data_2JDQ
# 
_entry.id   2JDQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JDQ         
PDBE  EBI-31054    
WWPDB D_1290031054 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2GMO 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        
;IDENTIFICATION BY SYSTEMATIC EXPRESSION SCREENING AND NMR STRUCTURE OF AN INDEPENDENTLY FOLDED C-TERMINAL DOMAIN OF INFLUENZA POLYMERASE SUBUNIT PB2
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JDQ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tarendeau, F.'   1 
'Guilligay, D.'   2 
'Mas, P.'         3 
'Boulo, S.'       4 
'Baudin, F.'      5 
'Ruigrok, R.W.H.' 6 
'Hart, D.J.'      7 
'Cusack, S.'      8 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Nuclear Import Function of the C- Terminal Domain of Influenza Virus Polymerase Pb2 Subunit' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            14 
_citation.page_first                229 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17310249 
_citation.pdbx_database_id_DOI      10.1038/NSMB1212 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tarendeau, F.'   1  ? 
primary 'Boudet, J.'      2  ? 
primary 'Guilligay, D.'   3  ? 
primary 'Mas, P.'         4  ? 
primary 'Bougault, C.'    5  ? 
primary 'Boulo, S.'       6  ? 
primary 'Baudin, F.'      7  ? 
primary 'Ruigrok, R.W.H.' 8  ? 
primary 'Daigle, N.'      9  ? 
primary 'Ellenberg, J.'   10 ? 
primary 'Cusack, S.'      11 ? 
primary 'Simorre, J.-P.'  12 ? 
primary 'Hart, D.J.'      13 ? 
# 
_cell.entry_id           2JDQ 
_cell.length_a           94.970 
_cell.length_b           100.550 
_cell.length_c           151.840 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JDQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'IMPORTIN ALPHA-1 SUBUNIT'   49687.676 2   ? ? 'RESIDUES 66-512'                     ? 
2 polymer man 'POLYMERASE BASIC PROTEIN 2' 8985.251  2   ? ? 'C-TERMINAL DOMAIN, RESIDUES 678-759' ? 
3 water   nat water                        18.015    265 ? ? ?                                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'KARYOPHERIN ALPHA-1 SUBUNIT, SRP1-BETA, RAG COHORT PROTEIN 2, NUCLEOPROTEIN INTERACTOR 1, NPI-1, IMPORTIN ALPHA 5' 
2 'RNA-DIRECTED RNA POLYMERASE SUBUNIT P3, INFLUENZA A VIRUS POLYMERASE PB2 SUBUNIT'                                  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCT
LQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSK
QNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV
ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIF
PALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNG
TGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSS
;
;GAMGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCT
LQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSK
QNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLV
ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIF
PALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNG
TGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSS
;
A,B ? 
2 'polypeptide(L)' no no 
;GDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRM
AIN
;
;GDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRM
AIN
;
D,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   PHE n 
1 6   HIS n 
1 7   GLU n 
1 8   ALA n 
1 9   GLN n 
1 10  ILE n 
1 11  ASN n 
1 12  ASN n 
1 13  MET n 
1 14  GLU n 
1 15  MET n 
1 16  ALA n 
1 17  PRO n 
1 18  GLY n 
1 19  GLY n 
1 20  VAL n 
1 21  ILE n 
1 22  THR n 
1 23  SER n 
1 24  ASP n 
1 25  MET n 
1 26  ILE n 
1 27  GLU n 
1 28  MET n 
1 29  ILE n 
1 30  PHE n 
1 31  SER n 
1 32  LYS n 
1 33  SER n 
1 34  PRO n 
1 35  GLU n 
1 36  GLN n 
1 37  GLN n 
1 38  LEU n 
1 39  SER n 
1 40  ALA n 
1 41  THR n 
1 42  GLN n 
1 43  LYS n 
1 44  PHE n 
1 45  ARG n 
1 46  LYS n 
1 47  LEU n 
1 48  LEU n 
1 49  SER n 
1 50  LYS n 
1 51  GLU n 
1 52  PRO n 
1 53  ASN n 
1 54  PRO n 
1 55  PRO n 
1 56  ILE n 
1 57  ASP n 
1 58  GLU n 
1 59  VAL n 
1 60  ILE n 
1 61  SER n 
1 62  THR n 
1 63  PRO n 
1 64  GLY n 
1 65  VAL n 
1 66  VAL n 
1 67  ALA n 
1 68  ARG n 
1 69  PHE n 
1 70  VAL n 
1 71  GLU n 
1 72  PHE n 
1 73  LEU n 
1 74  LYS n 
1 75  ARG n 
1 76  LYS n 
1 77  GLU n 
1 78  ASN n 
1 79  CYS n 
1 80  THR n 
1 81  LEU n 
1 82  GLN n 
1 83  PHE n 
1 84  GLU n 
1 85  SER n 
1 86  ALA n 
1 87  TRP n 
1 88  VAL n 
1 89  LEU n 
1 90  THR n 
1 91  ASN n 
1 92  ILE n 
1 93  ALA n 
1 94  SER n 
1 95  GLY n 
1 96  ASN n 
1 97  SER n 
1 98  LEU n 
1 99  GLN n 
1 100 THR n 
1 101 ARG n 
1 102 ILE n 
1 103 VAL n 
1 104 ILE n 
1 105 GLN n 
1 106 ALA n 
1 107 GLY n 
1 108 ALA n 
1 109 VAL n 
1 110 PRO n 
1 111 ILE n 
1 112 PHE n 
1 113 ILE n 
1 114 GLU n 
1 115 LEU n 
1 116 LEU n 
1 117 SER n 
1 118 SER n 
1 119 GLU n 
1 120 PHE n 
1 121 GLU n 
1 122 ASP n 
1 123 VAL n 
1 124 GLN n 
1 125 GLU n 
1 126 GLN n 
1 127 ALA n 
1 128 VAL n 
1 129 TRP n 
1 130 ALA n 
1 131 LEU n 
1 132 GLY n 
1 133 ASN n 
1 134 ILE n 
1 135 ALA n 
1 136 GLY n 
1 137 ASP n 
1 138 SER n 
1 139 THR n 
1 140 MET n 
1 141 CYS n 
1 142 ARG n 
1 143 ASP n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 ASP n 
1 148 CYS n 
1 149 ASN n 
1 150 ILE n 
1 151 LEU n 
1 152 PRO n 
1 153 PRO n 
1 154 LEU n 
1 155 LEU n 
1 156 GLN n 
1 157 LEU n 
1 158 PHE n 
1 159 SER n 
1 160 LYS n 
1 161 GLN n 
1 162 ASN n 
1 163 ARG n 
1 164 LEU n 
1 165 THR n 
1 166 MET n 
1 167 THR n 
1 168 ARG n 
1 169 ASN n 
1 170 ALA n 
1 171 VAL n 
1 172 TRP n 
1 173 ALA n 
1 174 LEU n 
1 175 SER n 
1 176 ASN n 
1 177 LEU n 
1 178 CYS n 
1 179 ARG n 
1 180 GLY n 
1 181 LYS n 
1 182 SER n 
1 183 PRO n 
1 184 PRO n 
1 185 PRO n 
1 186 GLU n 
1 187 PHE n 
1 188 ALA n 
1 189 LYS n 
1 190 VAL n 
1 191 SER n 
1 192 PRO n 
1 193 CYS n 
1 194 LEU n 
1 195 ASN n 
1 196 VAL n 
1 197 LEU n 
1 198 SER n 
1 199 TRP n 
1 200 LEU n 
1 201 LEU n 
1 202 PHE n 
1 203 VAL n 
1 204 SER n 
1 205 ASP n 
1 206 THR n 
1 207 ASP n 
1 208 VAL n 
1 209 LEU n 
1 210 ALA n 
1 211 ASP n 
1 212 ALA n 
1 213 CYS n 
1 214 TRP n 
1 215 ALA n 
1 216 LEU n 
1 217 SER n 
1 218 TYR n 
1 219 LEU n 
1 220 SER n 
1 221 ASP n 
1 222 GLY n 
1 223 PRO n 
1 224 ASN n 
1 225 ASP n 
1 226 LYS n 
1 227 ILE n 
1 228 GLN n 
1 229 ALA n 
1 230 VAL n 
1 231 ILE n 
1 232 ASP n 
1 233 ALA n 
1 234 GLY n 
1 235 VAL n 
1 236 CYS n 
1 237 ARG n 
1 238 ARG n 
1 239 LEU n 
1 240 VAL n 
1 241 GLU n 
1 242 LEU n 
1 243 LEU n 
1 244 MET n 
1 245 HIS n 
1 246 ASN n 
1 247 ASP n 
1 248 TYR n 
1 249 LYS n 
1 250 VAL n 
1 251 VAL n 
1 252 SER n 
1 253 PRO n 
1 254 ALA n 
1 255 LEU n 
1 256 ARG n 
1 257 ALA n 
1 258 VAL n 
1 259 GLY n 
1 260 ASN n 
1 261 ILE n 
1 262 VAL n 
1 263 THR n 
1 264 GLY n 
1 265 ASP n 
1 266 ASP n 
1 267 ILE n 
1 268 GLN n 
1 269 THR n 
1 270 GLN n 
1 271 VAL n 
1 272 ILE n 
1 273 LEU n 
1 274 ASN n 
1 275 CYS n 
1 276 SER n 
1 277 ALA n 
1 278 LEU n 
1 279 GLN n 
1 280 SER n 
1 281 LEU n 
1 282 LEU n 
1 283 HIS n 
1 284 LEU n 
1 285 LEU n 
1 286 SER n 
1 287 SER n 
1 288 PRO n 
1 289 LYS n 
1 290 GLU n 
1 291 SER n 
1 292 ILE n 
1 293 LYS n 
1 294 LYS n 
1 295 GLU n 
1 296 ALA n 
1 297 CYS n 
1 298 TRP n 
1 299 THR n 
1 300 ILE n 
1 301 SER n 
1 302 ASN n 
1 303 ILE n 
1 304 THR n 
1 305 ALA n 
1 306 GLY n 
1 307 ASN n 
1 308 ARG n 
1 309 ALA n 
1 310 GLN n 
1 311 ILE n 
1 312 GLN n 
1 313 THR n 
1 314 VAL n 
1 315 ILE n 
1 316 ASP n 
1 317 ALA n 
1 318 ASN n 
1 319 ILE n 
1 320 PHE n 
1 321 PRO n 
1 322 ALA n 
1 323 LEU n 
1 324 ILE n 
1 325 SER n 
1 326 ILE n 
1 327 LEU n 
1 328 GLN n 
1 329 THR n 
1 330 ALA n 
1 331 GLU n 
1 332 PHE n 
1 333 ARG n 
1 334 THR n 
1 335 ARG n 
1 336 LYS n 
1 337 GLU n 
1 338 ALA n 
1 339 ALA n 
1 340 TRP n 
1 341 ALA n 
1 342 ILE n 
1 343 THR n 
1 344 ASN n 
1 345 ALA n 
1 346 THR n 
1 347 SER n 
1 348 GLY n 
1 349 GLY n 
1 350 SER n 
1 351 ALA n 
1 352 GLU n 
1 353 GLN n 
1 354 ILE n 
1 355 LYS n 
1 356 TYR n 
1 357 LEU n 
1 358 VAL n 
1 359 GLU n 
1 360 LEU n 
1 361 GLY n 
1 362 CYS n 
1 363 ILE n 
1 364 LYS n 
1 365 PRO n 
1 366 LEU n 
1 367 CYS n 
1 368 ASP n 
1 369 LEU n 
1 370 LEU n 
1 371 THR n 
1 372 VAL n 
1 373 MET n 
1 374 ASP n 
1 375 SER n 
1 376 LYS n 
1 377 ILE n 
1 378 VAL n 
1 379 GLN n 
1 380 VAL n 
1 381 ALA n 
1 382 LEU n 
1 383 ASN n 
1 384 GLY n 
1 385 LEU n 
1 386 GLU n 
1 387 ASN n 
1 388 ILE n 
1 389 LEU n 
1 390 ARG n 
1 391 LEU n 
1 392 GLY n 
1 393 GLU n 
1 394 GLN n 
1 395 GLU n 
1 396 ALA n 
1 397 LYS n 
1 398 ARG n 
1 399 ASN n 
1 400 GLY n 
1 401 THR n 
1 402 GLY n 
1 403 ILE n 
1 404 ASN n 
1 405 PRO n 
1 406 TYR n 
1 407 CYS n 
1 408 ALA n 
1 409 LEU n 
1 410 ILE n 
1 411 GLU n 
1 412 GLU n 
1 413 ALA n 
1 414 TYR n 
1 415 GLY n 
1 416 LEU n 
1 417 ASP n 
1 418 LYS n 
1 419 ILE n 
1 420 GLU n 
1 421 PHE n 
1 422 LEU n 
1 423 GLN n 
1 424 SER n 
1 425 HIS n 
1 426 GLU n 
1 427 ASN n 
1 428 GLN n 
1 429 GLU n 
1 430 ILE n 
1 431 TYR n 
1 432 GLN n 
1 433 LYS n 
1 434 ALA n 
1 435 PHE n 
1 436 ASP n 
1 437 LEU n 
1 438 ILE n 
1 439 GLU n 
1 440 HIS n 
1 441 TYR n 
1 442 PHE n 
1 443 GLY n 
1 444 THR n 
1 445 GLU n 
1 446 ASP n 
1 447 GLU n 
1 448 ASP n 
1 449 SER n 
1 450 SER n 
2 1   GLY n 
2 2   ASP n 
2 3   PRO n 
2 4   ASP n 
2 5   GLU n 
2 6   SER n 
2 7   THR n 
2 8   SER n 
2 9   GLY n 
2 10  VAL n 
2 11  GLU n 
2 12  SER n 
2 13  ALA n 
2 14  VAL n 
2 15  LEU n 
2 16  ARG n 
2 17  GLY n 
2 18  PHE n 
2 19  LEU n 
2 20  ILE n 
2 21  LEU n 
2 22  GLY n 
2 23  LYS n 
2 24  GLU n 
2 25  ASP n 
2 26  ARG n 
2 27  ARG n 
2 28  TYR n 
2 29  GLY n 
2 30  PRO n 
2 31  ALA n 
2 32  LEU n 
2 33  SER n 
2 34  ILE n 
2 35  ASN n 
2 36  GLU n 
2 37  LEU n 
2 38  SER n 
2 39  ASN n 
2 40  LEU n 
2 41  ALA n 
2 42  LYS n 
2 43  GLY n 
2 44  GLU n 
2 45  LYS n 
2 46  ALA n 
2 47  ASN n 
2 48  VAL n 
2 49  LEU n 
2 50  ILE n 
2 51  GLY n 
2 52  GLN n 
2 53  GLY n 
2 54  ASP n 
2 55  VAL n 
2 56  VAL n 
2 57  LEU n 
2 58  VAL n 
2 59  MET n 
2 60  LYS n 
2 61  ARG n 
2 62  LYS n 
2 63  ARG n 
2 64  ASP n 
2 65  SER n 
2 66  SER n 
2 67  ILE n 
2 68  LEU n 
2 69  THR n 
2 70  ASP n 
2 71  SER n 
2 72  GLN n 
2 73  THR n 
2 74  ALA n 
2 75  THR n 
2 76  LYS n 
2 77  ARG n 
2 78  ILE n 
2 79  ARG n 
2 80  MET n 
2 81  ALA n 
2 82  ILE n 
2 83  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ?                        ? ? ? ? 'HOMO SAPIENS'      9606  ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 
? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? 'PPROEX HTB'        ? ? ? ? ? 
2 1 sample ? ? ? ?     ? ? ? 'A/VICTORIA/3/75 (H3N2)' ? ? ? ? 'INFLUENZA A VIRUS' 11320 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 
? ? ? ? ? ? BL21        ? ? ? ? ? ? ? ? 'PTRIEX DERIVATIVE' ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2JDQ       1 ? ? 2JDQ   ? 
2 UNP IMA1_HUMAN 1 ? ? P52294 ? 
3 PDB 2JDQ       2 ? ? 2JDQ   ? 
4 UNP PB2_IAVI7  2 ? ? P31345 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JDQ A 1 ? 3   ? 2JDQ   63  ? 65  ? 63  65  
2 2 2JDQ A 4 ? 450 ? P52294 66  ? 512 ? 66  512 
3 1 2JDQ B 1 ? 3   ? 2JDQ   63  ? 65  ? 63  65  
4 2 2JDQ B 4 ? 450 ? P52294 66  ? 512 ? 66  512 
5 3 2JDQ D 1 ? 1   ? 2JDQ   677 ? 677 ? 677 677 
6 4 2JDQ D 2 ? 83  ? P31345 678 ? 759 ? 678 759 
7 3 2JDQ E 1 ? 1   ? 2JDQ   677 ? 677 ? 677 677 
8 4 2JDQ E 2 ? 83  ? P31345 678 ? 759 ? 678 759 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JDQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   60.3 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;1 MICROLITRE OF PROTEIN SOLUTION, AT 20 MG/ML IN 30 MM TRIS-HCL, PH 7.5, 150 MM NACL, 3 MM BETA-MERCAPTOETHANOL WAS MIXED WITH AN EQUAL VOLUME OF RESERVOIR SOLUTION (0.1 M NAAC, PH 4.6, 5 MM CACL2, 15% MPD)
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2006-06-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07225 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.07225 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JDQ 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   74104 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.09000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.69000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.400 
_reflns_shell.pdbx_redundancy        4.06 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JDQ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     71120 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.000 
_refine.ls_number_reflns_R_free                  2969 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.B_iso_mean                               17.77 
_refine.aniso_B[1][1]                            2.72000 
_refine.aniso_B[2][2]                            0.08000 
_refine.aniso_B[3][3]                            -2.80000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1Q1S' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.205 
_refine.pdbx_overall_ESU_R_Free                  0.183 
_refine.overall_SU_ML                            0.166 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.255 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7597 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             265 
_refine_hist.number_atoms_total               7862 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 7715  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 5213  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.273  1.972  ? 10454 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.928  3.000  ? 12806 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.523  5.000  ? 972   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.588 25.060 ? 332   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.576 15.000 ? 1398  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.391 15.000 ? 46    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.073  0.200  ? 1233  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 8484  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1436  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.202  0.200  ? 1841  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.176  0.200  ? 5350  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.174  0.200  ? 3828  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.087  0.200  ? 3928  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.176  0.200  ? 273   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.189  0.200  ? 29    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.187  0.200  ? 64    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.185  0.200  ? 14    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.797  1.500  ? 6353  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.921  2.000  ? 7872  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.483  3.000  ? 3264  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.213  4.500  ? 2582  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             5187 
_refine_ls_shell.R_factor_R_work                  0.2840 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3400 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             221 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.012908 
_struct_ncs_oper.matrix[1][2]   0.998917 
_struct_ncs_oper.matrix[1][3]   0.044708 
_struct_ncs_oper.matrix[2][1]   -0.998464 
_struct_ncs_oper.matrix[2][2]   0.010467 
_struct_ncs_oper.matrix[2][3]   0.054411 
_struct_ncs_oper.matrix[3][1]   0.053884 
_struct_ncs_oper.matrix[3][2]   -0.045341 
_struct_ncs_oper.matrix[3][3]   0.997517 
_struct_ncs_oper.vector[1]      21.14320 
_struct_ncs_oper.vector[2]      120.69530 
_struct_ncs_oper.vector[3]      36.38540 
# 
_struct.entry_id                  2JDQ 
_struct.title                     
'C-terminal domain of influenza A virus polymerase PB2 subunit in complex with human importin alpha5' 
_struct.pdbx_descriptor           'IMPORTIN ALPHA-1 SUBUNIT, POLYMERASE BASIC PROTEIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JDQ 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            
;TRANSPORT, PB2 SUBUNIT, NUCLEAR PROTEIN, PROTEIN TRANSPORT, ARMADILLO REPEATS, INFLUENZA A VIRUS RNA-DEPENDENT RNA POLYMERASE, BIPARTITE NUCLEAR LOCALISATION SIGNAL, NUCLEAR IMPORT ADAPTER, HUMAN IMPORTIN ALPHA5, HOST-VIRUS INTERACTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 22  ? SER A 31  ? THR A 84  SER A 93  1 ? 10 
HELX_P HELX_P2  2  SER A 33  ? LYS A 50  ? SER A 95  LYS A 112 1 ? 18 
HELX_P HELX_P3  3  PRO A 55  ? SER A 61  ? PRO A 117 SER A 123 1 ? 7  
HELX_P HELX_P4  4  GLY A 64  ? LYS A 74  ? GLY A 126 LYS A 136 1 ? 11 
HELX_P HELX_P5  5  ASN A 78  ? SER A 94  ? ASN A 140 SER A 156 1 ? 17 
HELX_P HELX_P6  6  ASN A 96  ? ALA A 106 ? ASN A 158 ALA A 168 1 ? 11 
HELX_P HELX_P7  7  GLY A 107 ? LEU A 116 ? GLY A 169 LEU A 178 1 ? 10 
HELX_P HELX_P8  8  PHE A 120 ? GLY A 136 ? PHE A 182 GLY A 198 1 ? 17 
HELX_P HELX_P9  9  SER A 138 ? CYS A 148 ? SER A 200 CYS A 210 1 ? 11 
HELX_P HELX_P10 10 ILE A 150 ? PHE A 158 ? ILE A 212 PHE A 220 1 ? 9  
HELX_P HELX_P11 11 ARG A 163 ? ARG A 179 ? ARG A 225 ARG A 241 1 ? 17 
HELX_P HELX_P12 12 GLU A 186 ? VAL A 190 ? GLU A 248 VAL A 252 5 ? 5  
HELX_P HELX_P13 13 VAL A 190 ? PRO A 192 ? VAL A 252 PRO A 254 5 ? 3  
HELX_P HELX_P14 14 CYS A 193 ? LEU A 201 ? CYS A 255 LEU A 263 1 ? 9  
HELX_P HELX_P15 15 ASP A 205 ? SER A 220 ? ASP A 267 SER A 282 1 ? 16 
HELX_P HELX_P16 16 PRO A 223 ? ALA A 233 ? PRO A 285 ALA A 295 1 ? 11 
HELX_P HELX_P17 17 VAL A 235 ? LEU A 243 ? VAL A 297 LEU A 305 1 ? 9  
HELX_P HELX_P18 18 ASP A 247 ? VAL A 262 ? ASP A 309 VAL A 324 1 ? 16 
HELX_P HELX_P19 19 ASP A 265 ? ASN A 274 ? ASP A 327 ASN A 336 1 ? 10 
HELX_P HELX_P20 20 SER A 276 ? LEU A 285 ? SER A 338 LEU A 347 1 ? 10 
HELX_P HELX_P21 21 LYS A 289 ? THR A 304 ? LYS A 351 THR A 366 1 ? 16 
HELX_P HELX_P22 22 ASN A 307 ? ALA A 317 ? ASN A 369 ALA A 379 1 ? 11 
HELX_P HELX_P23 23 ASN A 318 ? ALA A 330 ? ASN A 380 ALA A 392 1 ? 13 
HELX_P HELX_P24 24 GLU A 331 ? GLY A 349 ? GLU A 393 GLY A 411 1 ? 19 
HELX_P HELX_P25 25 SER A 350 ? GLY A 361 ? SER A 412 GLY A 423 1 ? 12 
HELX_P HELX_P26 26 CYS A 362 ? LEU A 369 ? CYS A 424 LEU A 431 1 ? 8  
HELX_P HELX_P27 27 LEU A 370 ? VAL A 372 ? LEU A 432 VAL A 434 5 ? 3  
HELX_P HELX_P28 28 ASP A 374 ? ASN A 399 ? ASP A 436 ASN A 461 1 ? 26 
HELX_P HELX_P29 29 PRO A 405 ? GLY A 415 ? PRO A 467 GLY A 477 1 ? 11 
HELX_P HELX_P30 30 GLY A 415 ? SER A 424 ? GLY A 477 SER A 486 1 ? 10 
HELX_P HELX_P31 31 SER A 424 ? GLY A 443 ? SER A 486 GLY A 505 1 ? 20 
HELX_P HELX_P32 32 THR B 22  ? PHE B 30  ? THR B 84  PHE B 92  1 ? 9  
HELX_P HELX_P33 33 SER B 33  ? LEU B 48  ? SER B 95  LEU B 110 1 ? 16 
HELX_P HELX_P34 34 PRO B 55  ? SER B 61  ? PRO B 117 SER B 123 1 ? 7  
HELX_P HELX_P35 35 VAL B 65  ? LEU B 73  ? VAL B 127 LEU B 135 1 ? 9  
HELX_P HELX_P36 36 ASN B 78  ? SER B 94  ? ASN B 140 SER B 156 1 ? 17 
HELX_P HELX_P37 37 ASN B 96  ? ALA B 106 ? ASN B 158 ALA B 168 1 ? 11 
HELX_P HELX_P38 38 GLY B 107 ? LEU B 116 ? GLY B 169 LEU B 178 1 ? 10 
HELX_P HELX_P39 39 PHE B 120 ? GLY B 136 ? PHE B 182 GLY B 198 1 ? 17 
HELX_P HELX_P40 40 SER B 138 ? CYS B 148 ? SER B 200 CYS B 210 1 ? 11 
HELX_P HELX_P41 41 ILE B 150 ? LEU B 157 ? ILE B 212 LEU B 219 1 ? 8  
HELX_P HELX_P42 42 ARG B 163 ? ARG B 179 ? ARG B 225 ARG B 241 1 ? 17 
HELX_P HELX_P43 43 GLU B 186 ? SER B 191 ? GLU B 248 SER B 253 1 ? 6  
HELX_P HELX_P44 44 CYS B 193 ? LEU B 201 ? CYS B 255 LEU B 263 1 ? 9  
HELX_P HELX_P45 45 ASP B 205 ? SER B 220 ? ASP B 267 SER B 282 1 ? 16 
HELX_P HELX_P46 46 PRO B 223 ? ALA B 233 ? PRO B 285 ALA B 295 1 ? 11 
HELX_P HELX_P47 47 VAL B 235 ? LEU B 242 ? VAL B 297 LEU B 304 1 ? 8  
HELX_P HELX_P48 48 LEU B 243 ? HIS B 245 ? LEU B 305 HIS B 307 5 ? 3  
HELX_P HELX_P49 49 ASP B 247 ? VAL B 262 ? ASP B 309 VAL B 324 1 ? 16 
HELX_P HELX_P50 50 ASP B 265 ? ASN B 274 ? ASP B 327 ASN B 336 1 ? 10 
HELX_P HELX_P51 51 SER B 276 ? LEU B 285 ? SER B 338 LEU B 347 1 ? 10 
HELX_P HELX_P52 52 LYS B 289 ? THR B 304 ? LYS B 351 THR B 366 1 ? 16 
HELX_P HELX_P53 53 ASN B 307 ? ALA B 317 ? ASN B 369 ALA B 379 1 ? 11 
HELX_P HELX_P54 54 ILE B 319 ? ALA B 330 ? ILE B 381 ALA B 392 1 ? 12 
HELX_P HELX_P55 55 GLU B 331 ? GLY B 349 ? GLU B 393 GLY B 411 1 ? 19 
HELX_P HELX_P56 56 SER B 350 ? LEU B 360 ? SER B 412 LEU B 422 1 ? 11 
HELX_P HELX_P57 57 CYS B 362 ? LEU B 370 ? CYS B 424 LEU B 432 1 ? 9  
HELX_P HELX_P58 58 ASP B 374 ? ASN B 399 ? ASP B 436 ASN B 461 1 ? 26 
HELX_P HELX_P59 59 PRO B 405 ? GLY B 415 ? PRO B 467 GLY B 477 1 ? 11 
HELX_P HELX_P60 60 GLY B 415 ? SER B 424 ? GLY B 477 SER B 486 1 ? 10 
HELX_P HELX_P61 61 SER B 424 ? PHE B 442 ? SER B 486 PHE B 504 1 ? 19 
HELX_P HELX_P62 62 VAL C 14  ? ARG C 16  ? VAL D 690 ARG D 692 5 ? 3  
HELX_P HELX_P63 63 ASP C 25  ? GLY C 29  ? ASP D 701 GLY D 705 5 ? 5  
HELX_P HELX_P64 64 ASN C 35  ? LEU C 40  ? ASN D 711 LEU D 716 5 ? 6  
HELX_P HELX_P65 65 VAL D 10  ? ARG D 16  ? VAL E 686 ARG E 692 1 ? 7  
HELX_P HELX_P66 66 ASP D 25  ? GLY D 29  ? ASP E 701 GLY E 705 5 ? 5  
HELX_P HELX_P67 67 GLU D 36  ? LEU D 40  ? GLU E 712 LEU E 716 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 182 A . ? SER 244 A PRO 183 A ? PRO 245 A 1 -2.70  
2 SER 182 B . ? SER 244 B PRO 183 B ? PRO 245 B 1 -10.84 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
DA ? 3 ? 
EA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
DA 1 PHE C 18 ? LYS C 23 ? PHE D 694 LYS D 699 
DA 2 ASP C 54 ? LYS C 60 ? ASP D 730 LYS D 736 
DA 3 LYS C 45 ? GLY C 51 ? LYS D 721 GLY D 727 
EA 1 PHE D 18 ? LYS D 23 ? PHE E 694 LYS E 699 
EA 2 ASP D 54 ? LYS D 60 ? ASP E 730 LYS E 736 
EA 3 ALA D 46 ? GLY D 51 ? ALA E 722 GLY E 727 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
DA 1 2 N LEU C 21 ? N LEU D 697 O LEU C 57 ? O LEU D 733 
DA 2 3 N VAL C 58 ? N VAL D 734 O ALA C 46 ? O ALA D 722 
EA 1 2 N LEU D 21 ? N LEU E 697 O LEU D 57 ? O LEU E 733 
EA 2 3 N VAL D 58 ? N VAL E 734 O ALA D 46 ? O ALA E 722 
# 
_database_PDB_matrix.entry_id          2JDQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JDQ 
_atom_sites.fract_transf_matrix[1][1]   0.010530 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006586 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 22  ? 45.224 101.171 -8.492  1.00 33.64 ? 84   THR A N   1 
ATOM   2    C CA  . THR A 1 22  ? 45.073 101.764 -9.853  1.00 33.75 ? 84   THR A CA  1 
ATOM   3    C C   . THR A 1 22  ? 43.743 101.342 -10.469 1.00 33.79 ? 84   THR A C   1 
ATOM   4    O O   . THR A 1 22  ? 43.217 100.274 -10.160 1.00 33.96 ? 84   THR A O   1 
ATOM   5    C CB  . THR A 1 22  ? 46.224 101.327 -10.783 1.00 33.69 ? 84   THR A CB  1 
ATOM   6    O OG1 . THR A 1 22  ? 47.475 101.510 -10.113 1.00 33.73 ? 84   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 22  ? 46.229 102.134 -12.067 1.00 33.58 ? 84   THR A CG2 1 
ATOM   8    N N   . SER A 1 23  ? 43.204 102.195 -11.334 1.00 33.92 ? 85   SER A N   1 
ATOM   9    C CA  . SER A 1 23  ? 41.958 101.911 -12.046 1.00 33.90 ? 85   SER A CA  1 
ATOM   10   C C   . SER A 1 23  ? 42.195 101.089 -13.319 1.00 33.94 ? 85   SER A C   1 
ATOM   11   O O   . SER A 1 23  ? 41.253 100.507 -13.862 1.00 33.91 ? 85   SER A O   1 
ATOM   12   C CB  . SER A 1 23  ? 41.237 103.215 -12.385 1.00 33.87 ? 85   SER A CB  1 
ATOM   13   O OG  . SER A 1 23  ? 42.161 104.205 -12.793 1.00 33.86 ? 85   SER A OG  1 
ATOM   14   N N   . ASP A 1 24  ? 43.441 101.063 -13.798 1.00 33.96 ? 86   ASP A N   1 
ATOM   15   C CA  . ASP A 1 24  ? 43.846 100.161 -14.888 1.00 33.94 ? 86   ASP A CA  1 
ATOM   16   C C   . ASP A 1 24  ? 44.069 98.738  -14.363 1.00 33.82 ? 86   ASP A C   1 
ATOM   17   O O   . ASP A 1 24  ? 43.858 97.770  -15.093 1.00 33.76 ? 86   ASP A O   1 
ATOM   18   C CB  . ASP A 1 24  ? 45.104 100.671 -15.623 1.00 34.00 ? 86   ASP A CB  1 
ATOM   19   C CG  . ASP A 1 24  ? 44.826 101.066 -17.077 1.00 34.36 ? 86   ASP A CG  1 
ATOM   20   O OD1 . ASP A 1 24  ? 44.059 102.027 -17.316 1.00 34.59 ? 86   ASP A OD1 1 
ATOM   21   O OD2 . ASP A 1 24  ? 45.386 100.414 -17.986 1.00 34.96 ? 86   ASP A OD2 1 
ATOM   22   N N   . MET A 1 25  ? 44.501 98.618  -13.107 1.00 33.76 ? 87   MET A N   1 
ATOM   23   C CA  . MET A 1 25  ? 44.568 97.313  -12.428 1.00 33.69 ? 87   MET A CA  1 
ATOM   24   C C   . MET A 1 25  ? 43.174 96.692  -12.348 1.00 33.73 ? 87   MET A C   1 
ATOM   25   O O   . MET A 1 25  ? 42.982 95.533  -12.717 1.00 33.94 ? 87   MET A O   1 
ATOM   26   C CB  . MET A 1 25  ? 45.153 97.445  -11.013 1.00 33.62 ? 87   MET A CB  1 
ATOM   27   C CG  . MET A 1 25  ? 46.678 97.417  -10.942 1.00 33.39 ? 87   MET A CG  1 
ATOM   28   S SD  . MET A 1 25  ? 47.347 98.063  -9.385  1.00 33.45 ? 87   MET A SD  1 
ATOM   29   C CE  . MET A 1 25  ? 46.245 97.348  -8.168  1.00 33.08 ? 87   MET A CE  1 
ATOM   30   N N   . ILE A 1 26  ? 42.211 97.478  -11.867 1.00 33.65 ? 88   ILE A N   1 
ATOM   31   C CA  . ILE A 1 26  ? 40.816 97.045  -11.758 1.00 33.49 ? 88   ILE A CA  1 
ATOM   32   C C   . ILE A 1 26  ? 40.189 96.776  -13.131 1.00 33.41 ? 88   ILE A C   1 
ATOM   33   O O   . ILE A 1 26  ? 39.471 95.791  -13.293 1.00 33.51 ? 88   ILE A O   1 
ATOM   34   C CB  . ILE A 1 26  ? 39.962 98.080  -10.973 1.00 33.58 ? 88   ILE A CB  1 
ATOM   35   C CG1 . ILE A 1 26  ? 40.244 97.967  -9.471  1.00 33.33 ? 88   ILE A CG1 1 
ATOM   36   C CG2 . ILE A 1 26  ? 38.469 97.888  -11.250 1.00 33.67 ? 88   ILE A CG2 1 
ATOM   37   C CD1 . ILE A 1 26  ? 39.530 99.007  -8.634  1.00 33.42 ? 88   ILE A CD1 1 
ATOM   38   N N   . GLU A 1 27  ? 40.463 97.643  -14.107 1.00 33.20 ? 89   GLU A N   1 
ATOM   39   C CA  . GLU A 1 27  ? 39.969 97.452  -15.480 1.00 33.06 ? 89   GLU A CA  1 
ATOM   40   C C   . GLU A 1 27  ? 40.493 96.158  -16.097 1.00 32.84 ? 89   GLU A C   1 
ATOM   41   O O   . GLU A 1 27  ? 39.712 95.297  -16.502 1.00 32.85 ? 89   GLU A O   1 
ATOM   42   C CB  . GLU A 1 27  ? 40.361 98.627  -16.384 1.00 33.07 ? 89   GLU A CB  1 
ATOM   43   C CG  . GLU A 1 27  ? 39.385 99.785  -16.374 1.00 33.23 ? 89   GLU A CG  1 
ATOM   44   C CD  . GLU A 1 27  ? 39.815 100.927 -17.283 1.00 33.26 ? 89   GLU A CD  1 
ATOM   45   O OE1 . GLU A 1 27  ? 40.942 100.886 -17.826 1.00 33.58 ? 89   GLU A OE1 1 
ATOM   46   O OE2 . GLU A 1 27  ? 39.020 101.871 -17.458 1.00 33.84 ? 89   GLU A OE2 1 
ATOM   47   N N   . MET A 1 28  ? 41.816 96.030  -16.164 1.00 32.64 ? 90   MET A N   1 
ATOM   48   C CA  . MET A 1 28  ? 42.451 94.852  -16.760 1.00 32.48 ? 90   MET A CA  1 
ATOM   49   C C   . MET A 1 28  ? 42.068 93.548  -16.063 1.00 32.30 ? 90   MET A C   1 
ATOM   50   O O   . MET A 1 28  ? 41.927 92.525  -16.730 1.00 32.49 ? 90   MET A O   1 
ATOM   51   C CB  . MET A 1 28  ? 43.977 95.003  -16.784 1.00 32.51 ? 90   MET A CB  1 
ATOM   52   C CG  . MET A 1 28  ? 44.466 96.000  -17.827 1.00 32.57 ? 90   MET A CG  1 
ATOM   53   S SD  . MET A 1 28  ? 46.239 95.913  -18.126 1.00 32.68 ? 90   MET A SD  1 
ATOM   54   C CE  . MET A 1 28  ? 46.449 97.310  -19.232 1.00 32.68 ? 90   MET A CE  1 
ATOM   55   N N   . ILE A 1 29  ? 41.900 93.583  -14.737 1.00 31.99 ? 91   ILE A N   1 
ATOM   56   C CA  . ILE A 1 29  ? 41.481 92.392  -13.973 1.00 31.69 ? 91   ILE A CA  1 
ATOM   57   C C   . ILE A 1 29  ? 40.129 91.855  -14.434 1.00 31.46 ? 91   ILE A C   1 
ATOM   58   O O   . ILE A 1 29  ? 39.991 90.656  -14.680 1.00 31.16 ? 91   ILE A O   1 
ATOM   59   C CB  . ILE A 1 29  ? 41.409 92.653  -12.435 1.00 31.58 ? 91   ILE A CB  1 
ATOM   60   C CG1 . ILE A 1 29  ? 42.631 92.049  -11.732 1.00 31.86 ? 91   ILE A CG1 1 
ATOM   61   C CG2 . ILE A 1 29  ? 40.138 92.056  -11.842 1.00 31.22 ? 91   ILE A CG2 1 
ATOM   62   C CD1 . ILE A 1 29  ? 42.386 91.626  -10.281 1.00 31.69 ? 91   ILE A CD1 1 
ATOM   63   N N   . PHE A 1 30  ? 39.143 92.746  -14.550 1.00 31.23 ? 92   PHE A N   1 
ATOM   64   C CA  . PHE A 1 30  ? 37.781 92.353  -14.920 1.00 31.05 ? 92   PHE A CA  1 
ATOM   65   C C   . PHE A 1 30  ? 37.558 92.322  -16.431 1.00 30.80 ? 92   PHE A C   1 
ATOM   66   O O   . PHE A 1 30  ? 36.486 91.927  -16.879 1.00 30.84 ? 92   PHE A O   1 
ATOM   67   C CB  . PHE A 1 30  ? 36.747 93.242  -14.212 1.00 30.87 ? 92   PHE A CB  1 
ATOM   68   C CG  . PHE A 1 30  ? 36.751 93.084  -12.710 1.00 30.92 ? 92   PHE A CG  1 
ATOM   69   C CD1 . PHE A 1 30  ? 37.148 94.126  -11.882 1.00 30.88 ? 92   PHE A CD1 1 
ATOM   70   C CD2 . PHE A 1 30  ? 36.387 91.873  -12.126 1.00 30.76 ? 92   PHE A CD2 1 
ATOM   71   C CE1 . PHE A 1 30  ? 37.165 93.969  -10.500 1.00 30.96 ? 92   PHE A CE1 1 
ATOM   72   C CE2 . PHE A 1 30  ? 36.401 91.710  -10.747 1.00 30.53 ? 92   PHE A CE2 1 
ATOM   73   C CZ  . PHE A 1 30  ? 36.790 92.759  -9.933  1.00 30.66 ? 92   PHE A CZ  1 
ATOM   74   N N   . SER A 1 31  ? 38.574 92.705  -17.208 1.00 30.72 ? 93   SER A N   1 
ATOM   75   C CA  . SER A 1 31  ? 38.514 92.606  -18.674 1.00 30.74 ? 93   SER A CA  1 
ATOM   76   C C   . SER A 1 31  ? 38.504 91.141  -19.099 1.00 30.70 ? 93   SER A C   1 
ATOM   77   O O   . SER A 1 31  ? 38.598 90.249  -18.255 1.00 30.53 ? 93   SER A O   1 
ATOM   78   C CB  . SER A 1 31  ? 39.704 93.319  -19.323 1.00 30.71 ? 93   SER A CB  1 
ATOM   79   O OG  . SER A 1 31  ? 40.897 92.568  -19.169 1.00 30.54 ? 93   SER A OG  1 
ATOM   80   N N   . LYS A 1 32  ? 38.403 90.893  -20.402 1.00 30.61 ? 94   LYS A N   1 
ATOM   81   C CA  . LYS A 1 32  ? 38.284 89.524  -20.912 1.00 30.69 ? 94   LYS A CA  1 
ATOM   82   C C   . LYS A 1 32  ? 39.459 89.098  -21.800 1.00 30.58 ? 94   LYS A C   1 
ATOM   83   O O   . LYS A 1 32  ? 39.302 88.247  -22.676 1.00 30.64 ? 94   LYS A O   1 
ATOM   84   C CB  . LYS A 1 32  ? 36.947 89.358  -21.646 1.00 30.79 ? 94   LYS A CB  1 
ATOM   85   C CG  . LYS A 1 32  ? 35.743 89.353  -20.704 1.00 31.02 ? 94   LYS A CG  1 
ATOM   86   C CD  . LYS A 1 32  ? 34.439 89.703  -21.430 1.00 31.06 ? 94   LYS A CD  1 
ATOM   87   C CE  . LYS A 1 32  ? 33.295 89.836  -20.426 1.00 31.25 ? 94   LYS A CE  1 
ATOM   88   N NZ  . LYS A 1 32  ? 32.037 90.331  -21.045 1.00 31.42 ? 94   LYS A NZ  1 
ATOM   89   N N   . SER A 1 33  ? 40.636 89.674  -21.560 1.00 30.45 ? 95   SER A N   1 
ATOM   90   C CA  . SER A 1 33  ? 41.848 89.277  -22.278 1.00 30.29 ? 95   SER A CA  1 
ATOM   91   C C   . SER A 1 33  ? 42.842 88.650  -21.293 1.00 30.07 ? 95   SER A C   1 
ATOM   92   O O   . SER A 1 33  ? 43.199 89.286  -20.301 1.00 30.16 ? 95   SER A O   1 
ATOM   93   C CB  . SER A 1 33  ? 42.475 90.480  -22.999 1.00 30.37 ? 95   SER A CB  1 
ATOM   94   O OG  . SER A 1 33  ? 43.424 91.149  -22.185 1.00 30.76 ? 95   SER A OG  1 
ATOM   95   N N   . PRO A 1 34  ? 43.272 87.393  -21.549 1.00 29.79 ? 96   PRO A N   1 
ATOM   96   C CA  . PRO A 1 34  ? 44.297 86.679  -20.759 1.00 29.42 ? 96   PRO A CA  1 
ATOM   97   C C   . PRO A 1 34  ? 45.640 87.402  -20.547 1.00 29.16 ? 96   PRO A C   1 
ATOM   98   O O   . PRO A 1 34  ? 46.314 87.172  -19.540 1.00 29.09 ? 96   PRO A O   1 
ATOM   99   C CB  . PRO A 1 34  ? 44.535 85.407  -21.580 1.00 29.38 ? 96   PRO A CB  1 
ATOM   100  C CG  . PRO A 1 34  ? 43.266 85.174  -22.284 1.00 29.56 ? 96   PRO A CG  1 
ATOM   101  C CD  . PRO A 1 34  ? 42.743 86.537  -22.631 1.00 29.79 ? 96   PRO A CD  1 
ATOM   102  N N   . GLU A 1 35  ? 46.027 88.248  -21.498 1.00 28.98 ? 97   GLU A N   1 
ATOM   103  C CA  . GLU A 1 35  ? 47.286 88.995  -21.419 1.00 28.72 ? 97   GLU A CA  1 
ATOM   104  C C   . GLU A 1 35  ? 47.193 90.012  -20.281 1.00 28.33 ? 97   GLU A C   1 
ATOM   105  O O   . GLU A 1 35  ? 48.074 90.089  -19.422 1.00 27.99 ? 97   GLU A O   1 
ATOM   106  C CB  . GLU A 1 35  ? 47.605 89.735  -22.743 1.00 28.81 ? 97   GLU A CB  1 
ATOM   107  C CG  . GLU A 1 35  ? 47.150 89.068  -24.065 1.00 29.17 ? 97   GLU A CG  1 
ATOM   108  C CD  . GLU A 1 35  ? 47.608 87.618  -24.226 1.00 29.81 ? 97   GLU A CD  1 
ATOM   109  O OE1 . GLU A 1 35  ? 48.732 87.276  -23.796 1.00 29.80 ? 97   GLU A OE1 1 
ATOM   110  O OE2 . GLU A 1 35  ? 46.839 86.818  -24.804 1.00 30.13 ? 97   GLU A OE2 1 
ATOM   111  N N   . GLN A 1 36  ? 46.111 90.790  -20.303 1.00 28.15 ? 98   GLN A N   1 
ATOM   112  C CA  . GLN A 1 36  ? 45.875 91.859  -19.334 1.00 27.96 ? 98   GLN A CA  1 
ATOM   113  C C   . GLN A 1 36  ? 45.498 91.294  -17.980 1.00 27.57 ? 98   GLN A C   1 
ATOM   114  O O   . GLN A 1 36  ? 45.848 91.865  -16.952 1.00 27.44 ? 98   GLN A O   1 
ATOM   115  C CB  . GLN A 1 36  ? 44.756 92.794  -19.813 1.00 27.89 ? 98   GLN A CB  1 
ATOM   116  C CG  . GLN A 1 36  ? 45.084 93.584  -21.060 1.00 28.03 ? 98   GLN A CG  1 
ATOM   117  C CD  . GLN A 1 36  ? 43.925 94.455  -21.530 1.00 28.04 ? 98   GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 36  ? 42.916 94.608  -20.839 1.00 27.71 ? 98   GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 36  ? 44.072 95.035  -22.716 1.00 28.96 ? 98   GLN A NE2 1 
ATOM   120  N N   . GLN A 1 37  ? 44.756 90.191  -17.987 1.00 27.41 ? 99   GLN A N   1 
ATOM   121  C CA  . GLN A 1 37  ? 44.448 89.470  -16.757 1.00 27.33 ? 99   GLN A CA  1 
ATOM   122  C C   . GLN A 1 37  ? 45.743 89.132  -16.021 1.00 27.29 ? 99   GLN A C   1 
ATOM   123  O O   . GLN A 1 37  ? 45.913 89.522  -14.870 1.00 27.30 ? 99   GLN A O   1 
ATOM   124  C CB  . GLN A 1 37  ? 43.637 88.202  -17.049 1.00 27.17 ? 99   GLN A CB  1 
ATOM   125  C CG  . GLN A 1 37  ? 42.165 88.465  -17.349 1.00 26.98 ? 99   GLN A CG  1 
ATOM   126  C CD  . GLN A 1 37  ? 41.430 87.231  -17.841 1.00 26.89 ? 99   GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 37  ? 41.879 86.110  -17.633 1.00 26.47 ? 99   GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 37  ? 40.289 87.435  -18.488 1.00 25.99 ? 99   GLN A NE2 1 
ATOM   129  N N   . LEU A 1 38  ? 46.660 88.440  -16.698 1.00 27.37 ? 100  LEU A N   1 
ATOM   130  C CA  . LEU A 1 38  ? 47.962 88.095  -16.112 1.00 27.45 ? 100  LEU A CA  1 
ATOM   131  C C   . LEU A 1 38  ? 48.695 89.340  -15.628 1.00 27.52 ? 100  LEU A C   1 
ATOM   132  O O   . LEU A 1 38  ? 49.099 89.415  -14.472 1.00 27.54 ? 100  LEU A O   1 
ATOM   133  C CB  . LEU A 1 38  ? 48.837 87.331  -17.121 1.00 27.40 ? 100  LEU A CB  1 
ATOM   134  C CG  . LEU A 1 38  ? 50.288 87.009  -16.713 1.00 27.38 ? 100  LEU A CG  1 
ATOM   135  C CD1 . LEU A 1 38  ? 50.354 86.358  -15.341 1.00 26.60 ? 100  LEU A CD1 1 
ATOM   136  C CD2 . LEU A 1 38  ? 50.983 86.130  -17.757 1.00 27.38 ? 100  LEU A CD2 1 
ATOM   137  N N   . SER A 1 39  ? 48.840 90.317  -16.521 1.00 27.79 ? 101  SER A N   1 
ATOM   138  C CA  . SER A 1 39  ? 49.584 91.549  -16.237 1.00 27.90 ? 101  SER A CA  1 
ATOM   139  C C   . SER A 1 39  ? 49.100 92.263  -14.970 1.00 28.03 ? 101  SER A C   1 
ATOM   140  O O   . SER A 1 39  ? 49.915 92.682  -14.145 1.00 28.05 ? 101  SER A O   1 
ATOM   141  C CB  . SER A 1 39  ? 49.512 92.501  -17.437 1.00 27.89 ? 101  SER A CB  1 
ATOM   142  O OG  . SER A 1 39  ? 50.384 93.602  -17.260 1.00 27.85 ? 101  SER A OG  1 
ATOM   143  N N   . ALA A 1 40  ? 47.782 92.389  -14.817 1.00 28.17 ? 102  ALA A N   1 
ATOM   144  C CA  . ALA A 1 40  ? 47.190 93.023  -13.635 1.00 28.30 ? 102  ALA A CA  1 
ATOM   145  C C   . ALA A 1 40  ? 47.477 92.206  -12.374 1.00 28.44 ? 102  ALA A C   1 
ATOM   146  O O   . ALA A 1 40  ? 47.997 92.732  -11.384 1.00 28.49 ? 102  ALA A O   1 
ATOM   147  C CB  . ALA A 1 40  ? 45.688 93.206  -13.823 1.00 28.13 ? 102  ALA A CB  1 
ATOM   148  N N   . THR A 1 41  ? 47.156 90.916  -12.422 1.00 28.65 ? 103  THR A N   1 
ATOM   149  C CA  . THR A 1 41  ? 47.403 90.013  -11.299 1.00 28.83 ? 103  THR A CA  1 
ATOM   150  C C   . THR A 1 41  ? 48.868 90.038  -10.860 1.00 29.08 ? 103  THR A C   1 
ATOM   151  O O   . THR A 1 41  ? 49.157 89.945  -9.667  1.00 29.05 ? 103  THR A O   1 
ATOM   152  C CB  . THR A 1 41  ? 46.990 88.559  -11.631 1.00 28.84 ? 103  THR A CB  1 
ATOM   153  O OG1 . THR A 1 41  ? 45.597 88.517  -11.962 1.00 28.46 ? 103  THR A OG1 1 
ATOM   154  C CG2 . THR A 1 41  ? 47.260 87.619  -10.441 1.00 28.57 ? 103  THR A CG2 1 
ATOM   155  N N   . GLN A 1 42  ? 49.788 90.168  -11.817 1.00 29.37 ? 104  GLN A N   1 
ATOM   156  C CA  . GLN A 1 42  ? 51.216 90.225  -11.496 1.00 29.68 ? 104  GLN A CA  1 
ATOM   157  C C   . GLN A 1 42  ? 51.565 91.467  -10.680 1.00 29.97 ? 104  GLN A C   1 
ATOM   158  O O   . GLN A 1 42  ? 52.413 91.401  -9.795  1.00 29.96 ? 104  GLN A O   1 
ATOM   159  C CB  . GLN A 1 42  ? 52.075 90.167  -12.761 1.00 29.63 ? 104  GLN A CB  1 
ATOM   160  C CG  . GLN A 1 42  ? 52.085 88.810  -13.441 1.00 29.49 ? 104  GLN A CG  1 
ATOM   161  C CD  . GLN A 1 42  ? 53.176 88.695  -14.483 1.00 29.77 ? 104  GLN A CD  1 
ATOM   162  O OE1 . GLN A 1 42  ? 54.313 88.362  -14.163 1.00 30.40 ? 104  GLN A OE1 1 
ATOM   163  N NE2 . GLN A 1 42  ? 52.837 88.966  -15.737 1.00 29.07 ? 104  GLN A NE2 1 
ATOM   164  N N   . LYS A 1 43  ? 50.908 92.587  -10.978 1.00 30.43 ? 105  LYS A N   1 
ATOM   165  C CA  . LYS A 1 43  ? 51.087 93.816  -10.204 1.00 30.82 ? 105  LYS A CA  1 
ATOM   166  C C   . LYS A 1 43  ? 50.446 93.705  -8.824  1.00 31.23 ? 105  LYS A C   1 
ATOM   167  O O   . LYS A 1 43  ? 50.947 94.283  -7.863  1.00 31.30 ? 105  LYS A O   1 
ATOM   168  C CB  . LYS A 1 43  ? 50.512 95.019  -10.949 1.00 30.78 ? 105  LYS A CB  1 
ATOM   169  C CG  . LYS A 1 43  ? 51.247 95.352  -12.235 1.00 30.80 ? 105  LYS A CG  1 
ATOM   170  C CD  . LYS A 1 43  ? 50.503 96.409  -13.043 1.00 30.80 ? 105  LYS A CD  1 
ATOM   171  C CE  . LYS A 1 43  ? 51.102 96.575  -14.427 1.00 30.56 ? 105  LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 43  ? 50.197 97.344  -15.324 1.00 30.86 ? 105  LYS A NZ  1 
ATOM   173  N N   . PHE A 1 44  ? 49.340 92.966  -8.731  1.00 31.74 ? 106  PHE A N   1 
ATOM   174  C CA  . PHE A 1 44  ? 48.705 92.674  -7.436  1.00 32.14 ? 106  PHE A CA  1 
ATOM   175  C C   . PHE A 1 44  ? 49.616 91.858  -6.503  1.00 32.53 ? 106  PHE A C   1 
ATOM   176  O O   . PHE A 1 44  ? 49.659 92.113  -5.296  1.00 32.45 ? 106  PHE A O   1 
ATOM   177  C CB  . PHE A 1 44  ? 47.377 91.927  -7.629  1.00 32.14 ? 106  PHE A CB  1 
ATOM   178  C CG  . PHE A 1 44  ? 46.177 92.826  -7.786  1.00 32.06 ? 106  PHE A CG  1 
ATOM   179  C CD1 . PHE A 1 44  ? 45.646 93.093  -9.039  1.00 31.97 ? 106  PHE A CD1 1 
ATOM   180  C CD2 . PHE A 1 44  ? 45.555 93.373  -6.669  1.00 32.07 ? 106  PHE A CD2 1 
ATOM   181  C CE1 . PHE A 1 44  ? 44.524 93.914  -9.182  1.00 32.28 ? 106  PHE A CE1 1 
ATOM   182  C CE2 . PHE A 1 44  ? 44.435 94.188  -6.801  1.00 32.23 ? 106  PHE A CE2 1 
ATOM   183  C CZ  . PHE A 1 44  ? 43.919 94.461  -8.062  1.00 32.19 ? 106  PHE A CZ  1 
ATOM   184  N N   . ARG A 1 45  ? 50.322 90.874  -7.062  1.00 33.08 ? 107  ARG A N   1 
ATOM   185  C CA  . ARG A 1 45  ? 51.269 90.054  -6.294  1.00 33.52 ? 107  ARG A CA  1 
ATOM   186  C C   . ARG A 1 45  ? 52.424 90.880  -5.755  1.00 34.10 ? 107  ARG A C   1 
ATOM   187  O O   . ARG A 1 45  ? 52.818 90.725  -4.594  1.00 34.27 ? 107  ARG A O   1 
ATOM   188  C CB  . ARG A 1 45  ? 51.858 88.925  -7.152  1.00 33.56 ? 107  ARG A CB  1 
ATOM   189  C CG  . ARG A 1 45  ? 53.288 88.516  -6.742  1.00 33.10 ? 107  ARG A CG  1 
ATOM   190  C CD  . ARG A 1 45  ? 53.915 87.542  -7.697  1.00 33.07 ? 107  ARG A CD  1 
ATOM   191  N NE  . ARG A 1 45  ? 54.251 88.119  -9.002  1.00 32.87 ? 107  ARG A NE  1 
ATOM   192  C CZ  . ARG A 1 45  ? 55.471 88.497  -9.383  1.00 32.44 ? 107  ARG A CZ  1 
ATOM   193  N NH1 . ARG A 1 45  ? 56.518 88.410  -8.566  1.00 32.47 ? 107  ARG A NH1 1 
ATOM   194  N NH2 . ARG A 1 45  ? 55.641 88.988  -10.600 1.00 32.59 ? 107  ARG A NH2 1 
ATOM   195  N N   . LYS A 1 46  ? 52.990 91.711  -6.628  1.00 34.69 ? 108  LYS A N   1 
ATOM   196  C CA  . LYS A 1 46  ? 54.200 92.471  -6.321  1.00 35.18 ? 108  LYS A CA  1 
ATOM   197  C C   . LYS A 1 46  ? 53.981 93.456  -5.181  1.00 35.66 ? 108  LYS A C   1 
ATOM   198  O O   . LYS A 1 46  ? 54.913 93.749  -4.432  1.00 35.48 ? 108  LYS A O   1 
ATOM   199  C CB  . LYS A 1 46  ? 54.706 93.197  -7.572  1.00 35.19 ? 108  LYS A CB  1 
ATOM   200  C CG  . LYS A 1 46  ? 55.330 92.257  -8.602  1.00 35.23 ? 108  LYS A CG  1 
ATOM   201  C CD  . LYS A 1 46  ? 55.825 93.010  -9.826  1.00 35.09 ? 108  LYS A CD  1 
ATOM   202  C CE  . LYS A 1 46  ? 56.375 92.071  -10.884 1.00 34.98 ? 108  LYS A CE  1 
ATOM   203  N NZ  . LYS A 1 46  ? 57.099 92.799  -11.956 1.00 34.82 ? 108  LYS A NZ  1 
ATOM   204  N N   . LEU A 1 47  ? 52.751 93.955  -5.054  1.00 36.40 ? 109  LEU A N   1 
ATOM   205  C CA  . LEU A 1 47  ? 52.363 94.811  -3.927  1.00 36.95 ? 109  LEU A CA  1 
ATOM   206  C C   . LEU A 1 47  ? 52.257 94.016  -2.619  1.00 37.48 ? 109  LEU A C   1 
ATOM   207  O O   . LEU A 1 47  ? 52.605 94.525  -1.550  1.00 37.69 ? 109  LEU A O   1 
ATOM   208  C CB  . LEU A 1 47  ? 51.037 95.529  -4.219  1.00 36.95 ? 109  LEU A CB  1 
ATOM   209  C CG  . LEU A 1 47  ? 51.056 96.524  -5.385  1.00 37.11 ? 109  LEU A CG  1 
ATOM   210  C CD1 . LEU A 1 47  ? 49.646 96.998  -5.721  1.00 37.05 ? 109  LEU A CD1 1 
ATOM   211  C CD2 . LEU A 1 47  ? 51.960 97.709  -5.074  1.00 37.30 ? 109  LEU A CD2 1 
ATOM   212  N N   . LEU A 1 48  ? 51.779 92.775  -2.706  1.00 38.04 ? 110  LEU A N   1 
ATOM   213  C CA  . LEU A 1 48  ? 51.704 91.890  -1.540  1.00 38.40 ? 110  LEU A CA  1 
ATOM   214  C C   . LEU A 1 48  ? 52.988 91.074  -1.328  1.00 38.90 ? 110  LEU A C   1 
ATOM   215  O O   . LEU A 1 48  ? 53.085 90.313  -0.369  1.00 38.79 ? 110  LEU A O   1 
ATOM   216  C CB  . LEU A 1 48  ? 50.486 90.963  -1.643  1.00 38.27 ? 110  LEU A CB  1 
ATOM   217  C CG  . LEU A 1 48  ? 49.109 91.642  -1.681  1.00 37.95 ? 110  LEU A CG  1 
ATOM   218  C CD1 . LEU A 1 48  ? 48.003 90.602  -1.760  1.00 37.43 ? 110  LEU A CD1 1 
ATOM   219  C CD2 . LEU A 1 48  ? 48.893 92.547  -0.477  1.00 37.17 ? 110  LEU A CD2 1 
ATOM   220  N N   . SER A 1 49  ? 53.968 91.244  -2.216  1.00 39.63 ? 111  SER A N   1 
ATOM   221  C CA  . SER A 1 49  ? 55.288 90.624  -2.063  1.00 40.26 ? 111  SER A CA  1 
ATOM   222  C C   . SER A 1 49  ? 56.346 91.579  -1.495  1.00 40.84 ? 111  SER A C   1 
ATOM   223  O O   . SER A 1 49  ? 57.285 91.117  -0.840  1.00 40.96 ? 111  SER A O   1 
ATOM   224  C CB  . SER A 1 49  ? 55.774 90.043  -3.395  1.00 40.29 ? 111  SER A CB  1 
ATOM   225  O OG  . SER A 1 49  ? 55.304 88.717  -3.556  1.00 40.78 ? 111  SER A OG  1 
ATOM   226  N N   . LYS A 1 50  ? 56.211 92.887  -1.758  1.00 41.46 ? 112  LYS A N   1 
ATOM   227  C CA  . LYS A 1 50  ? 57.095 93.905  -1.157  1.00 41.86 ? 112  LYS A CA  1 
ATOM   228  C C   . LYS A 1 50  ? 57.069 93.761  0.361   1.00 42.38 ? 112  LYS A C   1 
ATOM   229  O O   . LYS A 1 50  ? 55.999 93.676  0.967   1.00 42.56 ? 112  LYS A O   1 
ATOM   230  C CB  . LYS A 1 50  ? 56.691 95.325  -1.564  1.00 41.87 ? 112  LYS A CB  1 
ATOM   231  C CG  . LYS A 1 50  ? 57.247 95.774  -2.911  1.00 41.94 ? 112  LYS A CG  1 
ATOM   232  C CD  . LYS A 1 50  ? 57.192 97.296  -3.071  1.00 41.90 ? 112  LYS A CD  1 
ATOM   233  C CE  . LYS A 1 50  ? 57.787 97.742  -4.403  1.00 41.82 ? 112  LYS A CE  1 
ATOM   234  N NZ  . LYS A 1 50  ? 57.942 99.220  -4.488  1.00 41.31 ? 112  LYS A NZ  1 
ATOM   235  N N   . GLU A 1 51  ? 58.251 93.763  0.970   1.00 42.91 ? 113  GLU A N   1 
ATOM   236  C CA  . GLU A 1 51  ? 58.452 93.086  2.260   1.00 43.30 ? 113  GLU A CA  1 
ATOM   237  C C   . GLU A 1 51  ? 57.837 93.686  3.540   1.00 43.54 ? 113  GLU A C   1 
ATOM   238  O O   . GLU A 1 51  ? 57.568 92.930  4.486   1.00 43.66 ? 113  GLU A O   1 
ATOM   239  C CB  . GLU A 1 51  ? 59.949 92.781  2.468   1.00 43.42 ? 113  GLU A CB  1 
ATOM   240  C CG  . GLU A 1 51  ? 60.528 91.866  1.366   1.00 43.87 ? 113  GLU A CG  1 
ATOM   241  C CD  . GLU A 1 51  ? 61.776 91.089  1.786   1.00 43.92 ? 113  GLU A CD  1 
ATOM   242  O OE1 . GLU A 1 51  ? 62.799 91.195  1.074   1.00 44.60 ? 113  GLU A OE1 1 
ATOM   243  O OE2 . GLU A 1 51  ? 61.732 90.363  2.810   1.00 44.37 ? 113  GLU A OE2 1 
ATOM   244  N N   . PRO A 1 52  ? 57.600 95.022  3.582   1.00 43.79 ? 114  PRO A N   1 
ATOM   245  C CA  . PRO A 1 52  ? 57.078 95.590  4.835   1.00 43.82 ? 114  PRO A CA  1 
ATOM   246  C C   . PRO A 1 52  ? 55.557 95.420  5.002   1.00 43.97 ? 114  PRO A C   1 
ATOM   247  O O   . PRO A 1 52  ? 54.789 96.247  4.498   1.00 44.10 ? 114  PRO A O   1 
ATOM   248  C CB  . PRO A 1 52  ? 57.466 97.073  4.730   1.00 43.80 ? 114  PRO A CB  1 
ATOM   249  C CG  . PRO A 1 52  ? 57.470 97.366  3.266   1.00 43.78 ? 114  PRO A CG  1 
ATOM   250  C CD  . PRO A 1 52  ? 57.776 96.064  2.547   1.00 43.83 ? 114  PRO A CD  1 
ATOM   251  N N   . ASN A 1 53  ? 55.153 94.346  5.693   1.00 43.96 ? 115  ASN A N   1 
ATOM   252  C CA  . ASN A 1 53  ? 53.745 94.042  6.018   1.00 43.90 ? 115  ASN A CA  1 
ATOM   253  C C   . ASN A 1 53  ? 52.730 94.631  5.019   1.00 43.95 ? 115  ASN A C   1 
ATOM   254  O O   . ASN A 1 53  ? 52.182 95.718  5.248   1.00 44.09 ? 115  ASN A O   1 
ATOM   255  C CB  . ASN A 1 53  ? 53.431 94.505  7.449   1.00 43.97 ? 115  ASN A CB  1 
ATOM   256  C CG  . ASN A 1 53  ? 52.265 93.749  8.073   1.00 43.99 ? 115  ASN A CG  1 
ATOM   257  O OD1 . ASN A 1 53  ? 52.301 92.521  8.206   1.00 44.01 ? 115  ASN A OD1 1 
ATOM   258  N ND2 . ASN A 1 53  ? 51.234 94.485  8.480   1.00 44.08 ? 115  ASN A ND2 1 
ATOM   259  N N   . PRO A 1 54  ? 52.469 93.907  3.912   1.00 43.76 ? 116  PRO A N   1 
ATOM   260  C CA  . PRO A 1 54  ? 51.815 94.480  2.722   1.00 43.64 ? 116  PRO A CA  1 
ATOM   261  C C   . PRO A 1 54  ? 50.375 94.986  2.921   1.00 43.48 ? 116  PRO A C   1 
ATOM   262  O O   . PRO A 1 54  ? 49.756 94.696  3.948   1.00 43.55 ? 116  PRO A O   1 
ATOM   263  C CB  . PRO A 1 54  ? 51.841 93.323  1.718   1.00 43.68 ? 116  PRO A CB  1 
ATOM   264  C CG  . PRO A 1 54  ? 51.992 92.091  2.534   1.00 43.73 ? 116  PRO A CG  1 
ATOM   265  C CD  . PRO A 1 54  ? 52.776 92.475  3.739   1.00 43.79 ? 116  PRO A CD  1 
ATOM   266  N N   . PRO A 1 55  ? 49.846 95.738  1.935   1.00 43.28 ? 117  PRO A N   1 
ATOM   267  C CA  . PRO A 1 55  ? 48.483 96.278  2.010   1.00 43.10 ? 117  PRO A CA  1 
ATOM   268  C C   . PRO A 1 55  ? 47.414 95.232  1.664   1.00 42.90 ? 117  PRO A C   1 
ATOM   269  O O   . PRO A 1 55  ? 46.886 95.217  0.545   1.00 42.89 ? 117  PRO A O   1 
ATOM   270  C CB  . PRO A 1 55  ? 48.507 97.413  0.980   1.00 43.10 ? 117  PRO A CB  1 
ATOM   271  C CG  . PRO A 1 55  ? 49.466 96.942  -0.056  1.00 43.13 ? 117  PRO A CG  1 
ATOM   272  C CD  . PRO A 1 55  ? 50.515 96.132  0.678   1.00 43.31 ? 117  PRO A CD  1 
ATOM   273  N N   . ILE A 1 56  ? 47.100 94.376  2.635   1.00 42.56 ? 118  ILE A N   1 
ATOM   274  C CA  . ILE A 1 56  ? 46.146 93.283  2.436   1.00 42.33 ? 118  ILE A CA  1 
ATOM   275  C C   . ILE A 1 56  ? 44.705 93.803  2.378   1.00 42.10 ? 118  ILE A C   1 
ATOM   276  O O   . ILE A 1 56  ? 43.979 93.506  1.429   1.00 42.08 ? 118  ILE A O   1 
ATOM   277  C CB  . ILE A 1 56  ? 46.281 92.204  3.541   1.00 42.30 ? 118  ILE A CB  1 
ATOM   278  C CG1 . ILE A 1 56  ? 47.679 91.577  3.512   1.00 42.25 ? 118  ILE A CG1 1 
ATOM   279  C CG2 . ILE A 1 56  ? 45.234 91.111  3.369   1.00 42.39 ? 118  ILE A CG2 1 
ATOM   280  C CD1 . ILE A 1 56  ? 47.897 90.512  4.567   1.00 42.34 ? 118  ILE A CD1 1 
ATOM   281  N N   . ASP A 1 57  ? 44.303 94.586  3.380   1.00 41.78 ? 119  ASP A N   1 
ATOM   282  C CA  . ASP A 1 57  ? 42.932 95.122  3.450   1.00 41.56 ? 119  ASP A CA  1 
ATOM   283  C C   . ASP A 1 57  ? 42.558 96.026  2.262   1.00 41.26 ? 119  ASP A C   1 
ATOM   284  O O   . ASP A 1 57  ? 41.410 96.019  1.809   1.00 41.08 ? 119  ASP A O   1 
ATOM   285  C CB  . ASP A 1 57  ? 42.700 95.870  4.773   1.00 41.58 ? 119  ASP A CB  1 
ATOM   286  C CG  . ASP A 1 57  ? 42.155 94.967  5.872   1.00 41.82 ? 119  ASP A CG  1 
ATOM   287  O OD1 . ASP A 1 57  ? 41.138 95.348  6.491   1.00 42.25 ? 119  ASP A OD1 1 
ATOM   288  O OD2 . ASP A 1 57  ? 42.730 93.882  6.112   1.00 41.68 ? 119  ASP A OD2 1 
ATOM   289  N N   . GLU A 1 58  ? 43.523 96.791  1.758   1.00 40.93 ? 120  GLU A N   1 
ATOM   290  C CA  . GLU A 1 58  ? 43.290 97.657  0.598   1.00 40.78 ? 120  GLU A CA  1 
ATOM   291  C C   . GLU A 1 58  ? 42.946 96.855  -0.664  1.00 40.39 ? 120  GLU A C   1 
ATOM   292  O O   . GLU A 1 58  ? 42.235 97.345  -1.546  1.00 40.37 ? 120  GLU A O   1 
ATOM   293  C CB  . GLU A 1 58  ? 44.504 98.560  0.336   1.00 40.87 ? 120  GLU A CB  1 
ATOM   294  C CG  . GLU A 1 58  ? 44.832 99.520  1.485   1.00 41.17 ? 120  GLU A CG  1 
ATOM   295  C CD  . GLU A 1 58  ? 45.697 100.702 1.053   1.00 41.25 ? 120  GLU A CD  1 
ATOM   296  O OE1 . GLU A 1 58  ? 45.237 101.523 0.224   1.00 40.94 ? 120  GLU A OE1 1 
ATOM   297  O OE2 . GLU A 1 58  ? 46.835 100.815 1.562   1.00 42.17 ? 120  GLU A OE2 1 
