM   1060 C  CB  . ASP A 1 150 ? 0.940   4.647   26.175  1.00 30.42 ? 150  ASP A CB  1 
ATOM   1061 C  CG  . ASP A 1 150 ? 1.892   4.280   27.316  1.00 30.70 ? 150  ASP A CG  1 
ATOM   1062 O  OD1 . ASP A 1 150 ? 2.157   5.100   28.225  1.00 30.82 ? 150  ASP A OD1 1 
ATOM   1063 O  OD2 . ASP A 1 150 ? 2.381   3.131   27.296  1.00 31.34 ? 150  ASP A OD2 1 
ATOM   1064 N  N   . GLY A 1 151 ? -1.126  5.223   28.268  1.00 33.21 ? 151  GLY A N   1 
ATOM   1065 C  CA  . GLY A 1 151 ? -1.735  5.355   29.596  1.00 34.52 ? 151  GLY A CA  1 
ATOM   1066 C  C   . GLY A 1 151 ? -0.810  5.020   30.764  1.00 35.40 ? 151  GLY A C   1 
ATOM   1067 O  O   . GLY A 1 151 ? -1.232  5.074   31.919  1.00 35.88 ? 151  GLY A O   1 
ATOM   1068 N  N   . LYS A 1 152 ? 0.447   4.690   30.465  1.00 35.99 ? 152  LYS A N   1 
ATOM   1069 C  CA  . LYS A 1 152 ? 1.395   4.137   31.446  1.00 36.58 ? 152  LYS A CA  1 
ATOM   1070 C  C   . LYS A 1 152 ? 2.653   4.977   31.621  1.00 37.19 ? 152  LYS A C   1 
ATOM   1071 O  O   . LYS A 1 152 ? 3.719   4.437   31.944  1.00 37.45 ? 152  LYS A O   1 
ATOM   1072 C  CB  . LYS A 1 152 ? 1.817   2.735   31.007  1.00 36.54 ? 152  LYS A CB  1 
ATOM   1073 C  CG  . LYS A 1 152 ? 0.753   1.676   31.190  1.00 36.89 ? 152  LYS A CG  1 
ATOM   1074 C  CD  . LYS A 1 152 ? 0.695   0.717   30.018  1.00 38.38 ? 152  LYS A CD  1 
ATOM   1075 C  CE  . LYS A 1 152 ? 1.790   -0.338  30.049  1.00 39.64 ? 152  LYS A CE  1 
ATOM   1076 N  NZ  . LYS A 1 152 ? 1.339   -1.590  29.339  1.00 39.69 ? 152  LYS A NZ  1 
ATOM   1077 N  N   . GLN A 1 153 ? 2.539   6.283   31.382  1.00 37.58 ? 153  GLN A N   1 
ATOM   1078 C  CA  . GLN A 1 153 ? 3.668   7.222   31.511  1.00 38.45 ? 153  GLN A CA  1 
ATOM   1079 C  C   . GLN A 1 153 ? 4.723   7.122   30.391  1.00 37.48 ? 153  GLN A C   1 
ATOM   1080 O  O   . GLN A 1 153 ? 5.749   7.815   30.434  1.00 38.02 ? 153  GLN A O   1 
ATOM   1081 C  CB  . GLN A 1 153 ? 4.337   7.105   32.892  1.00 38.32 ? 153  GLN A CB  1 
ATOM   1082 C  CG  . GLN A 1 153 ? 3.446   7.557   34.040  1.00 40.66 ? 153  GLN A CG  1 
ATOM   1083 C  CD  . GLN A 1 153 ? 4.144   7.518   35.393  1.00 41.19 ? 153  GLN A CD  1 
ATOM   1084 O  OE1 . GLN A 1 153 ? 4.758   6.512   35.762  1.00 46.12 ? 153  GLN A OE1 1 
ATOM   1085 N  NE2 . GLN A 1 153 ? 4.033   8.612   36.149  1.00 43.98 ? 153  GLN A NE2 1 
ATOM   1086 N  N   . ASN A 1 154 ? 4.473   6.278   29.393  1.00 35.98 ? 154  ASN A N   1 
ATOM   1087 C  CA  . ASN A 1 154 ? 5.417   6.124   28.280  1.00 34.77 ? 154  ASN A CA  1 
ATOM   1088 C  C   . ASN A 1 154 ? 5.238   7.174   27.171  1.00 34.59 ? 154  ASN A C   1 
ATOM   1089 O  O   . ASN A 1 154 ? 4.124   7.632   26.909  1.00 34.60 ? 154  ASN A O   1 
ATOM   1090 C  CB  . ASN A 1 154 ? 5.390   4.689   27.742  1.00 34.16 ? 154  ASN A CB  1 
ATOM   1091 C  CG  . ASN A 1 154 ? 5.617   3.664   28.842  1.00 32.62 ? 154  ASN A CG  1 
ATOM   1092 O  OD1 . ASN A 1 154 ? 6.529   3.815   29.657  1.00 30.15 ? 154  ASN A OD1 1 
ATOM   1093 N  ND2 . ASN A 1 154 ? 4.770   2.641   28.895  1.00 29.69 ? 154  ASN A ND2 1 
ATOM   1094 N  N   . VAL A 1 155 ? 6.356   7.553   26.557  1.00 33.91 ? 155  VAL A N   1 
ATOM   1095 C  CA  . VAL A 1 155 ? 6.415   8.577   25.522  1.00 33.74 ? 155  VAL A CA  1 
ATOM   1096 C  C   . VAL A 1 155 ? 6.800   7.896   24.210  1.00 33.92 ? 155  VAL A C   1 
ATOM   1097 O  O   . VAL A 1 155 ? 7.707   7.060   24.189  1.00 33.96 ? 155  VAL A O   1 
ATOM   1098 C  CB  . VAL A 1 155 ? 7.467   9.687   25.876  1.00 34.17 ? 155  VAL A CB  1 
ATOM   1099 C  CG1 . VAL A 1 155 ? 7.532   10.771  24.790  1.00 33.29 ? 155  VAL A CG1 1 
ATOM   1100 C  CG2 . VAL A 1 155 ? 7.169   10.317  27.248  1.00 32.15 ? 155  VAL A CG2 1 
ATOM   1101 N  N   . LYS A 1 156 ? 6.087   8.226   23.133  1.00 33.68 ? 156  LYS A N   1 
ATOM   1102 C  CA  . LYS A 1 156 ? 6.341   7.628   21.824  1.00 34.12 ? 156  LYS A CA  1 
ATOM   1103 C  C   . LYS A 1 156 ? 6.451   8.659   20.712  1.00 34.51 ? 156  LYS A C   1 
ATOM   1104 O  O   . LYS A 1 156 ? 5.587   9.530   20.555  1.00 34.09 ? 156  LYS A O   1 
ATOM   1105 C  CB  . LYS A 1 156 ? 5.267   6.600   21.439  1.00 33.96 ? 156  LYS A CB  1 
ATOM   1106 C  CG  . LYS A 1 156 ? 4.689   5.829   22.596  1.00 33.82 ? 156  LYS A CG  1 
ATOM   1107 C  CD  . LYS A 1 156 ? 4.771   4.380   22.336  1.00 34.00 ? 156  LYS A CD  1 
ATOM   1108 C  CE  . LYS A 1 156 ? 4.662   3.584   23.622  1.00 33.13 ? 156  LYS A CE  1 
ATOM   1109 N  NZ  . LYS A 1 156 ? 4.781   2.157   23.283  1.00 31.19 ? 156  LYS A NZ  1 
ATOM   1110 N  N   . LEU A 1 157 ? 7.513   8.526   19.928  1.00 34.95 ? 157  LEU A N   1 
ATOM   1111 C  CA  . LEU A 1 157 ? 7.697   9.342   18.749  1.00 35.82 ? 157  LEU A CA  1 
ATOM   1112 C  C   . LEU A 1 157 ? 6.876   8.778   17.594  1.00 36.53 ? 157  LEU A C   1 
ATOM   1113 O  O   . LEU A 1 157 ? 6.889   7.572   17.332  1.00 36.73 ? 157  LEU A O   1 
ATOM   1114 C  CB  . LEU A 1 157 ? 9.182   9.416   18.383  1.00 35.49 ? 157  LEU A CB  1 
ATOM   1115 C  CG  . LEU A 1 157 ? 9.616   10.323  17.231  1.00 35.80 ? 157  LEU A CG  1 
ATOM   1116 C  CD1 . LEU A 1 157 ? 9.298   11.802  17.523  1.00 34.34 ? 157  LEU A CD1 1 
ATOM   1117 C  CD2 . LEU A 1 157 ? 11.098  10.131  16.967  1.00 35.62 ? 157  LEU A CD2 1 
ATOM   1118 N  N   . GLY A 1 158 ? 6.145   9.653   16.916  1.00 37.56 ? 158  GLY A N   1 
ATOM   1119 C  CA  . GLY A 1 158 ? 5.467   9.272   15.688  1.00 39.01 ? 158  GLY A CA  1 
ATOM   1120 C  C   . GLY A 1 158 ? 6.467   8.983   14.584  1.00 40.42 ? 158  GLY A C   1 
ATOM   1121 O  O   . GLY A 1 158 ? 7.457   9.699   14.425  1.00 40.34 ? 158  GLY A O   1 
ATOM   1122 N  N   . ASP A 1 159 ? 6.217   7.908   13.840  1.00 41.90 ? 159  ASP A N   1 
ATOM   1123 C  CA  . ASP A 1 159 ? 6.939   7.608   12.609  1.00 43.41 ? 159  ASP A CA  1 
ATOM   1124 C  C   . ASP A 1 159 ? 6.998   8.863   11.728  1.00 44.17 ? 159  ASP A C   1 
ATOM   1125 O  O   . ASP A 1 159 ? 5.960   9.456   11.419  1.00 44.28 ? 159  ASP A O   1 
ATOM   1126 C  CB  . ASP A 1 159 ? 6.224   6.456   11.880  1.00 43.77 ? 159  ASP A CB  1 
ATOM   1127 C  CG  . ASP A 1 159 ? 6.835   6.132   10.529  1.00 44.88 ? 159  ASP A CG  1 
ATOM   1128 O  OD1 . ASP A 1 159 ? 8.076   6.012   10.431  1.00 46.53 ? 159  ASP A OD1 1 
ATOM   1129 O  OD2 . ASP A 1 159 ? 6.061   5.978   9.558   1.00 46.89 ? 159  ASP A OD2 1 
ATOM   1130 N  N   . PHE A 1 160 ? 8.209   9.281   11.359  1.00 45.05 ? 160  PHE A N   1 
ATOM   1131 C  CA  . PHE A 1 160 ? 8.396   10.438  10.477  1.00 45.98 ? 160  PHE A CA  1 
ATOM   1132 C  C   . PHE A 1 160 ? 7.768   10.204  9.099   1.00 46.45 ? 160  PHE A C   1 
ATOM   1133 O  O   . PHE A 1 160 ? 7.260   11.139  8.475   1.00 46.46 ? 160  PHE A O   1 
ATOM   1134 C  CB  . PHE A 1 160 ? 9.881   10.779  10.305  1.00 46.18 ? 160  PHE A CB  1 
ATOM   1135 C  CG  . PHE A 1 160 ? 10.561  11.247  11.562  1.00 46.90 ? 160  PHE A CG  1 
ATOM   1136 C  CD1 . PHE A 1 160 ? 11.805  10.733  11.918  1.00 47.13 ? 160  PHE A CD1 1 
ATOM   1137 C  CD2 . PHE A 1 160 ? 9.971   12.209  12.382  1.00 47.35 ? 160  PHE A CD2 1 
ATOM   1138 C  CE1 . PHE A 1 160 ? 12.450  11.165  13.071  1.00 47.09 ? 160  PHE A CE1 1 
ATOM   1139 C  CE2 . PHE A 1 160 ? 10.606  12.644  13.537  1.00 47.09 ? 160  PHE A CE2 1 
ATOM   1140 C  CZ  . PHE A 1 160 ? 11.849  12.121  13.884  1.00 47.19 ? 160  PHE A CZ  1 
ATOM   1141 N  N   . GLY A 1 161 ? 7.815   8.954   8.638   1.00 47.00 ? 161  GLY A N   1 
ATOM   1142 C  CA  . GLY A 1 161 ? 7.189   8.551   7.378   1.00 47.65 ? 161  GLY A CA  1 
ATOM   1143 C  C   . GLY A 1 161 ? 5.670   8.597   7.414   1.00 48.17 ? 161  GLY A C   1 
ATOM   1144 O  O   . GLY A 1 161 ? 5.030   8.822   6.386   1.00 47.92 ? 161  GLY A O   1 
ATOM   1145 N  N   . LEU A 1 162 ? 5.098   8.379   8.599   1.00 48.83 ? 162  LEU A N   1 
ATOM   1146 C  CA  . LEU A 1 162 ? 3.654   8.492   8.803   1.00 49.45 ? 162  LEU A CA  1 
ATOM   1147 C  C   . LEU A 1 162 ? 3.203   9.954   8.760   1.00 49.80 ? 162  LEU A C   1 
ATOM   1148 O  O   . LEU A 1 162 ? 2.188   10.273  8.141   1.00 49.89 ? 162  LEU A O   1 
ATOM   1149 C  CB  . LEU A 1 162 ? 3.226   7.831   10.125  1.00 49.56 ? 162  LEU A CB  1 
ATOM   1150 C  CG  . LEU A 1 162 ? 1.719   7.727   10.418  1.00 49.69 ? 162  LEU A CG  1 
ATOM   1151 C  CD1 . LEU A 1 162 ? 1.389   6.520   11.269  1.00 50.39 ? 162  LEU A CD1 1 
ATOM   1152 C  CD2 . LEU A 1 162 ? 1.205   8.976   11.084  1.00 49.80 ? 162  LEU A CD2 1 
ATOM   1153 N  N   . ALA A 1 163 ? 3.954   10.832  9.426   1.00 50.28 ? 163  ALA A N   1 
ATOM   1154 C  CA  . ALA A 1 163 ? 3.633   12.260  9.462   1.00 50.71 ? 163  ALA A CA  1 
ATOM   1155 C  C   . ALA A 1 163 ? 3.740   12.904  8.079   1.00 51.10 ? 163  ALA A C   1 
ATOM   1156 O  O   . ALA A 1 163 ? 3.062   13.896  7.799   1.00 51.27 ? 163  ALA A O   1 
ATOM   1157 C  CB  . ALA A 1 163 ? 4.520   12.983  10.458  1.00 50.54 ? 163  ALA A CB  1 
ATOM   1158 N  N   . ARG A 1 164 ? 4.591   12.335  7.224   1.00 51.48 ? 164  ARG A N   1 
ATOM   1159 C  CA  . ARG A 1 164 ? 4.759   12.814  5.851   1.00 51.88 ? 164  ARG A CA  1 
ATOM   1160 C  C   . ARG A 1 164 ? 3.542   12.529  4.972   1.00 52.01 ? 164  ARG A C   1 
ATOM   1161 O  O   . ARG A 1 164 ? 3.077   13.421  4.253   1.00 52.20 ? 164  ARG A O   1 
ATOM   1162 C  CB  . ARG A 1 164 ? 6.040   12.251  5.222   1.00 51.98 ? 164  ARG A CB  1 
ATOM   1163 C  CG  . ARG A 1 164 ? 7.176   13.273  5.101   1.00 52.22 ? 164  ARG A CG  1 
ATOM   1164 C  CD  . ARG A 1 164 ? 8.542   12.684  5.464   1.00 52.40 ? 164  ARG A CD  1 
ATOM   1165 N  NE  . ARG A 1 164 ? 8.802   11.385  4.840   1.00 52.20 ? 164  ARG A NE  1 
ATOM   1166 C  CZ  . ARG A 1 164 ? 9.731   10.526  5.253   1.00 52.30 ? 164  ARG A CZ  1 
ATOM   1167 N  NH1 . ARG A 1 164 ? 10.499  10.815  6.297   1.00 52.64 ? 164  ARG A NH1 1 
ATOM   1168 N  NH2 . ARG A 1 164 ? 9.891   9.370   4.625   1.00 52.76 ? 164  ARG A NH2 1 
ATOM   1169 N  N   . ILE A 1 165 ? 3.027   11.298  5.037   1.00 52.07 ? 165  ILE A N   1 
ATOM   1170 C  CA  . ILE A 1 165 ? 1.826   10.917  4.277   1.00 52.15 ? 165  ILE A CA  1 
ATOM   1171 C  C   . ILE A 1 165 ? 0.536   11.550  4.822   1.00 52.12 ? 165  ILE A C   1 
ATOM   1172 O  O   . ILE A 1 165 ? -0.375  11.869  4.054   1.00 52.09 ? 165  ILE A O   1 
ATOM   1173 C  CB  . ILE A 1 165 ? 1.674   9.372   4.088   1.00 52.16 ? 165  ILE A CB  1 
ATOM   1174 C  CG1 . ILE A 1 165 ? 1.883   8.614   5.405   1.00 52.25 ? 165  ILE A CG1 1 
ATOM   1175 C  CG2 . ILE A 1 165 ? 2.628   8.878   3.000   1.00 52.57 ? 165  ILE A CG2 1 
ATOM   1176 C  CD1 . ILE A 1 165 ? 1.652   7.111   5.318   1.00 52.08 ? 165  ILE A CD1 1 
ATOM   1177 N  N   . LEU A 1 166 ? 0.466   11.736  6.139   1.00 52.13 ? 166  LEU A N   1 
ATOM   1178 C  CA  . LEU A 1 166 ? -0.648  12.459  6.750   1.00 52.17 ? 166  LEU A CA  1 
ATOM   1179 C  C   . LEU A 1 166 ? -0.517  13.963  6.518   1.00 52.14 ? 166  LEU A C   1 
ATOM   1180 O  O   . LEU A 1 166 ? -1.479  14.712  6.681   1.00 52.12 ? 166  LEU A O   1 
ATOM   1181 C  CB  . LEU A 1 166 ? -0.734  12.176  8.253   1.00 52.25 ? 166  LEU A CB  1 
ATOM   1182 C  CG  . LEU A 1 166 ? -1.085  10.778  8.772   1.00 52.38 ? 166  LEU A CG  1 
ATOM   1183 C  CD1 . LEU A 1 166 ? -1.539  10.890  10.226  1.00 52.58 ? 166  LEU A CD1 1 
ATOM   1184 C  CD2 . LEU A 1 166 ? -2.147  10.072  7.927   1.00 52.20 ? 166  LEU A CD2 1 
ATOM   1185 N  N   . GLY A 1 178 ? 6.701   33.979  12.099  1.00 63.45 ? 178  GLY A N   1 
ATOM   1186 C  CA  . GLY A 1 178 ? 7.577   32.821  12.000  1.00 63.42 ? 178  GLY A CA  1 
ATOM   1187 C  C   . GLY A 1 178 ? 6.866   31.534  12.361  1.00 63.50 ? 178  GLY A C   1 
ATOM   1188 O  O   . GLY A 1 178 ? 6.593   31.279  13.535  1.00 63.63 ? 178  GLY A O   1 
ATOM   1189 N  N   . THR A 1 179 ? 6.575   30.716  11.351  1.00 63.45 ? 179  THR A N   1 
ATOM   1190 C  CA  . THR A 1 179 ? 5.787   29.493  11.550  1.00 63.43 ? 179  THR A CA  1 
ATOM   1191 C  C   . THR A 1 179 ? 6.543   28.254  12.100  1.00 63.18 ? 179  THR A C   1 
ATOM   1192 O  O   . THR A 1 179 ? 5.982   27.529  12.925  1.00 63.44 ? 179  THR A O   1 
ATOM   1193 C  CB  . THR A 1 179 ? 4.903   29.141  10.297  1.00 63.43 ? 179  THR A CB  1 
ATOM   1194 O  OG1 . THR A 1 179 ? 3.985   28.089  10.624  1.00 63.73 ? 179  THR A OG1 1 
ATOM   1195 C  CG2 . THR A 1 179 ? 5.746   28.728  9.090   1.00 63.62 ? 179  THR A CG2 1 
ATOM   1196 N  N   . PRO A 1 180 ? 7.805   28.010  11.662  1.00 62.87 ? 180  PRO A N   1 
ATOM   1197 C  CA  . PRO A 1 180 ? 8.454   26.742  12.037  1.00 62.41 ? 180  PRO A CA  1 
ATOM   1198 C  C   . PRO A 1 180 ? 8.963   26.639  13.486  1.00 61.94 ? 180  PRO A C   1 
ATOM   1199 O  O   . PRO A 1 180 ? 8.779   25.588  14.116  1.00 61.90 ? 180  PRO A O   1 
ATOM   1200 C  CB  . PRO A 1 180 ? 9.624   26.636  11.041  1.00 62.48 ? 180  PRO A CB  1 
ATOM   1201 C  CG  . PRO A 1 180 ? 9.404   27.749  10.031  1.00 62.69 ? 180  PRO A CG  1 
ATOM   1202 C  CD  . PRO A 1 180 ? 8.693   28.808  10.800  1.00 62.84 ? 180  PRO A CD  1 
ATOM   1203 N  N   . TYR A 1 181 ? 9.598   27.703  13.990  1.00 61.23 ? 181  TYR A N   1 
ATOM   1204 C  CA  . TYR A 1 181 ? 10.153  27.775  15.370  1.00 60.47 ? 181  TYR A CA  1 
ATOM   1205 C  C   . TYR A 1 181 ? 11.350  26.849  15.637  1.00 59.82 ? 181  TYR A C   1 
ATOM   1206 O  O   . TYR A 1 181 ? 12.373  27.297  16.171  1.00 59.74 ? 181  TYR A O   1 
ATOM   1207 C  CB  . TYR A 1 181 ? 9.078   27.550  16.454  1.00 60.80 ? 181  TYR A CB  1 
ATOM   1208 C  CG  . TYR A 1 181 ? 7.902   28.507  16.431  1.00 61.18 ? 181  TYR A CG  1 
ATOM   1209 C  CD1 . TYR A 1 181 ? 6.618   28.051  16.125  1.00 61.62 ? 181  TYR A CD1 1 
ATOM   1210 C  CD2 . TYR A 1 181 ? 8.066   29.862  16.731  1.00 60.92 ? 181  TYR A CD2 1 