ATOM   298  N N   . VAL A 1 59  ? 43.456 95.628  -0.740  1.00 40.02 ? 121  VAL A N   1 
ATOM   299  C CA  . VAL A 1 59  ? 43.173 94.721  -1.854  1.00 39.68 ? 121  VAL A CA  1 
ATOM   300  C C   . VAL A 1 59  ? 41.849 93.985  -1.635  1.00 39.27 ? 121  VAL A C   1 
ATOM   301  O O   . VAL A 1 59  ? 41.033 93.868  -2.554  1.00 39.12 ? 121  VAL A O   1 
ATOM   302  C CB  . VAL A 1 59  ? 44.298 93.668  -2.018  1.00 39.73 ? 121  VAL A CB  1 
ATOM   303  C CG1 . VAL A 1 59  ? 43.980 92.710  -3.162  1.00 39.84 ? 121  VAL A CG1 1 
ATOM   304  C CG2 . VAL A 1 59  ? 45.642 94.351  -2.244  1.00 39.96 ? 121  VAL A CG2 1 
ATOM   305  N N   . ILE A 1 60  ? 41.650 93.498  -0.411  1.00 38.74 ? 122  ILE A N   1 
ATOM   306  C CA  . ILE A 1 60  ? 40.482 92.685  -0.065  1.00 38.36 ? 122  ILE A CA  1 
ATOM   307  C C   . ILE A 1 60  ? 39.167 93.474  -0.112  1.00 37.93 ? 122  ILE A C   1 
ATOM   308  O O   . ILE A 1 60  ? 38.104 92.886  -0.321  1.00 37.93 ? 122  ILE A O   1 
ATOM   309  C CB  . ILE A 1 60  ? 40.650 92.034  1.335   1.00 38.30 ? 122  ILE A CB  1 
ATOM   310  C CG1 . ILE A 1 60  ? 41.790 91.015  1.319   1.00 38.51 ? 122  ILE A CG1 1 
ATOM   311  C CG2 . ILE A 1 60  ? 39.384 91.315  1.758   1.00 38.53 ? 122  ILE A CG2 1 
ATOM   312  C CD1 . ILE A 1 60  ? 42.047 90.367  2.668   1.00 38.36 ? 122  ILE A CD1 1 
ATOM   313  N N   . SER A 1 61  ? 39.242 94.793  0.070   1.00 37.40 ? 123  SER A N   1 
ATOM   314  C CA  . SER A 1 61  ? 38.047 95.644  0.102   1.00 36.94 ? 123  SER A CA  1 
ATOM   315  C C   . SER A 1 61  ? 37.509 95.994  -1.290  1.00 36.49 ? 123  SER A C   1 
ATOM   316  O O   . SER A 1 61  ? 36.379 96.471  -1.415  1.00 36.40 ? 123  SER A O   1 
ATOM   317  C CB  . SER A 1 61  ? 38.331 96.932  0.883   1.00 36.96 ? 123  SER A CB  1 
ATOM   318  O OG  . SER A 1 61  ? 39.097 97.843  0.112   1.00 37.12 ? 123  SER A OG  1 
ATOM   319  N N   . THR A 1 62  ? 38.316 95.773  -2.326  1.00 35.90 ? 124  THR A N   1 
ATOM   320  C CA  . THR A 1 62  ? 37.906 96.059  -3.702  1.00 35.55 ? 124  THR A CA  1 
ATOM   321  C C   . THR A 1 62  ? 36.863 95.035  -4.167  1.00 35.12 ? 124  THR A C   1 
ATOM   322  O O   . THR A 1 62  ? 37.121 93.833  -4.135  1.00 35.22 ? 124  THR A O   1 
ATOM   323  C CB  . THR A 1 62  ? 39.112 96.027  -4.662  1.00 35.52 ? 124  THR A CB  1 
ATOM   324  O OG1 . THR A 1 62  ? 40.234 96.675  -4.047  1.00 35.43 ? 124  THR A OG1 1 
ATOM   325  C CG2 . THR A 1 62  ? 38.775 96.717  -5.982  1.00 35.64 ? 124  THR A CG2 1 
ATOM   326  N N   . PRO A 1 63  ? 35.683 95.505  -4.610  1.00 34.69 ? 125  PRO A N   1 
ATOM   327  C CA  . PRO A 1 63  ? 34.566 94.590  -4.882  1.00 34.30 ? 125  PRO A CA  1 
ATOM   328  C C   . PRO A 1 63  ? 34.834 93.555  -5.983  1.00 33.85 ? 125  PRO A C   1 
ATOM   329  O O   . PRO A 1 63  ? 35.209 93.912  -7.103  1.00 33.83 ? 125  PRO A O   1 
ATOM   330  C CB  . PRO A 1 63  ? 33.427 95.535  -5.294  1.00 34.25 ? 125  PRO A CB  1 
ATOM   331  C CG  . PRO A 1 63  ? 34.099 96.775  -5.743  1.00 34.52 ? 125  PRO A CG  1 
ATOM   332  C CD  . PRO A 1 63  ? 35.324 96.905  -4.900  1.00 34.64 ? 125  PRO A CD  1 
ATOM   333  N N   . GLY A 1 64  ? 34.647 92.281  -5.644  1.00 33.25 ? 126  GLY A N   1 
ATOM   334  C CA  . GLY A 1 64  ? 34.745 91.191  -6.613  1.00 32.78 ? 126  GLY A CA  1 
ATOM   335  C C   . GLY A 1 64  ? 36.156 90.801  -7.021  1.00 32.29 ? 126  GLY A C   1 
ATOM   336  O O   . GLY A 1 64  ? 36.326 89.976  -7.919  1.00 32.22 ? 126  GLY A O   1 
ATOM   337  N N   . VAL A 1 65  ? 37.163 91.374  -6.357  1.00 31.65 ? 127  VAL A N   1 
ATOM   338  C CA  . VAL A 1 65  ? 38.571 91.152  -6.713  1.00 31.14 ? 127  VAL A CA  1 
ATOM   339  C C   . VAL A 1 65  ? 39.123 89.845  -6.140  1.00 30.63 ? 127  VAL A C   1 
ATOM   340  O O   . VAL A 1 65  ? 39.806 89.103  -6.846  1.00 30.63 ? 127  VAL A O   1 
ATOM   341  C CB  . VAL A 1 65  ? 39.461 92.332  -6.259  1.00 31.12 ? 127  VAL A CB  1 
ATOM   342  C CG1 . VAL A 1 65  ? 40.934 91.935  -6.249  1.00 31.12 ? 127  VAL A CG1 1 
ATOM   343  C CG2 . VAL A 1 65  ? 39.232 93.533  -7.161  1.00 31.25 ? 127  VAL A CG2 1 
ATOM   344  N N   . VAL A 1 66  ? 38.837 89.566  -4.870  1.00 29.94 ? 128  VAL A N   1 
ATOM   345  C CA  . VAL A 1 66  ? 39.258 88.301  -4.251  1.00 29.41 ? 128  VAL A CA  1 
ATOM   346  C C   . VAL A 1 66  ? 38.535 87.115  -4.909  1.00 29.02 ? 128  VAL A C   1 
ATOM   347  O O   . VAL A 1 66  ? 39.133 86.060  -5.131  1.00 28.90 ? 128  VAL A O   1 
ATOM   348  C CB  . VAL A 1 66  ? 39.024 88.290  -2.713  1.00 29.26 ? 128  VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 66  ? 39.420 86.941  -2.115  1.00 29.01 ? 128  VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 66  ? 39.804 89.413  -2.044  1.00 28.69 ? 128  VAL A CG2 1 
ATOM   351  N N   . ALA A 1 67  ? 37.257 87.304  -5.231  1.00 28.56 ? 129  ALA A N   1 
ATOM   352  C CA  . ALA A 1 67  ? 36.472 86.289  -5.932  1.00 28.17 ? 129  ALA A CA  1 
ATOM   353  C C   . ALA A 1 67  ? 36.950 86.097  -7.379  1.00 27.79 ? 129  ALA A C   1 
ATOM   354  O O   . ALA A 1 67  ? 36.815 85.003  -7.940  1.00 27.50 ? 129  ALA A O   1 
ATOM   355  C CB  . ALA A 1 67  ? 35.003 86.658  -5.902  1.00 28.23 ? 129  ALA A CB  1 
ATOM   356  N N   . ARG A 1 68  ? 37.503 87.159  -7.971  1.00 27.27 ? 130  ARG A N   1 
ATOM   357  C CA  . ARG A 1 68  ? 38.107 87.100  -9.309  1.00 27.11 ? 130  ARG A CA  1 
ATOM   358  C C   . ARG A 1 68  ? 39.396 86.274  -9.296  1.00 26.84 ? 130  ARG A C   1 
ATOM   359  O O   . ARG A 1 68  ? 39.642 85.488  -10.212 1.00 26.85 ? 130  ARG A O   1 
ATOM   360  C CB  . ARG A 1 68  ? 38.387 88.514  -9.837  1.00 27.07 ? 130  ARG A CB  1 
ATOM   361  C CG  . ARG A 1 68  ? 38.924 88.584  -11.259 1.00 27.10 ? 130  ARG A CG  1 
ATOM   362  C CD  . ARG A 1 68  ? 37.865 88.218  -12.302 1.00 27.01 ? 130  ARG A CD  1 
ATOM   363  N NE  . ARG A 1 68  ? 38.323 88.526  -13.659 1.00 27.07 ? 130  ARG A NE  1 
ATOM   364  C CZ  . ARG A 1 68  ? 37.717 88.129  -14.779 1.00 27.36 ? 130  ARG A CZ  1 
ATOM   365  N NH1 . ARG A 1 68  ? 36.623 87.374  -14.732 1.00 27.89 ? 130  ARG A NH1 1 
ATOM   366  N NH2 . ARG A 1 68  ? 38.219 88.471  -15.962 1.00 26.46 ? 130  ARG A NH2 1 
ATOM   367  N N   . PHE A 1 69  ? 40.216 86.451  -8.262  1.00 26.65 ? 131  PHE A N   1 
ATOM   368  C CA  . PHE A 1 69  ? 41.414 85.622  -8.082  1.00 26.28 ? 131  PHE A CA  1 
ATOM   369  C C   . PHE A 1 69  ? 41.045 84.147  -7.905  1.00 26.05 ? 131  PHE A C   1 
ATOM   370  O O   . PHE A 1 69  ? 41.766 83.269  -8.380  1.00 25.96 ? 131  PHE A O   1 
ATOM   371  C CB  . PHE A 1 69  ? 42.249 86.092  -6.887  1.00 26.30 ? 131  PHE A CB  1 
ATOM   372  C CG  . PHE A 1 69  ? 42.942 87.414  -7.097  1.00 26.49 ? 131  PHE A CG  1 
ATOM   373  C CD1 . PHE A 1 69  ? 42.803 88.443  -6.166  1.00 27.10 ? 131  PHE A CD1 1 
ATOM   374  C CD2 . PHE A 1 69  ? 43.740 87.635  -8.215  1.00 26.59 ? 131  PHE A CD2 1 
ATOM   375  C CE1 . PHE A 1 69  ? 43.440 89.671  -6.356  1.00 26.76 ? 131  PHE A CE1 1 
ATOM   376  C CE2 . PHE A 1 69  ? 44.377 88.859  -8.409  1.00 26.43 ? 131  PHE A CE2 1 
ATOM   377  C CZ  . PHE A 1 69  ? 44.227 89.873  -7.478  1.00 26.50 ? 131  PHE A CZ  1 
ATOM   378  N N   . VAL A 1 70  ? 39.927 83.880  -7.230  1.00 25.84 ? 132  VAL A N   1 
ATOM   379  C CA  . VAL A 1 70  ? 39.455 82.507  -7.017  1.00 25.76 ? 132  VAL A CA  1 
ATOM   380  C C   . VAL A 1 70  ? 38.918 81.890  -8.315  1.00 25.95 ? 132  VAL A C   1 
ATOM   381  O O   . VAL A 1 70  ? 39.016 80.678  -8.518  1.00 26.20 ? 132  VAL A O   1 
ATOM   382  C CB  . VAL A 1 70  ? 38.376 82.444  -5.911  1.00 25.46 ? 132  VAL A CB  1 
ATOM   383  C CG1 . VAL A 1 70  ? 37.869 81.022  -5.727  1.00 24.70 ? 132  VAL A CG1 1 
ATOM   384  C CG2 . VAL A 1 70  ? 38.922 82.998  -4.609  1.00 24.00 ? 132  VAL A CG2 1 
ATOM   385  N N   . GLU A 1 71  ? 38.355 82.726  -9.186  1.00 26.36 ? 133  GLU A N   1 
ATOM   386  C CA  . GLU A 1 71  ? 37.923 82.292  -10.513 1.00 26.30 ? 133  GLU A CA  1 
ATOM   387  C C   . GLU A 1 71  ? 39.133 81.936  -11.372 1.00 26.18 ? 133  GLU A C   1 
ATOM   388  O O   . GLU A 1 71  ? 39.069 80.999  -12.166 1.00 26.51 ? 133  GLU A O   1 
ATOM   389  C CB  . GLU A 1 71  ? 37.092 83.385  -11.205 1.00 26.48 ? 133  GLU A CB  1 
ATOM   390  C CG  . GLU A 1 71  ? 36.364 82.932  -12.476 1.00 26.84 ? 133  GLU A CG  1 
ATOM   391  C CD  . GLU A 1 71  ? 35.843 84.096  -13.321 1.00 27.28 ? 133  GLU A CD  1 
ATOM   392  O OE1 . GLU A 1 71  ? 35.919 84.000  -14.564 1.00 29.24 ? 133  GLU A OE1 1 
ATOM   393  O OE2 . GLU A 1 71  ? 35.355 85.105  -12.758 1.00 29.13 ? 133  GLU A OE2 1 
ATOM   394  N N   . PHE A 1 72  ? 40.230 82.677  -11.216 1.00 25.87 ? 134  PHE A N   1 
ATOM   395  C CA  . PHE A 1 72  ? 41.447 82.405  -11.991 1.00 25.68 ? 134  PHE A CA  1 
ATOM   396  C C   . PHE A 1 72  ? 42.082 81.050  -11.656 1.00 25.50 ? 134  PHE A C   1 
ATOM   397  O O   . PHE A 1 72  ? 42.663 80.417  -12.539 1.00 25.43 ? 134  PHE A O   1 
ATOM   398  C CB  . PHE A 1 72  ? 42.490 83.530  -11.845 1.00 25.54 ? 134  PHE A CB  1 
ATOM   399  C CG  . PHE A 1 72  ? 42.152 84.806  -12.594 1.00 26.04 ? 134  PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 72  ? 41.453 84.787  -13.803 1.00 25.26 ? 134  PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 72  ? 42.572 86.034  -12.099 1.00 26.09 ? 134  PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 72  ? 41.165 85.953  -14.467 1.00 25.62 ? 134  PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 72  ? 42.282 87.207  -12.770 1.00 25.34 ? 134  PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 72  ? 41.583 87.163  -13.951 1.00 25.54 ? 134  PHE A CZ  1 
ATOM   405  N N   . LEU A 1 73  ? 41.969 80.610  -10.399 1.00 25.32 ? 135  LEU A N   1 
ATOM   406  C CA  . LEU A 1 73  ? 42.464 79.290  -9.980  1.00 25.18 ? 135  LEU A CA  1 
ATOM   407  C C   . LEU A 1 73  ? 41.857 78.139  -10.795 1.00 25.34 ? 135  LEU A C   1 
ATOM   408  O O   . LEU A 1 73  ? 42.496 77.108  -10.982 1.00 25.55 ? 135  LEU A O   1 
ATOM   409  C CB  . LEU A 1 73  ? 42.193 79.051  -8.484  1.00 24.86 ? 135  LEU A CB  1 
ATOM   410  C CG  . LEU A 1 73  ? 42.919 79.933  -7.460  1.00 23.51 ? 135  LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 73  ? 42.459 79.613  -6.055  1.00 21.50 ? 135  LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 73  ? 44.422 79.783  -7.575  1.00 22.28 ? 135  LEU A CD2 1 
ATOM   413  N N   . LYS A 1 74  ? 40.628 78.321  -11.274 1.00 25.73 ? 136  LYS A N   1 
ATOM   414  C CA  . LYS A 1 74  ? 39.932 77.306  -12.067 1.00 25.87 ? 136  LYS A CA  1 
ATOM   415  C C   . LYS A 1 74  ? 40.417 77.212  -13.518 1.00 25.94 ? 136  LYS A C   1 
ATOM   416  O O   . LYS A 1 74  ? 40.058 76.267  -14.225 1.00 25.98 ? 136  LYS A O   1 
ATOM   417  C CB  . LYS A 1 74  ? 38.427 77.595  -12.089 1.00 26.19 ? 136  LYS A CB  1 
ATOM   418  C CG  . LYS A 1 74  ? 37.738 77.579  -10.733 1.00 26.39 ? 136  LYS A CG  1 
ATOM   419  C CD  . LYS A 1 74  ? 36.298 78.077  -10.863 1.00 26.47 ? 136  LYS A CD  1 
ATOM   420  C CE  . LYS A 1 74  ? 35.621 78.203  -9.504  1.00 27.08 ? 136  LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 74  ? 34.229 78.712  -9.635  1.00 27.29 ? 136  LYS A NZ  1 
ATOM   422  N N   . ARG A 1 75  ? 41.205 78.182  -13.977 1.00 25.79 ? 137  ARG A N   1 
ATOM   423  C CA  . ARG A 1 75  ? 41.608 78.211  -15.382 1.00 25.95 ? 137  ARG A CA  1 
ATOM   424  C C   . ARG A 1 75  ? 42.825 77.329  -15.683 1.00 25.63 ? 137  ARG A C   1 
ATOM   425  O O   . ARG A 1 75  ? 43.961 77.794  -15.737 1.00 24.88 ? 137  ARG A O   1 
ATOM   426  C CB  . ARG A 1 75  ? 41.775 79.652  -15.879 1.00 26.15 ? 137  ARG A CB  1 
ATOM   427  C CG  . ARG A 1 75  ? 40.421 80.333  -16.152 1.00 26.30 ? 137  ARG A CG  1 
ATOM   428  C CD  . ARG A 1 75  ? 40.427 81.040  -17.481 1.00 26.79 ? 137  ARG A CD  1 
ATOM   429  N NE  . ARG A 1 75  ? 41.400 82.126  -17.482 1.00 27.02 ? 137  ARG A NE  1 
ATOM   430  C CZ  . ARG A 1 75  ? 41.922 82.680  -18.570 1.00 27.18 ? 137  ARG A CZ  1 
ATOM   431  N NH1 . ARG A 1 75  ? 41.579 82.264  -19.783 1.00 27.96 ? 137  ARG A NH1 1 
ATOM   432  N NH2 . ARG A 1 75  ? 42.803 83.660  -18.444 1.00 27.36 ? 137  ARG A NH2 1 
ATOM   433  N N   . LYS A 1 76  ? 42.528 76.060  -15.949 1.00 25.92 ? 138  LYS A N   1 
ATOM   434  C CA  . LYS A 1 76  ? 43.514 74.984  -15.984 1.00 26.52 ? 138  LYS A CA  1 
ATOM   435  C C   . LYS A 1 76  ? 44.502 75.051  -17.155 1.00 26.52 ? 138  LYS A C   1 
ATOM   436  O O   . LYS A 1 76  ? 45.541 74.394  -17.116 1.00 26.93 ? 138  LYS A O   1 
ATOM   437  C CB  . LYS A 1 76  ? 42.795 73.619  -15.986 1.00 26.72 ? 138  LYS A CB  1 
ATOM   438  C CG  . LYS A 1 76  ? 41.717 73.469  -14.884 1.00 27.20 ? 138  LYS A CG  1 
ATOM   439  C CD  . LYS A 1 76  ? 41.791 72.113  -14.132 1.00 27.54 ? 138  LYS A CD  1 
ATOM   440  C CE  . LYS A 1 76  ? 41.278 72.205  -12.673 1.00 27.53 ? 138  LYS A CE  1 
ATOM   441  N NZ  . LYS A 1 76  ? 41.908 71.194  -11.769 1.00 26.95 ? 138  LYS A NZ  1 
ATOM   442  N N   . GLU A 1 77  ? 44.188 75.844  -18.178 1.00 26.63 ? 139  GLU A N   1 
ATOM   443  C CA  . GLU A 1 77  ? 45.007 75.921  -19.395 1.00 26.39 ? 139  GLU A CA  1 
ATOM   444  C C   . GLU A 1 77  ? 46.069 77.027  -19.386 1.00 26.15 ? 139  GLU A C   1 
ATOM   445  O O   . GLU A 1 77  ? 46.706 77.271  -20.407 1.00 26.02 ? 139  GLU A O   1 
ATOM   446  C CB  . GLU A 1 77  ? 44.098 76.108  -20.608 1.00 26.52 ? 139  GLU A CB  1 
ATOM   447  C CG  . GLU A 1 77  ? 43.045 75.022  -20.771 1.00 27.24 ? 139  GLU A CG  1 
ATOM   448  C CD  . GLU A 1 77  ? 43.644 73.649  -21.020 1.00 27.80 ? 139  GLU A CD  1 
ATOM   449  O OE1 . GLU A 1 77  ? 44.562 73.535  -21.856 1.00 28.44 ? 139  GLU A OE1 1 
ATOM   450  O OE2 . GLU A 1 77  ? 43.192 72.679  -20.385 1.00 28.86 ? 139  GLU A OE2 1 
ATOM   451  N N   . ASN A 1 78  ? 46.273 77.676  -18.241 1.00 25.85 ? 140  ASN A N   1 
ATOM   452  C CA  . ASN A 1 78  ? 47.201 78.805  -18.131 1.00 25.59 ? 140  ASN A CA  1 
ATOM   453  C C   . ASN A 1 78  ? 47.965 78.723  -16.823 1.00 25.29 ? 140  ASN A C   1 
ATOM   454  O O   . ASN A 1 78  ? 47.506 79.224  -15.799 1.00 25.33 ? 140  ASN A O   1 
ATOM   455  C CB  . ASN A 1 78  ? 46.433 80.134  -18.221 1.00 25.66 ? 140  ASN A CB  1 
ATOM   456  C CG  . ASN A 1 78  ? 47.351 81.356  -18.281 1.00 25.72 ? 140  ASN A CG  1 
ATOM   457  O OD1 . ASN A 1 78  ? 48.437 81.382  -17.695 1.00 25.79 ? 140  ASN A OD1 1 
ATOM   458  N ND2 . ASN A 1 78  ? 46.899 82.384  -18.988 1.00 26.63 ? 140  ASN A ND2 1 
ATOM   459  N N   . CYS A 1 79  ? 49.131 78.084  -16.874 1.00 24.95 ? 141  CYS A N   1 
ATOM   460  C CA  . CYS A 1 79  ? 49.977 77.863  -15.703 1.00 24.58 ? 141  CYS A CA  1 
ATOM   461  C C   . CYS A 1 79  ? 50.350 79.153  -14.992 1.00 24.31 ? 141  CYS A C   1 
ATOM   462  O O   . CYS A 1 79  ? 50.238 79.239  -13.776 1.00 24.19 ? 141  CYS A O   1 
ATOM   463  C CB  . CYS A 1 79  ? 51.269 77.138  -16.101 1.00 24.50 ? 141  CYS A CB  1 
ATOM   464  S SG  . CYS A 1 79  ? 52.497 77.019  -14.752 1.00 24.64 ? 141  CYS A SG  1 
ATOM   465  N N   . THR A 1 80  ? 50.801 80.148  -15.752 1.00 24.17 ? 142  THR A N   1 
ATOM   466  C CA  . THR A 1 80  ? 51.375 81.357  -15.164 1.00 24.00 ? 142  THR A CA  1 
ATOM   467  C C   . THR A 1 80  ? 50.340 82.136  -14.357 1.00 23.72 ? 142  THR A C   1 
ATOM   468  O O   . THR A 1 80  ? 50.626 82.601  -13.256 1.00 23.54 ? 142  THR A O   1 
ATOM   469  C CB  . THR A 1 80  ? 51.979 82.279  -16.234 1.00 24.04 ? 142  THR A CB  1 
ATOM   470  O OG1 . THR A 1 80  ? 52.325 81.511  -17.398 1.00 25.21 ? 142  THR A OG1 1 
ATOM   471  C CG2 . THR A 1 80  ? 53.212 82.992  -15.684 1.00 23.82 ? 142  THR A CG2 1 
ATOM   472  N N   . LEU A 1 81  ? 49.140 82.264  -14.914 1.00 23.49 ? 143  LEU A N   1 
ATOM   473  C CA  . LEU A 1 81  ? 48.041 82.963  -14.253 1.00 23.38 ? 143  LEU A CA  1 
ATOM   474  C C   . LEU A 1 81  ? 47.593 82.229  -12.986 1.00 23.42 ? 143  LEU A C   1 
ATOM   475  O O   . LEU A 1 81  ? 47.328 82.866  -11.969 1.00 23.51 ? 143  LEU A O   1 
ATOM   476  C CB  . LEU A 1 81  ? 46.864 83.129  -15.222 1.00 23.43 ? 143  LEU A CB  1 
ATOM   477  C CG  . LEU A 1 81  ? 45.708 84.043  -14.801 1.00 23.23 ? 143  LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 81  ? 46.138 85.492  -14.749 1.00 22.34 ? 143  LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 81  ? 44.555 83.872  -15.752 1.00 23.01 ? 143  LEU A CD2 1 
ATOM   480  N N   . GLN A 1 82  ? 47.520 80.896  -13.052 1.00 23.30 ? 144  GLN A N   1 
ATOM   481  C CA  . GLN A 1 82  ? 47.145 80.061  -11.899 1.00 23.05 ? 144  GLN A CA  1 
ATOM   482  C C   . GLN A 1 82  ? 48.144 80.209  -10.749 1.00 23.04 ? 144  GLN A C   1 
ATOM   483  O O   . GLN A 1 82  ? 47.760 80.215  -9.585  1.00 23.01 ? 144  GLN A O   1 
ATOM   484  C CB  . GLN A 1 82  ? 47.055 78.580  -12.297 1.00 23.00 ? 144  GLN A CB  1 
ATOM   485  C CG  . GLN A 1 82  ? 45.743 78.126  -12.927 1.00 22.64 ? 144  GLN A CG  1 
ATOM   486  C CD  . GLN A 1 82  ? 45.602 76.603  -12.925 1.00 23.01 ? 144  GLN A CD  1 
ATOM   487  O OE1 . GLN A 1 82  ? 46.396 75.891  -13.543 1.00 23.20 ? 144  GLN A OE1 1 
ATOM   488  N NE2 . GLN A 1 82  ? 44.601 76.099  -12.210 1.00 22.97 ? 144  GLN A NE2 1 
ATOM   489  N N   . PHE A 1 83  ? 49.425 80.307  -11.099 1.00 22.95 ? 145  PHE A N   1 
ATOM   490  C CA  . PHE A 1 83  ? 50.501 80.513  -10.143 1.00 22.86 ? 145  PHE A CA  1 
ATOM   491  C C   . PHE A 1 83  ? 50.478 81.916  -9.539  1.00 22.88 ? 145  PHE A C   1 
ATOM   492  O O   . PHE A 1 83  ? 50.623 82.073  -8.331  1.00 23.20 ? 145  PHE A O   1 
ATOM   493  C CB  . PHE A 1 83  ? 51.847 80.263  -10.820 1.00 22.72 ? 145  PHE A CB  1 
ATOM   494  C CG  . PHE A 1 83  ? 53.031 80.623  -9.969  1.00 22.97 ? 145  PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 83  ? 53.344 79.881  -8.839  1.00 22.75 ? 145  PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 83  ? 53.837 81.705  -10.300 1.00 23.20 ? 145  PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 83  ? 54.439 80.209  -8.057  1.00 22.69 ? 145  PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 83  ? 54.935 82.038  -9.518  1.00 22.79 ? 145  PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 83  ? 55.232 81.293  -8.399  1.00 22.80 ? 145  PHE A CZ  1 
ATOM   500  N N   . GLU A 1 84  ? 50.315 82.932  -10.376 1.00 22.97 ? 146  GLU A N   1 
ATOM   501  C CA  . GLU A 1 84  ? 50.259 84.313  -9.894  1.00 23.09 ? 146  GLU A CA  1 
ATOM   502  C C   . GLU A 1 84  ? 49.068 84.525  -8.962  1.00 23.17 ? 146  GLU A C   1 
ATOM   503  O O   . GLU A 1 84  ? 49.204 85.135  -7.902  1.00 23.27 ? 146  GLU A O   1 
ATOM   504  C CB  . GLU A 1 84  ? 50.193 85.294  -11.068 1.00 23.11 ? 146  GLU A CB  1 
ATOM   505  C CG  . GLU A 1 84  ? 51.479 85.369  -11.887 1.00 23.47 ? 146  GLU A CG  1 
ATOM   506  C CD  . GLU A 1 84  ? 52.635 85.964  -11.117 1.00 23.80 ? 146  GLU A CD  1 
ATOM   507  O OE1 . GLU A 1 84  ? 52.374 86.668  -10.124 1.00 24.26 ? 146  GLU A OE1 1 
ATOM   508  O OE2 . GLU A 1 84  ? 53.800 85.730  -11.508 1.00 23.96 ? 146  GLU A OE2 1 
ATOM   509  N N   . SER A 1 85  ? 47.904 84.019  -9.364  1.00 23.15 ? 147  SER A N   1 
ATOM   510  C CA  . SER A 1 85  ? 46.708 84.042  -8.519  1.00 23.10 ? 147  SER A CA  1 
ATOM   511  C C   . SER A 1 85  ? 46.959 83.332  -7.190  1.00 23.03 ? 147  SER A C   1 
ATOM   512  O O   . SER A 1 85  ? 46.648 83.857  -6.121  1.00 22.65 ? 147  SER A O   1 
ATOM   513  C CB  . SER A 1 85  ? 45.543 83.361  -9.235  1.00 22.99 ? 147  SER A CB  1 
ATOM   514  O OG  . SER A 1 85  ? 45.354 83.895  -10.530 1.00 22.97 ? 147  SER A OG  1 
ATOM   515  N N   . ALA A 1 86  ? 47.522 82.131  -7.275  1.00 23.18 ? 148  ALA A N   1 
ATOM   516  C CA  . ALA A 1 86  ? 47.794 81.325  -6.093  1.00 23.54 ? 148  ALA A CA  1 
ATOM   517  C C   . ALA A 1 86  ? 48.771 82.029  -5.149  1.00 23.72 ? 148  ALA A C   1 
ATOM   518  O O   . ALA A 1 86  ? 48.579 82.000  -3.938  1.00 23.98 ? 148  ALA A O   1 
ATOM   519  C CB  . ALA A 1 86  ? 48.323 79.952  -6.490  1.00 23.53 ? 148  ALA A CB  1 
ATOM   520  N N   . TRP A 1 87  ? 49.803 82.657  -5.710  1.00 24.11 ? 149  TRP A N   1 
ATOM   521  C CA  . TRP A 1 87  ? 50.775 83.457  -4.941  1.00 24.31 ? 149  TRP A CA  1 
ATOM   522  C C   . TRP A 1 87  ? 50.061 84.592  -4.186  1.00 24.57 ? 149  TRP A C   1 
ATOM   523  O O   . TRP A 1 87  ? 50.328 84.809  -3.000  1.00 24.43 ? 149  TRP A O   1 
ATOM   524  C CB  . TRP A 1 87  ? 51.852 84.019  -5.894  1.00 24.52 ? 149  TRP A CB  1 
ATOM   525  C CG  . TRP A 1 87  ? 53.112 84.666  -5.276  1.00 24.64 ? 149  TRP A CG  1 
ATOM   526  C CD1 . TRP A 1 87  ? 53.254 85.212  -4.025  1.00 24.62 ? 149  TRP A CD1 1 
ATOM   527  C CD2 . TRP A 1 87  ? 54.375 84.873  -5.939  1.00 25.12 ? 149  TRP A CD2 1 
ATOM   528  N NE1 . TRP A 1 87  ? 54.522 85.718  -3.868  1.00 24.65 ? 149  TRP A NE1 1 
ATOM   529  C CE2 . TRP A 1 87  ? 55.231 85.524  -5.023  1.00 24.63 ? 149  TRP A CE2 1 
ATOM   530  C CE3 . TRP A 1 87  ? 54.867 84.556  -7.214  1.00 24.62 ? 149  TRP A CE3 1 
ATOM   531  C CZ2 . TRP A 1 87  ? 56.551 85.865  -5.341  1.00 24.70 ? 149  TRP A CZ2 1 
ATOM   532  C CZ3 . TRP A 1 87  ? 56.184 84.900  -7.530  1.00 24.56 ? 149  TRP A CZ3 1 
ATOM   533  C CH2 . TRP A 1 87  ? 57.006 85.548  -6.596  1.00 24.53 ? 149  TRP A CH2 1 
ATOM   534  N N   . VAL A 1 88  ? 49.151 85.297  -4.869  1.00 24.69 ? 150  VAL A N   1 
ATOM   535  C CA  . VAL A 1 88  ? 48.425 86.434  -4.274  1.00 24.88 ? 150  VAL A CA  1 
ATOM   536  C C   . VAL A 1 88  ? 47.566 86.018  -3.077  1.00 25.00 ? 150  VAL A C   1 
ATOM   537  O O   . VAL A 1 88  ? 47.655 86.623  -2.006  1.00 24.77 ? 150  VAL A O   1 
ATOM   538  C CB  . VAL A 1 88  ? 47.508 87.145  -5.303  1.00 24.82 ? 150  VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 88  ? 46.680 88.238  -4.626  1.00 24.68 ? 150  VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 88  ? 48.330 87.736  -6.434  1.00 25.20 ? 150  VAL A CG2 1 
ATOM   541  N N   . LEU A 1 89  ? 46.738 84.992  -3.275  1.00 25.27 ? 151  LEU A N   1 
ATOM   542  C CA  . LEU A 1 89  ? 45.813 84.508  -2.240  1.00 25.58 ? 151  LEU A CA  1 
ATOM   543  C C   . LEU A 1 89  ? 46.526 83.874  -1.048  1.00 26.03 ? 151  LEU A C   1 
ATOM   544  O O   . LEU A 1 89  ? 45.986 83.855  0.064   1.00 26.19 ? 151  LEU A O   1 
ATOM   545  C CB  . LEU A 1 89  ? 44.821 83.503  -2.832  1.00 25.27 ? 151  LEU A CB  1 
ATOM   546  C CG  . LEU A 1 89  ? 43.801 84.073  -3.815  1.00 24.34 ? 151  LEU A CG  1 
ATOM   547  C CD1 . LEU A 1 89  ? 43.127 82.949  -4.598  1.00 23.00 ? 151  LEU A CD1 1 
ATOM   548  C CD2 . LEU A 1 89  ? 42.777 84.930  -3.079  1.00 22.42 ? 151  LEU A CD2 1 
ATOM   549  N N   . THR A 1 90  ? 47.724 83.340  -1.292  1.00 26.54 ? 152  THR A N   1 
ATOM   550  C CA  . THR A 1 90  ? 48.589 82.820  -0.234  1.00 26.91 ? 152  THR A CA  1 
ATOM   551  C C   . THR A 1 90  ? 48.966 83.934  0.736   1.00 27.42 ? 152  THR A C   1 
ATOM   552  O O   . THR A 1 90  ? 48.880 83.750  1.949   1.00 27.68 ? 152  THR A O   1 
ATOM   553  C CB  . THR A 1 90  ? 49.895 82.207  -0.814  1.00 26.93 ? 152  THR A CB  1 
ATOM   554  O OG1 . THR A 1 90  ? 49.580 81.062  -1.615  1.00 27.09 ? 152  THR A OG1 1 
ATOM   555  C CG2 . THR A 1 90  ? 50.843 81.795  0.286   1.00 26.21 ? 152  THR A CG2 1 
ATOM   556  N N   . ASN A 1 91  ? 49.383 85.079  0.191   1.00 27.83 ? 153  ASN A N   1 
ATOM   557  C CA  . ASN A 1 91  ? 49.832 86.219  0.990   1.00 28.25 ? 153  ASN A CA  1 
ATOM   558  C C   . ASN A 1 91  ? 48.691 86.921  1.727   1.00 28.76 ? 153  ASN A C   1 
ATOM   559  O O   . ASN A 1 91  ? 48.881 87.394  2.843   1.00 28.81 ? 153  ASN A O   1 
ATOM   560  C CB  . ASN A 1 91  ? 50.599 87.214  0.116   1.00 28.26 ? 153  ASN A CB  1 
ATOM   561  C CG  . ASN A 1 91  ? 51.922 86.656  -0.379  1.00 28.22 ? 153  ASN A CG  1 
ATOM   562  O OD1 . ASN A 1 91  ? 52.212 85.476  -0.206  1.00 29.27 ? 153  ASN A OD1 1 
ATOM   563  N ND2 . ASN A 1 91  ? 52.733 87.506  -0.993  1.00 28.20 ? 153  ASN A ND2 1 
ATOM   564  N N   . ILE A 1 92  ? 47.516 86.991  1.103   1.00 29.36 ? 154  ILE A N   1 
ATOM   565  C CA  . ILE A 1 92  ? 46.291 87.403  1.804   1.00 29.77 ? 154  ILE A CA  1 
ATOM   566  C C   . ILE A 1 92  ? 46.013 86.422  2.943   1.00 30.42 ? 154  ILE A C   1 
ATOM   567  O O   . ILE A 1 92  ? 45.586 86.824  4.028   1.00 30.57 ? 154  ILE A O   1 
ATOM   568  C CB  . ILE A 1 92  ? 45.055 87.426  0.866   1.00 29.72 ? 154  ILE A CB  1 
ATOM   569  C CG1 . ILE A 1 92  ? 45.199 88.508  -0.209  1.00 29.52 ? 154  ILE A CG1 1 
ATOM   570  C CG2 . ILE A 1 92  ? 43.769 87.659  1.659   1.00 29.45 ? 154  ILE A CG2 1 
ATOM   571  C CD1 . ILE A 1 92  ? 44.042 88.541  -1.184  1.00 29.57 ? 154  ILE A CD1 1 
ATOM   572  N N   . ALA A 1 93  ? 46.262 85.137  2.676   1.00 30.97 ? 155  ALA A N   1 
ATOM   573  C CA  . ALA A 1 93  ? 46.052 84.067  3.653   1.00 31.54 ? 155  ALA A CA  1 
ATOM   574  C C   . ALA A 1 93  ? 47.044 84.117  4.814   1.00 32.02 ? 155  ALA A C   1 
ATOM   575  O O   . ALA A 1 93  ? 46.741 83.626  5.899   1.00 32.17 ? 155  ALA A O   1 
ATOM   576  C CB  . ALA A 1 93  ? 46.110 82.701  2.972   1.00 31.59 ? 155  ALA A CB  1 
ATOM   577  N N   . SER A 1 94  ? 48.231 84.677  4.584   1.00 32.56 ? 156  SER A N   1 
ATOM   578  C CA  . SER A 1 94  ? 49.120 85.041  5.684   1.00 33.08 ? 156  SER A CA  1 
ATOM   579  C C   . SER A 1 94  ? 48.565 86.323  6.299   1.00 33.55 ? 156  SER A C   1 
ATOM   580  O O   . SER A 1 94  ? 48.007 87.163  5.593   1.00 34.08 ? 156  SER A O   1 
ATOM   581  C CB  . SER A 1 94  ? 50.559 85.248  5.200   1.00 33.03 ? 156  SER A CB  1 
ATOM   582  O OG  . SER A 1 94  ? 50.675 86.399  4.380   1.00 33.37 ? 156  SER A OG  1 
ATOM   583  N N   . GLY A 1 95  ? 48.697 86.472  7.609   1.00 33.94 ? 157  GLY A N   1 
ATOM   584  C CA  . GLY A 1 95  ? 48.161 87.649  8.283   1.00 34.29 ? 157  GLY A CA  1 
ATOM   585  C C   . GLY A 1 95  ? 46.916 87.320  9.080   1.00 34.69 ? 157  GLY A C   1 
ATOM   586  O O   . GLY A 1 95  ? 46.750 86.179  9.533   1.00 35.05 ? 157  GLY A O   1 
ATOM   587  N N   . ASN A 1 96  ? 46.042 88.319  9.232   1.00 34.77 ? 158  ASN A N   1 
ATOM   588  C CA  . ASN A 1 96  ? 44.901 88.258  10.157  1.00 34.80 ? 158  ASN A CA  1 
ATOM   589  C C   . ASN A 1 96  ? 43.981 87.078  9.906   1.00 34.72 ? 158  ASN A C   1 
ATOM   590  O O   . ASN A 1 96  ? 43.936 86.542  8.799   1.00 34.52 ? 158  ASN A O   1 
ATOM   591  C CB  . ASN A 1 96  ? 44.047 89.534  10.064  1.00 35.01 ? 158  ASN A CB  1 
ATOM   592  C CG  . ASN A 1 96  ? 44.809 90.783  10.431  1.00 35.54 ? 158  ASN A CG  1 
ATOM   593  O OD1 . ASN A 1 96  ? 46.041 90.783  10.486  1.00 37.43 ? 158  ASN A OD1 1 
ATOM   594  N ND2 . ASN A 1 96  ? 44.079 91.860  10.685  1.00 35.69 ? 158  ASN A ND2 1 
ATOM   595  N N   . SER A 1 97  ? 43.243 86.693  10.943  1.00 34.82 ? 159  SER A N   1 
ATOM   596  C CA  . SER A 1 97  ? 42.144 85.748  10.795  1.00 35.04 ? 159  SER A CA  1 
ATOM   597  C C   . SER A 1 97  ? 41.036 86.396  9.987   1.00 35.21 ? 159  SER A C   1 
ATOM   598  O O   . SER A 1 97  ? 40.401 85.736  9.171   1.00 35.25 ? 159  SER A O   1 
ATOM   599  C CB  . SER A 1 97  ? 41.601 85.290  12.155  1.00 35.08 ? 159  SER A CB  1 
ATOM   600  O OG  . SER A 1 97  ? 42.418 84.283  12.727  1.00 34.66 ? 159  SER A OG  1 
ATOM   601  N N   . LEU A 1 98  ? 40.823 87.694  10.208  1.00 35.62 ? 160  LEU A N   1 
ATOM   602  C CA  . LEU A 1 98  ? 39.804 88.454  9.477   1.00 35.66 ? 160  LEU A CA  1 
ATOM   603  C C   . LEU A 1 98  ? 40.105 88.451  7.980   1.00 35.72 ? 160  LEU A C   1 
ATOM   604  O O   . LEU A 1 98  ? 39.208 88.277  7.158   1.00 35.83 ? 160  LEU A O   1 
ATOM   605  C CB  . LEU A 1 98  ? 39.709 89.900  9.989   1.00 35.80 ? 160  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 98  ? 39.748 90.175  11.507  1.00 36.15 ? 160  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 98  ? 39.140 91.554  11.786  1.00 35.77 ? 160  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 98  ? 39.030 89.101  12.333  1.00 36.09 ? 160  LEU A CD2 1 
ATOM   609  N N   . GLN A 1 99  ? 41.377 88.634  7.643   1.00 35.77 ? 161  GLN A N   1 
ATOM   610  C CA  . GLN A 1 99  ? 41.836 88.617  6.254   1.00 35.95 ? 161  GLN A CA  1 
ATOM   611  C C   . GLN A 1 99  ? 41.736 87.214  5.642   1.00 36.15 ? 161  GLN A C   1 
ATOM   612  O O   . GLN A 1 99  ? 41.306 87.057  4.499   1.00 36.12 ? 161  GLN A O   1 
ATOM   613  C CB  . GLN A 1 99  ? 43.280 89.127  6.177   1.00 35.95 ? 161  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 99  ? 43.419 90.597  6.559   1.00 35.94 ? 161  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 99  ? 44.837 91.014  6.914   1.00 35.91 ? 161  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 99  ? 45.688 90.188  7.252   1.00 35.60 ? 161  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 99  ? 45.089 92.320  6.856   1.00 36.24 ? 161  GLN A NE2 1 
ATOM   618  N N   . THR A 1 100 ? 42.129 86.203  6.417   1.00 36.33 ? 162  THR A N   1 
ATOM   619  C CA  . THR A 1 100 ? 42.017 84.804  6.001   1.00 36.48 ? 162  THR A CA  1 
ATOM   620  C C   . THR A 1 100 ? 40.562 84.305  5.922   1.00 36.71 ? 162  THR A C   1 
ATOM   621  O O   . THR A 1 100 ? 40.315 83.246  5.349   1.00 36.81 ? 162  THR A O   1 
ATOM   622  C CB  . THR A 1 100 ? 42.826 83.877  6.952   1.00 36.67 ? 162  THR A CB  1 
ATOM   623  O OG1 . THR A 1 100 ? 44.145 84.412  7.139   1.00 36.58 ? 162  THR A OG1 1 
ATOM   624  C CG2 . THR A 1 100 ? 42.924 82.457  6.393   1.00 36.18 ? 162  THR A CG2 1 
ATOM   625  N N   . ARG A 1 101 ? 39.612 85.057  6.490   1.00 36.92 ? 163  ARG A N   1 
ATOM   626  C CA  . ARG A 1 101 ? 38.176 84.729  6.394   1.00 36.97 ? 163  ARG A CA  1 
ATOM   627  C C   . ARG A 1 101 ? 37.631 84.909  4.984   1.00 36.75 ? 163  ARG A C   1 
ATOM   628  O O   . ARG A 1 101 ? 36.866 84.082  4.490   1.00 36.81 ? 163  ARG A O   1 
ATOM   629  C CB  . ARG A 1 101 ? 37.331 85.593  7.351   1.00 37.27 ? 163  ARG A CB  1 
ATOM   630  C CG  . ARG A 1 101 ? 37.361 85.125  8.802   1.00 38.01 ? 163  ARG A CG  1 
ATOM   631  C CD  . ARG A 1 101 ? 36.696 86.119  9.769   1.00 38.09 ? 163  ARG A CD  1 
ATOM   632  N NE  . ARG A 1 101 ? 37.092 85.849  11.161  1.00 38.86 ? 163  ARG A NE  1 
ATOM   633  C CZ  . ARG A 1 101 ? 36.695 86.558  12.221  1.00 39.23 ? 163  ARG A CZ  1 
ATOM   634  N NH1 . ARG A 1 101 ? 35.876 87.601  12.075  1.00 39.41 ? 163  ARG A NH1 1 
ATOM   635  N NH2 . ARG A 1 101 ? 37.121 86.221  13.438  1.00 38.90 ? 163  ARG A NH2 1 
ATOM   636  N N   . ILE A 1 102 ? 38.005 86.012  4.350   1.00 36.37 ? 164  ILE A N   1 
ATOM   637  C CA  . ILE A 1 102 ? 37.497 86.337  3.026   1.00 36.13 ? 164  ILE A CA  1 
ATOM   638  C C   . ILE A 1 102 ? 37.945 85.309  1.978   1.00 35.86 ? 164  ILE A C   1 
ATOM   639  O O   . ILE A 1 102 ? 37.179 84.980  1.065   1.00 36.06 ? 164  ILE A O   1 
ATOM   640  C CB  . ILE A 1 102 ? 37.890 87.782  2.632   1.00 36.32 ? 164  ILE A CB  1 
ATOM   641  C CG1 . ILE A 1 102 ? 37.127 88.772  3.528   1.00 36.42 ? 164  ILE A CG1 1 
ATOM   642  C CG2 . ILE A 1 102 ? 37.593 88.045  1.153   1.00 36.11 ? 164  ILE A CG2 1 
ATOM   643  C CD1 . ILE A 1 102 ? 37.995 89.829  4.165   1.00 37.02 ? 164  ILE A CD1 1 
ATOM   644  N N   . VAL A 1 103 ? 39.164 84.788  2.134   1.00 35.34 ? 165  VAL A N   1 
ATOM   645  C CA  . VAL A 1 103 ? 39.698 83.767  1.230   1.00 34.81 ? 165  VAL A CA  1 
ATOM   646  C C   . VAL A 1 103 ? 38.912 82.458  1.338   1.00 34.42 ? 165  VAL A C   1 
ATOM   647  O O   . VAL A 1 103 ? 38.652 81.806  0.327   1.00 34.32 ? 165  VAL A O   1 
ATOM   648  C CB  . VAL A 1 103 ? 41.197 83.506  1.493   1.00 34.67 ? 165  VAL A CB  1 
ATOM   649  C CG1 . VAL A 1 103 ? 41.705 82.373  0.619   1.00 34.31 ? 165  VAL A CG1 1 
ATOM   650  C CG2 . VAL A 1 103 ? 42.007 84.773  1.247   1.00 34.73 ? 165  VAL A CG2 1 
ATOM   651  N N   . ILE A 1 104 ? 38.536 82.081  2.559   1.00 34.07 ? 166  ILE A N   1 
ATOM   652  C CA  . ILE A 1 104 ? 37.696 80.897  2.784   1.00 33.83 ? 166  ILE A CA  1 
ATOM   653  C C   . ILE A 1 104 ? 36.286 81.121  2.236   1.00 33.55 ? 166  ILE A C   1 
ATOM   654  O O   . ILE A 1 104 ? 35.763 80.296  1.477   1.00 33.67 ? 166  ILE A O   1 
ATOM   655  C CB  . ILE A 1 104 ? 37.587 80.548  4.283   1.00 33.69 ? 166  ILE A CB  1 
ATOM   656  C CG1 . ILE A 1 104 ? 38.937 80.064  4.811   1.00 33.93 ? 166  ILE A CG1 1 
ATOM   657  C CG2 . ILE A 1 104 ? 36.517 79.495  4.499   1.00 33.84 ? 166  ILE A CG2 1 
ATOM   658  C CD1 . ILE A 1 104 ? 38.908 79.584  6.248   1.00 34.05 ? 166  ILE A CD1 1 
ATOM   659  N N   . GLN A 1 105 ? 35.682 82.242  2.624   1.00 33.06 ? 167  GLN A N   1 
ATOM   660  C CA  . GLN A 1 105 ? 34.326 82.583  2.193   1.00 32.61 ? 167  GLN A CA  1 
ATOM   661  C C   . GLN A 1 105 ? 34.224 82.753  0.680   1.00 32.00 ? 167  GLN A C   1 
ATOM   662  O O   . GLN A 1 105 ? 33.177 82.482  0.104   1.00 32.22 ? 167  GLN A O   1 
ATOM   663  C CB  . GLN A 1 105 ? 33.824 83.828  2.923   1.00 32.59 ? 167  GLN A CB  1 
ATOM   664  C CG  . GLN A 1 105 ? 33.576 83.577  4.412   1.00 33.10 ? 167  GLN A CG  1 
ATOM   665  C CD  . GLN A 1 105 ? 32.948 84.767  5.126   1.00 33.17 ? 167  GLN A CD  1 
ATOM   666  O OE1 . GLN A 1 105 ? 33.088 85.914  4.696   1.00 32.61 ? 167  GLN A OE1 1 
ATOM   667  N NE2 . GLN A 1 105 ? 32.261 84.494  6.239   1.00 34.28 ? 167  GLN A NE2 1 
ATOM   668  N N   . ALA A 1 106 ? 35.311 83.176  0.038   1.00 31.36 ? 168  ALA A N   1 
ATOM   669  C CA  . ALA A 1 106 ? 35.371 83.207  -1.426  1.00 30.73 ? 168  ALA A CA  1 
ATOM   670  C C   . ALA A 1 106 ? 35.387 81.792  -2.037  1.00 30.30 ? 168  ALA A C   1 
ATOM   671  O O   . ALA A 1 106 ? 35.166 81.643  -3.238  1.00 30.67 ? 168  ALA A O   1 
ATOM   672  C CB  . ALA A 1 106 ? 36.580 84.012  -1.898  1.00 30.65 ? 168  ALA A CB  1 
ATOM   673  N N   . GLY A 1 107 ? 35.658 80.766  -1.223  1.00 29.48 ? 169  GLY A N   1 
ATOM   674  C CA  . GLY A 1 107 ? 35.510 79.367  -1.644  1.00 28.80 ? 169  GLY A CA  1 
ATOM   675  C C   . GLY A 1 107 ? 36.748 78.804  -2.319  1.00 28.15 ? 169  GLY A C   1 
ATOM   676  O O   . GLY A 1 107 ? 36.650 77.971  -3.227  1.00 27.85 ? 169  GLY A O   1 
ATOM   677  N N   . ALA A 1 108 ? 37.911 79.250  -1.844  1.00 27.39 ? 170  ALA A N   1 
ATOM   678  C CA  . ALA A 1 108 ? 39.201 78.953  -2.456  1.00 27.04 ? 170  ALA A CA  1 
ATOM   679  C C   . ALA A 1 108 ? 39.822 77.661  -1.958  1.00 26.59 ? 170  ALA A C   1 
ATOM   680  O O   . ALA A 1 108 ? 40.681 77.102  -2.638  1.00 26.35 ? 170  ALA A O   1 
ATOM   681  C CB  . ALA A 1 108 ? 40.166 80.098  -2.210  1.00 27.13 ? 170  ALA A CB  1 
ATOM   682  N N   . VAL A 1 109 ? 39.411 77.204  -0.773  1.00 26.10 ? 171  VAL A N   1 
ATOM   683  C CA  . VAL A 1 109 ? 39.952 75.984  -0.192  1.00 25.73 ? 171  VAL A CA  1 
ATOM   684  C C   . VAL A 1 109 ? 39.649 74.766  -1.078  1.00 25.52 ? 171  VAL A C   1 
ATOM   685  O O   . VAL A 1 109 ? 40.583 74.133  -1.571  1.00 25.94 ? 171  VAL A O   1 
ATOM   686  C CB  . VAL A 1 109 ? 39.511 75.782  1.301   1.00 25.66 ? 171  VAL A CB  1 
ATOM   687  C CG1 . VAL A 1 109 ? 39.922 74.410  1.814   1.00 24.80 ? 171  VAL A CG1 1 
ATOM   688  C CG2 . VAL A 1 109 ? 40.107 76.869  2.181   1.00 24.74 ? 171  VAL A CG2 1 
ATOM   689  N N   . PRO A 1 110 ? 38.365 74.443  -1.311  1.00 25.18 ? 172  PRO A N   1 
ATOM   690  C CA  . PRO A 1 110 ? 38.070 73.324  -2.217  1.00 25.22 ? 172  PRO A CA  1 
ATOM   691  C C   . PRO A 1 110 ? 38.817 73.357  -3.568  1.00 25.15 ? 172  PRO A C   1 
ATOM   692  O O   . PRO A 1 110 ? 39.224 72.307  -4.066  1.00 25.42 ? 172  PRO A O   1 
ATOM   693  C CB  . PRO A 1 110 ? 36.562 73.450  -2.446  1.00 25.13 ? 172  PRO A CB  1 
ATOM   694  C CG  . PRO A 1 110 ? 36.053 74.119  -1.246  1.00 25.20 ? 172  PRO A CG  1 
ATOM   695  C CD  . PRO A 1 110 ? 37.133 75.047  -0.779  1.00 25.32 ? 172  PRO A CD  1 
ATOM   696  N N   . ILE A 1 111 ? 38.994 74.549  -4.139  1.00 25.08 ? 173  ILE A N   1 
ATOM   697  C CA  . ILE A 1 111 ? 39.702 74.728  -5.412  1.00 24.84 ? 173  ILE A CA  1 
ATOM   698  C C   . ILE A 1 111 ? 41.220 74.542  -5.304  1.00 24.70 ? 173  ILE A C   1 
ATOM   699  O O   . ILE A 1 111 ? 41.843 74.001  -6.218  1.00 24.83 ? 173  ILE A O   1 
ATOM   700  C CB  . ILE A 1 111 ? 39.386 76.101  -6.023  1.00 25.02 ? 173  ILE A CB  1 
ATOM   701  C CG1 . ILE A 1 111 ? 37.953 76.100  -6.566  1.00 24.87 ? 173  ILE A CG1 1 
ATOM   702  C CG2 . ILE A 1 111 ? 40.368 76.427  -7.137  1.00 25.32 ? 173  ILE A CG2 1 
ATOM   703  C CD1 . ILE A 1 111 ? 37.408 77.457  -6.831  1.00 25.17 ? 173  ILE A CD1 1 
ATOM   704  N N   . PHE A 1 112 ? 41.817 74.982  -4.197  1.00 24.40 ? 174  PHE A N   1 
ATOM   705  C CA  . PHE A 1 112 ? 43.239 74.717  -3.938  1.00 24.10 ? 174  PHE A CA  1 
ATOM   706  C C   . PHE A 1 112 ? 43.542 73.220  -3.813  1.00 23.87 ? 174  PHE A C   1 
ATOM   707  O O   . PHE A 1 112 ? 44.587 72.744  -4.273  1.00 23.32 ? 174  PHE A O   1 
ATOM   708  C CB  . PHE A 1 112 ? 43.713 75.431  -2.672  1.00 23.95 ? 174  PHE A CB  1 
ATOM   709  C CG  . PHE A 1 112 ? 44.123 76.864  -2.892  1.00 24.23 ? 174  PHE A CG  1 
ATOM   710  C CD1 . PHE A 1 112 ? 45.052 77.197  -3.874  1.00 23.85 ? 174  PHE A CD1 1 
ATOM   711  C CD2 . PHE A 1 112 ? 43.613 77.878  -2.086  1.00 23.76 ? 174  PHE A CD2 1 
ATOM   712  C CE1 . PHE A 1 112 ? 45.440 78.508  -4.068  1.00 23.41 ? 174  PHE A CE1 1 
ATOM   713  C CE2 . PHE A 1 112 ? 44.002 79.192  -2.275  1.00 23.83 ? 174  PHE A CE2 1 
ATOM   714  C CZ  . PHE A 1 112 ? 44.915 79.507  -3.265  1.00 23.47 ? 174  PHE A CZ  1 
ATOM   715  N N   . ILE A 1 113 ? 42.622 72.488  -3.193  1.00 23.88 ? 175  ILE A N   1 
ATOM   716  C CA  . ILE A 1 113 ? 42.750 71.037  -3.053  1.00 24.06 ? 175  ILE A CA  1 
ATOM   717  C C   . ILE A 1 113 ? 42.655 70.339  -4.422  1.00 24.48 ? 175  ILE A C   1 
ATOM   718  O O   . ILE A 1 113 ? 43.327 69.332  -4.648  1.00 24.61 ? 175  ILE A O   1 
ATOM   719  C CB  . ILE A 1 113 ? 41.705 70.486  -2.059  1.00 23.74 ? 175  ILE A CB  1 
ATOM   720  C CG1 . ILE A 1 113 ? 42.054 70.960  -0.643  1.00 22.99 ? 175  ILE A CG1 1 
ATOM   721  C CG2 . ILE A 1 113 ? 41.622 68.965  -2.137  1.00 23.65 ? 175  ILE A CG2 1 
ATOM   722  C CD1 . ILE A 1 113 ? 40.968 70.721  0.387   1.00 23.02 ? 175  ILE A CD1 1 
ATOM   723  N N   . GLU A 1 114 ? 41.837 70.875  -5.331  1.00 25.00 ? 176  GLU A N   1 
ATOM   724  C CA  . GLU A 1 114 ? 41.848 70.420  -6.724  1.00 25.34 ? 176  GLU A CA  1 
ATOM   725  C C   . GLU A 1 114 ? 43.211 70.677  -7.373  1.00 25.05 ? 176  GLU A C   1 
ATOM   726  O O   . GLU A 1 114 ? 43.713 69.842  -8.124  1.00 25.12 ? 176  GLU A O   1 
ATOM   727  C CB  . GLU A 1 114 ? 40.774 71.124  -7.555  1.00 25.66 ? 176  GLU A CB  1 
ATOM   728  C CG  . GLU A 1 114 ? 39.340 70.797  -7.180  1.00 26.88 ? 176  GLU A CG  1 
ATOM   729  C CD  . GLU A 1 114 ? 38.337 71.532  -8.054  1.00 27.56 ? 176  GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 114 ? 38.453 71.469  -9.303  1.00 30.82 ? 176  GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 114 ? 37.429 72.186  -7.491  1.00 32.13 ? 176  GLU A OE2 1 
ATOM   732  N N   . LEU A 1 115 ? 43.799 71.837  -7.091  1.00 24.82 ? 177  LEU A N   1 
ATOM   733  C CA  . LEU A 1 115 ? 45.094 72.202  -7.674  1.00 24.86 ? 177  LEU A CA  1 
ATOM   734  C C   . LEU A 1 115 ? 46.266 71.376  -7.150  1.00 24.98 ? 177  LEU A C   1 
ATOM   735  O O   . LEU A 1 115 ? 47.341 71.390  -7.756  1.00 24.97 ? 177  LEU A O   1 
ATOM   736  C CB  . LEU A 1 115 ? 45.384 73.692  -7.468  1.00 24.84 ? 177  LEU A CB  1 
ATOM   737  C CG  . LEU A 1 115 ? 44.557 74.681  -8.289  1.00 24.41 ? 177  LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 115 ? 45.085 76.085  -8.073  1.00 23.83 ? 177  LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 115 ? 44.591 74.314  -9.761  1.00 24.30 ? 177  LEU A CD2 1 
ATOM   740  N N   . LEU A 1 116 ? 46.070 70.666  -6.036  1.00 24.98 ? 178  LEU A N   1 
ATOM   741  C CA  . LEU A 1 116 ? 47.043 69.676  -5.580  1.00 25.17 ? 178  LEU A CA  1 
ATOM   742  C C   . LEU A 1 116 ? 47.238 68.559  -6.609  1.00 25.42 ? 178  LEU A C   1 
ATOM   743  O O   . LEU A 1 116 ? 48.272 67.892  -6.603  1.00 25.48 ? 178  LEU A O   1 
ATOM   744  C CB  . LEU A 1 116 ? 46.622 69.071  -4.240  1.00 24.92 ? 178  LEU A CB  1 
ATOM   745  C CG  . LEU A 1 116 ? 46.673 69.971  -3.000  1.00 24.71 ? 178  LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 116 ? 46.212 69.205  -1.763  1.00 22.17 ? 178  LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 116 ? 48.075 70.510  -2.796  1.00 25.11 ? 178  LEU A CD2 1 
ATOM   748  N N   . SER A 1 117 ? 46.234 68.355  -7.470  1.00 25.88 ? 179  SER A N   1 
ATOM   749  C CA  . SER A 1 117 ? 46.304 67.422  -8.604  1.00 26.17 ? 179  SER A CA  1 
ATOM   750  C C   . SER A 1 117 ? 46.419 68.151  -9.944  1.00 26.24 ? 179  SER A C   1 
ATOM   751  O O   . SER A 1 117 ? 45.945 67.658  -10.965 1.00 26.57 ? 179  SER A O   1 
ATOM   752  C CB  . SER A 1 117 ? 45.058 66.523  -8.618  1.00 26.31 ? 179  SER A CB  1 
ATOM   753  O OG  . SER A 1 117 ? 44.942 65.811  -7.388  1.00 27.53 ? 179  SER A OG  1 
ATOM   754  N N   . SER A 1 118 ? 47.044 69.325  -9.936  1.00 26.44 ? 180  SER A N   1 
ATOM   755  C CA  . SER A 1 118 ? 47.327 70.070  -11.167 1.00 26.58 ? 180  SER A CA  1 
ATOM   756  C C   . SER A 1 118 ? 48.504 69.457  -11.914 1.00 26.86 ? 180  SER A C   1 
ATOM   757  O O   . SER A 1 118 ? 49.335 68.747  -11.325 1.00 26.60 ? 180  SER A O   1 
ATOM   758  C CB  . SER A 1 118 ? 47.647 71.534  -10.852 1.00 26.64 ? 180  SER A CB  1 
ATOM   759  O OG  . SER A 1 118 ? 48.201 72.187  -11.974 1.00 26.48 ? 180  SER A OG  1 
ATOM   760  N N   . GLU A 1 119 ? 48.569 69.748  -13.212 1.00 26.89 ? 181  GLU A N   1 
ATOM   761  C CA  . GLU A 1 119 ? 49.628 69.240  -14.081 1.00 27.27 ? 181  GLU A CA  1 
ATOM   762  C C   . GLU A 1 119 ? 50.911 70.092  -14.029 1.00 27.14 ? 181  GLU A C   1 
ATOM   763  O O   . GLU A 1 119 ? 51.948 69.687  -14.550 1.00 27.26 ? 181  GLU A O   1 
ATOM   764  C CB  . GLU A 1 119 ? 49.105 69.115  -15.529 1.00 27.43 ? 181  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 119 ? 47.933 68.120  -15.663 1.00 28.17 ? 181  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 119 ? 47.752 67.565  -17.079 1.00 28.30 ? 181  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 119 ? 48.087 66.377  -17.305 1.00 29.90 ? 181  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 119 ? 47.277 68.314  -17.964 1.00 29.29 ? 181  GLU A OE2 1 
ATOM   769  N N   . PHE A 1 120 ? 50.837 71.263  -13.399 1.00 27.20 ? 182  PHE A N   1 
ATOM   770  C CA  . PHE A 1 120 ? 51.993 72.153  -13.245 1.00 27.29 ? 182  PHE A CA  1 
ATOM   771  C C   . PHE A 1 120 ? 52.520 72.105  -11.796 1.00 27.21 ? 182  PHE A C   1 
ATOM   772  O O   . PHE A 1 120 ? 51.745 72.263  -10.856 1.00 26.63 ? 182  PHE A O   1 
ATOM   773  C CB  . PHE A 1 120 ? 51.599 73.589  -13.612 1.00 27.31 ? 182  PHE A CB  1 
ATOM   774  C CG  . PHE A 1 120 ? 50.719 73.687  -14.837 1.00 27.32 ? 182  PHE A CG  1 
ATOM   775  C CD1 . PHE A 1 120 ? 49.431 74.204  -14.745 1.00 27.03 ? 182  PHE A CD1 1 
ATOM   776  C CD2 . PHE A 1 120 ? 51.177 73.245  -16.074 1.00 27.29 ? 182  PHE A CD2 1 
ATOM   777  C CE1 . PHE A 1 120 ? 48.619 74.294  -15.860 1.00 27.33 ? 182  PHE A CE1 1 
ATOM   778  C CE2 . PHE A 1 120 ? 50.372 73.334  -17.210 1.00 27.91 ? 182  PHE A CE2 1 
ATOM   779  C CZ  . PHE A 1 120 ? 49.089 73.859  -17.102 1.00 27.77 ? 182  PHE A CZ  1 
ATOM   780  N N   . GLU A 1 121 ? 53.833 71.899  -11.639 1.00 27.40 ? 183  GLU A N   1 
ATOM   781  C CA  . GLU A 1 121 ? 54.480 71.804  -10.315 1.00 27.66 ? 183  GLU A CA  1 
ATOM   782  C C   . GLU A 1 121 ? 54.313 73.103  -9.538  1.00 27.33 ? 183  GLU A C   1 
ATOM   783  O O   . GLU A 1 121 ? 53.920 73.085  -8.376  1.00 27.85 ? 183  GLU A O   1 
ATOM   784  C CB  . GLU A 1 121 ? 55.991 71.536  -10.425 1.00 27.98 ? 183  GLU A CB  1 
ATOM   785  C CG  . GLU A 1 121 ? 56.436 70.336  -11.269 1.00 29.13 ? 183  GLU A CG  1 
ATOM   786  C CD  . GLU A 1 121 ? 57.899 70.464  -11.732 1.00 29.35 ? 183  GLU A CD  1 
ATOM   787  O OE1 . GLU A 1 121 ? 58.834 70.175  -10.934 1.00 32.10 ? 183  GLU A OE1 1 
ATOM   788  O OE2 . GLU A 1 121 ? 58.107 70.861  -12.899 1.00 31.63 ? 183  GLU A OE2 1 
ATOM   789  N N   . ASP A 1 122 ? 54.644 74.222  -10.185 1.00 26.90 ? 184  ASP A N   1 
ATOM   790  C CA  . ASP A 1 122 ? 54.530 75.553  -9.583  1.00 26.50 ? 184  ASP A CA  1 
ATOM   791  C C   . ASP A 1 122 ? 53.155 75.772  -8.947  1.00 25.98 ? 184  ASP A C   1 
ATOM   792  O O   . ASP A 1 122 ? 53.049 76.331  -7.856  1.00 25.72 ? 184  ASP A O   1 
ATOM   793  C CB  . ASP A 1 122 ? 54.775 76.645  -10.640 1.00 26.58 ? 184  ASP A CB  1 
ATOM   794  C CG  . ASP A 1 122 ? 56.234 76.738  -11.086 1.00 26.93 ? 184  ASP A CG  1 
ATOM   795  O OD1 . ASP A 1 122 ? 57.104 76.071  -10.494 1.00 27.41 ? 184  ASP A OD1 1 
ATOM   796  O OD2 . ASP A 1 122 ? 56.512 77.496  -12.041 1.00 27.04 ? 184  ASP A OD2 1 
ATOM   797  N N   . VAL A 1 123 ? 52.108 75.335  -9.644  1.00 25.61 ? 185  VAL A N   1 
ATOM   798  C CA  . VAL A 1 123 ? 50.737 75.514  -9.167  1.00 25.43 ? 185  VAL A CA  1 
ATOM   799  C C   . VAL A 1 123 ? 50.445 74.589  -7.979  1.00 25.13 ? 185  VAL A C   1 
ATOM   800  O O   . VAL A 1 123 ? 49.897 75.034  -6.969  1.00 24.96 ? 185  VAL A O   1 
ATOM   801  C CB  . VAL A 1 123 ? 49.706 75.291  -10.301 1.00 25.15 ? 185  VAL A CB  1 
ATOM   802  C CG1 . VAL A 1 123 ? 48.287 75.466  -9.786  1.00 24.80 ? 185  VAL A CG1 1 
ATOM   803  C CG2 . VAL A 1 123 ? 49.968 76.252  -11.440 1.00 24.71 ? 185  VAL A CG2 1 
ATOM   804  N N   . GLN A 1 124 ? 50.811 73.313  -8.119  1.00 24.99 ? 186  GLN A N   1 
ATOM   805  C CA  . GLN A 1 124 ? 50.672 72.308  -7.053  1.00 25.02 ? 186  GLN A CA  1 
ATOM   806  C C   . GLN A 1 124 ? 51.281 72.805  -5.752  1.00 24.50 ? 186  GLN A C   1 
ATOM   807  O O   . GLN A 1 124 ? 50.678 72.699  -4.689  1.00 24.26 ? 186  GLN A O   1 
ATOM   808  C CB  . GLN A 1 124 ? 51.383 70.995  -7.437  1.00 25.04 ? 186  GLN A CB  1 
ATOM   809  C CG  . GLN A 1 124 ? 50.629 70.075  -8.393  1.00 25.36 ? 186  GLN A CG  1 
ATOM   810  C CD  . GLN A 1 124 ? 51.296 68.711  -8.516  1.00 26.30 ? 186  GLN A CD  1 
ATOM   811  O OE1 . GLN A 1 124 ? 52.498 68.622  -8.766  1.00 28.98 ? 186  GLN A OE1 1 
ATOM   812  N NE2 . GLN A 1 124 ? 50.525 67.642  -8.313  1.00 27.87 ? 186  GLN A NE2 1 
ATOM   813  N N   . GLU A 1 125 ? 52.487 73.348  -5.873  1.00 24.30 ? 187  GLU A N   1 
ATOM   814  C CA  . GLU A 1 125 ? 53.299 73.752  -4.737  1.00 24.18 ? 187  GLU A CA  1 
ATOM   815  C C   . GLU A 1 125 ? 52.802 75.022  -4.049  1.00 23.48 ? 187  GLU A C   1 
ATOM   816  O O   . GLU A 1 125 ? 52.942 75.153  -2.852  1.00 23.13 ? 187  GLU A O   1 
ATOM   817  C CB  . GLU A 1 125 ? 54.746 73.930  -5.201  1.00 24.08 ? 187  GLU A CB  1 
ATOM   818  C CG  . GLU A 1 125 ? 55.718 74.313  -4.103  1.00 24.74 ? 187  GLU A CG  1 
ATOM   819  C CD  . GLU A 1 125 ? 57.182 74.205  -4.523  1.00 25.81 ? 187  GLU A CD  1 
ATOM   820  O OE1 . GLU A 1 125 ? 57.476 73.653  -5.610  1.00 28.64 ? 187  GLU A OE1 1 
ATOM   821  O OE2 . GLU A 1 125 ? 58.050 74.673  -3.757  1.00 27.46 ? 187  GLU A OE2 1 
ATOM   822  N N   . GLN A 1 126 ? 52.245 75.970  -4.800  1.00 23.26 ? 188  GLN A N   1 
ATOM   823  C CA  . GLN A 1 126 ? 51.727 77.202  -4.189  1.00 23.05 ? 188  GLN A CA  1 
ATOM   824  C C   . GLN A 1 126 ? 50.335 76.984  -3.628  1.00 22.67 ? 188  GLN A C   1 
ATOM   825  O O   . GLN A 1 126 ? 49.891 77.722  -2.749  1.00 22.19 ? 188  GLN A O   1 
ATOM   826  C CB  . GLN A 1 126 ? 51.712 78.360  -5.181  1.00 22.85 ? 188  GLN A CB  1 
ATOM   827  C CG  . GLN A 1 126 ? 51.490 79.717  -4.530  1.00 22.75 ? 188  GLN A CG  1 
ATOM   828  C CD  . GLN A 1 126 ? 52.625 80.117  -3.613  1.00 21.73 ? 188  GLN A CD  1 
ATOM   829  O OE1 . GLN A 1 126 ? 53.782 80.105  -4.016  1.00 21.64 ? 188  GLN A OE1 1 
ATOM   830  N NE2 . GLN A 1 126 ? 52.299 80.483  -2.378  1.00 21.82 ? 188  GLN A NE2 1 
ATOM   831  N N   . ALA A 1 127 ? 49.650 75.970  -4.143  1.00 22.70 ? 189  ALA A N   1 
ATOM   832  C CA  . ALA A 1 127 ? 48.374 75.547  -3.583  1.00 22.96 ? 189  ALA A CA  1 
ATOM   833  C C   . ALA A 1 127 ? 48.571 75.002  -2.170  1.00 23.04 ? 189  ALA A C   1 
ATOM   834  O O   . ALA A 1 127 ? 47.791 75.330  -1.281  1.00 22.90 ? 189  ALA A O   1 
ATOM   835  C CB  . ALA A 1 127 ? 47.706 74.510  -4.479  1.00 22.62 ? 189  ALA A CB  1 
ATOM   836  N N   . VAL A 1 128 ? 49.609 74.176  -1.985  1.00 23.47 ? 190  VAL A N   1 
ATOM   837  C CA  . VAL A 1 128 ? 49.977 73.594  -0.674  1.00 23.80 ? 190  VAL A CA  1 
ATOM   838  C C   . VAL A 1 128 ? 50.304 74.649  0.379   1.00 24.06 ? 190  VAL A C   1 