ATOM   1211 C  CE1 . TYR A 1 181 ? 5.527   28.921  16.104  1.00 61.70 ? 181  TYR A CE1 1 
ATOM   1212 C  CE2 . TYR A 1 181 ? 6.982   30.738  16.718  1.00 61.54 ? 181  TYR A CE2 1 
ATOM   1213 C  CZ  . TYR A 1 181 ? 5.715   30.261  16.403  1.00 61.68 ? 181  TYR A CZ  1 
ATOM   1214 O  OH  . TYR A 1 181 ? 4.638   31.124  16.379  1.00 61.64 ? 181  TYR A OH  1 
ATOM   1215 N  N   . TYR A 1 182 ? 11.199  25.569  15.270  1.00 58.79 ? 182  TYR A N   1 
ATOM   1216 C  CA  . TYR A 1 182 ? 12.179  24.497  15.521  1.00 57.92 ? 182  TYR A CA  1 
ATOM   1217 C  C   . TYR A 1 182 ? 13.194  24.360  14.384  1.00 57.65 ? 182  TYR A C   1 
ATOM   1218 O  O   . TYR A 1 182 ? 13.842  23.311  14.238  1.00 57.62 ? 182  TYR A O   1 
ATOM   1219 C  CB  . TYR A 1 182 ? 11.463  23.145  15.684  1.00 57.35 ? 182  TYR A CB  1 
ATOM   1220 C  CG  . TYR A 1 182 ? 10.592  22.984  16.916  1.00 56.90 ? 182  TYR A CG  1 
ATOM   1221 C  CD1 . TYR A 1 182 ? 9.850   24.051  17.428  1.00 56.78 ? 182  TYR A CD1 1 
ATOM   1222 C  CD2 . TYR A 1 182 ? 10.486  21.746  17.557  1.00 56.06 ? 182  TYR A CD2 1 
ATOM   1223 C  CE1 . TYR A 1 182 ? 9.042   23.895  18.550  1.00 56.06 ? 182  TYR A CE1 1 
ATOM   1224 C  CE2 . TYR A 1 182 ? 9.675   21.584  18.673  1.00 55.81 ? 182  TYR A CE2 1 
ATOM   1225 C  CZ  . TYR A 1 182 ? 8.958   22.665  19.160  1.00 55.61 ? 182  TYR A CZ  1 
ATOM   1226 O  OH  . TYR A 1 182 ? 8.161   22.520  20.262  1.00 55.85 ? 182  TYR A OH  1 
ATOM   1227 N  N   . MET A 1 183 ? 13.317  25.417  13.584  1.00 57.17 ? 183  MET A N   1 
ATOM   1228 C  CA  . MET A 1 183 ? 14.150  25.422  12.385  1.00 56.63 ? 183  MET A CA  1 
ATOM   1229 C  C   . MET A 1 183 ? 15.627  25.695  12.706  1.00 55.92 ? 183  MET A C   1 
ATOM   1230 O  O   . MET A 1 183 ? 16.048  26.854  12.810  1.00 55.93 ? 183  MET A O   1 
ATOM   1231 C  CB  . MET A 1 183 ? 13.596  26.431  11.361  1.00 56.73 ? 183  MET A CB  1 
ATOM   1232 C  CG  . MET A 1 183 ? 13.416  27.866  11.889  1.00 57.06 ? 183  MET A CG  1 
ATOM   1233 S  SD  . MET A 1 183 ? 12.508  29.012  10.817  1.00 57.49 ? 183  MET A SD  1 
ATOM   1234 C  CE  . MET A 1 183 ? 13.537  29.048  9.348   1.00 58.24 ? 183  MET A CE  1 
ATOM   1235 N  N   . SER A 1 184 ? 16.404  24.618  12.852  1.00 54.98 ? 184  SER A N   1 
ATOM   1236 C  CA  . SER A 1 184 ? 17.823  24.689  13.250  1.00 54.01 ? 184  SER A CA  1 
ATOM   1237 C  C   . SER A 1 184 ? 18.623  25.687  12.424  1.00 53.31 ? 184  SER A C   1 
ATOM   1238 O  O   . SER A 1 184 ? 18.283  25.933  11.271  1.00 53.48 ? 184  SER A O   1 
ATOM   1239 C  CB  . SER A 1 184 ? 18.478  23.303  13.171  1.00 54.04 ? 184  SER A CB  1 
ATOM   1240 O  OG  . SER A 1 184 ? 18.617  22.871  11.827  1.00 53.83 ? 184  SER A OG  1 
ATOM   1241 N  N   . PRO A 1 185 ? 19.681  26.279  13.016  1.00 52.70 ? 185  PRO A N   1 
ATOM   1242 C  CA  . PRO A 1 185 ? 20.571  27.178  12.273  1.00 52.16 ? 185  PRO A CA  1 
ATOM   1243 C  C   . PRO A 1 185 ? 21.202  26.557  11.018  1.00 51.61 ? 185  PRO A C   1 
ATOM   1244 O  O   . PRO A 1 185 ? 21.481  27.283  10.066  1.00 51.44 ? 185  PRO A O   1 
ATOM   1245 C  CB  . PRO A 1 185 ? 21.652  27.531  13.300  1.00 52.21 ? 185  PRO A CB  1 
ATOM   1246 C  CG  . PRO A 1 185 ? 20.991  27.362  14.605  1.00 52.49 ? 185  PRO A CG  1 
ATOM   1247 C  CD  . PRO A 1 185 ? 20.084  26.178  14.430  1.00 52.70 ? 185  PRO A CD  1 
ATOM   1248 N  N   . GLU A 1 186 ? 21.414  25.238  11.018  1.00 50.98 ? 186  GLU A N   1 
ATOM   1249 C  CA  . GLU A 1 186 ? 21.960  24.525  9.849   1.00 50.29 ? 186  GLU A CA  1 
ATOM   1250 C  C   . GLU A 1 186 ? 20.998  24.547  8.673   1.00 49.94 ? 186  GLU A C   1 
ATOM   1251 O  O   . GLU A 1 186 ? 21.385  24.912  7.573   1.00 49.90 ? 186  GLU A O   1 
ATOM   1252 C  CB  . GLU A 1 186 ? 22.310  23.065  10.171  1.00 50.25 ? 186  GLU A CB  1 
ATOM   1253 C  CG  . GLU A 1 186 ? 23.390  22.879  11.214  1.00 49.60 ? 186  GLU A CG  1 
ATOM   1254 C  CD  . GLU A 1 186 ? 22.830  22.904  12.612  1.00 48.55 ? 186  GLU A CD  1 
ATOM   1255 O  OE1 . GLU A 1 186 ? 22.176  21.915  13.005  1.00 48.01 ? 186  GLU A OE1 1 
ATOM   1256 O  OE2 . GLU A 1 186 ? 23.043  23.917  13.310  1.00 48.19 ? 186  GLU A OE2 1 
ATOM   1257 N  N   . GLN A 1 187 ? 19.753  24.138  8.916   1.00 49.64 ? 187  GLN A N   1 
ATOM   1258 C  CA  . GLN A 1 187 ? 18.702  24.140  7.897   1.00 49.44 ? 187  GLN A CA  1 
ATOM   1259 C  C   . GLN A 1 187 ? 18.530  25.537  7.315   1.00 49.07 ? 187  GLN A C   1 
ATOM   1260 O  O   . GLN A 1 187 ? 18.275  25.708  6.123   1.00 48.98 ? 187  GLN A O   1 
ATOM   1261 C  CB  . GLN A 1 187 ? 17.374  23.671  8.503   1.00 49.51 ? 187  GLN A CB  1 
ATOM   1262 C  CG  . GLN A 1 187 ? 16.205  23.639  7.507   1.00 50.13 ? 187  GLN A CG  1 
ATOM   1263 C  CD  . GLN A 1 187 ? 14.853  23.942  8.145   1.00 50.96 ? 187  GLN A CD  1 
ATOM   1264 O  OE1 . GLN A 1 187 ? 14.756  24.222  9.346   1.00 50.06 ? 187  GLN A OE1 1 
ATOM   1265 N  NE2 . GLN A 1 187 ? 13.798  23.889  7.335   1.00 50.74 ? 187  GLN A NE2 1 
ATOM   1266 N  N   . MET A 1 188 ? 18.683  26.523  8.190   1.00 48.86 ? 188  MET A N   1 
ATOM   1267 C  CA  . MET A 1 188 ? 18.507  27.931  7.879   1.00 48.52 ? 188  MET A CA  1 
ATOM   1268 C  C   . MET A 1 188 ? 19.681  28.466  7.062   1.00 48.30 ? 188  MET A C   1 
ATOM   1269 O  O   . MET A 1 188 ? 19.486  29.081  6.007   1.00 48.36 ? 188  MET A O   1 
ATOM   1270 C  CB  . MET A 1 188 ? 18.372  28.677  9.203   1.00 48.61 ? 188  MET A CB  1 
ATOM   1271 C  CG  . MET A 1 188 ? 18.357  30.181  9.137   1.00 48.68 ? 188  MET A CG  1 
ATOM   1272 S  SD  . MET A 1 188 ? 18.147  30.768  10.823  1.00 48.35 ? 188  MET A SD  1 
ATOM   1273 C  CE  . MET A 1 188 ? 16.482  30.188  11.146  1.00 48.42 ? 188  MET A CE  1 
ATOM   1274 N  N   . ASN A 1 189 ? 20.896  28.215  7.547   1.00 47.94 ? 189  ASN A N   1 
ATOM   1275 C  CA  . ASN A 1 189 ? 22.118  28.642  6.863   1.00 47.64 ? 189  ASN A CA  1 
ATOM   1276 C  C   . ASN A 1 189 ? 22.456  27.776  5.646   1.00 47.25 ? 189  ASN A C   1 
ATOM   1277 O  O   . ASN A 1 189 ? 23.577  27.826  5.121   1.00 47.08 ? 189  ASN A O   1 
ATOM   1278 C  CB  . ASN A 1 189 ? 23.293  28.709  7.849   1.00 47.78 ? 189  ASN A CB  1 
ATOM   1279 C  CG  . ASN A 1 189 ? 23.090  29.762  8.935   1.00 48.21 ? 189  ASN A CG  1 
ATOM   1280 O  OD1 . ASN A 1 189 ? 22.537  30.836  8.684   1.00 49.18 ? 189  ASN A OD1 1 
ATOM   1281 N  ND2 . ASN A 1 189 ? 23.542  29.456  10.147  1.00 47.70 ? 189  ASN A ND2 1 
ATOM   1282 N  N   . ARG A 1 190 ? 21.464  26.996  5.210   1.00 46.75 ? 190  ARG A N   1 
ATOM   1283 C  CA  . ARG A 1 190 ? 21.536  26.144  4.012   1.00 46.32 ? 190  ARG A CA  1 
ATOM   1284 C  C   . ARG A 1 190 ? 22.593  25.037  4.107   1.00 45.83 ? 190  ARG A C   1 
ATOM   1285 O  O   . ARG A 1 190 ? 23.113  24.558  3.091   1.00 45.90 ? 190  ARG A O   1 
ATOM   1286 C  CB  . ARG A 1 190 ? 21.703  26.986  2.737   1.00 46.31 ? 190  ARG A CB  1 
ATOM   1287 C  CG  . ARG A 1 190 ? 20.471  27.802  2.368   1.00 46.49 ? 190  ARG A CG  1 
ATOM   1288 N  N   . MET A 1 191 ? 22.900  24.645  5.341   1.00 45.15 ? 191  MET A N   1 
ATOM   1289 C  CA  . MET A 1 191 ? 23.786  23.522  5.614   1.00 44.44 ? 191  MET A CA  1 
ATOM   1290 C  C   . MET A 1 191 ? 22.996  22.227  5.492   1.00 43.85 ? 191  MET A C   1 
ATOM   1291 O  O   . MET A 1 191 ? 21.785  22.206  5.716   1.00 43.80 ? 191  MET A O   1 
ATOM   1292 C  CB  . MET A 1 191 ? 24.387  23.632  7.020   1.00 44.49 ? 191  MET A CB  1 
ATOM   1293 C  CG  . MET A 1 191 ? 25.328  24.812  7.229   1.00 44.58 ? 191  MET A CG  1 
ATOM   1294 N  N   . SER A 1 192 ? 23.689  21.151  5.128   1.00 43.25 ? 192  SER A N   1 
ATOM   1295 C  CA  . SER A 1 192 ? 23.083  19.826  5.051   1.00 42.57 ? 192  SER A CA  1 
ATOM   1296 C  C   . SER A 1 192 ? 22.702  19.361  6.448   1.00 41.95 ? 192  SER A C   1 
ATOM   1297 O  O   . SER A 1 192 ? 23.343  19.751  7.434   1.00 41.96 ? 192  SER A O   1 
ATOM   1298 C  CB  . SER A 1 192 ? 24.055  18.828  4.423   1.00 42.73 ? 192  SER A CB  1 
ATOM   1299 O  OG  . SER A 1 192 ? 25.162  18.592  5.280   1.00 43.12 ? 192  SER A OG  1 
ATOM   1300 N  N   . TYR A 1 193 ? 21.658  18.536  6.522   1.00 41.13 ? 193  TYR A N   1 
ATOM   1301 C  CA  . TYR A 1 193 ? 21.170  18.000  7.789   1.00 40.00 ? 193  TYR A CA  1 
ATOM   1302 C  C   . TYR A 1 193 ? 22.191  17.064  8.447   1.00 38.90 ? 193  TYR A C   1 
ATOM   1303 O  O   . TYR A 1 193 ? 22.889  16.290  7.773   1.00 38.47 ? 193  TYR A O   1 
ATOM   1304 C  CB  . TYR A 1 193 ? 19.817  17.289  7.600   1.00 40.65 ? 193  TYR A CB  1 
ATOM   1305 C  CG  . TYR A 1 193 ? 19.520  16.207  8.633   1.00 41.49 ? 193  TYR A CG  1 
ATOM   1306 C  CD1 . TYR A 1 193 ? 20.022  14.911  8.472   1.00 42.34 ? 193  TYR A CD1 1 
ATOM   1307 C  CD2 . TYR A 1 193 ? 18.745  16.477  9.764   1.00 42.18 ? 193  TYR A CD2 1 
ATOM   1308 C  CE1 . TYR A 1 193 ? 19.775  13.915  9.405   1.00 42.61 ? 193  TYR A CE1 1 
ATOM   1309 C  CE2 . TYR A 1 193 ? 18.480  15.474  10.709  1.00 42.56 ? 193  TYR A CE2 1 
ATOM   1310 C  CZ  . TYR A 1 193 ? 19.003  14.195  10.515  1.00 41.96 ? 193  TYR A CZ  1 
ATOM   1311 O  OH  . TYR A 1 193 ? 18.767  13.185  11.420  1.00 42.30 ? 193  TYR A OH  1 
ATOM   1312 N  N   . ASN A 1 194 ? 22.260  17.157  9.771   1.00 37.33 ? 194  ASN A N   1 
ATOM   1313 C  CA  . ASN A 1 194 ? 23.010  16.224  10.590  1.00 35.65 ? 194  ASN A CA  1 
ATOM   1314 C  C   . ASN A 1 194 ? 22.186  15.855  11.817  1.00 34.51 ? 194  ASN A C   1 
ATOM   1315 O  O   . ASN A 1 194 ? 21.162  16.486  12.104  1.00 34.12 ? 194  ASN A O   1 
ATOM   1316 C  CB  . ASN A 1 194 ? 24.387  16.798  10.968  1.00 36.12 ? 194  ASN A CB  1 
ATOM   1317 C  CG  . ASN A 1 194 ? 24.296  18.084  11.768  1.00 35.86 ? 194  ASN A CG  1 
ATOM   1318 O  OD1 . ASN A 1 194 ? 23.526  18.178  12.704  1.00 39.48 ? 194  ASN A OD1 1 
ATOM   1319 N  ND2 . ASN A 1 194 ? 25.095  19.074  11.407  1.00 36.14 ? 194  ASN A ND2 1 
ATOM   1320 N  N   . GLU A 1 195 ? 22.627  14.824  12.529  1.00 32.80 ? 195  GLU A N   1 
ATOM   1321 C  CA  . GLU A 1 195 ? 21.934  14.340  13.711  1.00 31.46 ? 195  GLU A CA  1 
ATOM   1322 C  C   . GLU A 1 195 ? 21.873  15.384  14.829  1.00 30.30 ? 195  GLU A C   1 
ATOM   1323 O  O   . GLU A 1 195 ? 20.948  15.369  15.651  1.00 29.95 ? 195  GLU A O   1 
ATOM   1324 C  CB  . GLU A 1 195 ? 22.578  13.041  14.199  1.00 31.33 ? 195  GLU A CB  1 
ATOM   1325 C  CG  . GLU A 1 195 ? 22.282  11.877  13.271  1.00 32.76 ? 195  GLU A CG  1 
ATOM   1326 C  CD  . GLU A 1 195 ? 23.264  10.715  13.390  1.00 34.21 ? 195  GLU A CD  1 
ATOM   1327 O  OE1 . GLU A 1 195 ? 23.863  10.496  14.474  1.00 34.50 ? 195  GLU A OE1 1 
ATOM   1328 O  OE2 . GLU A 1 195 ? 23.413  9.999   12.383  1.00 34.90 ? 195  GLU A OE2 1 
ATOM   1329 N  N   . LYS A 1 196 ? 22.839  16.299  14.853  1.00 29.18 ? 196  LYS A N   1 
ATOM   1330 C  CA  . LYS A 1 196 ? 22.810  17.400  15.820  1.00 28.68 ? 196  LYS A CA  1 
ATOM   1331 C  C   . LYS A 1 196 ? 21.654  18.366  15.569  1.00 28.17 ? 196  LYS A C   1 
ATOM   1332 O  O   . LYS A 1 196 ? 21.181  19.005  16.502  1.00 27.59 ? 196  LYS A O   1 
ATOM   1333 C  CB  . LYS A 1 196 ? 24.153  18.136  15.885  1.00 28.97 ? 196  LYS A CB  1 
ATOM   1334 C  CG  . LYS A 1 196 ? 25.278  17.328  16.547  1.00 28.85 ? 196  LYS A CG  1 
ATOM   1335 C  CD  . LYS A 1 196 ? 25.039  17.151  18.043  1.00 26.42 ? 196  LYS A CD  1 
ATOM   1336 C  CE  . LYS A 1 196 ? 26.178  16.379  18.704  1.00 26.48 ? 196  LYS A CE  1 
ATOM   1337 N  NZ  . LYS A 1 196 ? 27.361  17.241  18.987  1.00 24.95 ? 196  LYS A NZ  1 
ATOM   1338 N  N   . SER A 1 197 ? 21.179  18.452  14.324  1.00 27.72 ? 197  SER A N   1 
ATOM   1339 C  CA  . SER A 1 197 ? 19.945  19.202  14.039  1.00 27.93 ? 197  SER A CA  1 
ATOM   1340 C  C   . SER A 1 197 ? 18.729  18.659  14.801  1.00 28.06 ? 197  SER A C   1 
ATOM   1341 O  O   . SER A 1 197 ? 17.886  19.437  15.252  1.00 27.36 ? 197  SER A O   1 
ATOM   1342 C  CB  . SER A 1 197 ? 19.651  19.250  12.540  1.00 27.89 ? 197  SER A CB  1 
ATOM   1343 O  OG  . SER A 1 197 ? 20.762  19.770  11.840  1.00 28.32 ? 197  SER A OG  1 
ATOM   1344 N  N   . ASP A 1 198 ? 18.639  17.328  14.937  1.00 28.34 ? 198  ASP A N   1 
ATOM   1345 C  CA  . ASP A 1 198 ? 17.581  16.699  15.753  1.00 28.40 ? 198  ASP A CA  1 
ATOM   1346 C  C   . ASP A 1 198 ? 17.670  17.049  17.238  1.00 27.62 ? 198  ASP A C   1 
ATOM   1347 O  O   . ASP A 1 198 ? 16.645  17.136  17.924  1.00 27.46 ? 198  ASP A O   1 
ATOM   1348 C  CB  . ASP A 1 198 ? 17.603  15.181  15.586  1.00 28.51 ? 198  ASP A CB  1 
ATOM   1349 C  CG  . ASP A 1 198 ? 17.158  14.740  14.210  1.00 31.89 ? 198  ASP A CG  1 
ATOM   1350 O  OD1 . ASP A 1 198 ? 16.616  15.575  13.451  1.00 34.23 ? 198  ASP A OD1 1 
ATOM   1351 O  OD2 . ASP A 1 198 ? 17.350  13.545  13.879  1.00 35.39 ? 198  ASP A OD2 1 
ATOM   1352 N  N   . ILE A 1 199 ? 18.898  17.221  17.733  1.00 27.14 ? 199  ILE A N   1 
ATOM   1353 C  CA  . ILE A 1 199 ? 19.139  17.662  19.111  1.00 26.35 ? 199  ILE A CA  1 
ATOM   1354 C  C   . ILE A 1 199 ? 18.600  19.083  19.327  1.00 26.48 ? 199  ILE A C   1 
ATOM   1355 O  O   . ILE A 1 199 ? 17.961  19.373  20.360  1.00 26.10 ? 199  ILE A O   1 
ATOM   1356 C  CB  . ILE A 1 199 ? 20.650  17.575  19.509  1.00 26.40 ? 199  ILE A CB  1 
ATOM   1357 C  CG1 . ILE A 1 199 ? 21.226  16.170  19.278  1.00 25.37 ? 199  ILE A CG1 1 
ATOM   1358 C  CG2 . ILE A 1 199 ? 20.877  18.062  20.972  1.00 25.15 ? 199  ILE A CG2 1 
ATOM   1359 C  CD1 . ILE A 1 199 ? 20.478  15.033  19.933  1.00 25.27 ? 199  ILE A CD1 1 
ATOM   1360 N  N   . TRP A 1 200 ? 18.863  19.968  18.366  1.00 26.06 ? 200  TRP A N   1 
ATOM   1361 C  CA  . TRP A 1 200 ? 18.255  21.312  18.369  1.00 26.85 ? 200  TRP A CA  1 