ATOM   839  O O   . VAL A 1 128 ? 49.824 74.588  1.509   1.00 23.99 ? 190  VAL A O   1 
ATOM   840  C CB  . VAL A 1 128 ? 51.217 72.649  -0.798  1.00 24.22 ? 190  VAL A CB  1 
ATOM   841  C CG1 . VAL A 1 128 ? 52.132 72.803  0.387   1.00 23.72 ? 190  VAL A CG1 1 
ATOM   842  C CG2 . VAL A 1 128 ? 50.784 71.182  -0.942  1.00 24.92 ? 190  VAL A CG2 1 
ATOM   843  N N   . TRP A 1 129 ? 51.116 75.626  -0.033  1.00 24.55 ? 191  TRP A N   1 
ATOM   844  C CA  . TRP A 1 129 ? 51.496 76.781  0.782   1.00 23.78 ? 191  TRP A CA  1 
ATOM   845  C C   . TRP A 1 129 ? 50.258 77.588  1.164   1.00 23.45 ? 191  TRP A C   1 
ATOM   846  O O   . TRP A 1 129 ? 50.099 77.993  2.311   1.00 23.09 ? 191  TRP A O   1 
ATOM   847  C CB  . TRP A 1 129 ? 52.479 77.632  -0.026  1.00 24.00 ? 191  TRP A CB  1 
ATOM   848  C CG  . TRP A 1 129 ? 53.220 78.730  0.714   1.00 24.43 ? 191  TRP A CG  1 
ATOM   849  C CD1 . TRP A 1 129 ? 52.809 79.422  1.821   1.00 24.14 ? 191  TRP A CD1 1 
ATOM   850  C CD2 . TRP A 1 129 ? 54.481 79.299  0.335   1.00 24.16 ? 191  TRP A CD2 1 
ATOM   851  N NE1 . TRP A 1 129 ? 53.749 80.362  2.163   1.00 24.40 ? 191  TRP A NE1 1 
ATOM   852  C CE2 . TRP A 1 129 ? 54.782 80.310  1.267   1.00 24.28 ? 191  TRP A CE2 1 
ATOM   853  C CE3 . TRP A 1 129 ? 55.393 79.035  -0.691  1.00 24.18 ? 191  TRP A CE3 1 
ATOM   854  C CZ2 . TRP A 1 129 ? 55.953 81.062  1.201   1.00 24.49 ? 191  TRP A CZ2 1 
ATOM   855  C CZ3 . TRP A 1 129 ? 56.556 79.779  -0.756  1.00 24.25 ? 191  TRP A CZ3 1 
ATOM   856  C CH2 . TRP A 1 129 ? 56.825 80.785  0.181   1.00 24.35 ? 191  TRP A CH2 1 
ATOM   857  N N   . ALA A 1 130 ? 49.371 77.820  0.204   1.00 23.40 ? 192  ALA A N   1 
ATOM   858  C CA  . ALA A 1 130 ? 48.146 78.571  0.483   1.00 23.17 ? 192  ALA A CA  1 
ATOM   859  C C   . ALA A 1 130 ? 47.355 77.868  1.586   1.00 22.94 ? 192  ALA A C   1 
ATOM   860  O O   . ALA A 1 130 ? 46.983 78.486  2.589   1.00 22.73 ? 192  ALA A O   1 
ATOM   861  C CB  . ALA A 1 130 ? 47.303 78.716  -0.773  1.00 23.16 ? 192  ALA A CB  1 
ATOM   862  N N   . LEU A 1 131 ? 47.127 76.573  1.387   1.00 22.45 ? 193  LEU A N   1 
ATOM   863  C CA  . LEU A 1 131 ? 46.350 75.746  2.307   1.00 22.74 ? 193  LEU A CA  1 
ATOM   864  C C   . LEU A 1 131 ? 47.026 75.584  3.671   1.00 22.78 ? 193  LEU A C   1 
ATOM   865  O O   . LEU A 1 131 ? 46.350 75.427  4.682   1.00 22.10 ? 193  LEU A O   1 
ATOM   866  C CB  . LEU A 1 131 ? 46.134 74.356  1.695   1.00 22.56 ? 193  LEU A CB  1 
ATOM   867  C CG  . LEU A 1 131 ? 45.211 74.277  0.478   1.00 21.81 ? 193  LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 131 ? 45.626 73.099  -0.394  1.00 20.67 ? 193  LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 131 ? 43.740 74.179  0.909   1.00 18.62 ? 193  LEU A CD2 1 
ATOM   870  N N   . GLY A 1 132 ? 48.359 75.565  3.674   1.00 23.22 ? 194  GLY A N   1 
ATOM   871  C CA  . GLY A 1 132 ? 49.140 75.593  4.912   1.00 23.32 ? 194  GLY A CA  1 
ATOM   872  C C   . GLY A 1 132 ? 48.834 76.833  5.733   1.00 23.42 ? 194  GLY A C   1 
ATOM   873  O O   . GLY A 1 132 ? 48.671 76.757  6.949   1.00 23.33 ? 194  GLY A O   1 
ATOM   874  N N   . ASN A 1 133 ? 48.741 77.974  5.053   1.00 23.65 ? 195  ASN A N   1 
ATOM   875  C CA  . ASN A 1 133 ? 48.394 79.234  5.701   1.00 23.92 ? 195  ASN A CA  1 
ATOM   876  C C   . ASN A 1 133 ? 46.964 79.217  6.225   1.00 24.29 ? 195  ASN A C   1 
ATOM   877  O O   . ASN A 1 133 ? 46.725 79.591  7.373   1.00 24.54 ? 195  ASN A O   1 
ATOM   878  C CB  . ASN A 1 133 ? 48.613 80.430  4.756   1.00 23.66 ? 195  ASN A CB  1 
ATOM   879  C CG  . ASN A 1 133 ? 50.079 80.866  4.675   1.00 23.42 ? 195  ASN A CG  1 
ATOM   880  O OD1 . ASN A 1 133 ? 50.938 80.354  5.389   1.00 22.18 ? 195  ASN A OD1 1 
ATOM   881  N ND2 . ASN A 1 133 ? 50.359 81.833  3.814   1.00 23.31 ? 195  ASN A ND2 1 
ATOM   882  N N   . ILE A 1 134 ? 46.023 78.756  5.408   1.00 24.61 ? 196  ILE A N   1 
ATOM   883  C CA  . ILE A 1 134 ? 44.630 78.667  5.837   1.00 25.14 ? 196  ILE A CA  1 
ATOM   884  C C   . ILE A 1 134 ? 44.500 77.666  6.995   1.00 25.58 ? 196  ILE A C   1 
ATOM   885  O O   . ILE A 1 134 ? 43.829 77.940  7.975   1.00 25.92 ? 196  ILE A O   1 
ATOM   886  C CB  . ILE A 1 134 ? 43.681 78.291  4.673   1.00 25.25 ? 196  ILE A CB  1 
ATOM   887  C CG1 . ILE A 1 134 ? 43.740 79.334  3.551   1.00 25.33 ? 196  ILE A CG1 1 
ATOM   888  C CG2 . ILE A 1 134 ? 42.254 78.180  5.157   1.00 24.86 ? 196  ILE A CG2 1 
ATOM   889  C CD1 . ILE A 1 134 ? 43.062 78.903  2.258   1.00 25.11 ? 196  ILE A CD1 1 
ATOM   890  N N   . ALA A 1 135 ? 45.172 76.523  6.915   1.00 26.30 ? 197  ALA A N   1 
ATOM   891  C CA  . ALA A 1 135 ? 45.176 75.562  8.037   1.00 26.57 ? 197  ALA A CA  1 
ATOM   892  C C   . ALA A 1 135 ? 45.796 76.166  9.310   1.00 27.10 ? 197  ALA A C   1 
ATOM   893  O O   . ALA A 1 135 ? 45.399 75.832  10.432  1.00 26.97 ? 197  ALA A O   1 
ATOM   894  C CB  . ALA A 1 135 ? 45.900 74.280  7.651   1.00 26.35 ? 197  ALA A CB  1 
ATOM   895  N N   . GLY A 1 136 ? 46.750 77.075  9.123   1.00 27.62 ? 198  GLY A N   1 
ATOM   896  C CA  . GLY A 1 136 ? 47.469 77.691  10.232  1.00 28.01 ? 198  GLY A CA  1 
ATOM   897  C C   . GLY A 1 136 ? 46.768 78.845  10.909  1.00 28.48 ? 198  GLY A C   1 
ATOM   898  O O   . GLY A 1 136 ? 47.252 79.358  11.913  1.00 28.73 ? 198  GLY A O   1 
ATOM   899  N N   . ASP A 1 137 ? 45.631 79.278  10.372  1.00 29.33 ? 199  ASP A N   1 
ATOM   900  C CA  . ASP A 1 137 ? 44.944 80.426  10.942  1.00 29.19 ? 199  ASP A CA  1 
ATOM   901  C C   . ASP A 1 137 ? 44.314 80.120  12.296  1.00 29.41 ? 199  ASP A C   1 
ATOM   902  O O   . ASP A 1 137 ? 44.383 80.942  13.203  1.00 30.31 ? 199  ASP A O   1 
ATOM   903  C CB  . ASP A 1 137 ? 43.875 80.976  10.002  1.00 29.55 ? 199  ASP A CB  1 
ATOM   904  C CG  . ASP A 1 137 ? 43.294 82.287  10.510  1.00 30.08 ? 199  ASP A CG  1 
ATOM   905  O OD1 . ASP A 1 137 ? 44.078 83.130  11.018  1.00 31.62 ? 199  ASP A OD1 1 
ATOM   906  O OD2 . ASP A 1 137 ? 42.059 82.466  10.429  1.00 33.04 ? 199  ASP A OD2 1 
ATOM   907  N N   . SER A 1 138 ? 43.684 78.959  12.430  1.00 29.19 ? 200  SER A N   1 
ATOM   908  C CA  . SER A 1 138 ? 43.070 78.579  13.698  1.00 28.98 ? 200  SER A CA  1 
ATOM   909  C C   . SER A 1 138 ? 42.663 77.111  13.708  1.00 28.93 ? 200  SER A C   1 
ATOM   910  O O   . SER A 1 138 ? 42.810 76.403  12.710  1.00 28.94 ? 200  SER A O   1 
ATOM   911  C CB  . SER A 1 138 ? 41.837 79.447  13.977  1.00 28.51 ? 200  SER A CB  1 
ATOM   912  O OG  . SER A 1 138 ? 40.803 79.140  13.067  1.00 28.23 ? 200  SER A OG  1 
ATOM   913  N N   . THR A 1 139 ? 42.168 76.680  14.864  1.00 28.83 ? 201  THR A N   1 
ATOM   914  C CA  . THR A 1 139 ? 41.501 75.389  15.049  1.00 29.16 ? 201  THR A CA  1 
ATOM   915  C C   . THR A 1 139 ? 40.354 75.128  14.052  1.00 28.96 ? 201  THR A C   1 
ATOM   916  O O   . THR A 1 139 ? 40.228 74.038  13.498  1.00 28.36 ? 201  THR A O   1 
ATOM   917  C CB  . THR A 1 139 ? 40.978 75.277  16.529  1.00 29.02 ? 201  THR A CB  1 
ATOM   918  O OG1 . THR A 1 139 ? 41.809 74.358  17.246  1.00 30.34 ? 201  THR A OG1 1 
ATOM   919  C CG2 . THR A 1 139 ? 39.513 74.819  16.604  1.00 28.71 ? 201  THR A CG2 1 
ATOM   920  N N   . MET A 1 140 ? 39.529 76.137  13.821  1.00 29.48 ? 202  MET A N   1 
ATOM   921  C CA  . MET A 1 140 ? 38.333 75.973  12.979  1.00 29.96 ? 202  MET A CA  1 
ATOM   922  C C   . MET A 1 140 ? 38.677 75.935  11.493  1.00 29.63 ? 202  MET A C   1 
ATOM   923  O O   . MET A 1 140 ? 38.021 75.240  10.724  1.00 29.38 ? 202  MET A O   1 
ATOM   924  C CB  . MET A 1 140 ? 37.316 77.087  13.253  1.00 30.49 ? 202  MET A CB  1 
ATOM   925  C CG  . MET A 1 140 ? 37.033 77.330  14.739  1.00 32.43 ? 202  MET A CG  1 
ATOM   926  S SD  . MET A 1 140 ? 38.132 78.573  15.479  1.00 36.48 ? 202  MET A SD  1 
ATOM   927  C CE  . MET A 1 140 ? 37.304 80.091  14.967  1.00 35.57 ? 202  MET A CE  1 
ATOM   928  N N   . CYS A 1 141 ? 39.698 76.690  11.098  1.00 29.68 ? 203  CYS A N   1 
ATOM   929  C CA  . CYS A 1 141 ? 40.172 76.687  9.710   1.00 29.84 ? 203  CYS A CA  1 
ATOM   930  C C   . CYS A 1 141 ? 40.932 75.407  9.386   1.00 29.52 ? 203  CYS A C   1 
ATOM   931  O O   . CYS A 1 141 ? 40.849 74.905  8.275   1.00 29.83 ? 203  CYS A O   1 
ATOM   932  C CB  . CYS A 1 141 ? 41.069 77.896  9.436   1.00 29.90 ? 203  CYS A CB  1 
ATOM   933  S SG  . CYS A 1 141 ? 40.226 79.489  9.563   1.00 31.23 ? 203  CYS A SG  1 
ATOM   934  N N   . ARG A 1 142 ? 41.670 74.898  10.369  1.00 29.43 ? 204  ARG A N   1 
ATOM   935  C CA  . ARG A 1 142 ? 42.409 73.636  10.260  1.00 29.03 ? 204  ARG A CA  1 
ATOM   936  C C   . ARG A 1 142 ? 41.464 72.478  9.982   1.00 28.77 ? 204  ARG A C   1 
ATOM   937  O O   . ARG A 1 142 ? 41.722 71.653  9.103   1.00 28.59 ? 204  ARG A O   1 
ATOM   938  C CB  . ARG A 1 142 ? 43.179 73.385  11.556  1.00 28.89 ? 204  ARG A CB  1 
ATOM   939  C CG  . ARG A 1 142 ? 44.007 72.079  11.626  1.00 29.10 ? 204  ARG A CG  1 
ATOM   940  C CD  . ARG A 1 142 ? 44.183 71.633  13.090  1.00 29.12 ? 204  ARG A CD  1 
ATOM   941  N NE  . ARG A 1 142 ? 42.888 71.445  13.748  1.00 29.62 ? 204  ARG A NE  1 
ATOM   942  C CZ  . ARG A 1 142 ? 42.691 71.370  15.060  1.00 29.63 ? 204  ARG A CZ  1 
ATOM   943  N NH1 . ARG A 1 142 ? 43.708 71.450  15.904  1.00 29.81 ? 204  ARG A NH1 1 
ATOM   944  N NH2 . ARG A 1 142 ? 41.463 71.203  15.529  1.00 29.91 ? 204  ARG A NH2 1 
ATOM   945  N N   . ASP A 1 143 ? 40.368 72.425  10.734  1.00 28.51 ? 205  ASP A N   1 
ATOM   946  C CA  . ASP A 1 143 ? 39.409 71.332  10.609  1.00 28.40 ? 205  ASP A CA  1 
ATOM   947  C C   . ASP A 1 143 ? 38.617 71.376  9.302   1.00 27.74 ? 205  ASP A C   1 
ATOM   948  O O   . ASP A 1 143 ? 38.414 70.335  8.686   1.00 27.61 ? 205  ASP A O   1 
ATOM   949  C CB  . ASP A 1 143 ? 38.457 71.293  11.809  1.00 28.63 ? 205  ASP A CB  1 
ATOM   950  C CG  . ASP A 1 143 ? 39.083 70.651  13.040  1.00 30.96 ? 205  ASP A CG  1 
ATOM   951  O OD1 . ASP A 1 143 ? 40.035 69.833  12.920  1.00 33.77 ? 205  ASP A OD1 1 
ATOM   952  O OD2 . ASP A 1 143 ? 38.608 70.975  14.154  1.00 35.03 ? 205  ASP A OD2 1 
ATOM   953  N N   . TYR A 1 144 ? 38.178 72.569  8.897   1.00 27.11 ? 206  TYR A N   1 
ATOM   954  C CA  . TYR A 1 144 ? 37.506 72.779  7.605   1.00 26.85 ? 206  TYR A CA  1 
ATOM   955  C C   . TYR A 1 144 ? 38.361 72.252  6.458   1.00 26.41 ? 206  TYR A C   1 
ATOM   956  O O   . TYR A 1 144 ? 37.874 71.513  5.600   1.00 26.12 ? 206  TYR A O   1 
ATOM   957  C CB  . TYR A 1 144 ? 37.198 74.277  7.393   1.00 26.61 ? 206  TYR A CB  1 
ATOM   958  C CG  . TYR A 1 144 ? 36.623 74.665  6.028   1.00 26.79 ? 206  TYR A CG  1 
ATOM   959  C CD1 . TYR A 1 144 ? 35.315 74.313  5.664   1.00 26.30 ? 206  TYR A CD1 1 
ATOM   960  C CD2 . TYR A 1 144 ? 37.370 75.424  5.122   1.00 26.50 ? 206  TYR A CD2 1 
ATOM   961  C CE1 . TYR A 1 144 ? 34.788 74.665  4.426   1.00 26.19 ? 206  TYR A CE1 1 
ATOM   962  C CE2 . TYR A 1 144 ? 36.842 75.794  3.872   1.00 25.99 ? 206  TYR A CE2 1 
ATOM   963  C CZ  . TYR A 1 144 ? 35.547 75.415  3.526   1.00 26.83 ? 206  TYR A CZ  1 
ATOM   964  O OH  . TYR A 1 144 ? 35.005 75.787  2.286   1.00 25.65 ? 206  TYR A OH  1 
ATOM   965  N N   . VAL A 1 145 ? 39.639 72.620  6.460   1.00 26.10 ? 207  VAL A N   1 
ATOM   966  C CA  . VAL A 1 145 ? 40.563 72.152  5.436   1.00 25.95 ? 207  VAL A CA  1 
ATOM   967  C C   . VAL A 1 145 ? 40.616 70.615  5.466   1.00 25.88 ? 207  VAL A C   1 
ATOM   968  O O   . VAL A 1 145 ? 40.541 69.979  4.415   1.00 25.86 ? 207  VAL A O   1 
ATOM   969  C CB  . VAL A 1 145 ? 41.961 72.823  5.574   1.00 25.90 ? 207  VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 145 ? 42.965 72.214  4.608   1.00 26.30 ? 207  VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 145 ? 41.857 74.330  5.322   1.00 24.93 ? 207  VAL A CG2 1 
ATOM   972  N N   . LEU A 1 146 ? 40.686 70.024  6.661   1.00 25.80 ? 208  LEU A N   1 
ATOM   973  C CA  . LEU A 1 146 ? 40.648 68.558  6.808   1.00 25.82 ? 208  LEU A CA  1 
ATOM   974  C C   . LEU A 1 146 ? 39.327 67.982  6.316   1.00 26.35 ? 208  LEU A C   1 
ATOM   975  O O   . LEU A 1 146 ? 39.313 66.918  5.712   1.00 27.10 ? 208  LEU A O   1 
ATOM   976  C CB  . LEU A 1 146 ? 40.875 68.128  8.264   1.00 24.71 ? 208  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 146 ? 42.313 68.057  8.779   1.00 22.83 ? 208  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 146 ? 42.293 67.832  10.280  1.00 20.07 ? 208  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 146 ? 43.108 66.963  8.064   1.00 18.80 ? 208  LEU A CD2 1 
ATOM   980  N N   . ASP A 1 147 ? 38.231 68.686  6.598   1.00 26.92 ? 209  ASP A N   1 
ATOM   981  C CA  . ASP A 1 147 ? 36.870 68.294  6.160   1.00 27.35 ? 209  ASP A CA  1 
ATOM   982  C C   . ASP A 1 147 ? 36.593 68.515  4.668   1.00 27.59 ? 209  ASP A C   1 
ATOM   983  O O   . ASP A 1 147 ? 35.541 68.098  4.172   1.00 27.70 ? 209  ASP A O   1 
ATOM   984  C CB  . ASP A 1 147 ? 35.801 69.062  6.957   1.00 27.36 ? 209  ASP A CB  1 
ATOM   985  C CG  . ASP A 1 147 ? 35.855 68.781  8.448   1.00 28.90 ? 209  ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 147 ? 36.044 67.615  8.851   1.00 30.95 ? 209  ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 147 ? 35.704 69.738  9.234   1.00 31.77 ? 209  ASP A OD2 1 
ATOM   988  N N   . CYS A 1 148 ? 37.496 69.206  3.970   1.00 27.73 ? 210  CYS A N   1 
ATOM   989  C CA  . CYS A 1 148 ? 37.445 69.311  2.506   1.00 27.99 ? 210  CYS A CA  1 
ATOM   990  C C   . CYS A 1 148 ? 38.357 68.266  1.845   1.00 28.16 ? 210  CYS A C   1 
ATOM   991  O O   . CYS A 1 148 ? 38.701 68.392  0.672   1.00 28.38 ? 210  CYS A O   1 
ATOM   992  C CB  . CYS A 1 148 ? 37.838 70.723  2.044   1.00 27.90 ? 210  CYS A CB  1 
ATOM   993  S SG  . CYS A 1 148 ? 36.680 72.035  2.537   1.00 27.63 ? 210  CYS A SG  1 
ATOM   994  N N   . ASN A 1 149 ? 38.731 67.238  2.605   1.00 28.51 ? 211  ASN A N   1 
ATOM   995  C CA  . ASN A 1 149 ? 39.594 66.146  2.129   1.00 28.81 ? 211  ASN A CA  1 
ATOM   996  C C   . ASN A 1 149 ? 40.896 66.596  1.449   1.00 28.81 ? 211  ASN A C   1 
ATOM   997  O O   . ASN A 1 149 ? 41.220 66.150  0.348   1.00 29.17 ? 211  ASN A O   1 
ATOM   998  C CB  . ASN A 1 149 ? 38.810 65.200  1.212   1.00 29.20 ? 211  ASN A CB  1 
ATOM   999  C CG  . ASN A 1 149 ? 37.542 64.661  1.873   1.00 30.63 ? 211  ASN A CG  1 
ATOM   1000 O OD1 . ASN A 1 149 ? 37.581 64.083  2.972   1.00 31.36 ? 211  ASN A OD1 1 
ATOM   1001 N ND2 . ASN A 1 149 ? 36.406 64.860  1.208   1.00 32.81 ? 211  ASN A ND2 1 
ATOM   1002 N N   . ILE A 1 150 ? 41.645 67.467  2.121   1.00 28.66 ? 212  ILE A N   1 
ATOM   1003 C CA  . ILE A 1 150 ? 42.985 67.857  1.659   1.00 28.37 ? 212  ILE A CA  1 
ATOM   1004 C C   . ILE A 1 150 ? 43.952 66.680  1.669   1.00 28.47 ? 212  ILE A C   1 
ATOM   1005 O O   . ILE A 1 150 ? 44.847 66.608  0.827   1.00 28.51 ? 212  ILE A O   1 
ATOM   1006 C CB  . ILE A 1 150 ? 43.579 69.007  2.515   1.00 28.13 ? 212  ILE A CB  1 
ATOM   1007 C CG1 . ILE A 1 150 ? 44.883 69.523  1.909   1.00 27.85 ? 212  ILE A CG1 1 
ATOM   1008 C CG2 . ILE A 1 150 ? 43.823 68.551  3.951   1.00 28.44 ? 212  ILE A CG2 1 
ATOM   1009 C CD1 . ILE A 1 150 ? 45.529 70.628  2.704   1.00 27.78 ? 212  ILE A CD1 1 
ATOM   1010 N N   . LEU A 1 151 ? 43.766 65.744  2.603   1.00 28.58 ? 213  LEU A N   1 
ATOM   1011 C CA  . LEU A 1 151 ? 44.836 64.791  2.944   1.00 28.73 ? 213  LEU A CA  1 
ATOM   1012 C C   . LEU A 1 151 ? 45.226 63.792  1.840   1.00 28.70 ? 213  LEU A C   1 
ATOM   1013 O O   . LEU A 1 151 ? 46.418 63.645  1.547   1.00 28.45 ? 213  LEU A O   1 
ATOM   1014 C CB  . LEU A 1 151 ? 44.538 64.054  4.275   1.00 28.72 ? 213  LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 151 ? 45.787 63.449  4.919   1.00 28.40 ? 213  LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 151 ? 46.792 64.540  5.176   1.00 28.58 ? 213  LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 151 ? 45.471 62.720  6.205   1.00 28.42 ? 213  LEU A CD2 1 
ATOM   1018 N N   . PRO A 1 152 ? 44.248 63.069  1.270   1.00 28.62 ? 214  PRO A N   1 
ATOM   1019 C CA  . PRO A 1 152 ? 44.566 62.150  0.168   1.00 28.85 ? 214  PRO A CA  1 
ATOM   1020 C C   . PRO A 1 152 ? 45.413 62.751  -0.976  1.00 28.93 ? 214  PRO A C   1 
ATOM   1021 O O   . PRO A 1 152 ? 46.454 62.174  -1.297  1.00 28.81 ? 214  PRO A O   1 
ATOM   1022 C CB  . PRO A 1 152 ? 43.186 61.679  -0.312  1.00 28.93 ? 214  PRO A CB  1 
ATOM   1023 C CG  . PRO A 1 152 ? 42.330 61.781  0.923   1.00 28.96 ? 214  PRO A CG  1 
ATOM   1024 C CD  . PRO A 1 152 ? 42.820 63.012  1.631   1.00 28.87 ? 214  PRO A CD  1 
ATOM   1025 N N   . PRO A 1 153 ? 44.989 63.890  -1.582  1.00 28.86 ? 215  PRO A N   1 
ATOM   1026 C CA  . PRO A 1 153 ? 45.873 64.504  -2.586  1.00 29.07 ? 215  PRO A CA  1 
ATOM   1027 C C   . PRO A 1 153 ? 47.195 65.070  -2.049  1.00 29.08 ? 215  PRO A C   1 
ATOM   1028 O O   . PRO A 1 153 ? 48.187 65.068  -2.768  1.00 28.61 ? 215  PRO A O   1 
ATOM   1029 C CB  . PRO A 1 153 ? 45.006 65.619  -3.199  1.00 29.04 ? 215  PRO A CB  1 
ATOM   1030 C CG  . PRO A 1 153 ? 43.950 65.904  -2.207  1.00 29.01 ? 215  PRO A CG  1 
ATOM   1031 C CD  . PRO A 1 153 ? 43.714 64.627  -1.451  1.00 29.05 ? 215  PRO A CD  1 
ATOM   1032 N N   . LEU A 1 154 ? 47.207 65.552  -0.807  1.00 29.76 ? 216  LEU A N   1 
ATOM   1033 C CA  . LEU A 1 154 ? 48.414 66.128  -0.216  1.00 30.28 ? 216  LEU A CA  1 
ATOM   1034 C C   . LEU A 1 154 ? 49.493 65.058  -0.021  1.00 30.70 ? 216  LEU A C   1 
ATOM   1035 O O   . LEU A 1 154 ? 50.674 65.317  -0.232  1.00 30.58 ? 216  LEU A O   1 
ATOM   1036 C CB  . LEU A 1 154 ? 48.091 66.803  1.126   1.00 30.52 ? 216  LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 154 ? 49.251 67.506  1.863   1.00 30.60 ? 216  LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 154 ? 49.764 68.656  1.006   1.00 32.05 ? 216  LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 154 ? 48.851 68.002  3.248   1.00 30.04 ? 216  LEU A CD2 1 
ATOM   1040 N N   . LEU A 1 155 ? 49.073 63.864  0.394   1.00 31.29 ? 217  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 155 ? 49.993 62.756  0.622   1.00 31.89 ? 217  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 155 ? 50.480 62.171  -0.693  1.00 32.67 ? 217  LEU A C   1 
ATOM   1043 O O   . LEU A 1 155 ? 51.554 61.585  -0.754  1.00 32.88 ? 217  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 155 ? 49.330 61.658  1.463   1.00 31.36 ? 217  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 155 ? 49.031 61.958  2.937   1.00 29.95 ? 217  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 155 ? 48.425 60.724  3.556   1.00 27.55 ? 217  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 155 ? 50.276 62.432  3.709   1.00 27.78 ? 217  LEU A CD2 1 
ATOM   1048 N N   . GLN A 1 156 ? 49.678 62.325  -1.741  1.00 34.06 ? 218  GLN A N   1 
ATOM   1049 C CA  . GLN A 1 156 ? 50.069 61.903  -3.092  1.00 34.27 ? 218  GLN A CA  1 
ATOM   1050 C C   . GLN A 1 156 ? 51.224 62.734  -3.674  1.00 34.47 ? 218  GLN A C   1 
ATOM   1051 O O   . GLN A 1 156 ? 51.963 62.250  -4.517  1.00 34.56 ? 218  GLN A O   1 
ATOM   1052 C CB  . GLN A 1 156 ? 48.862 61.941  -4.020  1.00 34.49 ? 218  GLN A CB  1 
ATOM   1053 C CG  . GLN A 1 156 ? 48.989 61.061  -5.250  1.00 35.87 ? 218  GLN A CG  1 
ATOM   1054 C CD  . GLN A 1 156 ? 49.008 59.576  -4.925  1.00 38.85 ? 218  GLN A CD  1 
ATOM   1055 O OE1 . GLN A 1 156 ? 48.743 59.170  -3.792  1.00 41.15 ? 218  GLN A OE1 1 
ATOM   1056 N NE2 . GLN A 1 156 ? 49.319 58.757  -5.926  1.00 40.12 ? 218  GLN A NE2 1 
ATOM   1057 N N   . LEU A 1 157 ? 51.389 63.971  -3.221  1.00 34.90 ? 219  LEU A N   1 
ATOM   1058 C CA  . LEU A 1 157 ? 52.557 64.768  -3.598  1.00 35.50 ? 219  LEU A CA  1 
ATOM   1059 C C   . LEU A 1 157 ? 53.845 64.026  -3.263  1.00 36.05 ? 219  LEU A C   1 
ATOM   1060 O O   . LEU A 1 157 ? 54.727 63.892  -4.115  1.00 36.42 ? 219  LEU A O   1 
ATOM   1061 C CB  . LEU A 1 157 ? 52.552 66.144  -2.917  1.00 35.24 ? 219  LEU A CB  1 
ATOM   1062 C CG  . LEU A 1 157 ? 51.464 67.108  -3.390  1.00 35.55 ? 219  LEU A CG  1 
ATOM   1063 C CD1 . LEU A 1 157 ? 51.452 68.376  -2.558  1.00 35.04 ? 219  LEU A CD1 1 
ATOM   1064 C CD2 . LEU A 1 157 ? 51.651 67.441  -4.855  1.00 35.60 ? 219  LEU A CD2 1 
ATOM   1065 N N   . PHE A 1 158 ? 53.935 63.513  -2.036  1.00 36.62 ? 220  PHE A N   1 
ATOM   1066 C CA  . PHE A 1 158 ? 55.119 62.762  -1.585  1.00 36.97 ? 220  PHE A CA  1 
ATOM   1067 C C   . PHE A 1 158 ? 55.400 61.497  -2.419  1.00 38.08 ? 220  PHE A C   1 
ATOM   1068 O O   . PHE A 1 158 ? 56.533 61.016  -2.450  1.00 38.12 ? 220  PHE A O   1 
ATOM   1069 C CB  . PHE A 1 158 ? 54.981 62.386  -0.107  1.00 35.83 ? 220  PHE A CB  1 
ATOM   1070 C CG  . PHE A 1 158 ? 54.872 63.566  0.814   1.00 34.57 ? 220  PHE A CG  1 
ATOM   1071 C CD1 . PHE A 1 158 ? 53.672 63.883  1.412   1.00 33.27 ? 220  PHE A CD1 1 
ATOM   1072 C CD2 . PHE A 1 158 ? 55.979 64.352  1.091   1.00 34.28 ? 220  PHE A CD2 1 
ATOM   1073 C CE1 . PHE A 1 158 ? 53.564 64.965  2.269   1.00 33.34 ? 220  PHE A CE1 1 
ATOM   1074 C CE2 . PHE A 1 158 ? 55.878 65.436  1.942   1.00 33.59 ? 220  PHE A CE2 1 
ATOM   1075 C CZ  . PHE A 1 158 ? 54.664 65.743  2.528   1.00 33.17 ? 220  PHE A CZ  1 
ATOM   1076 N N   . SER A 1 159 ? 54.369 60.999  -3.116  1.00 39.57 ? 221  SER A N   1 
ATOM   1077 C CA  . SER A 1 159 ? 54.421 59.773  -3.938  1.00 40.02 ? 221  SER A CA  1 
ATOM   1078 C C   . SER A 1 159 ? 55.257 59.860  -5.218  1.00 40.87 ? 221  SER A C   1 
ATOM   1079 O O   . SER A 1 159 ? 55.291 58.907  -5.996  1.00 41.14 ? 221  SER A O   1 
ATOM   1080 C CB  . SER A 1 159 ? 52.987 59.371  -4.316  1.00 40.42 ? 221  SER A CB  1 
ATOM   1081 O OG  . SER A 1 159 ? 52.937 58.204  -5.107  1.00 40.63 ? 221  SER A OG  1 
ATOM   1082 N N   . LYS A 1 160 ? 55.918 60.988  -5.454  1.00 41.55 ? 222  LYS A N   1 
ATOM   1083 C CA  . LYS A 1 160 ? 56.792 61.131  -6.618  1.00 41.78 ? 222  LYS A CA  1 
ATOM   1084 C C   . LYS A 1 160 ? 58.038 61.914  -6.232  1.00 42.06 ? 222  LYS A C   1 
ATOM   1085 O O   . LYS A 1 160 ? 58.019 62.677  -5.257  1.00 41.95 ? 222  LYS A O   1 
ATOM   1086 C CB  . LYS A 1 160 ? 56.051 61.835  -7.760  1.00 42.11 ? 222  LYS A CB  1 
ATOM   1087 C CG  . LYS A 1 160 ? 55.539 63.223  -7.404  1.00 42.43 ? 222  LYS A CG  1 
ATOM   1088 C CD  . LYS A 1 160 ? 54.437 63.703  -8.349  1.00 42.88 ? 222  LYS A CD  1 
ATOM   1089 C CE  . LYS A 1 160 ? 53.815 65.022  -7.856  1.00 43.31 ? 222  LYS A CE  1 
ATOM   1090 N NZ  . LYS A 1 160 ? 52.758 65.545  -8.777  1.00 43.26 ? 222  LYS A NZ  1 
ATOM   1091 N N   . GLN A 1 161 ? 59.121 61.712  -6.988  1.00 42.22 ? 223  GLN A N   1 
ATOM   1092 C CA  . GLN A 1 161 ? 60.347 62.505  -6.803  1.00 42.08 ? 223  GLN A CA  1 
ATOM   1093 C C   . GLN A 1 161 ? 60.063 63.945  -7.230  1.00 41.78 ? 223  GLN A C   1 
ATOM   1094 O O   . GLN A 1 161 ? 60.172 64.317  -8.414  1.00 42.03 ? 223  GLN A O   1 
ATOM   1095 C CB  . GLN A 1 161 ? 61.566 61.903  -7.536  1.00 42.29 ? 223  GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 161 ? 62.362 60.914  -6.649  1.00 42.91 ? 223  GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 161 ? 63.528 60.211  -7.367  1.00 43.01 ? 223  GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 161 ? 63.612 60.195  -8.603  1.00 42.51 ? 223  GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 161 ? 64.431 59.616  -6.576  1.00 43.48 ? 223  GLN A NE2 1 
ATOM   1100 N N   . ASN A 1 162 ? 59.642 64.726  -6.236  1.00 41.19 ? 224  ASN A N   1 
ATOM   1101 C CA  . ASN A 1 162 ? 59.409 66.156  -6.390  1.00 40.46 ? 224  ASN A CA  1 
ATOM   1102 C C   . ASN A 1 162 ? 60.666 66.906  -5.994  1.00 39.55 ? 224  ASN A C   1 
ATOM   1103 O O   . ASN A 1 162 ? 61.548 66.347  -5.336  1.00 39.35 ? 224  ASN A O   1 
ATOM   1104 C CB  . ASN A 1 162 ? 58.229 66.602  -5.519  1.00 40.81 ? 224  ASN A CB  1 
ATOM   1105 C CG  . ASN A 1 162 ? 56.884 66.422  -6.218  1.00 42.11 ? 224  ASN A CG  1 
ATOM   1106 O OD1 . ASN A 1 162 ? 56.635 67.007  -7.281  1.00 44.02 ? 224  ASN A OD1 1 
ATOM   1107 N ND2 . ASN A 1 162 ? 56.004 65.633  -5.613  1.00 43.95 ? 224  ASN A ND2 1 
ATOM   1108 N N   . ARG A 1 163 ? 60.760 68.164  -6.410  1.00 38.30 ? 225  ARG A N   1 
ATOM   1109 C CA  . ARG A 1 163 ? 61.867 69.005  -5.971  1.00 37.42 ? 225  ARG A CA  1 
ATOM   1110 C C   . ARG A 1 163 ? 61.810 69.209  -4.447  1.00 36.17 ? 225  ARG A C   1 
ATOM   1111 O O   . ARG A 1 163 ? 60.782 68.974  -3.819  1.00 35.92 ? 225  ARG A O   1 
ATOM   1112 C CB  . ARG A 1 163 ? 61.872 70.346  -6.707  1.00 37.32 ? 225  ARG A CB  1 
ATOM   1113 C CG  . ARG A 1 163 ? 60.585 71.136  -6.592  1.00 37.67 ? 225  ARG A CG  1 
ATOM   1114 C CD  . ARG A 1 163 ? 60.642 72.380  -7.453  1.00 38.25 ? 225  ARG A CD  1 
ATOM   1115 N NE  . ARG A 1 163 ? 59.336 73.017  -7.578  1.00 38.81 ? 225  ARG A NE  1 
ATOM   1116 C CZ  . ARG A 1 163 ? 59.117 74.161  -8.220  1.00 39.71 ? 225  ARG A CZ  1 
ATOM   1117 N NH1 . ARG A 1 163 ? 60.113 74.812  -8.826  1.00 40.45 ? 225  ARG A NH1 1 
ATOM   1118 N NH2 . ARG A 1 163 ? 57.884 74.655  -8.265  1.00 39.92 ? 225  ARG A NH2 1 
ATOM   1119 N N   . LEU A 1 164 ? 62.925 69.651  -3.874  1.00 34.80 ? 226  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 164 ? 63.069 69.813  -2.424  1.00 33.92 ? 226  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 164 ? 62.125 70.869  -1.811  1.00 32.80 ? 226  LEU A C   1 
ATOM   1122 O O   . LEU A 1 164 ? 61.661 70.688  -0.697  1.00 32.76 ? 226  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 164 ? 64.534 70.136  -2.100  1.00 33.90 ? 226  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 164 ? 65.084 70.037  -0.669  1.00 34.31 ? 226  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 164 ? 64.902 68.650  -0.059  1.00 32.72 ? 226  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 164 ? 66.564 70.438  -0.680  1.00 33.78 ? 226  LEU A CD2 1 
ATOM   1127 N N   . THR A 1 165 ? 61.839 71.950  -2.539  1.00 31.69 ? 227  THR A N   1 
ATOM   1128 C CA  . THR A 1 165 ? 60.956 73.034  -2.062  1.00 30.83 ? 227  THR A CA  1 
ATOM   1129 C C   . THR A 1 165 ? 59.500 72.592  -1.929  1.00 29.89 ? 227  THR A C   1 
ATOM   1130 O O   . THR A 1 165 ? 58.768 73.093  -1.070  1.00 29.21 ? 227  THR A O   1 
ATOM   1131 C CB  . THR A 1 165 ? 60.979 74.260  -3.016  1.00 30.87 ? 227  THR A CB  1 
ATOM   1132 O OG1 . THR A 1 165 ? 60.690 73.837  -4.360  1.00 30.14 ? 227  THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 165 ? 62.327 74.959  -2.977  1.00 31.08 ? 227  THR A CG2 1 
ATOM   1134 N N   . MET A 1 166 ? 59.088 71.685  -2.812  1.00 29.09 ? 228  MET A N   1 
ATOM   1135 C CA  . MET A 1 166 ? 57.776 71.046  -2.749  1.00 28.77 ? 228  MET A CA  1 
ATOM   1136 C C   . MET A 1 166 ? 57.643 70.201  -1.488  1.00 28.02 ? 228  MET A C   1 
ATOM   1137 O O   . MET A 1 166 ? 56.670 70.316  -0.759  1.00 27.78 ? 228  MET A O   1 
ATOM   1138 C CB  . MET A 1 166 ? 57.571 70.143  -3.973  1.00 28.82 ? 228  MET A CB  1 
ATOM   1139 C CG  . MET A 1 166 ? 56.387 69.177  -3.873  1.00 29.74 ? 228  MET A CG  1 
ATOM   1140 S SD  . MET A 1 166 ? 54.777 70.000  -3.858  1.00 34.45 ? 228  MET A SD  1 
ATOM   1141 C CE  . MET A 1 166 ? 54.490 70.048  -5.634  1.00 30.99 ? 228  MET A CE  1 
ATOM   1142 N N   . THR A 1 167 ? 58.628 69.337  -1.267  1.00 27.36 ? 229  THR A N   1 
ATOM   1143 C CA  . THR A 1 167 ? 58.658 68.437  -0.119  1.00 27.31 ? 229  THR A CA  1 
ATOM   1144 C C   . THR A 1 167 ? 58.616 69.209  1.208   1.00 26.80 ? 229  THR A C   1 
ATOM   1145 O O   . THR A 1 167 ? 57.914 68.813  2.129   1.00 26.71 ? 229  THR A O   1 
ATOM   1146 C CB  . THR A 1 167 ? 59.910 67.532  -0.212  1.00 27.36 ? 229  THR A CB  1 
ATOM   1147 O OG1 . THR A 1 167 ? 59.869 66.797  -1.450  1.00 27.00 ? 229  THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 167 ? 60.018 66.569  0.982   1.00 27.32 ? 229  THR A CG2 1 
ATOM   1149 N N   . ARG A 1 168 ? 59.344 70.321  1.281   1.00 26.59 ? 230  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 168 ? 59.316 71.206  2.449   1.00 26.68 ? 230  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 168 ? 57.969 71.875  2.660   1.00 26.41 ? 230  ARG A C   1 
ATOM   1152 O O   . ARG A 1 168 ? 57.494 71.990  3.777   1.00 26.62 ? 230  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 168 ? 60.355 72.307  2.314   1.00 26.33 ? 230  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 168 ? 61.771 71.814  2.372   1.00 26.86 ? 230  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 168 ? 62.716 72.977  2.266   1.00 27.63 ? 230  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 168 ? 64.074 72.539  2.001   1.00 29.54 ? 230  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 168 ? 65.094 73.362  1.788   1.00 30.64 ? 230  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 168 ? 64.911 74.677  1.795   1.00 31.81 ? 230  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 168 ? 66.302 72.869  1.554   1.00 30.97 ? 230  ARG A NH2 1 
ATOM   1160 N N   . ASN A 1 169 ? 57.367 72.341  1.582   1.00 26.19 ? 231  ASN A N   1 
ATOM   1161 C CA  . ASN A 1 169 ? 56.068 72.992  1.670   1.00 26.22 ? 231  ASN A CA  1 
ATOM   1162 C C   . ASN A 1 169 ? 54.979 72.035  2.066   1.00 25.77 ? 231  ASN A C   1 
ATOM   1163 O O   . ASN A 1 169 ? 54.049 72.404  2.777   1.00 25.69 ? 231  ASN A O   1 
ATOM   1164 C CB  . ASN A 1 169 ? 55.716 73.651  0.341   1.00 26.21 ? 231  ASN A CB  1 
ATOM   1165 C CG  . ASN A 1 169 ? 56.342 74.995  0.203   1.00 26.92 ? 231  ASN A CG  1 
ATOM   1166 O OD1 . ASN A 1 169 ? 56.071 75.882  1.003   1.00 28.05 ? 231  ASN A OD1 1 
ATOM   1167 N ND2 . ASN A 1 169 ? 57.195 75.165  -0.800  1.00 28.70 ? 231  ASN A ND2 1 
ATOM   1168 N N   . ALA A 1 170 ? 55.106 70.806  1.594   1.00 25.65 ? 232  ALA A N   1 
ATOM   1169 C CA  . ALA A 1 170 ? 54.118 69.780  1.851   1.00 25.88 ? 232  ALA A CA  1 
ATOM   1170 C C   . ALA A 1 170 ? 54.180 69.295  3.298   1.00 25.64 ? 232  ALA A C   1 
ATOM   1171 O O   . ALA A 1 170 ? 53.143 69.087  3.914   1.00 25.69 ? 232  ALA A O   1 
ATOM   1172 C CB  . ALA A 1 170 ? 54.302 68.616  0.867   1.00 25.75 ? 232  ALA A CB  1 
ATOM   1173 N N   . VAL A 1 171 ? 55.383 69.107  3.840   1.00 25.87 ? 233  VAL A N   1 
ATOM   1174 C CA  . VAL A 1 171 ? 55.501 68.672  5.236   1.00 25.91 ? 233  VAL A CA  1 
ATOM   1175 C C   . VAL A 1 171 ? 55.097 69.785  6.169   1.00 25.99 ? 233  VAL A C   1 
ATOM   1176 O O   . VAL A 1 171 ? 54.533 69.527  7.236   1.00 26.09 ? 233  VAL A O   1 
ATOM   1177 C CB  . VAL A 1 171 ? 56.922 68.272  5.693   1.00 25.65 ? 233  VAL A CB  1 
ATOM   1178 C CG1 . VAL A 1 171 ? 56.799 67.242  6.823   1.00 25.94 ? 233  VAL A CG1 1 
ATOM   1179 C CG2 . VAL A 1 171 ? 57.739 67.697  4.584   1.00 28.00 ? 233  VAL A CG2 1 
ATOM   1180 N N   . TRP A 1 172 ? 55.437 71.017  5.792   1.00 25.98 ? 234  TRP A N   1 
ATOM   1181 C CA  . TRP A 1 172 ? 55.079 72.176  6.583   1.00 25.95 ? 234  TRP A CA  1 
ATOM   1182 C C   . TRP A 1 172 ? 53.561 72.259  6.698   1.00 25.74 ? 234  TRP A C   1 
ATOM   1183 O O   . TRP A 1 172 ? 53.030 72.437  7.771   1.00 25.67 ? 234  TRP A O   1 
ATOM   1184 C CB  . TRP A 1 172 ? 55.666 73.459  5.977   1.00 26.09 ? 234  TRP A CB  1 
ATOM   1185 C CG  . TRP A 1 172 ? 55.128 74.663  6.629   1.00 26.33 ? 234  TRP A CG  1 
ATOM   1186 C CD1 . TRP A 1 172 ? 55.430 75.118  7.874   1.00 26.76 ? 234  TRP A CD1 1 
ATOM   1187 C CD2 . TRP A 1 172 ? 54.162 75.567  6.091   1.00 26.98 ? 234  TRP A CD2 1 
ATOM   1188 N NE1 . TRP A 1 172 ? 54.717 76.258  8.146   1.00 26.86 ? 234  TRP A NE1 1 
ATOM   1189 C CE2 . TRP A 1 172 ? 53.931 76.555  7.066   1.00 26.90 ? 234  TRP A CE2 1 
ATOM   1190 C CE3 . TRP A 1 172 ? 53.478 75.647  4.868   1.00 26.96 ? 234  TRP A CE3 1 
ATOM   1191 C CZ2 . TRP A 1 172 ? 53.042 77.597  6.864   1.00 27.27 ? 234  TRP A CZ2 1 
ATOM   1192 C CZ3 . TRP A 1 172 ? 52.604 76.673  4.672   1.00 26.86 ? 234  TRP A CZ3 1 
ATOM   1193 C CH2 . TRP A 1 172 ? 52.389 77.640  5.659   1.00 26.90 ? 234  TRP A CH2 1 
ATOM   1194 N N   . ALA A 1 173 ? 52.862 72.097  5.587   1.00 26.04 ? 235  ALA A N   1 
ATOM   1195 C CA  . ALA A 1 173 ? 51.394 72.102  5.603   1.00 26.29 ? 235  ALA A CA  1 
ATOM   1196 C C   . ALA A 1 173 ? 50.845 70.981  6.475   1.00 26.31 ? 235  ALA A C   1 
ATOM   1197 O O   . ALA A 1 173 ? 49.911 71.179  7.247   1.00 26.09 ? 235  ALA A O   1 
ATOM   1198 C CB  . ALA A 1 173 ? 50.840 71.983  4.177   1.00 25.98 ? 235  ALA A CB  1 
ATOM   1199 N N   . LEU A 1 174 ? 51.430 69.801  6.312   1.00 26.69 ? 236  LEU A N   1 
ATOM   1200 C CA  . LEU A 1 174 ? 51.091 68.611  7.095   1.00 26.67 ? 236  LEU A CA  1 
ATOM   1201 C C   . LEU A 1 174 ? 51.173 68.905  8.599   1.00 26.86 ? 236  LEU A C   1 
ATOM   1202 O O   . LEU A 1 174 ? 50.249 68.580  9.364   1.00 27.04 ? 236  LEU A O   1 
ATOM   1203 C CB  . LEU A 1 174 ? 52.060 67.484  6.727   1.00 26.35 ? 236  LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 174 ? 51.681 66.036  6.983   1.00 27.27 ? 236  LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 174 ? 50.424 65.676  6.248   1.00 26.83 ? 236  LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 174 ? 52.839 65.118  6.535   1.00 26.89 ? 236  LEU A CD2 1 
ATOM   1207 N N   . SER A 1 175 ? 52.279 69.512  9.020   1.00 26.39 ? 237  SER A N   1 
ATOM   1208 C CA  . SER A 1 175 ? 52.469 69.870  10.416  1.00 26.43 ? 237  SER A CA  1 
ATOM   1209 C C   . SER A 1 175 ? 51.382 70.836  10.903  1.00 26.46 ? 237  SER A C   1 
ATOM   1210 O O   . SER A 1 175 ? 50.926 70.731  12.046  1.00 26.76 ? 237  SER A O   1 
ATOM   1211 C CB  . SER A 1 175 ? 53.860 70.472  10.646  1.00 26.49 ? 237  SER A CB  1 
ATOM   1212 O OG  . SER A 1 175 ? 53.934 71.800  10.162  1.00 27.69 ? 237  SER A OG  1 
ATOM   1213 N N   . ASN A 1 176 ? 50.957 71.758  10.043  1.00 26.04 ? 238  ASN A N   1 
ATOM   1214 C CA  . ASN A 1 176 ? 49.879 72.694  10.397  1.00 26.16 ? 238  ASN A CA  1 
ATOM   1215 C C   . ASN A 1 176 ? 48.519 72.010  10.505  1.00 26.01 ? 238  ASN A C   1 
ATOM   1216 O O   . ASN A 1 176 ? 47.668 72.446  11.270  1.00 26.27 ? 238  ASN A O   1 
ATOM   1217 C CB  . ASN A 1 176 ? 49.806 73.864  9.410   1.00 26.06 ? 238  ASN A CB  1 
ATOM   1218 C CG  . ASN A 1 176 ? 50.592 75.090  9.876   1.00 26.02 ? 238  ASN A CG  1 
ATOM   1219 O OD1 . ASN A 1 176 ? 51.113 75.129  10.987  1.00 27.50 ? 238  ASN A OD1 1 
ATOM   1220 N ND2 . ASN A 1 176 ? 50.674 76.099  9.015   1.00 26.27 ? 238  ASN A ND2 1 
ATOM   1221 N N   . LEU A 1 177 ? 48.336 70.916  9.771   1.00 25.96 ? 239  LEU A N   1 
ATOM   1222 C CA  . LEU A 1 177 ? 47.135 70.095  9.897   1.00 25.94 ? 239  LEU A CA  1 
ATOM   1223 C C   . LEU A 1 177 ? 47.064 69.342  11.231  1.00 25.88 ? 239  LEU A C   1 
ATOM   1224 O O   . LEU A 1 177 ? 45.980 69.168  11.795  1.00 24.41 ? 239  LEU A O   1 
ATOM   1225 C CB  . LEU A 1 177 ? 47.051 69.109  8.728   1.00 25.54 ? 239  LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 177 ? 46.888 69.749  7.348   1.00 24.76 ? 239  LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 177 ? 47.113 68.741  6.225   1.00 22.26 ? 239  LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 177 ? 45.515 70.382  7.253   1.00 23.73 ? 239  LEU A CD2 1 
ATOM   1229 N N   . CYS A 1 178 ? 48.226 68.908  11.728  1.00 26.57 ? 240  CYS A N   1 
ATOM   1230 C CA  . CYS A 1 178 ? 48.334 68.112  12.962  1.00 27.45 ? 240  CYS A CA  1 
ATOM   1231 C C   . CYS A 1 178 ? 48.357 68.968  14.229  1.00 28.30 ? 240  CYS A C   1 
ATOM   1232 O O   . CYS A 1 178 ? 48.275 68.438  15.334  1.00 28.62 ? 240  CYS A O   1 
ATOM   1233 C CB  . CYS A 1 178 ? 49.606 67.255  12.923  1.00 27.26 ? 240  CYS A CB  1 
ATOM   1234 S SG  . CYS A 1 178 ? 49.641 66.067  11.544  1.00 28.99 ? 240  CYS A SG  1 
ATOM   1235 N N   . ARG A 1 179 ? 48.439 70.283  14.044  1.00 29.29 ? 241  ARG A N   1 
ATOM   1236 C CA  . ARG A 1 179 ? 48.770 71.242  15.087  1.00 29.78 ? 241  ARG A CA  1 
ATOM   1237 C C   . ARG A 1 179 ? 47.542 71.686  15.829  1.00 30.41 ? 241  ARG A C   1 
ATOM   1238 O O   . ARG A 1 179 ? 46.437 71.649  15.282  1.00 30.30 ? 241  ARG A O   1 
ATOM   1239 C CB  . ARG A 1 179 ? 49.407 72.466  14.426  1.00 30.00 ? 241  ARG A CB  1 
ATOM   1240 C CG  . ARG A 1 179 ? 49.918 73.527  15.370  1.00 29.82 ? 241  ARG A CG  1 
ATOM   1241 C CD  . ARG A 1 179 ? 50.785 74.519  14.614  1.00 30.85 ? 241  ARG A CD  1 
ATOM   1242 N NE  . ARG A 1 179 ? 51.487 75.425  15.522  1.00 32.18 ? 241  ARG A NE  1 
ATOM   1243 C CZ  . ARG A 1 179 ? 52.596 76.103  15.217  1.00 33.96 ? 241  ARG A CZ  1 
ATOM   1244 N NH1 . ARG A 1 179 ? 53.162 75.982  14.016  1.00 35.09 ? 241  ARG A NH1 1 
ATOM   1245 N NH2 . ARG A 1 179 ? 53.152 76.913  16.122  1.00 34.01 ? 241  ARG A NH2 1 
ATOM   1246 N N   . GLY A 1 180 ? 47.732 72.150  17.060  1.00 31.10 ? 242  GLY A N   1 
ATOM   1247 C CA  . GLY A 1 180 ? 46.621 72.703  17.845  1.00 31.67 ? 242  GLY A CA  1 
ATOM   1248 C C   . GLY A 1 180 ? 46.098 71.703  18.856  1.00 32.32 ? 242  GLY A C   1 
ATOM   1249 O O   . GLY A 1 180 ? 45.869 70.539  18.536  1.00 32.50 ? 242  GLY A O   1 
ATOM   1250 N N   . LYS A 1 181 ? 45.912 72.164  20.088  1.00 33.24 ? 243  LYS A N   1 
ATOM   1251 C CA  . LYS A 1 181 ? 45.623 71.272  21.199  1.00 33.69 ? 243  LYS A CA  1 
ATOM   1252 C C   . LYS A 1 181 ? 44.215 71.463  21.756  1.00 33.68 ? 243  LYS A C   1 
ATOM   1253 O O   . LYS A 1 181 ? 43.732 70.597  22.482  1.00 34.01 ? 243  LYS A O   1 
ATOM   1254 C CB  . LYS A 1 181 ? 46.671 71.491  22.293  1.00 34.17 ? 243  LYS A CB  1 
ATOM   1255 C CG  . LYS A 1 181 ? 47.073 70.243  23.059  1.00 35.61 ? 243  LYS A CG  1 
ATOM   1256 C CD  . LYS A 1 181 ? 48.288 70.529  23.972  1.00 35.53 ? 243  LYS A CD  1 
ATOM   1257 C CE  . LYS A 1 181 ? 48.284 69.669  25.239  1.00 36.26 ? 243  LYS A CE  1 
ATOM   1258 N NZ  . LYS A 1 181 ? 49.401 70.044  26.176  1.00 36.83 ? 243  LYS A NZ  1 
ATOM   1259 N N   . SER A 1 182 ? 43.554 72.571  21.409  1.00 33.41 ? 244  SER A N   1 
ATOM   1260 C CA  . SER A 1 182 ? 42.293 72.948  22.048  1.00 33.55 ? 244  SER A CA  1 
ATOM   1261 C C   . SER A 1 182 ? 41.254 73.444  21.030  1.00 33.14 ? 244  SER A C   1 
ATOM   1262 O O   . SER A 1 182 ? 41.080 74.652  20.864  1.00 33.05 ? 244  SER A O   1 
ATOM   1263 C CB  . SER A 1 182 ? 42.538 74.028  23.124  1.00 33.72 ? 244  SER A CB  1 
ATOM   1264 O OG  . SER A 1 182 ? 43.576 73.642  24.024  1.00 34.29 ? 244  SER A OG  1 
ATOM   1265 N N   . PRO A 1 183 ? 40.556 72.513  20.349  1.00 32.48 ? 245  PRO A N   1 
ATOM   1266 C CA  . PRO A 1 183 ? 40.718 71.069  20.434  1.00 31.69 ? 245  PRO A CA  1 
ATOM   1267 C C   . PRO A 1 183 ? 41.676 70.568  19.364  1.00 31.53 ? 245  PRO A C   1 
ATOM   1268 O O   . PRO A 1 183 ? 41.873 71.255  18.355  1.00 31.58 ? 245  PRO A O   1 
ATOM   1269 C CB  . PRO A 1 183 ? 39.302 70.545  20.156  1.00 32.08 ? 245  PRO A CB  1 
ATOM   1270 C CG  . PRO A 1 183 ? 38.608 71.631  19.370  1.00 32.12 ? 245  PRO A CG  1 
ATOM   1271 C CD  . PRO A 1 183 ? 39.489 72.864  19.395  1.00 32.46 ? 245  PRO A CD  1 
ATOM   1272 N N   . PRO A 1 184 ? 42.227 69.354  19.545  1.00 30.35 ? 246  PRO A N   1 
ATOM   1273 C CA  . PRO A 1 184 ? 43.144 68.844  18.533  1.00 30.06 ? 246  PRO A CA  1 
ATOM   1274 C C   . PRO A 1 184 ? 42.364 68.350  17.313  1.00 29.52 ? 246  PRO A C   1 
ATOM   1275 O O   . PRO A 1 184 ? 41.140 68.224  17.369  1.00 28.71 ? 246  PRO A O   1 
ATOM   1276 C CB  . PRO A 1 184 ? 43.863 67.685  19.234  1.00 29.56 ? 246  PRO A CB  1 
ATOM   1277 C CG  . PRO A 1 184 ? 43.151 67.458  20.550  1.00 30.11 ? 246  PRO A CG  1 
ATOM   1278 C CD  . PRO A 1 184 ? 41.958 68.369  20.603  1.00 30.20 ? 246  PRO A CD  1 
ATOM   1279 N N   . PRO A 1 185 ? 43.068 68.063  16.213  1.00 29.00 ? 247  PRO A N   1 
ATOM   1280 C CA  . PRO A 1 185 ? 42.313 67.593  15.069  1.00 29.06 ? 247  PRO A CA  1 
ATOM   1281 C C   . PRO A 1 185 ? 41.746 66.225  15.402  1.00 29.17 ? 247  PRO A C   1 
ATOM   1282 O O   . PRO A 1 185 ? 42.365 65.478  16.180  1.00 29.00 ? 247  PRO A O   1 
ATOM   1283 C CB  . PRO A 1 185 ? 43.368 67.489  13.975  1.00 28.90 ? 247  PRO A CB  1 
ATOM   1284 C CG  . PRO A 1 185 ? 44.662 67.243  14.733  1.00 28.92 ? 247  PRO A CG  1 
ATOM   1285 C CD  . PRO A 1 185 ? 44.519 68.080  15.964  1.00 28.98 ? 247  PRO A CD  1 
ATOM   1286 N N   . GLU A 1 186 ? 40.574 65.902  14.862  1.00 28.91 ? 248  GLU A N   1 
ATOM   1287 C CA  . GLU A 1 186 ? 40.059 64.547  14.980  1.00 28.82 ? 248  GLU A CA  1 
ATOM   1288 C C   . GLU A 1 186 ? 41.131 63.611  14.455  1.00 28.11 ? 248  GLU A C   1 
ATOM   1289 O O   . GLU A 1 186 ? 41.619 63.789  13.348  1.00 28.17 ? 248  GLU A O   1 
ATOM   1290 C CB  . GLU A 1 186 ? 38.779 64.381  14.182  1.00 29.08 ? 248  GLU A CB  1 
ATOM   1291 C CG  . GLU A 1 186 ? 38.458 62.940  13.856  1.00 30.15 ? 248  GLU A CG  1 
ATOM   1292 C CD  . GLU A 1 186 ? 37.012 62.763  13.453  1.00 30.97 ? 248  GLU A CD  1 
ATOM   1293 O OE1 . GLU A 1 186 ? 36.566 63.390  12.471  1.00 33.89 ? 248  GLU A OE1 1 
ATOM   1294 O OE2 . GLU A 1 186 ? 36.316 61.991  14.135  1.00 37.05 ? 248  GLU A OE2 1 
ATOM   1295 N N   . PHE A 1 187 ? 41.513 62.629  15.261  1.00 27.66 ? 249  PHE A N   1 
ATOM   1296 C CA  . PHE A 1 187 ? 42.728 61.839  15.005  1.00 27.34 ? 249  PHE A CA  1 
ATOM   1297 C C   . PHE A 1 187 ? 42.619 60.977  13.745  1.00 27.09 ? 249  PHE A C   1 
ATOM   1298 O O   . PHE A 1 187 ? 43.595 60.791  13.034  1.00 26.76 ? 249  PHE A O   1 
ATOM   1299 C CB  . PHE A 1 187 ? 43.070 60.980  16.232  1.00 26.24 ? 249  PHE A CB  1 
ATOM   1300 C CG  . PHE A 1 187 ? 44.447 60.356  16.180  1.00 26.12 ? 249  PHE A CG  1 
ATOM   1301 C CD1 . PHE A 1 187 ? 45.576 61.143  16.301  1.00 24.51 ? 249  PHE A CD1 1 
ATOM   1302 C CD2 . PHE A 1 187 ? 44.603 58.987  16.014  1.00 23.82 ? 249  PHE A CD2 1 
ATOM   1303 C CE1 . PHE A 1 187 ? 46.831 60.586  16.260  1.00 24.96 ? 249  PHE A CE1 1 
ATOM   1304 C CE2 . PHE A 1 187 ? 45.882 58.414  15.966  1.00 24.47 ? 249  PHE A CE2 1 
ATOM   1305 C CZ  . PHE A 1 187 ? 46.983 59.216  16.086  1.00 24.66 ? 249  PHE A CZ  1 
ATOM   1306 N N   . ALA A 1 188 ? 41.427 60.469  13.462  1.00 27.68 ? 250  ALA A N   1 
ATOM   1307 C CA  . ALA A 1 188 ? 41.200 59.683  12.247  1.00 28.09 ? 250  ALA A CA  1 
ATOM   1308 C C   . ALA A 1 188 ? 41.472 60.468  10.930  1.00 28.57 ? 250  ALA A C   1 
ATOM   1309 O O   . ALA A 1 188 ? 41.735 59.855  9.877   1.00 29.05 ? 250  ALA A O   1 
ATOM   1310 C CB  . ALA A 1 188 ? 39.776 59.143  12.247  1.00 28.06 ? 250  ALA A CB  1 
ATOM   1311 N N   . LYS A 1 189 ? 41.401 61.802  10.985  1.00 28.14 ? 251  LYS A N   1 
ATOM   1312 C CA  . LYS A 1 189 ? 41.620 62.646  9.806   1.00 28.05 ? 251  LYS A CA  1 
ATOM   1313 C C   . LYS A 1 189 ? 43.075 62.966  9.525   1.00 27.77 ? 251  LYS A C   1 
ATOM   1314 O O   . LYS A 1 189 ? 43.398 63.418  8.438   1.00 27.91 ? 251  LYS A O   1 
ATOM   1315 C CB  . LYS A 1 189 ? 40.877 63.957  9.967   1.00 28.20 ? 251  LYS A CB  1 
ATOM   1316 C CG  . LYS A 1 189 ? 39.382 63.783  10.007  1.00 29.05 ? 251  LYS A CG  1 
ATOM   1317 C CD  . LYS A 1 189 ? 38.726 65.111  9.824   1.00 29.39 ? 251  LYS A CD  1 
ATOM   1318 C CE  . LYS A 1 189 ? 37.231 65.006  9.823   1.00 30.50 ? 251  LYS A CE  1 
ATOM   1319 N NZ  . LYS A 1 189 ? 36.662 66.272  10.380  1.00 33.44 ? 251  LYS A NZ  1 
ATOM   1320 N N   . VAL A 1 190 ? 43.948 62.745  10.497  1.00 27.51 ? 252  VAL A N   1 
ATOM   1321 C CA  . VAL A 1 190 ? 45.352 63.159  10.389  1.00 27.45 ? 252  VAL A CA  1 
ATOM   1322 C C   . VAL A 1 190 ? 46.321 61.967  10.512  1.00 27.48 ? 252  VAL A C   1 
ATOM   1323 O O   . VAL A 1 190 ? 47.474 62.028  10.044  1.00 28.00 ? 252  VAL A O   1 
ATOM   1324 C CB  . VAL A 1 190 ? 45.643 64.265  11.456  1.00 27.59 ? 252  VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 190 ? 47.065 64.680  11.425  1.00 29.48 ? 252  VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 190 ? 44.749 65.507  11.219  1.00 27.33 ? 252  VAL A CG2 1 
ATOM   1327 N N   . SER A 1 191 ? 45.859 60.874  11.122  1.00 27.12 ? 253  SER A N   1 
ATOM   1328 C CA  . SER A 1 191 ? 46.702 59.713  11.362  1.00 26.79 ? 253  SER A CA  1 
ATOM   1329 C C   . SER A 1 191 ? 47.186 59.000  10.088  1.00 26.71 ? 253  SER A C   1 
ATOM   1330 O O   . SER A 1 191 ? 48.321 58.471  10.081  1.00 26.54 ? 253  SER A O   1 
ATOM   1331 C CB  . SER A 1 191 ? 46.043 58.741  12.353  1.00 26.87 ? 253  SER A CB  1 
ATOM   1332 O OG  . SER A 1 191 ? 44.877 58.142  11.846  1.00 25.83 ? 253  SER A OG  1 
ATOM   1333 N N   . PRO A 1 192 ? 46.393 59.034  8.991   1.00 26.62 ? 254  PRO A N   1 
ATOM   1334 C CA  . PRO A 1 192 ? 46.916 58.480  7.734   1.00 26.53 ? 254  PRO A CA  1 
ATOM   1335 C C   . PRO A 1 192 ? 48.251 59.061  7.239   1.00 26.74 ? 254  PRO A C   1 
ATOM   1336 O O   . PRO A 1 192 ? 48.852 58.465  6.350   1.00 27.64 ? 254  PRO A O   1 
ATOM   1337 C CB  . PRO A 1 192 ? 45.813 58.795  6.728   1.00 26.91 ? 254  PRO A CB  1 
ATOM   1338 C CG  . PRO A 1 192 ? 44.554 58.846  7.557   1.00 26.59 ? 254  PRO A CG  1 
ATOM   1339 C CD  . PRO A 1 192 ? 45.011 59.525  8.812   1.00 26.95 ? 254  PRO A CD  1 
ATOM   1340 N N   . CYS A 1 193 ? 48.705 60.201  7.771   1.00 26.30 ? 255  CYS A N   1 
ATOM   1341 C CA  . CYS A 1 193 ? 49.980 60.797  7.326   1.00 26.39 ? 255  CYS A CA  1 
ATOM   1342 C C   . CYS A 1 193 ? 51.178 60.173  7.996   1.00 25.97 ? 255  CYS A C   1 
ATOM   1343 O O   . CYS A 1 193 ? 52.311 60.463  7.605   1.00 25.59 ? 255  CYS A O   1 
ATOM   1344 C CB  . CYS A 1 193 ? 50.021 62.294  7.582   1.00 26.44 ? 255  CYS A CB  1 
ATOM   1345 S SG  . CYS A 1 193 ? 50.366 62.722  9.291   1.00 29.20 ? 255  CYS A SG  1 
ATOM   1346 N N   . LEU A 1 194 ? 50.926 59.312  8.992   1.00 25.76 ? 256  LEU A N   1 
ATOM   1347 C CA  . LEU A 1 194 ? 51.969 58.709  9.808   1.00 26.04 ? 256  LEU A CA  1 
ATOM   1348 C C   . LEU A 1 194 ? 52.974 57.891  9.010   1.00 26.03 ? 256  LEU A C   1 
ATOM   1349 O O   . LEU A 1 194 ? 54.168 57.936  9.281   1.00 25.21 ? 256  LEU A O   1 
ATOM   1350 C CB  . LEU A 1 194 ? 51.366 57.882  10.964  1.00 25.66 ? 256  LEU A CB  1 
ATOM   1351 C CG  . LEU A 1 194 ? 51.122 58.750  12.196  1.00 24.24 ? 256  LEU A CG  1 
ATOM   1352 C CD1 . LEU A 1 194 ? 50.249 58.062  13.174  1.00 21.95 ? 256  LEU A CD1 1 
ATOM   1353 C CD2 . LEU A 1 194 ? 52.478 59.140  12.834  1.00 24.98 ? 256  LEU A CD2 1 
ATOM   1354 N N   . ASN A 1 195 ? 52.496 57.180  8.000   1.00 27.00 ? 257  ASN A N   1 
ATOM   1355 C CA  . ASN A 1 195 ? 53.379 56.394  7.139   1.00 27.60 ? 257  ASN A CA  1 
ATOM   1356 C C   . ASN A 1 195 ? 54.383 57.273  6.363   1.00 27.48 ? 257  ASN A C   1 
ATOM   1357 O O   . ASN A 1 195 ? 55.570 56.924  6.253   1.00 27.27 ? 257  ASN A O   1 
ATOM   1358 C CB  . ASN A 1 195 ? 52.558 55.486  6.215   1.00 28.56 ? 257  ASN A CB  1 
ATOM   1359 C CG  . ASN A 1 195 ? 51.678 54.485  6.996   1.00 31.66 ? 257  ASN A CG  1 
ATOM   1360 O OD1 . ASN A 1 195 ? 52.112 53.852  7.988   1.00 35.41 ? 257  ASN A OD1 1 
ATOM   1361 N ND2 . ASN A 1 195 ? 50.433 54.335  6.545   1.00 35.40 ? 257  ASN A ND2 1 
ATOM   1362 N N   . VAL A 1 196 ? 53.919 58.426  5.885   1.00 27.19 ? 258  VAL A N   1 
ATOM   1363 C CA  . VAL A 1 196 ? 54.777 59.397  5.197   1.00 26.91 ? 258  VAL A CA  1 
ATOM   1364 C C   . VAL A 1 196 ? 55.816 59.991  6.141   1.00 26.66 ? 258  VAL A C   1 
ATOM   1365 O O   . VAL A 1 196 ? 57.025 59.993  5.841   1.00 26.92 ? 258  VAL A O   1 
ATOM   1366 C CB  . VAL A 1 196 ? 53.910 60.519  4.503   1.00 27.47 ? 258  VAL A CB  1 
ATOM   1367 C CG1 . VAL A 1 196 ? 54.731 61.777  4.193   1.00 27.27 ? 258  VAL A CG1 1 
ATOM   1368 C CG2 . VAL A 1 196 ? 53.284 59.977  3.225   1.00 26.09 ? 258  VAL A CG2 1 
ATOM   1369 N N   . LEU A 1 197 ? 55.358 60.471  7.292   1.00 26.37 ? 259  LEU A N   1 
ATOM   1370 C CA  . LEU A 1 197 ? 56.252 61.012  8.325   1.00 26.73 ? 259  LEU A CA  1 
ATOM   1371 C C   . LEU A 1 197 ? 57.394 60.056  8.661   1.00 26.65 ? 259  LEU A C   1 
ATOM   1372 O O   . LEU A 1 197 ? 58.523 60.489  8.849   1.00 27.11 ? 259  LEU A O   1 
ATOM   1373 C CB  . LEU A 1 197 ? 55.476 61.346  9.598   1.00 26.62 ? 259  LEU A CB  1 
ATOM   1374 C CG  . LEU A 1 197 ? 54.934 62.762  9.888   1.00 26.99 ? 259  LEU A CG  1 
ATOM   1375 C CD1 . LEU A 1 197 ? 55.009 63.702  8.725   1.00 24.94 ? 259  LEU A CD1 1 
ATOM   1376 C CD2 . LEU A 1 197 ? 53.502 62.686  10.465  1.00 26.14 ? 259  LEU A CD2 1 
ATOM   1377 N N   . SER A 1 198 ? 57.106 58.764  8.719   1.00 26.66 ? 260  SER A N   1 
ATOM   1378 C CA  . SER A 1 198 ? 58.135 57.767  9.021   1.00 26.93 ? 260  SER A CA  1 