ATOM   1362 C  C   . TRP A 1 200 ? 16.721  21.243  18.489  1.00 27.07 ? 200  TRP A C   1 
ATOM   1363 O  O   . TRP A 1 200 ? 16.140  21.874  19.359  1.00 27.79 ? 200  TRP A O   1 
ATOM   1364 C  CB  . TRP A 1 200 ? 18.669  22.109  17.118  1.00 26.37 ? 200  TRP A CB  1 
ATOM   1365 C  CG  . TRP A 1 200 ? 17.890  23.401  16.924  1.00 26.25 ? 200  TRP A CG  1 
ATOM   1366 C  CD1 . TRP A 1 200 ? 16.683  23.546  16.293  1.00 25.67 ? 200  TRP A CD1 1 
ATOM   1367 C  CD2 . TRP A 1 200 ? 18.265  24.710  17.365  1.00 25.40 ? 200  TRP A CD2 1 
ATOM   1368 N  NE1 . TRP A 1 200 ? 16.286  24.854  16.318  1.00 26.93 ? 200  TRP A NE1 1 
ATOM   1369 C  CE2 . TRP A 1 200 ? 17.237  25.594  16.972  1.00 26.49 ? 200  TRP A CE2 1 
ATOM   1370 C  CE3 . TRP A 1 200 ? 19.368  25.222  18.052  1.00 25.42 ? 200  TRP A CE3 1 
ATOM   1371 C  CZ2 . TRP A 1 200 ? 17.285  26.967  17.235  1.00 27.13 ? 200  TRP A CZ2 1 
ATOM   1372 C  CZ3 . TRP A 1 200 ? 19.423  26.592  18.309  1.00 26.63 ? 200  TRP A CZ3 1 
ATOM   1373 C  CH2 . TRP A 1 200 ? 18.387  27.448  17.901  1.00 27.14 ? 200  TRP A CH2 1 
ATOM   1374 N  N   . SER A 1 201 ? 16.073  20.478  17.611  1.00 27.89 ? 201  SER A N   1 
ATOM   1375 C  CA  . SER A 1 201 ? 14.611  20.331  17.640  1.00 28.55 ? 201  SER A CA  1 
ATOM   1376 C  C   . SER A 1 201 ? 14.105  19.740  18.950  1.00 28.23 ? 201  SER A C   1 
ATOM   1377 O  O   . SER A 1 201 ? 13.071  20.152  19.450  1.00 28.35 ? 201  SER A O   1 
ATOM   1378 C  CB  . SER A 1 201 ? 14.131  19.462  16.480  1.00 28.42 ? 201  SER A CB  1 
ATOM   1379 O  OG  . SER A 1 201 ? 14.633  19.960  15.268  1.00 30.82 ? 201  SER A OG  1 
ATOM   1380 N  N   . LEU A 1 202 ? 14.825  18.755  19.482  1.00 28.64 ? 202  LEU A N   1 
ATOM   1381 C  CA  . LEU A 1 202 ? 14.554  18.240  20.820  1.00 29.12 ? 202  LEU A CA  1 
ATOM   1382 C  C   . LEU A 1 202 ? 14.601  19.322  21.901  1.00 28.52 ? 202  LEU A C   1 
ATOM   1383 O  O   . LEU A 1 202 ? 13.749  19.350  22.773  1.00 27.89 ? 202  LEU A O   1 
ATOM   1384 C  CB  . LEU A 1 202 ? 15.522  17.091  21.170  1.00 29.41 ? 202  LEU A CB  1 
ATOM   1385 C  CG  . LEU A 1 202 ? 15.416  16.452  22.560  1.00 30.22 ? 202  LEU A CG  1 
ATOM   1386 C  CD1 . LEU A 1 202 ? 14.002  15.906  22.826  1.00 29.88 ? 202  LEU A CD1 1 
ATOM   1387 C  CD2 . LEU A 1 202 ? 16.479  15.348  22.714  1.00 29.91 ? 202  LEU A CD2 1 
ATOM   1388 N  N   . GLY A 1 203 ? 15.610  20.194  21.854  1.00 28.98 ? 203  GLY A N   1 
ATOM   1389 C  CA  . GLY A 1 203 ? 15.732  21.303  22.821  1.00 29.19 ? 203  GLY A CA  1 
ATOM   1390 C  C   . GLY A 1 203 ? 14.547  22.268  22.794  1.00 29.16 ? 203  GLY A C   1 
ATOM   1391 O  O   . GLY A 1 203 ? 14.046  22.677  23.839  1.00 29.81 ? 203  GLY A O   1 
ATOM   1392 N  N   . CYS A 1 204 ? 14.092  22.603  21.587  1.00 29.23 ? 204  CYS A N   1 
ATOM   1393 C  CA  . CYS A 1 204 ? 12.936  23.463  21.368  1.00 29.14 ? 204  CYS A CA  1 
ATOM   1394 C  C   . CYS A 1 204 ? 11.676  22.822  21.944  1.00 29.35 ? 204  CYS A C   1 
ATOM   1395 O  O   . CYS A 1 204 ? 10.858  23.500  22.551  1.00 29.13 ? 204  CYS A O   1 
ATOM   1396 C  CB  . CYS A 1 204 ? 12.734  23.726  19.867  1.00 28.95 ? 204  CYS A CB  1 
ATOM   1397 S  SG  . CYS A 1 204 ? 13.961  24.759  19.056  1.00 30.77 ? 204  CYS A SG  1 
ATOM   1398 N  N   . LEU A 1 205 ? 11.526  21.514  21.750  1.00 29.74 ? 205  LEU A N   1 
ATOM   1399 C  CA  . LEU A 1 205 ? 10.373  20.793  22.286  1.00 29.71 ? 205  LEU A CA  1 
ATOM   1400 C  C   . LEU A 1 205 ? 10.402  20.777  23.811  1.00 29.50 ? 205  LEU A C   1 
ATOM   1401 O  O   . LEU A 1 205 ? 9.418   21.113  24.462  1.00 29.93 ? 205  LEU A O   1 
ATOM   1402 C  CB  . LEU A 1 205 ? 10.287  19.370  21.702  1.00 29.83 ? 205  LEU A CB  1 
ATOM   1403 C  CG  . LEU A 1 205 ? 9.122   18.450  22.110  1.00 30.71 ? 205  LEU A CG  1 
ATOM   1404 C  CD1 . LEU A 1 205 ? 8.881   17.368  21.051  1.00 31.16 ? 205  LEU A CD1 1 
ATOM   1405 C  CD2 . LEU A 1 205 ? 9.338   17.811  23.476  1.00 30.87 ? 205  LEU A CD2 1 
ATOM   1406 N  N   . LEU A 1 206 ? 11.532  20.394  24.389  1.00 29.60 ? 206  LEU A N   1 
ATOM   1407 C  CA  . LEU A 1 206 ? 11.642  20.338  25.844  1.00 29.04 ? 206  LEU A CA  1 
ATOM   1408 C  C   . LEU A 1 206 ? 11.486  21.724  26.470  1.00 29.15 ? 206  LEU A C   1 
ATOM   1409 O  O   . LEU A 1 206 ? 10.904  21.869  27.544  1.00 29.57 ? 206  LEU A O   1 
ATOM   1410 C  CB  . LEU A 1 206 ? 12.964  19.688  26.263  1.00 28.56 ? 206  LEU A CB  1 
ATOM   1411 C  CG  . LEU A 1 206 ? 13.149  18.205  25.903  1.00 28.65 ? 206  LEU A CG  1 
ATOM   1412 C  CD1 . LEU A 1 206 ? 14.545  17.811  26.207  1.00 28.78 ? 206  LEU A CD1 1 
ATOM   1413 C  CD2 . LEU A 1 206 ? 12.135  17.277  26.660  1.00 28.48 ? 206  LEU A CD2 1 
ATOM   1414 N  N   . TYR A 1 207 ? 12.003  22.735  25.783  1.00 28.74 ? 207  TYR A N   1 
ATOM   1415 C  CA  . TYR A 1 207 ? 11.859  24.109  26.221  1.00 28.50 ? 207  TYR A CA  1 
ATOM   1416 C  C   . TYR A 1 207 ? 10.399  24.508  26.255  1.00 28.59 ? 207  TYR A C   1 
ATOM   1417 O  O   . TYR A 1 207 ? 9.927   25.043  27.259  1.00 28.26 ? 207  TYR A O   1 
ATOM   1418 C  CB  . TYR A 1 207 ? 12.616  25.058  25.288  1.00 28.07 ? 207  TYR A CB  1 
ATOM   1419 C  CG  . TYR A 1 207 ? 12.608  26.481  25.788  1.00 28.19 ? 207  TYR A CG  1 
ATOM   1420 C  CD1 . TYR A 1 207 ? 11.501  27.313  25.583  1.00 28.23 ? 207  TYR A CD1 1 
ATOM   1421 C  CD2 . TYR A 1 207 ? 13.696  26.993  26.489  1.00 27.63 ? 207  TYR A CD2 1 
ATOM   1422 C  CE1 . TYR A 1 207 ? 11.491  28.609  26.061  1.00 28.73 ? 207  TYR A CE1 1 
ATOM   1423 C  CE2 . TYR A 1 207 ? 13.694  28.284  26.961  1.00 27.00 ? 207  TYR A CE2 1 
ATOM   1424 C  CZ  . TYR A 1 207 ? 12.597  29.085  26.743  1.00 27.88 ? 207  TYR A CZ  1 
ATOM   1425 O  OH  . TYR A 1 207 ? 12.599  30.368  27.222  1.00 29.48 ? 207  TYR A OH  1 
ATOM   1426 N  N   . GLU A 1 208 ? 9.694   24.268  25.145  1.00 28.93 ? 208  GLU A N   1 
ATOM   1427 C  CA  . GLU A 1 208 ? 8.281   24.594  25.055  1.00 29.35 ? 208  GLU A CA  1 
ATOM   1428 C  C   . GLU A 1 208 ? 7.481   23.852  26.133  1.00 29.72 ? 208  GLU A C   1 
ATOM   1429 O  O   . GLU A 1 208 ? 6.549   24.401  26.721  1.00 29.68 ? 208  GLU A O   1 
ATOM   1430 C  CB  . GLU A 1 208 ? 7.728   24.291  23.659  1.00 29.19 ? 208  GLU A CB  1 
ATOM   1431 C  CG  . GLU A 1 208 ? 6.357   24.889  23.449  1.00 30.67 ? 208  GLU A CG  1 
ATOM   1432 C  CD  . GLU A 1 208 ? 5.765   24.625  22.094  1.00 34.09 ? 208  GLU A CD  1 
ATOM   1433 O  OE1 . GLU A 1 208 ? 6.493   24.237  21.157  1.00 37.19 ? 208  GLU A OE1 1 
ATOM   1434 O  OE2 . GLU A 1 208 ? 4.544   24.814  21.958  1.00 36.30 ? 208  GLU A OE2 1 
ATOM   1435 N  N   . LEU A 1 209 ? 7.853   22.604  26.385  1.00 30.12 ? 209  LEU A N   1 
ATOM   1436 C  CA  . LEU A 1 209 ? 7.217   21.785  27.418  1.00 31.19 ? 209  LEU A CA  1 
ATOM   1437 C  C   . LEU A 1 209 ? 7.357   22.416  28.818  1.00 30.79 ? 209  LEU A C   1 
ATOM   1438 O  O   . LEU A 1 209 ? 6.416   22.416  29.611  1.00 30.78 ? 209  LEU A O   1 
ATOM   1439 C  CB  . LEU A 1 209 ? 7.850   20.394  27.388  1.00 31.72 ? 209  LEU A CB  1 
ATOM   1440 C  CG  . LEU A 1 209 ? 7.030   19.179  27.792  1.00 34.18 ? 209  LEU A CG  1 
ATOM   1441 C  CD1 . LEU A 1 209 ? 5.767   19.065  26.960  1.00 31.39 ? 209  LEU A CD1 1 
ATOM   1442 C  CD2 . LEU A 1 209 ? 7.936   17.946  27.625  1.00 34.32 ? 209  LEU A CD2 1 
ATOM   1443 N  N   . CYS A 1 210 ? 8.528   22.982  29.092  1.00 30.88 ? 210  CYS A N   1 
ATOM   1444 C  CA  . CYS A 1 210 ? 8.778   23.724  30.342  1.00 30.48 ? 210  CYS A CA  1 
ATOM   1445 C  C   . CYS A 1 210 ? 8.130   25.108  30.382  1.00 30.39 ? 210  CYS A C   1 
ATOM   1446 O  O   . CYS A 1 210 ? 7.491   25.460  31.383  1.00 29.96 ? 210  CYS A O   1 
ATOM   1447 C  CB  . CYS A 1 210 ? 10.280  23.882  30.593  1.00 30.03 ? 210  CYS A CB  1 
ATOM   1448 S  SG  . CYS A 1 210 ? 11.171  22.348  30.820  1.00 30.58 ? 210  CYS A SG  1 
ATOM   1449 N  N   . ALA A 1 211 ? 8.342   25.901  29.326  1.00 29.91 ? 211  ALA A N   1 
ATOM   1450 C  CA  . ALA A 1 211 ? 7.925   27.318  29.297  1.00 29.96 ? 211  ALA A CA  1 
ATOM   1451 C  C   . ALA A 1 211 ? 6.498   27.520  28.796  1.00 29.89 ? 211  ALA A C   1 
ATOM   1452 O  O   . ALA A 1 211 ? 5.904   28.603  28.942  1.00 29.23 ? 211  ALA A O   1 
ATOM   1453 C  CB  . ALA A 1 211 ? 8.919   28.152  28.457  1.00 28.96 ? 211  ALA A CB  1 
ATOM   1454 N  N   . LEU A 1 212 ? 5.946   26.457  28.215  1.00 30.98 ? 212  LEU A N   1 
ATOM   1455 C  CA  . LEU A 1 212 ? 4.655   26.494  27.508  1.00 31.68 ? 212  LEU A CA  1 
ATOM   1456 C  C   . LEU A 1 212 ? 4.665   27.495  26.349  1.00 32.54 ? 212  LEU A C   1 
ATOM   1457 O  O   . LEU A 1 212 ? 3.622   27.897  25.841  1.00 33.23 ? 212  LEU A O   1 
ATOM   1458 C  CB  . LEU A 1 212 ? 3.484   26.710  28.474  1.00 31.47 ? 212  LEU A CB  1 
ATOM   1459 C  CG  . LEU A 1 212 ? 3.331   25.657  29.585  1.00 31.46 ? 212  LEU A CG  1 
ATOM   1460 C  CD1 . LEU A 1 212 ? 2.338   26.148  30.623  1.00 29.97 ? 212  LEU A CD1 1 
ATOM   1461 C  CD2 . LEU A 1 212 ? 2.929   24.260  29.063  1.00 27.28 ? 212  LEU A CD2 1 
ATOM   1462 N  N   . MET A 1 213 ? 5.868   27.886  25.942  1.00 33.44 ? 213  MET A N   1 
ATOM   1463 C  CA  . MET A 1 213 ? 6.086   28.686  24.747  1.00 34.77 ? 213  MET A CA  1 
ATOM   1464 C  C   . MET A 1 213 ? 7.409   28.257  24.127  1.00 33.33 ? 213  MET A C   1 
ATOM   1465 O  O   . MET A 1 213 ? 8.290   27.783  24.849  1.00 33.58 ? 213  MET A O   1 
ATOM   1466 C  CB  . MET A 1 213 ? 6.076   30.194  25.060  1.00 34.79 ? 213  MET A CB  1 
ATOM   1467 C  CG  . MET A 1 213 ? 6.963   30.650  26.220  1.00 36.19 ? 213  MET A CG  1 
ATOM   1468 S  SD  . MET A 1 213 ? 6.749   32.430  26.560  1.00 40.15 ? 213  MET A SD  1 
ATOM   1469 C  CE  . MET A 1 213 ? 4.998   32.509  26.965  1.00 39.63 ? 213  MET A CE  1 
ATOM   1470 N  N   . PRO A 1 214 ? 7.536   28.362  22.787  1.00 32.52 ? 214  PRO A N   1 
ATOM   1471 C  CA  . PRO A 1 214 ? 8.818   28.076  22.132  1.00 31.90 ? 214  PRO A CA  1 
ATOM   1472 C  C   . PRO A 1 214 ? 9.909   29.081  22.535  1.00 31.07 ? 214  PRO A C   1 
ATOM   1473 O  O   . PRO A 1 214 ? 9.584   30.186  22.941  1.00 30.34 ? 214  PRO A O   1 
ATOM   1474 C  CB  . PRO A 1 214 ? 8.493   28.165  20.631  1.00 31.90 ? 214  PRO A CB  1 
ATOM   1475 C  CG  . PRO A 1 214 ? 7.206   28.915  20.543  1.00 32.74 ? 214  PRO A CG  1 
ATOM   1476 C  CD  . PRO A 1 214 ? 6.470   28.688  21.820  1.00 32.65 ? 214  PRO A CD  1 
ATOM   1477 N  N   . PRO A 1 215 ? 11.199  28.682  22.452  1.00 30.69 ? 215  PRO A N   1 
ATOM   1478 C  CA  . PRO A 1 215 ? 12.296  29.570  22.872  1.00 30.67 ? 215  PRO A CA  1 
ATOM   1479 C  C   . PRO A 1 215 ? 12.411  30.849  22.048  1.00 31.35 ? 215  PRO A C   1 
ATOM   1480 O  O   . PRO A 1 215 ? 12.787  31.900  22.586  1.00 31.23 ? 215  PRO A O   1 
ATOM   1481 C  CB  . PRO A 1 215 ? 13.551  28.702  22.703  1.00 30.75 ? 215  PRO A CB  1 
ATOM   1482 C  CG  . PRO A 1 215 ? 13.155  27.590  21.818  1.00 30.39 ? 215  PRO A CG  1 
ATOM   1483 C  CD  . PRO A 1 215 ? 11.688  27.370  21.998  1.00 30.32 ? 215  PRO A CD  1 
ATOM   1484 N  N   . PHE A 1 216 ? 12.079  30.748  20.759  1.00 31.63 ? 216  PHE A N   1 
ATOM   1485 C  CA  . PHE A 1 216 ? 12.145  31.864  19.833  1.00 32.44 ? 216  PHE A CA  1 
ATOM   1486 C  C   . PHE A 1 216 ? 10.768  32.085  19.229  1.00 33.93 ? 216  PHE A C   1 
ATOM   1487 O  O   . PHE A 1 216 ? 10.097  31.129  18.816  1.00 34.73 ? 216  PHE A O   1 
ATOM   1488 C  CB  . PHE A 1 216 ? 13.162  31.576  18.726  1.00 31.74 ? 216  PHE A CB  1 
ATOM   1489 C  CG  . PHE A 1 216 ? 14.499  31.107  19.232  1.00 30.22 ? 216  PHE A CG  1 
ATOM   1490 C  CD1 . PHE A 1 216 ? 15.474  32.024  19.615  1.00 28.58 ? 216  PHE A CD1 1 
ATOM   1491 C  CD2 . PHE A 1 216 ? 14.783  29.751  19.326  1.00 29.60 ? 216  PHE A CD2 1 
ATOM   1492 C  CE1 . PHE A 1 216 ? 16.718  31.599  20.091  1.00 27.52 ? 216  PHE A CE1 1 
ATOM   1493 C  CE2 . PHE A 1 216 ? 16.023  29.314  19.810  1.00 30.45 ? 216  PHE A CE2 1 
ATOM   1494 C  CZ  . PHE A 1 216 ? 16.998  30.256  20.181  1.00 29.25 ? 216  PHE A CZ  1 
ATOM   1495 N  N   . THR A 1 217 ? 10.340  33.343  19.200  1.00 35.03 ? 217  THR A N   1 
ATOM   1496 C  CA  . THR A 1 217 ? 9.076   33.730  18.585  1.00 36.18 ? 217  THR A CA  1 
ATOM   1497 C  C   . THR A 1 217 ? 9.233   35.091  17.924  1.00 36.83 ? 217  THR A C   1 
ATOM   1498 O  O   . THR A 1 217 ? 9.996   35.938  18.395  1.00 36.72 ? 217  THR A O   1 
ATOM   1499 C  CB  . THR A 1 217 ? 7.886   33.805  19.596  1.00 36.17 ? 217  THR A CB  1 
ATOM   1500 O  OG1 . THR A 1 217 ? 8.069   34.911  20.488  1.00 37.07 ? 217  THR A OG1 1 
ATOM   1501 C  CG2 . THR A 1 217 ? 7.731   32.518  20.400  1.00 36.11 ? 217  THR A CG2 1 
ATOM   1502 N  N   . ALA A 1 218 ? 8.506   35.286  16.828  1.00 37.85 ? 218  ALA A N   1 
ATOM   1503 C  CA  . ALA A 1 218 ? 8.514   36.545  16.089  1.00 38.92 ? 218  ALA A CA  1 
ATOM   1504 C  C   . ALA A 1 218 ? 7.277   36.657  15.202  1.00 39.68 ? 218  ALA A C   1 
ATOM   1505 O  O   . ALA A 1 218 ? 6.548   35.676  15.006  1.00 39.83 ? 218  ALA A O   1 
ATOM   1506 C  CB  . ALA A 1 218 ? 9.783   36.670  15.261  1.00 38.65 ? 218  ALA A CB  1 
ATOM   1507 N  N   . PHE A 1 219 ? 7.054   37.862  14.678  1.00 40.83 ? 219  PHE A N   1 
ATOM   1508 C  CA  . PHE A 1 219 ? 5.891   38.180  13.852  1.00 41.73 ? 219  PHE A CA  1 
ATOM   1509 C  C   . PHE A 1 219 ? 6.116   37.831  12.377  1.00 41.80 ? 219  PHE A C   1 
ATOM   1510 O  O   . PHE A 1 219 ? 5.158   37.689  11.612  1.00 42.00 ? 219  PHE A O   1 
ATOM   1511 C  CB  . PHE A 1 219 ? 5.531   39.667  13.992  1.00 42.38 ? 219  PHE A CB  1 
ATOM   1512 C  CG  . PHE A 1 219 ? 5.481   40.155  15.420  1.00 43.80 ? 219  PHE A CG  1 
ATOM   1513 C  CD1 . PHE A 1 219 ? 6.560   40.857  15.968  1.00 45.17 ? 219  PHE A CD1 1 
ATOM   1514 C  CD2 . PHE A 1 219 ? 4.360   39.913  16.217  1.00 44.92 ? 219  PHE A CD2 1 
ATOM   1515 C  CE1 . PHE A 1 219 ? 6.524   41.313  17.290  1.00 45.76 ? 219  PHE A CE1 1 
ATOM   1516 C  CE2 . PHE A 1 219 ? 4.311   40.360  17.541  1.00 45.63 ? 219  PHE A CE2 1 
ATOM   1517 C  CZ  . PHE A 1 219 ? 5.395   41.063  18.080  1.00 45.33 ? 219  PHE A CZ  1 
ATOM   1518 N  N   . SER A 1 220 ? 7.384   37.708  11.987  1.00 41.66 ? 220  SER A N   1 
ATOM   1519 C  CA  . SER A 1 220 ? 7.757   37.266  10.644  1.00 41.24 ? 220  SER A CA  1 
ATOM   1520 C  C   . SER A 1 220 ? 8.768   36.118  10.709  1.00 40.97 ? 220  SER A C   1 
ATOM   1521 O  O   . SER A 1 220 ? 9.389   35.892  11.746  1.00 40.52 ? 220  SER A O   1 
ATOM   1522 C  CB  . SER A 1 220 ? 8.348   38.428  9.859   1.00 41.29 ? 220  SER A CB  1 
ATOM   1523 O  OG  . SER A 1 220 ? 8.631   38.044  8.528   1.00 42.10 ? 220  SER A OG  1 
ATOM   1524 N  N   . GLN A 1 221 ? 8.928   35.405  9.595   1.00 40.75 ? 221  GLN A N   1 
ATOM   1525 C  CA  . GLN A 1 221 ? 9.906   34.314  9.491   1.00 40.59 ? 221  GLN A CA  1 
ATOM   1526 C  C   . GLN A 1 221 ? 11.351  34.800  9.386   1.00 40.27 ? 221  GLN A C   1 
ATOM   1527 O  O   . GLN A 1 221 ? 12.260  34.165  9.919   1.00 40.06 ? 221  GLN A O   1 
ATOM   1528 C  CB  . GLN A 1 221 ? 9.576   33.388  8.321   1.00 40.63 ? 221  GLN A CB  1 
ATOM   1529 C  CG  . GLN A 1 221 ? 8.889   32.095  8.726   1.00 41.41 ? 221  GLN A CG  1 
ATOM   1530 C  CD  . GLN A 1 221 ? 8.214   31.402  7.556   1.00 43.09 ? 221  GLN A CD  1 
ATOM   1531 O  OE1 . GLN A 1 221 ? 8.605   30.299  7.165   1.00 43.94 ? 221  GLN A OE1 1 
ATOM   1532 N  NE2 . GLN A 1 221 ? 7.198   32.051  6.982   1.00 42.81 ? 221  GLN A NE2 1 
ATOM   1533 N  N   . LYS A 1 222 ? 11.561  35.915  8.691   1.00 40.08 ? 222  LYS A N   1 
ATOM   1534 C  CA  . LYS A 1 222 ? 12.889  36.530  8.630   1.00 39.98 ? 222  LYS A CA  1 
ATOM   1535 C  C   . LYS A 1 222 ? 13.239  37.176  9.977   1.00 39.71 ? 222  LYS A C   1 
ATOM   1536 O  O   . LYS A 1 222 ? 14.414  37.326  10.312  1.00 39.74 ? 222  LYS A O   1 
ATOM   1537 C  CB  . LYS A 1 222 ? 13.005  37.516  7.452   1.00 39.93 ? 222  LYS A CB  1 
ATOM   1538 C  CG  . LYS A 1 222 ? 12.210  38.819  7.577   1.00 40.35 ? 222  LYS A CG  1 
ATOM   1539 C  CD  . LYS A 1 222 ? 13.106  40.022  7.873   1.00 40.77 ? 222  LYS A CD  1 
ATOM   1540 C  CE  . LYS A 1 222 ? 13.768  40.567  6.611   1.00 41.18 ? 222  LYS A CE  1 
ATOM   1541 N  N   . GLU A 1 223 ? 12.204  37.540  10.737  1.00 39.33 ? 223  GLU A N   1 
ATOM   1542 C  CA  . GLU A 1 223 ? 12.359  38.076  12.084  1.00 39.14 ? 223  GLU A CA  1 
ATOM   1543 C  C   . GLU A 1 223 ? 12.665  36.936  13.053  1.00 38.56 ? 223  GLU A C   1 
ATOM   1544 O  O   . GLU A 1 223 ? 13.459  37.098  13.981  1.00 38.35 ? 223  GLU A O   1 
ATOM   1545 C  CB  . GLU A 1 223 ? 11.094  38.821  12.520  1.00 39.08 ? 223  GLU A CB  1 
ATOM   1546 C  CG  . GLU A 1 223 ? 10.867  40.169  11.825  1.00 39.99 ? 223  GLU A CG  1 
ATOM   1547 C  CD  . GLU A 1 223 ? 9.524   40.805  12.178  1.00 40.19 ? 223  GLU A CD  1 
ATOM   1548 O  OE1 . GLU A 1 223 ? 8.632   40.096  12.703  1.00 43.27 ? 223  GLU A OE1 1 
ATOM   1549 O  OE2 . GLU A 1 223 ? 9.358   42.017  11.930  1.00 41.56 ? 223  GLU A OE2 1 
ATOM   1550 N  N   . LEU A 1 224 ? 12.028  35.788  12.822  1.00 37.98 ? 224  LEU A N   1 
ATOM   1551 C  CA  . LEU A 1 224 ? 12.295  34.566  13.573  1.00 37.43 ? 224  LEU A CA  1 
ATOM   1552 C  C   . LEU A 1 224 ? 13.738  34.109  13.380  1.00 36.97 ? 224  LEU A C   1 
ATOM   1553 O  O   . LEU A 1 224 ? 14.426  33.772  14.349  1.00 36.68 ? 224  LEU A O   1 
ATOM   1554 C  CB  . LEU A 1 224 ? 11.316  33.454  13.173  1.00 37.33 ? 224  LEU A CB  1 
ATOM   1555 C  CG  . LEU A 1 224 ? 11.532  32.070  13.804  1.00 37.92 ? 224  LEU A CG  1 
ATOM   1556 C  CD1 . LEU A 1 224 ? 11.489  32.134  15.328  1.00 37.40 ? 224  LEU A CD1 1 
ATOM   1557 C  CD2 . LEU A 1 224 ? 10.520  31.055  13.276  1.00 38.20 ? 224  LEU A CD2 1 
ATOM   1558 N  N   . ALA A 1 225 ? 14.177  34.106  12.124  1.00 36.59 ? 225  ALA A N   1 
ATOM   1559 C  CA  . ALA A 1 225 ? 15.547  33.761  11.750  1.00 36.64 ? 225  ALA A CA  1 
ATOM   1560 C  C   . ALA A 1 225 ? 16.575  34.614  12.488  1.00 36.51 ? 225  ALA A C   1 
ATOM   1561 O  O   . ALA A 1 225 ? 17.628  34.116  12.885  1.00 36.22 ? 225  ALA A O   1 
ATOM   1562 C  CB  . ALA A 1 225 ? 15.738  33.901  10.230  1.00 36.42 ? 225  ALA A CB  1 
ATOM   1563 N  N   . GLY A 1 226 ? 16.262  35.900  12.651  1.00 36.50 ? 226  GLY A N   1 
ATOM   1564 C  CA  . GLY A 1 226 ? 17.123  36.831  13.376  1.00 36.46 ? 226  GLY A CA  1 
ATOM   1565 C  C   . GLY A 1 226 ? 17.251  36.483  14.847  1.00 36.35 ? 226  GLY A C   1 
ATOM   1566 O  O   . GLY A 1 226 ? 18.340  36.574  15.413  1.00 36.45 ? 226  GLY A O   1 
ATOM   1567 N  N   . LYS A 1 227 ? 16.135  36.088  15.458  1.00 36.23 ? 227  LYS A N   1 
ATOM   1568 C  CA  . LYS A 1 227 ? 16.110  35.667  16.860  1.00 36.56 ? 227  LYS A CA  1 
ATOM   1569 C  C   . LYS A 1 227 ? 16.927  34.390  17.083  1.00 36.37 ? 227  LYS A C   1 
ATOM   1570 O  O   . LYS A 1 227 ? 17.740  34.314  18.013  1.00 36.28 ? 227  LYS A O   1 
ATOM   1571 C  CB  . LYS A 1 227 ? 14.662  35.440  17.342  1.00 36.60 ? 227  LYS A CB  1 
ATOM   1572 C  CG  . LYS A 1 227 ? 13.766  36.672  17.313  1.00 37.49 ? 227  LYS A CG  1 
ATOM   1573 C  CD  . LYS A 1 227 ? 14.002  37.568  18.523  1.00 39.20 ? 227  LYS A CD  1 
ATOM   1574 C  CE  . LYS A 1 227 ? 13.150  38.821  18.444  1.00 39.68 ? 227  LYS A CE  1 
ATOM   1575 N  N   . ILE A 1 228 ? 16.699  33.394  16.225  1.00 35.93 ? 228  ILE A N   1 
ATOM   1576 C  CA  . ILE A 1 228 ? 17.356  32.090  16.345  1.00 35.60 ? 228  ILE A CA  1 
ATOM   1577 C  C   . ILE A 1 228 ? 18.870  32.231  16.271  1.00 35.77 ? 228  ILE A C   1 
ATOM   1578 O  O   . ILE A 1 228 ? 19.593  31.606  17.050  1.00 35.73 ? 228  ILE A O   1 
ATOM   1579 C  CB  . ILE A 1 228 ? 16.875  31.112  15.248  1.00 35.45 ? 228  ILE A CB  1 
ATOM   1580 C  CG1 . ILE A 1 228 ? 15.449  30.660  15.531  1.00 34.76 ? 228  ILE A CG1 1 
ATOM   1581 C  CG2 . ILE A 1 228 ? 17.794  29.899  15.155  1.00 35.87 ? 228  ILE A CG2 1 
ATOM   1582 C  CD1 . ILE A 1 228 ? 14.732  30.162  14.333  1.00 34.25 ? 228  ILE A CD1 1 
ATOM   1583 N  N   . ARG A 1 229 ? 19.318  33.061  15.326  1.00 35.61 ? 229  ARG A N   1 
ATOM   1584 C  CA  . ARG A 1 229 ? 20.726  33.261  15.002  1.00 35.78 ? 229  ARG A CA  1 
ATOM   1585 C  C   . ARG A 1 229 ? 21.454  34.091  16.062  1.00 35.60 ? 229  ARG A C   1 
ATOM   1586 O  O   . ARG A 1 229 ? 22.639  33.871  16.325  1.00 35.53 ? 229  ARG A O   1 
ATOM   1587 C  CB  . ARG A 1 229 ? 20.832  33.913  13.622  1.00 35.73 ? 229  ARG A CB  1 
ATOM   1588 C  CG  . ARG A 1 229 ? 22.218  33.926  13.007  1.00 37.02 ? 229  ARG A CG  1 
ATOM   1589 C  CD  . ARG A 1 229 ? 22.202  33.802  11.462  1.00 38.74 ? 229  ARG A CD  1 
ATOM   1590 N  NE  . ARG A 1 229 ? 20.912  34.109  10.827  1.00 39.78 ? 229  ARG A NE  1 
ATOM   1591 C  CZ  . ARG A 1 229 ? 20.487  35.329  10.496  1.00 40.85 ? 229  ARG A CZ  1 
ATOM   1592 N  NH1 . ARG A 1 229 ? 21.231  36.401  10.751  1.00 41.54 ? 229  ARG A NH1 1 
ATOM   1593 N  NH2 . ARG A 1 229 ? 19.304  35.481  9.909   1.00 40.68 ? 229  ARG A NH2 1 
ATOM   1594 N  N   . GLU A 1 230 ? 20.739  35.046  16.660  1.00 35.29 ? 230  GLU A N   1 
ATOM   1595 C  CA  . GLU A 1 230 ? 21.203  35.730  17.871  1.00 34.61 ? 230  GLU A CA  1 
ATOM   1596 C  C   . GLU A 1 230 ? 21.407  34.732  19.032  1.00 33.82 ? 230  GLU A C   1 
ATOM   1597 O  O   . GLU A 1 230 ? 22.317  34.901  19.846  1.00 33.95 ? 230  GLU A O   1 
ATOM   1598 C  CB  . GLU A 1 230 ? 20.225  36.835  18.267  1.00 34.57 ? 230  GLU A CB  1 
ATOM   1599 C  CG  . GLU A 1 230 ? 20.899  38.148  18.607  1.00 35.77 ? 230  GLU A CG  1 
ATOM   1600 N  N   . GLY A 1 231 ? 20.560  33.706  19.104  1.00 33.02 ? 231  GLY A N   1 
ATOM   1601 C  CA  . GLY A 1 231 ? 20.752  32.593  20.050  1.00 32.29 ? 231  GLY A CA  1 
ATOM   1602 C  C   . GLY A 1 231 ? 20.258  32.779  21.477  1.00 31.92 ? 231  GLY A C   1 
ATOM   1603 O  O   . GLY A 1 231 ? 20.569  31.959  22.353  1.00 31.76 ? 231  GLY A O   1 
ATOM   1604 N  N   . LYS A 1 232 ? 19.457  33.827  21.692  1.00 30.97 ? 232  LYS A N   1 
ATOM   1605 C  CA  . LYS A 1 232 ? 19.020  34.259  23.021  1.00 29.98 ? 232  LYS A CA  1 
ATOM   1606 C  C   . LYS A 1 232 ? 17.542  33.939  23.329  1.00 29.74 ? 232  LYS A C   1 
ATOM   1607 O  O   . LYS A 1 232 ? 16.662  34.050  22.464  1.00 29.81 ? 232  LYS A O   1 
ATOM   1608 C  CB  . LYS A 1 232 ? 19.238  35.764  23.174  1.00 29.89 ? 232  LYS A CB  1 
ATOM   1609 C  CG  A LYS A 1 232 ? 20.705  36.145  23.262  0.50 29.94 ? 232  LYS A CG  1 
ATOM   1610 C  CG  B LYS A 1 232 ? 20.675  36.240  23.208  0.50 29.56 ? 232  LYS A CG  1 
ATOM   1611 C  CD  A LYS A 1 232 ? 20.922  37.637  23.132  0.50 30.30 ? 232  LYS A CD  1 
ATOM   1612 C  CD  B LYS A 1 232 ? 20.697  37.755  23.252  0.50 29.28 ? 232  LYS A CD  1 
ATOM   1613 C  CE  A LYS A 1 232 ? 22.347  37.950  22.671  0.50 30.86 ? 232  LYS A CE  1 
ATOM   1614 C  CE  B LYS A 1 232 ? 22.108  38.315  23.208  0.50 29.62 ? 232  LYS A CE  1 
ATOM   1615 N  NZ  A LYS A 1 232 ? 23.396  37.441  23.598  0.50 30.76 ? 232  LYS A NZ  1 
ATOM   1616 N  NZ  B LYS A 1 232 ? 22.071  39.800  23.276  0.50 28.43 ? 232  LYS A NZ  1 
ATOM   1617 N  N   . PHE A 1 233 ? 17.286  33.563  24.581  1.00 28.57 ? 233  PHE A N   1 
ATOM   1618 C  CA  . PHE A 1 233 ? 15.959  33.150  25.047  1.00 27.44 ? 233  PHE A CA  1 
ATOM   1619 C  C   . PHE A 1 233 ? 15.905  33.287  26.557  1.00 27.27 ? 233  PHE A C   1 
ATOM   1620 O  O   . PHE A 1 233 ? 16.936  33.405  27.217  1.00 26.95 ? 233  PHE A O   1 
ATOM   1621 C  CB  . PHE A 1 233 ? 15.630  31.697  24.656  1.00 26.96 ? 233  PHE A CB  1 
ATOM   1622 C  CG  . PHE A 1 233 ? 16.786  30.738  24.818  1.00 26.00 ? 233  PHE A CG  1 
ATOM   1623 C  CD1 . PHE A 1 233 ? 17.017  30.105  26.023  1.00 23.97 ? 233  PHE A CD1 1 
ATOM   1624 C  CD2 . PHE A 1 233 ? 17.650  30.486  23.754  1.00 26.63 ? 233  PHE A CD2 1 
ATOM   1625 C  CE1 . PHE A 1 233 ? 18.085  29.217  26.175  1.00 25.23 ? 233  PHE A CE1 1 
ATOM   1626 C  CE2 . PHE A 1 233 ? 18.739  29.606  23.890  1.00 26.54 ? 233  PHE A CE2 1 
ATOM   1627 C  CZ  . PHE A 1 233 ? 18.958  28.976  25.098  1.00 26.91 ? 233  PHE A CZ  1 
ATOM   1628 N  N   . ARG A 1 234 ? 14.690  33.282  27.091  1.00 27.58 ? 234  ARG A N   1 
ATOM   1629 C  CA  . ARG A 1 234 ? 14.470  33.347  28.526  1.00 27.53 ? 234  ARG A CA  1 
ATOM   1630 C  C   . ARG A 1 234 ? 14.845  31.996  29.102  1.00 27.82 ? 234  ARG A C   1 
ATOM   1631 O  O   . ARG A 1 234 ? 14.735  30.974  28.421  1.00 28.22 ? 234  ARG A O   1 
ATOM   1632 C  CB  . ARG A 1 234 ? 13.004  33.651  28.833  1.00 26.71 ? 234  ARG A CB  1 
ATOM   1633 C  CG  . ARG A 1 234 ? 12.556  35.017  28.377  1.00 26.75 ? 234  ARG A CG  1 
ATOM   1634 C  CD  . ARG A 1 234 ? 11.248  35.453  29.056  1.00 27.32 ? 234  ARG A CD  1 
ATOM   1635 N  NE  . ARG A 1 234 ? 11.339  35.587  30.517  1.00 27.08 ? 234  ARG A NE  1 
ATOM   1636 C  CZ  . ARG A 1 234 ? 11.835  36.638  31.174  1.00 28.23 ? 234  ARG A CZ  1 
ATOM   1637 N  NH1 . ARG A 1 234 ? 12.335  37.683  30.529  1.00 27.73 ? 234  ARG A NH1 1 
ATOM   1638 N  NH2 . ARG A 1 234 ? 11.852  36.634  32.497  1.00 28.07 ? 234  ARG A NH2 1 
ATOM   1639 N  N   . ARG A 1 235 ? 15.312  32.000  30.348  1.00 27.29 ? 235  ARG A N   1 
ATOM   1640 C  CA  . ARG A 1 235 ? 15.500  30.775  31.085  1.00 27.15 ? 235  ARG A CA  1 
ATOM   1641 C  C   . ARG A 1 235 ? 14.123  30.103  31.215  1.00 26.82 ? 235  ARG A C   1 
ATOM   1642 O  O   . ARG A 1 235 ? 13.100  30.784  31.259  1.00 26.46 ? 235  ARG A O   1 
ATOM   1643 C  CB  . ARG A 1 235 ? 16.048  31.102  32.479  1.00 27.01 ? 235  ARG A CB  1 
ATOM   1644 C  CG  . ARG A 1 235 ? 16.612  29.907  33.236  1.00 27.43 ? 235  ARG A CG  1 
ATOM   1645 C  CD  . ARG A 1 235 ? 16.346  30.061  34.733  1.00 27.54 ? 235  ARG A CD  1 
ATOM   1646 N  NE  . ARG A 1 235 ? 16.891  28.950  35.510  1.00 26.08 ? 235  ARG A NE  1 
ATOM   1647 C  CZ  . ARG A 1 235 ? 16.195  27.895  35.921  1.00 26.77 ? 235  ARG A CZ  1 
ATOM   1648 N  NH1 . ARG A 1 235 ? 14.901  27.775  35.626  1.00 23.32 ? 235  ARG A NH1 1 
ATOM   1649 N  NH2 . ARG A 1 235 ? 16.813  26.950  36.626  1.00 26.63 ? 235  ARG A NH2 1 
ATOM   1650 N  N   . ILE A 1 236 ? 14.097  28.777  31.302  1.00 26.73 ? 236  ILE A N   1 
ATOM   1651 C  CA  . ILE A 1 236 ? 12.846  28.074  31.604  1.00 26.60 ? 236  ILE A CA  1 
ATOM   1652 C  C   . ILE A 1 236 ? 12.360  28.499  33.010  1.00 26.40 ? 236  ILE A C   1 
ATOM   1653 O  O   . ILE A 1 236 ? 13.145  29.024  33.795  1.00 26.47 ? 236  ILE A O   1 
ATOM   1654 C  CB  . ILE A 1 236 ? 13.003  26.539  31.463  1.00 26.18 ? 236  ILE A CB  1 
ATOM   1655 C  CG1 . ILE A 1 236 ? 14.090  26.000  32.404  1.00 26.08 ? 236  ILE A CG1 1 
ATOM   1656 C  CG2 . ILE A 1 236 ? 13.288  26.160  30.003  1.00 26.56 ? 236  ILE A CG2 1 
ATOM   1657 C  CD1 . ILE A 1 236 ? 14.223  24.484  32.374  1.00 26.17 ? 236  ILE A CD1 1 
ATOM   1658 N  N   . PRO A 1 237 ? 11.063  28.324  33.319  1.00 26.67 ? 237  PRO A N   1 
ATOM   1659 C  CA  . PRO A 1 237 ? 10.611  28.753  34.661  1.00 26.70 ? 237  PRO A CA  1 
ATOM   1660 C  C   . PRO A 1 237 ? 11.506  28.257  35.808  1.00 26.85 ? 237  PRO A C   1 
ATOM   1661 O  O   . PRO A 1 237 ? 12.092  27.172  35.718  1.00 26.87 ? 237  PRO A O   1 
ATOM   1662 C  CB  . PRO A 1 237 ? 9.209   28.165  34.750  1.00 26.90 ? 237  PRO A CB  1 
ATOM   1663 C  CG  . PRO A 1 237 ? 8.734   28.176  33.312  1.00 26.19 ? 237  PRO A CG  1 