ATOM   1379 C C   . SER A 1 198 ? 59.273 57.722  8.046   1.00 26.49 ? 260  SER A C   1 
ATOM   1380 O O   . SER A 1 198 ? 60.436 57.647  8.451   1.00 26.11 ? 260  SER A O   1 
ATOM   1381 C CB  . SER A 1 198 ? 57.543 56.368  9.066   1.00 27.51 ? 260  SER A CB  1 
ATOM   1382 O OG  . SER A 1 198 ? 58.476 55.502  9.661   1.00 30.22 ? 260  SER A OG  1 
ATOM   1383 N N   . TRP A 1 199 ? 58.959 57.694  6.755   1.00 26.32 ? 261  TRP A N   1 
ATOM   1384 C CA  . TRP A 1 199 ? 60.033 57.650  5.771   1.00 25.90 ? 261  TRP A CA  1 
ATOM   1385 C C   . TRP A 1 199 ? 60.686 59.026  5.552   1.00 24.68 ? 261  TRP A C   1 
ATOM   1386 O O   . TRP A 1 199 ? 61.871 59.099  5.243   1.00 24.20 ? 261  TRP A O   1 
ATOM   1387 C CB  . TRP A 1 199 ? 59.640 56.895  4.478   1.00 27.75 ? 261  TRP A CB  1 
ATOM   1388 C CG  . TRP A 1 199 ? 58.554 57.468  3.645   1.00 28.98 ? 261  TRP A CG  1 
ATOM   1389 C CD1 . TRP A 1 199 ? 57.239 57.076  3.623   1.00 30.48 ? 261  TRP A CD1 1 
ATOM   1390 C CD2 . TRP A 1 199 ? 58.690 58.490  2.648   1.00 29.99 ? 261  TRP A CD2 1 
ATOM   1391 N NE1 . TRP A 1 199 ? 56.538 57.815  2.688   1.00 30.94 ? 261  TRP A NE1 1 
ATOM   1392 C CE2 . TRP A 1 199 ? 57.404 58.699  2.084   1.00 30.81 ? 261  TRP A CE2 1 
ATOM   1393 C CE3 . TRP A 1 199 ? 59.767 59.268  2.195   1.00 30.14 ? 261  TRP A CE3 1 
ATOM   1394 C CZ2 . TRP A 1 199 ? 57.168 59.650  1.082   1.00 30.53 ? 261  TRP A CZ2 1 
ATOM   1395 C CZ3 . TRP A 1 199 ? 59.534 60.222  1.198   1.00 30.44 ? 261  TRP A CZ3 1 
ATOM   1396 C CH2 . TRP A 1 199 ? 58.243 60.399  0.649   1.00 30.52 ? 261  TRP A CH2 1 
ATOM   1397 N N   . LEU A 1 200 ? 59.951 60.105  5.799   1.00 23.86 ? 262  LEU A N   1 
ATOM   1398 C CA  . LEU A 1 200 ? 60.532 61.453  5.786   1.00 23.78 ? 262  LEU A CA  1 
ATOM   1399 C C   . LEU A 1 200 ? 61.652 61.704  6.798   1.00 23.23 ? 262  LEU A C   1 
ATOM   1400 O O   . LEU A 1 200 ? 62.412 62.638  6.614   1.00 22.34 ? 262  LEU A O   1 
ATOM   1401 C CB  . LEU A 1 200 ? 59.457 62.527  5.971   1.00 23.51 ? 262  LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 200 ? 58.529 62.801  4.775   1.00 23.94 ? 262  LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 200 ? 57.517 63.836  5.195   1.00 24.31 ? 262  LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 200 ? 59.306 63.251  3.550   1.00 23.97 ? 262  LEU A CD2 1 
ATOM   1405 N N   . LEU A 1 201 ? 61.725 60.904  7.874   1.00 23.68 ? 263  LEU A N   1 
ATOM   1406 C CA  . LEU A 1 201 ? 62.824 60.989  8.857   1.00 23.33 ? 263  LEU A CA  1 
ATOM   1407 C C   . LEU A 1 201 ? 64.137 60.435  8.339   1.00 23.29 ? 263  LEU A C   1 
ATOM   1408 O O   . LEU A 1 201 ? 65.160 60.524  9.020   1.00 23.03 ? 263  LEU A O   1 
ATOM   1409 C CB  . LEU A 1 201 ? 62.455 60.285  10.168  1.00 23.26 ? 263  LEU A CB  1 
ATOM   1410 C CG  . LEU A 1 201 ? 61.255 60.885  10.911  1.00 23.97 ? 263  LEU A CG  1 
ATOM   1411 C CD1 . LEU A 1 201 ? 60.891 60.065  12.150  1.00 26.07 ? 263  LEU A CD1 1 
ATOM   1412 C CD2 . LEU A 1 201 ? 61.511 62.344  11.262  1.00 21.81 ? 263  LEU A CD2 1 
ATOM   1413 N N   . PHE A 1 202 ? 64.108 59.862  7.139   1.00 23.61 ? 264  PHE A N   1 
ATOM   1414 C CA  . PHE A 1 202 ? 65.298 59.377  6.458   1.00 23.75 ? 264  PHE A CA  1 
ATOM   1415 C C   . PHE A 1 202 ? 65.863 60.406  5.463   1.00 24.49 ? 264  PHE A C   1 
ATOM   1416 O O   . PHE A 1 202 ? 66.955 60.211  4.934   1.00 25.17 ? 264  PHE A O   1 
ATOM   1417 C CB  . PHE A 1 202 ? 65.006 58.035  5.756   1.00 23.05 ? 264  PHE A CB  1 
ATOM   1418 C CG  . PHE A 1 202 ? 64.812 56.889  6.708   1.00 21.87 ? 264  PHE A CG  1 
ATOM   1419 C CD1 . PHE A 1 202 ? 63.552 56.530  7.138   1.00 22.52 ? 264  PHE A CD1 1 
ATOM   1420 C CD2 . PHE A 1 202 ? 65.895 56.160  7.174   1.00 22.96 ? 264  PHE A CD2 1 
ATOM   1421 C CE1 . PHE A 1 202 ? 63.375 55.474  8.018   1.00 21.19 ? 264  PHE A CE1 1 
ATOM   1422 C CE2 . PHE A 1 202 ? 65.723 55.119  8.085   1.00 21.90 ? 264  PHE A CE2 1 
ATOM   1423 C CZ  . PHE A 1 202 ? 64.459 54.776  8.493   1.00 21.84 ? 264  PHE A CZ  1 
ATOM   1424 N N   . VAL A 1 203 ? 65.139 61.498  5.210   1.00 25.14 ? 265  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 203 ? 65.646 62.569  4.338   1.00 25.48 ? 265  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 203 ? 66.746 63.360  5.082   1.00 25.56 ? 265  VAL A C   1 
ATOM   1427 O O   . VAL A 1 203 ? 66.751 63.418  6.310   1.00 26.74 ? 265  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 203 ? 64.489 63.505  3.855   1.00 25.79 ? 265  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 203 ? 65.010 64.565  2.928   1.00 25.74 ? 265  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 203 ? 63.377 62.693  3.140   1.00 25.44 ? 265  VAL A CG2 1 
ATOM   1431 N N   . SER A 1 204 ? 67.692 63.938  4.353   1.00 25.74 ? 266  SER A N   1 
ATOM   1432 C CA  . SER A 1 204 ? 68.783 64.700  4.988   1.00 25.69 ? 266  SER A CA  1 
ATOM   1433 C C   . SER A 1 204 ? 68.441 66.179  5.214   1.00 25.40 ? 266  SER A C   1 
ATOM   1434 O O   . SER A 1 204 ? 68.972 66.799  6.125   1.00 25.64 ? 266  SER A O   1 
ATOM   1435 C CB  . SER A 1 204 ? 70.059 64.616  4.161   1.00 25.53 ? 266  SER A CB  1 
ATOM   1436 O OG  . SER A 1 204 ? 70.109 65.693  3.242   1.00 26.46 ? 266  SER A OG  1 
ATOM   1437 N N   . ASP A 1 205 ? 67.563 66.743  4.390   1.00 25.41 ? 267  ASP A N   1 
ATOM   1438 C CA  . ASP A 1 205 ? 67.246 68.167  4.492   1.00 25.07 ? 267  ASP A CA  1 
ATOM   1439 C C   . ASP A 1 205 ? 66.772 68.518  5.898   1.00 24.63 ? 267  ASP A C   1 
ATOM   1440 O O   . ASP A 1 205 ? 65.846 67.916  6.404   1.00 24.38 ? 267  ASP A O   1 
ATOM   1441 C CB  . ASP A 1 205 ? 66.195 68.590  3.470   1.00 24.78 ? 267  ASP A CB  1 
ATOM   1442 C CG  . ASP A 1 205 ? 65.960 70.101  3.472   1.00 25.42 ? 267  ASP A CG  1 
ATOM   1443 O OD1 . ASP A 1 205 ? 66.936 70.877  3.286   1.00 25.79 ? 267  ASP A OD1 1 
ATOM   1444 O OD2 . ASP A 1 205 ? 64.798 70.511  3.671   1.00 23.36 ? 267  ASP A OD2 1 
ATOM   1445 N N   . THR A 1 206 ? 67.434 69.493  6.510   1.00 24.42 ? 268  THR A N   1 
ATOM   1446 C CA  . THR A 1 206 ? 67.127 69.946  7.861   1.00 24.32 ? 268  THR A CA  1 
ATOM   1447 C C   . THR A 1 206 ? 65.718 70.519  7.994   1.00 24.04 ? 268  THR A C   1 
ATOM   1448 O O   . THR A 1 206 ? 65.073 70.330  9.027   1.00 24.11 ? 268  THR A O   1 
ATOM   1449 C CB  . THR A 1 206 ? 68.128 71.020  8.299   1.00 24.29 ? 268  THR A CB  1 
ATOM   1450 O OG1 . THR A 1 206 ? 69.433 70.442  8.345   1.00 25.33 ? 268  THR A OG1 1 
ATOM   1451 C CG2 . THR A 1 206 ? 67.774 71.568  9.677   1.00 24.85 ? 268  THR A CG2 1 
ATOM   1452 N N   . ASP A 1 207 ? 65.246 71.227  6.968   1.00 23.72 ? 269  ASP A N   1 
ATOM   1453 C CA  . ASP A 1 207 ? 63.906 71.838  7.008   1.00 23.58 ? 269  ASP A CA  1 
ATOM   1454 C C   . ASP A 1 207 ? 62.818 70.767  7.017   1.00 23.10 ? 269  ASP A C   1 
ATOM   1455 O O   . ASP A 1 207 ? 61.835 70.892  7.755   1.00 23.56 ? 269  ASP A O   1 
ATOM   1456 C CB  . ASP A 1 207 ? 63.664 72.801  5.839   1.00 24.17 ? 269  ASP A CB  1 
ATOM   1457 C CG  . ASP A 1 207 ? 64.287 74.179  6.051   1.00 25.49 ? 269  ASP A CG  1 
ATOM   1458 O OD1 . ASP A 1 207 ? 64.769 74.473  7.163   1.00 28.21 ? 269  ASP A OD1 1 
ATOM   1459 O OD2 . ASP A 1 207 ? 64.285 74.983  5.087   1.00 28.65 ? 269  ASP A OD2 1 
ATOM   1460 N N   . VAL A 1 208 ? 62.995 69.724  6.211   1.00 22.20 ? 270  VAL A N   1 
ATOM   1461 C CA  . VAL A 1 208 ? 62.020 68.629  6.151   1.00 21.80 ? 270  VAL A CA  1 
ATOM   1462 C C   . VAL A 1 208 ? 62.040 67.818  7.442   1.00 21.44 ? 270  VAL A C   1 
ATOM   1463 O O   . VAL A 1 208 ? 60.991 67.570  8.007   1.00 21.23 ? 270  VAL A O   1 
ATOM   1464 C CB  . VAL A 1 208 ? 62.235 67.711  4.910   1.00 22.03 ? 270  VAL A CB  1 
ATOM   1465 C CG1 . VAL A 1 208 ? 61.278 66.481  4.936   1.00 21.39 ? 270  VAL A CG1 1 
ATOM   1466 C CG2 . VAL A 1 208 ? 62.060 68.524  3.621   1.00 20.19 ? 270  VAL A CG2 1 
ATOM   1467 N N   . LEU A 1 209 ? 63.231 67.428  7.914   1.00 21.39 ? 271  LEU A N   1 
ATOM   1468 C CA  . LEU A 1 209 ? 63.366 66.709  9.192   1.00 21.51 ? 271  LEU A CA  1 
ATOM   1469 C C   . LEU A 1 209 ? 62.700 67.498  10.337  1.00 21.57 ? 271  LEU A C   1 
ATOM   1470 O O   . LEU A 1 209 ? 61.886 66.946  11.075  1.00 21.29 ? 271  LEU A O   1 
ATOM   1471 C CB  . LEU A 1 209 ? 64.842 66.448  9.546   1.00 21.48 ? 271  LEU A CB  1 
ATOM   1472 C CG  . LEU A 1 209 ? 65.674 65.488  8.719   1.00 19.71 ? 271  LEU A CG  1 
ATOM   1473 C CD1 . LEU A 1 209 ? 67.151 65.657  9.093   1.00 19.20 ? 271  LEU A CD1 1 
ATOM   1474 C CD2 . LEU A 1 209 ? 65.214 64.100  8.956   1.00 19.52 ? 271  LEU A CD2 1 
ATOM   1475 N N   . ALA A 1 210 ? 63.047 68.780  10.482  1.00 21.75 ? 272  ALA A N   1 
ATOM   1476 C CA  . ALA A 1 210 ? 62.445 69.615  11.530  1.00 22.11 ? 272  ALA A CA  1 
ATOM   1477 C C   . ALA A 1 210 ? 60.926 69.589  11.510  1.00 22.14 ? 272  ALA A C   1 
ATOM   1478 O O   . ALA A 1 210 ? 60.307 69.370  12.531  1.00 22.43 ? 272  ALA A O   1 
ATOM   1479 C CB  . ALA A 1 210 ? 62.951 71.052  11.457  1.00 21.91 ? 272  ALA A CB  1 
ATOM   1480 N N   . ASP A 1 211 ? 60.309 69.805  10.357  1.00 22.87 ? 273  ASP A N   1 
ATOM   1481 C CA  . ASP A 1 211 ? 58.823 69.868  10.296  1.00 22.61 ? 273  ASP A CA  1 
ATOM   1482 C C   . ASP A 1 211 ? 58.131 68.508  10.432  1.00 22.20 ? 273  ASP A C   1 
ATOM   1483 O O   . ASP A 1 211 ? 56.992 68.433  10.886  1.00 21.99 ? 273  ASP A O   1 
ATOM   1484 C CB  . ASP A 1 211 ? 58.376 70.530  9.000   1.00 23.52 ? 273  ASP A CB  1 
ATOM   1485 C CG  . ASP A 1 211 ? 58.576 72.040  9.004   1.00 25.07 ? 273  ASP A CG  1 
ATOM   1486 O OD1 . ASP A 1 211 ? 58.578 72.651  10.095  1.00 28.78 ? 273  ASP A OD1 1 
ATOM   1487 O OD2 . ASP A 1 211 ? 58.688 72.612  7.904   1.00 26.86 ? 273  ASP A OD2 1 
ATOM   1488 N N   . ALA A 1 212 ? 58.810 67.452  9.997   1.00 21.90 ? 274  ALA A N   1 
ATOM   1489 C CA  . ALA A 1 212 ? 58.364 66.080  10.203  1.00 22.02 ? 274  ALA A CA  1 
ATOM   1490 C C   . ALA A 1 212 ? 58.302 65.758  11.698  1.00 21.92 ? 274  ALA A C   1 
ATOM   1491 O O   . ALA A 1 212 ? 57.314 65.187  12.190  1.00 21.48 ? 274  ALA A O   1 
ATOM   1492 C CB  . ALA A 1 212 ? 59.307 65.111  9.492   1.00 22.13 ? 274  ALA A CB  1 
ATOM   1493 N N   . CYS A 1 213 ? 59.352 66.144  12.417  1.00 21.33 ? 275  CYS A N   1 
ATOM   1494 C CA  . CYS A 1 213 ? 59.368 66.042  13.878  1.00 21.08 ? 275  CYS A CA  1 
ATOM   1495 C C   . CYS A 1 213 ? 58.288 66.897  14.558  1.00 21.28 ? 275  CYS A C   1 
ATOM   1496 O O   . CYS A 1 213 ? 57.627 66.433  15.473  1.00 21.21 ? 275  CYS A O   1 
ATOM   1497 C CB  . CYS A 1 213 ? 60.737 66.403  14.398  1.00 21.23 ? 275  CYS A CB  1 
ATOM   1498 S SG  . CYS A 1 213 ? 61.984 65.166  13.941  1.00 21.47 ? 275  CYS A SG  1 
ATOM   1499 N N   . TRP A 1 214 ? 58.088 68.135  14.109  1.00 20.67 ? 276  TRP A N   1 
ATOM   1500 C CA  . TRP A 1 214 ? 57.042 68.961  14.689  1.00 20.30 ? 276  TRP A CA  1 
ATOM   1501 C C   . TRP A 1 214 ? 55.680 68.262  14.518  1.00 20.56 ? 276  TRP A C   1 
ATOM   1502 O O   . TRP A 1 214 ? 54.933 68.140  15.482  1.00 20.94 ? 276  TRP A O   1 
ATOM   1503 C CB  . TRP A 1 214 ? 57.014 70.365  14.082  1.00 19.61 ? 276  TRP A CB  1 
ATOM   1504 C CG  . TRP A 1 214 ? 57.974 71.312  14.681  1.00 18.19 ? 276  TRP A CG  1 
ATOM   1505 C CD1 . TRP A 1 214 ? 59.030 71.873  14.069  1.00 18.54 ? 276  TRP A CD1 1 
ATOM   1506 C CD2 . TRP A 1 214 ? 57.959 71.825  16.018  1.00 17.67 ? 276  TRP A CD2 1 
ATOM   1507 N NE1 . TRP A 1 214 ? 59.691 72.719  14.936  1.00 18.67 ? 276  TRP A NE1 1 
ATOM   1508 C CE2 . TRP A 1 214 ? 59.058 72.686  16.146  1.00 16.88 ? 276  TRP A CE2 1 
ATOM   1509 C CE3 . TRP A 1 214 ? 57.120 71.635  17.125  1.00 19.01 ? 276  TRP A CE3 1 
ATOM   1510 C CZ2 . TRP A 1 214 ? 59.349 73.359  17.338  1.00 18.75 ? 276  TRP A CZ2 1 
ATOM   1511 C CZ3 . TRP A 1 214 ? 57.417 72.300  18.319  1.00 18.38 ? 276  TRP A CZ3 1 
ATOM   1512 C CH2 . TRP A 1 214 ? 58.513 73.149  18.410  1.00 18.43 ? 276  TRP A CH2 1 
ATOM   1513 N N   . ALA A 1 215 ? 55.390 67.776  13.316  1.00 20.61 ? 277  ALA A N   1 
ATOM   1514 C CA  . ALA A 1 215 ? 54.147 67.034  13.063  1.00 21.05 ? 277  ALA A CA  1 
ATOM   1515 C C   . ALA A 1 215 ? 53.940 65.869  14.050  1.00 20.74 ? 277  ALA A C   1 
ATOM   1516 O O   . ALA A 1 215 ? 52.875 65.725  14.623  1.00 20.10 ? 277  ALA A O   1 
ATOM   1517 C CB  . ALA A 1 215 ? 54.126 66.524  11.635  1.00 21.19 ? 277  ALA A CB  1 
ATOM   1518 N N   . LEU A 1 216 ? 54.966 65.042  14.209  1.00 20.58 ? 278  LEU A N   1 
ATOM   1519 C CA  . LEU A 1 216 ? 54.964 63.911  15.139  1.00 21.23 ? 278  LEU A CA  1 
ATOM   1520 C C   . LEU A 1 216 ? 54.828 64.293  16.600  1.00 21.35 ? 278  LEU A C   1 
ATOM   1521 O O   . LEU A 1 216 ? 54.201 63.576  17.374  1.00 21.88 ? 278  LEU A O   1 
ATOM   1522 C CB  . LEU A 1 216 ? 56.262 63.088  15.005  1.00 19.95 ? 278  LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 216 ? 56.294 62.299  13.706  1.00 19.60 ? 278  LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 216 ? 57.689 61.693  13.395  1.00 13.23 ? 278  LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 216 ? 55.212 61.234  13.693  1.00 13.82 ? 278  LEU A CD2 1 
ATOM   1526 N N   . SER A 1 217 ? 55.456 65.388  16.997  1.00 22.53 ? 279  SER A N   1 
ATOM   1527 C CA  . SER A 1 217 ? 55.284 65.895  18.356  1.00 22.75 ? 279  SER A CA  1 
ATOM   1528 C C   . SER A 1 217 ? 53.816 66.266  18.646  1.00 23.48 ? 279  SER A C   1 
ATOM   1529 O O   . SER A 1 217 ? 53.327 66.130  19.783  1.00 23.52 ? 279  SER A O   1 
ATOM   1530 C CB  . SER A 1 217 ? 56.211 67.073  18.586  1.00 22.90 ? 279  SER A CB  1 
ATOM   1531 O OG  . SER A 1 217 ? 55.628 68.288  18.193  1.00 23.89 ? 279  SER A OG  1 
ATOM   1532 N N   . TYR A 1 218 ? 53.101 66.715  17.620  1.00 23.88 ? 280  TYR A N   1 
ATOM   1533 C CA  . TYR A 1 218 ? 51.702 67.077  17.784  1.00 24.33 ? 280  TYR A CA  1 
ATOM   1534 C C   . TYR A 1 218 ? 50.826 65.825  17.843  1.00 24.58 ? 280  TYR A C   1 
ATOM   1535 O O   . TYR A 1 218 ? 49.850 65.791  18.573  1.00 24.98 ? 280  TYR A O   1 
ATOM   1536 C CB  . TYR A 1 218 ? 51.230 67.951  16.616  1.00 25.23 ? 280  TYR A CB  1 
ATOM   1537 C CG  . TYR A 1 218 ? 51.982 69.260  16.431  1.00 25.76 ? 280  TYR A CG  1 
ATOM   1538 C CD1 . TYR A 1 218 ? 52.408 69.672  15.171  1.00 24.67 ? 280  TYR A CD1 1 
ATOM   1539 C CD2 . TYR A 1 218 ? 52.260 70.085  17.512  1.00 26.82 ? 280  TYR A CD2 1 
ATOM   1540 C CE1 . TYR A 1 218 ? 53.081 70.872  15.000  1.00 25.30 ? 280  TYR A CE1 1 
ATOM   1541 C CE2 . TYR A 1 218 ? 52.947 71.291  17.342  1.00 26.38 ? 280  TYR A CE2 1 
ATOM   1542 C CZ  . TYR A 1 218 ? 53.352 71.667  16.087  1.00 25.05 ? 280  TYR A CZ  1 
ATOM   1543 O OH  . TYR A 1 218 ? 54.030 72.847  15.936  1.00 26.89 ? 280  TYR A OH  1 
ATOM   1544 N N   . LEU A 1 219 ? 51.169 64.810  17.045  1.00 25.01 ? 281  LEU A N   1 
ATOM   1545 C CA  . LEU A 1 219 ? 50.351 63.592  16.914  1.00 24.65 ? 281  LEU A CA  1 
ATOM   1546 C C   . LEU A 1 219 ? 50.456 62.732  18.175  1.00 24.94 ? 281  LEU A C   1 
ATOM   1547 O O   . LEU A 1 219 ? 49.474 62.108  18.581  1.00 24.41 ? 281  LEU A O   1 
ATOM   1548 C CB  . LEU A 1 219 ? 50.738 62.788  15.662  1.00 24.02 ? 281  LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 219 ? 50.253 63.416  14.346  1.00 24.97 ? 281  LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 219 ? 50.590 62.591  13.155  1.00 21.48 ? 281  LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 219 ? 48.749 63.674  14.387  1.00 22.23 ? 281  LEU A CD2 1 
ATOM   1552 N N   . SER A 1 220 ? 51.628 62.761  18.815  1.00 24.17 ? 282  SER A N   1 
ATOM   1553 C CA  . SER A 1 220 ? 51.860 62.052  20.064  1.00 24.54 ? 282  SER A CA  1 
ATOM   1554 C C   . SER A 1 220 ? 51.545 62.861  21.322  1.00 24.86 ? 282  SER A C   1 
ATOM   1555 O O   . SER A 1 220 ? 51.860 62.423  22.418  1.00 25.27 ? 282  SER A O   1 
ATOM   1556 C CB  . SER A 1 220 ? 53.320 61.589  20.121  1.00 24.85 ? 282  SER A CB  1 
ATOM   1557 O OG  . SER A 1 220 ? 54.172 62.688  19.907  1.00 26.26 ? 282  SER A OG  1 
ATOM   1558 N N   . ASP A 1 221 ? 50.899 64.022  21.173  1.00 25.25 ? 283  ASP A N   1 
ATOM   1559 C CA  . ASP A 1 221 ? 50.470 64.821  22.291  1.00 24.14 ? 283  ASP A CA  1 
ATOM   1560 C C   . ASP A 1 221 ? 49.024 64.500  22.584  1.00 24.36 ? 283  ASP A C   1 
ATOM   1561 O O   . ASP A 1 221 ? 48.107 65.034  21.931  1.00 25.96 ? 283  ASP A O   1 
ATOM   1562 C CB  . ASP A 1 221 ? 50.638 66.317  21.988  1.00 24.61 ? 283  ASP A CB  1 
ATOM   1563 C CG  . ASP A 1 221 ? 50.530 67.179  23.236  1.00 26.55 ? 283  ASP A CG  1 
ATOM   1564 O OD1 . ASP A 1 221 ? 49.974 66.696  24.240  1.00 32.05 ? 283  ASP A OD1 1 
ATOM   1565 O OD2 . ASP A 1 221 ? 50.994 68.337  23.235  1.00 30.66 ? 283  ASP A OD2 1 
ATOM   1566 N N   . GLY A 1 222 ? 48.788 63.649  23.567  1.00 23.37 ? 284  GLY A N   1 
ATOM   1567 C CA  . GLY A 1 222 ? 47.423 63.190  23.843  1.00 21.65 ? 284  GLY A CA  1 
ATOM   1568 C C   . GLY A 1 222 ? 47.395 61.850  24.539  1.00 20.59 ? 284  GLY A C   1 
ATOM   1569 O O   . GLY A 1 222 ? 48.431 61.394  25.081  1.00 19.27 ? 284  GLY A O   1 
ATOM   1570 N N   . PRO A 1 223 ? 46.224 61.210  24.564  1.00 19.86 ? 285  PRO A N   1 
ATOM   1571 C CA  . PRO A 1 223 ? 46.115 59.941  25.233  1.00 20.47 ? 285  PRO A CA  1 
ATOM   1572 C C   . PRO A 1 223 ? 46.952 58.842  24.571  1.00 21.01 ? 285  PRO A C   1 
ATOM   1573 O O   . PRO A 1 223 ? 47.460 58.985  23.447  1.00 20.28 ? 285  PRO A O   1 
ATOM   1574 C CB  . PRO A 1 223 ? 44.620 59.632  25.163  1.00 20.70 ? 285  PRO A CB  1 
ATOM   1575 C CG  . PRO A 1 223 ? 43.960 60.927  24.853  1.00 20.73 ? 285  PRO A CG  1 
ATOM   1576 C CD  . PRO A 1 223 ? 44.934 61.640  23.999  1.00 20.12 ? 285  PRO A CD  1 
ATOM   1577 N N   . ASN A 1 224 ? 47.115 57.753  25.295  1.00 21.81 ? 286  ASN A N   1 
ATOM   1578 C CA  . ASN A 1 224 ? 48.047 56.707  24.914  1.00 21.27 ? 286  ASN A CA  1 
ATOM   1579 C C   . ASN A 1 224 ? 47.694 55.910  23.654  1.00 21.56 ? 286  ASN A C   1 
ATOM   1580 O O   . ASN A 1 224 ? 48.554 55.216  23.114  1.00 19.96 ? 286  ASN A O   1 
ATOM   1581 C CB  . ASN A 1 224 ? 48.177 55.765  26.078  1.00 22.52 ? 286  ASN A CB  1 
ATOM   1582 C CG  . ASN A 1 224 ? 48.852 56.434  27.274  1.00 25.89 ? 286  ASN A CG  1 
ATOM   1583 O OD1 . ASN A 1 224 ? 49.027 57.661  27.245  1.00 29.29 ? 286  ASN A OD1 1 
ATOM   1584 N ND2 . ASN A 1 224 ? 49.230 55.641  28.322  1.00 20.64 ? 286  ASN A ND2 1 
ATOM   1585 N N   . ASP A 1 225 ? 46.437 55.975  23.216  1.00 20.53 ? 287  ASP A N   1 
ATOM   1586 C CA  . ASP A 1 225 ? 46.030 55.403  21.935  1.00 22.20 ? 287  ASP A CA  1 
ATOM   1587 C C   . ASP A 1 225 ? 46.663 56.181  20.756  1.00 22.56 ? 287  ASP A C   1 
ATOM   1588 O O   . ASP A 1 225 ? 46.957 55.609  19.710  1.00 23.60 ? 287  ASP A O   1 
ATOM   1589 C CB  . ASP A 1 225 ? 44.487 55.375  21.803  1.00 21.91 ? 287  ASP A CB  1 
ATOM   1590 C CG  . ASP A 1 225 ? 43.855 56.758  21.971  1.00 24.89 ? 287  ASP A CG  1 
ATOM   1591 O OD1 . ASP A 1 225 ? 44.641 57.673  22.304  1.00 26.91 ? 287  ASP A OD1 1 
ATOM   1592 O OD2 . ASP A 1 225 ? 42.600 56.968  21.751  1.00 23.20 ? 287  ASP A OD2 1 
ATOM   1593 N N   . LYS A 1 226 ? 46.888 57.482  20.915  1.00 22.67 ? 288  LYS A N   1 
ATOM   1594 C CA  . LYS A 1 226 ? 47.546 58.258  19.871  1.00 22.41 ? 288  LYS A CA  1 
ATOM   1595 C C   . LYS A 1 226 ? 49.022 57.905  19.827  1.00 22.96 ? 288  LYS A C   1 
ATOM   1596 O O   . LYS A 1 226 ? 49.606 57.849  18.740  1.00 23.08 ? 288  LYS A O   1 
ATOM   1597 C CB  . LYS A 1 226 ? 47.353 59.752  20.096  1.00 22.54 ? 288  LYS A CB  1 
ATOM   1598 C CG  . LYS A 1 226 ? 45.875 60.150  20.144  1.00 22.73 ? 288  LYS A CG  1 
ATOM   1599 C CD  . LYS A 1 226 ? 45.725 61.638  20.016  1.00 23.11 ? 288  LYS A CD  1 
ATOM   1600 C CE  . LYS A 1 226 ? 44.259 62.023  19.824  1.00 23.32 ? 288  LYS A CE  1 
ATOM   1601 N NZ  . LYS A 1 226 ? 44.113 63.487  19.554  1.00 24.67 ? 288  LYS A NZ  1 
ATOM   1602 N N   . ILE A 1 227 ? 49.614 57.631  20.995  1.00 22.29 ? 289  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 227 ? 51.053 57.298  21.058  1.00 22.78 ? 289  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 227 ? 51.309 55.893  20.486  1.00 22.46 ? 289  ILE A C   1 
ATOM   1605 O O   . ILE A 1 227 ? 52.385 55.601  20.002  1.00 23.58 ? 289  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 227 ? 51.550 57.404  22.534  1.00 22.56 ? 289  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 227 ? 51.444 58.867  23.015  1.00 23.64 ? 289  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 227 ? 52.944 56.892  22.705  1.00 21.27 ? 289  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 227 ? 51.781 59.108  24.536  1.00 22.53 ? 289  ILE A CD1 1 
ATOM   1610 N N   . GLN A 1 228 ? 50.325 55.011  20.625  1.00 22.80 ? 290  GLN A N   1 
ATOM   1611 C CA  . GLN A 1 228 ? 50.382 53.664  20.096  1.00 22.46 ? 290  GLN A CA  1 
ATOM   1612 C C   . GLN A 1 228 ? 50.395 53.794  18.556  1.00 22.06 ? 290  GLN A C   1 
ATOM   1613 O O   . GLN A 1 228 ? 51.180 53.156  17.903  1.00 22.01 ? 290  GLN A O   1 
ATOM   1614 C CB  . GLN A 1 228 ? 49.157 52.852  20.595  1.00 23.59 ? 290  GLN A CB  1 
ATOM   1615 C CG  . GLN A 1 228 ? 49.109 51.382  20.149  1.00 22.97 ? 290  GLN A CG  1 
ATOM   1616 C CD  . GLN A 1 228 ? 47.916 50.619  20.667  1.00 23.40 ? 290  GLN A CD  1 
ATOM   1617 O OE1 . GLN A 1 228 ? 46.811 51.160  20.759  1.00 19.98 ? 290  GLN A OE1 1 
ATOM   1618 N NE2 . GLN A 1 228 ? 48.125 49.329  21.001  1.00 20.67 ? 290  GLN A NE2 1 
ATOM   1619 N N   . ALA A 1 229 ? 49.528 54.625  17.980  1.00 21.65 ? 291  ALA A N   1 
ATOM   1620 C CA  . ALA A 1 229 ? 49.512 54.871  16.512  1.00 21.09 ? 291  ALA A CA  1 
ATOM   1621 C C   . ALA A 1 229 ? 50.840 55.438  16.011  1.00 21.06 ? 291  ALA A C   1 
ATOM   1622 O O   . ALA A 1 229 ? 51.348 55.022  14.967  1.00 22.96 ? 291  ALA A O   1 
ATOM   1623 C CB  . ALA A 1 229 ? 48.384 55.782  16.139  1.00 20.85 ? 291  ALA A CB  1 
ATOM   1624 N N   . VAL A 1 230 ? 51.442 56.334  16.778  1.00 20.17 ? 292  VAL A N   1 
ATOM   1625 C CA  . VAL A 1 230 ? 52.750 56.918  16.423  1.00 18.80 ? 292  VAL A CA  1 
ATOM   1626 C C   . VAL A 1 230 ? 53.876 55.895  16.535  1.00 19.40 ? 292  VAL A C   1 
ATOM   1627 O O   . VAL A 1 230 ? 54.728 55.805  15.641  1.00 20.85 ? 292  VAL A O   1 
ATOM   1628 C CB  . VAL A 1 230 ? 52.999 58.229  17.238  1.00 18.59 ? 292  VAL A CB  1 
ATOM   1629 C CG1 . VAL A 1 230 ? 54.379 58.824  16.994  1.00 17.18 ? 292  VAL A CG1 1 
ATOM   1630 C CG2 . VAL A 1 230 ? 51.923 59.279  16.878  1.00 15.61 ? 292  VAL A CG2 1 
ATOM   1631 N N   . ILE A 1 231 ? 53.913 55.096  17.603  1.00 19.28 ? 293  ILE A N   1 
ATOM   1632 C CA  . ILE A 1 231 ? 54.980 54.057  17.745  1.00 17.26 ? 293  ILE A CA  1 
ATOM   1633 C C   . ILE A 1 231 ? 54.841 52.995  16.663  1.00 17.03 ? 293  ILE A C   1 
ATOM   1634 O O   . ILE A 1 231 ? 55.852 52.461  16.174  1.00 14.06 ? 293  ILE A O   1 
ATOM   1635 C CB  . ILE A 1 231 ? 54.888 53.332  19.133  1.00 17.84 ? 293  ILE A CB  1 
ATOM   1636 C CG1 . ILE A 1 231 ? 55.258 54.328  20.248  1.00 15.30 ? 293  ILE A CG1 1 
ATOM   1637 C CG2 . ILE A 1 231 ? 55.790 52.040  19.129  1.00 19.57 ? 293  ILE A CG2 1 
ATOM   1638 C CD1 . ILE A 1 231 ? 54.953 53.892  21.680  1.00 15.86 ? 293  ILE A CD1 1 
ATOM   1639 N N   . ASP A 1 232 ? 53.572 52.626  16.376  1.00 14.79 ? 294  ASP A N   1 
ATOM   1640 C CA  . ASP A 1 232 ? 53.181 51.660  15.343  1.00 17.59 ? 294  ASP A CA  1 
ATOM   1641 C C   . ASP A 1 232 ? 53.709 52.007  13.949  1.00 18.77 ? 294  ASP A C   1 
ATOM   1642 O O   . ASP A 1 232 ? 53.920 51.111  13.097  1.00 19.07 ? 294  ASP A O   1 
ATOM   1643 C CB  . ASP A 1 232 ? 51.602 51.599  15.194  1.00 16.29 ? 294  ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 232 ? 50.939 50.683  16.200  1.00 16.93 ? 294  ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 232 ? 51.726 49.966  16.839  1.00 14.59 ? 294  ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 232 ? 49.624 50.593  16.296  1.00 17.99 ? 294  ASP A OD2 1 
ATOM   1647 N N   . ALA A 1 233 ? 53.872 53.310  13.716  1.00 20.74 ? 295  ALA A N   1 
ATOM   1648 C CA  . ALA A 1 233 ? 54.399 53.846  12.456  1.00 21.04 ? 295  ALA A CA  1 
ATOM   1649 C C   . ALA A 1 233 ? 55.893 53.683  12.336  1.00 21.31 ? 295  ALA A C   1 
ATOM   1650 O O   . ALA A 1 233 ? 56.418 53.902  11.256  1.00 21.62 ? 295  ALA A O   1 
ATOM   1651 C CB  . ALA A 1 233 ? 54.019 55.313  12.290  1.00 21.73 ? 295  ALA A CB  1 
ATOM   1652 N N   . GLY A 1 234 ? 56.560 53.307  13.427  1.00 21.88 ? 296  GLY A N   1 
ATOM   1653 C CA  . GLY A 1 234 ? 58.025 53.007  13.466  1.00 21.87 ? 296  GLY A CA  1 
ATOM   1654 C C   . GLY A 1 234 ? 59.010 54.126  13.723  1.00 22.86 ? 296  GLY A C   1 
ATOM   1655 O O   . GLY A 1 234 ? 60.235 53.944  13.636  1.00 22.13 ? 296  GLY A O   1 
ATOM   1656 N N   . VAL A 1 235 ? 58.495 55.299  14.041  1.00 23.91 ? 297  VAL A N   1 
ATOM   1657 C CA  . VAL A 1 235 ? 59.325 56.516  14.134  1.00 23.34 ? 297  VAL A CA  1 
ATOM   1658 C C   . VAL A 1 235 ? 60.292 56.635  15.336  1.00 24.25 ? 297  VAL A C   1 
ATOM   1659 O O   . VAL A 1 235 ? 61.314 57.372  15.259  1.00 24.40 ? 297  VAL A O   1 
ATOM   1660 C CB  . VAL A 1 235 ? 58.373 57.730  14.105  1.00 24.41 ? 297  VAL A CB  1 
ATOM   1661 C CG1 . VAL A 1 235 ? 57.626 57.770  12.750  1.00 20.17 ? 297  VAL A CG1 1 
ATOM   1662 C CG2 . VAL A 1 235 ? 57.340 57.647  15.237  1.00 23.78 ? 297  VAL A CG2 1 
ATOM   1663 N N   . CYS A 1 236 ? 60.072 55.889  16.418  1.00 23.73 ? 298  CYS A N   1 
ATOM   1664 C CA  . CYS A 1 236 ? 60.893 56.148  17.633  1.00 23.74 ? 298  CYS A CA  1 
ATOM   1665 C C   . CYS A 1 236 ? 62.378 56.058  17.455  1.00 23.20 ? 298  CYS A C   1 
ATOM   1666 O O   . CYS A 1 236 ? 63.143 56.889  18.029  1.00 24.00 ? 298  CYS A O   1 
ATOM   1667 C CB  . CYS A 1 236 ? 60.518 55.186  18.750  1.00 24.19 ? 298  CYS A CB  1 
ATOM   1668 S SG  . CYS A 1 236 ? 58.924 55.500  19.370  1.00 27.94 ? 298  CYS A SG  1 
ATOM   1669 N N   . ARG A 1 237 ? 62.854 55.076  16.695  1.00 22.55 ? 299  ARG A N   1 
ATOM   1670 C CA  . ARG A 1 237 ? 64.359 54.961  16.582  1.00 22.46 ? 299  ARG A CA  1 
ATOM   1671 C C   . ARG A 1 237 ? 64.961 56.156  15.905  1.00 22.22 ? 299  ARG A C   1 
ATOM   1672 O O   . ARG A 1 237 ? 66.010 56.703  16.363  1.00 23.78 ? 299  ARG A O   1 
ATOM   1673 C CB  . ARG A 1 237 ? 64.779 53.694  15.878  1.00 21.54 ? 299  ARG A CB  1 
ATOM   1674 C CG  . ARG A 1 237 ? 66.235 53.354  16.004  1.00 23.67 ? 299  ARG A CG  1 
ATOM   1675 C CD  . ARG A 1 237 ? 66.464 51.904  15.680  1.00 24.31 ? 299  ARG A CD  1 
ATOM   1676 N NE  . ARG A 1 237 ? 66.259 51.070  16.855  1.00 25.12 ? 299  ARG A NE  1 
ATOM   1677 C CZ  . ARG A 1 237 ? 67.159 50.926  17.835  1.00 26.85 ? 299  ARG A CZ  1 
ATOM   1678 N NH1 . ARG A 1 237 ? 68.320 51.597  17.827  1.00 26.59 ? 299  ARG A NH1 1 
ATOM   1679 N NH2 . ARG A 1 237 ? 66.879 50.132  18.860  1.00 27.35 ? 299  ARG A NH2 1 
ATOM   1680 N N   . ARG A 1 238 ? 64.369 56.559  14.779  1.00 21.87 ? 300  ARG A N   1 
ATOM   1681 C CA  . ARG A 1 238 ? 64.873 57.722  14.053  1.00 22.14 ? 300  ARG A CA  1 
ATOM   1682 C C   . ARG A 1 238 ? 64.760 58.986  14.901  1.00 21.79 ? 300  ARG A C   1 
ATOM   1683 O O   . ARG A 1 238 ? 65.697 59.754  14.975  1.00 22.03 ? 300  ARG A O   1 
ATOM   1684 C CB  . ARG A 1 238 ? 64.199 57.907  12.698  1.00 22.59 ? 300  ARG A CB  1 
ATOM   1685 C CG  . ARG A 1 238 ? 64.733 57.004  11.564  1.00 24.73 ? 300  ARG A CG  1 
ATOM   1686 C CD  . ARG A 1 238 ? 66.182 57.271  11.205  1.00 28.38 ? 300  ARG A CD  1 
ATOM   1687 N NE  . ARG A 1 238 ? 66.396 58.655  10.787  1.00 30.15 ? 300  ARG A NE  1 
ATOM   1688 C CZ  . ARG A 1 238 ? 67.527 59.345  10.960  1.00 30.21 ? 300  ARG A CZ  1 
ATOM   1689 N NH1 . ARG A 1 238 ? 68.585 58.816  11.574  1.00 29.17 ? 300  ARG A NH1 1 
ATOM   1690 N NH2 . ARG A 1 238 ? 67.592 60.599  10.537  1.00 31.20 ? 300  ARG A NH2 1 
ATOM   1691 N N   . LEU A 1 239 ? 63.623 59.186  15.554  1.00 21.25 ? 301  LEU A N   1 
ATOM   1692 C CA  . LEU A 1 239 ? 63.475 60.305  16.500  1.00 20.81 ? 301  LEU A CA  1 
ATOM   1693 C C   . LEU A 1 239 ? 64.625 60.351  17.498  1.00 20.60 ? 301  LEU A C   1 
ATOM   1694 O O   . LEU A 1 239 ? 65.225 61.390  17.715  1.00 21.04 ? 301  LEU A O   1 
ATOM   1695 C CB  . LEU A 1 239 ? 62.178 60.173  17.278  1.00 20.58 ? 301  LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 239 ? 60.949 61.008  16.869  1.00 21.97 ? 301  LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 239 ? 61.058 61.730  15.561  1.00 16.21 ? 301  LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 239 ? 59.655 60.201  16.976  1.00 18.74 ? 301  LEU A CD2 1 
ATOM   1699 N N   . VAL A 1 240 ? 64.905 59.213  18.119  1.00 20.14 ? 302  VAL A N   1 
ATOM   1700 C CA  . VAL A 1 240 ? 65.892 59.145  19.150  1.00 19.40 ? 302  VAL A CA  1 
ATOM   1701 C C   . VAL A 1 240 ? 67.240 59.468  18.552  1.00 18.84 ? 302  VAL A C   1 
ATOM   1702 O O   . VAL A 1 240 ? 67.944 60.235  19.129  1.00 19.21 ? 302  VAL A O   1 
ATOM   1703 C CB  . VAL A 1 240 ? 65.869 57.825  19.949  1.00 19.01 ? 302  VAL A CB  1 
ATOM   1704 C CG1 . VAL A 1 240 ? 67.108 57.709  20.848  1.00 21.21 ? 302  VAL A CG1 1 
ATOM   1705 C CG2 . VAL A 1 240 ? 64.606 57.770  20.804  1.00 18.31 ? 302  VAL A CG2 1 
ATOM   1706 N N   . GLU A 1 241 ? 67.551 58.951  17.366  1.00 18.73 ? 303  GLU A N   1 
ATOM   1707 C CA  . GLU A 1 241 ? 68.762 59.314  16.639  1.00 18.25 ? 303  GLU A CA  1 
ATOM   1708 C C   . GLU A 1 241 ? 68.914 60.810  16.302  1.00 18.32 ? 303  GLU A C   1 
ATOM   1709 O O   . GLU A 1 241 ? 70.028 61.331  16.262  1.00 17.26 ? 303  GLU A O   1 
ATOM   1710 C CB  . GLU A 1 241 ? 68.881 58.477  15.350  1.00 17.79 ? 303  GLU A CB  1 
ATOM   1711 C CG  . GLU A 1 241 ? 69.111 56.986  15.692  1.00 17.97 ? 303  GLU A CG  1 
ATOM   1712 C CD  . GLU A 1 241 ? 69.252 56.106  14.487  1.00 17.87 ? 303  GLU A CD  1 
ATOM   1713 O OE1 . GLU A 1 241 ? 69.053 56.604  13.366  1.00 18.14 ? 303  GLU A OE1 1 
ATOM   1714 O OE2 . GLU A 1 241 ? 69.540 54.902  14.660  1.00 20.28 ? 303  GLU A OE2 1 
ATOM   1715 N N   . LEU A 1 242 ? 67.804 61.487  16.049  1.00 18.15 ? 304  LEU A N   1 
ATOM   1716 C CA  . LEU A 1 242 ? 67.829 62.921  15.708  1.00 18.52 ? 304  LEU A CA  1 
ATOM   1717 C C   . LEU A 1 242 ? 68.075 63.842  16.931  1.00 18.99 ? 304  LEU A C   1 
ATOM   1718 O O   . LEU A 1 242 ? 68.343 65.053  16.770  1.00 18.21 ? 304  LEU A O   1 
ATOM   1719 C CB  . LEU A 1 242 ? 66.524 63.311  15.005  1.00 18.24 ? 304  LEU A CB  1 
ATOM   1720 C CG  . LEU A 1 242 ? 66.334 62.787  13.563  1.00 18.05 ? 304  LEU A CG  1 
ATOM   1721 C CD1 . LEU A 1 242 ? 64.869 62.886  13.080  1.00 14.80 ? 304  LEU A CD1 1 
ATOM   1722 C CD2 . LEU A 1 242 ? 67.227 63.497  12.608  1.00 15.21 ? 304  LEU A CD2 1 
ATOM   1723 N N   . LEU A 1 243 ? 68.007 63.271  18.142  1.00 19.33 ? 305  LEU A N   1 
ATOM   1724 C CA  . LEU A 1 243 ? 68.392 63.996  19.355  1.00 19.63 ? 305  LEU A CA  1 
ATOM   1725 C C   . LEU A 1 243 ? 69.860 64.403  19.275  1.00 20.46 ? 305  LEU A C   1 
ATOM   1726 O O   . LEU A 1 243 ? 70.276 65.336  19.957  1.00 20.58 ? 305  LEU A O   1 
ATOM   1727 C CB  . LEU A 1 243 ? 68.135 63.164  20.622  1.00 19.11 ? 305  LEU A CB  1 
ATOM   1728 C CG  . LEU A 1 243 ? 66.689 62.748  20.928  1.00 18.55 ? 305  LEU A CG  1 
ATOM   1729 C CD1 . LEU A 1 243 ? 66.615 61.909  22.214  1.00 14.95 ? 305  LEU A CD1 1 
ATOM   1730 C CD2 . LEU A 1 243 ? 65.797 63.986  21.018  1.00 19.19 ? 305  LEU A CD2 1 
ATOM   1731 N N   . MET A 1 244 ? 70.635 63.730  18.420  1.00 21.55 ? 306  MET A N   1 
ATOM   1732 C CA  . MET A 1 244 ? 72.074 64.039  18.251  1.00 22.35 ? 306  MET A CA  1 
ATOM   1733 C C   . MET A 1 244 ? 72.408 64.873  16.990  1.00 22.59 ? 306  MET A C   1 
ATOM   1734 O O   . MET A 1 244 ? 73.566 65.023  16.616  1.00 22.52 ? 306  MET A O   1 
ATOM   1735 C CB  . MET A 1 244 ? 72.854 62.736  18.260  1.00 22.83 ? 306  MET A CB  1 
ATOM   1736 C CG  . MET A 1 244 ? 72.795 62.016  19.592  1.00 25.60 ? 306  MET A CG  1 
ATOM   1737 S SD  . MET A 1 244 ? 73.895 62.802  20.848  1.00 27.79 ? 306  MET A SD  1 
ATOM   1738 C CE  . MET A 1 244 ? 72.638 63.714  21.734  1.00 29.18 ? 306  MET A CE  1 
ATOM   1739 N N   . HIS A 1 245 ? 71.395 65.463  16.370  1.00 23.21 ? 307  HIS A N   1 
ATOM   1740 C CA  . HIS A 1 245 ? 71.616 66.340  15.219  1.00 23.47 ? 307  HIS A CA  1 
ATOM   1741 C C   . HIS A 1 245 ? 72.396 67.602  15.622  1.00 23.59 ? 307  HIS A C   1 
ATOM   1742 O O   . HIS A 1 245 ? 72.372 68.007  16.788  1.00 22.94 ? 307  HIS A O   1 
ATOM   1743 C CB  . HIS A 1 245 ? 70.268 66.715  14.592  1.00 23.86 ? 307  HIS A CB  1 
ATOM   1744 C CG  . HIS A 1 245 ? 70.337 67.082  13.136  1.00 23.99 ? 307  HIS A CG  1 
ATOM   1745 N ND1 . HIS A 1 245 ? 70.784 68.306  12.692  1.00 23.04 ? 307  HIS A ND1 1 
ATOM   1746 C CD2 . HIS A 1 245 ? 69.942 66.403  12.032  1.00 25.22 ? 307  HIS A CD2 1 
ATOM   1747 C CE1 . HIS A 1 245 ? 70.701 68.350  11.375  1.00 25.17 ? 307  HIS A CE1 1 
ATOM   1748 N NE2 . HIS A 1 245 ? 70.182 67.211  10.952  1.00 25.24 ? 307  HIS A NE2 1 
ATOM   1749 N N   . ASN A 1 246 ? 73.098 68.188  14.648  1.00 23.77 ? 308  ASN A N   1 
ATOM   1750 C CA  . ASN A 1 246 ? 73.844 69.443  14.815  1.00 24.57 ? 308  ASN A CA  1 
ATOM   1751 C C   . ASN A 1 246 ? 72.993 70.706  14.924  1.00 24.18 ? 308  ASN A C   1 
ATOM   1752 O O   . ASN A 1 246 ? 73.472 71.751  15.364  1.00 24.35 ? 308  ASN A O   1 
ATOM   1753 C CB  . ASN A 1 246 ? 74.763 69.673  13.604  1.00 25.52 ? 308  ASN A CB  1 
ATOM   1754 C CG  . ASN A 1 246 ? 75.916 68.695  13.539  1.00 28.76 ? 308  ASN A CG  1 
ATOM   1755 O OD1 . ASN A 1 246 ? 76.226 67.985  14.514  1.00 32.96 ? 308  ASN A OD1 1 
ATOM   1756 N ND2 . ASN A 1 246 ? 76.578 68.656  12.374  1.00 32.05 ? 308  ASN A ND2 1 
ATOM   1757 N N   . ASP A 1 247 ? 71.752 70.622  14.484  1.00 23.87 ? 309  ASP A N   1 
ATOM   1758 C CA  . ASP A 1 247 ? 70.905 71.787  14.334  1.00 23.53 ? 309  ASP A CA  1 
ATOM   1759 C C   . ASP A 1 247 ? 69.802 71.685  15.387  1.00 22.88 ? 309  ASP A C   1 
ATOM   1760 O O   . ASP A 1 247 ? 69.068 70.695  15.439  1.00 22.00 ? 309  ASP A O   1 
ATOM   1761 C CB  . ASP A 1 247 ? 70.345 71.819  12.895  1.00 24.10 ? 309  ASP A CB  1 
ATOM   1762 C CG  . ASP A 1 247 ? 69.798 73.192  12.482  1.00 24.95 ? 309  ASP A CG  1 
ATOM   1763 O OD1 . ASP A 1 247 ? 69.285 73.946  13.348  1.00 26.50 ? 309  ASP A OD1 1 
ATOM   1764 O OD2 . ASP A 1 247 ? 69.881 73.505  11.264  1.00 29.47 ? 309  ASP A OD2 1 
ATOM   1765 N N   . TYR A 1 248 ? 69.712 72.707  16.235  1.00 22.51 ? 310  TYR A N   1 
ATOM   1766 C CA  . TYR A 1 248 ? 68.691 72.782  17.281  1.00 22.20 ? 310  TYR A CA  1 
ATOM   1767 C C   . TYR A 1 248 ? 67.292 72.823  16.689  1.00 21.64 ? 310  TYR A C   1 
ATOM   1768 O O   . TYR A 1 248 ? 66.327 72.470  17.362  1.00 21.34 ? 310  TYR A O   1 
ATOM   1769 C CB  . TYR A 1 248 ? 68.899 74.017  18.178  1.00 23.02 ? 310  TYR A CB  1 
ATOM   1770 C CG  . TYR A 1 248 ? 70.212 74.069  18.954  1.00 23.32 ? 310  TYR A CG  1 
ATOM   1771 C CD1 . TYR A 1 248 ? 70.663 72.972  19.688  1.00 23.71 ? 310  TYR A CD1 1 
ATOM   1772 C CD2 . TYR A 1 248 ? 70.983 75.231  18.980  1.00 24.69 ? 310  TYR A CD2 1 
ATOM   1773 C CE1 . TYR A 1 248 ? 71.849 73.028  20.417  1.00 23.14 ? 310  TYR A CE1 1 
ATOM   1774 C CE2 . TYR A 1 248 ? 72.181 75.294  19.707  1.00 24.30 ? 310  TYR A CE2 1 
ATOM   1775 C CZ  . TYR A 1 248 ? 72.601 74.179  20.420  1.00 24.42 ? 310  TYR A CZ  1 
ATOM   1776 O OH  . TYR A 1 248 ? 73.776 74.215  21.146  1.00 24.66 ? 310  TYR A OH  1 
ATOM   1777 N N   . LYS A 1 249 ? 67.182 73.259  15.437  1.00 21.00 ? 311  LYS A N   1 
ATOM   1778 C CA  . LYS A 1 249 ? 65.909 73.248  14.711  1.00 20.66 ? 311  LYS A CA  1 
ATOM   1779 C C   . LYS A 1 249 ? 65.388 71.849  14.524  1.00 19.65 ? 311  LYS A C   1 
ATOM   1780 O O   . LYS A 1 249 ? 64.192 71.670  14.409  1.00 18.79 ? 311  LYS A O   1 
ATOM   1781 C CB  . LYS A 1 249 ? 66.030 73.926  13.336  1.00 20.76 ? 311  LYS A CB  1 
ATOM   1782 C CG  . LYS A 1 249 ? 66.320 75.409  13.441  1.00 22.45 ? 311  LYS A CG  1 
ATOM   1783 C CD  . LYS A 1 249 ? 66.620 76.071  12.090  1.00 22.72 ? 311  LYS A CD  1 
ATOM   1784 C CE  . LYS A 1 249 ? 67.287 77.445  12.305  1.00 23.50 ? 311  LYS A CE  1 
ATOM   1785 N NZ  . LYS A 1 249 ? 67.360 78.257  11.050  1.00 24.46 ? 311  LYS A NZ  1 
ATOM   1786 N N   . VAL A 1 250 ? 66.273 70.856  14.466  1.00 18.88 ? 312  VAL A N   1 
ATOM   1787 C CA  . VAL A 1 250 ? 65.813 69.458  14.444  1.00 18.78 ? 312  VAL A CA  1 
ATOM   1788 C C   . VAL A 1 250 ? 65.678 68.871  15.869  1.00 18.50 ? 312  VAL A C   1 
ATOM   1789 O O   . VAL A 1 250 ? 64.671 68.234  16.183  1.00 17.98 ? 312  VAL A O   1 
ATOM   1790 C CB  . VAL A 1 250 ? 66.714 68.565  13.559  1.00 18.83 ? 312  VAL A CB  1 
ATOM   1791 C CG1 . VAL A 1 250 ? 66.186 67.131  13.525  1.00 16.92 ? 312  VAL A CG1 1 
ATOM   1792 C CG2 . VAL A 1 250 ? 66.798 69.148  12.130  1.00 18.06 ? 312  VAL A CG2 1 
ATOM   1793 N N   . VAL A 1 251 ? 66.663 69.126  16.730  1.00 18.14 ? 313  VAL A N   1 
ATOM   1794 C CA  . VAL A 1 251 ? 66.678 68.568  18.094  1.00 17.99 ? 313  VAL A CA  1 
ATOM   1795 C C   . VAL A 1 251 ? 65.478 68.990  18.934  1.00 18.62 ? 313  VAL A C   1 
ATOM   1796 O O   . VAL A 1 251 ? 64.862 68.140  19.572  1.00 19.70 ? 313  VAL A O   1 
ATOM   1797 C CB  . VAL A 1 251 ? 67.952 68.946  18.868  1.00 18.61 ? 313  VAL A CB  1 
ATOM   1798 C CG1 . VAL A 1 251 ? 67.918 68.310  20.278  1.00 17.17 ? 313  VAL A CG1 1 
ATOM   1799 C CG2 . VAL A 1 251 ? 69.195 68.520  18.081  1.00 16.66 ? 313  VAL A CG2 1 
ATOM   1800 N N   . SER A 1 252 ? 65.133 70.278  18.930  1.00 18.16 ? 314  SER A N   1 
ATOM   1801 C CA  . SER A 1 252 ? 63.968 70.755  19.675  1.00 18.09 ? 314  SER A CA  1 
ATOM   1802 C C   . SER A 1 252 ? 62.707 69.930  19.388  1.00 18.43 ? 314  SER A C   1 
ATOM   1803 O O   . SER A 1 252 ? 62.199 69.310  20.302  1.00 18.40 ? 314  SER A O   1 
ATOM   1804 C CB  . SER A 1 252 ? 63.715 72.230  19.442  1.00 17.45 ? 314  SER A CB  1 
ATOM   1805 O OG  . SER A 1 252 ? 64.864 72.955  19.816  1.00 18.69 ? 314  SER A OG  1 
ATOM   1806 N N   . PRO A 1 253 ? 62.214 69.904  18.127  1.00 18.62 ? 315  PRO A N   1 
ATOM   1807 C CA  . PRO A 1 253 ? 61.044 69.058  17.847  1.00 18.56 ? 315  PRO A CA  1 
ATOM   1808 C C   . PRO A 1 253 ? 61.221 67.552  18.010  1.00 18.76 ? 315  PRO A C   1 
ATOM   1809 O O   . PRO A 1 253 ? 60.274 66.890  18.372  1.00 19.97 ? 315  PRO A O   1 
ATOM   1810 C CB  . PRO A 1 253 ? 60.715 69.382  16.400  1.00 18.95 ? 315  PRO A CB  1 
ATOM   1811 C CG  . PRO A 1 253 ? 61.975 69.958  15.818  1.00 18.36 ? 315  PRO A CG  1 
ATOM   1812 C CD  . PRO A 1 253 ? 62.638 70.662  16.933  1.00 18.66 ? 315  PRO A CD  1 
ATOM   1813 N N   . ALA A 1 254 ? 62.387 67.005  17.689  1.00 19.14 ? 316  ALA A N   1 
ATOM   1814 C CA  . ALA A 1 254 ? 62.650 65.583  17.898  1.00 18.94 ? 316  ALA A CA  1 
ATOM   1815 C C   . ALA A 1 254 ? 62.518 65.277  19.393  1.00 19.09 ? 316  ALA A C   1 
ATOM   1816 O O   . ALA A 1 254 ? 61.779 64.361  19.802  1.00 19.37 ? 316  ALA A O   1 
ATOM   1817 C CB  . ALA A 1 254 ? 64.023 65.215  17.377  1.00 18.45 ? 316  ALA A CB  1 
ATOM   1818 N N   . LEU A 1 255 ? 63.161 66.112  20.204  1.00 18.83 ? 317  LEU A N   1 
ATOM   1819 C CA  . LEU A 1 255 ? 63.063 66.022  21.662  1.00 18.85 ? 317  LEU A CA  1 
ATOM   1820 C C   . LEU A 1 255 ? 61.642 66.192  22.201  1.00 19.46 ? 317  LEU A C   1 
ATOM   1821 O O   . LEU A 1 255 ? 61.280 65.569  23.193  1.00 20.64 ? 317  LEU A O   1 
ATOM   1822 C CB  . LEU A 1 255 ? 63.985 67.050  22.300  1.00 18.64 ? 317  LEU A CB  1 
ATOM   1823 C CG  . LEU A 1 255 ? 64.216 67.011  23.797  1.00 18.60 ? 317  LEU A CG  1 
ATOM   1824 C CD1 . LEU A 1 255 ? 64.450 65.577  24.288  1.00 18.78 ? 317  LEU A CD1 1 
ATOM   1825 C CD2 . LEU A 1 255 ? 65.402 67.933  24.102  1.00 17.80 ? 317  LEU A CD2 1 
ATOM   1826 N N   . ARG A 1 256 ? 60.830 66.997  21.532  1.00 19.15 ? 318  ARG A N   1 
ATOM   1827 C CA  . ARG A 1 256 ? 59.472 67.243  21.967  1.00 18.30 ? 318  ARG A CA  1 
ATOM   1828 C C   . ARG A 1 256 ? 58.595 66.025  21.679  1.00 17.40 ? 318  ARG A C   1 
ATOM   1829 O O   . ARG A 1 256 ? 57.731 65.686  22.506  1.00 18.55 ? 318  ARG A O   1 
ATOM   1830 C CB  . ARG A 1 256 ? 58.935 68.479  21.259  1.00 19.49 ? 318  ARG A CB  1 
ATOM   1831 C CG  . ARG A 1 256 ? 57.775 69.178  21.938  1.00 20.91 ? 318  ARG A CG  1 
ATOM   1832 C CD  . ARG A 1 256 ? 57.271 70.322  21.019  1.00 23.64 ? 318  ARG A CD  1 
ATOM   1833 N NE  . ARG A 1 256 ? 56.228 71.194  21.616  1.00 26.66 ? 318  ARG A NE  1 
ATOM   1834 C CZ  . ARG A 1 256 ? 56.490 72.305  22.307  1.00 30.37 ? 318  ARG A CZ  1 
ATOM   1835 N NH1 . ARG A 1 256 ? 57.755 72.696  22.548  1.00 32.49 ? 318  ARG A NH1 1 
ATOM   1836 N NH2 . ARG A 1 256 ? 55.478 73.022  22.794  1.00 31.96 ? 318  ARG A NH2 1 
ATOM   1837 N N   . ALA A 1 257 ? 58.813 65.376  20.524  1.00 13.67 ? 319  ALA A N   1 
ATOM   1838 C CA  . ALA A 1 257 ? 58.140 64.118  20.175  1.00 11.71 ? 319  ALA A CA  1 
ATOM   1839 C C   . ALA A 1 257 ? 58.488 62.978  21.127  1.00 9.38  ? 319  ALA A C   1 
ATOM   1840 O O   . ALA A 1 257 ? 57.606 62.309  21.653  1.00 9.04  ? 319  ALA A O   1 
ATOM   1841 C CB  . ALA A 1 257 ? 58.465 63.696  18.731  1.00 10.46 ? 319  ALA A CB  1 
ATOM   1842 N N   . VAL A 1 258 ? 59.776 62.764  21.316  1.00 7.34  ? 320  VAL A N   1 
ATOM   1843 C CA  . VAL A 1 258 ? 60.277 61.780  22.251  1.00 6.91  ? 320  VAL A CA  1 
ATOM   1844 C C   . VAL A 1 258 ? 59.696 61.966  23.674  1.00 5.55  ? 320  VAL A C   1 
ATOM   1845 O O   . VAL A 1 258 ? 59.267 61.028  24.307  1.00 3.92  ? 320  VAL A O   1 
ATOM   1846 C CB  . VAL A 1 258 ? 61.790 61.900  22.363  1.00 6.81  ? 320  VAL A CB  1 
ATOM   1847 C CG1 . VAL A 1 258 ? 62.285 61.076  23.531  1.00 6.84  ? 320  VAL A CG1 1 
ATOM   1848 C CG2 . VAL A 1 258 ? 62.465 61.472  21.045  1.00 6.44  ? 320  VAL A CG2 1 
ATOM   1849 N N   . GLY A 1 259 ? 59.691 63.204  24.145  1.00 4.56  ? 321  GLY A N   1 
ATOM   1850 C CA  . GLY A 1 259 ? 59.255 63.500  25.472  1.00 4.42  ? 321  GLY A CA  1 
ATOM   1851 C C   . GLY A 1 259 ? 57.809 63.182  25.625  1.00 3.08  ? 321  GLY A C   1 
ATOM   1852 O O   . GLY A 1 259 ? 57.388 62.739  26.685  1.00 2.47  ? 321  GLY A O   1 
ATOM   1853 N N   . ASN A 1 260 ? 57.049 63.404  24.565  1.00 3.37  ? 322  ASN A N   1 
ATOM   1854 C CA  . ASN A 1 260 ? 55.597 63.089  24.566  1.00 3.57  ? 322  ASN A CA  1 
ATOM   1855 C C   . ASN A 1 260 ? 55.303 61.576  24.492  1.00 3.45  ? 322  ASN A C   1 
ATOM   1856 O O   . ASN A 1 260 ? 54.286 61.094  25.005  1.00 3.36  ? 322  ASN A O   1 
ATOM   1857 C CB  . ASN A 1 260 ? 54.916 63.758  23.387  1.00 3.12  ? 322  ASN A CB  1 
ATOM   1858 C CG  . ASN A 1 260 ? 54.504 65.193  23.661  1.00 4.62  ? 322  ASN A CG  1 
ATOM   1859 O OD1 . ASN A 1 260 ? 54.265 65.593  24.800  1.00 6.92  ? 322  ASN A OD1 1 
ATOM   1860 N ND2 . ASN A 1 260 ? 54.370 65.964  22.600  1.00 6.48  ? 322  ASN A ND2 1 
ATOM   1861 N N   . ILE A 1 261 ? 56.180 60.832  23.823  1.00 3.31  ? 323  ILE A N   1 
ATOM   1862 C CA  . ILE A 1 261 ? 55.940 59.401  23.653  1.00 3.40  ? 323  ILE A CA  1 
ATOM   1863 C C   . ILE A 1 261 ? 56.179 58.732  25.015  1.00 3.33  ? 323  ILE A C   1 
ATOM   1864 O O   . ILE A 1 261 ? 55.379 57.889  25.449  1.00 2.29  ? 323  ILE A O   1 
ATOM   1865 C CB  . ILE A 1 261 ? 56.812 58.783  22.532  1.00 3.08  ? 323  ILE A CB  1 
ATOM   1866 C CG1 . ILE A 1 261 ? 56.348 59.263  21.150  1.00 2.95  ? 323  ILE A CG1 1 
ATOM   1867 C CG2 . ILE A 1 261 ? 56.741 57.266  22.576  1.00 3.34  ? 323  ILE A CG2 1 
ATOM   1868 C CD1 . ILE A 1 261 ? 57.474 59.198  20.093  1.00 2.63  ? 323  ILE A CD1 1 
ATOM   1869 N N   . VAL A 1 262 ? 57.244 59.154  25.715  1.00 2.84  ? 324  VAL A N   1 
ATOM   1870 C CA  . VAL A 1 262 ? 57.482 58.696  27.097  1.00 2.49  ? 324  VAL A CA  1 
ATOM   1871 C C   . VAL A 1 262 ? 56.528 59.241  28.177  1.00 2.82  ? 324  VAL A C   1 
ATOM   1872 O O   . VAL A 1 262 ? 56.800 59.054  29.361  1.00 2.01  ? 324  VAL A O   1 
ATOM   1873 C CB  . VAL A 1 262 ? 58.964 58.897  27.573  1.00 3.15  ? 324  VAL A CB  1 
ATOM   1874 C CG1 . VAL A 1 262 ? 59.922 58.210  26.609  1.00 2.00  ? 324  VAL A CG1 1 
ATOM   1875 C CG2 . VAL A 1 262 ? 59.269 60.356  27.767  1.00 3.46  ? 324  VAL A CG2 1 
ATOM   1876 N N   . THR A 1 263 ? 55.428 59.909  27.786  1.00 2.22  ? 325  THR A N   1 
ATOM   1877 C CA  . THR A 1 263 ? 54.290 60.119  28.674  1.00 2.08  ? 325  THR A CA  1 
ATOM   1878 C C   . THR A 1 263 ? 53.314 58.943  28.513  1.00 2.89  ? 325  THR A C   1 
ATOM   1879 O O   . THR A 1 263 ? 52.224 58.938  29.117  1.00 2.95  ? 325  THR A O   1 
ATOM   1880 C CB  . THR A 1 263 ? 53.485 61.415  28.332  1.00 2.59  ? 325  THR A CB  1 
ATOM   1881 O OG1 . THR A 1 263 ? 52.789 61.238  27.093  1.00 2.00  ? 325  THR A OG1 1 
ATOM   1882 C CG2 . THR A 1 263 ? 54.417 62.658  28.243  1.00 2.00  ? 325  THR A CG2 1 
ATOM   1883 N N   . GLY A 1 264 ? 53.706 57.975  27.673  1.00 3.08  ? 326  GLY A N   1 
ATOM   1884 C CA  . GLY A 1 264 ? 53.024 56.703  27.505  1.00 2.53  ? 326  GLY A CA  1 
ATOM   1885 C C   . GLY A 1 264 ? 53.133 55.791  28.717  1.00 2.80  ? 326  GLY A C   1 
ATOM   1886 O O   . GLY A 1 264 ? 53.943 56.040  29.613  1.00 2.00  ? 326  GLY A O   1 
ATOM   1887 N N   . ASP A 1 265 ? 52.293 54.739  28.761  1.00 3.20  ? 327  ASP A N   1 
ATOM   1888 C CA  . ASP A 1 265 ? 52.444 53.692  29.789  1.00 3.34  ? 327  ASP A CA  1 
ATOM   1889 C C   . ASP A 1 265 ? 53.864 53.163  29.713  1.00 3.40  ? 327  ASP A C   1 
ATOM   1890 O O   . ASP A 1 265 ? 54.622 53.692  28.956  1.00 3.73  ? 327  ASP A O   1 
ATOM   1891 C CB  . ASP A 1 265 ? 51.457 52.564  29.606  1.00 3.11  ? 327  ASP A CB  1 
ATOM   1892 C CG  . ASP A 1 265 ? 51.629 51.828  28.303  1.00 4.87  ? 327  ASP A CG  1 
ATOM   1893 O OD1 . ASP A 1 265 ? 52.798 51.495  27.875  1.00 2.00  ? 327  ASP A OD1 1 
ATOM   1894 O OD2 . ASP A 1 265 ? 50.562 51.555  27.716  1.00 2.00  ? 327  ASP A OD2 1 
ATOM   1895 N N   . ASP A 1 266 ? 54.185 52.113  30.482  1.00 3.33  ? 328  ASP A N   1 
ATOM   1896 C CA  . ASP A 1 266 ? 55.536 51.636  30.681  1.00 3.93  ? 328  ASP A CA  1 
ATOM   1897 C C   . ASP A 1 266 ? 56.126 50.875  29.492  1.00 2.79  ? 328  ASP A C   1 
ATOM   1898 O O   . ASP A 1 266 ? 57.349 50.811  29.332  1.00 3.71  ? 328  ASP A O   1 
ATOM   1899 C CB  . ASP A 1 266 ? 55.571 50.725  31.942  1.00 4.28  ? 328  ASP A CB  1 
ATOM   1900 C CG  . ASP A 1 266 ? 55.263 51.481  33.270  1.00 6.69  ? 328  ASP A CG  1 
ATOM   1901 O OD1 . ASP A 1 266 ? 54.811 52.682  33.306  1.00 5.40  ? 328  ASP A OD1 1 
ATOM   1902 O OD2 . ASP A 1 266 ? 55.460 50.820  34.315  1.00 11.31 ? 328  ASP A OD2 1 
ATOM   1903 N N   . ILE A 1 267 ? 55.253 50.234  28.727  1.00 2.47  ? 329  ILE A N   1 
ATOM   1904 C CA  . ILE A 1 267 ? 55.544 49.527  27.452  1.00 2.53  ? 329  ILE A CA  1 
ATOM   1905 C C   . ILE A 1 267 ? 55.992 50.559  26.393  1.00 2.35  ? 329  ILE A C   1 
ATOM   1906 O O   . ILE A 1 267 ? 57.132 50.500  25.827  1.00 2.00  ? 329  ILE A O   1 
ATOM   1907 C CB  . ILE A 1 267 ? 54.243 48.684  26.997  1.00 2.00  ? 329  ILE A CB  1 
ATOM   1908 C CG1 . ILE A 1 267 ? 53.984 47.464  27.888  1.00 2.00  ? 329  ILE A CG1 1 
ATOM   1909 C CG2 . ILE A 1 267 ? 54.370 48.133  25.570  1.00 3.86  ? 329  ILE A CG2 1 
ATOM   1910 C CD1 . ILE A 1 267 ? 52.468 46.747  27.640  1.00 3.48  ? 329  ILE A CD1 1 
ATOM   1911 N N   . GLN A 1 268 ? 55.174 51.589  26.239  1.00 2.00  ? 330  GLN A N   1 
ATOM   1912 C CA  . GLN A 1 268 ? 55.447 52.698  25.323  1.00 2.04  ? 330  GLN A CA  1 
ATOM   1913 C C   . GLN A 1 268 ? 56.760 53.429  25.625  1.00 3.40  ? 330  GLN A C   1 
ATOM   1914 O O   . GLN A 1 268 ? 57.554 53.767  24.724  1.00 4.63  ? 330  GLN A O   1 
ATOM   1915 C CB  . GLN A 1 268 ? 54.241 53.638  25.328  1.00 2.43  ? 330  GLN A CB  1 
ATOM   1916 C CG  . GLN A 1 268 ? 53.006 53.064  24.606  1.00 2.00  ? 330  GLN A CG  1 
ATOM   1917 C CD  . GLN A 1 268 ? 51.757 53.875  24.824  1.00 3.48  ? 330  GLN A CD  1 
ATOM   1918 O OE1 . GLN A 1 268 ? 51.631 54.510  25.858  1.00 5.59  ? 330  GLN A OE1 1 
ATOM   1919 N NE2 . GLN A 1 268 ? 50.811 53.861  23.844  1.00 2.00  ? 330  GLN A NE2 1 
ATOM   1920 N N   . THR A 1 269 ? 57.066 53.614  26.907  1.00 3.20  ? 331  THR A N   1 
ATOM   1921 C CA  . THR A 1 269 ? 58.262 54.337  27.247  1.00 2.00  ? 331  THR A CA  1 
ATOM   1922 C C   . THR A 1 269 ? 59.493 53.432  27.138  1.00 2.00  ? 331  THR A C   1 
ATOM   1923 O O   . THR A 1 269 ? 60.545 53.905  26.784  1.00 2.00  ? 331  THR A O   1 
ATOM   1924 C CB  . THR A 1 269 ? 58.126 55.192  28.597  1.00 2.53  ? 331  THR A CB  1 
ATOM   1925 O OG1 . THR A 1 269 ? 59.079 54.823  29.578  1.00 6.17  ? 331  THR A OG1 1 
ATOM   1926 C CG2 . THR A 1 269 ? 56.702 55.249  29.179  1.00 2.00  ? 331  THR A CG2 1 
ATOM   1927 N N   . GLN A 1 270 ? 59.340 52.127  27.332  1.00 2.00  ? 332  GLN A N   1 
ATOM   1928 C CA  . GLN A 1 270 ? 60.426 51.159  27.032  1.00 2.00  ? 332  GLN A CA  1 
ATOM   1929 C C   . GLN A 1 270 ? 60.775 51.176  25.561  1.00 2.00  ? 332  GLN A C   1 
ATOM   1930 O O   . GLN A 1 270 ? 61.988 51.099  25.202  1.00 2.00  ? 332  GLN A O   1 
ATOM   1931 C CB  . GLN A 1 270 ? 60.057 49.721  27.409  1.00 2.00  ? 332  GLN A CB  1 
ATOM   1932 C CG  . GLN A 1 270 ? 61.233 48.749  27.566  1.00 2.00  ? 332  GLN A CG  1 
ATOM   1933 C CD  . GLN A 1 270 ? 62.171 49.215  28.601  1.00 2.67  ? 332  GLN A CD  1 
ATOM   1934 O OE1 . GLN A 1 270 ? 61.754 49.629  29.688  1.00 5.34  ? 332  GLN A OE1 1 
ATOM   1935 N NE2 . GLN A 1 270 ? 63.443 49.236  28.267  1.00 2.00  ? 332  GLN A NE2 1 
ATOM   1936 N N   . VAL A 1 271 ? 59.773 51.340  24.708  1.00 2.00  ? 333  VAL A N   1 
ATOM   1937 C CA  . VAL A 1 271 ? 60.044 51.454  23.273  1.00 2.00  ? 333  VAL A CA  1 
ATOM   1938 C C   . VAL A 1 271 ? 61.177 52.462  22.981  1.00 2.00  ? 333  VAL A C   1 
ATOM   1939 O O   . VAL A 1 271 ? 61.867 52.234  22.085  1.00 2.00  ? 333  VAL A O   1 
ATOM   1940 C CB  . VAL A 1 271 ? 58.888 51.881  22.396  1.00 2.00  ? 333  VAL A CB  1 
ATOM   1941 C CG1 . VAL A 1 271 ? 59.349 52.028  20.968  1.00 2.00  ? 333  VAL A CG1 1 
ATOM   1942 C CG2 . VAL A 1 271 ? 57.550 50.883  22.530  1.00 2.00  ? 333  VAL A CG2 1 
ATOM   1943 N N   . ILE A 1 272 ? 61.247 53.587  23.698  1.00 2.02  ? 334  ILE A N   1 
ATOM   1944 C CA  . ILE A 1 272 ? 62.281 54.695  23.574  1.00 2.00  ? 334  ILE A CA  1 
ATOM   1945 C C   . ILE A 1 272 ? 63.559 54.394  24.266  1.00 2.69  ? 334  ILE A C   1 
ATOM   1946 O O   . ILE A 1 272 ? 64.639 54.823  23.836  1.00 3.73  ? 334  ILE A O   1 
ATOM   1947 C CB  . ILE A 1 272 ? 61.693 56.021  24.203  1.00 2.00  ? 334  ILE A CB  1 
ATOM   1948 C CG1 . ILE A 1 272 ? 60.558 56.595  23.320  1.00 3.28  ? 334  ILE A CG1 1 
ATOM   1949 C CG2 . ILE A 1 272 ? 62.724 57.061  24.448  1.00 2.95  ? 334  ILE A CG2 1 
ATOM   1950 C CD1 . ILE A 1 272 ? 61.063 57.154  21.918  1.00 3.02  ? 334  ILE A CD1 1 
ATOM   1951 N N   . LEU A 1 273 ? 63.465 53.729  25.417  1.00 4.23  ? 335  LEU A N   1 
ATOM   1952 C CA  . LEU A 1 273 ? 64.661 53.387  26.162  1.00 4.07  ? 335  LEU A CA  1 
ATOM   1953 C C   . LEU A 1 273 ? 65.425 52.390  25.371  1.00 3.78  ? 335  LEU A C   1 
ATOM   1954 O O   . LEU A 1 273 ? 66.670 52.422  25.339  1.00 3.95  ? 335  LEU A O   1 
ATOM   1955 C CB  . LEU A 1 273 ? 64.329 52.851  27.567  1.00 5.19  ? 335  LEU A CB  1 
ATOM   1956 C CG  . LEU A 1 273 ? 63.571 53.810  28.553  1.00 5.20  ? 335  LEU A CG  1 
ATOM   1957 C CD1 . LEU A 1 273 ? 63.617 53.244  29.960  1.00 4.32  ? 335  LEU A CD1 1 
ATOM   1958 C CD2 . LEU A 1 273 ? 64.157 55.210  28.609  1.00 5.81  ? 335  LEU A CD2 1 
ATOM   1959 N N   . ASN A 1 274 ? 64.716 51.503  24.701  1.00 2.00  ? 336  ASN A N   1 
ATOM   1960 C CA  . ASN A 1 274 ? 65.417 50.548  23.837  1.00 2.28  ? 336  ASN A CA  1 
ATOM   1961 C C   . ASN A 1 274 ? 66.203 51.156  22.647  1.00 2.00  ? 336  ASN A C   1 
ATOM   1962 O O   . ASN A 1 274 ? 66.661 50.414  21.818  1.00 2.00  ? 336  ASN A O   1 
ATOM   1963 C CB  . ASN A 1 274 ? 64.403 49.554  23.239  1.00 2.00  ? 336  ASN A CB  1 
ATOM   1964 C CG  . ASN A 1 274 ? 63.799 48.591  24.283  1.00 4.52  ? 336  ASN A CG  1 
ATOM   1965 O OD1 . ASN A 1 274 ? 64.369 48.386  25.345  1.00 5.85  ? 336  ASN A OD1 1 
ATOM   1966 N ND2 . ASN A 1 274 ? 62.646 47.956  23.938  1.00 3.01  ? 336  ASN A ND2 1 
ATOM   1967 N N   . CYS A 1 275 ? 66.238 52.473  22.460  1.00 2.00  ? 337  CYS A N   1 
ATOM   1968 C CA  . CYS A 1 275 ? 66.760 53.008  21.222  1.00 2.00  ? 337  CYS A CA  1 
ATOM   1969 C C   . CYS A 1 275 ? 67.996 53.739  21.697  1.00 2.00  ? 337  CYS A C   1 
ATOM   1970 O O   . CYS A 1 275 ? 68.504 54.527  20.955  1.00 2.00  ? 337  CYS A O   1 
ATOM   1971 C CB  . CYS A 1 275 ? 65.872 53.993  20.480  1.00 2.00  ? 337  CYS A CB  1 
ATOM   1972 S SG  . CYS A 1 275 ? 64.228 53.353  19.866  1.00 2.27  ? 337  CYS A SG  1 
ATOM   1973 N N   . SER A 1 276 ? 68.392 53.446  22.932  1.00 2.00  ? 338  SER A N   1 
ATOM   1974 C CA  . SER A 1 276 ? 69.348 54.168  23.692  1.00 3.22  ? 338  SER A CA  1 
ATOM   1975 C C   . SER A 1 276 ? 69.120 55.646  23.881  1.00 4.61  ? 338  SER A C   1 
ATOM   1976 O O   . SER A 1 276 ? 70.072 56.385  23.840  1.00 3.47  ? 338  SER A O   1 
ATOM   1977 C CB  . SER A 1 276 ? 70.694 53.987  23.058  1.00 2.00  ? 338  SER A CB  1 
ATOM   1978 O OG  . SER A 1 276 ? 70.893 52.625  22.721  1.00 2.00  ? 338  SER A OG  1 
ATOM   1979 N N   . ALA A 1 277 ? 67.894 56.082  24.151  1.00 5.34  ? 339  ALA A N   1 
ATOM   1980 C CA  . ALA A 1 277 ? 67.713 57.518  24.367  1.00 6.52  ? 339  ALA A CA  1 
ATOM   1981 C C   . ALA A 1 277 ? 68.566 58.154  25.500  1.00 7.54  ? 339  ALA A C   1 
ATOM   1982 O O   . ALA A 1 277 ? 69.028 59.283  25.352  1.00 8.44  ? 339  ALA A O   1 
ATOM   1983 C CB  . ALA A 1 277 ? 66.239 57.846  24.550  1.00 6.24  ? 339  ALA A CB  1 
ATOM   1984 N N   . LEU A 1 278 ? 68.806 57.453  26.617  1.00 8.56  ? 340  LEU A N   1 
ATOM   1985 C CA  . LEU A 1 278 ? 69.392 58.110  27.790  1.00 8.20  ? 340  LEU A CA  1 
ATOM   1986 C C   . LEU A 1 278 ? 70.790 58.662  27.590  1.00 8.94  ? 340  LEU A C   1 
ATOM   1987 O O   . LEU A 1 278 ? 71.076 59.719  28.151  1.00 8.39  ? 340  LEU A O   1 
ATOM   1988 C CB  . LEU A 1 278 ? 69.347 57.222  29.039  1.00 8.18  ? 340  LEU A CB  1 
ATOM   1989 C CG  . LEU A 1 278 ? 67.925 56.812  29.500  1.00 8.26  ? 340  LEU A CG  1 
ATOM   1990 C CD1 . LEU A 1 278 ? 68.026 55.660  30.457  1.00 8.85  ? 340  LEU A CD1 1 
ATOM   1991 C CD2 . LEU A 1 278 ? 67.139 57.981  30.129  1.00 4.78  ? 340  LEU A CD2 1 
ATOM   1992 N N   . GLN A 1 279 ? 71.688 58.017  26.838  1.00 10.34 ? 341  GLN A N   1 
ATOM   1993 C CA  . GLN A 1 279 ? 73.029 58.670  26.704  1.00 11.71 ? 341  GLN A CA  1 
ATOM   1994 C C   . GLN A 1 279 ? 72.866 59.963  25.913  1.00 11.87 ? 341  GLN A C   1 
ATOM   1995 O O   . GLN A 1 279 ? 73.511 60.932  26.223  1.00 12.44 ? 341  GLN A O   1 
ATOM   1996 C CB  . GLN A 1 279 ? 74.203 57.785  26.165  1.00 11.99 ? 341  GLN A CB  1 
ATOM   1997 C CG  . GLN A 1 279 ? 73.898 56.594  25.244  1.00 14.33 ? 341  GLN A CG  1 
ATOM   1998 C CD  . GLN A 1 279 ? 75.194 55.878  24.743  1.00 14.83 ? 341  GLN A CD  1 
ATOM   1999 O OE1 . GLN A 1 279 ? 76.263 55.946  25.399  1.00 23.29 ? 341  GLN A OE1 1 
ATOM   2000 N NE2 . GLN A 1 279 ? 75.111 55.214  23.582  1.00 12.17 ? 341  GLN A NE2 1 
ATOM   2001 N N   . SER A 1 280 ? 71.939 59.991  24.946  1.00 12.98 ? 342  SER A N   1 
ATOM   2002 C CA  . SER A 1 280 ? 71.646 61.221  24.179  1.00 12.45 ? 342  SER A CA  1 
ATOM   2003 C C   . SER A 1 280 ? 71.001 62.284  25.060  1.00 12.23 ? 342  SER A C   1 
ATOM   2004 O O   . SER A 1 280 ? 71.350 63.454  24.996  1.00 12.55 ? 342  SER A O   1 
ATOM   2005 C CB  . SER A 1 280 ? 70.730 60.906  23.018  1.00 12.44 ? 342  SER A CB  1 
ATOM   2006 O OG  . SER A 1 280 ? 71.273 59.860  22.243  1.00 14.51 ? 342  SER A OG  1 
ATOM   2007 N N   . LEU A 1 281 ? 70.080 61.865  25.907  1.00 11.50 ? 343  LEU A N   1 
ATOM   2008 C CA  . LEU A 1 281 ? 69.489 62.769  26.899  1.00 11.09 ? 343  LEU A CA  1 
ATOM   2009 C C   . LEU A 1 281 ? 70.499 63.291  27.910  1.00 10.71 ? 343  LEU A C   1 
ATOM   2010 O O   . LEU A 1 281 ? 70.466 64.463  28.226  1.00 10.50 ? 343  LEU A O   1 
ATOM   2011 C CB  . LEU A 1 281 ? 68.315 62.101  27.603  1.00 10.37 ? 343  LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 281 ? 67.110 61.835  26.692  1.00 9.12  ? 343  LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 281 ? 66.045 61.059  27.448  1.00 6.45  ? 343  LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 281 ? 66.543 63.141  26.134  1.00 7.33  ? 343  LEU A CD2 1 
ATOM   2015 N N   . LEU A 1 282 ? 71.420 62.458  28.393  1.00 10.87 ? 344  LEU A N   1 
ATOM   2016 C CA  . LEU A 1 282 ? 72.489 62.975  29.270  1.00 10.87 ? 344  LEU A CA  1 
ATOM   2017 C C   . LEU A 1 282 ? 73.335 64.040  28.568  1.00 10.71 ? 344  LEU A C   1 
ATOM   2018 O O   . LEU A 1 282 ? 73.745 65.010  29.175  1.00 10.72 ? 344  LEU A O   1 
ATOM   2019 C CB  . LEU A 1 282 ? 73.373 61.849  29.823  1.00 10.50 ? 344  LEU A CB  1 
ATOM   2020 C CG  . LEU A 1 282 ? 74.672 62.280  30.537  1.00 11.51 ? 344  LEU A CG  1 
ATOM   2021 C CD1 . LEU A 1 282 ? 74.369 63.190  31.739  1.00 12.69 ? 344  LEU A CD1 1 
ATOM   2022 C CD2 . LEU A 1 282 ? 75.477 61.067  30.972  1.00 11.41 ? 344  LEU A CD2 1 
ATOM   2023 N N   . HIS A 1 283 ? 73.608 63.849  27.287  1.00 11.31 ? 345  HIS A N   1 
ATOM   2024 C CA  . HIS A 1 283 ? 74.337 64.843  26.489  1.00 11.10 ? 345  HIS A CA  1 
ATOM   2025 C C   . HIS A 1 283 ? 73.551 66.159  26.386  1.00 10.45 ? 345  HIS A C   1 
ATOM   2026 O O   . HIS A 1 283 ? 74.092 67.219  26.579  1.00 10.34 ? 345  HIS A O   1 
ATOM   2027 C CB  . HIS A 1 283 ? 74.622 64.252  25.101  1.00 11.68 ? 345  HIS A CB  1 
ATOM   2028 C CG  . HIS A 1 283 ? 75.195 65.223  24.120  1.00 12.87 ? 345  HIS A CG  1 
ATOM   2029 N ND1 . HIS A 1 283 ? 76.484 65.698  24.211  1.00 14.81 ? 345  HIS A ND1 1 
ATOM   2030 C CD2 . HIS A 1 283 ? 74.660 65.785  23.007  1.00 14.84 ? 345  HIS A CD2 1 
ATOM   2031 C CE1 . HIS A 1 283 ? 76.717 66.519  23.201  1.00 16.75 ? 345  HIS A CE1 1 
ATOM   2032 N NE2 . HIS A 1 283 ? 75.627 66.586  22.455  1.00 15.55 ? 345  HIS A NE2 1 
ATOM   2033 N N   . LEU A 1 284 ? 72.255 66.087  26.134  1.00 10.40 ? 346  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 284 ? 71.461 67.307  26.029  1.00 10.29 ? 346  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 284 ? 71.260 68.044  27.367  1.00 10.53 ? 346  LEU A C   1 
ATOM   2036 O O   . LEU A 1 284 ? 70.796 69.186  27.369  1.00 10.75 ? 346  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 284 ? 70.125 67.018  25.341  1.00 10.27 ? 346  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 284 ? 70.245 66.415  23.919  1.00 8.90  ? 346  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 284 ? 68.899 65.968  23.386  1.00 5.32  ? 346  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 284 ? 70.879 67.418  22.969  1.00 6.83  ? 346  LEU A CD2 1 
ATOM   2041 N N   . LEU A 1 285 ? 71.615 67.427  28.498  1.00 10.22 ? 347  LEU A N   1 
ATOM   2042 C CA  . LEU A 1 285 ? 71.554 68.132  29.778  1.00 10.42 ? 347  LEU A CA  1 
ATOM   2043 C C   . LEU A 1 285 ? 72.706 69.125  29.917  1.00 11.01 ? 347  LEU A C   1 
ATOM   2044 O O   . LEU A 1 285 ? 72.592 70.056  30.703  1.00 11.35 ? 347  LEU A O   1 
ATOM   2045 C CB  . LEU A 1 285 ? 71.544 67.162  30.959  1.00 10.11 ? 347  LEU A CB  1 
ATOM   2046 C CG  . LEU A 1 285 ? 70.247 66.393  31.238  1.00 9.05  ? 347  LEU A CG  1 
ATOM   2047 C CD1 . LEU A 1 285 ? 70.485 65.419  32.348  1.00 9.15  ? 347  LEU A CD1 1 
ATOM   2048 C CD2 . LEU A 1 285 ? 69.094 67.301  31.583  1.00 7.20  ? 347  LEU A CD2 1 
ATOM   2049 N N   . SER A 1 286 ? 73.793 68.932  29.154  1.00 11.49 ? 348  SER A N   1 
ATOM   2050 C CA  . SER A 1 286 ? 74.916 69.889  29.078  1.00 12.41 ? 348  SER A CA  1 
ATOM   2051 C C   . SER A 1 286 ? 74.816 70.890  27.915  1.00 13.11 ? 348  SER A C   1 
ATOM   2052 O O   . SER A 1 286 ? 75.784 71.576  27.600  1.00 13.83 ? 348  SER A O   1 
ATOM   2053 C CB  . SER A 1 286 ? 76.244 69.139  28.901  1.00 12.50 ? 348  SER A CB  1 
ATOM   2054 O OG  . SER A 1 286 ? 76.636 68.503  30.095  1.00 13.87 ? 348  SER A OG  1 
ATOM   2055 N N   . SER A 1 287 ? 73.656 70.973  27.283  1.00 13.86 ? 349  SER A N   1 
ATOM   2056 C CA  . SER A 1 287 ? 73.468 71.815  26.124  1.00 13.93 ? 349  SER A CA  1 
ATOM   2057 C C   . SER A 1 287 ? 73.654 73.253  26.510  1.00 14.43 ? 349  SER A C   1 
ATOM   2058 O O   . SER A 1 287 ? 73.220 73.651  27.587  1.00 14.44 ? 349  SER A O   1 
ATOM   2059 C CB  . SER A 1 287 ? 72.054 71.651  25.573  1.00 13.91 ? 349  SER A CB  1 
ATOM   2060 O OG  . SER A 1 287 ? 71.862 72.471  24.433  1.00 13.97 ? 349  SER A OG  1 
ATOM   2061 N N   . PRO A 1 288 ? 74.288 74.050  25.625  1.00 15.06 ? 350  PRO A N   1 
ATOM   2062 C CA  . PRO A 1 288 ? 74.381 75.473  25.915  1.00 15.14 ? 350  PRO A CA  1 
ATOM   2063 C C   . PRO A 1 288 ? 73.035 76.195  25.738  1.00 15.78 ? 350  PRO A C   1 
ATOM   2064 O O   . PRO A 1 288 ? 72.864 77.286  26.285  1.00 16.13 ? 350  PRO A O   1 
ATOM   2065 C CB  . PRO A 1 288 ? 75.426 75.961  24.916  1.00 15.33 ? 350  PRO A CB  1 
ATOM   2066 C CG  . PRO A 1 288 ? 75.339 75.025  23.782  1.00 15.16 ? 350  PRO A CG  1 
ATOM   2067 C CD  . PRO A 1 288 ? 74.941 73.700  24.351  1.00 14.79 ? 350  PRO A CD  1 
ATOM   2068 N N   . LYS A 1 289 ? 72.091 75.592  25.003  1.00 15.86 ? 351  LYS A N   1 
ATOM   2069 C CA  . LYS A 1 289 ? 70.772 76.194  24.793  1.00 15.77 ? 351  LYS A CA  1 
ATOM   2070 C C   . LYS A 1 289 ? 69.847 75.797  25.928  1.00 15.70 ? 351  LYS A C   1 
ATOM   2071 O O   . LYS A 1 289 ? 69.560 74.619  26.123  1.00 15.98 ? 351  LYS A O   1 
ATOM   2072 C CB  . LYS A 1 289 ? 70.176 75.772  23.442  1.00 15.94 ? 351  LYS A CB  1 
ATOM   2073 C CG  . LYS A 1 289 ? 68.898 76.522  23.098  1.00 16.28 ? 351  LYS A CG  1 
ATOM   2074 C CD  . LYS A 1 289 ? 68.335 76.180  21.730  1.00 16.92 ? 351  LYS A CD  1 
ATOM   2075 C CE  . LYS A 1 289 ? 67.374 77.275  21.237  1.00 18.40 ? 351  LYS A CE  1 
ATOM   2076 N NZ  . LYS A 1 289 ? 66.403 77.750  22.301  1.00 20.25 ? 351  LYS A NZ  1 
ATOM   2077 N N   . GLU A 1 290 ? 69.357 76.783  26.665  1.00 15.63 ? 352  GLU A N   1 
ATOM   2078 C CA  . GLU A 1 290 ? 68.662 76.527  27.918  1.00 15.31 ? 352  GLU A CA  1 
ATOM   2079 C C   . GLU A 1 290 ? 67.342 75.773  27.721  1.00 14.98 ? 352  GLU A C   1 
ATOM   2080 O O   . GLU A 1 290 ? 66.922 75.002  28.598  1.00 15.43 ? 352  GLU A O   1 
ATOM   2081 C CB  . GLU A 1 290 ? 68.408 77.844  28.665  1.00 15.61 ? 352  GLU A CB  1 
ATOM   2082 C CG  . GLU A 1 290 ? 67.897 77.669  30.092  1.00 16.48 ? 352  GLU A CG  1 
ATOM   2083 C CD  . GLU A 1 290 ? 68.943 77.082  31.034  1.00 18.79 ? 352  GLU A CD  1 
ATOM   2084 O OE1 . GLU A 1 290 ? 70.155 77.152  30.719  1.00 22.11 ? 352  GLU A OE1 1 
ATOM   2085 O OE2 . GLU A 1 290 ? 68.555 76.570  32.103  1.00 18.28 ? 352  GLU A OE2 1 
ATOM   2086 N N   . SER A 1 291 ? 66.696 75.977  26.582  1.00 14.27 ? 353  SER A N   1 
ATOM   2087 C CA  . SER A 1 291 ? 65.391 75.359  26.341  1.00 13.97 ? 353  SER A CA  1 
ATOM   2088 C C   . SER A 1 291 ? 65.532 73.861  26.056  1.00 13.34 ? 353  SER A C   1 
ATOM   2089 O O   . SER A 1 291 ? 64.622 73.090  26.331  1.00 13.49 ? 353  SER A O   1 
ATOM   2090 C CB  . SER A 1 291 ? 64.660 76.067  25.192  1.00 13.76 ? 353  SER A CB  1 
ATOM   2091 O OG  . SER A 1 291 ? 65.371 75.950  23.975  1.00 14.07 ? 353  SER A OG  1 
ATOM   2092 N N   . ILE A 1 292 ? 66.682 73.465  25.517  1.00 12.97 ? 354  ILE A N   1 
ATOM   2093 C CA  . ILE A 1 292 ? 66.991 72.053  25.251  1.00 12.70 ? 354  ILE A CA  1 
ATOM   2094 C C   . ILE A 1 292 ? 67.303 71.336  26.566  1.00 12.44 ? 354  ILE A C   1 
ATOM   2095 O O   . ILE A 1 292 ? 66.874 70.225  26.784  1.00 11.79 ? 354  ILE A O   1 
ATOM   2096 C CB  . ILE A 1 292 ? 68.164 71.933  24.268  1.00 12.34 ? 354  ILE A CB  1 
ATOM   2097 C CG1 . ILE A 1 292 ? 67.788 72.546  22.912  1.00 11.54 ? 354  ILE A CG1 1 
ATOM   2098 C CG2 . ILE A 1 292 ? 68.608 70.492  24.093  1.00 12.61 ? 354  ILE A CG2 1 
ATOM   2099 C CD1 . ILE A 1 292 ? 66.859 71.734  22.103  1.00 11.04 ? 354  ILE A CD1 1 
ATOM   2100 N N   . LYS A 1 293 ? 68.052 72.004  27.437  1.00 12.85 ? 355  LYS A N   1 
ATOM   2101 C CA  . LYS A 1 293 ? 68.346 71.536  28.785  1.00 12.66 ? 355  LYS A CA  1 
ATOM   2102 C C   . LYS A 1 293 ? 67.023 71.232  29.504  1.00 12.21 ? 355  LYS A C   1 
ATOM   2103 O O   . LYS A 1 293 ? 66.823 70.129  30.019  1.00 12.08 ? 355  LYS A O   1 
ATOM   2104 C CB  . LYS A 1 293 ? 69.157 72.621  29.536  1.00 13.14 ? 355  LYS A CB  1 
ATOM   2105 C CG  . LYS A 1 293 ? 70.128 72.127  30.642  1.00 13.79 ? 355  LYS A CG  1 
ATOM   2106 C CD  . LYS A 1 293 ? 70.892 73.313  31.294  1.00 15.14 ? 355  LYS A CD  1 
ATOM   2107 C CE  . LYS A 1 293 ? 72.438 73.140  31.322  1.00 17.71 ? 355  LYS A CE  1 
ATOM   2108 N NZ  . LYS A 1 293 ? 73.002 72.434  32.568  1.00 21.27 ? 355  LYS A NZ  1 
ATOM   2109 N N   . LYS A 1 294 ? 66.117 72.208  29.505  1.00 11.81 ? 356  LYS A N   1 
ATOM   2110 C CA  . LYS A 1 294 ? 64.828 72.081  30.158  1.00 11.64 ? 356  LYS A CA  1 
ATOM   2111 C C   . LYS A 1 294 ? 64.029 70.928  29.576  1.00 10.72 ? 356  LYS A C   1 
ATOM   2112 O O   . LYS A 1 294 ? 63.484 70.130  30.325  1.00 10.08 ? 356  LYS A O   1 
ATOM   2113 C CB  . LYS A 1 294 ? 64.031 73.389  30.044  1.00 12.09 ? 356  LYS A CB  1 
ATOM   2114 C CG  . LYS A 1 294 ? 62.572 73.302  30.517  1.00 12.88 ? 356  LYS A CG  1 
ATOM   2115 C CD  . LYS A 1 294 ? 61.883 74.669  30.531  1.00 14.35 ? 356  LYS A CD  1 
ATOM   2116 C CE  . LYS A 1 294 ? 60.328 74.532  30.541  1.00 17.34 ? 356  LYS A CE  1 
ATOM   2117 N NZ  . LYS A 1 294 ? 59.550 75.776  31.027  1.00 17.94 ? 356  LYS A NZ  1 
ATOM   2118 N N   . GLU A 1 295 ? 63.952 70.849  28.245  1.00 10.52 ? 357  GLU A N   1 
ATOM   2119 C CA  . GLU A 1 295 ? 63.201 69.767  27.559  1.00 10.20 ? 357  GLU A CA  1 
ATOM   2120 C C   . GLU A 1 295 ? 63.781 68.383  27.827  1.00 8.52  ? 357  GLU A C   1 
ATOM   2121 O O   . GLU A 1 295 ? 63.047 67.423  27.882  1.00 8.05  ? 357  GLU A O   1 
ATOM   2122 C CB  . GLU A 1 295 ? 63.189 69.973  26.044  1.00 10.81 ? 357  GLU A CB  1 
ATOM   2123 C CG  . GLU A 1 295 ? 62.206 71.001  25.504  1.00 12.70 ? 357  GLU A CG  1 
ATOM   2124 C CD  . GLU A 1 295 ? 62.409 71.276  23.991  1.00 13.79 ? 357  GLU A CD  1 
ATOM   2125 O OE1 . GLU A 1 295 ? 62.362 72.471  23.596  1.00 19.22 ? 357  GLU A OE1 1 
ATOM   2126 O OE2 . GLU A 1 295 ? 62.618 70.312  23.201  1.00 16.69 ? 357  GLU A OE2 1 
ATOM   2127 N N   . ALA A 1 296 ? 65.098 68.288  27.951  1.00 7.04  ? 358  ALA A N   1 
ATOM   2128 C CA  . ALA A 1 296 ? 65.756 67.038  28.328  1.00 6.73  ? 358  ALA A CA  1 
ATOM   2129 C C   . ALA A 1 296 ? 65.431 66.595  29.771  1.00 6.10  ? 358  ALA A C   1 
ATOM   2130 O O   . ALA A 1 296 ? 65.198 65.411  30.009  1.00 5.86  ? 358  ALA A O   1 
ATOM   2131 C CB  . ALA A 1 296 ? 67.229 67.136  28.122  1.00 6.52  ? 358  ALA A CB  1 
ATOM   2132 N N   . CYS A 1 297 ? 65.352 67.546  30.709  1.00 5.49  ? 359  CYS A N   1 
ATOM   2133 C CA  . CYS A 1 297 ? 64.880 67.263  32.082  1.00 4.65  ? 359  CYS A CA  1 
ATOM   2134 C C   . CYS A 1 297 ? 63.460 66.795  32.067  1.00 3.75  ? 359  CYS A C   1 
ATOM   2135 O O   . CYS A 1 297 ? 63.120 65.860  32.766  1.00 3.75  ? 359  CYS A O   1 
ATOM   2136 C CB  . CYS A 1 297 ? 64.949 68.504  32.973  1.00 4.92  ? 359  CYS A CB  1 
ATOM   2137 S SG  . CYS A 1 297 ? 66.570 68.980  33.440  1.00 6.01  ? 359  CYS A SG  1 
ATOM   2138 N N   . TRP A 1 298 ? 62.635 67.494  31.292  1.00 2.34  ? 360  TRP A N   1 
ATOM   2139 C CA  . TRP A 1 298 ? 61.230 67.195  31.174  1.00 2.78  ? 360  TRP A CA  1 
ATOM   2140 C C   . TRP A 1 298 ? 61.024 65.777  30.653  1.00 2.75  ? 360  TRP A C   1 
ATOM   2141 O O   . TRP A 1 298 ? 60.359 64.980  31.284  1.00 3.43  ? 360  TRP A O   1 
ATOM   2142 C CB  . TRP A 1 298 ? 60.540 68.238  30.296  1.00 2.00  ? 360  TRP A CB  1 
ATOM   2143 C CG  . TRP A 1 298 ? 59.312 67.777  29.731  1.00 2.13  ? 360  TRP A CG  1 
ATOM   2144 C CD1 . TRP A 1 298 ? 58.138 67.554  30.382  1.00 2.00  ? 360  TRP A CD1 1 
ATOM   2145 C CD2 . TRP A 1 298 ? 59.072 67.476  28.348  1.00 2.20  ? 360  TRP A CD2 1 
ATOM   2146 N NE1 . TRP A 1 298 ? 57.193 67.105  29.495  1.00 2.00  ? 360  TRP A NE1 1 
ATOM   2147 C CE2 . TRP A 1 298 ? 57.744 67.050  28.242  1.00 2.00  ? 360  TRP A CE2 1 
ATOM   2148 C CE3 . TRP A 1 298 ? 59.859 67.513  27.197  1.00 2.00  ? 360  TRP A CE3 1 
ATOM   2149 C CZ2 . TRP A 1 298 ? 57.180 66.675  27.020  1.00 2.61  ? 360  TRP A CZ2 1 
ATOM   2150 C CZ3 . TRP A 1 298 ? 59.294 67.138  25.991  1.00 2.00  ? 360  TRP A CZ3 1 
ATOM   2151 C CH2 . TRP A 1 298 ? 57.974 66.724  25.917  1.00 2.00  ? 360  TRP A CH2 1 
ATOM   2152 N N   . THR A 1 299 ? 61.690 65.438  29.557  1.00 2.97  ? 361  THR A N   1 
ATOM   2153 C CA  . THR A 1 299 ? 61.657 64.086  29.024  1.00 2.00  ? 361  THR A CA  1 
ATOM   2154 C C   . THR A 1 299 ? 62.088 63.065  30.065  1.00 2.05  ? 361  THR A C   1 
ATOM   2155 O O   . THR A 1 299 ? 61.393 62.058  30.290  1.00 2.00  ? 361  THR A O   1 
ATOM   2156 C CB  . THR A 1 299 ? 62.525 63.995  27.763  1.00 2.00  ? 361  THR A CB  1 
ATOM   2157 O OG1 . THR A 1 299 ? 62.000 64.909  26.790  1.00 2.00  ? 361  THR A OG1 1 
ATOM   2158 C CG2 . THR A 1 299 ? 62.571 62.587  27.191  1.00 2.00  ? 361  THR A CG2 1 
ATOM   2159 N N   . ILE A 1 300 ? 63.247 63.303  30.688  1.00 2.01  ? 362  ILE A N   1 
ATOM   2160 C CA  . ILE A 1 300 ? 63.745 62.382  31.702  1.00 2.19  ? 362  ILE A CA  1 
ATOM   2161 C C   . ILE A 1 300 ? 62.802 62.176  32.876  1.00 2.69  ? 362  ILE A C   1 
ATOM   2162 O O   . ILE A 1 300 ? 62.707 61.062  33.384  1.00 3.80  ? 362  ILE A O   1 
ATOM   2163 C CB  . ILE A 1 300 ? 65.095 62.775  32.299  1.00 2.73  ? 362  ILE A CB  1 
ATOM   2164 C CG1 . ILE A 1 300 ? 66.201 62.705  31.233  1.00 2.00  ? 362  ILE A CG1 1 
ATOM   2165 C CG2 . ILE A 1 300 ? 65.372 61.838  33.479  1.00 2.26  ? 362  ILE A CG2 1 
ATOM   2166 C CD1 . ILE A 1 300 ? 67.556 63.304  31.686  1.00 2.00  ? 362  ILE A CD1 1 
ATOM   2167 N N   . SER A 1 301 ? 62.070 63.218  33.279  1.00 3.04  ? 363  SER A N   1 
ATOM   2168 C CA  . SER A 1 301 ? 61.066 63.086  34.351  1.00 2.79  ? 363  SER A CA  1 
ATOM   2169 C C   . SER A 1 301 ? 59.894 62.204  34.018  1.00 2.55  ? 363  SER A C   1 
ATOM   2170 O O   . SER A 1 301 ? 59.222 61.693  34.902  1.00 2.05  ? 363  SER A O   1 
ATOM   2171 C CB  . SER A 1 301 ? 60.497 64.454  34.742  1.00 2.93  ? 363  SER A CB  1 
ATOM   2172 O OG  . SER A 1 301 ? 59.642 64.953  33.740  1.00 2.00  ? 363  SER A OG  1 
ATOM   2173 N N   . ASN A 1 302 ? 59.606 62.083  32.732  1.00 3.74  ? 364  ASN A N   1 
ATOM   2174 C CA  . ASN A 1 302 ? 58.507 61.252  32.244  1.00 2.46  ? 364  ASN A CA  1 
ATOM   2175 C C   . ASN A 1 302 ? 58.959 59.770  32.273  1.00 2.80  ? 364  ASN A C   1 
ATOM   2176 O O   . ASN A 1 302 ? 58.159 58.845  32.432  1.00 2.67  ? 364  ASN A O   1 
ATOM   2177 C CB  . ASN A 1 302 ? 58.117 61.719  30.839  1.00 3.07  ? 364  ASN A CB  1 
ATOM   2178 C CG  . ASN A 1 302 ? 57.023 62.846  30.831  1.00 4.00  ? 364  ASN A CG  1 
ATOM   2179 O OD1 . ASN A 1 302 ? 56.285 63.031  31.797  1.00 3.38  ? 364  ASN A OD1 1 
ATOM   2180 N ND2 . ASN A 1 302 ? 56.942 63.592  29.715  1.00 2.00  ? 364  ASN A ND2 1 
ATOM   2181 N N   . ILE A 1 303 ? 60.264 59.540  32.152  1.00 2.50  ? 365  ILE A N   1 
ATOM   2182 C CA  . ILE A 1 303 ? 60.825 58.177  32.242  1.00 2.18  ? 365  ILE A CA  1 
ATOM   2183 C C   . ILE A 1 303 ? 60.953 57.737  33.731  1.00 2.00  ? 365  ILE A C   1 
ATOM   2184 O O   . ILE A 1 303 ? 60.539 56.641  34.114  1.00 2.00  ? 365  ILE A O   1 
ATOM   2185 C CB  . ILE A 1 303 ? 62.197 58.138  31.545  1.00 2.27  ? 365  ILE A CB  1 
ATOM   2186 C CG1 . ILE A 1 303 ? 62.034 58.392  30.023  1.00 2.00  ? 365  ILE A CG1 1 
ATOM   2187 C CG2 . ILE A 1 303 ? 62.909 56.797  31.791  1.00 2.00  ? 365  ILE A CG2 1 
ATOM   2188 C CD1 . ILE A 1 303 ? 63.328 58.885  29.348  1.00 2.66  ? 365  ILE A CD1 1 
ATOM   2189 N N   . THR A 1 304 ? 61.493 58.624  34.574  1.00 2.02  ? 366  THR A N   1 
ATOM   2190 C CA  . THR A 1 304 ? 61.507 58.373  36.039  1.00 2.03  ? 366  THR A CA  1 
ATOM   2191 C C   . THR A 1 304 ? 60.116 58.250  36.684  1.00 2.00  ? 366  THR A C   1 
ATOM   2192 O O   . THR A 1 304 ? 60.006 57.762  37.807  1.00 2.00  ? 366  THR A O   1 
ATOM   2193 C CB  . THR A 1 304 ? 62.319 59.408  36.830  1.00 2.18  ? 366  THR A CB  1 
ATOM   2194 O OG1 . THR A 1 304 ? 61.681 60.680  36.740  1.00 2.90  ? 366  THR A OG1 1 
ATOM   2195 C CG2 . THR A 1 304 ? 63.744 59.510  36.349  1.00 2.00  ? 366  THR A CG2 1 
ATOM   2196 N N   . ALA A 1 305 ? 59.050 58.618  35.972  1.00 2.00  ? 367  ALA A N   1 
ATOM   2197 C CA  . ALA A 1 305 ? 57.668 58.231  36.380  1.00 2.14  ? 367  ALA A CA  1 
ATOM   2198 C C   . ALA A 1 305 ? 57.400 56.771  35.981  1.00 2.97  ? 367  ALA A C   1 
ATOM   2199 O O   . ALA A 1 305 ? 56.266 56.276  36.022  1.00 3.49  ? 367  ALA A O   1 
ATOM   2200 C CB  . ALA A 1 305 ? 56.632 59.168  35.741  1.00 2.00  ? 367  ALA A CB  1 
ATOM   2201 N N   . GLY A 1 306 ? 58.454 56.082  35.553  1.00 4.61  ? 368  GLY A N   1 
ATOM   2202 C CA  . GLY A 1 306 ? 58.357 54.697  35.106  1.00 4.43  ? 368  GLY A CA  1 
ATOM   2203 C C   . GLY A 1 306 ? 58.418 53.691  36.246  1.00 4.54  ? 368  GLY A C   1 
ATOM   2204 O O   . GLY A 1 306 ? 58.227 54.054  37.406  1.00 5.52  ? 368  GLY A O   1 
ATOM   2205 N N   . ASN A 1 307 ? 58.685 52.431  35.894  1.00 3.08  ? 369  ASN A N   1 
ATOM   2206 C CA  . ASN A 1 307 ? 58.749 51.363  36.830  1.00 4.11  ? 369  ASN A CA  1 
ATOM   2207 C C   . ASN A 1 307 ? 60.205 51.286  37.353  1.00 4.37  ? 369  ASN A C   1 
ATOM   2208 O O   . ASN A 1 307 ? 61.054 52.056  36.931  1.00 2.48  ? 369  ASN A O   1 
ATOM   2209 C CB  . ASN A 1 307 ? 58.226 50.064  36.148  1.00 4.34  ? 369  ASN A CB  1 
ATOM   2210 C CG  . ASN A 1 307 ? 59.175 49.548  35.104  1.00 5.85  ? 369  ASN A CG  1 
ATOM   2211 O OD1 . ASN A 1 307 ? 60.358 49.902  35.111  1.00 2.00  ? 369  ASN A OD1 1 
ATOM   2212 N ND2 . ASN A 1 307 ? 58.667 48.756  34.168  1.00 4.25  ? 369  ASN A ND2 1 
ATOM   2213 N N   . ARG A 1 308 ? 60.488 50.420  38.316  1.00 5.29  ? 370  ARG A N   1 
ATOM   2214 C CA  . ARG A 1 308 ? 61.790 50.473  39.001  1.00 5.72  ? 370  ARG A CA  1 
ATOM   2215 C C   . ARG A 1 308 ? 62.915 50.147  38.078  1.00 5.13  ? 370  ARG A C   1 
ATOM   2216 O O   . ARG A 1 308 ? 63.999 50.702  38.201  1.00 4.49  ? 370  ARG A O   1 
ATOM   2217 C CB  . ARG A 1 308 ? 61.852 49.487  40.170  1.00 6.83  ? 370  ARG A CB  1 
ATOM   2218 C CG  . ARG A 1 308 ? 60.716 49.627  41.112  1.00 8.36  ? 370  ARG A CG  1 
ATOM   2219 C CD  . ARG A 1 308 ? 61.115 49.217  42.515  1.00 10.36 ? 370  ARG A CD  1 
ATOM   2220 N NE  . ARG A 1 308 ? 60.204 49.764  43.523  1.00 12.30 ? 370  ARG A NE  1 
ATOM   2221 C CZ  . ARG A 1 308 ? 59.999 49.193  44.708  1.00 15.30 ? 370  ARG A CZ  1 
ATOM   2222 N NH1 . ARG A 1 308 ? 60.629 48.056  45.036  1.00 15.75 ? 370  ARG A NH1 1 
ATOM   2223 N NH2 . ARG A 1 308 ? 59.159 49.759  45.573  1.00 14.93 ? 370  ARG A NH2 1 
ATOM   2224 N N   . ALA A 1 309 ? 62.645 49.186  37.196  1.00 4.50  ? 371  ALA A N   1 
ATOM   2225 C CA  . ALA A 1 309 ? 63.499 48.850  36.044  1.00 4.45  ? 371  ALA A CA  1 
ATOM   2226 C C   . ALA A 1 309 ? 63.935 50.092  35.261  1.00 3.41  ? 371  ALA A C   1 
ATOM   2227 O O   . ALA A 1 309 ? 65.160 50.375  35.019  1.00 2.00  ? 371  ALA A O   1 
ATOM   2228 C CB  . ALA A 1 309 ? 62.676 47.868  35.117  1.00 5.19  ? 371  ALA A CB  1 
ATOM   2229 N N   . GLN A 1 310 ? 62.942 50.886  34.897  1.00 2.00  ? 372  GLN A N   1 
ATOM   2230 C CA  . GLN A 1 310 ? 63.236 52.109  34.143  1.00 2.19  ? 372  GLN A CA  1 
ATOM   2231 C C   . GLN A 1 310 ? 63.911 53.201  34.940  1.00 2.00  ? 372  GLN A C   1 
ATOM   2232 O O   . GLN A 1 310 ? 64.824 53.886  34.426  1.00 2.69  ? 372  GLN A O   1 
ATOM   2233 C CB  . GLN A 1 310 ? 61.990 52.625  33.458  1.00 2.00  ? 372  GLN A CB  1 
ATOM   2234 C CG  . GLN A 1 310 ? 61.574 51.728  32.316  1.00 2.00  ? 372  GLN A CG  1 
ATOM   2235 C CD  . GLN A 1 310 ? 60.103 51.889  32.011  1.00 2.91  ? 372  GLN A CD  1 
ATOM   2236 O OE1 . GLN A 1 310 ? 59.454 52.641  32.683  1.00 2.00  ? 372  GLN A OE1 1 
ATOM   2237 N NE2 . GLN A 1 310 ? 59.617 51.261  30.918  1.00 2.00  ? 372  GLN A NE2 1 
ATOM   2238 N N   . ILE A 1 311 ? 63.527 53.358  36.203  1.00 2.00  ? 373  ILE A N   1 
ATOM   2239 C CA  . ILE A 1 311 ? 64.298 54.215  37.070  1.00 2.00  ? 373  ILE A CA  1 
ATOM   2240 C C   . ILE A 1 311 ? 65.757 53.731  37.143  1.00 2.00  ? 373  ILE A C   1 
ATOM   2241 O O   . ILE A 1 311 ? 66.665 54.558  37.117  1.00 2.76  ? 373  ILE A O   1 
ATOM   2242 C CB  . ILE A 1 311 ? 63.692 54.351  38.484  1.00 2.02  ? 373  ILE A CB  1 
ATOM   2243 C CG1 . ILE A 1 311 ? 62.362 55.129  38.426  1.00 2.00  ? 373  ILE A CG1 1 
ATOM   2244 C CG2 . ILE A 1 311 ? 64.677 55.105  39.382  1.00 2.00  ? 373  ILE A CG2 1 
ATOM   2245 C CD1 . ILE A 1 311 ? 61.482 54.915  39.634  1.00 2.00  ? 373  ILE A CD1 1 
ATOM   2246 N N   . GLN A 1 312 ? 65.999 52.428  37.221  1.00 2.00  ? 374  GLN A N   1 
ATOM   2247 C CA  . GLN A 1 312 ? 67.435 51.924  37.275  1.00 3.16  ? 374  GLN A CA  1 
ATOM   2248 C C   . GLN A 1 312 ? 68.209 52.265  36.029  1.00 2.84  ? 374  GLN A C   1 
ATOM   2249 O O   . GLN A 1 312 ? 69.377 52.618  36.084  1.00 4.91  ? 374  GLN A O   1 
ATOM   2250 C CB  . GLN A 1 312 ? 67.488 50.411  37.521  1.00 2.77  ? 374  GLN A CB  1 
ATOM   2251 C CG  . GLN A 1 312 ? 68.873 49.882  37.958  1.00 3.29  ? 374  GLN A CG  1 
ATOM   2252 C CD  . GLN A 1 312 ? 69.258 50.425  39.294  1.00 5.14  ? 374  GLN A CD  1 
ATOM   2253 O OE1 . GLN A 1 312 ? 68.382 50.723  40.107  1.00 7.18  ? 374  GLN A OE1 1 
ATOM   2254 N NE2 . GLN A 1 312 ? 70.551 50.602  39.527  1.00 2.46  ? 374  GLN A NE2 1 
ATOM   2255 N N   . THR A 1 313 ? 67.572 52.230  34.867  1.00 4.73  ? 375  THR A N   1 
ATOM   2256 C CA  . THR A 1 313 ? 68.309 52.556  33.633  1.00 5.40  ? 375  THR A CA  1 
ATOM   2257 C C   . THR A 1 313 ? 68.807 54.023  33.706  1.00 5.75  ? 375  THR A C   1 
ATOM   2258 O O   . THR A 1 313 ? 69.956 54.322  33.402  1.00 6.17  ? 375  THR A O   1 
ATOM   2259 C CB  . THR A 1 313 ? 67.471 52.282  32.368  1.00 6.34  ? 375  THR A CB  1 
ATOM   2260 O OG1 . THR A 1 313 ? 66.442 53.240  32.298  1.00 8.19  ? 375  THR A OG1 1 
ATOM   2261 C CG2 . THR A 1 313 ? 66.862 50.914  32.366  1.00 4.79  ? 375  THR A CG2 1 
ATOM   2262 N N   . VAL A 1 314 ? 67.954 54.937  34.168  1.00 5.60  ? 376  VAL A N   1 
ATOM   2263 C CA  . VAL A 1 314 ? 68.376 56.338  34.385  1.00 4.50  ? 376  VAL A CA  1 
ATOM   2264 C C   . VAL A 1 314 ? 69.504 56.452  35.378  1.00 4.93  ? 376  VAL A C   1 
ATOM   2265 O O   . VAL A 1 314 ? 70.439 57.237  35.177  1.00 5.49  ? 376  VAL A O   1 
ATOM   2266 C CB  . VAL A 1 314 ? 67.213 57.230  34.870  1.00 4.40  ? 376  VAL A CB  1 
ATOM   2267 C CG1 . VAL A 1 314 ? 67.689 58.718  34.946  1.00 2.80  ? 376  VAL A CG1 1 
ATOM   2268 C CG2 . VAL A 1 314 ? 66.028 57.072  33.987  1.00 2.00  ? 376  VAL A CG2 1 
ATOM   2269 N N   . ILE A 1 315 ? 69.446 55.674  36.462  1.00 6.21  ? 377  ILE A N   1 
ATOM   2270 C CA  . ILE A 1 315 ? 70.554 55.658  37.432  1.00 6.41  ? 377  ILE A CA  1 
ATOM   2271 C C   . ILE A 1 315 ? 71.834 55.195  36.761  1.00 7.48  ? 377  ILE A C   1 
ATOM   2272 O O   . ILE A 1 315 ? 72.887 55.818  36.946  1.00 7.56  ? 377  ILE A O   1 
ATOM   2273 C CB  . ILE A 1 315 ? 70.324 54.740  38.670  1.00 6.24  ? 377  ILE A CB  1 
ATOM   2274 C CG1 . ILE A 1 315 ? 69.328 55.367  39.644  1.00 5.91  ? 377  ILE A CG1 1 
ATOM   2275 C CG2 . ILE A 1 315 ? 71.668 54.478  39.400  1.00 5.24  ? 377  ILE A CG2 1 
ATOM   2276 C CD1 . ILE A 1 315 ? 68.858 54.433  40.746  1.00 5.34  ? 377  ILE A CD1 1 
ATOM   2277 N N   . ASP A 1 316 ? 71.760 54.086  36.014  1.00 8.27  ? 378  ASP A N   1 
ATOM   2278 C CA  . ASP A 1 316 ? 72.970 53.526  35.378  1.00 9.04  ? 378  ASP A CA  1 
ATOM   2279 C C   . ASP A 1 316 ? 73.570 54.391  34.248  1.00 9.57  ? 378  ASP A C   1 
ATOM   2280 O O   . ASP A 1 316 ? 74.744 54.229  33.928  1.00 9.93  ? 378  ASP A O   1 
ATOM   2281 C CB  . ASP A 1 316 ? 72.720 52.096  34.888  1.00 9.59  ? 378  ASP A CB  1 
ATOM   2282 C CG  . ASP A 1 316 ? 72.594 51.065  36.047  1.00 11.85 ? 378  ASP A CG  1 
ATOM   2283 O OD1 . ASP A 1 316 ? 73.207 51.227  37.127  1.00 14.80 ? 378  ASP A OD1 1 
ATOM   2284 O OD2 . ASP A 1 316 ? 71.859 50.069  35.857  1.00 19.87 ? 378  ASP A OD2 1 
ATOM   2285 N N   . ALA A 1 317 ? 72.777 55.287  33.650  1.00 9.51  ? 379  ALA A N   1 
ATOM   2286 C CA  . ALA A 1 317 ? 73.262 56.246  32.630  1.00 8.96  ? 379  ALA A CA  1 
ATOM   2287 C C   . ALA A 1 317 ? 74.026 57.389  33.244  1.00 9.47  ? 379  ALA A C   1 
ATOM   2288 O O   . ALA A 1 317 ? 74.609 58.215  32.517  1.00 11.54 ? 379  ALA A O   1 
ATOM   2289 C CB  . ALA A 1 317 ? 72.093 56.818  31.831  1.00 8.83  ? 379  ALA A CB  1 
ATOM   2290 N N   . ASN A 1 318 ? 74.042 57.464  34.578  1.00 8.81  ? 380  ASN A N   1 
ATOM   2291 C CA  . ASN A 1 318 ? 74.670 58.566  35.294  1.00 8.16  ? 380  ASN A CA  1 
ATOM   2292 C C   . ASN A 1 318 ? 73.955 59.918  35.071  1.00 6.76  ? 380  ASN A C   1 
ATOM   2293 O O   . ASN A 1 318 ? 74.559 60.997  35.019  1.00 4.65  ? 380  ASN A O   1 
ATOM   2294 C CB  . ASN A 1 318 ? 76.156 58.641  34.966  1.00 9.23  ? 380  ASN A CB  1 
ATOM   2295 C CG  . ASN A 1 318 ? 76.998 59.106  36.144  1.00 13.74 ? 380  ASN A CG  1 
ATOM   2296 O OD1 . ASN A 1 318 ? 78.099 59.666  35.965  1.00 20.28 ? 380  ASN A OD1 1 
ATOM   2297 N ND2 . ASN A 1 318 ? 76.508 58.871  37.359  1.00 18.37 ? 380  ASN A ND2 1 
ATOM   2298 N N   . ILE A 1 319 ? 72.635 59.847  34.982  1.00 5.45  ? 381  ILE A N   1 
ATOM   2299 C CA  . ILE A 1 319 ? 71.832 61.039  34.778  1.00 5.39  ? 381  ILE A CA  1 
ATOM   2300 C C   . ILE A 1 319 ? 71.727 61.860  36.088  1.00 5.06  ? 381  ILE A C   1 
ATOM   2301 O O   . ILE A 1 319 ? 71.715 63.088  36.055  1.00 5.74  ? 381  ILE A O   1 
ATOM   2302 C CB  . ILE A 1 319 ? 70.385 60.671  34.303  1.00 5.92  ? 381  ILE A CB  1 
ATOM   2303 C CG1 . ILE A 1 319 ? 70.365 59.903  32.932  1.00 6.38  ? 381  ILE A CG1 1 
ATOM   2304 C CG2 . ILE A 1 319 ? 69.517 61.905  34.339  1.00 4.75  ? 381  ILE A CG2 1 
ATOM   2305 C CD1 . ILE A 1 319 ? 70.649 60.670  31.705  1.00 2.50  ? 381  ILE A CD1 1 
ATOM   2306 N N   . PHE A 1 320 ? 71.644 61.216  37.255  1.00 4.85  ? 382  PHE A N   1 
ATOM   2307 C CA  . PHE A 1 320 ? 71.273 61.975  38.477  1.00 4.40  ? 382  PHE A CA  1 
ATOM   2308 C C   . PHE A 1 320 ? 72.250 63.026  38.971  1.00 4.48  ? 382  PHE A C   1 
ATOM   2309 O O   . PHE A 1 320 ? 71.805 64.086  39.416  1.00 4.77  ? 382  PHE A O   1 
ATOM   2310 C CB  . PHE A 1 320 ? 70.779 61.058  39.606  1.00 3.70  ? 382  PHE A CB  1 
ATOM   2311 C CG  . PHE A 1 320 ? 69.400 60.464  39.321  1.00 2.00  ? 382  PHE A CG  1 
ATOM   2312 C CD1 . PHE A 1 320 ? 69.267 59.182  38.851  1.00 2.00  ? 382  PHE A CD1 1 
ATOM   2313 C CD2 . PHE A 1 320 ? 68.254 61.225  39.471  1.00 2.52  ? 382  PHE A CD2 1 
ATOM   2314 C CE1 . PHE A 1 320 ? 67.992 58.645  38.552  1.00 3.19  ? 382  PHE A CE1 1 
ATOM   2315 C CE2 . PHE A 1 320 ? 66.985 60.692  39.197  1.00 2.00  ? 382  PHE A CE2 1 
ATOM   2316 C CZ  . PHE A 1 320 ? 66.864 59.415  38.726  1.00 2.00  ? 382  PHE A CZ  1 
ATOM   2317 N N   . PRO A 1 321 ? 73.568 62.770  38.922  1.00 4.42  ? 383  PRO A N   1 
ATOM   2318 C CA  . PRO A 1 321 ? 74.428 63.881  39.300  1.00 4.66  ? 383  PRO A CA  1 
ATOM   2319 C C   . PRO A 1 321 ? 74.152 65.178  38.516  1.00 5.91  ? 383  PRO A C   1 
ATOM   2320 O O   . PRO A 1 321 ? 74.119 66.272  39.118  1.00 7.17  ? 383  PRO A O   1 
ATOM   2321 C CB  . PRO A 1 321 ? 75.832 63.339  39.032  1.00 5.17  ? 383  PRO A CB  1 
ATOM   2322 C CG  . PRO A 1 321 ? 75.713 61.878  39.157  1.00 4.14  ? 383  PRO A CG  1 
ATOM   2323 C CD  . PRO A 1 321 ? 74.339 61.551  38.623  1.00 4.08  ? 383  PRO A CD  1 
ATOM   2324 N N   . ALA A 1 322 ? 73.917 65.061  37.203  1.00 6.65  ? 384  ALA A N   1 
ATOM   2325 C CA  . ALA A 1 322 ? 73.567 66.216  36.338  1.00 6.49  ? 384  ALA A CA  1 
ATOM   2326 C C   . ALA A 1 322 ? 72.218 66.845  36.697  1.00 7.04  ? 384  ALA A C   1 
ATOM   2327 O O   . ALA A 1 322 ? 72.103 68.069  36.728  1.00 7.01  ? 384  ALA A O   1 
ATOM   2328 C CB  . ALA A 1 322 ? 73.604 65.815  34.846  1.00 5.68  ? 384  ALA A CB  1 
ATOM   2329 N N   . LEU A 1 323 ? 71.200 66.020  36.975  1.00 7.73  ? 385  LEU A N   1 
ATOM   2330 C CA  . LEU A 1 323 ? 69.894 66.552  37.410  1.00 7.93  ? 385  LEU A CA  1 
ATOM   2331 C C   . LEU A 1 323 ? 69.990 67.294  38.730  1.00 8.59  ? 385  LEU A C   1 
ATOM   2332 O O   . LEU A 1 323 ? 69.284 68.277  38.943  1.00 8.35  ? 385  LEU A O   1 
ATOM   2333 C CB  . LEU A 1 323 ? 68.856 65.444  37.568  1.00 7.96  ? 385  LEU A CB  1 
ATOM   2334 C CG  . LEU A 1 323 ? 68.360 64.719  36.338  1.00 7.47  ? 385  LEU A CG  1 
ATOM   2335 C CD1 . LEU A 1 323 ? 67.240 63.715  36.749  1.00 7.98  ? 385  LEU A CD1 1 
ATOM   2336 C CD2 . LEU A 1 323 ? 67.854 65.727  35.297  1.00 8.88  ? 385  LEU A CD2 1 
ATOM   2337 N N   . ILE A 1 324 ? 70.862 66.824  39.620  1.00 9.58  ? 386  ILE A N   1 
ATOM   2338 C CA  . ILE A 1 324 ? 71.034 67.427  40.937  1.00 10.07 ? 386  ILE A CA  1 
ATOM   2339 C C   . ILE A 1 324 ? 71.799 68.750  40.801  1.00 11.12 ? 386  ILE A C   1 
ATOM   2340 O O   . ILE A 1 324 ? 71.457 69.756  41.429  1.00 10.55 ? 386  ILE A O   1 
ATOM   2341 C CB  . ILE A 1 324 ? 71.704 66.411  41.935  1.00 10.34 ? 386  ILE A CB  1 
ATOM   2342 C CG1 . ILE A 1 324 ? 70.646 65.385  42.407  1.00 10.72 ? 386  ILE A CG1 1 
ATOM   2343 C CG2 . ILE A 1 324 ? 72.300 67.112  43.143  1.00 8.95  ? 386  ILE A CG2 1 
ATOM   2344 C CD1 . ILE A 1 324 ? 71.226 64.110  43.016  1.00 9.65  ? 386  ILE A CD1 1 
ATOM   2345 N N   . SER A 1 325 ? 72.813 68.759  39.952  1.00 11.96 ? 387  SER A N   1 
ATOM   2346 C CA  . SER A 1 325 ? 73.502 69.993  39.618  1.00 13.00 ? 387  SER A CA  1 
ATOM   2347 C C   . SER A 1 325 ? 72.544 71.058  39.066  1.00 13.90 ? 387  SER A C   1 
ATOM   2348 O O   . SER A 1 325 ? 72.585 72.214  39.462  1.00 14.74 ? 387  SER A O   1 
ATOM   2349 C CB  . SER A 1 325 ? 74.579 69.697  38.593  1.00 13.14 ? 387  SER A CB  1 
ATOM   2350 O OG  . SER A 1 325 ? 75.456 70.797  38.486  1.00 15.80 ? 387  SER A OG  1 
ATOM   2351 N N   . ILE A 1 326 ? 71.678 70.654  38.151  1.00 15.01 ? 388  ILE A N   1 
ATOM   2352 C CA  . ILE A 1 326 ? 70.697 71.549  37.540  1.00 15.49 ? 388  ILE A CA  1 
ATOM   2353 C C   . ILE A 1 326 ? 69.707 72.045  38.589  1.00 16.16 ? 388  ILE A C   1 
ATOM   2354 O O   . ILE A 1 326 ? 69.299 73.192  38.567  1.00 16.52 ? 388  ILE A O   1 
ATOM   2355 C CB  . ILE A 1 326 ? 69.950 70.815  36.375  1.00 15.40 ? 388  ILE A CB  1 
ATOM   2356 C CG1 . ILE A 1 326 ? 70.887 70.612  35.185  1.00 15.07 ? 388  ILE A CG1 1 
ATOM   2357 C CG2 . ILE A 1 326 ? 68.708 71.566  35.944  1.00 15.30 ? 388  ILE A CG2 1 
ATOM   2358 C CD1 . ILE A 1 326 ? 70.357 69.640  34.128  1.00 15.09 ? 388  ILE A CD1 1 
ATOM   2359 N N   . LEU A 1 327 ? 69.336 71.172  39.517  1.00 17.44 ? 389  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 327 ? 68.312 71.466  40.533  1.00 18.16 ? 389  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 327 ? 68.725 72.604  41.483  1.00 19.37 ? 389  LEU A C   1 
ATOM   2362 O O   . LEU A 1 327 ? 67.867 73.235  42.113  1.00 19.57 ? 389  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 327 ? 68.003 70.217  41.381  1.00 17.91 ? 389  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 327 ? 66.544 69.847  41.696  1.00 17.39 ? 389  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 327 ? 66.468 69.145  43.047  1.00 15.01 ? 389  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 327 ? 65.609 71.040  41.673  1.00 16.71 ? 389  LEU A CD2 1 
ATOM   2367 N N   . GLN A 1 328 ? 70.027 72.865  41.588  1.00 20.06 ? 390  GLN A N   1 
ATOM   2368 C CA  . GLN A 1 328 ? 70.521 73.854  42.535  1.00 20.52 ? 390  GLN A CA  1 
ATOM   2369 C C   . GLN A 1 328 ? 71.177 75.079  41.893  1.00 20.69 ? 390  GLN A C   1 
ATOM   2370 O O   . GLN A 1 328 ? 71.469 76.038  42.585  1.00 20.57 ? 390  GLN A O   1 
ATOM   2371 C CB  . GLN A 1 328 ? 71.462 73.178  43.545  1.00 20.78 ? 390  GLN A CB  1 
ATOM   2372 C CG  . GLN A 1 328 ? 72.747 72.622  42.976  1.00 21.49 ? 390  GLN A CG  1 
ATOM   2373 C CD  . GLN A 1 328 ? 73.383 71.548  43.845  1.00 22.17 ? 390  GLN A CD  1 
ATOM   2374 O OE1 . GLN A 1 328 ? 74.244 70.812  43.376  1.00 26.19 ? 390  GLN A OE1 1 
ATOM   2375 N NE2 . GLN A 1 328 ? 72.982 71.461  45.114  1.00 24.24 ? 390  GLN A NE2 1 
ATOM   2376 N N   . THR A 1 329 ? 71.390 75.072  40.582  1.00 21.02 ? 391  THR A N   1 
ATOM   2377 C CA  . THR A 1 329 ? 71.991 76.227  39.923  1.00 21.15 ? 391  THR A CA  1 
ATOM   2378 C C   . THR A 1 329 ? 71.244 76.763  38.701  1.00 20.99 ? 391  THR A C   1 
ATOM   2379 O O   . THR A 1 329 ? 71.456 77.908  38.317  1.00 20.79 ? 391  THR A O   1 
ATOM   2380 C CB  . THR A 1 329 ? 73.456 75.941  39.515  1.00 21.40 ? 391  THR A CB  1 
ATOM   2381 O OG1 . THR A 1 329 ? 73.493 74.963  38.475  1.00 22.55 ? 391  THR A OG1 1 
ATOM   2382 C CG2 . THR A 1 329 ? 74.249 75.439  40.709  1.00 22.72 ? 391  THR A CG2 1 
ATOM   2383 N N   . ALA A 1 330 ? 70.385 75.961  38.079  1.00 20.93 ? 392  ALA A N   1 
ATOM   2384 C CA  . ALA A 1 330 ? 69.751 76.389  36.826  1.00 20.94 ? 392  ALA A CA  1 
ATOM   2385 C C   . ALA A 1 330 ? 68.653 77.414  37.068  1.00 20.92 ? 392  ALA A C   1 
ATOM   2386 O O   . ALA A 1 330 ? 68.207 77.621  38.205  1.00 20.77 ? 392  ALA A O   1 
ATOM   2387 C CB  . ALA A 1 330 ? 69.197 75.203  36.054  1.00 20.74 ? 392  ALA A CB  1 
ATOM   2388 N N   . GLU A 1 331 ? 68.216 78.054  35.986  1.00 21.02 ? 393  GLU A N   1 
ATOM   2389 C CA  . GLU A 1 331 ? 67.138 79.023  36.078  1.00 21.02 ? 393  GLU A CA  1 
ATOM   2390 C C   . GLU A 1 331 ? 65.833 78.304  36.411  1.00 20.42 ? 393  GLU A C   1 
ATOM   2391 O O   . GLU A 1 331 ? 65.664 77.137  36.088  1.00 20.40 ? 393  GLU A O   1 
ATOM   2392 C CB  . GLU A 1 331 ? 67.033 79.863  34.799  1.00 21.26 ? 393  GLU A CB  1 
ATOM   2393 C CG  . GLU A 1 331 ? 66.468 79.161  33.576  1.00 22.25 ? 393  GLU A CG  1 
ATOM   2394 C CD  . GLU A 1 331 ? 66.285 80.121  32.407  1.00 22.44 ? 393  GLU A CD  1 
ATOM   2395 O OE1 . GLU A 1 331 ? 67.276 80.784  32.011  1.00 23.48 ? 393  GLU A OE1 1 
ATOM   2396 O OE2 . GLU A 1 331 ? 65.148 80.214  31.888  1.00 24.21 ? 393  GLU A OE2 1 
ATOM   2397 N N   . PHE A 1 332 ? 64.935 79.019  37.075  1.00 20.22 ? 394  PHE A N   1 
ATOM   2398 C CA  . PHE A 1 332 ? 63.711 78.460  37.628  1.00 20.05 ? 394  PHE A CA  1 
ATOM   2399 C C   . PHE A 1 332 ? 63.029 77.425  36.725  1.00 19.59 ? 394  PHE A C   1 
ATOM   2400 O O   . PHE A 1 332 ? 62.786 76.292  37.141  1.00 19.86 ? 394  PHE A O   1 
ATOM   2401 C CB  . PHE A 1 332 ? 62.724 79.597  37.973  1.00 20.87 ? 394  PHE A CB  1 
ATOM   2402 C CG  . PHE A 1 332 ? 61.340 79.111  38.328  1.00 21.07 ? 394  PHE A CG  1 
ATOM   2403 C CD1 . PHE A 1 332 ? 61.061 78.631  39.604  1.00 23.06 ? 394  PHE A CD1 1 
ATOM   2404 C CD2 . PHE A 1 332 ? 60.330 79.101  37.375  1.00 22.22 ? 394  PHE A CD2 1 
ATOM   2405 C CE1 . PHE A 1 332 ? 59.794 78.160  39.920  1.00 22.23 ? 394  PHE A CE1 1 
ATOM   2406 C CE2 . PHE A 1 332 ? 59.068 78.627  37.678  1.00 22.06 ? 394  PHE A CE2 1 
ATOM   2407 C CZ  . PHE A 1 332 ? 58.798 78.160  38.949  1.00 22.99 ? 394  PHE A CZ  1 
ATOM   2408 N N   . ARG A 1 333 ? 62.710 77.798  35.495  1.00 18.91 ? 395  ARG A N   1 
ATOM   2409 C CA  . ARG A 1 333 ? 61.907 76.909  34.647  1.00 18.59 ? 395  ARG A CA  1 
ATOM   2410 C C   . ARG A 1 333 ? 62.592 75.574  34.329  1.00 17.22 ? 395  ARG A C   1 
ATOM   2411 O O   . ARG A 1 333 ? 61.925 74.556  34.222  1.00 16.89 ? 395  ARG A O   1 
ATOM   2412 C CB  . ARG A 1 333 ? 61.430 77.636  33.399  1.00 19.24 ? 395  ARG A CB  1 
ATOM   2413 C CG  . ARG A 1 333 ? 60.458 78.741  33.762  1.00 19.95 ? 395  ARG A CG  1 
ATOM   2414 C CD  . ARG A 1 333 ? 59.555 79.177  32.618  1.00 21.54 ? 395  ARG A CD  1 
ATOM   2415 N NE  . ARG A 1 333 ? 58.486 80.039  33.144  1.00 24.24 ? 395  ARG A NE  1 
ATOM   2416 C CZ  . ARG A 1 333 ? 57.737 80.869  32.419  1.00 26.60 ? 395  ARG A CZ  1 
ATOM   2417 N NH1 . ARG A 1 333 ? 57.907 80.969  31.100  1.00 27.83 ? 395  ARG A NH1 1 
ATOM   2418 N NH2 . ARG A 1 333 ? 56.803 81.607  33.019  1.00 26.89 ? 395  ARG A NH2 1 
ATOM   2419 N N   . THR A 1 334 ? 63.916 75.582  34.228  1.00 15.83 ? 396  THR A N   1 
ATOM   2420 C CA  . THR A 1 334 ? 64.678 74.357  34.090  1.00 15.07 ? 396  THR A CA  1 
ATOM   2421 C C   . THR A 1 334 ? 64.675 73.580  35.416  1.00 14.29 ? 396  THR A C   1 
ATOM   2422 O O   . THR A 1 334 ? 64.377 72.391  35.433  1.00 13.43 ? 396  THR A O   1 
ATOM   2423 C CB  . THR A 1 334 ? 66.101 74.672  33.655  1.00 14.72 ? 396  THR A CB  1 
ATOM   2424 O OG1 . THR A 1 334 ? 66.059 75.503  32.489  1.00 14.54 ? 396  THR A OG1 1 
ATOM   2425 C CG2 . THR A 1 334 ? 66.849 73.408  33.349  1.00 13.97 ? 396  THR A CG2 1 
ATOM   2426 N N   . ARG A 1 335 ? 64.969 74.280  36.520  1.00 13.67 ? 397  ARG A N   1 
ATOM   2427 C CA  . ARG A 1 335 ? 64.948 73.704  37.881  1.00 13.28 ? 397  ARG A CA  1 
ATOM   2428 C C   . ARG A 1 335 ? 63.687 72.930  38.194  1.00 11.95 ? 397  ARG A C   1 
ATOM   2429 O O   . ARG A 1 335 ? 63.734 71.894  38.839  1.00 10.47 ? 397  ARG A O   1 
ATOM   2430 C CB  . ARG A 1 335 ? 65.067 74.799  38.940  1.00 13.72 ? 397  ARG A CB  1 
ATOM   2431 C CG  . ARG A 1 335 ? 66.471 75.065  39.445  1.00 15.95 ? 397  ARG A CG  1 
ATOM   2432 C CD  . ARG A 1 335 ? 66.500 76.262  40.411  1.00 15.63 ? 397  ARG A CD  1 
ATOM   2433 N NE  . ARG A 1 335 ? 66.337 75.874  41.799  1.00 17.06 ? 397  ARG A NE  1 
ATOM   2434 C CZ  . ARG A 1 335 ? 66.359 76.736  42.817  1.00 18.84 ? 397  ARG A CZ  1 
ATOM   2435 N NH1 . ARG A 1 335 ? 66.500 78.037  42.591  1.00 20.19 ? 397  ARG A NH1 1 
ATOM   2436 N NH2 . ARG A 1 335 ? 66.240 76.304  44.070  1.00 19.05 ? 397  ARG A NH2 1 
ATOM   2437 N N   . LYS A 1 336 ? 62.557 73.482  37.778  1.00 11.43 ? 398  LYS A N   1 
ATOM   2438 C CA  . LYS A 1 336 ? 61.269 72.861  37.972  1.00 11.26 ? 398  LYS A CA  1 
ATOM   2439 C C   . LYS A 1 336 ? 61.151 71.508  37.255  1.00 10.43 ? 398  LYS A C   1 
ATOM   2440 O O   . LYS A 1 336 ? 60.574 70.568  37.797  1.00 10.44 ? 398  LYS A O   1 
ATOM   2441 C CB  . LYS A 1 336 ? 60.175 73.811  37.481  1.00 11.76 ? 398  LYS A CB  1 
ATOM   2442 C CG  . LYS A 1 336 ? 58.763 73.351  37.795  1.00 12.56 ? 398  LYS A CG  1 
ATOM   2443 C CD  . LYS A 1 336 ? 57.736 74.198  37.050  1.00 13.89 ? 398  LYS A CD  1 
ATOM   2444 C CE  . LYS A 1 336 ? 56.324 73.944  37.574  1.00 16.62 ? 398  LYS A CE  1 
ATOM   2445 N NZ  . LYS A 1 336 ? 56.029 72.495  37.704  1.00 19.97 ? 398  LYS A NZ  1 
ATOM   2446 N N   . GLU A 1 337 ? 61.690 71.395  36.045  1.00 9.53  ? 399  GLU A N   1 
ATOM   2447 C CA  . GLU A 1 337 ? 61.607 70.124  35.336  1.00 8.90  ? 399  GLU A CA  1 
ATOM   2448 C C   . GLU A 1 337 ? 62.515 69.068  35.984  1.00 7.93  ? 399  GLU A C   1 
ATOM   2449 O O   . GLU A 1 337 ? 62.141 67.888  36.074  1.00 7.60  ? 399  GLU A O   1 
ATOM   2450 C CB  . GLU A 1 337 ? 61.948 70.291  33.844  1.00 9.15  ? 399  GLU A CB  1 
ATOM   2451 C CG  . GLU A 1 337 ? 61.029 71.194  33.091  1.00 9.58  ? 399  GLU A CG  1 
ATOM   2452 C CD  . GLU A 1 337 ? 59.562 70.823  33.280  1.00 12.58 ? 399  GLU A CD  1 
ATOM   2453 O OE1 . GLU A 1 337 ? 59.238 69.609  33.262  1.00 12.44 ? 399  GLU A OE1 1 
ATOM   2454 O OE2 . GLU A 1 337 ? 58.742 71.748  33.474  1.00 12.33 ? 399  GLU A OE2 1 
ATOM   2455 N N   . ALA A 1 338 ? 63.699 69.488  36.418  1.00 6.51  ? 400  ALA A N   1 
ATOM   2456 C CA  . ALA A 1 338 ? 64.623 68.596  37.100  1.00 6.45  ? 400  ALA A CA  1 
ATOM   2457 C C   . ALA A 1 338 ? 64.047 68.112  38.429  1.00 6.35  ? 400  ALA A C   1 
ATOM   2458 O O   . ALA A 1 338 ? 64.311 66.985  38.856  1.00 5.79  ? 400  ALA A O   1 
ATOM   2459 C CB  . ALA A 1 338 ? 65.980 69.302  37.327  1.00 5.80  ? 400  ALA A CB  1 
ATOM   2460 N N   . ALA A 1 339 ? 63.258 68.973  39.081  1.00 6.54  ? 401  ALA A N   1 
ATOM   2461 C CA  . ALA A 1 339 ? 62.560 68.639  40.332  1.00 6.41  ? 401  ALA A CA  1 
ATOM   2462 C C   . ALA A 1 339 ? 61.560 67.522  40.118  1.00 6.17  ? 401  ALA A C   1 
ATOM   2463 O O   . ALA A 1 339 ? 61.488 66.584  40.882  1.00 6.65  ? 401  ALA A O   1 
ATOM   2464 C CB  . ALA A 1 339 ? 61.832 69.872  40.869  1.00 6.35  ? 401  ALA A CB  1 
ATOM   2465 N N   . TRP A 1 340 ? 60.747 67.666  39.080  1.00 6.39  ? 402  TRP A N   1 
ATOM   2466 C CA  . TRP A 1 340 ? 59.835 66.600  38.643  1.00 5.47  ? 402  TRP A CA  1 