ATOM   1664 C  CD  . PRO A 1 237 ? 9.942   27.820  32.497  1.00 26.52 ? 237  PRO A CD  1 
ATOM   1665 N  N   . TYR A 1 238 ? 11.624  29.071  36.854  1.00 27.24 ? 238  TYR A N   1 
ATOM   1666 C  CA  . TYR A 1 238 ? 12.453  28.764  38.037  1.00 27.83 ? 238  TYR A CA  1 
ATOM   1667 C  C   . TYR A 1 238 ? 12.041  27.533  38.835  1.00 29.04 ? 238  TYR A C   1 
ATOM   1668 O  O   . TYR A 1 238 ? 12.796  27.070  39.692  1.00 29.20 ? 238  TYR A O   1 
ATOM   1669 C  CB  . TYR A 1 238 ? 12.537  29.977  38.966  1.00 27.15 ? 238  TYR A CB  1 
ATOM   1670 C  CG  . TYR A 1 238 ? 13.311  31.113  38.341  1.00 26.16 ? 238  TYR A CG  1 
ATOM   1671 C  CD1 . TYR A 1 238 ? 12.660  32.267  37.901  1.00 25.32 ? 238  TYR A CD1 1 
ATOM   1672 C  CD2 . TYR A 1 238 ? 14.689  31.013  38.145  1.00 23.17 ? 238  TYR A CD2 1 
ATOM   1673 C  CE1 . TYR A 1 238 ? 13.372  33.307  37.307  1.00 24.66 ? 238  TYR A CE1 1 
ATOM   1674 C  CE2 . TYR A 1 238 ? 15.406  32.044  37.543  1.00 23.51 ? 238  TYR A CE2 1 
ATOM   1675 C  CZ  . TYR A 1 238 ? 14.746  33.177  37.125  1.00 23.94 ? 238  TYR A CZ  1 
ATOM   1676 O  OH  . TYR A 1 238 ? 15.455  34.190  36.539  1.00 24.75 ? 238  TYR A OH  1 
ATOM   1677 N  N   . ARG A 1 239 ? 10.861  26.986  38.554  1.00 30.21 ? 239  ARG A N   1 
ATOM   1678 C  CA  . ARG A 1 239 ? 10.494  25.702  39.155  1.00 31.72 ? 239  ARG A CA  1 
ATOM   1679 C  C   . ARG A 1 239 ? 11.341  24.552  38.614  1.00 31.31 ? 239  ARG A C   1 
ATOM   1680 O  O   . ARG A 1 239 ? 11.446  23.519  39.253  1.00 32.02 ? 239  ARG A O   1 
ATOM   1681 C  CB  . ARG A 1 239 ? 9.004   25.404  39.004  1.00 32.64 ? 239  ARG A CB  1 
ATOM   1682 C  CG  . ARG A 1 239 ? 8.536   25.059  37.614  1.00 35.19 ? 239  ARG A CG  1 
ATOM   1683 C  CD  . ARG A 1 239 ? 7.055   24.691  37.668  1.00 41.91 ? 239  ARG A CD  1 
ATOM   1684 N  NE  . ARG A 1 239 ? 6.842   23.250  37.801  1.00 46.05 ? 239  ARG A NE  1 
ATOM   1685 C  CZ  . ARG A 1 239 ? 5.710   22.684  38.217  1.00 49.08 ? 239  ARG A CZ  1 
ATOM   1686 N  NH1 . ARG A 1 239 ? 5.629   21.368  38.287  1.00 51.82 ? 239  ARG A NH1 1 
ATOM   1687 N  NH2 . ARG A 1 239 ? 4.662   23.419  38.578  1.00 50.03 ? 239  ARG A NH2 1 
ATOM   1688 N  N   . TYR A 1 240 ? 11.958  24.737  37.450  1.00 30.78 ? 240  TYR A N   1 
ATOM   1689 C  CA  . TYR A 1 240 ? 12.872  23.728  36.930  1.00 30.24 ? 240  TYR A CA  1 
ATOM   1690 C  C   . TYR A 1 240 ? 14.304  23.940  37.390  1.00 30.16 ? 240  TYR A C   1 
ATOM   1691 O  O   . TYR A 1 240 ? 14.824  25.069  37.412  1.00 30.74 ? 240  TYR A O   1 
ATOM   1692 C  CB  . TYR A 1 240 ? 12.776  23.620  35.414  1.00 29.54 ? 240  TYR A CB  1 
ATOM   1693 C  CG  . TYR A 1 240 ? 11.349  23.409  34.956  1.00 28.84 ? 240  TYR A CG  1 
ATOM   1694 C  CD1 . TYR A 1 240 ? 10.630  24.452  34.374  1.00 25.80 ? 240  TYR A CD1 1 
ATOM   1695 C  CD2 . TYR A 1 240 ? 10.714  22.177  35.115  1.00 27.51 ? 240  TYR A CD2 1 
ATOM   1696 C  CE1 . TYR A 1 240 ? 9.313   24.284  33.970  1.00 27.39 ? 240  TYR A CE1 1 
ATOM   1697 C  CE2 . TYR A 1 240 ? 9.375   21.993  34.702  1.00 29.02 ? 240  TYR A CE2 1 
ATOM   1698 C  CZ  . TYR A 1 240 ? 8.691   23.058  34.129  1.00 27.95 ? 240  TYR A CZ  1 
ATOM   1699 O  OH  . TYR A 1 240 ? 7.386   22.924  33.716  1.00 29.51 ? 240  TYR A OH  1 
ATOM   1700 N  N   . SER A 1 241 ? 14.939  22.834  37.747  1.00 29.76 ? 241  SER A N   1 
ATOM   1701 C  CA  . SER A 1 241 ? 16.294  22.849  38.299  1.00 29.79 ? 241  SER A CA  1 
ATOM   1702 C  C   . SER A 1 241 ? 17.284  23.478  37.321  1.00 29.78 ? 241  SER A C   1 
ATOM   1703 O  O   . SER A 1 241 ? 17.053  23.498  36.109  1.00 29.61 ? 241  SER A O   1 
ATOM   1704 C  CB  . SER A 1 241 ? 16.737  21.424  38.641  1.00 29.40 ? 241  SER A CB  1 
ATOM   1705 O  OG  . SER A 1 241 ? 16.910  20.691  37.442  1.00 29.26 ? 241  SER A OG  1 
ATOM   1706 N  N   . ASP A 1 242 ? 18.374  23.993  37.874  1.00 29.59 ? 242  ASP A N   1 
ATOM   1707 C  CA  . ASP A 1 242 ? 19.510  24.502  37.118  1.00 30.37 ? 242  ASP A CA  1 
ATOM   1708 C  C   . ASP A 1 242 ? 20.087  23.466  36.128  1.00 30.41 ? 242  ASP A C   1 
ATOM   1709 O  O   . ASP A 1 242 ? 20.479  23.802  35.004  1.00 30.79 ? 242  ASP A O   1 
ATOM   1710 C  CB  . ASP A 1 242 ? 20.592  24.960  38.110  1.00 30.20 ? 242  ASP A CB  1 
ATOM   1711 C  CG  . ASP A 1 242 ? 20.319  26.349  38.696  1.00 31.92 ? 242  ASP A CG  1 
ATOM   1712 O  OD1 . ASP A 1 242 ? 19.426  27.078  38.206  1.00 32.57 ? 242  ASP A OD1 1 
ATOM   1713 O  OD2 . ASP A 1 242 ? 21.019  26.722  39.661  1.00 34.66 ? 242  ASP A OD2 1 
ATOM   1714 N  N   . GLU A 1 243 ? 20.124  22.209  36.554  1.00 30.29 ? 243  GLU A N   1 
ATOM   1715 C  CA  . GLU A 1 243 ? 20.613  21.105  35.741  1.00 30.59 ? 243  GLU A CA  1 
ATOM   1716 C  C   . GLU A 1 243 ? 19.729  20.818  34.515  1.00 30.31 ? 243  GLU A C   1 
ATOM   1717 O  O   . GLU A 1 243 ? 20.243  20.616  33.411  1.00 30.01 ? 243  GLU A O   1 
ATOM   1718 C  CB  . GLU A 1 243 ? 20.784  19.844  36.608  1.00 31.00 ? 243  GLU A CB  1 
ATOM   1719 C  CG  . GLU A 1 243 ? 21.784  19.981  37.781  1.00 32.86 ? 243  GLU A CG  1 
ATOM   1720 C  CD  . GLU A 1 243 ? 21.244  20.753  39.000  1.00 36.31 ? 243  GLU A CD  1 
ATOM   1721 O  OE1 . GLU A 1 243 ? 20.015  20.898  39.153  1.00 35.82 ? 243  GLU A OE1 1 
ATOM   1722 O  OE2 . GLU A 1 243 ? 22.069  21.235  39.821  1.00 39.71 ? 243  GLU A OE2 1 
ATOM   1723 N  N   . LEU A 1 244 ? 18.412  20.813  34.695  1.00 30.33 ? 244  LEU A N   1 
ATOM   1724 C  CA  . LEU A 1 244 ? 17.494  20.673  33.553  1.00 30.94 ? 244  LEU A CA  1 
ATOM   1725 C  C   . LEU A 1 244 ? 17.631  21.844  32.581  1.00 31.00 ? 244  LEU A C   1 
ATOM   1726 O  O   . LEU A 1 244 ? 17.713  21.652  31.349  1.00 30.67 ? 244  LEU A O   1 
ATOM   1727 C  CB  . LEU A 1 244 ? 16.029  20.496  33.999  1.00 30.90 ? 244  LEU A CB  1 
ATOM   1728 C  CG  . LEU A 1 244 ? 14.995  20.363  32.855  1.00 31.36 ? 244  LEU A CG  1 
ATOM   1729 C  CD1 . LEU A 1 244 ? 15.321  19.227  31.920  1.00 31.46 ? 244  LEU A CD1 1 
ATOM   1730 C  CD2 . LEU A 1 244 ? 13.568  20.210  33.379  1.00 31.02 ? 244  LEU A CD2 1 
ATOM   1731 N  N   . ASN A 1 245 ? 17.664  23.050  33.144  1.00 30.59 ? 245  ASN A N   1 
ATOM   1732 C  CA  . ASN A 1 245 ? 17.907  24.250  32.357  1.00 30.28 ? 245  ASN A CA  1 
ATOM   1733 C  C   . ASN A 1 245 ? 19.215  24.201  31.570  1.00 30.29 ? 245  ASN A C   1 
ATOM   1734 O  O   . ASN A 1 245 ? 19.257  24.604  30.415  1.00 30.61 ? 245  ASN A O   1 
ATOM   1735 C  CB  . ASN A 1 245 ? 17.900  25.503  33.229  1.00 29.21 ? 245  ASN A CB  1 
ATOM   1736 C  CG  . ASN A 1 245 ? 18.102  26.747  32.415  1.00 29.35 ? 245  ASN A CG  1 
ATOM   1737 O  OD1 . ASN A 1 245 ? 17.231  27.138  31.641  1.00 30.45 ? 245  ASN A OD1 1 
ATOM   1738 N  ND2 . ASN A 1 245 ? 19.267  27.353  32.542  1.00 28.52 ? 245  ASN A ND2 1 
ATOM   1739 N  N   . GLU A 1 246 ? 20.278  23.732  32.210  1.00 30.37 ? 246  GLU A N   1 
ATOM   1740 C  CA  . GLU A 1 246 ? 21.585  23.590  31.569  1.00 30.83 ? 246  GLU A CA  1 
ATOM   1741 C  C   . GLU A 1 246 ? 21.520  22.680  30.337  1.00 30.24 ? 246  GLU A C   1 
ATOM   1742 O  O   . GLU A 1 246 ? 22.092  23.010  29.289  1.00 30.43 ? 246  GLU A O   1 
ATOM   1743 C  CB  . GLU A 1 246 ? 22.611  23.061  32.583  1.00 30.76 ? 246  GLU A CB  1 
ATOM   1744 C  CG  A GLU A 1 246 ? 24.079  23.236  32.187  0.50 31.94 ? 246  GLU A CG  1 
ATOM   1745 C  CG  B GLU A 1 246 ? 24.056  23.031  32.104  0.50 31.92 ? 246  GLU A CG  1 
ATOM   1746 C  CD  A GLU A 1 246 ? 24.585  22.185  31.200  0.50 33.35 ? 246  GLU A CD  1 
ATOM   1747 C  CD  B GLU A 1 246 ? 24.959  22.167  32.980  0.50 32.54 ? 246  GLU A CD  1 
ATOM   1748 O  OE1 A GLU A 1 246 ? 24.064  21.047  31.189  0.50 33.80 ? 246  GLU A OE1 1 
ATOM   1749 O  OE1 B GLU A 1 246 ? 24.497  21.666  34.033  0.50 35.57 ? 246  GLU A OE1 1 
ATOM   1750 O  OE2 A GLU A 1 246 ? 25.531  22.497  30.444  0.50 34.51 ? 246  GLU A OE2 1 
ATOM   1751 O  OE2 B GLU A 1 246 ? 26.138  21.971  32.603  0.50 34.61 ? 246  GLU A OE2 1 
ATOM   1752 N  N   . ILE A 1 247 ? 20.854  21.535  30.466  1.00 29.64 ? 247  ILE A N   1 
ATOM   1753 C  CA  . ILE A 1 247 ? 20.806  20.572  29.366  1.00 30.08 ? 247  ILE A CA  1 
ATOM   1754 C  C   . ILE A 1 247 ? 19.986  21.098  28.163  1.00 29.94 ? 247  ILE A C   1 
ATOM   1755 O  O   . ILE A 1 247 ? 20.448  21.034  27.026  1.00 29.22 ? 247  ILE A O   1 
ATOM   1756 C  CB  . ILE A 1 247 ? 20.464  19.098  29.831  1.00 30.75 ? 247  ILE A CB  1 
ATOM   1757 C  CG1 . ILE A 1 247 ? 20.751  18.071  28.713  1.00 30.49 ? 247  ILE A CG1 1 
ATOM   1758 C  CG2 . ILE A 1 247 ? 19.059  18.957  30.370  1.00 27.54 ? 247  ILE A CG2 1 
ATOM   1759 C  CD1 . ILE A 1 247 ? 22.200  17.906  28.430  1.00 35.08 ? 247  ILE A CD1 1 
ATOM   1760 N  N   . ILE A 1 248 ? 18.821  21.674  28.429  1.00 30.04 ? 248  ILE A N   1 
ATOM   1761 C  CA  . ILE A 1 248 ? 17.997  22.280  27.377  1.00 30.22 ? 248  ILE A CA  1 
ATOM   1762 C  C   . ILE A 1 248 ? 18.761  23.403  26.675  1.00 30.01 ? 248  ILE A C   1 
ATOM   1763 O  O   . ILE A 1 248 ? 18.801  23.459  25.439  1.00 29.84 ? 248  ILE A O   1 
ATOM   1764 C  CB  . ILE A 1 248 ? 16.617  22.742  27.924  1.00 30.62 ? 248  ILE A CB  1 
ATOM   1765 C  CG1 . ILE A 1 248 ? 15.778  21.497  28.296  1.00 30.91 ? 248  ILE A CG1 1 
ATOM   1766 C  CG2 . ILE A 1 248 ? 15.893  23.628  26.891  1.00 31.52 ? 248  ILE A CG2 1 
ATOM   1767 C  CD1 . ILE A 1 248 ? 14.495  21.782  29.099  1.00 30.42 ? 248  ILE A CD1 1 
ATOM   1768 N  N   . THR A 1 249 ? 19.411  24.257  27.469  1.00 29.79 ? 249  THR A N   1 
ATOM   1769 C  CA  . THR A 1 249 ? 20.197  25.364  26.947  1.00 29.42 ? 249  THR A CA  1 
ATOM   1770 C  C   . THR A 1 249 ? 21.284  24.847  26.004  1.00 29.36 ? 249  THR A C   1 
ATOM   1771 O  O   . THR A 1 249 ? 21.452  25.375  24.908  1.00 29.25 ? 249  THR A O   1 
ATOM   1772 C  CB  . THR A 1 249 ? 20.805  26.232  28.078  1.00 29.37 ? 249  THR A CB  1 
ATOM   1773 O  OG1 . THR A 1 249 ? 19.752  26.900  28.785  1.00 31.01 ? 249  THR A OG1 1 
ATOM   1774 C  CG2 . THR A 1 249 ? 21.767  27.283  27.523  1.00 28.27 ? 249  THR A CG2 1 
ATOM   1775 N  N   . ARG A 1 250 ? 22.001  23.813  26.442  1.00 29.26 ? 250  ARG A N   1 
ATOM   1776 C  CA  . ARG A 1 250 ? 23.049  23.162  25.648  1.00 29.50 ? 250  ARG A CA  1 
ATOM   1777 C  C   . ARG A 1 250 ? 22.537  22.682  24.289  1.00 28.83 ? 250  ARG A C   1 
ATOM   1778 O  O   . ARG A 1 250 ? 23.216  22.843  23.281  1.00 28.24 ? 250  ARG A O   1 
ATOM   1779 C  CB  . ARG A 1 250 ? 23.645  21.989  26.431  1.00 29.39 ? 250  ARG A CB  1 
ATOM   1780 C  CG  A ARG A 1 250 ? 24.980  22.309  27.109  0.50 31.35 ? 250  ARG A CG  1 
ATOM   1781 C  CG  B ARG A 1 250 ? 25.144  21.882  26.390  0.50 32.19 ? 250  ARG A CG  1 
ATOM   1782 C  CD  A ARG A 1 250 ? 26.186  21.658  26.382  0.50 32.74 ? 250  ARG A CD  1 
ATOM   1783 C  CD  B ARG A 1 250 ? 25.641  21.105  27.610  0.50 34.37 ? 250  ARG A CD  1 
ATOM   1784 N  NE  A ARG A 1 250 ? 26.311  20.238  26.722  0.50 33.13 ? 250  ARG A NE  1 
ATOM   1785 N  NE  B ARG A 1 250 ? 25.925  19.705  27.301  0.50 35.97 ? 250  ARG A NE  1 
ATOM   1786 C  CZ  A ARG A 1 250 ? 27.156  19.374  26.161  0.50 33.61 ? 250  ARG A CZ  1 
ATOM   1787 C  CZ  B ARG A 1 250 ? 25.809  18.697  28.164  0.50 36.18 ? 250  ARG A CZ  1 
ATOM   1788 N  NH1 A ARG A 1 250 ? 27.161  18.114  26.572  0.50 32.02 ? 250  ARG A NH1 1 
ATOM   1789 N  NH1 B ARG A 1 250 ? 26.106  17.468  27.767  0.50 36.50 ? 250  ARG A NH1 1 
ATOM   1790 N  NH2 A ARG A 1 250 ? 27.991  19.751  25.192  0.50 33.71 ? 250  ARG A NH2 1 
ATOM   1791 N  NH2 B ARG A 1 250 ? 25.384  18.904  29.408  0.50 35.62 ? 250  ARG A NH2 1 
ATOM   1792 N  N   . MET A 1 251 ? 21.345  22.095  24.264  1.00 28.47 ? 251  MET A N   1 
ATOM   1793 C  CA  . MET A 1 251 ? 20.764  21.617  22.999  1.00 29.98 ? 251  MET A CA  1 
ATOM   1794 C  C   . MET A 1 251 ? 20.391  22.783  22.081  1.00 29.27 ? 251  MET A C   1 
ATOM   1795 O  O   . MET A 1 251 ? 20.297  22.628  20.871  1.00 29.70 ? 251  MET A O   1 
ATOM   1796 C  CB  . MET A 1 251 ? 19.526  20.752  23.239  1.00 29.20 ? 251  MET A CB  1 
ATOM   1797 C  CG  . MET A 1 251 ? 19.692  19.602  24.215  1.00 29.91 ? 251  MET A CG  1 
ATOM   1798 S  SD  . MET A 1 251 ? 18.100  18.756  24.327  1.00 33.02 ? 251  MET A SD  1 
ATOM   1799 C  CE  . MET A 1 251 ? 18.320  17.704  25.726  1.00 30.07 ? 251  MET A CE  1 
ATOM   1800 N  N   . LEU A 1 252 ? 20.182  23.948  22.676  1.00 29.64 ? 252  LEU A N   1 
ATOM   1801 C  CA  . LEU A 1 252 ? 19.862  25.153  21.908  1.00 29.93 ? 252  LEU A CA  1 
ATOM   1802 C  C   . LEU A 1 252 ? 21.075  25.983  21.526  1.00 29.77 ? 252  LEU A C   1 
ATOM   1803 O  O   . LEU A 1 252 ? 20.918  27.117  21.091  1.00 30.43 ? 252  LEU A O   1 
ATOM   1804 C  CB  . LEU A 1 252 ? 18.831  26.017  22.640  1.00 28.96 ? 252  LEU A CB  1 
ATOM   1805 C  CG  . LEU A 1 252 ? 17.443  25.373  22.772  1.00 28.69 ? 252  LEU A CG  1 
ATOM   1806 C  CD1 . LEU A 1 252 ? 16.586  26.186  23.740  1.00 26.94 ? 252  LEU A CD1 1 
ATOM   1807 C  CD2 . LEU A 1 252 ? 16.752  25.211  21.396  1.00 27.38 ? 252  LEU A CD2 1 
ATOM   1808 N  N   . ASN A 1 253 ? 22.282  25.432  21.657  1.00 29.79 ? 253  ASN A N   1 
ATOM   1809 C  CA  . ASN A 1 253 ? 23.460  26.134  21.125  1.00 29.51 ? 253  ASN A CA  1 
ATOM   1810 C  C   . ASN A 1 253 ? 23.372  26.327  19.613  1.00 29.84 ? 253  ASN A C   1 
ATOM   1811 O  O   . ASN A 1 253 ? 22.853  25.460  18.900  1.00 29.55 ? 253  ASN A O   1 
ATOM   1812 C  CB  . ASN A 1 253 ? 24.770  25.409  21.454  1.00 29.26 ? 253  ASN A CB  1 
ATOM   1813 C  CG  A ASN A 1 253 ? 25.963  26.371  21.535  0.50 29.07 ? 253  ASN A CG  1 
ATOM   1814 C  CG  B ASN A 1 253 ? 25.304  25.743  22.819  0.50 29.51 ? 253  ASN A CG  1 