ATOM   2467 C C   . TRP A 1 340 ? 60.602 65.292  38.387  1.00 4.94  ? 402  TRP A C   1 
ATOM   2468 O O   . TRP A 1 340 ? 60.190 64.225  38.790  1.00 5.46  ? 402  TRP A O   1 
ATOM   2469 C CB  . TRP A 1 340 ? 59.104 67.037  37.377  1.00 5.28  ? 402  TRP A CB  1 
ATOM   2470 C CG  . TRP A 1 340 ? 57.777 67.682  37.628  1.00 5.24  ? 402  TRP A CG  1 
ATOM   2471 C CD1 . TRP A 1 340 ? 57.444 68.995  37.466  1.00 5.01  ? 402  TRP A CD1 1 
ATOM   2472 C CD2 . TRP A 1 340 ? 56.596 67.024  38.057  1.00 5.24  ? 402  TRP A CD2 1 
ATOM   2473 N NE1 . TRP A 1 340 ? 56.115 69.189  37.782  1.00 5.29  ? 402  TRP A NE1 1 
ATOM   2474 C CE2 . TRP A 1 340 ? 55.575 67.986  38.132  1.00 5.17  ? 402  TRP A CE2 1 
ATOM   2475 C CE3 . TRP A 1 340 ? 56.292 65.703  38.374  1.00 6.95  ? 402  TRP A CE3 1 
ATOM   2476 C CZ2 . TRP A 1 340 ? 54.296 67.670  38.526  1.00 5.31  ? 402  TRP A CZ2 1 
ATOM   2477 C CZ3 . TRP A 1 340 ? 54.996 65.393  38.750  1.00 5.66  ? 402  TRP A CZ3 1 
ATOM   2478 C CH2 . TRP A 1 340 ? 54.027 66.363  38.822  1.00 5.09  ? 402  TRP A CH2 1 
ATOM   2479 N N   . ALA A 1 341 ? 61.749 65.373  37.752  1.00 4.87  ? 403  ALA A N   1 
ATOM   2480 C CA  . ALA A 1 341 ? 62.495 64.165  37.460  1.00 4.68  ? 403  ALA A CA  1 
ATOM   2481 C C   . ALA A 1 341 ? 62.886 63.488  38.748  1.00 4.66  ? 403  ALA A C   1 
ATOM   2482 O O   . ALA A 1 341 ? 62.687 62.288  38.877  1.00 5.18  ? 403  ALA A O   1 
ATOM   2483 C CB  . ALA A 1 341 ? 63.720 64.468  36.590  1.00 4.52  ? 403  ALA A CB  1 
ATOM   2484 N N   . ILE A 1 342 ? 63.440 64.248  39.706  1.00 5.31  ? 404  ILE A N   1 
ATOM   2485 C CA  . ILE A 1 342 ? 63.962 63.683  40.965  1.00 4.46  ? 404  ILE A CA  1 
ATOM   2486 C C   . ILE A 1 342 ? 62.817 63.114  41.773  1.00 4.51  ? 404  ILE A C   1 
ATOM   2487 O O   . ILE A 1 342 ? 62.942 62.040  42.316  1.00 4.74  ? 404  ILE A O   1 
ATOM   2488 C CB  . ILE A 1 342 ? 64.685 64.702  41.836  1.00 5.04  ? 404  ILE A CB  1 
ATOM   2489 C CG1 . ILE A 1 342 ? 65.904 65.301  41.122  1.00 5.72  ? 404  ILE A CG1 1 
ATOM   2490 C CG2 . ILE A 1 342 ? 65.136 64.056  43.132  1.00 5.16  ? 404  ILE A CG2 1 
ATOM   2491 C CD1 . ILE A 1 342 ? 66.993 64.282  40.856  1.00 8.81  ? 404  ILE A CD1 1 
ATOM   2492 N N   . THR A 1 343 ? 61.703 63.836  41.831  1.00 3.68  ? 405  THR A N   1 
ATOM   2493 C CA  . THR A 1 343 ? 60.564 63.443  42.616  1.00 3.22  ? 405  THR A CA  1 
ATOM   2494 C C   . THR A 1 343 ? 59.838 62.235  42.060  1.00 2.52  ? 405  THR A C   1 
ATOM   2495 O O   . THR A 1 343 ? 59.384 61.388  42.808  1.00 2.44  ? 405  THR A O   1 
ATOM   2496 C CB  . THR A 1 343 ? 59.552 64.627  42.769  1.00 3.88  ? 405  THR A CB  1 
ATOM   2497 O OG1 . THR A 1 343 ? 60.056 65.551  43.726  1.00 2.91  ? 405  THR A OG1 1 
ATOM   2498 C CG2 . THR A 1 343 ? 58.151 64.129  43.237  1.00 3.36  ? 405  THR A CG2 1 
ATOM   2499 N N   . ASN A 1 344 ? 59.688 62.142  40.749  1.00 2.77  ? 406  ASN A N   1 
ATOM   2500 C CA  . ASN A 1 344 ? 59.089 60.921  40.179  1.00 2.02  ? 406  ASN A CA  1 
ATOM   2501 C C   . ASN A 1 344 ? 59.932 59.705  40.509  1.00 2.00  ? 406  ASN A C   1 
ATOM   2502 O O   . ASN A 1 344 ? 59.408 58.675  40.874  1.00 2.00  ? 406  ASN A O   1 
ATOM   2503 C CB  . ASN A 1 344 ? 58.861 61.075  38.669  1.00 2.26  ? 406  ASN A CB  1 
ATOM   2504 C CG  . ASN A 1 344 ? 57.798 62.078  38.357  1.00 2.39  ? 406  ASN A CG  1 
ATOM   2505 O OD1 . ASN A 1 344 ? 57.025 62.435  39.229  1.00 3.57  ? 406  ASN A OD1 1 
ATOM   2506 N ND2 . ASN A 1 344 ? 57.756 62.561  37.113  1.00 3.36  ? 406  ASN A ND2 1 
ATOM   2507 N N   . ALA A 1 345 ? 61.253 59.848  40.427  1.00 2.00  ? 407  ALA A N   1 
ATOM   2508 C CA  . ALA A 1 345 ? 62.186 58.787  40.795  1.00 2.00  ? 407  ALA A CA  1 
ATOM   2509 C C   . ALA A 1 345 ? 61.903 58.355  42.233  1.00 2.01  ? 407  ALA A C   1 
ATOM   2510 O O   . ALA A 1 345 ? 61.657 57.176  42.489  1.00 2.65  ? 407  ALA A O   1 
ATOM   2511 C CB  . ALA A 1 345 ? 63.642 59.276  40.609  1.00 2.00  ? 407  ALA A CB  1 
ATOM   2512 N N   . THR A 1 346 ? 61.817 59.307  43.173  1.00 2.41  ? 408  THR A N   1 
ATOM   2513 C CA  . THR A 1 346 ? 61.526 58.954  44.568  1.00 2.64  ? 408  THR A CA  1 
ATOM   2514 C C   . THR A 1 346 ? 60.112 58.325  44.739  1.00 2.80  ? 408  THR A C   1 
ATOM   2515 O O   . THR A 1 346 ? 59.892 57.567  45.671  1.00 2.09  ? 408  THR A O   1 
ATOM   2516 C CB  . THR A 1 346 ? 61.641 60.149  45.550  1.00 2.48  ? 408  THR A CB  1 
ATOM   2517 O OG1 . THR A 1 346 ? 60.514 61.018  45.367  1.00 2.09  ? 408  THR A OG1 1 
ATOM   2518 C CG2 . THR A 1 346 ? 62.955 60.935  45.378  1.00 2.00  ? 408  THR A CG2 1 
ATOM   2519 N N   . SER A 1 347 ? 59.147 58.642  43.876  1.00 4.03  ? 409  SER A N   1 
ATOM   2520 C CA  . SER A 1 347 ? 57.788 58.011  44.019  1.00 4.59  ? 409  SER A CA  1 
ATOM   2521 C C   . SER A 1 347 ? 57.794 56.546  43.635  1.00 5.08  ? 409  SER A C   1 
ATOM   2522 O O   . SER A 1 347 ? 57.104 55.723  44.255  1.00 6.71  ? 409  SER A O   1 
ATOM   2523 C CB  . SER A 1 347 ? 56.721 58.715  43.195  1.00 4.48  ? 409  SER A CB  1 
ATOM   2524 O OG  . SER A 1 347 ? 57.001 58.621  41.791  1.00 10.41 ? 409  SER A OG  1 
ATOM   2525 N N   . GLY A 1 348 ? 58.564 56.210  42.613  1.00 4.76  ? 410  GLY A N   1 
ATOM   2526 C CA  . GLY A 1 348 ? 58.560 54.868  42.078  1.00 4.59  ? 410  GLY A CA  1 
ATOM   2527 C C   . GLY A 1 348 ? 59.663 53.946  42.515  1.00 4.51  ? 410  GLY A C   1 
ATOM   2528 O O   . GLY A 1 348 ? 59.542 52.726  42.340  1.00 4.01  ? 410  GLY A O   1 
ATOM   2529 N N   . GLY A 1 349 ? 60.724 54.498  43.100  1.00 4.39  ? 411  GLY A N   1 
ATOM   2530 C CA  . GLY A 1 349 ? 61.948 53.733  43.319  1.00 4.17  ? 411  GLY A CA  1 
ATOM   2531 C C   . GLY A 1 349 ? 61.998 52.919  44.605  1.00 4.19  ? 411  GLY A C   1 
ATOM   2532 O O   . GLY A 1 349 ? 61.161 53.104  45.503  1.00 3.32  ? 411  GLY A O   1 
ATOM   2533 N N   . SER A 1 350 ? 63.008 52.036  44.672  1.00 3.74  ? 412  SER A N   1 
ATOM   2534 C CA  . SER A 1 350 ? 63.280 51.183  45.833  1.00 3.99  ? 412  SER A CA  1 
ATOM   2535 C C   . SER A 1 350 ? 64.085 51.920  46.890  1.00 4.21  ? 412  SER A C   1 
ATOM   2536 O O   . SER A 1 350 ? 64.610 53.006  46.637  1.00 5.14  ? 412  SER A O   1 
ATOM   2537 C CB  . SER A 1 350 ? 64.070 49.940  45.418  1.00 4.17  ? 412  SER A CB  1 
ATOM   2538 O OG  . SER A 1 350 ? 65.398 50.273  45.032  1.00 3.91  ? 412  SER A OG  1 
ATOM   2539 N N   . ALA A 1 351 ? 64.209 51.313  48.062  1.00 3.66  ? 413  ALA A N   1 
ATOM   2540 C CA  . ALA A 1 351 ? 64.960 51.910  49.138  1.00 3.48  ? 413  ALA A CA  1 
ATOM   2541 C C   . ALA A 1 351 ? 66.399 52.128  48.724  1.00 3.92  ? 413  ALA A C   1 
ATOM   2542 O O   . ALA A 1 351 ? 67.014 53.166  49.069  1.00 3.59  ? 413  ALA A O   1 
ATOM   2543 C CB  . ALA A 1 351 ? 64.882 51.017  50.386  1.00 2.95  ? 413  ALA A CB  1 
ATOM   2544 N N   . GLU A 1 352 ? 66.947 51.165  47.981  1.00 3.55  ? 414  GLU A N   1 
ATOM   2545 C CA  . GLU A 1 352 ? 68.351 51.226  47.595  1.00 4.85  ? 414  GLU A CA  1 
ATOM   2546 C C   . GLU A 1 352 ? 68.625 52.356  46.580  1.00 4.92  ? 414  GLU A C   1 
ATOM   2547 O O   . GLU A 1 352 ? 69.709 52.967  46.615  1.00 4.65  ? 414  GLU A O   1 
ATOM   2548 C CB  . GLU A 1 352 ? 68.829 49.879  47.060  1.00 5.14  ? 414  GLU A CB  1 
ATOM   2549 C CG  . GLU A 1 352 ? 68.895 48.788  48.130  1.00 8.61  ? 414  GLU A CG  1 
ATOM   2550 C CD  . GLU A 1 352 ? 67.524 48.146  48.470  1.00 13.95 ? 414  GLU A CD  1 
ATOM   2551 O OE1 . GLU A 1 352 ? 66.532 48.297  47.687  1.00 13.92 ? 414  GLU A OE1 1 
ATOM   2552 O OE2 . GLU A 1 352 ? 67.453 47.476  49.539  1.00 17.66 ? 414  GLU A OE2 1 
ATOM   2553 N N   . GLN A 1 353 ? 67.641 52.618  45.710  1.00 4.74  ? 415  GLN A N   1 
ATOM   2554 C CA  . GLN A 1 353 ? 67.714 53.664  44.650  1.00 5.00  ? 415  GLN A CA  1 
ATOM   2555 C C   . GLN A 1 353 ? 67.584 55.052  45.259  1.00 5.10  ? 415  GLN A C   1 
ATOM   2556 O O   . GLN A 1 353 ? 68.342 55.956  44.918  1.00 5.03  ? 415  GLN A O   1 
ATOM   2557 C CB  . GLN A 1 353 ? 66.619 53.471  43.607  1.00 4.42  ? 415  GLN A CB  1 
ATOM   2558 C CG  . GLN A 1 353 ? 66.767 52.225  42.735  1.00 4.11  ? 415  GLN A CG  1 
ATOM   2559 C CD  . GLN A 1 353 ? 65.565 51.971  41.800  1.00 5.76  ? 415  GLN A CD  1 
ATOM   2560 O OE1 . GLN A 1 353 ? 64.394 52.233  42.153  1.00 2.00  ? 415  GLN A OE1 1 
ATOM   2561 N NE2 . GLN A 1 353 ? 65.855 51.462  40.600  1.00 3.23  ? 415  GLN A NE2 1 
ATOM   2562 N N   . ILE A 1 354 ? 66.635 55.201  46.187  1.00 5.30  ? 416  ILE A N   1 
ATOM   2563 C CA  . ILE A 1 354 ? 66.563 56.404  47.035  1.00 5.21  ? 416  ILE A CA  1 
ATOM   2564 C C   . ILE A 1 354 ? 67.816 56.664  47.893  1.00 4.62  ? 416  ILE A C   1 
ATOM   2565 O O   . ILE A 1 354 ? 68.241 57.791  48.010  1.00 5.23  ? 416  ILE A O   1 
ATOM   2566 C CB  . ILE A 1 354 ? 65.338 56.392  47.943  1.00 5.36  ? 416  ILE A CB  1 
ATOM   2567 C CG1 . ILE A 1 354 ? 64.114 56.869  47.161  1.00 6.94  ? 416  ILE A CG1 1 
ATOM   2568 C CG2 . ILE A 1 354 ? 65.530 57.320  49.140  1.00 5.30  ? 416  ILE A CG2 1 
ATOM   2569 C CD1 . ILE A 1 354 ? 63.853 56.096  45.866  1.00 7.82  ? 416  ILE A CD1 1 
ATOM   2570 N N   . LYS A 1 355 ? 68.362 55.631  48.521  1.00 4.44  ? 417  LYS A N   1 
ATOM   2571 C CA  . LYS A 1 355 ? 69.620 55.740  49.273  1.00 4.40  ? 417  LYS A CA  1 
ATOM   2572 C C   . LYS A 1 355 ? 70.703 56.357  48.393  1.00 3.96  ? 417  LYS A C   1 
ATOM   2573 O O   . LYS A 1 355 ? 71.378 57.297  48.802  1.00 4.20  ? 417  LYS A O   1 
ATOM   2574 C CB  . LYS A 1 355 ? 70.046 54.362  49.823  1.00 4.15  ? 417  LYS A CB  1 
ATOM   2575 C CG  . LYS A 1 355 ? 71.361 54.334  50.635  1.00 5.10  ? 417  LYS A CG  1 
ATOM   2576 C CD  . LYS A 1 355 ? 71.778 52.912  51.080  1.00 4.82  ? 417  LYS A CD  1 
ATOM   2577 C CE  . LYS A 1 355 ? 71.350 52.559  52.499  1.00 7.49  ? 417  LYS A CE  1 
ATOM   2578 N NZ  . LYS A 1 355 ? 72.289 51.528  53.237  1.00 7.22  ? 417  LYS A NZ  1 
ATOM   2579 N N   . TYR A 1 356 ? 70.864 55.833  47.178  1.00 4.37  ? 418  TYR A N   1 
ATOM   2580 C CA  . TYR A 1 356 ? 71.776 56.420  46.184  1.00 4.17  ? 418  TYR A CA  1 
ATOM   2581 C C   . TYR A 1 356 ? 71.452 57.889  45.852  1.00 3.61  ? 418  TYR A C   1 
ATOM   2582 O O   . TYR A 1 356 ? 72.356 58.700  45.812  1.00 2.00  ? 418  TYR A O   1 
ATOM   2583 C CB  . TYR A 1 356 ? 71.807 55.559  44.920  1.00 5.93  ? 418  TYR A CB  1 
ATOM   2584 C CG  . TYR A 1 356 ? 72.477 56.180  43.729  1.00 6.41  ? 418  TYR A CG  1 
ATOM   2585 C CD1 . TYR A 1 356 ? 73.866 56.219  43.615  1.00 9.61  ? 418  TYR A CD1 1 
ATOM   2586 C CD2 . TYR A 1 356 ? 71.724 56.682  42.685  1.00 8.98  ? 418  TYR A CD2 1 
ATOM   2587 C CE1 . TYR A 1 356 ? 74.477 56.782  42.476  1.00 8.38  ? 418  TYR A CE1 1 
ATOM   2588 C CE2 . TYR A 1 356 ? 72.324 57.250  41.572  1.00 9.28  ? 418  TYR A CE2 1 
ATOM   2589 C CZ  . TYR A 1 356 ? 73.691 57.294  41.476  1.00 9.76  ? 418  TYR A CZ  1 
ATOM   2590 O OH  . TYR A 1 356 ? 74.249 57.864  40.338  1.00 11.51 ? 418  TYR A OH  1 
ATOM   2591 N N   . LEU A 1 357 ? 70.174 58.243  45.658  1.00 2.48  ? 419  LEU A N   1 
ATOM   2592 C CA  . LEU A 1 357 ? 69.836 59.644  45.383  1.00 2.35  ? 419  LEU A CA  1 
ATOM   2593 C C   . LEU A 1 357 ? 70.164 60.557  46.558  1.00 2.00  ? 419  LEU A C   1 
ATOM   2594 O O   . LEU A 1 357 ? 70.608 61.688  46.371  1.00 2.00  ? 419  LEU A O   1 
ATOM   2595 C CB  . LEU A 1 357 ? 68.357 59.805  44.981  1.00 2.86  ? 419  LEU A CB  1 
ATOM   2596 C CG  . LEU A 1 357 ? 67.961 59.129  43.667  1.00 4.30  ? 419  LEU A CG  1 
ATOM   2597 C CD1 . LEU A 1 357 ? 66.504 59.400  43.301  1.00 2.00  ? 419  LEU A CD1 1 
ATOM   2598 C CD2 . LEU A 1 357 ? 68.936 59.491  42.519  1.00 2.00  ? 419  LEU A CD2 1 
ATOM   2599 N N   . VAL A 1 358 ? 69.985 60.048  47.776  1.00 2.00  ? 420  VAL A N   1 
ATOM   2600 C CA  . VAL A 1 358 ? 70.341 60.782  48.976  1.00 2.00  ? 420  VAL A CA  1 
ATOM   2601 C C   . VAL A 1 358 ? 71.854 60.993  49.095  1.00 2.00  ? 420  VAL A C   1 
ATOM   2602 O O   . VAL A 1 358 ? 72.293 62.080  49.482  1.00 2.00  ? 420  VAL A O   1 
ATOM   2603 C CB  . VAL A 1 358 ? 69.742 60.102  50.229  1.00 2.00  ? 420  VAL A CB  1 
ATOM   2604 C CG1 . VAL A 1 358 ? 70.374 60.629  51.499  1.00 2.00  ? 420  VAL A CG1 1 
ATOM   2605 C CG2 . VAL A 1 358 ? 68.246 60.308  50.231  1.00 2.00  ? 420  VAL A CG2 1 
ATOM   2606 N N   . GLU A 1 359 ? 72.633 59.968  48.751  1.00 2.00  ? 421  GLU A N   1 
ATOM   2607 C CA  . GLU A 1 359 ? 74.094 60.025  48.758  1.00 2.24  ? 421  GLU A CA  1 
ATOM   2608 C C   . GLU A 1 359 ? 74.720 60.977  47.706  1.00 3.26  ? 421  GLU A C   1 
ATOM   2609 O O   . GLU A 1 359 ? 75.870 61.417  47.864  1.00 4.16  ? 421  GLU A O   1 
ATOM   2610 C CB  . GLU A 1 359 ? 74.657 58.615  48.531  1.00 2.00  ? 421  GLU A CB  1 
ATOM   2611 C CG  . GLU A 1 359 ? 74.473 57.625  49.695  1.00 2.06  ? 421  GLU A CG  1 
ATOM   2612 C CD  . GLU A 1 359 ? 75.057 56.210  49.445  1.00 2.97  ? 421  GLU A CD  1 
ATOM   2613 O OE1 . GLU A 1 359 ? 75.140 55.739  48.304  1.00 8.88  ? 421  GLU A OE1 1 
ATOM   2614 O OE2 . GLU A 1 359 ? 75.410 55.528  50.408  1.00 5.96  ? 421  GLU A OE2 1 
ATOM   2615 N N   . LEU A 1 360 ? 73.990 61.245  46.619  1.00 3.71  ? 422  LEU A N   1 
ATOM   2616 C CA  . LEU A 1 360 ? 74.403 62.206  45.594  1.00 3.43  ? 422  LEU A CA  1 
ATOM   2617 C C   . LEU A 1 360 ? 74.001 63.606  45.991  1.00 3.86  ? 422  LEU A C   1 
ATOM   2618 O O   . LEU A 1 360 ? 74.454 64.572  45.380  1.00 4.28  ? 422  LEU A O   1 
ATOM   2619 C CB  . LEU A 1 360 ? 73.750 61.895  44.253  1.00 3.71  ? 422  LEU A CB  1 
ATOM   2620 C CG  . LEU A 1 360 ? 74.182 60.651  43.505  1.00 2.00  ? 422  LEU A CG  1 
ATOM   2621 C CD1 . LEU A 1 360 ? 73.454 60.634  42.207  1.00 2.00  ? 422  LEU A CD1 1 
ATOM   2622 C CD2 . LEU A 1 360 ? 75.688 60.679  43.293  1.00 3.31  ? 422  LEU A CD2 1 
ATOM   2623 N N   . GLY A 1 361 ? 73.133 63.699  46.995  1.00 3.60  ? 423  GLY A N   1 
ATOM   2624 C CA  . GLY A 1 361 ? 72.852 64.932  47.687  1.00 3.62  ? 423  GLY A CA  1 
ATOM   2625 C C   . GLY A 1 361 ? 71.530 65.522  47.270  1.00 3.90  ? 423  GLY A C   1 
ATOM   2626 O O   . GLY A 1 361 ? 71.414 66.724  47.174  1.00 4.71  ? 423  GLY A O   1 
ATOM   2627 N N   . CYS A 1 362 ? 70.514 64.709  47.022  1.00 3.75  ? 424  CYS A N   1 
ATOM   2628 C CA  . CYS A 1 362 ? 69.267 65.276  46.527  1.00 3.83  ? 424  CYS A CA  1 
ATOM   2629 C C   . CYS A 1 362 ? 68.418 66.001  47.570  1.00 3.37  ? 424  CYS A C   1 
ATOM   2630 O O   . CYS A 1 362 ? 67.558 66.790  47.181  1.00 4.08  ? 424  CYS A O   1 
ATOM   2631 C CB  . CYS A 1 362 ? 68.415 64.226  45.825  1.00 4.36  ? 424  CYS A CB  1 
ATOM   2632 S SG  . CYS A 1 362 ? 67.801 62.965  46.905  1.00 7.83  ? 424  CYS A SG  1 
ATOM   2633 N N   . ILE A 1 363 ? 68.625 65.752  48.868  1.00 2.98  ? 425  ILE A N   1 
ATOM   2634 C CA  . ILE A 1 363 ? 67.713 66.293  49.878  1.00 3.00  ? 425  ILE A CA  1 
ATOM   2635 C C   . ILE A 1 363 ? 67.837 67.803  49.983  1.00 3.19  ? 425  ILE A C   1 
ATOM   2636 O O   . ILE A 1 363 ? 66.820 68.487  50.030  1.00 3.41  ? 425  ILE A O   1 
ATOM   2637 C CB  . ILE A 1 363 ? 67.883 65.614  51.276  1.00 3.40  ? 425  ILE A CB  1 
ATOM   2638 C CG1 . ILE A 1 363 ? 67.432 64.157  51.231  1.00 2.24  ? 425  ILE A CG1 1 
ATOM   2639 C CG2 . ILE A 1 363 ? 67.113 66.371  52.388  1.00 2.05  ? 425  ILE A CG2 1 
ATOM   2640 C CD1 . ILE A 1 363 ? 67.604 63.418  52.553  1.00 2.00  ? 425  ILE A CD1 1 
ATOM   2641 N N   . LYS A 1 364 ? 69.063 68.324  50.007  1.00 3.43  ? 426  LYS A N   1 
ATOM   2642 C CA  . LYS A 1 364 ? 69.282 69.769  50.147  1.00 4.32  ? 426  LYS A CA  1 
ATOM   2643 C C   . LYS A 1 364 ? 68.586 70.602  49.055  1.00 4.87  ? 426  LYS A C   1 
ATOM   2644 O O   . LYS A 1 364 ? 67.780 71.470  49.396  1.00 6.30  ? 426  LYS A O   1 
ATOM   2645 C CB  . LYS A 1 364 ? 70.780 70.097  50.248  1.00 4.50  ? 426  LYS A CB  1 
ATOM   2646 C CG  . LYS A 1 364 ? 71.150 71.586  50.280  1.00 4.61  ? 426  LYS A CG  1 
ATOM   2647 C CD  . LYS A 1 364 ? 70.400 72.327  51.366  1.00 6.02  ? 426  LYS A CD  1 
ATOM   2648 C CE  . LYS A 1 364 ? 70.886 73.747  51.564  1.00 5.81  ? 426  LYS A CE  1 
ATOM   2649 N NZ  . LYS A 1 364 ? 69.992 74.442  52.541  1.00 5.19  ? 426  LYS A NZ  1 
ATOM   2650 N N   . PRO A 1 365 ? 68.859 70.342  47.758  1.00 5.00  ? 427  PRO A N   1 
ATOM   2651 C CA  . PRO A 1 365 ? 68.159 71.067  46.675  1.00 5.61  ? 427  PRO A CA  1 
ATOM   2652 C C   . PRO A 1 365 ? 66.637 71.004  46.740  1.00 6.37  ? 427  PRO A C   1 
ATOM   2653 O O   . PRO A 1 365 ? 65.947 71.950  46.384  1.00 6.73  ? 427  PRO A O   1 
ATOM   2654 C CB  . PRO A 1 365 ? 68.614 70.350  45.410  1.00 6.02  ? 427  PRO A CB  1 
ATOM   2655 C CG  . PRO A 1 365 ? 69.662 69.393  45.797  1.00 5.80  ? 427  PRO A CG  1 
ATOM   2656 C CD  . PRO A 1 365 ? 69.868 69.403  47.243  1.00 4.58  ? 427  PRO A CD  1 
ATOM   2657 N N   . LEU A 1 366 ? 66.123 69.869  47.175  1.00 6.68  ? 428  LEU A N   1 
ATOM   2658 C CA  . LEU A 1 366 ? 64.695 69.659  47.255  1.00 6.35  ? 428  LEU A CA  1 
ATOM   2659 C C   . LEU A 1 366 ? 64.136 70.534  48.381  1.00 6.82  ? 428  LEU A C   1 
ATOM   2660 O O   . LEU A 1 366 ? 63.070 71.132  48.241  1.00 6.53  ? 428  LEU A O   1 
ATOM   2661 C CB  . LEU A 1 366 ? 64.424 68.181  47.502  1.00 6.07  ? 428  LEU A CB  1 
ATOM   2662 C CG  . LEU A 1 366 ? 63.580 67.291  46.571  1.00 7.49  ? 428  LEU A CG  1 
ATOM   2663 C CD1 . LEU A 1 366 ? 63.571 67.648  45.056  1.00 4.82  ? 428  LEU A CD1 1 
ATOM   2664 C CD2 . LEU A 1 366 ? 63.934 65.807  46.839  1.00 6.19  ? 428  LEU A CD2 1 
ATOM   2665 N N   . CYS A 1 367 ? 64.879 70.626  49.485  1.00 7.11  ? 429  CYS A N   1 
ATOM   2666 C CA  . CYS A 1 367 ? 64.485 71.449  50.638  1.00 7.25  ? 429  CYS A CA  1 
ATOM   2667 C C   . CYS A 1 367 ? 64.552 72.934  50.298  1.00 7.44  ? 429  CYS A C   1 
ATOM   2668 O O   . CYS A 1 367 ? 63.643 73.695  50.653  1.00 7.14  ? 429  CYS A O   1 
ATOM   2669 C CB  . CYS A 1 367 ? 65.350 71.135  51.873  1.00 6.82  ? 429  CYS A CB  1 
ATOM   2670 S SG  . CYS A 1 367 ? 64.917 69.600  52.696  1.00 7.50  ? 429  CYS A SG  1 
ATOM   2671 N N   . ASP A 1 368 ? 65.622 73.329  49.602  1.00 7.81  ? 430  ASP A N   1 
ATOM   2672 C CA  . ASP A 1 368 ? 65.776 74.699  49.088  1.00 8.16  ? 430  ASP A CA  1 
ATOM   2673 C C   . ASP A 1 368 ? 64.617 75.167  48.206  1.00 8.37  ? 430  ASP A C   1 
ATOM   2674 O O   . ASP A 1 368 ? 64.313 76.362  48.180  1.00 8.51  ? 430  ASP A O   1 
ATOM   2675 C CB  . ASP A 1 368 ? 67.078 74.830  48.306  1.00 8.39  ? 430  ASP A CB  1 
ATOM   2676 C CG  . ASP A 1 368 ? 68.301 74.931  49.200  1.00 8.76  ? 430  ASP A CG  1 
ATOM   2677 O OD1 . ASP A 1 368 ? 68.190 74.974  50.449  1.00 8.82  ? 430  ASP A OD1 1 
ATOM   2678 O OD2 . ASP A 1 368 ? 69.406 74.972  48.630  1.00 12.08 ? 430  ASP A OD2 1 
ATOM   2679 N N   . LEU A 1 369 ? 63.956 74.241  47.511  1.00 8.46  ? 431  LEU A N   1 
ATOM   2680 C CA  . LEU A 1 369 ? 62.753 74.578  46.723  1.00 9.04  ? 431  LEU A CA  1 
ATOM   2681 C C   . LEU A 1 369 ? 61.519 74.898  47.552  1.00 9.45  ? 431  LEU A C   1 
ATOM   2682 O O   . LEU A 1 369 ? 60.555 75.453  47.028  1.00 9.78  ? 431  LEU A O   1 
ATOM   2683 C CB  . LEU A 1 369 ? 62.379 73.440  45.770  1.00 8.66  ? 431  LEU A CB  1 
ATOM   2684 C CG  . LEU A 1 369 ? 63.275 73.301  44.560  1.00 8.19  ? 431  LEU A CG  1 
ATOM   2685 C CD1 . LEU A 1 369 ? 63.039 71.957  43.900  1.00 7.80  ? 431  LEU A CD1 1 
ATOM   2686 C CD2 . LEU A 1 369 ? 63.003 74.444  43.606  1.00 9.13  ? 431  LEU A CD2 1 
ATOM   2687 N N   . LEU A 1 370 ? 61.522 74.524  48.826  1.00 10.50 ? 432  LEU A N   1 
ATOM   2688 C CA  . LEU A 1 370 ? 60.374 74.759  49.694  1.00 11.18 ? 432  LEU A CA  1 
ATOM   2689 C C   . LEU A 1 370 ? 60.177 76.254  49.990  1.00 12.20 ? 432  LEU A C   1 
ATOM   2690 O O   . LEU A 1 370 ? 59.082 76.669  50.379  1.00 11.99 ? 432  LEU A O   1 
ATOM   2691 C CB  . LEU A 1 370 ? 60.505 73.946  50.983  1.00 10.73 ? 432  LEU A CB  1 
ATOM   2692 C CG  . LEU A 1 370 ? 60.578 72.415  50.819  1.00 10.64 ? 432  LEU A CG  1 
ATOM   2693 C CD1 . LEU A 1 370 ? 60.855 71.737  52.132  1.00 8.61  ? 432  LEU A CD1 1 
ATOM   2694 C CD2 . LEU A 1 370 ? 59.308 71.868  50.237  1.00 6.64  ? 432  LEU A CD2 1 
ATOM   2695 N N   . THR A 1 371 ? 61.213 77.062  49.751  1.00 13.29 ? 433  THR A N   1 
ATOM   2696 C CA  . THR A 1 371 ? 61.156 78.502  50.013  1.00 14.66 ? 433  THR A CA  1 
ATOM   2697 C C   . THR A 1 371 ? 60.927 79.345  48.758  1.00 15.58 ? 433  THR A C   1 
ATOM   2698 O O   . THR A 1 371 ? 60.877 80.577  48.833  1.00 15.59 ? 433  THR A O   1 
ATOM   2699 C CB  . THR A 1 371 ? 62.459 78.969  50.673  1.00 14.86 ? 433  THR A CB  1 
ATOM   2700 O OG1 . THR A 1 371 ? 63.551 78.699  49.789  1.00 15.97 ? 433  THR A OG1 1 
ATOM   2701 C CG2 . THR A 1 371 ? 62.679 78.233  51.998  1.00 15.27 ? 433  THR A CG2 1 
ATOM   2702 N N   . VAL A 1 372 ? 60.787 78.677  47.612  1.00 16.72 ? 434  VAL A N   1 
ATOM   2703 C CA  . VAL A 1 372 ? 60.571 79.335  46.325  1.00 17.31 ? 434  VAL A CA  1 
ATOM   2704 C C   . VAL A 1 372 ? 59.098 79.735  46.197  1.00 18.21 ? 434  VAL A C   1 
ATOM   2705 O O   . VAL A 1 372 ? 58.204 79.007  46.626  1.00 18.16 ? 434  VAL A O   1 
ATOM   2706 C CB  . VAL A 1 372 ? 61.017 78.410  45.172  1.00 17.44 ? 434  VAL A CB  1 
ATOM   2707 C CG1 . VAL A 1 372 ? 60.302 78.735  43.877  1.00 17.87 ? 434  VAL A CG1 1 
ATOM   2708 C CG2 . VAL A 1 372 ? 62.522 78.490  44.993  1.00 17.69 ? 434  VAL A CG2 1 
ATOM   2709 N N   . MET A 1 373 ? 58.849 80.909  45.628  1.00 19.51 ? 435  MET A N   1 
ATOM   2710 C CA  . MET A 1 373 ? 57.497 81.449  45.552  1.00 20.11 ? 435  MET A CA  1 
ATOM   2711 C C   . MET A 1 373 ? 56.842 80.949  44.276  1.00 20.09 ? 435  MET A C   1 
ATOM   2712 O O   . MET A 1 373 ? 56.575 81.716  43.361  1.00 20.41 ? 435  MET A O   1 
ATOM   2713 C CB  . MET A 1 373 ? 57.499 82.989  45.604  1.00 21.47 ? 435  MET A CB  1 
ATOM   2714 C CG  . MET A 1 373 ? 58.080 83.624  46.878  1.00 24.32 ? 435  MET A CG  1 
ATOM   2715 S SD  . MET A 1 373 ? 57.496 82.909  48.439  1.00 34.63 ? 435  MET A SD  1 
ATOM   2716 C CE  . MET A 1 373 ? 55.716 82.745  48.119  1.00 33.34 ? 435  MET A CE  1 
ATOM   2717 N N   . ASP A 1 374 ? 56.630 79.638  44.220  1.00 19.76 ? 436  ASP A N   1 
ATOM   2718 C CA  . ASP A 1 374 ? 55.843 78.994  43.169  1.00 18.98 ? 436  ASP A CA  1 
ATOM   2719 C C   . ASP A 1 374 ? 55.235 77.731  43.770  1.00 18.35 ? 436  ASP A C   1 
ATOM   2720 O O   . ASP A 1 374 ? 55.958 76.795  44.105  1.00 18.16 ? 436  ASP A O   1 
ATOM   2721 C CB  . ASP A 1 374 ? 56.698 78.628  41.956  1.00 19.48 ? 436  ASP A CB  1 
ATOM   2722 C CG  . ASP A 1 374 ? 55.889 77.929  40.862  1.00 20.07 ? 436  ASP A CG  1 
ATOM   2723 O OD1 . ASP A 1 374 ? 54.824 78.449  40.474  1.00 22.94 ? 436  ASP A OD1 1 
ATOM   2724 O OD2 . ASP A 1 374 ? 56.316 76.859  40.385  1.00 22.53 ? 436  ASP A OD2 1 
ATOM   2725 N N   . SER A 1 375 ? 53.910 77.724  43.903  1.00 17.26 ? 437  SER A N   1 
ATOM   2726 C CA  . SER A 1 375 ? 53.199 76.675  44.612  1.00 16.52 ? 437  SER A CA  1 
ATOM   2727 C C   . SER A 1 375 ? 53.321 75.313  43.915  1.00 15.85 ? 437  SER A C   1 
ATOM   2728 O O   . SER A 1 375 ? 53.218 74.260  44.560  1.00 16.14 ? 437  SER A O   1 
ATOM   2729 C CB  . SER A 1 375 ? 51.721 77.046  44.742  1.00 16.43 ? 437  SER A CB  1 
ATOM   2730 O OG  . SER A 1 375 ? 50.983 76.545  43.642  1.00 16.92 ? 437  SER A OG  1 
ATOM   2731 N N   . LYS A 1 376 ? 53.510 75.333  42.602  1.00 14.59 ? 438  LYS A N   1 
ATOM   2732 C CA  . LYS A 1 376 ? 53.633 74.099  41.842  1.00 14.21 ? 438  LYS A CA  1 
ATOM   2733 C C   . LYS A 1 376 ? 54.966 73.377  42.142  1.00 12.53 ? 438  LYS A C   1 
ATOM   2734 O O   . LYS A 1 376 ? 54.984 72.167  42.293  1.00 11.81 ? 438  LYS A O   1 
ATOM   2735 C CB  . LYS A 1 376 ? 53.487 74.372  40.334  1.00 14.50 ? 438  LYS A CB  1 
ATOM   2736 C CG  . LYS A 1 376 ? 52.134 74.961  39.904  1.00 16.24 ? 438  LYS A CG  1 
ATOM   2737 C CD  . LYS A 1 376 ? 52.045 75.117  38.368  1.00 16.66 ? 438  LYS A CD  1 
ATOM   2738 C CE  . LYS A 1 376 ? 50.654 75.561  37.900  1.00 18.52 ? 438  LYS A CE  1 
ATOM   2739 N NZ  . LYS A 1 376 ? 49.647 74.450  37.898  1.00 20.91 ? 438  LYS A NZ  1 
ATOM   2740 N N   . ILE A 1 377 ? 56.073 74.114  42.234  1.00 11.64 ? 439  ILE A N   1 
ATOM   2741 C CA  . ILE A 1 377 ? 57.392 73.488  42.479  1.00 10.92 ? 439  ILE A CA  1 
ATOM   2742 C C   . ILE A 1 377 ? 57.529 73.005  43.928  1.00 9.80  ? 439  ILE A C   1 
ATOM   2743 O O   . ILE A 1 377 ? 58.165 71.981  44.198  1.00 8.08  ? 439  ILE A O   1 
ATOM   2744 C CB  . ILE A 1 377 ? 58.554 74.431  42.099  1.00 10.98 ? 439  ILE A CB  1 
ATOM   2745 C CG1 . ILE A 1 377 ? 59.843 73.634  41.887  1.00 12.40 ? 439  ILE A CG1 1 
ATOM   2746 C CG2 . ILE A 1 377 ? 58.784 75.483  43.159  1.00 11.14 ? 439  ILE A CG2 1 
ATOM   2747 C CD1 . ILE A 1 377 ? 60.884 74.373  41.044  1.00 11.22 ? 439  ILE A CD1 1 
ATOM   2748 N N   . VAL A 1 378 ? 56.891 73.729  44.849  1.00 9.27  ? 440  VAL A N   1 
ATOM   2749 C CA  . VAL A 1 378 ? 56.838 73.328  46.249  1.00 8.80  ? 440  VAL A CA  1 
ATOM   2750 C C   . VAL A 1 378 ? 56.041 72.034  46.402  1.00 8.73  ? 440  VAL A C   1 
ATOM   2751 O O   . VAL A 1 378 ? 56.459 71.139  47.114  1.00 8.46  ? 440  VAL A O   1 
ATOM   2752 C CB  . VAL A 1 378 ? 56.257 74.454  47.158  1.00 8.54  ? 440  VAL A CB  1 
ATOM   2753 C CG1 . VAL A 1 378 ? 56.228 74.013  48.616  1.00 6.58  ? 440  VAL A CG1 1 
ATOM   2754 C CG2 . VAL A 1 378 ? 57.075 75.741  47.011  1.00 7.52  ? 440  VAL A CG2 1 
ATOM   2755 N N   . GLN A 1 379 ? 54.900 71.926  45.721  1.00 8.97  ? 441  GLN A N   1 
ATOM   2756 C CA  . GLN A 1 379 ? 54.144 70.672  45.712  1.00 8.68  ? 441  GLN A CA  1 
ATOM   2757 C C   . GLN A 1 379 ? 55.061 69.533  45.293  1.00 8.36  ? 441  GLN A C   1 
ATOM   2758 O O   . GLN A 1 379 ? 55.075 68.472  45.910  1.00 8.12  ? 441  GLN A O   1 
ATOM   2759 C CB  . GLN A 1 379 ? 52.956 70.737  44.740  1.00 9.69  ? 441  GLN A CB  1 
ATOM   2760 C CG  . GLN A 1 379 ? 51.633 71.354  45.299  1.00 11.91 ? 441  GLN A CG  1 
ATOM   2761 C CD  . GLN A 1 379 ? 50.878 70.423  46.251  1.00 15.25 ? 441  GLN A CD  1 
ATOM   2762 O OE1 . GLN A 1 379 ? 51.340 69.325  46.575  1.00 19.26 ? 441  GLN A OE1 1 
ATOM   2763 N NE2 . GLN A 1 379 ? 49.716 70.871  46.716  1.00 16.67 ? 441  GLN A NE2 1 
ATOM   2764 N N   . VAL A 1 380 ? 55.813 69.742  44.216  1.00 8.14  ? 442  VAL A N   1 
ATOM   2765 C CA  . VAL A 1 380 ? 56.646 68.674  43.667  1.00 7.70  ? 442  VAL A CA  1 
ATOM   2766 C C   . VAL A 1 380 ? 57.743 68.328  44.661  1.00 7.33  ? 442  VAL A C   1 
ATOM   2767 O O   . VAL A 1 380 ? 58.014 67.153  44.882  1.00 7.56  ? 442  VAL A O   1 
ATOM   2768 C CB  . VAL A 1 380 ? 57.217 69.046  42.259  1.00 7.68  ? 442  VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 380 ? 58.235 68.032  41.763  1.00 6.80  ? 442  VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 380 ? 56.108 69.146  41.286  1.00 6.40  ? 442  VAL A CG2 1 
ATOM   2771 N N   . ALA A 1 381 ? 58.355 69.361  45.244  1.00 6.89  ? 443  ALA A N   1 
ATOM   2772 C CA  . ALA A 1 381 ? 59.438 69.221  46.220  1.00 6.79  ? 443  ALA A CA  1 
ATOM   2773 C C   . ALA A 1 381 ? 58.968 68.520  47.486  1.00 5.91  ? 443  ALA A C   1 
ATOM   2774 O O   . ALA A 1 381 ? 59.647 67.674  48.012  1.00 4.57  ? 443  ALA A O   1 
ATOM   2775 C CB  . ALA A 1 381 ? 60.028 70.593  46.583  1.00 6.02  ? 443  ALA A CB  1 
ATOM   2776 N N   . LEU A 1 382 ? 57.813 68.923  47.985  1.00 6.31  ? 444  LEU A N   1 
ATOM   2777 C CA  . LEU A 1 382 ? 57.190 68.259  49.121  1.00 6.65  ? 444  LEU A CA  1 
ATOM   2778 C C   . LEU A 1 382 ? 56.889 66.807  48.826  1.00 6.27  ? 444  LEU A C   1 
ATOM   2779 O O   . LEU A 1 382 ? 57.095 65.960  49.670  1.00 6.71  ? 444  LEU A O   1 
ATOM   2780 C CB  . LEU A 1 382 ? 55.890 68.965  49.536  1.00 7.33  ? 444  LEU A CB  1 
ATOM   2781 C CG  . LEU A 1 382 ? 55.942 70.022  50.635  1.00 7.08  ? 444  LEU A CG  1 
ATOM   2782 C CD1 . LEU A 1 382 ? 54.546 70.613  50.809  1.00 7.74  ? 444  LEU A CD1 1 
ATOM   2783 C CD2 . LEU A 1 382 ? 56.466 69.406  51.941  1.00 8.87  ? 444  LEU A CD2 1 
ATOM   2784 N N   . ASN A 1 383 ? 56.383 66.512  47.638  1.00 6.41  ? 445  ASN A N   1 
ATOM   2785 C CA  . ASN A 1 383 ? 56.102 65.115  47.291  1.00 6.15  ? 445  ASN A CA  1 
ATOM   2786 C C   . ASN A 1 383 ? 57.361 64.244  47.311  1.00 5.51  ? 445  ASN A C   1 
ATOM   2787 O O   . ASN A 1 383 ? 57.314 63.132  47.790  1.00 6.81  ? 445  ASN A O   1 
ATOM   2788 C CB  . ASN A 1 383 ? 55.389 64.996  45.953  1.00 6.31  ? 445  ASN A CB  1 
ATOM   2789 C CG  . ASN A 1 383 ? 54.926 63.575  45.670  1.00 6.23  ? 445  ASN A CG  1 
ATOM   2790 O OD1 . ASN A 1 383 ? 55.523 62.871  44.861  1.00 5.37  ? 445  ASN A OD1 1 
ATOM   2791 N ND2 . ASN A 1 383 ? 53.883 63.140  46.359  1.00 7.45  ? 445  ASN A ND2 1 
ATOM   2792 N N   . GLY A 1 384 ? 58.495 64.762  46.859  1.00 5.04  ? 446  GLY A N   1 
ATOM   2793 C CA  . GLY A 1 384 ? 59.748 63.997  46.877  1.00 4.77  ? 446  GLY A CA  1 
ATOM   2794 C C   . GLY A 1 384 ? 60.329 63.724  48.236  1.00 4.87  ? 446  GLY A C   1 
ATOM   2795 O O   . GLY A 1 384 ? 60.848 62.618  48.510  1.00 4.99  ? 446  GLY A O   1 
ATOM   2796 N N   . LEU A 1 385 ? 60.299 64.755  49.086  1.00 4.93  ? 447  LEU A N   1 
ATOM   2797 C CA  . LEU A 1 385 ? 60.673 64.622  50.492  1.00 4.40  ? 447  LEU A CA  1 
ATOM   2798 C C   . LEU A 1 385 ? 59.763 63.618  51.209  1.00 4.21  ? 447  LEU A C   1 
ATOM   2799 O O   . LEU A 1 385 ? 60.245 62.791  51.966  1.00 2.56  ? 447  LEU A O   1 
ATOM   2800 C CB  . LEU A 1 385 ? 60.626 65.978  51.199  1.00 4.37  ? 447  LEU A CB  1 
ATOM   2801 C CG  . LEU A 1 385 ? 61.678 66.992  50.738  1.00 3.86  ? 447  LEU A CG  1 
ATOM   2802 C CD1 . LEU A 1 385 ? 61.414 68.319  51.416  1.00 4.02  ? 447  LEU A CD1 1 
ATOM   2803 C CD2 . LEU A 1 385 ? 63.100 66.478  50.989  1.00 2.00  ? 447  LEU A CD2 1 
ATOM   2804 N N   . GLU A 1 386 ? 58.457 63.673  50.936  1.00 4.61  ? 448  GLU A N   1 
ATOM   2805 C CA  . GLU A 1 386 ? 57.517 62.703  51.490  1.00 4.95  ? 448  GLU A CA  1 
ATOM   2806 C C   . GLU A 1 386 ? 57.851 61.271  51.116  1.00 4.75  ? 448  GLU A C   1 
ATOM   2807 O O   . GLU A 1 386 ? 57.778 60.383  51.955  1.00 5.47  ? 448  GLU A O   1 
ATOM   2808 C CB  . GLU A 1 386 ? 56.081 62.997  51.049  1.00 4.70  ? 448  GLU A CB  1 
ATOM   2809 C CG  . GLU A 1 386 ? 55.113 61.901  51.495  1.00 6.61  ? 448  GLU A CG  1 
ATOM   2810 C CD  . GLU A 1 386 ? 53.630 62.269  51.374  1.00 9.14  ? 448  GLU A CD  1 
ATOM   2811 O OE1 . GLU A 1 386 ? 53.263 62.971  50.403  1.00 16.57 ? 448  GLU A OE1 1 
ATOM   2812 O OE2 . GLU A 1 386 ? 52.832 61.834  52.251  1.00 13.74 ? 448  GLU A OE2 1 
ATOM   2813 N N   . ASN A 1 387 ? 58.190 61.031  49.846  1.00 5.45  ? 449  ASN A N   1 
ATOM   2814 C CA  . ASN A 1 387 ? 58.552 59.683  49.388  1.00 4.78  ? 449  ASN A CA  1 
ATOM   2815 C C   . ASN A 1 387 ? 59.837 59.189  50.008  1.00 4.38  ? 449  ASN A C   1 
ATOM   2816 O O   . ASN A 1 387 ? 59.927 58.032  50.368  1.00 4.21  ? 449  ASN A O   1 
ATOM   2817 C CB  . ASN A 1 387 ? 58.707 59.628  47.865  1.00 4.96  ? 449  ASN A CB  1 
ATOM   2818 C CG  . ASN A 1 387 ? 57.448 59.963  47.119  1.00 5.41  ? 449  ASN A CG  1 
ATOM   2819 O OD1 . ASN A 1 387 ? 56.349 59.596  47.523  1.00 8.00  ? 449  ASN A OD1 1 
ATOM   2820 N ND2 . ASN A 1 387 ? 57.605 60.662  45.990  1.00 7.34  ? 449  ASN A ND2 1 
ATOM   2821 N N   . ILE A 1 388 ? 60.847 60.056  50.090  1.00 4.45  ? 450  ILE A N   1 
ATOM   2822 C CA  . ILE A 1 388 ? 62.118 59.724  50.763  1.00 4.59  ? 450  ILE A CA  1 
ATOM   2823 C C   . ILE A 1 388 ? 61.890 59.279  52.220  1.00 5.10  ? 450  ILE A C   1 
ATOM   2824 O O   . ILE A 1 388 ? 62.409 58.252  52.668  1.00 4.24  ? 450  ILE A O   1 
ATOM   2825 C CB  . ILE A 1 388 ? 63.135 60.906  50.671  1.00 4.05  ? 450  ILE A CB  1 
ATOM   2826 C CG1 . ILE A 1 388 ? 63.626 61.031  49.229  1.00 2.58  ? 450  ILE A CG1 1 
ATOM   2827 C CG2 . ILE A 1 388 ? 64.323 60.689  51.594  1.00 3.72  ? 450  ILE A CG2 1 
ATOM   2828 C CD1 . ILE A 1 388 ? 64.228 62.364  48.859  1.00 3.94  ? 450  ILE A CD1 1 
ATOM   2829 N N   . LEU A 1 389 ? 61.079 60.039  52.936  1.00 5.98  ? 451  LEU A N   1 
ATOM   2830 C CA  . LEU A 1 389 ? 60.790 59.771  54.347  1.00 7.01  ? 451  LEU A CA  1 
ATOM   2831 C C   . LEU A 1 389 ? 60.109 58.437  54.571  1.00 8.24  ? 451  LEU A C   1 
ATOM   2832 O O   . LEU A 1 389 ? 60.418 57.736  55.545  1.00 8.21  ? 451  LEU A O   1 
ATOM   2833 C CB  . LEU A 1 389 ? 59.924 60.899  54.934  1.00 6.50  ? 451  LEU A CB  1 
ATOM   2834 C CG  . LEU A 1 389 ? 60.708 62.143  55.389  1.00 5.71  ? 451  LEU A CG  1 
ATOM   2835 C CD1 . LEU A 1 389 ? 59.770 63.328  55.617  1.00 4.52  ? 451  LEU A CD1 1 
ATOM   2836 C CD2 . LEU A 1 389 ? 61.518 61.829  56.636  1.00 2.00  ? 451  LEU A CD2 1 
ATOM   2837 N N   . ARG A 1 390 ? 59.182 58.100  53.677  1.00 10.21 ? 452  ARG A N   1 
ATOM   2838 C CA  . ARG A 1 390 ? 58.418 56.851  53.745  1.00 11.42 ? 452  ARG A CA  1 
ATOM   2839 C C   . ARG A 1 390 ? 59.354 55.647  53.654  1.00 12.14 ? 452  ARG A C   1 
ATOM   2840 O O   . ARG A 1 390 ? 59.209 54.681  54.399  1.00 11.59 ? 452  ARG A O   1 
ATOM   2841 C CB  . ARG A 1 390 ? 57.381 56.805  52.612  1.00 11.56 ? 452  ARG A CB  1 
ATOM   2842 C CG  . ARG A 1 390 ? 56.396 55.649  52.681  1.00 12.36 ? 452  ARG A CG  1 
ATOM   2843 C CD  . ARG A 1 390 ? 55.673 55.412  51.345  1.00 14.90 ? 452  ARG A CD  1 
ATOM   2844 N NE  . ARG A 1 390 ? 56.630 55.071  50.295  1.00 17.99 ? 452  ARG A NE  1 
ATOM   2845 C CZ  . ARG A 1 390 ? 56.779 55.705  49.135  1.00 21.15 ? 452  ARG A CZ  1 
ATOM   2846 N NH1 . ARG A 1 390 ? 55.989 56.720  48.785  1.00 23.83 ? 452  ARG A NH1 1 
ATOM   2847 N NH2 . ARG A 1 390 ? 57.728 55.309  48.291  1.00 21.19 ? 452  ARG A NH2 1 
ATOM   2848 N N   . LEU A 1 391 ? 60.318 55.716  52.741  1.00 13.12 ? 453  LEU A N   1 
ATOM   2849 C CA  . LEU A 1 391 ? 61.311 54.655  52.594  1.00 14.05 ? 453  LEU A CA  1 
ATOM   2850 C C   . LEU A 1 391 ? 62.289 54.647  53.752  1.00 15.03 ? 453  LEU A C   1 
ATOM   2851 O O   . LEU A 1 391 ? 62.843 53.604  54.081  1.00 15.31 ? 453  LEU A O   1 
ATOM   2852 C CB  . LEU A 1 391 ? 62.040 54.792  51.263  1.00 13.91 ? 453  LEU A CB  1 
ATOM   2853 C CG  . LEU A 1 391 ? 61.091 54.518  50.084  1.00 14.21 ? 453  LEU A CG  1 
ATOM   2854 C CD1 . LEU A 1 391 ? 61.580 55.181  48.848  1.00 14.57 ? 453  LEU A CD1 1 
ATOM   2855 C CD2 . LEU A 1 391 ? 60.867 53.017  49.851  1.00 14.38 ? 453  LEU A CD2 1 
ATOM   2856 N N   . GLY A 1 392 ? 62.505 55.810  54.361  1.00 16.51 ? 454  GLY A N   1 
ATOM   2857 C CA  . GLY A 1 392 ? 63.271 55.922  55.594  1.00 17.71 ? 454  GLY A CA  1 
ATOM   2858 C C   . GLY A 1 392 ? 62.668 55.148  56.757  1.00 18.99 ? 454  GLY A C   1 
ATOM   2859 O O   . GLY A 1 392 ? 63.375 54.783  57.692  1.00 18.66 ? 454  GLY A O   1 
ATOM   2860 N N   . GLU A 1 393 ? 61.356 54.906  56.707  1.00 20.96 ? 455  GLU A N   1 
ATOM   2861 C CA  . GLU A 1 393 ? 60.680 54.027  57.669  1.00 22.18 ? 455  GLU A CA  1 
ATOM   2862 C C   . GLU A 1 393 ? 60.993 52.549  57.389  1.00 23.36 ? 455  GLU A C   1 
ATOM   2863 O O   . GLU A 1 393 ? 61.162 51.760  58.313  1.00 23.27 ? 455  GLU A O   1 
ATOM   2864 C CB  . GLU A 1 393 ? 59.178 54.277  57.641  1.00 22.49 ? 455  GLU A CB  1 
ATOM   2865 C CG  . GLU A 1 393 ? 58.803 55.689  58.036  1.00 23.21 ? 455  GLU A CG  1 
ATOM   2866 C CD  . GLU A 1 393 ? 58.939 55.949  59.540  1.00 25.69 ? 455  GLU A CD  1 
ATOM   2867 O OE1 . GLU A 1 393 ? 58.353 55.161  60.317  1.00 28.28 ? 455  GLU A OE1 1 
ATOM   2868 O OE2 . GLU A 1 393 ? 59.599 56.948  59.953  1.00 25.55 ? 455  GLU A OE2 1 
ATOM   2869 N N   . GLN A 1 394 ? 61.093 52.176  56.117  1.00 24.81 ? 456  GLN A N   1 
ATOM   2870 C CA  . GLN A 1 394 ? 61.572 50.833  55.761  1.00 25.89 ? 456  GLN A CA  1 
ATOM   2871 C C   . GLN A 1 394 ? 62.978 50.560  56.324  1.00 26.79 ? 456  GLN A C   1 
ATOM   2872 O O   . GLN A 1 394 ? 63.266 49.454  56.786  1.00 27.34 ? 456  GLN A O   1 
ATOM   2873 C CB  . GLN A 1 394 ? 61.594 50.629  54.234  1.00 26.36 ? 456  GLN A CB  1 
ATOM   2874 C CG  . GLN A 1 394 ? 60.220 50.411  53.567  1.00 26.91 ? 456  GLN A CG  1 
ATOM   2875 C CD  . GLN A 1 394 ? 60.342 49.972  52.109  1.00 26.32 ? 456  GLN A CD  1 
ATOM   2876 O OE1 . GLN A 1 394 ? 61.330 49.341  51.715  1.00 27.04 ? 456  GLN A OE1 1 
ATOM   2877 N NE2 . GLN A 1 394 ? 59.337 50.298  51.306  1.00 26.13 ? 456  GLN A NE2 1 
ATOM   2878 N N   . GLU A 1 395 ? 63.850 51.564  56.271  1.00 27.59 ? 457  GLU A N   1 
ATOM   2879 C CA  . GLU A 1 395 ? 65.231 51.424  56.750  1.00 28.01 ? 457  GLU A CA  1 
ATOM   2880 C C   . GLU A 1 395 ? 65.285 51.467  58.278  1.00 28.43 ? 457  GLU A C   1 
ATOM   2881 O O   . GLU A 1 395 ? 66.225 50.947  58.871  1.00 28.74 ? 457  GLU A O   1 
ATOM   2882 C CB  . GLU A 1 395 ? 66.133 52.519  56.161  1.00 28.28 ? 457  GLU A CB  1 
ATOM   2883 C CG  . GLU A 1 395 ? 66.015 52.723  54.621  1.00 28.72 ? 457  GLU A CG  1 
ATOM   2884 C CD  . GLU A 1 395 ? 67.027 51.926  53.793  1.00 29.67 ? 457  GLU A CD  1 
ATOM   2885 O OE1 . GLU A 1 395 ? 67.823 51.141  54.356  1.00 30.49 ? 457  GLU A OE1 1 
ATOM   2886 O OE2 . GLU A 1 395 ? 67.026 52.096  52.554  1.00 29.86 ? 457  GLU A OE2 1 
ATOM   2887 N N   . ALA A 1 396 ? 64.272 52.072  58.905  1.00 28.89 ? 458  ALA A N   1 
ATOM   2888 C CA  . ALA A 1 396 ? 64.170 52.167  60.370  1.00 29.35 ? 458  ALA A CA  1 
ATOM   2889 C C   . ALA A 1 396 ? 63.648 50.880  61.026  1.00 29.99 ? 458  ALA A C   1 
ATOM   2890 O O   . ALA A 1 396 ? 63.546 50.801  62.262  1.00 29.97 ? 458  ALA A O   1 
ATOM   2891 C CB  . ALA A 1 396 ? 63.281 53.349  60.771  1.00 29.11 ? 458  ALA A CB  1 
ATOM   2892 N N   . LYS A 1 397 ? 63.294 49.896  60.196  1.00 30.67 ? 459  LYS A N   1 
ATOM   2893 C CA  . LYS A 1 397 ? 62.905 48.555  60.653  1.00 30.94 ? 459  LYS A CA  1 
ATOM   2894 C C   . LYS A 1 397 ? 63.868 47.483  60.144  1.00 31.09 ? 459  LYS A C   1 
ATOM   2895 O O   . LYS A 1 397 ? 64.012 46.440  60.778  1.00 31.30 ? 459  LYS A O   1 
ATOM   2896 C CB  . LYS A 1 397 ? 61.471 48.256  60.225  1.00 31.17 ? 459  LYS A CB  1 
ATOM   2897 C CG  . LYS A 1 397 ? 60.431 49.046  61.038  1.00 31.58 ? 459  LYS A CG  1 
ATOM   2898 C CD  . LYS A 1 397 ? 59.242 49.473  60.182  1.00 31.65 ? 459  LYS A CD  1 
ATOM   2899 C CE  . LYS A 1 397 ? 58.262 50.362  60.963  1.00 32.06 ? 459  LYS A CE  1 
ATOM   2900 N NZ  . LYS A 1 397 ? 57.501 51.285  60.052  1.00 31.97 ? 459  LYS A NZ  1 
ATOM   2901 N N   . ARG A 1 398 ? 64.528 47.736  59.012  1.00 31.32 ? 460  ARG A N   1 
ATOM   2902 C CA  . ARG A 1 398 ? 65.702 46.941  58.616  1.00 31.58 ? 460  ARG A CA  1 
ATOM   2903 C C   . ARG A 1 398 ? 66.816 47.023  59.663  1.00 31.48 ? 460  ARG A C   1 
ATOM   2904 O O   . ARG A 1 398 ? 67.513 46.031  59.900  1.00 31.95 ? 460  ARG A O   1 
ATOM   2905 C CB  . ARG A 1 398 ? 66.250 47.365  57.250  1.00 31.63 ? 460  ARG A CB  1 
ATOM   2906 C CG  . ARG A 1 398 ? 65.559 46.656  56.107  1.00 32.60 ? 460  ARG A CG  1 
ATOM   2907 C CD  . ARG A 1 398 ? 66.061 47.118  54.754  1.00 33.46 ? 460  ARG A CD  1 
ATOM   2908 N NE  . ARG A 1 398 ? 64.973 47.154  53.773  1.00 35.71 ? 460  ARG A NE  1 
ATOM   2909 C CZ  . ARG A 1 398 ? 65.064 47.674  52.546  1.00 36.18 ? 460  ARG A CZ  1 
ATOM   2910 N NH1 . ARG A 1 398 ? 66.209 48.204  52.104  1.00 36.37 ? 460  ARG A NH1 1 
ATOM   2911 N NH2 . ARG A 1 398 ? 63.993 47.658  51.751  1.00 35.93 ? 460  ARG A NH2 1 
ATOM   2912 N N   . ASN A 1 399 ? 66.965 48.195  60.289  1.00 30.98 ? 461  ASN A N   1 
ATOM   2913 C CA  . ASN A 1 399 ? 67.978 48.417  61.328  1.00 30.31 ? 461  ASN A CA  1 
ATOM   2914 C C   . ASN A 1 399 ? 67.425 48.382  62.772  1.00 29.60 ? 461  ASN A C   1 
ATOM   2915 O O   . ASN A 1 399 ? 68.197 48.321  63.745  1.00 29.35 ? 461  ASN A O   1 
ATOM   2916 C CB  . ASN A 1 399 ? 68.736 49.725  61.036  1.00 30.79 ? 461  ASN A CB  1 
ATOM   2917 C CG  . ASN A 1 399 ? 69.686 49.598  59.836  1.00 32.35 ? 461  ASN A CG  1 
ATOM   2918 O OD1 . ASN A 1 399 ? 70.535 48.691  59.796  1.00 33.62 ? 461  ASN A OD1 1 
ATOM   2919 N ND2 . ASN A 1 399 ? 69.547 50.509  58.854  1.00 33.26 ? 461  ASN A ND2 1 
ATOM   2920 N N   . GLY A 1 400 ? 66.097 48.431  62.910  1.00 28.45 ? 462  GLY A N   1 
ATOM   2921 C CA  . GLY A 1 400 ? 65.434 48.225  64.211  1.00 27.33 ? 462  GLY A CA  1 
ATOM   2922 C C   . GLY A 1 400 ? 65.559 49.332  65.253  1.00 26.46 ? 462  GLY A C   1 
ATOM   2923 O O   . GLY A 1 400 ? 65.065 49.178  66.378  1.00 26.51 ? 462  GLY A O   1 
ATOM   2924 N N   . THR A 1 401 ? 66.200 50.448  64.890  1.00 25.09 ? 463  THR A N   1 
ATOM   2925 C CA  . THR A 1 401 ? 66.418 51.574  65.814  1.00 23.75 ? 463  THR A CA  1 
ATOM   2926 C C   . THR A 1 401 ? 65.154 52.407  66.054  1.00 22.53 ? 463  THR A C   1 
ATOM   2927 O O   . THR A 1 401 ? 65.016 53.042  67.102  1.00 22.64 ? 463  THR A O   1 
ATOM   2928 C CB  . THR A 1 401 ? 67.488 52.546  65.274  1.00 23.63 ? 463  THR A CB  1 
ATOM   2929 O OG1 . THR A 1 401 ? 67.071 53.038  63.995  1.00 24.37 ? 463  THR A OG1 1 
ATOM   2930 C CG2 . THR A 1 401 ? 68.837 51.864  65.143  1.00 24.02 ? 463  THR A CG2 1 
ATOM   2931 N N   . GLY A 1 402 ? 64.256 52.432  65.069  1.00 20.89 ? 464  GLY A N   1 
ATOM   2932 C CA  . GLY A 1 402 ? 63.088 53.313  65.110  1.00 19.28 ? 464  GLY A CA  1 
ATOM   2933 C C   . GLY A 1 402 ? 63.442 54.740  64.721  1.00 18.01 ? 464  GLY A C   1 
ATOM   2934 O O   . GLY A 1 402 ? 62.624 55.664  64.882  1.00 18.41 ? 464  GLY A O   1 
ATOM   2935 N N   . ILE A 1 403 ? 64.658 54.925  64.200  1.00 15.69 ? 465  ILE A N   1 
ATOM   2936 C CA  . ILE A 1 403 ? 65.116 56.233  63.742  1.00 13.97 ? 465  ILE A CA  1 
ATOM   2937 C C   . ILE A 1 403 ? 65.111 56.240  62.223  1.00 12.11 ? 465  ILE A C   1 
ATOM   2938 O O   . ILE A 1 403 ? 65.758 55.424  61.575  1.00 11.34 ? 465  ILE A O   1 
ATOM   2939 C CB  . ILE A 1 403 ? 66.509 56.578  64.299  1.00 13.97 ? 465  ILE A CB  1 
ATOM   2940 C CG1 . ILE A 1 403 ? 66.422 56.750  65.820  1.00 13.48 ? 465  ILE A CG1 1 
ATOM   2941 C CG2 . ILE A 1 403 ? 67.048 57.846  63.667  1.00 14.41 ? 465  ILE A CG2 1 
ATOM   2942 C CD1 . ILE A 1 403 ? 67.750 56.925  66.479  1.00 13.50 ? 465  ILE A CD1 1 
ATOM   2943 N N   . ASN A 1 404 ? 64.322 57.148  61.671  1.00 9.96  ? 466  ASN A N   1 
ATOM   2944 C CA  . ASN A 1 404 ? 64.324 57.410  60.243  1.00 9.10  ? 466  ASN A CA  1 
ATOM   2945 C C   . ASN A 1 404 ? 65.612 58.189  59.905  1.00 7.41  ? 466  ASN A C   1 
ATOM   2946 O O   . ASN A 1 404 ? 65.844 59.251  60.457  1.00 6.53  ? 466  ASN A O   1 
ATOM   2947 C CB  . ASN A 1 404 ? 63.064 58.220  59.912  1.00 8.84  ? 466  ASN A CB  1 
ATOM   2948 C CG  . ASN A 1 404 ? 62.794 58.334  58.435  1.00 8.78  ? 466  ASN A CG  1 
ATOM   2949 O OD1 . ASN A 1 404 ? 63.711 58.447  57.629  1.00 4.94  ? 466  ASN A OD1 1 
ATOM   2950 N ND2 . ASN A 1 404 ? 61.511 58.353  58.075  1.00 8.74  ? 466  ASN A ND2 1 
ATOM   2951 N N   . PRO A 1 405 ? 66.473 57.639  59.027  1.00 6.58  ? 467  PRO A N   1 
ATOM   2952 C CA  . PRO A 1 405 ? 67.743 58.317  58.756  1.00 5.97  ? 467  PRO A CA  1 
ATOM   2953 C C   . PRO A 1 405 ? 67.598 59.653  58.041  1.00 4.77  ? 467  PRO A C   1 
ATOM   2954 O O   . PRO A 1 405 ? 68.473 60.497  58.146  1.00 4.52  ? 467  PRO A O   1 
ATOM   2955 C CB  . PRO A 1 405 ? 68.501 57.320  57.873  1.00 5.80  ? 467  PRO A CB  1 
ATOM   2956 C CG  . PRO A 1 405 ? 67.470 56.463  57.275  1.00 6.04  ? 467  PRO A CG  1 
ATOM   2957 C CD  . PRO A 1 405 ? 66.344 56.394  58.247  1.00 6.69  ? 467  PRO A CD  1 
ATOM   2958 N N   . TYR A 1 406 ? 66.502 59.862  57.330  1.00 3.84  ? 468  TYR A N   1 
ATOM   2959 C CA  . TYR A 1 406 ? 66.369 61.071  56.523  1.00 3.67  ? 468  TYR A CA  1 
ATOM   2960 C C   . TYR A 1 406 ? 65.730 62.243  57.288  1.00 3.26  ? 468  TYR A C   1 
ATOM   2961 O O   . TYR A 1 406 ? 65.600 63.330  56.749  1.00 3.22  ? 468  TYR A O   1 
ATOM   2962 C CB  . TYR A 1 406 ? 65.600 60.752  55.240  1.00 3.42  ? 468  TYR A CB  1 
ATOM   2963 C CG  . TYR A 1 406 ? 66.134 59.562  54.480  1.00 2.43  ? 468  TYR A CG  1 
ATOM   2964 C CD1 . TYR A 1 406 ? 67.481 59.444  54.195  1.00 4.10  ? 468  TYR A CD1 1 
ATOM   2965 C CD2 . TYR A 1 406 ? 65.291 58.562  54.045  1.00 3.03  ? 468  TYR A CD2 1 
ATOM   2966 C CE1 . TYR A 1 406 ? 67.975 58.357  53.495  1.00 4.19  ? 468  TYR A CE1 1 
ATOM   2967 C CE2 . TYR A 1 406 ? 65.765 57.478  53.324  1.00 3.13  ? 468  TYR A CE2 1 
ATOM   2968 C CZ  . TYR A 1 406 ? 67.113 57.378  53.056  1.00 3.48  ? 468  TYR A CZ  1 
ATOM   2969 O OH  . TYR A 1 406 ? 67.601 56.311  52.361  1.00 2.00  ? 468  TYR A OH  1 
ATOM   2970 N N   . CYS A 1 407 ? 65.324 61.997  58.532  1.00 3.30  ? 469  CYS A N   1 
ATOM   2971 C CA  . CYS A 1 407 ? 64.858 63.047  59.434  1.00 3.39  ? 469  CYS A CA  1 
ATOM   2972 C C   . CYS A 1 407 ? 65.970 64.035  59.764  1.00 2.51  ? 469  CYS A C   1 
ATOM   2973 O O   . CYS A 1 407 ? 65.817 65.228  59.542  1.00 2.43  ? 469  CYS A O   1 
ATOM   2974 C CB  . CYS A 1 407 ? 64.281 62.443  60.713  1.00 3.69  ? 469  CYS A CB  1 
ATOM   2975 S SG  . CYS A 1 407 ? 62.632 61.790  60.428  1.00 7.01  ? 469  CYS A SG  1 
ATOM   2976 N N   . ALA A 1 408 ? 67.090 63.534  60.264  1.00 2.00  ? 470  ALA A N   1 
ATOM   2977 C CA  . ALA A 1 408 ? 68.235 64.383  60.549  1.00 2.11  ? 470  ALA A CA  1 
ATOM   2978 C C   . ALA A 1 408 ? 68.756 65.095  59.291  1.00 2.00  ? 470  ALA A C   1 
ATOM   2979 O O   . ALA A 1 408 ? 69.136 66.250  59.375  1.00 2.00  ? 470  ALA A O   1 
ATOM   2980 C CB  . ALA A 1 408 ? 69.352 63.582  61.259  1.00 2.00  ? 470  ALA A CB  1 
ATOM   2981 N N   . LEU A 1 409 ? 68.739 64.438  58.126  1.00 2.34  ? 471  LEU A N   1 
ATOM   2982 C CA  . LEU A 1 409 ? 69.186 65.078  56.881  1.00 2.75  ? 471  LEU A CA  1 
ATOM   2983 C C   . LEU A 1 409 ? 68.278 66.203  56.405  1.00 2.72  ? 471  LEU A C   1 
ATOM   2984 O O   . LEU A 1 409 ? 68.764 67.252  55.984  1.00 2.70  ? 471  LEU A O   1 
ATOM   2985 C CB  . LEU A 1 409 ? 69.362 64.053  55.750  1.00 3.27  ? 471  LEU A CB  1 
ATOM   2986 C CG  . LEU A 1 409 ? 70.507 63.060  55.977  1.00 3.97  ? 471  LEU A CG  1 
ATOM   2987 C CD1 . LEU A 1 409 ? 70.468 61.998  54.884  1.00 5.60  ? 471  LEU A CD1 1 
ATOM   2988 C CD2 . LEU A 1 409 ? 71.850 63.795  56.012  1.00 3.86  ? 471  LEU A CD2 1 
ATOM   2989 N N   . ILE A 1 410 ? 66.968 65.972  56.439  1.00 2.71  ? 472  ILE A N   1 
ATOM   2990 C CA  . ILE A 1 410 ? 65.991 67.009  56.119  1.00 3.16  ? 472  ILE A CA  1 
ATOM   2991 C C   . ILE A 1 410 ? 66.101 68.183  57.106  1.00 3.75  ? 472  ILE A C   1 
ATOM   2992 O O   . ILE A 1 410 ? 66.091 69.353  56.699  1.00 3.84  ? 472  ILE A O   1 
ATOM   2993 C CB  . ILE A 1 410 ? 64.552 66.422  56.056  1.00 2.81  ? 472  ILE A CB  1 
ATOM   2994 C CG1 . ILE A 1 410 ? 64.398 65.565  54.785  1.00 3.55  ? 472  ILE A CG1 1 
ATOM   2995 C CG2 . ILE A 1 410 ? 63.508 67.526  56.081  1.00 2.53  ? 472  ILE A CG2 1 
ATOM   2996 C CD1 . ILE A 1 410 ? 63.102 64.799  54.661  1.00 2.94  ? 472  ILE A CD1 1 
ATOM   2997 N N   . GLU A 1 411 ? 66.261 67.883  58.395  1.00 4.54  ? 473  GLU A N   1 
ATOM   2998 C CA  . GLU A 1 411 ? 66.540 68.928  59.398  1.00 5.00  ? 473  GLU A CA  1 
ATOM   2999 C C   . GLU A 1 411 ? 67.800 69.741  59.117  1.00 4.86  ? 473  GLU A C   1 
ATOM   3000 O O   . GLU A 1 411 ? 67.785 70.967  59.223  1.00 4.65  ? 473  GLU A O   1 
ATOM   3001 C CB  . GLU A 1 411 ? 66.632 68.346  60.799  1.00 5.49  ? 473  GLU A CB  1 
ATOM   3002 C CG  . GLU A 1 411 ? 65.499 68.783  61.657  1.00 7.55  ? 473  GLU A CG  1 
ATOM   3003 C CD  . GLU A 1 411 ? 65.649 68.360  63.065  1.00 7.20  ? 473  GLU A CD  1 
ATOM   3004 O OE1 . GLU A 1 411 ? 65.510 67.147  63.334  1.00 11.64 ? 473  GLU A OE1 1 
ATOM   3005 O OE2 . GLU A 1 411 ? 65.908 69.244  63.902  1.00 12.75 ? 473  GLU A OE2 1 
ATOM   3006 N N   . GLU A 1 412 ? 68.886 69.066  58.761  1.00 4.92  ? 474  GLU A N   1 
ATOM   3007 C CA  . GLU A 1 412 ? 70.101 69.762  58.367  1.00 5.33  ? 474  GLU A CA  1 
ATOM   3008 C C   . GLU A 1 412 ? 69.888 70.676  57.190  1.00 5.91  ? 474  GLU A C   1 
ATOM   3009 O O   . GLU A 1 412 ? 70.446 71.767  57.169  1.00 6.17  ? 474  GLU A O   1 
ATOM   3010 C CB  . GLU A 1 412 ? 71.223 68.791  58.006  1.00 5.11  ? 474  GLU A CB  1 
ATOM   3011 C CG  . GLU A 1 412 ? 72.024 68.329  59.157  1.00 5.51  ? 474  GLU A CG  1 
ATOM   3012 C CD  . GLU A 1 412 ? 72.584 69.483  59.973  1.00 4.89  ? 474  GLU A CD  1 
ATOM   3013 O OE1 . GLU A 1 412 ? 73.519 70.180  59.504  1.00 4.89  ? 474  GLU A OE1 1 