ATOM   1815 O  OD1 A ASN A 1 253 ? 26.416  26.917  20.528  0.50 28.76 ? 253  ASN A OD1 1 
ATOM   1816 O  OD1 B ASN A 1 253 ? 25.473  26.910  23.166  0.50 31.84 ? 253  ASN A OD1 1 
ATOM   1817 N  ND2 A ASN A 1 253 ? 26.470  26.579  22.740  0.50 29.06 ? 253  ASN A ND2 1 
ATOM   1818 N  ND2 B ASN A 1 253 ? 25.612  24.717  23.593  0.50 29.51 ? 253  ASN A ND2 1 
ATOM   1819 N  N   . LEU A 1 254 ? 23.905  27.457  19.142  1.00 29.99 ? 254  LEU A N   1 
ATOM   1820 C  CA  . LEU A 1 254 ? 23.935  27.803  17.726  1.00 30.47 ? 254  LEU A CA  1 
ATOM   1821 C  C   . LEU A 1 254 ? 24.842  26.877  16.943  1.00 30.79 ? 254  LEU A C   1 
ATOM   1822 O  O   . LEU A 1 254 ? 24.548  26.547  15.794  1.00 31.33 ? 254  LEU A O   1 
ATOM   1823 C  CB  . LEU A 1 254 ? 24.430  29.248  17.530  1.00 30.30 ? 254  LEU A CB  1 
ATOM   1824 C  CG  . LEU A 1 254 ? 23.637  30.360  18.220  1.00 30.82 ? 254  LEU A CG  1 
ATOM   1825 C  CD1 . LEU A 1 254 ? 24.347  31.712  18.094  1.00 31.89 ? 254  LEU A CD1 1 
ATOM   1826 C  CD2 . LEU A 1 254 ? 22.227  30.420  17.662  1.00 30.01 ? 254  LEU A CD2 1 
ATOM   1827 N  N   . LYS A 1 255 ? 25.967  26.502  17.553  1.00 30.60 ? 255  LYS A N   1 
ATOM   1828 C  CA  . LYS A 1 255 ? 26.933  25.621  16.916  1.00 30.31 ? 255  LYS A CA  1 
ATOM   1829 C  C   . LYS A 1 255 ? 26.545  24.186  17.205  1.00 29.92 ? 255  LYS A C   1 
ATOM   1830 O  O   . LYS A 1 255 ? 26.431  23.792  18.359  1.00 29.50 ? 255  LYS A O   1 
ATOM   1831 C  CB  . LYS A 1 255 ? 28.357  25.913  17.406  1.00 30.40 ? 255  LYS A CB  1 
ATOM   1832 C  CG  . LYS A 1 255 ? 29.056  27.083  16.690  1.00 31.62 ? 255  LYS A CG  1 
ATOM   1833 C  CD  . LYS A 1 255 ? 28.696  28.431  17.301  1.00 33.90 ? 255  LYS A CD  1 
ATOM   1834 C  CE  . LYS A 1 255 ? 28.967  29.601  16.344  1.00 36.06 ? 255  LYS A CE  1 
ATOM   1835 N  NZ  . LYS A 1 255 ? 28.077  30.783  16.650  1.00 36.05 ? 255  LYS A NZ  1 
ATOM   1836 N  N   . ASP A 1 256 ? 26.322  23.417  16.148  1.00 30.17 ? 256  ASP A N   1 
ATOM   1837 C  CA  . ASP A 1 256 ? 25.934  22.022  16.287  1.00 30.75 ? 256  ASP A CA  1 
ATOM   1838 C  C   . ASP A 1 256 ? 26.914  21.206  17.131  1.00 30.70 ? 256  ASP A C   1 
ATOM   1839 O  O   . ASP A 1 256 ? 26.493  20.316  17.858  1.00 30.87 ? 256  ASP A O   1 
ATOM   1840 C  CB  . ASP A 1 256 ? 25.660  21.364  14.919  1.00 30.96 ? 256  ASP A CB  1 
ATOM   1841 C  CG  . ASP A 1 256 ? 26.825  21.472  13.954  1.00 32.47 ? 256  ASP A CG  1 
ATOM   1842 O  OD1 . ASP A 1 256 ? 26.737  20.852  12.871  1.00 34.03 ? 256  ASP A OD1 1 
ATOM   1843 O  OD2 . ASP A 1 256 ? 27.820  22.176  14.251  1.00 34.97 ? 256  ASP A OD2 1 
ATOM   1844 N  N   . TYR A 1 257 ? 28.201  21.547  17.078  1.00 30.84 ? 257  TYR A N   1 
ATOM   1845 C  CA  . TYR A 1 257 ? 29.221  20.830  17.851  1.00 31.15 ? 257  TYR A CA  1 
ATOM   1846 C  C   . TYR A 1 257 ? 29.236  21.127  19.361  1.00 31.45 ? 257  TYR A C   1 
ATOM   1847 O  O   . TYR A 1 257 ? 29.857  20.383  20.129  1.00 31.66 ? 257  TYR A O   1 
ATOM   1848 C  CB  . TYR A 1 257 ? 30.622  21.006  17.238  1.00 31.17 ? 257  TYR A CB  1 
ATOM   1849 C  CG  . TYR A 1 257 ? 31.062  22.435  16.996  1.00 31.64 ? 257  TYR A CG  1 
ATOM   1850 C  CD1 . TYR A 1 257 ? 31.079  22.969  15.705  1.00 31.65 ? 257  TYR A CD1 1 
ATOM   1851 C  CD2 . TYR A 1 257 ? 31.493  23.246  18.051  1.00 31.42 ? 257  TYR A CD2 1 
ATOM   1852 C  CE1 . TYR A 1 257 ? 31.491  24.271  15.471  1.00 30.99 ? 257  TYR A CE1 1 
ATOM   1853 C  CE2 . TYR A 1 257 ? 31.908  24.556  17.827  1.00 30.73 ? 257  TYR A CE2 1 
ATOM   1854 C  CZ  . TYR A 1 257 ? 31.909  25.060  16.535  1.00 31.65 ? 257  TYR A CZ  1 
ATOM   1855 O  OH  . TYR A 1 257 ? 32.323  26.358  16.306  1.00 31.30 ? 257  TYR A OH  1 
ATOM   1856 N  N   . HIS A 1 258 ? 28.562  22.201  19.780  1.00 31.43 ? 258  HIS A N   1 
ATOM   1857 C  CA  . HIS A 1 258 ? 28.367  22.498  21.216  1.00 31.55 ? 258  HIS A CA  1 
ATOM   1858 C  C   . HIS A 1 258 ? 27.141  21.824  21.836  1.00 31.21 ? 258  HIS A C   1 
ATOM   1859 O  O   . HIS A 1 258 ? 26.947  21.875  23.057  1.00 31.98 ? 258  HIS A O   1 
ATOM   1860 C  CB  . HIS A 1 258 ? 28.287  24.011  21.472  1.00 31.65 ? 258  HIS A CB  1 
ATOM   1861 C  CG  . HIS A 1 258 ? 29.589  24.738  21.279  1.00 33.57 ? 258  HIS A CG  1 
ATOM   1862 N  ND1 . HIS A 1 258 ? 30.786  24.280  21.789  1.00 34.66 ? 258  HIS A ND1 1 
ATOM   1863 C  CD2 . HIS A 1 258 ? 29.870  25.909  20.659  1.00 33.88 ? 258  HIS A CD2 1 
ATOM   1864 C  CE1 . HIS A 1 258 ? 31.752  25.125  21.471  1.00 34.72 ? 258  HIS A CE1 1 
ATOM   1865 N  NE2 . HIS A 1 258 ? 31.222  26.124  20.789  1.00 34.69 ? 258  HIS A NE2 1 
ATOM   1866 N  N   . ARG A 1 259 ? 26.295  21.222  21.006  1.00 30.34 ? 259  ARG A N   1 
ATOM   1867 C  CA  . ARG A 1 259 ? 25.108  20.536  21.499  1.00 28.79 ? 259  ARG A CA  1 
ATOM   1868 C  C   . ARG A 1 259 ? 25.510  19.154  21.971  1.00 29.08 ? 259  ARG A C   1 
ATOM   1869 O  O   . ARG A 1 259 ? 26.426  18.545  21.405  1.00 28.68 ? 259  ARG A O   1 
ATOM   1870 C  CB  . ARG A 1 259 ? 24.050  20.413  20.403  1.00 28.66 ? 259  ARG A CB  1 
ATOM   1871 C  CG  . ARG A 1 259 ? 23.628  21.726  19.784  1.00 27.51 ? 259  ARG A CG  1 
ATOM   1872 C  CD  . ARG A 1 259 ? 22.658  21.537  18.619  1.00 27.59 ? 259  ARG A CD  1 
ATOM   1873 N  NE  . ARG A 1 259 ? 22.595  22.779  17.851  1.00 28.13 ? 259  ARG A NE  1 
ATOM   1874 C  CZ  . ARG A 1 259 ? 22.499  22.862  16.524  1.00 27.61 ? 259  ARG A CZ  1 
ATOM   1875 N  NH1 . ARG A 1 259 ? 22.426  21.772  15.771  1.00 26.08 ? 259  ARG A NH1 1 
ATOM   1876 N  NH2 . ARG A 1 259 ? 22.482  24.053  15.949  1.00 27.28 ? 259  ARG A NH2 1 
ATOM   1877 N  N   . PRO A 1 260 ? 24.819  18.624  22.997  1.00 29.35 ? 260  PRO A N   1 
ATOM   1878 C  CA  . PRO A 1 260 ? 25.199  17.275  23.397  1.00 29.54 ? 260  PRO A CA  1 
ATOM   1879 C  C   . PRO A 1 260 ? 24.698  16.215  22.410  1.00 29.54 ? 260  PRO A C   1 
ATOM   1880 O  O   . PRO A 1 260 ? 23.635  16.382  21.798  1.00 29.52 ? 260  PRO A O   1 
ATOM   1881 C  CB  . PRO A 1 260 ? 24.504  17.109  24.744  1.00 28.95 ? 260  PRO A CB  1 
ATOM   1882 C  CG  . PRO A 1 260 ? 23.310  17.954  24.627  1.00 30.57 ? 260  PRO A CG  1 
ATOM   1883 C  CD  . PRO A 1 260 ? 23.724  19.153  23.825  1.00 28.92 ? 260  PRO A CD  1 
ATOM   1884 N  N   . SER A 1 261 ? 25.477  15.148  22.258  1.00 29.39 ? 261  SER A N   1 
ATOM   1885 C  CA  . SER A 1 261 ? 25.045  13.959  21.541  1.00 29.13 ? 261  SER A CA  1 
ATOM   1886 C  C   . SER A 1 261 ? 23.983  13.242  22.358  1.00 29.47 ? 261  SER A C   1 
ATOM   1887 O  O   . SER A 1 261 ? 23.816  13.532  23.555  1.00 29.50 ? 261  SER A O   1 
ATOM   1888 C  CB  . SER A 1 261 ? 26.230  13.018  21.341  1.00 29.25 ? 261  SER A CB  1 
ATOM   1889 O  OG  . SER A 1 261 ? 26.684  12.520  22.591  1.00 27.99 ? 261  SER A OG  1 
ATOM   1890 N  N   . VAL A 1 262 ? 23.262  12.327  21.706  1.00 29.42 ? 262  VAL A N   1 
ATOM   1891 C  CA  . VAL A 1 262 ? 22.317  11.407  22.361  1.00 30.30 ? 262  VAL A CA  1 
ATOM   1892 C  C   . VAL A 1 262 ? 22.955  10.726  23.587  1.00 29.97 ? 262  VAL A C   1 
ATOM   1893 O  O   . VAL A 1 262 ? 22.374  10.680  24.667  1.00 30.09 ? 262  VAL A O   1 
ATOM   1894 C  CB  . VAL A 1 262 ? 21.829  10.306  21.348  1.00 30.52 ? 262  VAL A CB  1 
ATOM   1895 C  CG1 . VAL A 1 262 ? 21.263  9.088   22.080  1.00 31.64 ? 262  VAL A CG1 1 
ATOM   1896 C  CG2 . VAL A 1 262 ? 20.785  10.875  20.395  1.00 32.08 ? 262  VAL A CG2 1 
ATOM   1897 N  N   . GLU A 1 263 ? 24.154  10.192  23.398  1.00 29.93 ? 263  GLU A N   1 
ATOM   1898 C  CA  . GLU A 1 263 ? 24.892  9.529   24.468  1.00 30.33 ? 263  GLU A CA  1 
ATOM   1899 C  C   . GLU A 1 263 ? 25.209  10.442  25.651  1.00 30.04 ? 263  GLU A C   1 
ATOM   1900 O  O   . GLU A 1 263 ? 25.012  10.055  26.799  1.00 29.89 ? 263  GLU A O   1 
ATOM   1901 C  CB  . GLU A 1 263 ? 26.177  8.936   23.899  1.00 30.39 ? 263  GLU A CB  1 
ATOM   1902 C  CG  . GLU A 1 263 ? 25.931  7.673   23.099  1.00 32.80 ? 263  GLU A CG  1 
ATOM   1903 C  CD  . GLU A 1 263 ? 25.258  7.913   21.739  1.00 35.57 ? 263  GLU A CD  1 
ATOM   1904 O  OE1 . GLU A 1 263 ? 25.444  9.002   21.125  1.00 35.43 ? 263  GLU A OE1 1 
ATOM   1905 O  OE2 . GLU A 1 263 ? 24.557  6.980   21.277  1.00 35.83 ? 263  GLU A OE2 1 
ATOM   1906 N  N   . GLU A 1 264 ? 25.682  11.655  25.363  1.00 29.75 ? 264  GLU A N   1 
ATOM   1907 C  CA  . GLU A 1 264 ? 25.926  12.656  26.400  1.00 30.37 ? 264  GLU A CA  1 
ATOM   1908 C  C   . GLU A 1 264 ? 24.663  13.037  27.167  1.00 29.77 ? 264  GLU A C   1 
ATOM   1909 O  O   . GLU A 1 264 ? 24.738  13.260  28.364  1.00 29.79 ? 264  GLU A O   1 
ATOM   1910 C  CB  . GLU A 1 264 ? 26.565  13.920  25.824  1.00 30.37 ? 264  GLU A CB  1 
ATOM   1911 C  CG  . GLU A 1 264 ? 27.951  13.738  25.234  1.00 34.00 ? 264  GLU A CG  1 
ATOM   1912 C  CD  . GLU A 1 264 ? 28.399  14.984  24.490  1.00 38.11 ? 264  GLU A CD  1 
ATOM   1913 O  OE1 . GLU A 1 264 ? 29.320  15.663  24.981  1.00 40.81 ? 264  GLU A OE1 1 
ATOM   1914 O  OE2 . GLU A 1 264 ? 27.806  15.306  23.436  1.00 39.20 ? 264  GLU A OE2 1 
ATOM   1915 N  N   . ILE A 1 265 ? 23.519  13.119  26.480  1.00 29.94 ? 265  ILE A N   1 
ATOM   1916 C  CA  . ILE A 1 265 ? 22.216  13.418  27.135  1.00 30.09 ? 265  ILE A CA  1 
ATOM   1917 C  C   . ILE A 1 265 ? 21.829  12.336  28.157  1.00 30.20 ? 265  ILE A C   1 
ATOM   1918 O  O   . ILE A 1 265 ? 21.481  12.647  29.297  1.00 31.05 ? 265  ILE A O   1 
ATOM   1919 C  CB  . ILE A 1 265 ? 21.040  13.600  26.108  1.00 29.74 ? 265  ILE A CB  1 
ATOM   1920 C  CG1 . ILE A 1 265 ? 21.230  14.874  25.267  1.00 30.62 ? 265  ILE A CG1 1 
ATOM   1921 C  CG2 . ILE A 1 265 ? 19.681  13.651  26.820  1.00 29.35 ? 265  ILE A CG2 1 
ATOM   1922 C  CD1 . ILE A 1 265 ? 20.320  14.956  24.017  1.00 29.75 ? 265  ILE A CD1 1 
ATOM   1923 N  N   . LEU A 1 266 ? 21.875  11.076  27.737  1.00 30.03 ? 266  LEU A N   1 
ATOM   1924 C  CA  . LEU A 1 266 ? 21.496  9.957   28.596  1.00 30.31 ? 266  LEU A CA  1 
ATOM   1925 C  C   . LEU A 1 266 ? 22.454  9.679   29.772  1.00 30.79 ? 266  LEU A C   1 
ATOM   1926 O  O   . LEU A 1 266 ? 22.051  9.059   30.759  1.00 30.15 ? 266  LEU A O   1 
ATOM   1927 C  CB  . LEU A 1 266 ? 21.293  8.689   27.766  1.00 30.17 ? 266  LEU A CB  1 
ATOM   1928 C  CG  . LEU A 1 266 ? 20.228  8.710   26.661  1.00 30.49 ? 266  LEU A CG  1 
ATOM   1929 C  CD1 . LEU A 1 266 ? 20.438  7.527   25.720  1.00 31.47 ? 266  LEU A CD1 1 
ATOM   1930 C  CD2 . LEU A 1 266 ? 18.794  8.780   27.192  1.00 30.02 ? 266  LEU A CD2 1 
ATOM   1931 N  N   . GLU A 1 267 ? 23.709  10.114  29.657  1.00 31.32 ? 267  GLU A N   1 
ATOM   1932 C  CA  . GLU A 1 267 ? 24.668  10.081  30.779  1.00 32.88 ? 267  GLU A CA  1 
ATOM   1933 C  C   . GLU A 1 267 ? 24.379  11.133  31.867  1.00 32.55 ? 267  GLU A C   1 
ATOM   1934 O  O   . GLU A 1 267 ? 25.017  11.138  32.914  1.00 32.54 ? 267  GLU A O   1 
ATOM   1935 C  CB  . GLU A 1 267 ? 26.105  10.308  30.284  1.00 32.59 ? 267  GLU A CB  1 
ATOM   1936 C  CG  . GLU A 1 267 ? 26.670  9.242   29.352  1.00 34.67 ? 267  GLU A CG  1 
ATOM   1937 C  CD  . GLU A 1 267 ? 28.022  9.645   28.757  1.00 35.60 ? 267  GLU A CD  1 
ATOM   1938 O  OE1 . GLU A 1 267 ? 28.351  10.859  28.771  1.00 39.45 ? 267  GLU A OE1 1 
ATOM   1939 O  OE2 . GLU A 1 267 ? 28.761  8.747   28.279  1.00 38.91 ? 267  GLU A OE2 1 
ATOM   1940 N  N   . ASN A 1 268 ? 23.432  12.029  31.616  1.00 33.16 ? 268  ASN A N   1 
ATOM   1941 C  CA  . ASN A 1 268 ? 23.169  13.125  32.540  1.00 33.31 ? 268  ASN A CA  1 
ATOM   1942 C  C   . ASN A 1 268 ? 22.626  12.589  33.868  1.00 32.64 ? 268  ASN A C   1 
ATOM   1943 O  O   . ASN A 1 268 ? 21.713  11.756  33.858  1.00 32.70 ? 268  ASN A O   1 
ATOM   1944 C  CB  . ASN A 1 268 ? 22.223  14.151  31.896  1.00 33.25 ? 268  ASN A CB  1 
ATOM   1945 C  CG  . ASN A 1 268 ? 22.123  15.445  32.693  1.00 35.31 ? 268  ASN A CG  1 
ATOM   1946 O  OD1 . ASN A 1 268 ? 21.407  15.508  33.689  1.00 36.55 ? 268  ASN A OD1 1 
ATOM   1947 N  ND2 . ASN A 1 268 ? 22.824  16.492  32.238  1.00 33.09 ? 268  ASN A ND2 1 
ATOM   1948 N  N   . PRO A 1 269 ? 23.204  13.042  35.008  1.00 32.13 ? 269  PRO A N   1 
ATOM   1949 C  CA  . PRO A 1 269 ? 22.762  12.602  36.338  1.00 31.87 ? 269  PRO A CA  1 
ATOM   1950 C  C   . PRO A 1 269 ? 21.260  12.730  36.614  1.00 31.41 ? 269  PRO A C   1 
ATOM   1951 O  O   . PRO A 1 269 ? 20.731  11.944  37.398  1.00 31.33 ? 269  PRO A O   1 
ATOM   1952 C  CB  . PRO A 1 269 ? 23.592  13.473  37.297  1.00 31.94 ? 269  PRO A CB  1 
ATOM   1953 C  CG  . PRO A 1 269 ? 24.854  13.753  36.521  1.00 32.26 ? 269  PRO A CG  1 
ATOM   1954 C  CD  . PRO A 1 269 ? 24.352  13.974  35.104  1.00 32.26 ? 269  PRO A CD  1 
ATOM   1955 N  N   . LEU A 1 270 ? 20.581  13.665  35.952  1.00 31.02 ? 270  LEU A N   1 
ATOM   1956 C  CA  . LEU A 1 270 ? 19.124  13.796  36.071  1.00 31.77 ? 270  LEU A CA  1 
ATOM   1957 C  C   . LEU A 1 270 ? 18.336  12.552  35.641  1.00 31.46 ? 270  LEU A C   1 
ATOM   1958 O  O   . LEU A 1 270 ? 17.263  12.271  36.178  1.00 30.92 ? 270  LEU A O   1 
ATOM   1959 C  CB  . LEU A 1 270 ? 18.605  14.991  35.265  1.00 32.36 ? 270  LEU A CB  1 
ATOM   1960 C  CG  . LEU A 1 270 ? 18.916  16.426  35.705  1.00 33.46 ? 270  LEU A CG  1 
ATOM   1961 C  CD1 . LEU A 1 270 ? 18.560  17.334  34.556  1.00 32.73 ? 270  LEU A CD1 1 
ATOM   1962 C  CD2 . LEU A 1 270 ? 18.120  16.795  36.953  1.00 34.16 ? 270  LEU A CD2 1 
ATOM   1963 N  N   . ILE A 1 271 ? 18.876  11.815  34.680  1.00 31.18 ? 271  ILE A N   1 
ATOM   1964 C  CA  . ILE A 1 271 ? 18.120  10.755  34.007  1.00 31.24 ? 271  ILE A CA  1 
ATOM   1965 C  C   . ILE A 1 271 ? 18.270  9.423   34.739  1.00 30.54 ? 271  ILE A C   1 