ATOM   3014 O OE2 . GLU A 1 412 ? 72.075 69.688  61.080  1.00 2.59  ? 474  GLU A OE2 1 
ATOM   3015 N N   . ALA A 1 413 ? 69.105 70.219  56.208  1.00 6.37  ? 475  ALA A N   1 
ATOM   3016 C CA  . ALA A 1 413 ? 68.938 70.927  54.943  1.00 7.01  ? 475  ALA A CA  1 
ATOM   3017 C C   . ALA A 1 413 ? 68.002 72.122  55.065  1.00 7.26  ? 475  ALA A C   1 
ATOM   3018 O O   . ALA A 1 413 ? 68.251 73.183  54.484  1.00 7.07  ? 475  ALA A O   1 
ATOM   3019 C CB  . ALA A 1 413 ? 68.424 69.965  53.833  1.00 6.29  ? 475  ALA A CB  1 
ATOM   3020 N N   . TYR A 1 414 ? 66.926 71.923  55.815  1.00 8.28  ? 476  TYR A N   1 
ATOM   3021 C CA  . TYR A 1 414 ? 65.807 72.864  55.886  1.00 8.31  ? 476  TYR A CA  1 
ATOM   3022 C C   . TYR A 1 414 ? 65.941 73.848  57.064  1.00 8.50  ? 476  TYR A C   1 
ATOM   3023 O O   . TYR A 1 414 ? 65.595 75.028  56.947  1.00 8.13  ? 476  TYR A O   1 
ATOM   3024 C CB  . TYR A 1 414 ? 64.515 72.057  56.002  1.00 8.68  ? 476  TYR A CB  1 
ATOM   3025 C CG  . TYR A 1 414 ? 63.248 72.824  55.718  1.00 9.50  ? 476  TYR A CG  1 
ATOM   3026 C CD1 . TYR A 1 414 ? 63.187 73.763  54.693  1.00 9.86  ? 476  TYR A CD1 1 
ATOM   3027 C CD2 . TYR A 1 414 ? 62.091 72.583  56.448  1.00 10.12 ? 476  TYR A CD2 1 
ATOM   3028 C CE1 . TYR A 1 414 ? 62.028 74.455  54.424  1.00 9.33  ? 476  TYR A CE1 1 
ATOM   3029 C CE2 . TYR A 1 414 ? 60.920 73.278  56.176  1.00 10.28 ? 476  TYR A CE2 1 
ATOM   3030 C CZ  . TYR A 1 414 ? 60.900 74.205  55.172  1.00 9.96  ? 476  TYR A CZ  1 
ATOM   3031 O OH  . TYR A 1 414 ? 59.747 74.893  54.889  1.00 11.96 ? 476  TYR A OH  1 
ATOM   3032 N N   . GLY A 1 415 ? 66.437 73.353  58.196  1.00 8.88  ? 477  GLY A N   1 
ATOM   3033 C CA  . GLY A 1 415 ? 66.693 74.177  59.359  1.00 9.30  ? 477  GLY A CA  1 
ATOM   3034 C C   . GLY A 1 415 ? 65.791 73.773  60.490  1.00 9.93  ? 477  GLY A C   1 
ATOM   3035 O O   . GLY A 1 415 ? 64.629 73.428  60.278  1.00 10.01 ? 477  GLY A O   1 
ATOM   3036 N N   . LEU A 1 416 ? 66.334 73.819  61.701  1.00 10.94 ? 478  LEU A N   1 
ATOM   3037 C CA  . LEU A 1 416 ? 65.607 73.427  62.890  1.00 11.19 ? 478  LEU A CA  1 
ATOM   3038 C C   . LEU A 1 416 ? 64.470 74.409  63.157  1.00 11.70 ? 478  LEU A C   1 
ATOM   3039 O O   . LEU A 1 416 ? 63.412 74.004  63.618  1.00 11.69 ? 478  LEU A O   1 
ATOM   3040 C CB  . LEU A 1 416 ? 66.558 73.346  64.069  1.00 11.35 ? 478  LEU A CB  1 
ATOM   3041 C CG  . LEU A 1 416 ? 66.025 72.852  65.417  1.00 11.89 ? 478  LEU A CG  1 
ATOM   3042 C CD1 . LEU A 1 416 ? 65.437 71.445  65.290  1.00 14.29 ? 478  LEU A CD1 1 
ATOM   3043 C CD2 . LEU A 1 416 ? 67.135 72.893  66.471  1.00 11.45 ? 478  LEU A CD2 1 
ATOM   3044 N N   . ASP A 1 417 ? 64.671 75.684  62.823  1.00 12.24 ? 479  ASP A N   1 
ATOM   3045 C CA  . ASP A 1 417 ? 63.622 76.706  62.973  1.00 12.48 ? 479  ASP A CA  1 
ATOM   3046 C C   . ASP A 1 417 ? 62.385 76.301  62.207  1.00 11.94 ? 479  ASP A C   1 
ATOM   3047 O O   . ASP A 1 417 ? 61.267 76.328  62.721  1.00 12.17 ? 479  ASP A O   1 
ATOM   3048 C CB  . ASP A 1 417 ? 64.063 78.071  62.401  1.00 13.52 ? 479  ASP A CB  1 
ATOM   3049 C CG  . ASP A 1 417 ? 65.441 78.519  62.898  1.00 17.16 ? 479  ASP A CG  1 
ATOM   3050 O OD1 . ASP A 1 417 ? 66.399 78.354  62.088  1.00 22.56 ? 479  ASP A OD1 1 
ATOM   3051 O OD2 . ASP A 1 417 ? 65.567 79.016  64.063  1.00 18.32 ? 479  ASP A OD2 1 
ATOM   3052 N N   . LYS A 1 418 ? 62.606 75.965  60.942  1.00 11.53 ? 480  LYS A N   1 
ATOM   3053 C CA  . LYS A 1 418 ? 61.530 75.654  60.024  1.00 10.59 ? 480  LYS A CA  1 
ATOM   3054 C C   . LYS A 1 418 ? 60.882 74.334  60.364  1.00 8.97  ? 480  LYS A C   1 
ATOM   3055 O O   . LYS A 1 418 ? 59.687 74.211  60.280  1.00 8.07  ? 480  LYS A O   1 
ATOM   3056 C CB  . LYS A 1 418 ? 62.047 75.689  58.602  1.00 11.20 ? 480  LYS A CB  1 
ATOM   3057 C CG  . LYS A 1 418 ? 62.413 77.091  58.154  1.00 12.13 ? 480  LYS A CG  1 
ATOM   3058 C CD  . LYS A 1 418 ? 62.702 77.146  56.664  1.00 12.51 ? 480  LYS A CD  1 
ATOM   3059 C CE  . LYS A 1 418 ? 62.770 78.588  56.142  1.00 14.75 ? 480  LYS A CE  1 
ATOM   3060 N NZ  . LYS A 1 418 ? 61.404 79.161  55.853  1.00 16.83 ? 480  LYS A NZ  1 
ATOM   3061 N N   . ILE A 1 419 ? 61.659 73.361  60.808  1.00 8.25  ? 481  ILE A N   1 
ATOM   3062 C CA  . ILE A 1 419 ? 61.076 72.101  61.250  1.00 8.37  ? 481  ILE A CA  1 
ATOM   3063 C C   . ILE A 1 419 ? 60.202 72.295  62.502  1.00 8.36  ? 481  ILE A C   1 
ATOM   3064 O O   . ILE A 1 419 ? 59.097 71.746  62.585  1.00 8.03  ? 481  ILE A O   1 
ATOM   3065 C CB  . ILE A 1 419 ? 62.161 71.023  61.474  1.00 8.01  ? 481  ILE A CB  1 
ATOM   3066 C CG1 . ILE A 1 419 ? 62.762 70.592  60.116  1.00 7.56  ? 481  ILE A CG1 1 
ATOM   3067 C CG2 . ILE A 1 419 ? 61.584 69.801  62.217  1.00 8.31  ? 481  ILE A CG2 1 
ATOM   3068 C CD1 . ILE A 1 419 ? 61.781 69.976  59.165  1.00 2.82  ? 481  ILE A CD1 1 
ATOM   3069 N N   . GLU A 1 420 ? 60.688 73.099  63.448  1.00 8.18  ? 482  GLU A N   1 
ATOM   3070 C CA  . GLU A 1 420 ? 59.946 73.414  64.667  1.00 8.65  ? 482  GLU A CA  1 
ATOM   3071 C C   . GLU A 1 420 ? 58.643 74.177  64.388  1.00 8.18  ? 482  GLU A C   1 
ATOM   3072 O O   . GLU A 1 420 ? 57.619 73.892  64.984  1.00 8.21  ? 482  GLU A O   1 
ATOM   3073 C CB  . GLU A 1 420 ? 60.824 74.220  65.611  1.00 8.73  ? 482  GLU A CB  1 
ATOM   3074 C CG  . GLU A 1 420 ? 61.964 73.425  66.265  1.00 9.97  ? 482  GLU A CG  1 
ATOM   3075 C CD  . GLU A 1 420 ? 62.740 74.266  67.280  1.00 11.01 ? 482  GLU A CD  1 
ATOM   3076 O OE1 . GLU A 1 420 ? 62.811 75.514  67.122  1.00 13.99 ? 482  GLU A OE1 1 
ATOM   3077 O OE2 . GLU A 1 420 ? 63.261 73.679  68.251  1.00 14.63 ? 482  GLU A OE2 1 
ATOM   3078 N N   . PHE A 1 421 ? 58.677 75.131  63.470  1.00 7.94  ? 483  PHE A N   1 
ATOM   3079 C CA  . PHE A 1 421 ? 57.452 75.809  63.053  1.00 7.71  ? 483  PHE A CA  1 
ATOM   3080 C C   . PHE A 1 421 ? 56.405 74.802  62.577  1.00 7.25  ? 483  PHE A C   1 
ATOM   3081 O O   . PHE A 1 421 ? 55.258 74.868  62.994  1.00 6.51  ? 483  PHE A O   1 
ATOM   3082 C CB  . PHE A 1 421 ? 57.746 76.843  61.965  1.00 8.28  ? 483  PHE A CB  1 
ATOM   3083 C CG  . PHE A 1 421 ? 56.505 77.455  61.351  1.00 8.51  ? 483  PHE A CG  1 
ATOM   3084 C CD1 . PHE A 1 421 ? 55.831 78.489  61.989  1.00 9.92  ? 483  PHE A CD1 1 
ATOM   3085 C CD2 . PHE A 1 421 ? 56.016 76.993  60.145  1.00 8.91  ? 483  PHE A CD2 1 
ATOM   3086 C CE1 . PHE A 1 421 ? 54.691 79.044  61.427  1.00 9.29  ? 483  PHE A CE1 1 
ATOM   3087 C CE2 . PHE A 1 421 ? 54.882 77.546  59.577  1.00 9.68  ? 483  PHE A CE2 1 
ATOM   3088 C CZ  . PHE A 1 421 ? 54.220 78.569  60.222  1.00 9.18  ? 483  PHE A CZ  1 
ATOM   3089 N N   . LEU A 1 422 ? 56.813 73.855  61.731  1.00 7.15  ? 484  LEU A N   1 
ATOM   3090 C CA  . LEU A 1 422 ? 55.895 72.856  61.176  1.00 6.70  ? 484  LEU A CA  1 
ATOM   3091 C C   . LEU A 1 422 ? 55.503 71.737  62.134  1.00 6.40  ? 484  LEU A C   1 
ATOM   3092 O O   . LEU A 1 422 ? 54.512 71.064  61.896  1.00 6.41  ? 484  LEU A O   1 
ATOM   3093 C CB  . LEU A 1 422 ? 56.490 72.235  59.912  1.00 7.03  ? 484  LEU A CB  1 
ATOM   3094 C CG  . LEU A 1 422 ? 56.714 73.091  58.664  1.00 5.87  ? 484  LEU A CG  1 
ATOM   3095 C CD1 . LEU A 1 422 ? 57.534 72.303  57.665  1.00 5.82  ? 484  LEU A CD1 1 
ATOM   3096 C CD2 . LEU A 1 422 ? 55.417 73.519  58.043  1.00 4.15  ? 484  LEU A CD2 1 
ATOM   3097 N N   . GLN A 1 423 ? 56.284 71.521  63.194  1.00 6.67  ? 485  GLN A N   1 
ATOM   3098 C CA  . GLN A 1 423 ? 55.966 70.522  64.240  1.00 6.65  ? 485  GLN A CA  1 
ATOM   3099 C C   . GLN A 1 423 ? 54.849 70.999  65.183  1.00 6.67  ? 485  GLN A C   1 
ATOM   3100 O O   . GLN A 1 423 ? 54.267 70.209  65.898  1.00 6.15  ? 485  GLN A O   1 
ATOM   3101 C CB  . GLN A 1 423 ? 57.201 70.200  65.095  1.00 6.66  ? 485  GLN A CB  1 
ATOM   3102 C CG  . GLN A 1 423 ? 58.132 69.155  64.521  1.00 6.79  ? 485  GLN A CG  1 
ATOM   3103 C CD  . GLN A 1 423 ? 59.249 68.783  65.497  1.00 6.90  ? 485  GLN A CD  1 
ATOM   3104 O OE1 . GLN A 1 423 ? 60.166 69.565  65.727  1.00 7.40  ? 485  GLN A OE1 1 
ATOM   3105 N NE2 . GLN A 1 423 ? 59.174 67.591  66.065  1.00 5.35  ? 485  GLN A NE2 1 
ATOM   3106 N N   . SER A 1 424 ? 54.575 72.298  65.183  1.00 6.71  ? 486  SER A N   1 
ATOM   3107 C CA  . SER A 1 424 ? 53.524 72.872  65.996  1.00 6.98  ? 486  SER A CA  1 
ATOM   3108 C C   . SER A 1 424 ? 52.144 72.638  65.400  1.00 6.75  ? 486  SER A C   1 
ATOM   3109 O O   . SER A 1 424 ? 51.835 73.167  64.331  1.00 6.51  ? 486  SER A O   1 
ATOM   3110 C CB  . SER A 1 424 ? 53.746 74.372  66.138  1.00 6.77  ? 486  SER A CB  1 
ATOM   3111 O OG  . SER A 1 424 ? 52.655 74.925  66.841  1.00 8.85  ? 486  SER A OG  1 
ATOM   3112 N N   . HIS A 1 425 ? 51.312 71.865  66.091  1.00 6.88  ? 487  HIS A N   1 
ATOM   3113 C CA  . HIS A 1 425 ? 49.926 71.660  65.661  1.00 7.21  ? 487  HIS A CA  1 
ATOM   3114 C C   . HIS A 1 425 ? 49.070 72.930  65.830  1.00 7.29  ? 487  HIS A C   1 
ATOM   3115 O O   . HIS A 1 425 ? 48.077 73.108  65.132  1.00 6.97  ? 487  HIS A O   1 
ATOM   3116 C CB  . HIS A 1 425 ? 49.273 70.490  66.413  1.00 7.41  ? 487  HIS A CB  1 
ATOM   3117 C CG  . HIS A 1 425 ? 47.983 70.049  65.805  1.00 8.11  ? 487  HIS A CG  1 
ATOM   3118 N ND1 . HIS A 1 425 ? 47.872 69.712  64.471  1.00 12.11 ? 487  HIS A ND1 1 
ATOM   3119 C CD2 . HIS A 1 425 ? 46.740 69.927  66.326  1.00 10.86 ? 487  HIS A CD2 1 
ATOM   3120 C CE1 . HIS A 1 425 ? 46.619 69.387  64.202  1.00 12.65 ? 487  HIS A CE1 1 
ATOM   3121 N NE2 . HIS A 1 425 ? 45.914 69.502  65.313  1.00 12.39 ? 487  HIS A NE2 1 
ATOM   3122 N N   . GLU A 1 426 ? 49.451 73.790  66.774  1.00 7.23  ? 488  GLU A N   1 
ATOM   3123 C CA  . GLU A 1 426 ? 48.782 75.074  66.968  1.00 7.38  ? 488  GLU A CA  1 
ATOM   3124 C C   . GLU A 1 426 ? 49.013 75.980  65.769  1.00 6.65  ? 488  GLU A C   1 
ATOM   3125 O O   . GLU A 1 426 ? 48.077 76.623  65.300  1.00 6.65  ? 488  GLU A O   1 
ATOM   3126 C CB  . GLU A 1 426 ? 49.262 75.745  68.255  1.00 7.62  ? 488  GLU A CB  1 
ATOM   3127 C CG  . GLU A 1 426 ? 48.834 74.998  69.512  1.00 9.07  ? 488  GLU A CG  1 
ATOM   3128 C CD  . GLU A 1 426 ? 49.435 75.574  70.784  1.00 10.35 ? 488  GLU A CD  1 
ATOM   3129 O OE1 . GLU A 1 426 ? 50.508 76.225  70.718  1.00 15.14 ? 488  GLU A OE1 1 
ATOM   3130 O OE2 . GLU A 1 426 ? 48.844 75.368  71.874  1.00 17.37 ? 488  GLU A OE2 1 
ATOM   3131 N N   . ASN A 1 427 ? 50.242 76.019  65.253  1.00 5.94  ? 489  ASN A N   1 
ATOM   3132 C CA  . ASN A 1 427 ? 50.492 76.702  63.963  1.00 5.58  ? 489  ASN A CA  1 
ATOM   3133 C C   . ASN A 1 427 ? 49.660 76.106  62.826  1.00 4.84  ? 489  ASN A C   1 
ATOM   3134 O O   . ASN A 1 427 ? 49.127 76.835  62.012  1.00 4.43  ? 489  ASN A O   1 
ATOM   3135 C CB  . ASN A 1 427 ? 51.970 76.683  63.583  1.00 5.36  ? 489  ASN A CB  1 
ATOM   3136 C CG  . ASN A 1 427 ? 52.823 77.501  64.514  1.00 5.03  ? 489  ASN A CG  1 
ATOM   3137 O OD1 . ASN A 1 427 ? 52.316 78.289  65.288  1.00 5.92  ? 489  ASN A OD1 1 
ATOM   3138 N ND2 . ASN A 1 427 ? 54.136 77.319  64.438  1.00 5.27  ? 489  ASN A ND2 1 
ATOM   3139 N N   . GLN A 1 428 ? 49.524 74.790  62.792  1.00 4.73  ? 490  GLN A N   1 
ATOM   3140 C CA  . GLN A 1 428 ? 48.697 74.140  61.779  1.00 5.08  ? 490  GLN A CA  1 
ATOM   3141 C C   . GLN A 1 428 ? 47.233 74.588  61.818  1.00 5.05  ? 490  GLN A C   1 
ATOM   3142 O O   . GLN A 1 428 ? 46.582 74.743  60.756  1.00 5.13  ? 490  GLN A O   1 
ATOM   3143 C CB  . GLN A 1 428 ? 48.778 72.613  61.895  1.00 4.70  ? 490  GLN A CB  1 
ATOM   3144 C CG  . GLN A 1 428 ? 47.923 71.857  60.877  1.00 5.52  ? 490  GLN A CG  1 
ATOM   3145 C CD  . GLN A 1 428 ? 48.213 70.362  60.825  1.00 7.30  ? 490  GLN A CD  1 
ATOM   3146 O OE1 . GLN A 1 428 ? 47.849 69.678  59.861  1.00 11.23 ? 490  GLN A OE1 1 
ATOM   3147 N NE2 . GLN A 1 428 ? 48.866 69.844  61.864  1.00 11.34 ? 490  GLN A NE2 1 
ATOM   3148 N N   . GLU A 1 429 ? 46.721 74.763  63.035  1.00 4.94  ? 491  GLU A N   1 
ATOM   3149 C CA  . GLU A 1 429 ? 45.323 75.145  63.275  1.00 5.10  ? 491  GLU A CA  1 
ATOM   3150 C C   . GLU A 1 429 ? 45.057 76.606  62.876  1.00 4.48  ? 491  GLU A C   1 
ATOM   3151 O O   . GLU A 1 429 ? 43.985 76.940  62.354  1.00 4.18  ? 491  GLU A O   1 
ATOM   3152 C CB  . GLU A 1 429 ? 44.984 74.960  64.765  1.00 5.27  ? 491  GLU A CB  1 
ATOM   3153 C CG  . GLU A 1 429 ? 44.875 73.505  65.254  1.00 6.22  ? 491  GLU A CG  1 
ATOM   3154 C CD  . GLU A 1 429 ? 44.742 73.364  66.795  1.00 7.28  ? 491  GLU A CD  1 
ATOM   3155 O OE1 . GLU A 1 429 ? 45.002 74.337  67.555  1.00 6.28  ? 491  GLU A OE1 1 
ATOM   3156 O OE2 . GLU A 1 429 ? 44.375 72.245  67.241  1.00 12.18 ? 491  GLU A OE2 1 
ATOM   3157 N N   . ILE A 1 430 ? 46.036 77.462  63.160  1.00 4.15  ? 492  ILE A N   1 
ATOM   3158 C CA  . ILE A 1 430 ? 46.016 78.882  62.794  1.00 4.19  ? 492  ILE A CA  1 
ATOM   3159 C C   . ILE A 1 430 ? 45.960 79.081  61.268  1.00 3.93  ? 492  ILE A C   1 
ATOM   3160 O O   . ILE A 1 430 ? 45.102 79.800  60.751  1.00 3.79  ? 492  ILE A O   1 
ATOM   3161 C CB  . ILE A 1 430 ? 47.263 79.600  63.377  1.00 3.77  ? 492  ILE A CB  1 
ATOM   3162 C CG1 . ILE A 1 430 ? 47.090 79.802  64.869  1.00 3.98  ? 492  ILE A CG1 1 
ATOM   3163 C CG2 . ILE A 1 430 ? 47.505 80.940  62.697  1.00 4.44  ? 492  ILE A CG2 1 
ATOM   3164 C CD1 . ILE A 1 430 ? 48.354 80.254  65.573  1.00 4.24  ? 492  ILE A CD1 1 
ATOM   3165 N N   . TYR A 1 431 ? 46.866 78.428  60.552  1.00 4.10  ? 493  TYR A N   1 
ATOM   3166 C CA  . TYR A 1 431 ? 46.918 78.543  59.093  1.00 4.12  ? 493  TYR A CA  1 
ATOM   3167 C C   . TYR A 1 431 ? 45.670 77.968  58.441  1.00 3.83  ? 493  TYR A C   1 
ATOM   3168 O O   . TYR A 1 431 ? 45.095 78.586  57.563  1.00 3.57  ? 493  TYR A O   1 
ATOM   3169 C CB  . TYR A 1 431 ? 48.198 77.914  58.528  1.00 4.74  ? 493  TYR A CB  1 
ATOM   3170 C CG  . TYR A 1 431 ? 49.376 78.858  58.594  1.00 4.85  ? 493  TYR A CG  1 
ATOM   3171 C CD1 . TYR A 1 431 ? 50.098 79.025  59.768  1.00 5.89  ? 493  TYR A CD1 1 
ATOM   3172 C CD2 . TYR A 1 431 ? 49.744 79.615  57.493  1.00 6.09  ? 493  TYR A CD2 1 
ATOM   3173 C CE1 . TYR A 1 431 ? 51.166 79.915  59.844  1.00 5.74  ? 493  TYR A CE1 1 
ATOM   3174 C CE2 . TYR A 1 431 ? 50.816 80.511  57.549  1.00 5.64  ? 493  TYR A CE2 1 
ATOM   3175 C CZ  . TYR A 1 431 ? 51.523 80.651  58.722  1.00 6.66  ? 493  TYR A CZ  1 
ATOM   3176 O OH  . TYR A 1 431 ? 52.588 81.527  58.777  1.00 6.74  ? 493  TYR A OH  1 
ATOM   3177 N N   . GLN A 1 432 ? 45.235 76.802  58.894  1.00 3.85  ? 494  GLN A N   1 
ATOM   3178 C CA  . GLN A 1 432 ? 44.033 76.194  58.363  1.00 3.85  ? 494  GLN A CA  1 
ATOM   3179 C C   . GLN A 1 432 ? 42.857 77.157  58.482  1.00 4.04  ? 494  GLN A C   1 
ATOM   3180 O O   . GLN A 1 432 ? 42.127 77.364  57.518  1.00 3.80  ? 494  GLN A O   1 
ATOM   3181 C CB  . GLN A 1 432 ? 43.746 74.884  59.104  1.00 4.36  ? 494  GLN A CB  1 
ATOM   3182 C CG  . GLN A 1 432 ? 42.319 74.333  58.942  1.00 5.84  ? 494  GLN A CG  1 
ATOM   3183 C CD  . GLN A 1 432 ? 42.184 73.375  57.805  1.00 11.09 ? 494  GLN A CD  1 
ATOM   3184 O OE1 . GLN A 1 432 ? 41.492 73.656  56.806  1.00 16.65 ? 494  GLN A OE1 1 
ATOM   3185 N NE2 . GLN A 1 432 ? 42.851 72.223  57.925  1.00 13.51 ? 494  GLN A NE2 1 
ATOM   3186 N N   . LYS A 1 433 ? 42.678 77.731  59.675  1.00 4.08  ? 495  LYS A N   1 
ATOM   3187 C CA  . LYS A 1 433 ? 41.606 78.684  59.945  1.00 3.78  ? 495  LYS A CA  1 
ATOM   3188 C C   . LYS A 1 433 ? 41.743 79.977  59.125  1.00 3.42  ? 495  LYS A C   1 
ATOM   3189 O O   . LYS A 1 433 ? 40.758 80.490  58.605  1.00 3.15  ? 495  LYS A O   1 
ATOM   3190 C CB  . LYS A 1 433 ? 41.568 78.988  61.449  1.00 3.96  ? 495  LYS A CB  1 
ATOM   3191 C CG  . LYS A 1 433 ? 40.741 80.178  61.870  1.00 5.77  ? 495  LYS A CG  1 
ATOM   3192 C CD  . LYS A 1 433 ? 39.443 79.790  62.569  1.00 9.00  ? 495  LYS A CD  1 
ATOM   3193 C CE  . LYS A 1 433 ? 38.437 79.143  61.612  1.00 10.02 ? 495  LYS A CE  1 
ATOM   3194 N NZ  . LYS A 1 433 ? 37.070 79.149  62.233  1.00 9.88  ? 495  LYS A NZ  1 
ATOM   3195 N N   . ALA A 1 434 ? 42.958 80.509  59.032  1.00 3.23  ? 496  ALA A N   1 
ATOM   3196 C CA  . ALA A 1 434 ? 43.214 81.734  58.266  1.00 2.85  ? 496  ALA A CA  1 
ATOM   3197 C C   . ALA A 1 434 ? 42.915 81.530  56.772  1.00 2.12  ? 496  ALA A C   1 
ATOM   3198 O O   . ALA A 1 434 ? 42.268 82.357  56.151  1.00 2.00  ? 496  ALA A O   1 
ATOM   3199 C CB  . ALA A 1 434 ? 44.662 82.211  58.477  1.00 2.16  ? 496  ALA A CB  1 
ATOM   3200 N N   . PHE A 1 435 ? 43.375 80.424  56.215  1.00 2.20  ? 497  PHE A N   1 
ATOM   3201 C CA  . PHE A 1 435 ? 43.084 80.078  54.816  1.00 2.49  ? 497  PHE A CA  1 
ATOM   3202 C C   . PHE A 1 435 ? 41.575 79.921  54.588  1.00 2.87  ? 497  PHE A C   1 
ATOM   3203 O O   . PHE A 1 435 ? 41.002 80.531  53.676  1.00 2.76  ? 497  PHE A O   1 
ATOM   3204 C CB  . PHE A 1 435 ? 43.805 78.787  54.403  1.00 2.56  ? 497  PHE A CB  1 
ATOM   3205 C CG  . PHE A 1 435 ? 45.266 78.966  54.078  1.00 2.00  ? 497  PHE A CG  1 
ATOM   3206 C CD1 . PHE A 1 435 ? 46.233 78.262  54.767  1.00 2.60  ? 497  PHE A CD1 1 
ATOM   3207 C CD2 . PHE A 1 435 ? 45.666 79.823  53.066  1.00 2.07  ? 497  PHE A CD2 1 
ATOM   3208 C CE1 . PHE A 1 435 ? 47.558 78.417  54.478  1.00 2.00  ? 497  PHE A CE1 1 
ATOM   3209 C CE2 . PHE A 1 435 ? 46.985 79.998  52.780  1.00 2.00  ? 497  PHE A CE2 1 
ATOM   3210 C CZ  . PHE A 1 435 ? 47.938 79.281  53.485  1.00 2.97  ? 497  PHE A CZ  1 
ATOM   3211 N N   . ASP A 1 436 ? 40.937 79.109  55.431  1.00 3.15  ? 498  ASP A N   1 
ATOM   3212 C CA  . ASP A 1 436 ? 39.485 78.879  55.373  1.00 2.97  ? 498  ASP A CA  1 
ATOM   3213 C C   . ASP A 1 436 ? 38.677 80.175  55.458  1.00 2.69  ? 498  ASP A C   1 
ATOM   3214 O O   . ASP A 1 436 ? 37.703 80.351  54.714  1.00 3.35  ? 498  ASP A O   1 
ATOM   3215 C CB  . ASP A 1 436 ? 39.025 77.973  56.536  1.00 3.79  ? 498  ASP A CB  1 
ATOM   3216 C CG  . ASP A 1 436 ? 39.269 76.490  56.287  1.00 6.46  ? 498  ASP A CG  1 
ATOM   3217 O OD1 . ASP A 1 436 ? 39.336 76.056  55.118  1.00 11.05 ? 498  ASP A OD1 1 
ATOM   3218 O OD2 . ASP A 1 436 ? 39.378 75.741  57.285  1.00 11.15 ? 498  ASP A OD2 1 
ATOM   3219 N N   . LEU A 1 437 ? 39.065 81.059  56.376  1.00 2.00  ? 499  LEU A N   1 
ATOM   3220 C CA  . LEU A 1 437 ? 38.330 82.284  56.633  1.00 2.00  ? 499  LEU A CA  1 
ATOM   3221 C C   . LEU A 1 437 ? 38.413 83.274  55.476  1.00 2.00  ? 499  LEU A C   1 
ATOM   3222 O O   . LEU A 1 437 ? 37.396 83.826  55.063  1.00 2.00  ? 499  LEU A O   1 
ATOM   3223 C CB  . LEU A 1 437 ? 38.836 82.949  57.919  1.00 2.00  ? 499  LEU A CB  1 
ATOM   3224 C CG  . LEU A 1 437 ? 38.030 84.128  58.457  1.00 2.00  ? 499  LEU A CG  1 
ATOM   3225 C CD1 . LEU A 1 437 ? 36.652 83.664  58.849  1.00 2.97  ? 499  LEU A CD1 1 
ATOM   3226 C CD2 . LEU A 1 437 ? 38.718 84.775  59.659  1.00 2.00  ? 499  LEU A CD2 1 
ATOM   3227 N N   . ILE A 1 438 ? 39.624 83.529  54.991  1.00 2.00  ? 500  ILE A N   1 
ATOM   3228 C CA  . ILE A 1 438 ? 39.812 84.481  53.908  1.00 2.00  ? 500  ILE A CA  1 
ATOM   3229 C C   . ILE A 1 438 ? 39.185 83.944  52.631  1.00 2.00  ? 500  ILE A C   1 
ATOM   3230 O O   . ILE A 1 438 ? 38.491 84.664  51.947  1.00 2.00  ? 500  ILE A O   1 
ATOM   3231 C CB  . ILE A 1 438 ? 41.302 84.832  53.667  1.00 2.00  ? 500  ILE A CB  1 
ATOM   3232 C CG1 . ILE A 1 438 ? 41.870 85.652  54.837  1.00 2.00  ? 500  ILE A CG1 1 
ATOM   3233 C CG2 . ILE A 1 438 ? 41.470 85.588  52.358  1.00 2.00  ? 500  ILE A CG2 1 
ATOM   3234 C CD1 . ILE A 1 438 ? 40.919 86.719  55.412  1.00 2.00  ? 500  ILE A CD1 1 
ATOM   3235 N N   . GLU A 1 439 ? 39.402 82.671  52.337  1.00 2.00  ? 501  GLU A N   1 
ATOM   3236 C CA  . GLU A 1 439 ? 38.815 82.064  51.142  1.00 2.14  ? 501  GLU A CA  1 
ATOM   3237 C C   . GLU A 1 439 ? 37.275 82.110  51.116  1.00 2.48  ? 501  GLU A C   1 
ATOM   3238 O O   . GLU A 1 439 ? 36.680 82.328  50.063  1.00 3.44  ? 501  GLU A O   1 
ATOM   3239 C CB  . GLU A 1 439 ? 39.375 80.655  50.920  1.00 2.49  ? 501  GLU A CB  1 
ATOM   3240 C CG  . GLU A 1 439 ? 40.858 80.714  50.523  1.00 3.12  ? 501  GLU A CG  1 
ATOM   3241 C CD  . GLU A 1 439 ? 41.527 79.365  50.333  1.00 4.05  ? 501  GLU A CD  1 
ATOM   3242 O OE1 . GLU A 1 439 ? 40.842 78.408  49.930  1.00 9.62  ? 501  GLU A OE1 1 
ATOM   3243 O OE2 . GLU A 1 439 ? 42.758 79.267  50.551  1.00 6.36  ? 501  GLU A OE2 1 
ATOM   3244 N N   . HIS A 1 440 ? 36.632 81.979  52.269  1.00 2.47  ? 502  HIS A N   1 
ATOM   3245 C CA  . HIS A 1 440 ? 35.178 82.042  52.353  1.00 2.11  ? 502  HIS A CA  1 
ATOM   3246 C C   . HIS A 1 440 ? 34.583 83.456  52.191  1.00 2.22  ? 502  HIS A C   1 
ATOM   3247 O O   . HIS A 1 440 ? 33.588 83.637  51.491  1.00 2.00  ? 502  HIS A O   1 
ATOM   3248 C CB  . HIS A 1 440 ? 34.725 81.448  53.687  1.00 2.32  ? 502  HIS A CB  1 
ATOM   3249 C CG  . HIS A 1 440 ? 33.243 81.477  53.888  1.00 2.39  ? 502  HIS A CG  1 
ATOM   3250 N ND1 . HIS A 1 440 ? 32.386 80.600  53.256  1.00 2.94  ? 502  HIS A ND1 1 
ATOM   3251 C CD2 . HIS A 1 440 ? 32.466 82.284  54.640  1.00 2.35  ? 502  HIS A CD2 1 
ATOM   3252 C CE1 . HIS A 1 440 ? 31.144 80.871  53.615  1.00 3.86  ? 502  HIS A CE1 1 
ATOM   3253 N NE2 . HIS A 1 440 ? 31.165 81.889  54.454  1.00 2.21  ? 502  HIS A NE2 1 
ATOM   3254 N N   . TYR A 1 441 ? 35.169 84.451  52.859  1.00 2.16  ? 503  TYR A N   1 
ATOM   3255 C CA  . TYR A 1 441 ? 34.621 85.809  52.842  1.00 2.03  ? 503  TYR A CA  1 
ATOM   3256 C C   . TYR A 1 441 ? 35.192 86.713  51.735  1.00 2.30  ? 503  TYR A C   1 
ATOM   3257 O O   . TYR A 1 441 ? 34.555 87.715  51.381  1.00 2.00  ? 503  TYR A O   1 
ATOM   3258 C CB  . TYR A 1 441 ? 34.788 86.483  54.213  1.00 2.00  ? 503  TYR A CB  1 
ATOM   3259 C CG  . TYR A 1 441 ? 33.946 85.859  55.299  1.00 2.00  ? 503  TYR A CG  1 
ATOM   3260 C CD1 . TYR A 1 441 ? 34.488 84.940  56.178  1.00 2.00  ? 503  TYR A CD1 1 
ATOM   3261 C CD2 . TYR A 1 441 ? 32.609 86.168  55.432  1.00 2.00  ? 503  TYR A CD2 1 
ATOM   3262 C CE1 . TYR A 1 441 ? 33.733 84.355  57.160  1.00 2.00  ? 503  TYR A CE1 1 
ATOM   3263 C CE2 . TYR A 1 441 ? 31.855 85.581  56.420  1.00 2.00  ? 503  TYR A CE2 1 
ATOM   3264 C CZ  . TYR A 1 441 ? 32.415 84.674  57.273  1.00 2.00  ? 503  TYR A CZ  1 
ATOM   3265 O OH  . TYR A 1 441 ? 31.626 84.120  58.256  1.00 2.00  ? 503  TYR A OH  1 
ATOM   3266 N N   . PHE A 1 442 ? 36.380 86.381  51.218  1.00 2.38  ? 504  PHE A N   1 
ATOM   3267 C CA  . PHE A 1 442 ? 37.015 87.136  50.128  1.00 3.61  ? 504  PHE A CA  1 
ATOM   3268 C C   . PHE A 1 442 ? 37.071 86.371  48.796  1.00 4.70  ? 504  PHE A C   1 
ATOM   3269 O O   . PHE A 1 442 ? 37.451 86.939  47.783  1.00 4.76  ? 504  PHE A O   1 
ATOM   3270 C CB  . PHE A 1 442 ? 38.448 87.532  50.504  1.00 2.64  ? 504  PHE A CB  1 
ATOM   3271 C CG  . PHE A 1 442 ? 38.540 88.433  51.685  1.00 2.42  ? 504  PHE A CG  1 
ATOM   3272 C CD1 . PHE A 1 442 ? 38.442 87.923  52.975  1.00 2.00  ? 504  PHE A CD1 1 
ATOM   3273 C CD2 . PHE A 1 442 ? 38.728 89.794  51.520  1.00 2.00  ? 504  PHE A CD2 1 
ATOM   3274 C CE1 . PHE A 1 442 ? 38.532 88.745  54.073  1.00 2.00  ? 504  PHE A CE1 1 
ATOM   3275 C CE2 . PHE A 1 442 ? 38.816 90.622  52.616  1.00 2.00  ? 504  PHE A CE2 1 
ATOM   3276 C CZ  . PHE A 1 442 ? 38.714 90.101  53.895  1.00 2.00  ? 504  PHE A CZ  1 
ATOM   3277 N N   . GLY A 1 443 ? 36.735 85.085  48.805  1.00 6.35  ? 505  GLY A N   1 
ATOM   3278 C CA  . GLY A 1 443 ? 36.737 84.276  47.598  1.00 7.74  ? 505  GLY A CA  1 
ATOM   3279 C C   . GLY A 1 443 ? 38.100 83.685  47.350  1.00 9.15  ? 505  GLY A C   1 
ATOM   3280 O O   . GLY A 1 443 ? 39.101 84.239  47.794  1.00 9.51  ? 505  GLY A O   1 
ATOM   3281 N N   . THR A 1 444 ? 38.134 82.561  46.639  1.00 10.97 ? 506  THR A N   1 
ATOM   3282 C CA  . THR A 1 444 ? 39.378 81.847  46.355  1.00 12.36 ? 506  THR A CA  1 
ATOM   3283 C C   . THR A 1 444 ? 40.044 82.355  45.067  1.00 13.87 ? 506  THR A C   1 
ATOM   3284 O O   . THR A 1 444 ? 39.367 82.773  44.130  1.00 14.45 ? 506  THR A O   1 
ATOM   3285 C CB  . THR A 1 444 ? 39.120 80.327  46.244  1.00 12.63 ? 506  THR A CB  1 
ATOM   3286 O OG1 . THR A 1 444 ? 38.505 79.869  47.452  1.00 14.06 ? 506  THR A OG1 1 
ATOM   3287 C CG2 . THR A 1 444 ? 40.409 79.556  46.044  1.00 11.61 ? 506  THR A CG2 1 
ATOM   3288 N N   . GLU A 1 445 ? 41.375 82.294  45.032  1.00 15.42 ? 507  GLU A N   1 
ATOM   3289 C CA  . GLU A 1 445 ? 42.170 82.956  44.009  1.00 15.72 ? 507  GLU A CA  1 
ATOM   3290 C C   . GLU A 1 445 ? 43.544 82.321  43.929  1.00 16.24 ? 507  GLU A C   1 
ATOM   3291 O O   . GLU A 1 445 ? 43.830 81.584  42.984  1.00 17.59 ? 507  GLU A O   1 
ATOM   3292 C CB  . GLU A 1 445 ? 42.321 84.435  44.366  1.00 16.16 ? 507  GLU A CB  1 
ATOM   3293 C CG  . GLU A 1 445 ? 42.974 85.292  43.281  1.00 17.09 ? 507  GLU A CG  1 
ATOM   3294 C CD  . GLU A 1 445 ? 43.125 86.751  43.689  1.00 17.85 ? 507  GLU A CD  1 
ATOM   3295 O OE1 . GLU A 1 445 ? 43.742 87.018  44.745  1.00 20.85 ? 507  GLU A OE1 1 
ATOM   3296 O OE2 . GLU A 1 445 ? 42.638 87.630  42.943  1.00 21.50 ? 507  GLU A OE2 1 
ATOM   3297 N N   . THR B 1 22  ? 17.300 28.069  -44.846 1.00 39.04 ? 84   THR B N   1 
ATOM   3298 C CA  . THR B 1 22  ? 16.445 27.664  -45.998 1.00 39.10 ? 84   THR B CA  1 
ATOM   3299 C C   . THR B 1 22  ? 16.722 26.214  -46.374 1.00 39.12 ? 84   THR B C   1 
ATOM   3300 O O   . THR B 1 22  ? 17.736 25.644  -45.978 1.00 39.21 ? 84   THR B O   1 
ATOM   3301 C CB  . THR B 1 22  ? 16.703 28.551  -47.245 1.00 39.01 ? 84   THR B CB  1 
ATOM   3302 O OG1 . THR B 1 22  ? 17.150 29.851  -46.844 1.00 38.89 ? 84   THR B OG1 1 
ATOM   3303 C CG2 . THR B 1 22  ? 15.438 28.689  -48.085 1.00 39.10 ? 84   THR B CG2 1 
ATOM   3304 N N   . SER B 1 23  ? 15.808 25.623  -47.136 1.00 39.26 ? 85   SER B N   1 
ATOM   3305 C CA  . SER B 1 23  ? 16.038 24.322  -47.766 1.00 39.31 ? 85   SER B CA  1 
ATOM   3306 C C   . SER B 1 23  ? 16.798 24.494  -49.087 1.00 39.36 ? 85   SER B C   1 
ATOM   3307 O O   . SER B 1 23  ? 17.137 23.509  -49.748 1.00 39.31 ? 85   SER B O   1 
ATOM   3308 C CB  . SER B 1 23  ? 14.712 23.604  -48.010 1.00 39.29 ? 85   SER B CB  1 
ATOM   3309 O OG  . SER B 1 23  ? 13.843 24.402  -48.791 1.00 39.35 ? 85   SER B OG  1 
ATOM   3310 N N   . ASP B 1 24  ? 17.022 25.750  -49.477 1.00 39.43 ? 86   ASP B N   1 
ATOM   3311 C CA  . ASP B 1 24  ? 17.982 26.098  -50.529 1.00 39.46 ? 86   ASP B CA  1 
ATOM   3312 C C   . ASP B 1 24  ? 19.416 25.846  -50.068 1.00 39.42 ? 86   ASP B C   1 
ATOM   3313 O O   . ASP B 1 24  ? 20.291 25.576  -50.885 1.00 39.40 ? 86   ASP B O   1 
ATOM   3314 C CB  . ASP B 1 24  ? 17.839 27.573  -50.941 1.00 39.49 ? 86   ASP B CB  1 
ATOM   3315 C CG  . ASP B 1 24  ? 16.851 27.775  -52.072 1.00 39.64 ? 86   ASP B CG  1 
ATOM   3316 O OD1 . ASP B 1 24  ? 17.050 27.175  -53.150 1.00 39.76 ? 86   ASP B OD1 1 
ATOM   3317 O OD2 . ASP B 1 24  ? 15.887 28.549  -51.892 1.00 39.95 ? 86   ASP B OD2 1 
ATOM   3318 N N   . MET B 1 25  ? 19.652 25.948  -48.763 1.00 39.41 ? 87   MET B N   1 
ATOM   3319 C CA  . MET B 1 25  ? 20.978 25.713  -48.200 1.00 39.41 ? 87   MET B CA  1 
ATOM   3320 C C   . MET B 1 25  ? 21.388 24.242  -48.285 1.00 39.30 ? 87   MET B C   1 
ATOM   3321 O O   . MET B 1 25  ? 22.495 23.936  -48.725 1.00 39.47 ? 87   MET B O   1 
ATOM   3322 C CB  . MET B 1 25  ? 21.031 26.185  -46.743 1.00 39.48 ? 87   MET B CB  1 
ATOM   3323 C CG  . MET B 1 25  ? 20.967 27.698  -46.582 1.00 39.56 ? 87   MET B CG  1 
ATOM   3324 S SD  . MET B 1 25  ? 20.226 28.215  -45.020 1.00 39.89 ? 87   MET B SD  1 
ATOM   3325 C CE  . MET B 1 25  ? 21.161 27.258  -43.828 1.00 39.86 ? 87   MET B CE  1 
ATOM   3326 N N   . ILE B 1 26  ? 20.494 23.342  -47.879 1.00 39.16 ? 88   ILE B N   1 
ATOM   3327 C CA  . ILE B 1 26  ? 20.819 21.912  -47.784 1.00 39.00 ? 88   ILE B CA  1 
ATOM   3328 C C   . ILE B 1 26  ? 21.009 21.241  -49.154 1.00 38.87 ? 88   ILE B C   1 
ATOM   3329 O O   . ILE B 1 26  ? 21.945 20.462  -49.335 1.00 38.91 ? 88   ILE B O   1 
ATOM   3330 C CB  . ILE B 1 26  ? 19.754 21.128  -46.968 1.00 39.04 ? 88   ILE B CB  1 
ATOM   3331 C CG1 . ILE B 1 26  ? 19.693 21.632  -45.523 1.00 38.93 ? 88   ILE B CG1 1 
ATOM   3332 C CG2 . ILE B 1 26  ? 20.066 19.638  -46.964 1.00 39.18 ? 88   ILE B CG2 1 
ATOM   3333 C CD1 . ILE B 1 26  ? 18.653 20.915  -44.672 1.00 38.93 ? 88   ILE B CD1 1 
ATOM   3334 N N   . GLU B 1 27  ? 20.135 21.540  -50.114 1.00 38.65 ? 89   GLU B N   1 
ATOM   3335 C CA  . GLU B 1 27  ? 20.218 20.903  -51.439 1.00 38.48 ? 89   GLU B CA  1 
ATOM   3336 C C   . GLU B 1 27  ? 21.304 21.491  -52.350 1.00 38.26 ? 89   GLU B C   1 
ATOM   3337 O O   . GLU B 1 27  ? 21.868 20.768  -53.173 1.00 38.33 ? 89   GLU B O   1 
ATOM   3338 C CB  . GLU B 1 27  ? 18.858 20.900  -52.157 1.00 38.48 ? 89   GLU B CB  1 
ATOM   3339 C CG  . GLU B 1 27  ? 18.026 19.641  -51.900 1.00 38.58 ? 89   GLU B CG  1 
ATOM   3340 C CD  . GLU B 1 27  ? 17.243 19.189  -53.124 1.00 38.71 ? 89   GLU B CD  1 
ATOM   3341 O OE1 . GLU B 1 27  ? 16.425 19.979  -53.643 1.00 39.40 ? 89   GLU B OE1 1 
ATOM   3342 O OE2 . GLU B 1 27  ? 17.444 18.036  -53.567 1.00 38.81 ? 89   GLU B OE2 1 
ATOM   3343 N N   . MET B 1 28  ? 21.589 22.787  -52.213 1.00 37.96 ? 90   MET B N   1 
ATOM   3344 C CA  . MET B 1 28  ? 22.668 23.426  -52.983 1.00 37.73 ? 90   MET B CA  1 
ATOM   3345 C C   . MET B 1 28  ? 24.052 22.996  -52.502 1.00 37.49 ? 90   MET B C   1 
ATOM   3346 O O   . MET B 1 28  ? 24.948 22.769  -53.316 1.00 37.47 ? 90   MET B O   1 
ATOM   3347 C CB  . MET B 1 28  ? 22.582 24.955  -52.912 1.00 37.75 ? 90   MET B CB  1 
ATOM   3348 C CG  . MET B 1 28  ? 21.540 25.570  -53.820 1.00 37.85 ? 90   MET B CG  1 
ATOM   3349 S SD  . MET B 1 28  ? 21.726 27.359  -53.966 1.00 37.69 ? 90   MET B SD  1 
ATOM   3350 C CE  . MET B 1 28  ? 20.390 27.710  -55.119 1.00 37.69 ? 90   MET B CE  1 
ATOM   3351 N N   . ILE B 1 29  ? 24.222 22.903  -51.182 1.00 37.13 ? 91   ILE B N   1 
ATOM   3352 C CA  . ILE B 1 29  ? 25.512 22.550  -50.592 1.00 36.87 ? 91   ILE B CA  1 
ATOM   3353 C C   . ILE B 1 29  ? 25.950 21.141  -50.999 1.00 36.61 ? 91   ILE B C   1 
ATOM   3354 O O   . ILE B 1 29  ? 27.115 20.931  -51.331 1.00 36.55 ? 91   ILE B O   1 
ATOM   3355 C CB  . ILE B 1 29  ? 25.510 22.711  -49.041 1.00 36.87 ? 91   ILE B CB  1 
ATOM   3356 C CG1 . ILE B 1 29  ? 26.941 22.668  -48.491 1.00 36.85 ? 91   ILE B CG1 1 
ATOM   3357 C CG2 . ILE B 1 29  ? 24.649 21.645  -48.373 1.00 36.76 ? 91   ILE B CG2 1 
ATOM   3358 C CD1 . ILE B 1 29  ? 27.082 23.232  -47.090 1.00 36.86 ? 91   ILE B CD1 1 
ATOM   3359 N N   . PHE B 1 30  ? 25.015 20.192  -51.004 1.00 36.43 ? 92   PHE B N   1 
ATOM   3360 C CA  . PHE B 1 30  ? 25.304 18.818  -51.436 1.00 36.25 ? 92   PHE B CA  1 
ATOM   3361 C C   . PHE B 1 30  ? 25.281 18.637  -52.955 1.00 35.91 ? 92   PHE B C   1 
ATOM   3362 O O   . PHE B 1 30  ? 25.671 17.581  -53.443 1.00 35.82 ? 92   PHE B O   1 
ATOM   3363 C CB  . PHE B 1 30  ? 24.347 17.818  -50.769 1.00 36.28 ? 92   PHE B CB  1 
ATOM   3364 C CG  . PHE B 1 30  ? 24.704 17.504  -49.338 1.00 36.44 ? 92   PHE B CG  1 
ATOM   3365 C CD1 . PHE B 1 30  ? 23.888 17.914  -48.292 1.00 36.37 ? 92   PHE B CD1 1 
ATOM   3366 C CD2 . PHE B 1 30  ? 25.868 16.805  -49.039 1.00 36.29 ? 92   PHE B CD2 1 
ATOM   3367 C CE1 . PHE B 1 30  ? 24.220 17.626  -46.978 1.00 36.38 ? 92   PHE B CE1 1 
ATOM   3368 C CE2 . PHE B 1 30  ? 26.206 16.513  -47.728 1.00 36.34 ? 92   PHE B CE2 1 
ATOM   3369 C CZ  . PHE B 1 30  ? 25.382 16.926  -46.697 1.00 36.44 ? 92   PHE B CZ  1 
ATOM   3370 N N   . SER B 1 31  ? 24.847 19.660  -53.695 1.00 35.70 ? 93   SER B N   1 
ATOM   3371 C CA  . SER B 1 31  ? 24.806 19.599  -55.162 1.00 35.71 ? 93   SER B CA  1 
ATOM   3372 C C   . SER B 1 31  ? 26.204 19.505  -55.764 1.00 35.61 ? 93   SER B C   1 
ATOM   3373 O O   . SER B 1 31  ? 27.195 19.756  -55.082 1.00 35.71 ? 93   SER B O   1 
ATOM   3374 C CB  . SER B 1 31  ? 24.083 20.818  -55.743 1.00 35.69 ? 93   SER B CB  1 
ATOM   3375 O OG  . SER B 1 31  ? 24.818 22.009  -55.528 1.00 35.39 ? 93   SER B OG  1 
ATOM   3376 N N   . LYS B 1 32  ? 26.268 19.168  -57.050 1.00 35.52 ? 94   LYS B N   1 
ATOM   3377 C CA  . LYS B 1 32  ? 27.534 18.872  -57.723 1.00 35.55 ? 94   LYS B CA  1 
ATOM   3378 C C   . LYS B 1 32  ? 28.094 20.035  -58.554 1.00 35.52 ? 94   LYS B C   1 
ATOM   3379 O O   . LYS B 1 32  ? 28.978 19.820  -59.381 1.00 35.47 ? 94   LYS B O   1 
ATOM   3380 C CB  . LYS B 1 32  ? 27.368 17.632  -58.613 1.00 35.54 ? 94   LYS B CB  1 
ATOM   3381 C CG  . LYS B 1 32  ? 26.879 16.399  -57.864 1.00 35.45 ? 94   LYS B CG  1 
ATOM   3382 C CD  . LYS B 1 32  ? 26.466 15.292  -58.816 1.00 35.61 ? 94   LYS B CD  1 
ATOM   3383 C CE  . LYS B 1 32  ? 25.564 14.271  -58.131 1.00 35.66 ? 94   LYS B CE  1 
ATOM   3384 N NZ  . LYS B 1 32  ? 24.878 13.390  -59.113 1.00 35.04 ? 94   LYS B NZ  1 
ATOM   3385 N N   . SER B 1 33  ? 27.598 21.254  -58.336 1.00 35.58 ? 95   SER B N   1 
ATOM   3386 C CA  . SER B 1 33  ? 28.137 22.443  -59.010 1.00 35.72 ? 95   SER B CA  1 
ATOM   3387 C C   . SER B 1 33  ? 28.921 23.326  -58.029 1.00 35.97 ? 95   SER B C   1 
ATOM   3388 O O   . SER B 1 33  ? 28.487 23.507  -56.892 1.00 35.97 ? 95   SER B O   1 
ATOM   3389 C CB  . SER B 1 33  ? 27.013 23.263  -59.642 1.00 35.62 ? 95   SER B CB  1 
ATOM   3390 O OG  . SER B 1 33  ? 26.273 23.974  -58.666 1.00 35.18 ? 95   SER B OG  1 
ATOM   3391 N N   . PRO B 1 34  ? 30.073 23.887  -58.462 1.00 36.24 ? 96   PRO B N   1 
ATOM   3392 C CA  . PRO B 1 34  ? 30.822 24.805  -57.585 1.00 36.36 ? 96   PRO B CA  1 
ATOM   3393 C C   . PRO B 1 34  ? 30.136 26.163  -57.346 1.00 36.59 ? 96   PRO B C   1 
ATOM   3394 O O   . PRO B 1 34  ? 30.420 26.827  -56.344 1.00 36.52 ? 96   PRO B O   1 
ATOM   3395 C CB  . PRO B 1 34  ? 32.153 25.012  -58.333 1.00 36.29 ? 96   PRO B CB  1 
ATOM   3396 C CG  . PRO B 1 34  ? 32.179 23.986  -59.420 1.00 36.34 ? 96   PRO B CG  1 
ATOM   3397 C CD  . PRO B 1 34  ? 30.754 23.704  -59.756 1.00 36.20 ? 96   PRO B CD  1 
ATOM   3398 N N   . GLU B 1 35  ? 29.247 26.562  -58.256 1.00 36.88 ? 97   GLU B N   1 
ATOM   3399 C CA  . GLU B 1 35  ? 28.558 27.854  -58.170 1.00 37.06 ? 97   GLU B CA  1 
ATOM   3400 C C   . GLU B 1 35  ? 27.627 27.872  -56.964 1.00 37.20 ? 97   GLU B C   1 
ATOM   3401 O O   . GLU B 1 35  ? 27.698 28.768  -56.123 1.00 37.10 ? 97   GLU B O   1 
ATOM   3402 C CB  . GLU B 1 35  ? 27.737 28.130  -59.443 1.00 37.19 ? 97   GLU B CB  1 
ATOM   3403 C CG  . GLU B 1 35  ? 28.513 28.079  -60.772 1.00 37.39 ? 97   GLU B CG  1 
ATOM   3404 C CD  . GLU B 1 35  ? 29.386 29.303  -61.021 1.00 37.67 ? 97   GLU B CD  1 
ATOM   3405 O OE1 . GLU B 1 35  ? 29.558 30.135  -60.101 1.00 37.64 ? 97   GLU B OE1 1 
ATOM   3406 O OE2 . GLU B 1 35  ? 29.907 29.430  -62.152 1.00 37.44 ? 97   GLU B OE2 1 
ATOM   3407 N N   . GLN B 1 36  ? 26.761 26.864  -56.893 1.00 37.48 ? 98   GLN B N   1 
ATOM   3408 C CA  . GLN B 1 36  ? 25.743 26.762  -55.846 1.00 37.64 ? 98   GLN B CA  1 
ATOM   3409 C C   . GLN B 1 36  ? 26.357 26.512  -54.470 1.00 37.84 ? 98   GLN B C   1 
ATOM   3410 O O   . GLN B 1 36  ? 25.791 26.916  -53.454 1.00 37.98 ? 98   GLN B O   1 
ATOM   3411 C CB  . GLN B 1 36  ? 24.736 25.649  -56.179 1.00 37.61 ? 98   GLN B CB  1 
ATOM   3412 C CG  . GLN B 1 36  ? 23.901 25.915  -57.425 1.00 37.51 ? 98   GLN B CG  1 
ATOM   3413 C CD  . GLN B 1 36  ? 22.856 24.841  -57.684 1.00 37.49 ? 98   GLN B CD  1 
ATOM   3414 O OE1 . GLN B 1 36  ? 23.019 23.684  -57.296 1.00 37.32 ? 98   GLN B OE1 1 
ATOM   3415 N NE2 . GLN B 1 36  ? 21.776 25.223  -58.351 1.00 37.37 ? 98   GLN B NE2 1 
ATOM   3416 N N   . GLN B 1 37  ? 27.512 25.852  -54.443 1.00 38.02 ? 99   GLN B N   1 
ATOM   3417 C CA  . GLN B 1 37  ? 28.189 25.522  -53.188 1.00 38.24 ? 99   GLN B CA  1 
ATOM   3418 C C   . GLN B 1 37  ? 28.821 26.748  -52.517 1.00 38.35 ? 99   GLN B C   1 
ATOM   3419 O O   . GLN B 1 37  ? 28.680 26.935  -51.310 1.00 38.26 ? 99   GLN B O   1 
ATOM   3420 C CB  . GLN B 1 37  ? 29.257 24.454  -53.435 1.00 38.26 ? 99   GLN B CB  1 
ATOM   3421 C CG  . GLN B 1 37  ? 28.694 23.081  -53.810 1.00 38.30 ? 99   GLN B CG  1 
ATOM   3422 C CD  . GLN B 1 37  ? 29.718 22.202  -54.501 1.00 38.23 ? 99   GLN B CD  1 
ATOM   3423 O OE1 . GLN B 1 37  ? 30.860 22.606  -54.688 1.00 38.84 ? 99   GLN B OE1 1 
ATOM   3424 N NE2 . GLN B 1 37  ? 29.312 21.000  -54.888 1.00 37.81 ? 99   GLN B NE2 1 
ATOM   3425 N N   . LEU B 1 38  ? 29.515 27.569  -53.303 1.00 38.61 ? 100  LEU B N   1 
ATOM   3426 C CA  . LEU B 1 38  ? 30.133 28.798  -52.796 1.00 38.84 ? 100  LEU B CA  1 
ATOM   3427 C C   . LEU B 1 38  ? 29.051 29.792  -52.384 1.00 39.08 ? 100  LEU B C   1 
ATOM   3428 O O   . LEU B 1 38  ? 29.160 30.450  -51.348 1.00 39.17 ? 100  LEU B O   1 
ATOM   3429 C CB  . LEU B 1 38  ? 31.048 29.434  -53.851 1.00 38.71 ? 100  LEU B CB  1 
ATOM   3430 C CG  . LEU B 1 38  ? 32.279 30.210  -53.359 1.00 38.79 ? 100  LEU B CG  1 
ATOM   3431 C CD1 . LEU B 1 38  ? 32.812 31.081  -54.490 1.00 39.03 ? 100  LEU B CD1 1 
ATOM   3432 C CD2 . LEU B 1 38  ? 32.001 31.057  -52.121 1.00 38.07 ? 100  LEU B CD2 1 
ATOM   3433 N N   . SER B 1 39  ? 28.014 29.894  -53.211 1.00 39.45 ? 101  SER B N   1 
ATOM   3434 C CA  . SER B 1 39  ? 26.858 30.736  -52.924 1.00 39.70 ? 101  SER B CA  1 
ATOM   3435 C C   . SER B 1 39  ? 26.223 30.360  -51.581 1.00 39.92 ? 101  SER B C   1 
ATOM   3436 O O   . SER B 1 39  ? 26.071 31.208  -50.700 1.00 39.74 ? 101  SER B O   1 
ATOM   3437 C CB  . SER B 1 39  ? 25.830 30.601  -54.052 1.00 39.71 ? 101  SER B CB  1 
ATOM   3438 O OG  . SER B 1 39  ? 24.674 31.374  -53.794 1.00 39.82 ? 101  SER B OG  1 
ATOM   3439 N N   . ALA B 1 40  ? 25.873 29.083  -51.435 1.00 40.27 ? 102  ALA B N   1 
ATOM   3440 C CA  . ALA B 1 40  ? 25.238 28.573  -50.217 1.00 40.52 ? 102  ALA B CA  1 
ATOM   3441 C C   . ALA B 1 40  ? 26.158 28.660  -49.004 1.00 40.82 ? 102  ALA B C   1 
ATOM   3442 O O   . ALA B 1 40  ? 25.681 28.772  -47.877 1.00 41.12 ? 102  ALA B O   1 
ATOM   3443 C CB  . ALA B 1 40  ? 24.774 27.135  -50.416 1.00 40.45 ? 102  ALA B CB  1 
ATOM   3444 N N   . THR B 1 41  ? 27.469 28.601  -49.232 1.00 41.11 ? 103  THR B N   1 
ATOM   3445 C CA  . THR B 1 41  ? 28.446 28.739  -48.150 1.00 41.31 ? 103  THR B CA  1 
ATOM   3446 C C   . THR B 1 41  ? 28.588 30.199  -47.699 1.00 41.53 ? 103  THR B C   1 
ATOM   3447 O O   . THR B 1 41  ? 28.794 30.460  -46.510 1.00 41.64 ? 103  THR B O   1 
ATOM   3448 C CB  . THR B 1 41  ? 29.819 28.162  -48.557 1.00 41.32 ? 103  THR B CB  1 
ATOM   3449 O OG1 . THR B 1 41  ? 29.673 26.773  -48.875 1.00 41.56 ? 103  THR B OG1 1 
ATOM   3450 C CG2 . THR B 1 41  ? 30.831 28.306  -47.433 1.00 41.18 ? 103  THR B CG2 1 
ATOM   3451 N N   . GLN B 1 42  ? 28.475 31.144  -48.635 1.00 41.75 ? 104  GLN B N   1 
ATOM   3452 C CA  . GLN B 1 42  ? 28.484 32.576  -48.291 1.00 42.04 ? 104  GLN B CA  1 
ATOM   3453 C C   . GLN B 1 42  ? 27.234 32.956  -47.480 1.00 42.31 ? 104  GLN B C   1 
ATOM   3454 O O   . GLN B 1 42  ? 27.274 33.874  -46.654 1.00 42.29 ? 104  GLN B O   1 
ATOM   3455 C CB  . GLN B 1 42  ? 28.610 33.450  -49.549 1.00 42.00 ? 104  GLN B CB  1 
ATOM   3456 C CG  . GLN B 1 42  ? 30.021 33.480  -50.155 1.00 42.03 ? 104  GLN B CG  1 
ATOM   3457 C CD  . GLN B 1 42  ? 30.063 34.024  -51.584 1.00 42.00 ? 104  GLN B CD  1 
ATOM   3458 O OE1 . GLN B 1 42  ? 29.206 33.709  -52.409 1.00 41.88 ? 104  GLN B OE1 1 
ATOM   3459 N NE2 . GLN B 1 42  ? 31.077 34.830  -51.880 1.00 41.93 ? 104  GLN B NE2 1 
ATOM   3460 N N   . LYS B 1 43  ? 26.134 32.240  -47.721 1.00 42.66 ? 105  LYS B N   1 
ATOM   3461 C CA  . LYS B 1 43  ? 24.923 32.358  -46.904 1.00 42.94 ? 105  LYS B CA  1 
ATOM   3462 C C   . LYS B 1 43  ? 25.149 31.771  -45.512 1.00 43.22 ? 105  LYS B C   1 
ATOM   3463 O O   . LYS B 1 43  ? 24.812 32.403  -44.513 1.00 43.46 ? 105  LYS B O   1 
ATOM   3464 C CB  . LYS B 1 43  ? 23.725 31.660  -47.570 1.00 42.88 ? 105  LYS B CB  1 
ATOM   3465 C CG  . LYS B 1 43  ? 22.922 32.544  -48.512 1.00 42.85 ? 105  LYS B CG  1 
ATOM   3466 C CD  . LYS B 1 43  ? 21.619 31.870  -48.926 1.00 42.93 ? 105  LYS B CD  1 
ATOM   3467 C CE  . LYS B 1 43  ? 20.736 32.800  -49.747 1.00 42.79 ? 105  LYS B CE  1 
ATOM   3468 N NZ  . LYS B 1 43  ? 19.495 32.123  -50.206 1.00 42.81 ? 105  LYS B NZ  1 
ATOM   3469 N N   . PHE B 1 44  ? 25.712 30.563  -45.452 1.00 43.50 ? 106  PHE B N   1 
ATOM   3470 C CA  . PHE B 1 44  ? 26.018 29.909  -44.171 1.00 43.82 ? 106  PHE B CA  1 
ATOM   3471 C C   . PHE B 1 44  ? 26.946 30.748  -43.291 1.00 44.13 ? 106  PHE B C   1 
ATOM   3472 O O   . PHE B 1 44  ? 26.858 30.685  -42.066 1.00 44.09 ? 106  PHE B O   1 
ATOM   3473 C CB  . PHE B 1 44  ? 26.646 28.521  -44.380 1.00 43.63 ? 106  PHE B CB  1 
ATOM   3474 C CG  . PHE B 1 44  ? 25.671 27.377  -44.259 1.00 43.53 ? 106  PHE B CG  1 
ATOM   3475 C CD1 . PHE B 1 44  ? 25.391 26.560  -45.351 1.00 43.13 ? 106  PHE B CD1 1 
ATOM   3476 C CD2 . PHE B 1 44  ? 25.051 27.102  -43.047 1.00 43.31 ? 106  PHE B CD2 1 
ATOM   3477 C CE1 . PHE B 1 44  ? 24.505 25.501  -45.238 1.00 43.15 ? 106  PHE B CE1 1 
ATOM   3478 C CE2 . PHE B 1 44  ? 24.160 26.044  -42.931 1.00 43.41 ? 106  PHE B CE2 1 
ATOM   3479 C CZ  . PHE B 1 44  ? 23.888 25.242  -44.030 1.00 43.25 ? 106  PHE B CZ  1 
ATOM   3480 N N   . ARG B 1 45  ? 27.834 31.518  -43.916 1.00 44.69 ? 107  ARG B N   1 
ATOM   3481 C CA  . ARG B 1 45  ? 28.739 32.409  -43.186 1.00 45.09 ? 107  ARG B CA  1 
ATOM   3482 C C   . ARG B 1 45  ? 27.981 33.536  -42.477 1.00 45.49 ? 107  ARG B C   1 
ATOM   3483 O O   . ARG B 1 45  ? 28.366 33.945  -41.381 1.00 45.49 ? 107  ARG B O   1 
ATOM   3484 C CB  . ARG B 1 45  ? 29.791 33.003  -44.131 1.00 45.08 ? 107  ARG B CB  1 
ATOM   3485 C CG  . ARG B 1 45  ? 30.824 33.903  -43.443 1.00 44.98 ? 107  ARG B CG  1 
ATOM   3486 C CD  . ARG B 1 45  ? 31.370 34.976  -44.367 1.00 45.15 ? 107  ARG B CD  1 
ATOM   3487 N NE  . ARG B 1 45  ? 30.323 35.745  -45.031 1.00 45.06 ? 107  ARG B NE  1 
ATOM   3488 C CZ  . ARG B 1 45  ? 30.523 36.578  -46.052 1.00 45.34 ? 107  ARG B CZ  1 
ATOM   3489 N NH1 . ARG B 1 45  ? 31.738 36.774  -46.556 1.00 45.37 ? 107  ARG B NH1 1 
ATOM   3490 N NH2 . ARG B 1 45  ? 29.488 37.221  -46.580 1.00 45.64 ? 107  ARG B NH2 1 
ATOM   3491 N N   . LYS B 1 46  ? 26.915 34.035  -43.103 1.00 46.00 ? 108  LYS B N   1 
ATOM   3492 C CA  . LYS B 1 46  ? 26.125 35.129  -42.531 1.00 46.38 ? 108  LYS B CA  1 
ATOM   3493 C C   . LYS B 1 46  ? 25.324 34.698  -41.301 1.00 46.81 ? 108  LYS B C   1 
ATOM   3494 O O   . LYS B 1 46  ? 25.099 35.507  -40.401 1.00 47.02 ? 108  LYS B O   1 
ATOM   3495 C CB  . LYS B 1 46  ? 25.182 35.729  -43.577 1.00 46.33 ? 108  LYS B CB  1 
ATOM   3496 C CG  . LYS B 1 46  ? 25.890 36.456  -44.705 1.00 46.28 ? 108  LYS B CG  1 
ATOM   3497 C CD  . LYS B 1 46  ? 24.904 36.902  -45.767 1.00 46.37 ? 108  LYS B CD  1 
ATOM   3498 C CE  . LYS B 1 46  ? 25.615 37.466  -46.979 1.00 46.29 ? 108  LYS B CE  1 
ATOM   3499 N NZ  . LYS B 1 46  ? 24.654 37.787  -48.065 1.00 46.11 ? 108  LYS B NZ  1 
ATOM   3500 N N   . LEU B 1 47  ? 24.895 33.436  -41.263 1.00 47.28 ? 109  LEU B N   1 
ATOM   3501 C CA  . LEU B 1 47  ? 24.168 32.904  -40.099 1.00 47.64 ? 109  LEU B CA  1 
ATOM   3502 C C   . LEU B 1 47  ? 25.016 32.884  -38.826 1.00 48.01 ? 109  LEU B C   1 
ATOM   3503 O O   . LEU B 1 47  ? 24.488 33.084  -37.732 1.00 48.10 ? 109  LEU B O   1 
ATOM   3504 C CB  . LEU B 1 47  ? 23.617 31.494  -40.371 1.00 47.65 ? 109  LEU B CB  1 
ATOM   3505 C CG  . LEU B 1 47  ? 22.102 31.386  -40.543 1.00 47.67 ? 109  LEU B CG  1 
ATOM   3506 C CD1 . LEU B 1 47  ? 21.714 29.985  -40.978 1.00 47.77 ? 109  LEU B CD1 1 
ATOM   3507 C CD2 . LEU B 1 47  ? 21.392 31.759  -39.250 1.00 48.00 ? 109  LEU B CD2 1 
ATOM   3508 N N   . LEU B 1 48  ? 26.320 32.648  -38.976 1.00 48.47 ? 110  LEU B N   1 
ATOM   3509 C CA  . LEU B 1 48  ? 27.244 32.567  -37.838 1.00 48.83 ? 110  LEU B CA  1 
ATOM   3510 C C   . LEU B 1 48  ? 28.129 33.819  -37.675 1.00 49.23 ? 110  LEU B C   1 
ATOM   3511 O O   . LEU B 1 48  ? 29.116 33.786  -36.934 1.00 49.31 ? 110  LEU B O   1 
ATOM   3512 C CB  . LEU B 1 48  ? 28.125 31.317  -37.974 1.00 48.79 ? 110  LEU B CB  1 
ATOM   3513 C CG  . LEU B 1 48  ? 27.393 29.975  -38.100 1.00 48.72 ? 110  LEU B CG  1 
ATOM   3514 C CD1 . LEU B 1 48  ? 28.369 28.857  -38.438 1.00 48.70 ? 110  LEU B CD1 1 
ATOM   3515 C CD2 . LEU B 1 48  ? 26.625 29.649  -36.826 1.00 48.59 ? 110  LEU B CD2 1 
ATOM   3516 N N   . SER B 1 49  ? 27.769 34.913  -38.352 1.00 49.71 ? 111  SER B N   1 
ATOM   3517 C CA  . SER B 1 49  ? 28.521 36.180  -38.279 1.00 49.95 ? 111  SER B CA  1 
ATOM   3518 C C   . SER B 1 49  ? 27.853 37.236  -37.391 1.00 50.26 ? 111  SER B C   1 
ATOM   3519 O O   . SER B 1 49  ? 28.535 38.144  -36.904 1.00 50.32 ? 111  SER B O   1 
ATOM   3520 C CB  . SER B 1 49  ? 28.735 36.764  -39.684 1.00 50.05 ? 111  SER B CB  1 
ATOM   3521 O OG  . SER B 1 49  ? 29.721 36.044  -40.403 1.00 49.99 ? 111  SER B OG  1 
ATOM   3522 N N   . LYS B 1 50  ? 26.535 37.123  -37.188 1.00 50.53 ? 112  LYS B N   1 
ATOM   3523 C CA  . LYS B 1 50  ? 25.771 38.093  -36.382 1.00 50.71 ? 112  LYS B CA  1 
ATOM   3524 C C   . LYS B 1 50  ? 26.159 38.039  -34.899 1.00 51.00 ? 112  LYS B C   1 
ATOM   3525 O O   . LYS B 1 50  ? 26.364 36.955  -34.344 1.00 51.06 ? 112  LYS B O   1 
ATOM   3526 C CB  . LYS B 1 50  ? 24.265 37.848  -36.532 1.00 50.68 ? 112  LYS B CB  1 
ATOM   3527 C CG  . LYS B 1 50  ? 23.743 38.070  -37.945 1.00 50.61 ? 112  LYS B CG  1 
ATOM   3528 C CD  . LYS B 1 50  ? 22.488 37.247  -38.227 1.00 50.67 ? 112  LYS B CD  1 
ATOM   3529 C CE  . LYS B 1 50  ? 22.050 37.373  -39.681 1.00 50.42 ? 112  LYS B CE  1 
ATOM   3530 N NZ  . LYS B 1 50  ? 21.123 36.280  -40.084 1.00 50.42 ? 112  LYS B NZ  1 
ATOM   3531 N N   . GLU B 1 51  ? 26.252 39.217  -34.272 1.00 51.32 ? 113  GLU B N   1 
ATOM   3532 C CA  . GLU B 1 51  ? 26.683 39.356  -32.863 1.00 51.38 ? 113  GLU B CA  1 
ATOM   3533 C C   . GLU B 1 51  ? 25.802 38.618  -31.836 1.00 51.47 ? 113  GLU B C   1 
ATOM   3534 O O   . GLU B 1 51  ? 26.348 38.003  -30.907 1.00 51.46 ? 113  GLU B O   1 
ATOM   3535 C CB  . GLU B 1 51  ? 26.791 40.840  -32.452 1.00 51.64 ? 113  GLU B CB  1 
ATOM   3536 C CG  . GLU B 1 51  ? 28.020 41.591  -32.993 1.00 51.93 ? 113  GLU B CG  1 
ATOM   3537 C CD  . GLU B 1 51  ? 27.883 42.038  -34.452 1.00 52.62 ? 113  GLU B CD  1 
ATOM   3538 O OE1 . GLU B 1 51  ? 26.766 41.985  -35.018 1.00 52.60 ? 113  GLU B OE1 1 
ATOM   3539 O OE2 . GLU B 1 51  ? 28.908 42.453  -35.035 1.00 53.28 ? 113  GLU B OE2 1 
ATOM   3540 N N   . PRO B 1 52  ? 24.451 38.701  -31.971 1.00 51.35 ? 114  PRO B N   1 
ATOM   3541 C CA  . PRO B 1 52  ? 23.604 37.887  -31.086 1.00 51.22 ? 114  PRO B CA  1 
ATOM   3542 C C   . PRO B 1 52  ? 23.845 36.385  -31.297 1.00 51.16 ? 114  PRO B C   1 
ATOM   3543 O O   . PRO B 1 52  ? 23.842 35.918  -32.444 1.00 51.32 ? 114  PRO B O   1 
ATOM   3544 C CB  . PRO B 1 52  ? 22.173 38.284  -31.490 1.00 51.27 ? 114  PRO B CB  1 
ATOM   3545 C CG  . PRO B 1 52  ? 22.294 38.858  -32.855 1.00 51.31 ? 114  PRO B CG  1 
ATOM   3546 C CD  . PRO B 1 52  ? 23.636 39.527  -32.885 1.00 51.40 ? 114  PRO B CD  1 
ATOM   3547 N N   . ASN B 1 53  ? 24.043 35.658  -30.192 1.00 50.90 ? 115  ASN B N   1 
ATOM   3548 C CA  . ASN B 1 53  ? 24.491 34.247  -30.197 1.00 50.52 ? 115  ASN B CA  1 
ATOM   3549 C C   . ASN B 1 53  ? 24.029 33.411  -31.412 1.00 50.15 ? 115  ASN B C   1 
ATOM   3550 O O   . ASN B 1 53  ? 22.827 33.353  -31.706 1.00 50.09 ? 115  ASN B O   1 
ATOM   3551 C CB  . ASN B 1 53  ? 24.070 33.551  -28.892 1.00 50.65 ? 115  ASN B CB  1 
ATOM   3552 C CG  . ASN B 1 53  ? 24.851 34.046  -27.682 1.00 50.79 ? 115  ASN B CG  1 
ATOM   3553 O OD1 . ASN B 1 53  ? 24.269 34.536  -26.712 1.00 51.34 ? 115  ASN B OD1 1 
ATOM   3554 N ND2 . ASN B 1 53  ? 26.174 33.923  -27.737 1.00 50.88 ? 115  ASN B ND2 1 
ATOM   3555 N N   . PRO B 1 54  ? 24.982 32.740  -32.099 1.00 49.57 ? 116  PRO B N   1 
ATOM   3556 C CA  . PRO B 1 54  ? 24.704 32.163  -33.420 1.00 49.18 ? 116  PRO B CA  1 
ATOM   3557 C C   . PRO B 1 54  ? 24.241 30.700  -33.372 1.00 48.72 ? 116  PRO B C   1 
ATOM   3558 O O   . PRO B 1 54  ? 24.590 29.978  -32.438 1.00 48.80 ? 116  PRO B O   1 
ATOM   3559 C CB  . PRO B 1 54  ? 26.062 32.259  -34.113 1.00 49.24 ? 116  PRO B CB  1 
ATOM   3560 C CG  . PRO B 1 54  ? 27.079 32.136  -32.972 1.00 49.47 ? 116  PRO B CG  1 