ATOM   1966 O  O   . ILE A 1 271 ? 19.367  8.865   34.832  1.00 30.69 ? 271  ILE A O   1 
ATOM   1967 C  CB  . ILE A 1 271 ? 18.522  10.641  32.518  1.00 30.94 ? 271  ILE A CB  1 
ATOM   1968 C  CG1 . ILE A 1 271 ? 18.034  11.881  31.752  1.00 32.01 ? 271  ILE A CG1 1 
ATOM   1969 C  CG2 . ILE A 1 271 ? 18.023  9.306   31.899  1.00 30.82 ? 271  ILE A CG2 1 
ATOM   1970 C  CD1 . ILE A 1 271 ? 18.299  11.831  30.220  1.00 31.94 ? 271  ILE A CD1 1 
ATOM   1971 N  N   . LEU A 1 272 ? 17.160  8.926   35.265  1.00 29.66 ? 272  LEU A N   1 
ATOM   1972 C  CA  . LEU A 1 272 ? 17.181  7.727   36.116  1.00 29.35 ? 272  LEU A CA  1 
ATOM   1973 C  C   . LEU A 1 272 ? 16.344  6.603   35.514  1.00 28.51 ? 272  LEU A C   1 
ATOM   1974 O  O   . LEU A 1 272 ? 15.620  6.821   34.539  1.00 28.31 ? 272  LEU A O   1 
ATOM   1975 C  CB  . LEU A 1 272 ? 16.695  8.089   37.538  1.00 29.81 ? 272  LEU A CB  1 
ATOM   1976 C  CG  . LEU A 1 272 ? 17.541  9.129   38.290  1.00 30.31 ? 272  LEU A CG  1 
ATOM   1977 C  CD1 . LEU A 1 272 ? 16.934  9.430   39.652  1.00 31.75 ? 272  LEU A CD1 1 
ATOM   1978 C  CD2 . LEU A 1 272 ? 18.983  8.634   38.449  1.00 32.11 ? 272  LEU A CD2 1 
ATOM   1979 N  N   . GLU A 1 273 ? 16.435  5.405   36.086  1.00 28.59 ? 273  GLU A N   1 
ATOM   1980 C  CA  . GLU A 1 273 ? 15.674  4.248   35.585  1.00 28.10 ? 273  GLU A CA  1 
ATOM   1981 C  C   . GLU A 1 273 ? 14.192  4.586   35.396  1.00 28.23 ? 273  GLU A C   1 
ATOM   1982 O  O   . GLU A 1 273 ? 13.623  4.310   34.336  1.00 27.82 ? 273  GLU A O   1 
ATOM   1983 C  CB  . GLU A 1 273 ? 15.828  3.029   36.496  1.00 28.12 ? 273  GLU A CB  1 
ATOM   1984 C  CG  . GLU A 1 273 ? 15.490  1.670   35.827  1.00 28.83 ? 273  GLU A CG  1 
ATOM   1985 C  CD  . GLU A 1 273 ? 13.982  1.371   35.744  1.00 32.33 ? 273  GLU A CD  1 
ATOM   1986 O  OE1 . GLU A 1 273 ? 13.565  0.581   34.858  1.00 32.91 ? 273  GLU A OE1 1 
ATOM   1987 O  OE2 . GLU A 1 273 ? 13.204  1.910   36.568  1.00 33.71 ? 273  GLU A OE2 1 
ATOM   1988 N  N   . HIS A 1 274 ? 13.585  5.205   36.406  1.00 27.84 ? 274  HIS A N   1 
ATOM   1989 C  CA  . HIS A 1 274 ? 12.136  5.420   36.392  1.00 28.64 ? 274  HIS A CA  1 
ATOM   1990 C  C   . HIS A 1 274 ? 11.659  6.405   35.301  1.00 28.46 ? 274  HIS A C   1 
ATOM   1991 O  O   . HIS A 1 274 ? 10.469  6.474   35.017  1.00 29.49 ? 274  HIS A O   1 
ATOM   1992 C  CB  . HIS A 1 274 ? 11.596  5.760   37.801  1.00 27.60 ? 274  HIS A CB  1 
ATOM   1993 C  CG  . HIS A 1 274 ? 11.851  7.174   38.229  1.00 29.43 ? 274  HIS A CG  1 
ATOM   1994 N  ND1 . HIS A 1 274 ? 13.087  7.614   38.658  1.00 28.28 ? 274  HIS A ND1 1 
ATOM   1995 C  CD2 . HIS A 1 274 ? 11.021  8.244   38.306  1.00 27.64 ? 274  HIS A CD2 1 
ATOM   1996 C  CE1 . HIS A 1 274 ? 13.011  8.894   38.969  1.00 27.75 ? 274  HIS A CE1 1 
ATOM   1997 N  NE2 . HIS A 1 274 ? 11.769  9.298   38.769  1.00 29.31 ? 274  HIS A NE2 1 
ATOM   1998 N  N   . HIS A 1 275 ? 12.589  7.108   34.659  1.00 28.41 ? 275  HIS A N   1 
ATOM   1999 C  CA  . HIS A 1 275 ? 12.258  8.021   33.566  1.00 28.19 ? 275  HIS A CA  1 
ATOM   2000 C  C   . HIS A 1 275 ? 12.126  7.312   32.213  1.00 28.30 ? 275  HIS A C   1 
ATOM   2001 O  O   . HIS A 1 275 ? 11.661  7.916   31.236  1.00 28.34 ? 275  HIS A O   1 
ATOM   2002 C  CB  . HIS A 1 275 ? 13.298  9.138   33.442  1.00 28.10 ? 275  HIS A CB  1 
ATOM   2003 C  CG  . HIS A 1 275 ? 13.372  10.047  34.627  1.00 27.96 ? 275  HIS A CG  1 
ATOM   2004 N  ND1 . HIS A 1 275 ? 14.552  10.302  35.289  1.00 28.45 ? 275  HIS A ND1 1 
ATOM   2005 C  CD2 . HIS A 1 275 ? 12.425  10.788  35.249  1.00 27.91 ? 275  HIS A CD2 1 
ATOM   2006 C  CE1 . HIS A 1 275 ? 14.332  11.154  36.274  1.00 27.66 ? 275  HIS A CE1 1 
ATOM   2007 N  NE2 . HIS A 1 275 ? 13.048  11.458  36.278  1.00 29.04 ? 275  HIS A NE2 1 
ATOM   2008 N  N   . HIS A 1 276 ? 12.555  6.047   32.167  1.00 27.87 ? 276  HIS A N   1 
ATOM   2009 C  CA  . HIS A 1 276 ? 12.521  5.212   30.965  1.00 28.01 ? 276  HIS A CA  1 
ATOM   2010 C  C   . HIS A 1 276 ? 11.150  4.583   30.789  1.00 28.53 ? 276  HIS A C   1 
ATOM   2011 O  O   . HIS A 1 276 ? 10.294  4.711   31.659  1.00 28.63 ? 276  HIS A O   1 
ATOM   2012 C  CB  . HIS A 1 276 ? 13.600  4.110   31.042  1.00 27.09 ? 276  HIS A CB  1 
ATOM   2013 C  CG  . HIS A 1 276 ? 15.000  4.632   30.935  1.00 25.66 ? 276  HIS A CG  1 
ATOM   2014 N  ND1 . HIS A 1 276 ? 15.605  5.352   31.942  1.00 23.44 ? 276  HIS A ND1 1 
ATOM   2015 C  CD2 . HIS A 1 276 ? 15.907  4.560   29.932  1.00 23.02 ? 276  HIS A CD2 1 
ATOM   2016 C  CE1 . HIS A 1 276 ? 16.819  5.706   31.560  1.00 23.10 ? 276  HIS A CE1 1 
ATOM   2017 N  NE2 . HIS A 1 276 ? 17.030  5.231   30.351  1.00 20.64 ? 276  HIS A NE2 1 
ATOM   2018 N  N   . HIS A 1 277 ? 10.948  3.908   29.660  1.00 29.48 ? 277  HIS A N   1 
ATOM   2019 C  CA  . HIS A 1 277 ? 9.687   3.241   29.365  1.00 30.90 ? 277  HIS A CA  1 
ATOM   2020 C  C   . HIS A 1 277 ? 9.455   2.076   30.326  1.00 31.51 ? 277  HIS A C   1 
ATOM   2021 O  O   . HIS A 1 277 ? 10.408  1.457   30.804  1.00 31.36 ? 277  HIS A O   1 
ATOM   2022 C  CB  . HIS A 1 277 ? 9.650   2.747   27.906  1.00 30.92 ? 277  HIS A CB  1 
ATOM   2023 C  CG  . HIS A 1 277 ? 10.324  1.422   27.696  1.00 31.97 ? 277  HIS A CG  1 
ATOM   2024 N  ND1 . HIS A 1 277 ? 9.665   0.219   27.842  1.00 33.18 ? 277  HIS A ND1 1 
ATOM   2025 C  CD2 . HIS A 1 277 ? 11.602  1.110   27.372  1.00 32.71 ? 277  HIS A CD2 1 
ATOM   2026 C  CE1 . HIS A 1 277 ? 10.503  -0.777  27.612  1.00 32.37 ? 277  HIS A CE1 1 
ATOM   2027 N  NE2 . HIS A 1 277 ? 11.687  -0.263  27.329  1.00 33.49 ? 277  HIS A NE2 1 
ATOM   2028 N  N   . HIS A 1 278 ? 8.183   1.796   30.608  1.00 32.85 ? 278  HIS A N   1 
ATOM   2029 C  CA  . HIS A 1 278 ? 7.780   0.615   31.373  1.00 34.48 ? 278  HIS A CA  1 
ATOM   2030 C  C   . HIS A 1 278 ? 6.487   0.058   30.784  1.00 35.52 ? 278  HIS A C   1 
ATOM   2031 O  O   . HIS A 1 278 ? 5.446   0.721   30.827  1.00 35.40 ? 278  HIS A O   1 
ATOM   2032 C  CB  . HIS A 1 278 ? 7.573   0.954   32.850  1.00 34.38 ? 278  HIS A CB  1 
ATOM   2033 C  CG  . HIS A 1 278 ? 8.791   1.495   33.530  1.00 34.53 ? 278  HIS A CG  1 
ATOM   2034 N  ND1 . HIS A 1 278 ? 9.073   2.841   33.593  1.00 33.10 ? 278  HIS A ND1 1 
ATOM   2035 C  CD2 . HIS A 1 278 ? 9.795   0.869   34.189  1.00 35.53 ? 278  HIS A CD2 1 
ATOM   2036 C  CE1 . HIS A 1 278 ? 10.198  3.021   34.261  1.00 34.39 ? 278  HIS A CE1 1 
ATOM   2037 N  NE2 . HIS A 1 278 ? 10.659  1.840   34.630  1.00 35.04 ? 278  HIS A NE2 1 
ATOM   2038 N  N   . HIS A 1 279 ? 6.566   -1.150  30.226  1.00 36.94 ? 279  HIS A N   1 
ATOM   2039 C  CA  . HIS A 1 279 ? 5.416   -1.801  29.581  1.00 38.68 ? 279  HIS A CA  1 
ATOM   2040 C  C   . HIS A 1 279 ? 5.078   -3.137  30.229  1.00 39.52 ? 279  HIS A C   1 
ATOM   2041 O  O   . HIS A 1 279 ? 5.970   -3.865  30.685  1.00 40.28 ? 279  HIS A O   1 
ATOM   2042 C  CB  . HIS A 1 279 ? 5.662   -2.015  28.072  1.00 38.88 ? 279  HIS A CB  1 
ATOM   2043 C  CG  A HIS A 1 279 ? 5.878   -0.749  27.299  0.50 37.87 ? 279  HIS A CG  1 
ATOM   2044 C  CG  B HIS A 1 279 ? 6.708   -3.042  27.760  0.50 39.28 ? 279  HIS A CG  1 
ATOM   2045 N  ND1 A HIS A 1 279 ? 7.131   -0.233  27.054  0.50 36.86 ? 279  HIS A ND1 1 
ATOM   2046 N  ND1 B HIS A 1 279 ? 8.031   -2.891  28.113  0.50 40.23 ? 279  HIS A ND1 1 
ATOM   2047 C  CD2 A HIS A 1 279 ? 5.003   0.088   26.693  0.50 38.14 ? 279  HIS A CD2 1 
ATOM   2048 C  CD2 B HIS A 1 279 ? 6.626   -4.226  27.110  0.50 40.01 ? 279  HIS A CD2 1 
ATOM   2049 C  CE1 A HIS A 1 279 ? 7.020   0.876   26.344  0.50 36.90 ? 279  HIS A CE1 1 
ATOM   2050 C  CE1 B HIS A 1 279 ? 8.718   -3.941  27.703  0.50 40.18 ? 279  HIS A CE1 1 
ATOM   2051 N  NE2 A HIS A 1 279 ? 5.739   1.093   26.111  0.50 37.66 ? 279  HIS A NE2 1 
ATOM   2052 N  NE2 B HIS A 1 279 ? 7.888   -4.768  27.093  0.50 40.25 ? 279  HIS A NE2 1 
ATOM   2053 O  OXT . HIS A 1 279 ? 3.905   -3.540  30.294  1.00 40.68 ? 279  HIS A OXT 1 
HETATM 2054 C  C17 . 5Z5 B 2 .   ? -6.901  14.763  21.683  1.00 29.18 ? 1280 5Z5 A C17 1 
HETATM 2055 N  N3  . 5Z5 B 2 .   ? -6.193  13.591  21.113  1.00 29.35 ? 1280 5Z5 A N3  1 
HETATM 2056 C  C16 . 5Z5 B 2 .   ? -6.335  12.369  21.595  1.00 29.11 ? 1280 5Z5 A C16 1 
HETATM 2057 O  O2  . 5Z5 B 2 .   ? -7.054  12.117  22.563  1.00 29.94 ? 1280 5Z5 A O2  1 
HETATM 2058 C  C12 . 5Z5 B 2 .   ? -5.529  11.254  20.888  1.00 28.30 ? 1280 5Z5 A C12 1 
HETATM 2059 C  C11 . 5Z5 B 2 .   ? -4.676  11.346  19.789  1.00 28.73 ? 1280 5Z5 A C11 1 
HETATM 2060 C  C14 . 5Z5 B 2 .   ? -4.334  12.644  18.999  1.00 28.33 ? 1280 5Z5 A C14 1 
HETATM 2061 C  C13 . 5Z5 B 2 .   ? -5.540  9.919   21.243  1.00 27.65 ? 1280 5Z5 A C13 1 
HETATM 2062 C  C15 . 5Z5 B 2 .   ? -6.321  9.286   22.387  1.00 28.22 ? 1280 5Z5 A C15 1 
HETATM 2063 N  N2  . 5Z5 B 2 .   ? -4.753  9.234   20.420  1.00 28.49 ? 1280 5Z5 A N2  1 
HETATM 2064 C  C10 . 5Z5 B 2 .   ? -4.201  10.056  19.520  1.00 28.35 ? 1280 5Z5 A C10 1 
HETATM 2065 C  C9  . 5Z5 B 2 .   ? -3.325  9.796   18.463  1.00 29.12 ? 1280 5Z5 A C9  1 
HETATM 2066 C  C7  . 5Z5 B 2 .   ? -2.790  8.540   18.125  1.00 28.67 ? 1280 5Z5 A C7  1 
HETATM 2067 C  C5  . 5Z5 B 2 .   ? -1.906  8.332   17.072  1.00 29.41 ? 1280 5Z5 A C5  1 
HETATM 2068 C  C4  . 5Z5 B 2 .   ? -1.330  9.170   16.119  1.00 29.48 ? 1280 5Z5 A C4  1 
HETATM 2069 C  C1  . 5Z5 B 2 .   ? -0.450  8.647   15.173  1.00 29.14 ? 1280 5Z5 A C1  1 
HETATM 2070 CL CL1 . 5Z5 B 2 .   ? 0.257   9.693   13.997  1.00 31.23 ? 1280 5Z5 A CL1 1 
HETATM 2071 C  C2  . 5Z5 B 2 .   ? -0.145  7.288   15.162  1.00 29.03 ? 1280 5Z5 A C2  1 
HETATM 2072 C  C3  . 5Z5 B 2 .   ? -0.726  6.457   16.121  1.00 29.18 ? 1280 5Z5 A C3  1 
HETATM 2073 C  C6  . 5Z5 B 2 .   ? -1.595  6.969   17.070  1.00 28.07 ? 1280 5Z5 A C6  1 
HETATM 2074 N  N1  . 5Z5 B 2 .   ? -2.261  6.380   18.062  1.00 28.56 ? 1280 5Z5 A N1  1 
HETATM 2075 C  C8  . 5Z5 B 2 .   ? -2.984  7.285   18.708  1.00 28.41 ? 1280 5Z5 A C8  1 
HETATM 2076 O  O1  . 5Z5 B 2 .   ? -3.693  7.002   19.671  1.00 28.95 ? 1280 5Z5 A O1  1 
HETATM 2077 O  O   . HOH C 3 .   ? -9.520  8.146   23.093  1.00 38.24 ? 2001 HOH A O   1 
HETATM 2078 O  O   . HOH C 3 .   ? -12.087 9.043   23.916  1.00 38.68 ? 2002 HOH A O   1 
HETATM 2079 O  O   . HOH C 3 .   ? -5.383  12.809  15.737  1.00 33.98 ? 2003 HOH A O   1 
HETATM 2080 O  O   . HOH C 3 .   ? -12.419 -1.085  26.730  1.00 35.67 ? 2004 HOH A O   1 
HETATM 2081 O  O   . HOH C 3 .   ? 14.539  2.274   27.999  1.00 25.54 ? 2005 HOH A O   1 
HETATM 2082 O  O   . HOH C 3 .   ? -2.364  -0.317  21.222  1.00 33.65 ? 2006 HOH A O   1 
HETATM 2083 O  O   . HOH C 3 .   ? -2.708  12.271  15.370  1.00 41.58 ? 2007 HOH A O   1 
HETATM 2084 O  O   . HOH C 3 .   ? 0.391   25.886  22.385  1.00 39.48 ? 2008 HOH A O   1 
HETATM 2085 O  O   . HOH C 3 .   ? -2.968  27.499  23.830  1.00 38.06 ? 2009 HOH A O   1 
HETATM 2086 O  O   . HOH C 3 .   ? -5.509  29.089  27.058  1.00 46.30 ? 2010 HOH A O   1 
HETATM 2087 O  O   . HOH C 3 .   ? 26.768  11.653  39.228  1.00 50.00 ? 2011 HOH A O   1 
HETATM 2088 O  O   . HOH C 3 .   ? 0.359   19.487  35.014  1.00 37.07 ? 2012 HOH A O   1 
HETATM 2089 O  O   . HOH C 3 .   ? 8.791   31.931  30.251  1.00 31.87 ? 2013 HOH A O   1 
HETATM 2090 O  O   . HOH C 3 .   ? 15.237  15.376  39.308  1.00 41.75 ? 2014 HOH A O   1 
HETATM 2091 O  O   . HOH C 3 .   ? 24.324  6.131   15.023  1.00 44.37 ? 2015 HOH A O   1 
HETATM 2092 O  O   . HOH C 3 .   ? 7.996   0.730   17.406  1.00 24.91 ? 2016 HOH A O   1 
HETATM 2093 O  O   . HOH C 3 .   ? 12.792  4.226   27.389  1.00 19.99 ? 2017 HOH A O   1 
HETATM 2094 O  O   . HOH C 3 .   ? 6.050   1.349   20.717  1.00 27.35 ? 2018 HOH A O   1 
HETATM 2095 O  O   . HOH C 3 .   ? 9.099   -2.902  21.737  1.00 45.65 ? 2019 HOH A O   1 
HETATM 2096 O  O   . HOH C 3 .   ? 2.016   -1.168  22.246  1.00 50.40 ? 2020 HOH A O   1 
HETATM 2097 O  O   . HOH C 3 .   ? 0.162   2.198   23.688  1.00 45.01 ? 2021 HOH A O   1 
HETATM 2098 O  O   . HOH C 3 .   ? -7.868  9.260   26.489  1.00 39.70 ? 2022 HOH A O   1 
HETATM 2099 O  O   . HOH C 3 .   ? -2.233  3.875   25.309  1.00 22.96 ? 2023 HOH A O   1 
HETATM 2100 O  O   . HOH C 3 .   ? -2.776  14.845  25.131  1.00 26.51 ? 2024 HOH A O   1 
HETATM 2101 O  O   . HOH C 3 .   ? 10.265  32.710  32.651  0.50 23.10 ? 2025 HOH A O   1 
HETATM 2102 O  O   . HOH C 3 .   ? 12.838  19.120  41.296  1.00 46.73 ? 2026 HOH A O   1 
HETATM 2103 O  O   . HOH C 3 .   ? 0.741   23.068  21.705  1.00 44.10 ? 2027 HOH A O   1 
HETATM 2104 O  O   . HOH C 3 .   ? -0.855  19.811  30.655  1.00 21.43 ? 2028 HOH A O   1 
HETATM 2105 O  O   . HOH C 3 .   ? -2.499  25.624  21.941  1.00 53.83 ? 2029 HOH A O   1 
HETATM 2106 O  O   . HOH C 3 .   ? -4.488  26.827  25.893  1.00 28.27 ? 2030 HOH A O   1 
HETATM 2107 O  O   . HOH C 3 .   ? -0.383  27.081  24.652  1.00 47.50 ? 2031 HOH A O   1 
HETATM 2108 O  O   . HOH C 3 .   ? 26.415  14.662  32.194  1.00 35.60 ? 2032 HOH A O   1 
HETATM 2109 O  O   . HOH C 3 .   ? 25.418  10.029  37.744  1.00 28.27 ? 2033 HOH A O   1 
HETATM 2110 O  O   . HOH C 3 .   ? 8.927   3.292   37.779  1.00 40.01 ? 2034 HOH A O   1 
HETATM 2111 O  O   . HOH C 3 .   ? -0.420  21.388  33.394  1.00 27.61 ? 2035 HOH A O   1 
HETATM 2112 O  O   . HOH C 3 .   ? -0.841  25.459  40.193  1.00 46.66 ? 2036 HOH A O   1 
HETATM 2113 O  O   . HOH C 3 .   ? 6.476   30.720  30.732  1.00 22.34 ? 2037 HOH A O   1 
HETATM 2114 O  O   . HOH C 3 .   ? 2.711   26.293  37.758  1.00 32.66 ? 2038 HOH A O   1 
HETATM 2115 O  O   . HOH C 3 .   ? 7.620   -2.549  34.361  1.00 44.93 ? 2039 HOH A O   1 
HETATM 2116 O  O   . HOH C 3 .   ? 2.893   17.225  34.896  1.00 28.38 ? 2040 HOH A O   1 
HETATM 2117 O  O   . HOH C 3 .   ? 12.689  15.599  39.201  1.00 37.32 ? 2041 HOH A O   1 
HETATM 2118 O  O   . HOH C 3 .   ? 14.112  12.087  39.815  1.00 19.62 ? 2042 HOH A O   1 
HETATM 2119 O  O   . HOH C 3 .   ? 2.294   11.469  33.646  1.00 47.67 ? 2043 HOH A O   1 
HETATM 2120 O  O   . HOH C 3 .   ? 8.450   6.541   32.727  1.00 25.73 ? 2044 HOH A O   1 
HETATM 2121 O  O   . HOH C 3 .   ? 17.071  3.506   21.750  1.00 23.46 ? 2045 HOH A O   1 
HETATM 2122 O  O   . HOH C 3 .   ? 22.707  6.275   18.165  1.00 41.97 ? 2046 HOH A O   1 
HETATM 2123 O  O   . HOH C 3 .   ? 19.539  1.819   23.750  1.00 34.70 ? 2047 HOH A O   1 
HETATM 2124 O  O   . HOH C 3 .   ? 23.850  5.289   24.605  1.00 34.38 ? 2048 HOH A O   1 
HETATM 2125 O  O   . HOH C 3 .   ? 18.613  2.253   19.956  1.00 30.52 ? 2049 HOH A O   1 
HETATM 2126 O  O   . HOH C 3 .   ? 22.650  10.081  17.360  1.00 40.45 ? 2050 HOH A O   1 
HETATM 2127 O  O   . HOH C 3 .   ? 3.092   20.869  17.419  1.00 22.47 ? 2051 HOH A O   1 
HETATM 2128 O  O   . HOH C 3 .   ? -1.118  14.892  16.619  1.00 30.24 ? 2052 HOH A O   1 
HETATM 2129 O  O   . HOH C 3 .   ? 1.134   13.317  13.547  1.00 55.72 ? 2053 HOH A O   1 
HETATM 2130 O  O   . HOH C 3 .   ? 3.634   10.486  12.837  1.00 54.57 ? 2054 HOH A O   1 
HETATM 2131 O  O   . HOH C 3 .   ? 1.024   1.111   26.063  1.00 41.80 ? 2055 HOH A O   1 
HETATM 2132 O  O   . HOH C 3 .   ? -1.420  1.932   27.876  1.00 45.06 ? 2056 HOH A O   1 
HETATM 2133 O  O   . HOH C 3 .   ? 6.767   4.496   32.186  1.00 40.20 ? 2057 HOH A O   1 
HETATM 2134 O  O   . HOH C 3 .   ? 9.945   7.852   14.104  1.00 47.00 ? 2058 HOH A O   1 
HETATM 2135 O  O   . HOH C 3 .   ? 25.156  13.439  11.759  1.00 38.96 ? 2059 HOH A O   1 
HETATM 2136 O  O   . HOH C 3 .   ? 4.107   26.983  19.506  1.00 44.64 ? 2060 HOH A O   1 
HETATM 2137 O  O   . HOH C 3 .   ? 5.716   24.162  18.512  1.00 43.33 ? 2061 HOH A O   1 
HETATM 2138 O  O   . HOH C 3 .   ? 5.410   23.579  31.847  1.00 13.78 ? 2062 HOH A O   1 
HETATM 2139 O  O   . HOH C 3 .   ? 2.998   27.100  23.335  1.00 39.52 ? 2063 HOH A O   1 
HETATM 2140 O  O   . HOH C 3 .   ? 12.449  33.246  25.086  1.00 22.90 ? 2064 HOH A O   1 
HETATM 2141 O  O   . HOH C 3 .   ? 11.777  35.034  20.885  1.00 40.14 ? 2065 HOH A O   1 
HETATM 2142 O  O   . HOH C 3 .   ? 14.780  39.564  14.584  1.00 41.58 ? 2066 HOH A O   1 
HETATM 2143 O  O   . HOH C 3 .   ? 17.401  35.594  20.339  1.00 30.76 ? 2067 HOH A O   1 
HETATM 2144 O  O   . HOH C 3 .   ? 22.158  29.740  22.260  1.00 38.53 ? 2068 HOH A O   1 
HETATM 2145 O  O   . HOH C 3 .   ? 14.157  34.399  22.094  1.00 31.59 ? 2069 HOH A O   1 
HETATM 2146 O  O   . HOH C 3 .   ? 23.898  33.843  24.011  1.00 39.25 ? 2070 HOH A O   1 
HETATM 2147 O  O   . HOH C 3 .   ? 12.080  33.025  33.688  0.50 19.85 ? 2071 HOH A O   1 
HETATM 2148 O  O   . HOH C 3 .   ? 10.805  30.483  29.783  1.00 26.31 ? 2072 HOH A O   1 
HETATM 2149 O  O   . HOH C 3 .   ? 15.390  27.337  40.268  1.00 33.63 ? 2073 HOH A O   1 
HETATM 2150 O  O   . HOH C 3 .   ? 9.495   31.264  36.717  1.00 21.65 ? 2074 HOH A O   1 
HETATM 2151 O  O   . HOH C 3 .   ? 8.403   28.821  38.093  1.00 16.70 ? 2075 HOH A O   1 
HETATM 2152 O  O   . HOH C 3 .   ? 11.953  21.106  39.833  1.00 47.90 ? 2076 HOH A O   1 
HETATM 2153 O  O   . HOH C 3 .   ? 8.424   20.395  39.190  1.00 26.05 ? 2077 HOH A O   1 
HETATM 2154 O  O   . HOH C 3 .   ? 18.334  29.753  39.220  1.00 32.43 ? 2078 HOH A O   1 
HETATM 2155 O  O   . HOH C 3 .   ? 18.541  23.858  40.849  1.00 35.08 ? 2079 HOH A O   1 
HETATM 2156 O  O   . HOH C 3 .   ? 22.839  24.977  40.555  1.00 35.89 ? 2080 HOH A O   1 
HETATM 2157 O  O   . HOH C 3 .   ? 19.964  28.957  35.886  1.00 26.01 ? 2081 HOH A O   1 
HETATM 2158 O  O   . HOH C 3 .   ? 21.105  26.322  34.587  1.00 23.69 ? 2082 HOH A O   1 
HETATM 2159 O  O   . HOH C 3 .   ? 22.456  19.317  33.172  1.00 20.52 ? 2083 HOH A O   1 
HETATM 2160 O  O   . HOH C 3 .   ? 16.496  27.973  29.174  1.00 40.05 ? 2084 HOH A O   1 
HETATM 2161 O  O   . HOH C 3 .   ? 23.841  23.182  36.226  1.00 44.93 ? 2085 HOH A O   1 
HETATM 2162 O  O   . HOH C 3 .   ? 24.125  25.616  29.205  1.00 50.83 ? 2086 HOH A O   1 
HETATM 2163 O  O   . HOH C 3 .   ? 22.704  28.008  24.311  1.00 35.92 ? 2087 HOH A O   1 
HETATM 2164 O  O   . HOH C 3 .   ? 24.722  29.477  21.676  1.00 39.48 ? 2088 HOH A O   1 
HETATM 2165 O  O   . HOH C 3 .   ? 25.189  26.156  26.786  1.00 35.05 ? 2089 HOH A O   1 
HETATM 2166 O  O   . HOH C 3 .   ? 28.483  10.185  21.682  1.00 30.96 ? 2090 HOH A O   1 
HETATM 2167 O  O   . HOH C 3 .   ? 23.819  12.365  18.615  1.00 28.13 ? 2091 HOH A O   1 
HETATM 2168 O  O   . HOH C 3 .   ? 24.022  8.486   18.656  1.00 26.43 ? 2092 HOH A O   1 
HETATM 2169 O  O   . HOH C 3 .   ? 24.128  15.655  29.767  1.00 31.55 ? 2093 HOH A O   1 
HETATM 2170 O  O   . HOH C 3 .   ? 20.564  6.838   31.318  1.00 18.86 ? 2094 HOH A O   1 
HETATM 2171 O  O   . HOH C 3 .   ? 26.212  9.842   34.793  1.00 35.80 ? 2095 HOH A O   1 
HETATM 2172 O  O   . HOH C 3 .   ? 22.449  17.035  36.031  1.00 38.63 ? 2096 HOH A O   1 
HETATM 2173 O  O   . HOH C 3 .   ? 18.630  13.155  40.137  1.00 39.24 ? 2097 HOH A O   1 
HETATM 2174 O  O   . HOH C 3 .   ? 22.358  9.965   38.526  1.00 35.45 ? 2098 HOH A O   1 
HETATM 2175 O  O   . HOH C 3 .   ? 16.378  13.084  38.468  1.00 23.04 ? 2099 HOH A O   1 
HETATM 2176 O  O   . HOH C 3 .   ? 19.626  6.260   33.884  1.00 12.36 ? 2100 HOH A O   1 
HETATM 2177 O  O   . HOH C 3 .   ? 12.382  2.734   39.013  1.00 45.64 ? 2101 HOH A O   1 
HETATM 2178 O  O   . HOH C 3 .   ? 11.992  -1.531  34.449  1.00 29.59 ? 2102 HOH A O   1 
HETATM 2179 O  O   . HOH C 3 .   ? 8.371   5.158   36.174  1.00 32.51 ? 2103 HOH A O   1 
HETATM 2180 O  O   . HOH C 3 .   ? 14.825  5.354   39.175  1.00 14.39 ? 2104 HOH A O   1 
HETATM 2181 O  O   . HOH C 3 .   ? 11.188  -1.487  31.869  1.00 34.25 ? 2105 HOH A O   1 
HETATM 2182 O  O   . HOH C 3 .   ? 13.256  0.964   31.741  1.00 27.95 ? 2106 HOH A O   1 
HETATM 2183 O  O   . HOH C 3 .   ? 8.855   -2.778  31.058  1.00 35.73 ? 2107 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ARG 77  77  ?   ?   ?   A . n 
A 1 78  THR 78  78  ?   ?   ?   A . n 
A 1 79  ASN 79  79  ?   ?   ?   A . n 
A 1 80  THR 80  80  ?   ?   ?   A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 HIS 128 128 128 HIS HIS A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 ASP 132 132 ?   ?   ?   A . n 
A 1 133 GLY 133 133 ?   ?   ?   A . n 
A 1 134 GLY 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 THR 136 136 ?   ?   ?   A . n 
A 1 137 VAL 137 137 ?   ?   ?   A . n 
A 1 138 LEU 138 138 ?   ?   ?   A . n 
A 1 139 HIS 139 139 ?   ?   ?   A . n 
A 1 140 ARG 140 140 ?   ?   ?   A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASN 167 167 ?   ?   ?   A . n 
A 1 168 HIS 168 168 ?   ?   ?   A . n 
A 1 169 ASP 169 169 ?   ?   ?   A . n 
A 1 170 THR 170 170 ?   ?   ?   A . n 
A 1 171 SER 171 171 ?   ?   ?   A . n 
A 1 172 PHE 172 172 ?   ?   ?   A . n 
A 1 173 ALA 173 173 ?   ?   ?   A . n 
A 1 174 LYS 174 174 ?   ?   ?   A . n 
A 1 175 ALA 175 175 ?   ?   ?   A . n 
A 1 176 PHE 176 176 ?   ?   ?   A . n 
A 1 177 VAL 177 177 ?   ?   ?   A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 MET 188 188 188 MET MET A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 CYS 210 210 210 CYS CYS A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 MET 213 213 213 MET MET A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ARG 239 239 239 ARG ARG A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 HIS 274 274 274 HIS HIS A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 HIS 277 277 277 HIS HIS A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 5Z5 1   1280 1280 5Z5 5Z5 A . 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-04 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Structure summary'         
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author       
2 4 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.name'         
2 4 'Structure model' '_exptl_crystal_grow.method' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -3.9591 2.2859  10.5005 0.4429  0.0551  0.1932  0.0085 -0.3760 -0.1895 13.4988 4.4903 4.6756 
-3.1466 4.8513 -1.4348 1.0386 1.6194 -1.5073 -1.4248 -0.4728 0.6732 0.7313  0.2933  -0.5658 
'X-RAY DIFFRACTION' 2 ? refined 12.8160 19.1608 22.8707 -0.1575 -0.1417 -0.2082 0.0032 0.0174  0.0179  2.5486  4.3558 2.0580 
0.0526  0.0378 0.2130  0.0445 0.3536 0.0935  -0.5251 -0.0189 0.0503 -0.0078 -0.0305 -0.0256 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 3  ? ? A 90  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 91 ? ? A 279 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2JAV 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, THR 175 TO ALA' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'C-TERMINAL HEXA-HISTIDINE TAG' 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            N 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             3 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_2             3 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.584 
_pdbx_validate_rmsd_bond.bond_target_value         1.459 
_pdbx_validate_rmsd_bond.bond_deviation            0.125 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.020 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 181 ? ? 67.83  -49.58 
2 1 SER A 184 ? ? -49.74 150.87 
3 1 LEU A 212 ? ? 58.71  17.11  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 3   ? OG  ? A SER 3   OG  
2  1 Y 1 A ARG 4   ? CB  ? A ARG 4   CB  
3  1 Y 1 A ARG 4   ? CG  ? A ARG 4   CG  
4  1 Y 1 A ARG 4   ? CD  ? A ARG 4   CD  
5  1 Y 1 A ARG 4   ? NE  ? A ARG 4   NE  
6  1 Y 1 A ARG 4   ? CZ  ? A ARG 4   CZ  
7  1 Y 1 A ARG 4   ? NH1 ? A ARG 4   NH1 
8  1 Y 1 A ARG 4   ? NH2 ? A ARG 4   NH2 
9  1 Y 1 A GLU 6   ? OE1 ? A GLU 6   OE1 
10 1 Y 1 A GLU 6   ? OE2 ? A GLU 6   OE2 
11 1 Y 1 A SER 18  ? OG  ? A SER 18  OG  
12 1 Y 1 A LYS 28  ? CG  ? A LYS 28  CG  
13 1 Y 1 A LYS 28  ? CD  ? A LYS 28  CD  
14 1 Y 1 A LYS 28  ? CE  ? A LYS 28  CE  
15 1 Y 1 A LYS 28  ? NZ  ? A LYS 28  NZ  
16 1 Y 1 A ASP 30  ? CG  ? A ASP 30  CG  
17 1 Y 1 A ASP 30  ? OD1 ? A ASP 30  OD1 
18 1 Y 1 A ASP 30  ? OD2 ? A ASP 30  OD2 
19 1 Y 1 A MET 44  ? CG  ? A MET 44  CG  
20 1 Y 1 A MET 44  ? SD  ? A MET 44  SD  
21 1 Y 1 A MET 44  ? CE  ? A MET 44  CE  
22 1 Y 1 A LYS 49  ? CG  ? A LYS 49  CG  
23 1 Y 1 A LYS 49  ? CD  ? A LYS 49  CD  
24 1 Y 1 A LYS 49  ? CE  ? A LYS 49  CE  
25 1 Y 1 A LYS 49  ? NZ  ? A LYS 49  NZ  
26 1 Y 1 A GLN 50  ? CG  ? A GLN 50  CG  
27 1 Y 1 A GLN 50  ? CD  ? A GLN 50  CD  
28 1 Y 1 A GLN 50  ? OE1 ? A GLN 50  OE1 
29 1 Y 1 A GLN 50  ? NE2 ? A GLN 50  NE2 
30 1 Y 1 A MET 51  ? CG  ? A MET 51  CG  
31 1 Y 1 A MET 51  ? SD  ? A MET 51  SD  
32 1 Y 1 A MET 51  ? CE  ? A MET 51  CE  
33 1 Y 1 A LEU 52  ? CG  ? A LEU 52  CG  
34 1 Y 1 A LEU 52  ? CD1 ? A LEU 52  CD1 
35 1 Y 1 A LEU 52  ? CD2 ? A LEU 52  CD2 
36 1 Y 1 A ASN 57  ? CG  ? A ASN 57  CG  
37 1 Y 1 A ASN 57  ? OD1 ? A ASN 57  OD1 
38 1 Y 1 A ASN 57  ? ND2 ? A ASN 57  ND2 
39 1 Y 1 A LEU 58  ? CG  ? A LEU 58  CG  
40 1 Y 1 A LEU 58  ? CD1 ? A LEU 58  CD1 
41 1 Y 1 A LEU 58  ? CD2 ? A LEU 58  CD2 
42 1 Y 1 A LEU 59  ? CG  ? A LEU 59  CG  
43 1 Y 1 A LEU 59  ? CD1 ? A LEU 59  CD1 
44 1 Y 1 A LEU 59  ? CD2 ? A LEU 59  CD2 
45 1 Y 1 A GLU 61  ? OE1 ? A GLU 61  OE1 
46 1 Y 1 A GLU 61  ? OE2 ? A GLU 61  OE2 
47 1 Y 1 A LYS 63  ? CD  ? A LYS 63  CD  
48 1 Y 1 A LYS 63  ? CE  ? A LYS 63  CE  
49 1 Y 1 A LYS 63  ? NZ  ? A LYS 63  NZ  
50 1 Y 1 A ARG 73  ? NE  ? A ARG 73  NE  
51 1 Y 1 A ARG 73  ? CZ  ? A ARG 73  CZ  
52 1 Y 1 A ARG 73  ? NH1 ? A ARG 73  NH1 
53 1 Y 1 A ARG 73  ? NH2 ? A ARG 73  NH2 
54 1 Y 1 A LYS 100 ? NZ  ? A LYS 100 NZ  
55 1 Y 1 A ARG 130 ? CD  ? A ARG 130 CD  
56 1 Y 1 A ARG 130 ? NE  ? A ARG 130 NE  
57 1 Y 1 A ARG 130 ? CZ  ? A ARG 130 CZ  
58 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 
59 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 
60 1 Y 1 A ARG 190 ? CD  ? A ARG 190 CD  
61 1 Y 1 A ARG 190 ? NE  ? A ARG 190 NE  
62 1 Y 1 A ARG 190 ? CZ  ? A ARG 190 CZ  
63 1 Y 1 A ARG 190 ? NH1 ? A ARG 190 NH1 
64 1 Y 1 A ARG 190 ? NH2 ? A ARG 190 NH2 
65 1 Y 1 A MET 191 ? SD  ? A MET 191 SD  
66 1 Y 1 A MET 191 ? CE  ? A MET 191 CE  
67 1 Y 1 A LYS 222 ? NZ  ? A LYS 222 NZ  
68 1 Y 1 A LYS 227 ? NZ  ? A LYS 227 NZ  
69 1 Y 1 A GLU 230 ? CD  ? A GLU 230 CD  
70 1 Y 1 A GLU 230 ? OE1 ? A GLU 230 OE1 
71 1 Y 1 A GLU 230 ? OE2 ? A GLU 230 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A ARG 77  ? A ARG 77  
4  1 Y 1 A THR 78  ? A THR 78  
5  1 Y 1 A ASN 79  ? A ASN 79  
6  1 Y 1 A THR 80  ? A THR 80  
7  1 Y 1 A ASP 132 ? A ASP 132 
8  1 Y 1 A GLY 133 ? A GLY 133 
9  1 Y 1 A GLY 134 ? A GLY 134 
10 1 Y 1 A HIS 135 ? A HIS 135 
11 1 Y 1 A THR 136 ? A THR 136 
12 1 Y 1 A VAL 137 ? A VAL 137 
13 1 Y 1 A LEU 138 ? A LEU 138 
14 1 Y 1 A HIS 139 ? A HIS 139 
15 1 Y 1 A ARG 140 ? A ARG 140 
16 1 Y 1 A ASN 167 ? A ASN 167 
17 1 Y 1 A HIS 168 ? A HIS 168 
18 1 Y 1 A ASP 169 ? A ASP 169 
19 1 Y 1 A THR 170 ? A THR 170 
20 1 Y 1 A SER 171 ? A SER 171 
21 1 Y 1 A PHE 172 ? A PHE 172 
22 1 Y 1 A ALA 173 ? A ALA 173 
23 1 Y 1 A LYS 174 ? A LYS 174 
24 1 Y 1 A ALA 175 ? A ALA 175 
25 1 Y 1 A PHE 176 ? A PHE 176 
26 1 Y 1 A VAL 177 ? A VAL 177 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5-[(Z)-(5-CHLORO-2-OXO-1,2-DIHYDRO-3H-INDOL-3-YLIDENE)METHYL]-N-(DIETHYLAMINO)ETHYL]-2,4-DIMETHYL-1H-PYRROLE-3-CARBOXAMIDE' 5Z5 
3 water                                                                                                                        HOH 
#