ATOM   3561 C CD  . PRO B 1 54  ? 26.366 32.448  -31.673 1.00 49.50 ? 116  PRO B CD  1 
ATOM   3562 N N   . PRO B 1 55  ? 23.471 30.255  -34.383 1.00 48.13 ? 117  PRO B N   1 
ATOM   3563 C CA  . PRO B 1 55  ? 22.982 28.876  -34.403 1.00 47.74 ? 117  PRO B CA  1 
ATOM   3564 C C   . PRO B 1 55  ? 24.057 27.869  -34.846 1.00 47.29 ? 117  PRO B C   1 
ATOM   3565 O O   . PRO B 1 55  ? 24.021 27.358  -35.968 1.00 47.33 ? 117  PRO B O   1 
ATOM   3566 C CB  . PRO B 1 55  ? 21.817 28.940  -35.397 1.00 47.79 ? 117  PRO B CB  1 
ATOM   3567 C CG  . PRO B 1 55  ? 22.199 30.017  -36.345 1.00 47.97 ? 117  PRO B CG  1 
ATOM   3568 C CD  . PRO B 1 55  ? 23.015 31.015  -35.561 1.00 48.09 ? 117  PRO B CD  1 
ATOM   3569 N N   . ILE B 1 56  ? 25.003 27.592  -33.953 1.00 46.68 ? 118  ILE B N   1 
ATOM   3570 C CA  . ILE B 1 56  ? 26.078 26.634  -34.216 1.00 46.26 ? 118  ILE B CA  1 
ATOM   3571 C C   . ILE B 1 56  ? 25.547 25.202  -34.134 1.00 45.82 ? 118  ILE B C   1 
ATOM   3572 O O   . ILE B 1 56  ? 25.802 24.382  -35.020 1.00 45.61 ? 118  ILE B O   1 
ATOM   3573 C CB  . ILE B 1 56  ? 27.236 26.801  -33.203 1.00 46.13 ? 118  ILE B CB  1 
ATOM   3574 C CG1 . ILE B 1 56  ? 27.905 28.168  -33.368 1.00 46.20 ? 118  ILE B CG1 1 
ATOM   3575 C CG2 . ILE B 1 56  ? 28.268 25.698  -33.375 1.00 46.42 ? 118  ILE B CG2 1 
ATOM   3576 C CD1 . ILE B 1 56  ? 28.999 28.444  -32.344 1.00 46.05 ? 118  ILE B CD1 1 
ATOM   3577 N N   . ASP B 1 57  ? 24.810 24.918  -33.061 1.00 45.37 ? 119  ASP B N   1 
ATOM   3578 C CA  . ASP B 1 57  ? 24.263 23.582  -32.809 1.00 45.00 ? 119  ASP B CA  1 
ATOM   3579 C C   . ASP B 1 57  ? 23.318 23.137  -33.919 1.00 44.58 ? 119  ASP B C   1 
ATOM   3580 O O   . ASP B 1 57  ? 23.282 21.958  -34.268 1.00 44.64 ? 119  ASP B O   1 
ATOM   3581 C CB  . ASP B 1 57  ? 23.541 23.539  -31.456 1.00 45.01 ? 119  ASP B CB  1 
ATOM   3582 C CG  . ASP B 1 57  ? 24.494 23.692  -30.278 1.00 45.07 ? 119  ASP B CG  1 
ATOM   3583 O OD1 . ASP B 1 57  ? 25.415 22.861  -30.137 1.00 45.40 ? 119  ASP B OD1 1 
ATOM   3584 O OD2 . ASP B 1 57  ? 24.327 24.644  -29.488 1.00 45.10 ? 119  ASP B OD2 1 
ATOM   3585 N N   . GLU B 1 58  ? 22.564 24.082  -34.475 1.00 44.08 ? 120  GLU B N   1 
ATOM   3586 C CA  . GLU B 1 58  ? 21.621 23.779  -35.557 1.00 43.74 ? 120  GLU B CA  1 
ATOM   3587 C C   . GLU B 1 58  ? 22.316 23.556  -36.905 1.00 43.32 ? 120  GLU B C   1 
ATOM   3588 O O   . GLU B 1 58  ? 21.775 22.880  -37.779 1.00 43.21 ? 120  GLU B O   1 
ATOM   3589 C CB  . GLU B 1 58  ? 20.553 24.872  -35.656 1.00 43.76 ? 120  GLU B CB  1 
ATOM   3590 C CG  . GLU B 1 58  ? 19.511 24.774  -34.540 1.00 43.82 ? 120  GLU B CG  1 
ATOM   3591 C CD  . GLU B 1 58  ? 18.910 26.110  -34.155 1.00 43.68 ? 120  GLU B CD  1 
ATOM   3592 O OE1 . GLU B 1 58  ? 17.665 26.220  -34.155 1.00 43.38 ? 120  GLU B OE1 1 
ATOM   3593 O OE2 . GLU B 1 58  ? 19.681 27.046  -33.846 1.00 43.20 ? 120  GLU B OE2 1 
ATOM   3594 N N   . VAL B 1 59  ? 23.511 24.122  -37.067 1.00 42.89 ? 121  VAL B N   1 
ATOM   3595 C CA  . VAL B 1 59  ? 24.355 23.816  -38.224 1.00 42.44 ? 121  VAL B CA  1 
ATOM   3596 C C   . VAL B 1 59  ? 24.943 22.415  -38.047 1.00 41.98 ? 121  VAL B C   1 
ATOM   3597 O O   . VAL B 1 59  ? 24.808 21.554  -38.920 1.00 41.97 ? 121  VAL B O   1 
ATOM   3598 C CB  . VAL B 1 59  ? 25.501 24.843  -38.384 1.00 42.50 ? 121  VAL B CB  1 
ATOM   3599 C CG1 . VAL B 1 59  ? 26.413 24.460  -39.549 1.00 42.66 ? 121  VAL B CG1 1 
ATOM   3600 C CG2 . VAL B 1 59  ? 24.938 26.241  -38.584 1.00 42.45 ? 121  VAL B CG2 1 
ATOM   3601 N N   . ILE B 1 60  ? 25.582 22.207  -36.896 1.00 41.36 ? 122  ILE B N   1 
ATOM   3602 C CA  . ILE B 1 60  ? 26.188 20.926  -36.521 1.00 40.94 ? 122  ILE B CA  1 
ATOM   3603 C C   . ILE B 1 60  ? 25.269 19.731  -36.720 1.00 40.34 ? 122  ILE B C   1 
ATOM   3604 O O   . ILE B 1 60  ? 25.684 18.715  -37.271 1.00 40.32 ? 122  ILE B O   1 
ATOM   3605 C CB  . ILE B 1 60  ? 26.606 20.936  -35.036 1.00 40.93 ? 122  ILE B CB  1 
ATOM   3606 C CG1 . ILE B 1 60  ? 27.914 21.702  -34.864 1.00 41.10 ? 122  ILE B CG1 1 
ATOM   3607 C CG2 . ILE B 1 60  ? 26.746 19.513  -34.506 1.00 41.10 ? 122  ILE B CG2 1 
ATOM   3608 C CD1 . ILE B 1 60  ? 28.305 21.898  -33.417 1.00 41.23 ? 122  ILE B CD1 1 
ATOM   3609 N N   . SER B 1 61  ? 24.029 19.859  -36.259 1.00 39.74 ? 123  SER B N   1 
ATOM   3610 C CA  . SER B 1 61  ? 23.079 18.743  -36.257 1.00 39.27 ? 123  SER B CA  1 
ATOM   3611 C C   . SER B 1 61  ? 22.545 18.346  -37.639 1.00 38.70 ? 123  SER B C   1 
ATOM   3612 O O   . SER B 1 61  ? 21.961 17.272  -37.779 1.00 38.84 ? 123  SER B O   1 
ATOM   3613 C CB  . SER B 1 61  ? 21.904 19.057  -35.329 1.00 39.28 ? 123  SER B CB  1 
ATOM   3614 O OG  . SER B 1 61  ? 21.211 20.211  -35.767 1.00 39.47 ? 123  SER B OG  1 
ATOM   3615 N N   . THR B 1 62  ? 22.727 19.198  -38.650 1.00 38.03 ? 124  THR B N   1 
ATOM   3616 C CA  . THR B 1 62  ? 22.285 18.877  -40.018 1.00 37.57 ? 124  THR B CA  1 
ATOM   3617 C C   . THR B 1 62  ? 23.110 17.707  -40.569 1.00 36.96 ? 124  THR B C   1 
ATOM   3618 O O   . THR B 1 62  ? 24.322 17.663  -40.351 1.00 36.96 ? 124  THR B O   1 
ATOM   3619 C CB  . THR B 1 62  ? 22.418 20.097  -40.968 1.00 37.63 ? 124  THR B CB  1 
ATOM   3620 O OG1 . THR B 1 62  ? 21.682 21.204  -40.436 1.00 38.04 ? 124  THR B OG1 1 
ATOM   3621 C CG2 . THR B 1 62  ? 21.889 19.782  -42.357 1.00 37.73 ? 124  THR B CG2 1 
ATOM   3622 N N   . PRO B 1 63  ? 22.459 16.753  -41.270 1.00 36.12 ? 125  PRO B N   1 
ATOM   3623 C CA  . PRO B 1 63  ? 23.146 15.539  -41.727 1.00 35.57 ? 125  PRO B CA  1 
ATOM   3624 C C   . PRO B 1 63  ? 24.445 15.795  -42.487 1.00 34.90 ? 125  PRO B C   1 
ATOM   3625 O O   . PRO B 1 63  ? 24.424 16.427  -43.543 1.00 34.85 ? 125  PRO B O   1 
ATOM   3626 C CB  . PRO B 1 63  ? 22.115 14.875  -42.657 1.00 35.67 ? 125  PRO B CB  1 
ATOM   3627 C CG  . PRO B 1 63  ? 21.075 15.918  -42.917 1.00 35.99 ? 125  PRO B CG  1 
ATOM   3628 C CD  . PRO B 1 63  ? 21.044 16.738  -41.677 1.00 36.13 ? 125  PRO B CD  1 
ATOM   3629 N N   . GLY B 1 64  ? 25.556 15.307  -41.935 1.00 34.13 ? 126  GLY B N   1 
ATOM   3630 C CA  . GLY B 1 64  ? 26.876 15.388  -42.569 1.00 33.55 ? 126  GLY B CA  1 
ATOM   3631 C C   . GLY B 1 64  ? 27.200 16.703  -43.256 1.00 32.94 ? 126  GLY B C   1 
ATOM   3632 O O   . GLY B 1 64  ? 27.745 16.710  -44.357 1.00 33.17 ? 126  GLY B O   1 
ATOM   3633 N N   . VAL B 1 65  ? 26.859 17.812  -42.608 1.00 32.12 ? 127  VAL B N   1 
ATOM   3634 C CA  . VAL B 1 65  ? 27.116 19.150  -43.146 1.00 31.46 ? 127  VAL B CA  1 
ATOM   3635 C C   . VAL B 1 65  ? 28.489 19.669  -42.719 1.00 30.75 ? 127  VAL B C   1 
ATOM   3636 O O   . VAL B 1 65  ? 29.118 20.428  -43.455 1.00 30.65 ? 127  VAL B O   1 
ATOM   3637 C CB  . VAL B 1 65  ? 26.010 20.155  -42.715 1.00 31.57 ? 127  VAL B CB  1 
ATOM   3638 C CG1 . VAL B 1 65  ? 26.529 21.592  -42.703 1.00 31.54 ? 127  VAL B CG1 1 
ATOM   3639 C CG2 . VAL B 1 65  ? 24.804 20.032  -43.625 1.00 31.36 ? 127  VAL B CG2 1 
ATOM   3640 N N   . VAL B 1 66  ? 28.950 19.268  -41.537 1.00 29.92 ? 128  VAL B N   1 
ATOM   3641 C CA  . VAL B 1 66  ? 30.283 19.662  -41.067 1.00 29.30 ? 128  VAL B CA  1 
ATOM   3642 C C   . VAL B 1 66  ? 31.386 18.956  -41.867 1.00 28.76 ? 128  VAL B C   1 
ATOM   3643 O O   . VAL B 1 66  ? 32.399 19.574  -42.202 1.00 29.20 ? 128  VAL B O   1 
ATOM   3644 C CB  . VAL B 1 66  ? 30.464 19.419  -39.545 1.00 29.12 ? 128  VAL B CB  1 
ATOM   3645 C CG1 . VAL B 1 66  ? 31.918 19.606  -39.128 1.00 28.86 ? 128  VAL B CG1 1 
ATOM   3646 C CG2 . VAL B 1 66  ? 29.576 20.359  -38.762 1.00 29.05 ? 128  VAL B CG2 1 
ATOM   3647 N N   . ALA B 1 67  ? 31.190 17.675  -42.175 1.00 28.03 ? 129  ALA B N   1 
ATOM   3648 C CA  . ALA B 1 67  ? 32.131 16.923  -43.019 1.00 27.44 ? 129  ALA B CA  1 
ATOM   3649 C C   . ALA B 1 67  ? 32.147 17.443  -44.463 1.00 26.85 ? 129  ALA B C   1 
ATOM   3650 O O   . ALA B 1 67  ? 33.125 17.245  -45.183 1.00 26.56 ? 129  ALA B O   1 
ATOM   3651 C CB  . ALA B 1 67  ? 31.795 15.436  -42.996 1.00 27.44 ? 129  ALA B CB  1 
ATOM   3652 N N   . ARG B 1 68  ? 31.061 18.100  -44.873 1.00 26.11 ? 130  ARG B N   1 
ATOM   3653 C CA  . ARG B 1 68  ? 30.984 18.768  -46.171 1.00 25.86 ? 130  ARG B CA  1 
ATOM   3654 C C   . ARG B 1 68  ? 31.793 20.063  -46.230 1.00 25.45 ? 130  ARG B C   1 
ATOM   3655 O O   . ARG B 1 68  ? 32.319 20.406  -47.283 1.00 25.23 ? 130  ARG B O   1 
ATOM   3656 C CB  . ARG B 1 68  ? 29.523 19.060  -46.529 1.00 25.73 ? 130  ARG B CB  1 
ATOM   3657 C CG  . ARG B 1 68  ? 29.282 19.517  -47.970 1.00 25.71 ? 130  ARG B CG  1 
ATOM   3658 C CD  . ARG B 1 68  ? 29.790 18.513  -49.008 1.00 25.17 ? 130  ARG B CD  1 
ATOM   3659 N NE  . ARG B 1 68  ? 29.158 18.727  -50.313 1.00 25.12 ? 130  ARG B NE  1 
ATOM   3660 C CZ  . ARG B 1 68  ? 29.599 18.249  -51.477 1.00 24.63 ? 130  ARG B CZ  1 
ATOM   3661 N NH1 . ARG B 1 68  ? 30.699 17.505  -51.548 1.00 24.29 ? 130  ARG B NH1 1 
ATOM   3662 N NH2 . ARG B 1 68  ? 28.927 18.519  -52.590 1.00 24.83 ? 130  ARG B NH2 1 
ATOM   3663 N N   . PHE B 1 69  ? 31.869 20.793  -45.116 1.00 25.38 ? 131  PHE B N   1 
ATOM   3664 C CA  . PHE B 1 69  ? 32.731 21.988  -45.022 1.00 25.22 ? 131  PHE B CA  1 
ATOM   3665 C C   . PHE B 1 69  ? 34.220 21.623  -44.971 1.00 24.90 ? 131  PHE B C   1 
ATOM   3666 O O   . PHE B 1 69  ? 35.064 22.360  -45.484 1.00 25.07 ? 131  PHE B O   1 
ATOM   3667 C CB  . PHE B 1 69  ? 32.376 22.841  -43.793 1.00 25.53 ? 131  PHE B CB  1 
ATOM   3668 C CG  . PHE B 1 69  ? 31.021 23.505  -43.869 1.00 25.69 ? 131  PHE B CG  1 
ATOM   3669 C CD1 . PHE B 1 69  ? 30.099 23.352  -42.838 1.00 26.18 ? 131  PHE B CD1 1 
ATOM   3670 C CD2 . PHE B 1 69  ? 30.674 24.295  -44.959 1.00 25.70 ? 131  PHE B CD2 1 
ATOM   3671 C CE1 . PHE B 1 69  ? 28.848 23.964  -42.899 1.00 26.19 ? 131  PHE B CE1 1 
ATOM   3672 C CE2 . PHE B 1 69  ? 29.427 24.911  -45.028 1.00 26.09 ? 131  PHE B CE2 1 
ATOM   3673 C CZ  . PHE B 1 69  ? 28.512 24.743  -43.998 1.00 26.09 ? 131  PHE B CZ  1 
ATOM   3674 N N   . VAL B 1 70  ? 34.535 20.498  -44.334 1.00 24.48 ? 132  VAL B N   1 
ATOM   3675 C CA  . VAL B 1 70  ? 35.900 19.979  -44.303 1.00 24.16 ? 132  VAL B CA  1 
ATOM   3676 C C   . VAL B 1 70  ? 36.304 19.511  -45.704 1.00 23.88 ? 132  VAL B C   1 
ATOM   3677 O O   . VAL B 1 70  ? 37.448 19.680  -46.107 1.00 23.71 ? 132  VAL B O   1 
ATOM   3678 C CB  . VAL B 1 70  ? 36.046 18.817  -43.289 1.00 24.14 ? 132  VAL B CB  1 
ATOM   3679 C CG1 . VAL B 1 70  ? 37.490 18.343  -43.205 1.00 24.09 ? 132  VAL B CG1 1 
ATOM   3680 C CG2 . VAL B 1 70  ? 35.571 19.246  -41.919 1.00 23.75 ? 132  VAL B CG2 1 
ATOM   3681 N N   . GLU B 1 71  ? 35.355 18.926  -46.436 1.00 23.70 ? 133  GLU B N   1 
ATOM   3682 C CA  . GLU B 1 71  ? 35.539 18.584  -47.861 1.00 23.60 ? 133  GLU B CA  1 
ATOM   3683 C C   . GLU B 1 71  ? 35.956 19.801  -48.691 1.00 23.46 ? 133  GLU B C   1 
ATOM   3684 O O   . GLU B 1 71  ? 36.914 19.731  -49.456 1.00 23.51 ? 133  GLU B O   1 
ATOM   3685 C CB  . GLU B 1 71  ? 34.256 17.979  -48.465 1.00 23.40 ? 133  GLU B CB  1 
ATOM   3686 C CG  . GLU B 1 71  ? 34.223 16.453  -48.528 1.00 23.36 ? 133  GLU B CG  1 
ATOM   3687 C CD  . GLU B 1 71  ? 32.873 15.903  -49.024 1.00 23.58 ? 133  GLU B CD  1 
ATOM   3688 O OE1 . GLU B 1 71  ? 32.830 15.318  -50.133 1.00 22.11 ? 133  GLU B OE1 1 
ATOM   3689 O OE2 . GLU B 1 71  ? 31.855 16.059  -48.306 1.00 23.22 ? 133  GLU B OE2 1 
ATOM   3690 N N   . PHE B 1 72  ? 35.233 20.909  -48.535 1.00 23.41 ? 134  PHE B N   1 
ATOM   3691 C CA  . PHE B 1 72  ? 35.533 22.141  -49.271 1.00 23.31 ? 134  PHE B CA  1 
ATOM   3692 C C   . PHE B 1 72  ? 36.896 22.764  -48.931 1.00 23.28 ? 134  PHE B C   1 
ATOM   3693 O O   . PHE B 1 72  ? 37.415 23.550  -49.723 1.00 23.27 ? 134  PHE B O   1 
ATOM   3694 C CB  . PHE B 1 72  ? 34.441 23.200  -49.058 1.00 23.31 ? 134  PHE B CB  1 
ATOM   3695 C CG  . PHE B 1 72  ? 33.108 22.862  -49.683 1.00 23.48 ? 134  PHE B CG  1 
ATOM   3696 C CD1 . PHE B 1 72  ? 33.023 22.202  -50.904 1.00 23.05 ? 134  PHE B CD1 1 
ATOM   3697 C CD2 . PHE B 1 72  ? 31.931 23.251  -49.059 1.00 23.74 ? 134  PHE B CD2 1 
ATOM   3698 C CE1 . PHE B 1 72  ? 31.795 21.911  -51.465 1.00 23.52 ? 134  PHE B CE1 1 
ATOM   3699 C CE2 . PHE B 1 72  ? 30.694 22.965  -49.626 1.00 23.29 ? 134  PHE B CE2 1 
ATOM   3700 C CZ  . PHE B 1 72  ? 30.631 22.294  -50.824 1.00 23.50 ? 134  PHE B CZ  1 
ATOM   3701 N N   . LEU B 1 73  ? 37.474 22.435  -47.776 1.00 23.10 ? 135  LEU B N   1 
ATOM   3702 C CA  . LEU B 1 73  ? 38.821 22.917  -47.453 1.00 23.18 ? 135  LEU B CA  1 
ATOM   3703 C C   . LEU B 1 73  ? 39.880 22.412  -48.439 1.00 23.17 ? 135  LEU B C   1 
ATOM   3704 O O   . LEU B 1 73  ? 40.895 23.070  -48.636 1.00 22.94 ? 135  LEU B O   1 
ATOM   3705 C CB  . LEU B 1 73  ? 39.231 22.535  -46.020 1.00 23.15 ? 135  LEU B CB  1 
ATOM   3706 C CG  . LEU B 1 73  ? 38.522 23.208  -44.837 1.00 22.66 ? 135  LEU B CG  1 
ATOM   3707 C CD1 . LEU B 1 73  ? 39.134 22.743  -43.525 1.00 21.73 ? 135  LEU B CD1 1 
ATOM   3708 C CD2 . LEU B 1 73  ? 38.578 24.719  -44.948 1.00 22.25 ? 135  LEU B CD2 1 
ATOM   3709 N N   . LYS B 1 74  ? 39.636 21.257  -49.056 1.00 23.56 ? 136  LYS B N   1 
ATOM   3710 C CA  . LYS B 1 74  ? 40.587 20.641  -49.995 1.00 24.04 ? 136  LYS B CA  1 
ATOM   3711 C C   . LYS B 1 74  ? 40.499 21.154  -51.441 1.00 24.17 ? 136  LYS B C   1 
ATOM   3712 O O   . LYS B 1 74  ? 41.320 20.773  -52.273 1.00 24.20 ? 136  LYS B O   1 
ATOM   3713 C CB  . LYS B 1 74  ? 40.389 19.122  -50.021 1.00 24.12 ? 136  LYS B CB  1 
ATOM   3714 C CG  . LYS B 1 74  ? 40.532 18.410  -48.669 1.00 24.70 ? 136  LYS B CG  1 
ATOM   3715 C CD  . LYS B 1 74  ? 39.838 17.048  -48.738 1.00 24.76 ? 136  LYS B CD  1 
ATOM   3716 C CE  . LYS B 1 74  ? 40.286 16.077  -47.657 1.00 25.06 ? 136  LYS B CE  1 
ATOM   3717 N NZ  . LYS B 1 74  ? 39.873 14.685  -48.034 1.00 24.82 ? 136  LYS B NZ  1 
ATOM   3718 N N   . ARG B 1 75  ? 39.518 22.007  -51.739 1.00 24.42 ? 137  ARG B N   1 
ATOM   3719 C CA  . ARG B 1 75  ? 39.262 22.473  -53.113 1.00 24.47 ? 137  ARG B CA  1 
ATOM   3720 C C   . ARG B 1 75  ? 40.252 23.565  -53.549 1.00 24.67 ? 137  ARG B C   1 
ATOM   3721 O O   . ARG B 1 75  ? 39.911 24.744  -53.665 1.00 24.48 ? 137  ARG B O   1 
ATOM   3722 C CB  . ARG B 1 75  ? 37.815 22.960  -53.246 1.00 24.37 ? 137  ARG B CB  1 
ATOM   3723 C CG  . ARG B 1 75  ? 36.773 21.896  -52.894 1.00 23.93 ? 137  ARG B CG  1 
ATOM   3724 C CD  . ARG B 1 75  ? 36.379 21.016  -54.077 1.00 23.17 ? 137  ARG B CD  1 
ATOM   3725 N NE  . ARG B 1 75  ? 34.977 21.214  -54.449 1.00 22.91 ? 137  ARG B NE  1 
ATOM   3726 C CZ  . ARG B 1 75  ? 34.518 22.153  -55.278 1.00 22.97 ? 137  ARG B CZ  1 
ATOM   3727 N NH1 . ARG B 1 75  ? 35.330 23.022  -55.868 1.00 23.33 ? 137  ARG B NH1 1 
ATOM   3728 N NH2 . ARG B 1 75  ? 33.223 22.226  -55.521 1.00 22.46 ? 137  ARG B NH2 1 
ATOM   3729 N N   . LYS B 1 76  ? 41.475 23.125  -53.816 1.00 25.14 ? 138  LYS B N   1 
ATOM   3730 C CA  . LYS B 1 76  ? 42.610 23.970  -54.196 1.00 25.48 ? 138  LYS B CA  1 
ATOM   3731 C C   . LYS B 1 76  ? 42.365 24.929  -55.378 1.00 25.67 ? 138  LYS B C   1 
ATOM   3732 O O   . LYS B 1 76  ? 43.044 25.946  -55.513 1.00 25.44 ? 138  LYS B O   1 
ATOM   3733 C CB  . LYS B 1 76  ? 43.767 23.037  -54.549 1.00 25.53 ? 138  LYS B CB  1 
ATOM   3734 C CG  . LYS B 1 76  ? 45.133 23.655  -54.588 1.00 25.62 ? 138  LYS B CG  1 
ATOM   3735 C CD  . LYS B 1 76  ? 46.133 22.606  -55.042 1.00 26.03 ? 138  LYS B CD  1 
ATOM   3736 C CE  . LYS B 1 76  ? 47.555 22.991  -54.696 1.00 26.43 ? 138  LYS B CE  1 
ATOM   3737 N NZ  . LYS B 1 76  ? 48.522 22.091  -55.387 1.00 27.00 ? 138  LYS B NZ  1 
ATOM   3738 N N   . GLU B 1 77  ? 41.420 24.593  -56.250 1.00 26.20 ? 139  GLU B N   1 
ATOM   3739 C CA  . GLU B 1 77  ? 41.129 25.429  -57.418 1.00 26.48 ? 139  GLU B CA  1 
ATOM   3740 C C   . GLU B 1 77  ? 40.122 26.553  -57.129 1.00 26.83 ? 139  GLU B C   1 
ATOM   3741 O O   . GLU B 1 77  ? 39.831 27.349  -58.020 1.00 27.03 ? 139  GLU B O   1 
ATOM   3742 C CB  . GLU B 1 77  ? 40.673 24.571  -58.608 1.00 26.47 ? 139  GLU B CB  1 
ATOM   3743 C CG  . GLU B 1 77  ? 39.223 24.066  -58.571 1.00 26.67 ? 139  GLU B CG  1 
ATOM   3744 C CD  . GLU B 1 77  ? 38.937 23.102  -57.427 1.00 26.66 ? 139  GLU B CD  1 
ATOM   3745 O OE1 . GLU B 1 77  ? 39.889 22.521  -56.866 1.00 26.43 ? 139  GLU B OE1 1 
ATOM   3746 O OE2 . GLU B 1 77  ? 37.752 22.922  -57.093 1.00 26.04 ? 139  GLU B OE2 1 
ATOM   3747 N N   . ASN B 1 78  ? 39.604 26.624  -55.900 1.00 27.22 ? 140  ASN B N   1 
ATOM   3748 C CA  . ASN B 1 78  ? 38.611 27.642  -55.526 1.00 27.39 ? 140  ASN B CA  1 
ATOM   3749 C C   . ASN B 1 78  ? 38.800 28.110  -54.078 1.00 27.63 ? 140  ASN B C   1 
ATOM   3750 O O   . ASN B 1 78  ? 38.177 27.595  -53.145 1.00 27.62 ? 140  ASN B O   1 
ATOM   3751 C CB  . ASN B 1 78  ? 37.180 27.118  -55.762 1.00 27.40 ? 140  ASN B CB  1 
ATOM   3752 C CG  . ASN B 1 78  ? 36.119 28.224  -55.710 1.00 27.46 ? 140  ASN B CG  1 
ATOM   3753 O OD1 . ASN B 1 78  ? 36.377 29.347  -55.273 1.00 28.19 ? 140  ASN B OD1 1 
ATOM   3754 N ND2 . ASN B 1 78  ? 34.913 27.896  -56.156 1.00 27.68 ? 140  ASN B ND2 1 
ATOM   3755 N N   . CYS B 1 79  ? 39.659 29.109  -53.913 1.00 27.84 ? 141  CYS B N   1 
ATOM   3756 C CA  . CYS B 1 79  ? 40.003 29.642  -52.596 1.00 28.12 ? 141  CYS B CA  1 
ATOM   3757 C C   . CYS B 1 79  ? 38.847 30.375  -51.905 1.00 28.11 ? 141  CYS B C   1 
ATOM   3758 O O   . CYS B 1 79  ? 38.763 30.380  -50.672 1.00 27.98 ? 141  CYS B O   1 
ATOM   3759 C CB  . CYS B 1 79  ? 41.187 30.594  -52.722 1.00 28.23 ? 141  CYS B CB  1 
ATOM   3760 S SG  . CYS B 1 79  ? 40.878 31.875  -53.950 1.00 29.67 ? 141  CYS B SG  1 
ATOM   3761 N N   . THR B 1 80  ? 37.973 31.013  -52.684 1.00 28.16 ? 142  THR B N   1 
ATOM   3762 C CA  . THR B 1 80  ? 36.785 31.650  -52.110 1.00 28.09 ? 142  THR B CA  1 
ATOM   3763 C C   . THR B 1 80  ? 36.022 30.588  -51.323 1.00 27.93 ? 142  THR B C   1 
ATOM   3764 O O   . THR B 1 80  ? 35.617 30.823  -50.181 1.00 27.71 ? 142  THR B O   1 
ATOM   3765 C CB  . THR B 1 80  ? 35.853 32.270  -53.187 1.00 28.28 ? 142  THR B CB  1 
ATOM   3766 O OG1 . THR B 1 80  ? 36.584 33.208  -53.984 1.00 28.89 ? 142  THR B OG1 1 
ATOM   3767 C CG2 . THR B 1 80  ? 34.670 32.987  -52.538 1.00 28.26 ? 142  THR B CG2 1 
ATOM   3768 N N   . LEU B 1 81  ? 35.860 29.412  -51.933 1.00 27.63 ? 143  LEU B N   1 
ATOM   3769 C CA  . LEU B 1 81  ? 35.190 28.299  -51.278 1.00 27.50 ? 143  LEU B CA  1 
ATOM   3770 C C   . LEU B 1 81  ? 35.987 27.831  -50.064 1.00 27.38 ? 143  LEU B C   1 
ATOM   3771 O O   . LEU B 1 81  ? 35.417 27.613  -48.999 1.00 27.32 ? 143  LEU B O   1 
ATOM   3772 C CB  . LEU B 1 81  ? 34.962 27.145  -52.256 1.00 27.53 ? 143  LEU B CB  1 
ATOM   3773 C CG  . LEU B 1 81  ? 34.007 26.046  -51.786 1.00 27.55 ? 143  LEU B CG  1 
ATOM   3774 C CD1 . LEU B 1 81  ? 32.669 26.616  -51.313 1.00 27.04 ? 143  LEU B CD1 1 
ATOM   3775 C CD2 . LEU B 1 81  ? 33.799 25.026  -52.901 1.00 27.31 ? 143  LEU B CD2 1 
ATOM   3776 N N   . GLN B 1 82  ? 37.302 27.691  -50.216 1.00 27.25 ? 144  GLN B N   1 
ATOM   3777 C CA  . GLN B 1 82  ? 38.163 27.366  -49.079 1.00 27.08 ? 144  GLN B CA  1 
ATOM   3778 C C   . GLN B 1 82  ? 38.024 28.426  -47.980 1.00 27.19 ? 144  GLN B C   1 
ATOM   3779 O O   . GLN B 1 82  ? 37.810 28.088  -46.815 1.00 26.86 ? 144  GLN B O   1 
ATOM   3780 C CB  . GLN B 1 82  ? 39.630 27.243  -49.506 1.00 26.95 ? 144  GLN B CB  1 
ATOM   3781 C CG  . GLN B 1 82  ? 39.960 25.992  -50.304 1.00 26.51 ? 144  GLN B CG  1 
ATOM   3782 C CD  . GLN B 1 82  ? 41.427 25.920  -50.690 1.00 26.40 ? 144  GLN B CD  1 
ATOM   3783 O OE1 . GLN B 1 82  ? 41.988 26.879  -51.219 1.00 25.37 ? 144  GLN B OE1 1 
ATOM   3784 N NE2 . GLN B 1 82  ? 42.057 24.779  -50.427 1.00 24.92 ? 144  GLN B NE2 1 
ATOM   3785 N N   . PHE B 1 83  ? 38.119 29.700  -48.367 1.00 27.34 ? 145  PHE B N   1 
ATOM   3786 C CA  . PHE B 1 83  ? 38.042 30.821  -47.421 1.00 27.48 ? 145  PHE B CA  1 
ATOM   3787 C C   . PHE B 1 83  ? 36.709 30.837  -46.683 1.00 27.54 ? 145  PHE B C   1 
ATOM   3788 O O   . PHE B 1 83  ? 36.671 30.741  -45.457 1.00 27.36 ? 145  PHE B O   1 
ATOM   3789 C CB  . PHE B 1 83  ? 38.261 32.165  -48.136 1.00 27.58 ? 145  PHE B CB  1 
ATOM   3790 C CG  . PHE B 1 83  ? 38.112 33.373  -47.235 1.00 27.43 ? 145  PHE B CG  1 
ATOM   3791 C CD1 . PHE B 1 83  ? 38.930 33.533  -46.118 1.00 27.73 ? 145  PHE B CD1 1 
ATOM   3792 C CD2 . PHE B 1 83  ? 37.162 34.353  -47.511 1.00 27.89 ? 145  PHE B CD2 1 
ATOM   3793 C CE1 . PHE B 1 83  ? 38.797 34.643  -45.289 1.00 27.46 ? 145  PHE B CE1 1 
ATOM   3794 C CE2 . PHE B 1 83  ? 37.025 35.471  -46.682 1.00 27.91 ? 145  PHE B CE2 1 
ATOM   3795 C CZ  . PHE B 1 83  ? 37.842 35.614  -45.573 1.00 27.68 ? 145  PHE B CZ  1 
ATOM   3796 N N   . GLU B 1 84  ? 35.617 30.945  -47.436 1.00 27.60 ? 146  GLU B N   1 
ATOM   3797 C CA  . GLU B 1 84  ? 34.288 30.996  -46.836 1.00 27.76 ? 146  GLU B CA  1 
ATOM   3798 C C   . GLU B 1 84  ? 34.030 29.777  -45.935 1.00 27.75 ? 146  GLU B C   1 
ATOM   3799 O O   . GLU B 1 84  ? 33.374 29.900  -44.905 1.00 27.70 ? 146  GLU B O   1 
ATOM   3800 C CB  . GLU B 1 84  ? 33.204 31.132  -47.918 1.00 27.96 ? 146  GLU B CB  1 
ATOM   3801 C CG  . GLU B 1 84  ? 33.262 32.444  -48.728 1.00 28.19 ? 146  GLU B CG  1 
ATOM   3802 C CD  . GLU B 1 84  ? 32.945 33.680  -47.897 1.00 28.56 ? 146  GLU B CD  1 
ATOM   3803 O OE1 . GLU B 1 84  ? 31.878 33.709  -47.249 1.00 28.61 ? 146  GLU B OE1 1 
ATOM   3804 O OE2 . GLU B 1 84  ? 33.759 34.627  -47.901 1.00 29.04 ? 146  GLU B OE2 1 
ATOM   3805 N N   . SER B 1 85  ? 34.570 28.616  -46.311 1.00 27.82 ? 147  SER B N   1 
ATOM   3806 C CA  . SER B 1 85  ? 34.442 27.396  -45.501 1.00 27.94 ? 147  SER B CA  1 
ATOM   3807 C C   . SER B 1 85  ? 35.321 27.426  -44.266 1.00 27.94 ? 147  SER B C   1 
ATOM   3808 O O   . SER B 1 85  ? 34.925 26.945  -43.204 1.00 27.74 ? 147  SER B O   1 
ATOM   3809 C CB  . SER B 1 85  ? 34.789 26.153  -46.319 1.00 27.89 ? 147  SER B CB  1 
ATOM   3810 O OG  . SER B 1 85  ? 33.827 25.946  -47.334 1.00 27.95 ? 147  SER B OG  1 
ATOM   3811 N N   . ALA B 1 86  ? 36.526 27.970  -44.417 1.00 28.22 ? 148  ALA B N   1 
ATOM   3812 C CA  . ALA B 1 86  ? 37.445 28.141  -43.295 1.00 28.37 ? 148  ALA B CA  1 
ATOM   3813 C C   . ALA B 1 86  ? 36.879 29.142  -42.280 1.00 28.66 ? 148  ALA B C   1 
ATOM   3814 O O   . ALA B 1 86  ? 37.180 29.063  -41.085 1.00 28.73 ? 148  ALA B O   1 
ATOM   3815 C CB  . ALA B 1 86  ? 38.809 28.600  -43.793 1.00 28.31 ? 148  ALA B CB  1 
ATOM   3816 N N   . TRP B 1 87  ? 36.060 30.074  -42.771 1.00 28.86 ? 149  TRP B N   1 
ATOM   3817 C CA  . TRP B 1 87  ? 35.379 31.062  -41.938 1.00 28.77 ? 149  TRP B CA  1 
ATOM   3818 C C   . TRP B 1 87  ? 34.311 30.359  -41.098 1.00 28.66 ? 149  TRP B C   1 
ATOM   3819 O O   . TRP B 1 87  ? 34.305 30.475  -39.870 1.00 28.96 ? 149  TRP B O   1 
ATOM   3820 C CB  . TRP B 1 87  ? 34.750 32.135  -42.837 1.00 29.33 ? 149  TRP B CB  1 
ATOM   3821 C CG  . TRP B 1 87  ? 34.349 33.440  -42.178 1.00 29.45 ? 149  TRP B CG  1 
ATOM   3822 C CD1 . TRP B 1 87  ? 33.927 33.634  -40.888 1.00 30.12 ? 149  TRP B CD1 1 
ATOM   3823 C CD2 . TRP B 1 87  ? 34.282 34.724  -42.815 1.00 30.03 ? 149  TRP B CD2 1 
ATOM   3824 N NE1 . TRP B 1 87  ? 33.626 34.962  -40.679 1.00 30.30 ? 149  TRP B NE1 1 
ATOM   3825 C CE2 . TRP B 1 87  ? 33.828 35.652  -41.846 1.00 30.33 ? 149  TRP B CE2 1 
ATOM   3826 C CE3 . TRP B 1 87  ? 34.569 35.183  -44.110 1.00 30.25 ? 149  TRP B CE3 1 
ATOM   3827 C CZ2 . TRP B 1 87  ? 33.656 37.014  -42.131 1.00 30.25 ? 149  TRP B CZ2 1 
ATOM   3828 C CZ3 . TRP B 1 87  ? 34.397 36.537  -44.393 1.00 30.16 ? 149  TRP B CZ3 1 
ATOM   3829 C CH2 . TRP B 1 87  ? 33.943 37.436  -43.405 1.00 30.05 ? 149  TRP B CH2 1 
ATOM   3830 N N   . VAL B 1 88  ? 33.428 29.620  -41.765 1.00 28.33 ? 150  VAL B N   1 
ATOM   3831 C CA  . VAL B 1 88  ? 32.330 28.901  -41.108 1.00 28.17 ? 150  VAL B CA  1 
ATOM   3832 C C   . VAL B 1 88  ? 32.838 27.966  -40.019 1.00 27.92 ? 150  VAL B C   1 
ATOM   3833 O O   . VAL B 1 88  ? 32.304 27.954  -38.911 1.00 27.90 ? 150  VAL B O   1 
ATOM   3834 C CB  . VAL B 1 88  ? 31.491 28.082  -42.131 1.00 28.10 ? 150  VAL B CB  1 
ATOM   3835 C CG1 . VAL B 1 88  ? 30.537 27.125  -41.424 1.00 28.13 ? 150  VAL B CG1 1 
ATOM   3836 C CG2 . VAL B 1 88  ? 30.725 29.012  -43.054 1.00 28.04 ? 150  VAL B CG2 1 
ATOM   3837 N N   . LEU B 1 89  ? 33.876 27.198  -40.341 1.00 27.86 ? 151  LEU B N   1 
ATOM   3838 C CA  . LEU B 1 89  ? 34.476 26.257  -39.393 1.00 27.87 ? 151  LEU B CA  1 
ATOM   3839 C C   . LEU B 1 89  ? 35.209 26.950  -38.229 1.00 28.00 ? 151  LEU B C   1 
ATOM   3840 O O   . LEU B 1 89  ? 35.336 26.374  -37.148 1.00 28.00 ? 151  LEU B O   1 
ATOM   3841 C CB  . LEU B 1 89  ? 35.411 25.291  -40.131 1.00 27.66 ? 151  LEU B CB  1 
ATOM   3842 C CG  . LEU B 1 89  ? 34.692 24.275  -41.028 1.00 27.22 ? 151  LEU B CG  1 
ATOM   3843 C CD1 . LEU B 1 89  ? 35.650 23.631  -42.020 1.00 26.29 ? 151  LEU B CD1 1 
ATOM   3844 C CD2 . LEU B 1 89  ? 33.998 23.216  -40.178 1.00 26.54 ? 151  LEU B CD2 1 
ATOM   3845 N N   . THR B 1 90  ? 35.681 28.178  -38.448 1.00 28.08 ? 152  THR B N   1 
ATOM   3846 C CA  . THR B 1 90  ? 36.261 28.977  -37.374 1.00 28.31 ? 152  THR B CA  1 
ATOM   3847 C C   . THR B 1 90  ? 35.198 29.369  -36.354 1.00 28.69 ? 152  THR B C   1 
ATOM   3848 O O   . THR B 1 90  ? 35.440 29.319  -35.146 1.00 28.80 ? 152  THR B O   1 
ATOM   3849 C CB  . THR B 1 90  ? 36.905 30.277  -37.894 1.00 28.19 ? 152  THR B CB  1 
ATOM   3850 O OG1 . THR B 1 90  ? 37.968 29.958  -38.787 1.00 27.98 ? 152  THR B OG1 1 
ATOM   3851 C CG2 . THR B 1 90  ? 37.458 31.107  -36.739 1.00 28.00 ? 152  THR B CG2 1 
ATOM   3852 N N   . ASN B 1 91  ? 34.030 29.771  -36.847 1.00 28.90 ? 153  ASN B N   1 
ATOM   3853 C CA  . ASN B 1 91  ? 32.955 30.253  -35.979 1.00 29.04 ? 153  ASN B CA  1 
ATOM   3854 C C   . ASN B 1 91  ? 32.248 29.130  -35.216 1.00 29.28 ? 153  ASN B C   1 
ATOM   3855 O O   . ASN B 1 91  ? 31.756 29.349  -34.108 1.00 29.22 ? 153  ASN B O   1 
ATOM   3856 C CB  . ASN B 1 91  ? 31.950 31.088  -36.780 1.00 28.94 ? 153  ASN B CB  1 
ATOM   3857 C CG  . ASN B 1 91  ? 32.493 32.465  -37.149 1.00 28.79 ? 153  ASN B CG  1 
ATOM   3858 O OD1 . ASN B 1 91  ? 33.659 32.784  -36.896 1.00 28.91 ? 153  ASN B OD1 1 
ATOM   3859 N ND2 . ASN B 1 91  ? 31.640 33.292  -37.743 1.00 28.49 ? 153  ASN B ND2 1 
ATOM   3860 N N   . ILE B 1 92  ? 32.198 27.936  -35.806 1.00 29.55 ? 154  ILE B N   1 
ATOM   3861 C CA  . ILE B 1 92  ? 31.742 26.744  -35.085 1.00 29.78 ? 154  ILE B CA  1 
ATOM   3862 C C   . ILE B 1 92  ? 32.765 26.401  -33.998 1.00 30.10 ? 154  ILE B C   1 
ATOM   3863 O O   . ILE B 1 92  ? 32.402 26.111  -32.855 1.00 30.19 ? 154  ILE B O   1 
ATOM   3864 C CB  . ILE B 1 92  ? 31.543 25.538  -36.029 1.00 29.58 ? 154  ILE B CB  1 
ATOM   3865 C CG1 . ILE B 1 92  ? 30.391 25.803  -36.996 1.00 29.38 ? 154  ILE B CG1 1 
ATOM   3866 C CG2 . ILE B 1 92  ? 31.251 24.270  -35.238 1.00 29.52 ? 154  ILE B CG2 1 
ATOM   3867 C CD1 . ILE B 1 92  ? 30.225 24.730  -38.043 1.00 29.72 ? 154  ILE B CD1 1 
ATOM   3868 N N   . ALA B 1 93  ? 34.044 26.459  -34.364 1.00 30.45 ? 155  ALA B N   1 
ATOM   3869 C CA  . ALA B 1 93  ? 35.139 26.165  -33.441 1.00 30.80 ? 155  ALA B CA  1 
ATOM   3870 C C   . ALA B 1 93  ? 35.230 27.165  -32.281 1.00 31.04 ? 155  ALA B C   1 
ATOM   3871 O O   . ALA B 1 93  ? 35.834 26.854  -31.258 1.00 30.87 ? 155  ALA B O   1 
ATOM   3872 C CB  . ALA B 1 93  ? 36.461 26.094  -34.190 1.00 30.64 ? 155  ALA B CB  1 
ATOM   3873 N N   . SER B 1 94  ? 34.653 28.357  -32.455 1.00 31.58 ? 156  SER B N   1 
ATOM   3874 C CA  . SER B 1 94  ? 34.373 29.265  -31.336 1.00 32.14 ? 156  SER B CA  1 
ATOM   3875 C C   . SER B 1 94  ? 33.053 28.845  -30.694 1.00 32.61 ? 156  SER B C   1 
ATOM   3876 O O   . SER B 1 94  ? 31.986 29.021  -31.287 1.00 32.72 ? 156  SER B O   1 
ATOM   3877 C CB  . SER B 1 94  ? 34.287 30.725  -31.801 1.00 32.12 ? 156  SER B CB  1 
ATOM   3878 O OG  . SER B 1 94  ? 33.206 30.933  -32.696 1.00 31.95 ? 156  SER B OG  1 
ATOM   3879 N N   . GLY B 1 95  ? 33.117 28.278  -29.495 1.00 33.15 ? 157  GLY B N   1 
ATOM   3880 C CA  . GLY B 1 95  ? 31.919 27.760  -28.849 1.00 33.65 ? 157  GLY B CA  1 
ATOM   3881 C C   . GLY B 1 95  ? 32.194 26.584  -27.938 1.00 34.08 ? 157  GLY B C   1 
ATOM   3882 O O   . GLY B 1 95  ? 33.297 26.439  -27.411 1.00 33.99 ? 157  GLY B O   1 
ATOM   3883 N N   . ASN B 1 96  ? 31.180 25.739  -27.771 1.00 34.67 ? 158  ASN B N   1 
ATOM   3884 C CA  . ASN B 1 96  ? 31.229 24.621  -26.826 1.00 35.07 ? 158  ASN B CA  1 
ATOM   3885 C C   . ASN B 1 96  ? 32.401 23.685  -27.093 1.00 35.38 ? 158  ASN B C   1 
ATOM   3886 O O   . ASN B 1 96  ? 32.950 23.654  -28.199 1.00 35.34 ? 158  ASN B O   1 
ATOM   3887 C CB  . ASN B 1 96  ? 29.927 23.800  -26.868 1.00 35.12 ? 158  ASN B CB  1 
ATOM   3888 C CG  . ASN B 1 96  ? 28.680 24.661  -26.793 1.00 35.72 ? 158  ASN B CG  1 
ATOM   3889 O OD1 . ASN B 1 96  ? 28.754 25.867  -26.549 1.00 36.96 ? 158  ASN B OD1 1 
ATOM   3890 N ND2 . ASN B 1 96  ? 27.522 24.044  -27.015 1.00 36.26 ? 158  ASN B ND2 1 
ATOM   3891 N N   . SER B 1 97  ? 32.761 22.909  -26.075 1.00 35.69 ? 159  SER B N   1 
ATOM   3892 C CA  . SER B 1 97  ? 33.808 21.906  -26.213 1.00 35.93 ? 159  SER B CA  1 
ATOM   3893 C C   . SER B 1 97  ? 33.316 20.756  -27.103 1.00 36.11 ? 159  SER B C   1 
ATOM   3894 O O   . SER B 1 97  ? 34.098 20.197  -27.880 1.00 36.10 ? 159  SER B O   1 
ATOM   3895 C CB  . SER B 1 97  ? 34.265 21.393  -24.841 1.00 36.07 ? 159  SER B CB  1 
ATOM   3896 O OG  . SER B 1 97  ? 35.673 21.229  -24.809 1.00 36.33 ? 159  SER B OG  1 
ATOM   3897 N N   . LEU B 1 98  ? 32.027 20.420  -26.998 1.00 36.26 ? 160  LEU B N   1 
ATOM   3898 C CA  . LEU B 1 98  ? 31.405 19.443  -27.904 1.00 36.40 ? 160  LEU B CA  1 
ATOM   3899 C C   . LEU B 1 98  ? 31.136 20.019  -29.306 1.00 36.50 ? 160  LEU B C   1 
ATOM   3900 O O   . LEU B 1 98  ? 31.042 19.262  -30.280 1.00 36.48 ? 160  LEU B O   1 
ATOM   3901 C CB  . LEU B 1 98  ? 30.089 18.890  -27.324 1.00 36.58 ? 160  LEU B CB  1 
ATOM   3902 C CG  . LEU B 1 98  ? 30.104 18.163  -25.969 1.00 36.81 ? 160  LEU B CG  1 
ATOM   3903 C CD1 . LEU B 1 98  ? 28.857 17.280  -25.842 1.00 36.14 ? 160  LEU B CD1 1 
ATOM   3904 C CD2 . LEU B 1 98  ? 31.369 17.329  -25.766 1.00 36.95 ? 160  LEU B CD2 1 
ATOM   3905 N N   . GLN B 1 99  ? 30.994 21.344  -29.402 1.00 36.44 ? 161  GLN B N   1 
ATOM   3906 C CA  . GLN B 1 99  ? 30.824 22.022  -30.697 1.00 36.36 ? 161  GLN B CA  1 
ATOM   3907 C C   . GLN B 1 99  ? 32.136 21.994  -31.474 1.00 36.36 ? 161  GLN B C   1 
ATOM   3908 O O   . GLN B 1 99  ? 32.155 21.734  -32.681 1.00 36.17 ? 161  GLN B O   1 
ATOM   3909 C CB  . GLN B 1 99  ? 30.369 23.477  -30.513 1.00 36.34 ? 161  GLN B CB  1 
ATOM   3910 C CG  . GLN B 1 99  ? 28.870 23.647  -30.301 1.00 36.29 ? 161  GLN B CG  1 
ATOM   3911 C CD  . GLN B 1 99  ? 28.465 25.089  -30.034 1.00 36.12 ? 161  GLN B CD  1 
ATOM   3912 O OE1 . GLN B 1 99  ? 29.305 25.954  -29.797 1.00 35.62 ? 161  GLN B OE1 1 
ATOM   3913 N NE2 . GLN B 1 99  ? 27.168 25.349  -30.065 1.00 35.67 ? 161  GLN B NE2 1 
ATOM   3914 N N   . THR B 1 100 ? 33.227 22.265  -30.761 1.00 36.36 ? 162  THR B N   1 
ATOM   3915 C CA  . THR B 1 100 ? 34.568 22.248  -31.335 1.00 36.31 ? 162  THR B CA  1 
ATOM   3916 C C   . THR B 1 100 ? 34.980 20.835  -31.762 1.00 36.36 ? 162  THR B C   1 
ATOM   3917 O O   . THR B 1 100 ? 35.721 20.677  -32.730 1.00 36.42 ? 162  THR B O   1 
ATOM   3918 C CB  . THR B 1 100 ? 35.607 22.829  -30.330 1.00 36.33 ? 162  THR B CB  1 
ATOM   3919 O OG1 . THR B 1 100 ? 35.254 24.176  -29.994 1.00 35.95 ? 162  THR B OG1 1 
ATOM   3920 C CG2 . THR B 1 100 ? 37.015 22.825  -30.910 1.00 36.28 ? 162  THR B CG2 1 
ATOM   3921 N N   . ARG B 1 101 ? 34.489 19.814  -31.060 1.00 36.35 ? 163  ARG B N   1 
ATOM   3922 C CA  . ARG B 1 101 ? 34.918 18.429  -31.311 1.00 36.25 ? 163  ARG B CA  1 
ATOM   3923 C C   . ARG B 1 101 ? 34.231 17.770  -32.516 1.00 35.86 ? 163  ARG B C   1 
ATOM   3924 O O   . ARG B 1 101 ? 34.704 16.753  -33.021 1.00 35.86 ? 163  ARG B O   1 
ATOM   3925 C CB  . ARG B 1 101 ? 34.721 17.567  -30.060 1.00 36.50 ? 163  ARG B CB  1 
ATOM   3926 C CG  . ARG B 1 101 ? 35.615 16.327  -30.027 1.00 36.85 ? 163  ARG B CG  1 
ATOM   3927 C CD  . ARG B 1 101 ? 35.273 15.401  -28.869 1.00 37.31 ? 163  ARG B CD  1 
ATOM   3928 N NE  . ARG B 1 101 ? 35.428 13.991  -29.232 1.00 37.91 ? 163  ARG B NE  1 
ATOM   3929 C CZ  . ARG B 1 101 ? 35.079 12.970  -28.453 1.00 38.51 ? 163  ARG B CZ  1 
ATOM   3930 N NH1 . ARG B 1 101 ? 34.559 13.185  -27.244 1.00 38.87 ? 163  ARG B NH1 1 
ATOM   3931 N NH2 . ARG B 1 101 ? 35.253 11.722  -28.884 1.00 38.81 ? 163  ARG B NH2 1 
ATOM   3932 N N   . ILE B 1 102 ? 33.122 18.343  -32.973 1.00 35.38 ? 164  ILE B N   1 
ATOM   3933 C CA  . ILE B 1 102 ? 32.475 17.892  -34.211 1.00 35.02 ? 164  ILE B CA  1 
ATOM   3934 C C   . ILE B 1 102 ? 33.333 18.247  -35.429 1.00 34.61 ? 164  ILE B C   1 
ATOM   3935 O O   . ILE B 1 102 ? 33.282 17.568  -36.456 1.00 34.80 ? 164  ILE B O   1 
ATOM   3936 C CB  . ILE B 1 102 ? 31.049 18.482  -34.336 1.00 35.08 ? 164  ILE B CB  1 
ATOM   3937 C CG1 . ILE B 1 102 ? 30.126 17.799  -33.315 1.00 35.10 ? 164  ILE B CG1 1 
ATOM   3938 C CG2 . ILE B 1 102 ? 30.500 18.306  -35.748 1.00 35.16 ? 164  ILE B CG2 1 
ATOM   3939 C CD1 . ILE B 1 102 ? 29.109 18.722  -32.673 1.00 35.29 ? 164  ILE B CD1 1 
ATOM   3940 N N   . VAL B 1 103 ? 34.124 19.308  -35.293 1.00 34.07 ? 165  VAL B N   1 
ATOM   3941 C CA  . VAL B 1 103 ? 35.121 19.701  -36.290 1.00 33.60 ? 165  VAL B CA  1 
ATOM   3942 C C   . VAL B 1 103 ? 36.391 18.832  -36.200 1.00 33.17 ? 165  VAL B C   1 
ATOM   3943 O O   . VAL B 1 103 ? 36.939 18.430  -37.232 1.00 33.33 ? 165  VAL B O   1 
ATOM   3944 C CB  . VAL B 1 103 ? 35.486 21.207  -36.131 1.00 33.71 ? 165  VAL B CB  1 
ATOM   3945 C CG1 . VAL B 1 103 ? 36.675 21.595  -37.008 1.00 33.85 ? 165  VAL B CG1 1 
ATOM   3946 C CG2 . VAL B 1 103 ? 34.272 22.076  -36.448 1.00 33.77 ? 165  VAL B CG2 1 
ATOM   3947 N N   . ILE B 1 104 ? 36.852 18.551  -34.976 1.00 32.24 ? 166  ILE B N   1 
ATOM   3948 C CA  . ILE B 1 104 ? 38.017 17.677  -34.747 1.00 31.60 ? 166  ILE B CA  1 
ATOM   3949 C C   . ILE B 1 104 ? 37.787 16.239  -35.231 1.00 31.11 ? 166  ILE B C   1 
ATOM   3950 O O   . ILE B 1 104 ? 38.709 15.610  -35.755 1.00 31.19 ? 166  ILE B O   1 
ATOM   3951 C CB  . ILE B 1 104 ? 38.424 17.624  -33.252 1.00 31.69 ? 166  ILE B CB  1 
ATOM   3952 C CG1 . ILE B 1 104 ? 38.884 19.002  -32.760 1.00 31.57 ? 166  ILE B CG1 1 
ATOM   3953 C CG2 . ILE B 1 104 ? 39.543 16.606  -33.035 1.00 31.86 ? 166  ILE B CG2 1 
ATOM   3954 C CD1 . ILE B 1 104 ? 39.206 19.048  -31.289 1.00 31.45 ? 166  ILE B CD1 1 
ATOM   3955 N N   . GLN B 1 105 ? 36.566 15.728  -35.043 1.00 30.27 ? 167  GLN B N   1 
ATOM   3956 C CA  . GLN B 1 105 ? 36.199 14.376  -35.475 1.00 29.55 ? 167  GLN B CA  1 
ATOM   3957 C C   . GLN B 1 105 ? 35.941 14.305  -36.987 1.00 28.85 ? 167  GLN B C   1 
ATOM   3958 O O   . GLN B 1 105 ? 36.042 13.233  -37.588 1.00 28.58 ? 167  GLN B O   1 
ATOM   3959 C CB  . GLN B 1 105 ? 34.957 13.891  -34.723 1.00 29.65 ? 167  GLN B CB  1 
ATOM   3960 C CG  . GLN B 1 105 ? 35.148 13.695  -33.217 1.00 29.88 ? 167  GLN B CG  1 
ATOM   3961 C CD  . GLN B 1 105 ? 33.832 13.400  -32.495 1.00 29.75 ? 167  GLN B CD  1 
ATOM   3962 O OE1 . GLN B 1 105 ? 33.000 12.632  -32.985 1.00 31.08 ? 167  GLN B OE1 1 
ATOM   3963 N NE2 . GLN B 1 105 ? 33.640 14.011  -31.334 1.00 28.97 ? 167  GLN B NE2 1 
ATOM   3964 N N   . ALA B 1 106 ? 35.593 15.443  -37.588 1.00 28.00 ? 168  ALA B N   1 
ATOM   3965 C CA  . ALA B 1 106 ? 35.446 15.549  -39.041 1.00 27.44 ? 168  ALA B CA  1 
ATOM   3966 C C   . ALA B 1 106 ? 36.805 15.548  -39.758 1.00 26.85 ? 168  ALA B C   1 
ATOM   3967 O O   . ALA B 1 106 ? 36.860 15.394  -40.977 1.00 26.57 ? 168  ALA B O   1 
ATOM   3968 C CB  . ALA B 1 106 ? 34.658 16.800  -39.403 1.00 27.23 ? 168  ALA B CB  1 
ATOM   3969 N N   . GLY B 1 107 ? 37.886 15.736  -38.997 1.00 26.22 ? 169  GLY B N   1 
ATOM   3970 C CA  . GLY B 1 107 ? 39.254 15.611  -39.505 1.00 25.87 ? 169  GLY B CA  1 
ATOM   3971 C C   . GLY B 1 107 ? 39.825 16.906  -40.063 1.00 25.45 ? 169  GLY B C   1 
ATOM   3972 O O   . GLY B 1 107 ? 40.588 16.886  -41.032 1.00 25.53 ? 169  GLY B O   1 
ATOM   3973 N N   . ALA B 1 108 ? 39.480 18.030  -39.436 1.00 24.90 ? 170  ALA B N   1 
ATOM   3974 C CA  . ALA B 1 108 ? 39.752 19.353  -40.002 1.00 24.44 ? 170  ALA B CA  1 
ATOM   3975 C C   . ALA B 1 108 ? 41.158 19.896  -39.696 1.00 24.04 ? 170  ALA B C   1 
ATOM   3976 O O   . ALA B 1 108 ? 41.699 20.691  -40.473 1.00 24.10 ? 170  ALA B O   1 
ATOM   3977 C CB  . ALA B 1 108 ? 38.687 20.340  -39.537 1.00 24.53 ? 170  ALA B CB  1 
ATOM   3978 N N   . VAL B 1 109 ? 41.749 19.463  -38.584 1.00 23.42 ? 171  VAL B N   1 
ATOM   3979 C CA  . VAL B 1 109 ? 43.046 19.993  -38.134 1.00 23.00 ? 171  VAL B CA  1 
ATOM   3980 C C   . VAL B 1 109 ? 44.214 19.753  -39.127 1.00 22.46 ? 171  VAL B C   1 
ATOM   3981 O O   . VAL B 1 109 ? 44.898 20.702  -39.501 1.00 22.41 ? 171  VAL B O   1 
ATOM   3982 C CB  . VAL B 1 109 ? 43.400 19.487  -36.698 1.00 22.94 ? 171  VAL B CB  1 
ATOM   3983 C CG1 . VAL B 1 109 ? 44.891 19.634  -36.419 1.00 22.71 ? 171  VAL B CG1 1 
ATOM   3984 C CG2 . VAL B 1 109 ? 42.559 20.216  -35.648 1.00 23.17 ? 171  VAL B CG2 1 
ATOM   3985 N N   . PRO B 1 110 ? 44.465 18.493  -39.529 1.00 21.76 ? 172  PRO B N   1 
ATOM   3986 C CA  . PRO B 1 110 ? 45.453 18.205  -40.584 1.00 21.57 ? 172  PRO B CA  1 
ATOM   3987 C C   . PRO B 1 110 ? 45.302 19.030  -41.872 1.00 21.12 ? 172  PRO B C   1 
ATOM   3988 O O   . PRO B 1 110 ? 46.297 19.436  -42.476 1.00 20.43 ? 172  PRO B O   1 
ATOM   3989 C CB  . PRO B 1 110 ? 45.199 16.727  -40.888 1.00 21.38 ? 172  PRO B CB  1 
ATOM   3990 C CG  . PRO B 1 110 ? 44.708 16.174  -39.619 1.00 21.70 ? 172  PRO B CG  1 
ATOM   3991 C CD  . PRO B 1 110 ? 43.891 17.254  -38.977 1.00 21.58 ? 172  PRO B CD  1 
ATOM   3992 N N   . ILE B 1 111 ? 44.057 19.250  -42.284 1.00 21.03 ? 173  ILE B N   1 
ATOM   3993 C CA  . ILE B 1 111 ? 43.751 19.999  -43.497 1.00 21.08 ? 173  ILE B CA  1 
ATOM   3994 C C   . ILE B 1 111 ? 44.060 21.478  -43.303 1.00 21.00 ? 173  ILE B C   1 
ATOM   3995 O O   . ILE B 1 111 ? 44.708 22.084  -44.138 1.00 20.55 ? 173  ILE B O   1 
ATOM   3996 C CB  . ILE B 1 111 ? 42.274 19.804  -43.920 1.00 20.86 ? 173  ILE B CB  1 
ATOM   3997 C CG1 . ILE B 1 111 ? 42.014 18.333  -44.265 1.00 20.89 ? 173  ILE B CG1 1 
ATOM   3998 C CG2 . ILE B 1 111 ? 41.942 20.678  -45.120 1.00 20.70 ? 173  ILE B CG2 1 
ATOM   3999 C CD1 . ILE B 1 111 ? 40.596 17.887  -44.023 1.00 20.72 ? 173  ILE B CD1 1 
ATOM   4000 N N   . PHE B 1 112 ? 43.602 22.052  -42.194 1.00 21.62 ? 174  PHE B N   1 
ATOM   4001 C CA  . PHE B 1 112 ? 43.966 23.429  -41.840 1.00 21.89 ? 174  PHE B CA  1 
ATOM   4002 C C   . PHE B 1 112 ? 45.485 23.653  -41.786 1.00 22.10 ? 174  PHE B C   1 
ATOM   4003 O O   . PHE B 1 112 ? 45.968 24.743  -42.116 1.00 22.46 ? 174  PHE B O   1 
ATOM   4004 C CB  . PHE B 1 112 ? 43.366 23.827  -40.484 1.00 22.39 ? 174  PHE B CB  1 
ATOM   4005 C CG  . PHE B 1 112 ? 41.921 24.277  -40.542 1.00 22.36 ? 174  PHE B CG  1 
ATOM   4006 C CD1 . PHE B 1 112 ? 41.503 25.236  -41.458 1.00 22.41 ? 174  PHE B CD1 1 
ATOM   4007 C CD2 . PHE B 1 112 ? 40.997 23.785  -39.626 1.00 22.51 ? 174  PHE B CD2 1 
ATOM   4008 C CE1 . PHE B 1 112 ? 40.173 25.662  -41.488 1.00 23.18 ? 174  PHE B CE1 1 
ATOM   4009 C CE2 . PHE B 1 112 ? 39.671 24.206  -39.648 1.00 22.82 ? 174  PHE B CE2 1 
ATOM   4010 C CZ  . PHE B 1 112 ? 39.259 25.146  -40.580 1.00 22.90 ? 174  PHE B CZ  1 
ATOM   4011 N N   . ILE B 1 113 ? 46.231 22.637  -41.350 1.00 22.23 ? 175  ILE B N   1 
ATOM   4012 C CA  . ILE B 1 113 ? 47.686 22.748  -41.211 1.00 22.36 ? 175  ILE B CA  1 
ATOM   4013 C C   . ILE B 1 113 ? 48.373 22.752  -42.572 1.00 22.77 ? 175  ILE B C   1 
ATOM   4014 O O   . ILE B 1 113 ? 49.372 23.447  -42.757 1.00 22.88 ? 175  ILE B O   1 
ATOM   4015 C CB  . ILE B 1 113 ? 48.260 21.646  -40.277 1.00 22.31 ? 175  ILE B CB  1 
ATOM   4016 C CG1 . ILE B 1 113 ? 47.885 21.965  -38.820 1.00 22.29 ? 175  ILE B CG1 1 
ATOM   4017 C CG2 . ILE B 1 113 ? 49.780 21.553  -40.397 1.00 22.26 ? 175  ILE B CG2 1 
ATOM   4018 C CD1 . ILE B 1 113 ? 48.037 20.812  -37.861 1.00 22.20 ? 175  ILE B CD1 1 
ATOM   4019 N N   . GLU B 1 114 ? 47.831 21.984  -43.523 1.00 23.19 ? 176  GLU B N   1 
ATOM   4020 C CA  . GLU B 1 114 ? 48.254 22.064  -44.919 1.00 23.32 ? 176  GLU B CA  1 
ATOM   4021 C C   . GLU B 1 114 ? 47.942 23.451  -45.499 1.00 23.25 ? 176  GLU B C   1 
ATOM   4022 O O   . GLU B 1 114 ? 48.770 24.056  -46.172 1.00 23.19 ? 176  GLU B O   1 
ATOM   4023 C CB  . GLU B 1 114 ? 47.551 20.982  -45.755 1.00 23.60 ? 176  GLU B CB  1 
ATOM   4024 C CG  . GLU B 1 114 ? 47.930 19.536  -45.397 1.00 23.95 ? 176  GLU B CG  1 
ATOM   4025 C CD  . GLU B 1 114 ? 47.033 18.502  -46.076 1.00 24.19 ? 176  GLU B CD  1 
ATOM   4026 O OE1 . GLU B 1 114 ? 46.767 18.650  -47.291 1.00 24.77 ? 176  GLU B OE1 1 
ATOM   4027 O OE2 . GLU B 1 114 ? 46.597 17.540  -45.397 1.00 24.88 ? 176  GLU B OE2 1 
ATOM   4028 N N   . LEU B 1 115 ? 46.740 23.947  -45.218 1.00 23.37 ? 177  LEU B N   1 
ATOM   4029 C CA  . LEU B 1 115 ? 46.303 25.278  -45.665 1.00 23.42 ? 177  LEU B CA  1 
ATOM   4030 C C   . LEU B 1 115 ? 47.143 26.451  -45.128 1.00 23.54 ? 177  LEU B C   1 
ATOM   4031 O O   . LEU B 1 115 ? 47.083 27.543  -45.683 1.00 23.49 ? 177  LEU B O   1 
ATOM   4032 C CB  . LEU B 1 115 ? 44.829 25.506  -45.299 1.00 23.10 ? 177  LEU B CB  1 
ATOM   4033 C CG  . LEU B 1 115 ? 43.756 24.858  -46.173 1.00 22.84 ? 177  LEU B CG  1 
ATOM   4034 C CD1 . LEU B 1 115 ? 42.381 25.087  -45.568 1.00 21.68 ? 177  LEU B CD1 1 
ATOM   4035 C CD2 . LEU B 1 115 ? 43.818 25.412  -47.588 1.00 22.58 ? 177  LEU B CD2 1 
ATOM   4036 N N   . LEU B 1 116 ? 47.912 26.251  -44.058 1.00 24.02 ? 178  LEU B N   1 
ATOM   4037 C CA  . LEU B 1 116 ? 48.875 27.285  -43.618 1.00 24.23 ? 178  LEU B CA  1 
ATOM   4038 C C   . LEU B 1 116 ? 49.957 27.542  -44.676 1.00 24.68 ? 178  LEU B C   1 
ATOM   4039 O O   . LEU B 1 116 ? 50.628 28.586  -44.644 1.00 24.57 ? 178  LEU B O   1 
ATOM   4040 C CB  . LEU B 1 116 ? 49.552 26.916  -42.287 1.00 23.73 ? 178  LEU B CB  1 
ATOM   4041 C CG  . LEU B 1 116 ? 48.683 26.842  -41.035 1.00 22.68 ? 178  LEU B CG  1 
ATOM   4042 C CD1 . LEU B 1 116 ? 49.541 26.455  -39.871 1.00 21.28 ? 178  LEU B CD1 1 
ATOM   4043 C CD2 . LEU B 1 116 ? 47.957 28.145  -40.755 1.00 20.69 ? 178  LEU B CD2 1 
ATOM   4044 N N   . SER B 1 117 ? 50.137 26.582  -45.587 1.00 25.33 ? 179  SER B N   1 
ATOM   4045 C CA  . SER B 1 117 ? 51.116 26.694  -46.673 1.00 26.00 ? 179  SER B CA  1 
ATOM   4046 C C   . SER B 1 117 ? 50.488 27.148  -47.994 1.00 26.59 ? 179  SER B C   1 
ATOM   4047 O O   . SER B 1 117 ? 51.151 27.157  -49.029 1.00 26.66 ? 179  SER B O   1 
ATOM   4048 C CB  . SER B 1 117 ? 51.818 25.354  -46.873 1.00 26.01 ? 179  SER B CB  1 
ATOM   4049 O OG  . SER B 1 117 ? 52.344 24.896  -45.644 1.00 26.77 ? 179  SER B OG  1 
ATOM   4050 N N   . SER B 1 118 ? 49.214 27.532  -47.952 1.00 27.28 ? 180  SER B N   1 
ATOM   4051 C CA  . SER B 1 118 ? 48.521 28.080  -49.119 1.00 27.63 ? 180  SER B CA  1 
ATOM   4052 C C   . SER B 1 118 ? 49.168 29.385  -49.612 1.00 28.15 ? 180  SER B C   1 
ATOM   4053 O O   . SER B 1 118 ? 49.860 30.084  -48.856 1.00 28.30 ? 180  SER B O   1 
ATOM   4054 C CB  . SER B 1 118 ? 47.042 28.314  -48.775 1.00 27.65 ? 180  SER B CB  1 
ATOM   4055 O OG  . SER B 1 118 ? 46.361 28.988  -49.814 1.00 27.38 ? 180  SER B OG  1 
ATOM   4056 N N   . GLU B 1 119 ? 48.937 29.701  -50.885 1.00 28.68 ? 181  GLU B N   1 
ATOM   4057 C CA  . GLU B 1 119 ? 49.453 30.927  -51.502 1.00 28.99 ? 181  GLU B CA  1 
ATOM   4058 C C   . GLU B 1 119 ? 48.548 32.122  -51.236 1.00 29.41 ? 181  GLU B C   1 
ATOM   4059 O O   . GLU B 1 119 ? 48.999 33.268  -51.292 1.00 29.77 ? 181  GLU B O   1 
ATOM   4060 C CB  . GLU B 1 119 ? 49.608 30.749  -53.012 1.00 29.17 ? 181  GLU B CB  1 
ATOM   4061 C CG  . GLU B 1 119 ? 50.656 29.728  -53.409 1.00 29.08 ? 181  GLU B CG  1 
ATOM   4062 C CD  . GLU B 1 119 ? 51.297 30.036  -54.745 1.00 29.04 ? 181  GLU B CD  1 
ATOM   4063 O OE1 . GLU B 1 119 ? 50.838 30.977  -55.436 1.00 28.46 ? 181  GLU B OE1 1 
ATOM   4064 O OE2 . GLU B 1 119 ? 52.272 29.338  -55.097 1.00 29.00 ? 181  GLU B OE2 1 
ATOM   4065 N N   . PHE B 1 120 ? 47.279 31.849  -50.940 1.00 29.69 ? 182  PHE B N   1 
ATOM   4066 C CA  . PHE B 1 120 ? 46.293 32.898  -50.690 1.00 30.01 ? 182  PHE B CA  1 
ATOM   4067 C C   . PHE B 1 120 ? 46.256 33.223  -49.195 1.00 30.25 ? 182  PHE B C   1 
ATOM   4068 O O   . PHE B 1 120 ? 45.905 32.364  -48.380 1.00 30.18 ? 182  PHE B O   1 
ATOM   4069 C CB  . PHE B 1 120 ? 44.917 32.450  -51.182 1.00 30.17 ? 182  PHE B CB  1 
ATOM   4070 C CG  . PHE B 1 120 ? 44.942 31.850  -52.558 1.00 30.41 ? 182  PHE B CG  1 
ATOM   4071 C CD1 . PHE B 1 120 ? 44.973 30.469  -52.729 1.00 30.50 ? 182  PHE B CD1 1 
ATOM   4072 C CD2 . PHE B 1 120 ? 44.962 32.663  -53.682 1.00 30.65 ? 182  PHE B CD2 1 
ATOM   4073 C CE1 . PHE B 1 120 ? 45.012 29.910  -53.996 1.00 30.70 ? 182  PHE B CE1 1 
ATOM   4074 C CE2 . PHE B 1 120 ? 44.995 32.114  -54.955 1.00 30.51 ? 182  PHE B CE2 1 
ATOM   4075 C CZ  . PHE B 1 120 ? 45.021 30.735  -55.114 1.00 30.59 ? 182  PHE B CZ  1 
ATOM   4076 N N   . GLU B 1 121 ? 46.624 34.459  -48.845 1.00 30.42 ? 183  GLU B N   1 
ATOM   4077 C CA  . GLU B 1 121 ? 46.722 34.877  -47.443 1.00 30.49 ? 183  GLU B CA  1 
ATOM   4078 C C   . GLU B 1 121 ? 45.375 34.989  -46.728 1.00 30.16 ? 183  GLU B C   1 
ATOM   4079 O O   . GLU B 1 121 ? 45.341 35.026  -45.500 1.00 30.37 ? 183  GLU B O   1 
ATOM   4080 C CB  . GLU B 1 121 ? 47.520 36.192  -47.282 1.00 30.69 ? 183  GLU B CB  1 
ATOM   4081 C CG  . GLU B 1 121 ? 49.015 35.988  -46.895 1.00 31.95 ? 183  GLU B CG  1 
ATOM   4082 C CD  . GLU B 1 121 ? 49.509 36.916  -45.765 1.00 32.02 ? 183  GLU B CD  1 
ATOM   4083 O OE1 . GLU B 1 121 ? 49.259 38.143  -45.823 1.00 34.28 ? 183  GLU B OE1 1 
ATOM   4084 O OE2 . GLU B 1 121 ? 50.169 36.414  -44.819 1.00 34.76 ? 183  GLU B OE2 1 
ATOM   4085 N N   . ASP B 1 122 ? 44.275 35.052  -47.471 1.00 29.86 ? 184  ASP B N   1 
ATOM   4086 C CA  . ASP B 1 122 ? 42.953 34.954  -46.855 1.00 29.76 ? 184  ASP B CA  1 
ATOM   4087 C C   . ASP B 1 122 ? 42.767 33.553  -46.263 1.00 29.53 ? 184  ASP B C   1 
ATOM   4088 O O   . ASP B 1 122 ? 42.202 33.399  -45.184 1.00 29.66 ? 184  ASP B O   1 
ATOM   4089 C CB  . ASP B 1 122 ? 41.836 35.246  -47.868 1.00 30.00 ? 184  ASP B CB  1 
ATOM   4090 C CG  . ASP B 1 122 ? 41.810 36.700  -48.332 1.00 30.13 ? 184  ASP B CG  1 
ATOM   4091 O OD1 . ASP B 1 122 ? 42.114 37.605  -47.535 1.00 30.94 ? 184  ASP B OD1 1 
ATOM   4092 O OD2 . ASP B 1 122 ? 41.464 36.936  -49.506 1.00 31.19 ? 184  ASP B OD2 1 
ATOM   4093 N N   . VAL B 1 123 ? 43.267 32.543  -46.972 1.00 29.32 ? 185  VAL B N   1 
ATOM   4094 C CA  . VAL B 1 123 ? 43.124 31.143  -46.568 1.00 29.03 ? 185  VAL B CA  1 
ATOM   4095 C C   . VAL B 1 123 ? 44.104 30.835  -45.439 1.00 28.84 ? 185  VAL B C   1 
ATOM   4096 O O   . VAL B 1 123 ? 43.716 30.276  -44.412 1.00 28.77 ? 185  VAL B O   1 
ATOM   4097 C CB  . VAL B 1 123 ? 43.365 30.174  -47.772 1.00 29.07 ? 185  VAL B CB  1 
ATOM   4098 C CG1 . VAL B 1 123 ? 42.981 28.744  -47.416 1.00 28.79 ? 185  VAL B CG1 1 
ATOM   4099 C CG2 . VAL B 1 123 ? 42.584 30.624  -48.986 1.00 28.48 ? 185  VAL B CG2 1 
ATOM   4100 N N   . GLN B 1 124 ? 45.369 31.208  -45.631 1.00 28.70 ? 186  GLN B N   1 
ATOM   4101 C CA  . GLN B 1 124 ? 46.410 31.053  -44.597 1.00 28.71 ? 186  GLN B CA  1 
ATOM   4102 C C   . GLN B 1 124 ? 45.989 31.648  -43.250 1.00 28.65 ? 186  GLN B C   1 
ATOM   4103 O O   . GLN B 1 124 ? 46.174 31.033  -42.196 1.00 28.56 ? 186  GLN B O   1 
ATOM   4104 C CB  . GLN B 1 124 ? 47.723 31.730  -45.033 1.00 28.66 ? 186  GLN B CB  1 
ATOM   4105 C CG  . GLN B 1 124 ? 48.562 30.933  -46.025 1.00 28.90 ? 186  GLN B CG  1 
ATOM   4106 C CD  . GLN B 1 124 ? 49.949 31.531  -46.244 1.00 28.75 ? 186  GLN B CD  1 
ATOM   4107 O OE1 . GLN B 1 124 ? 50.079 32.684  -46.657 1.00 29.47 ? 186  GLN B OE1 1 
ATOM   4108 N NE2 . GLN B 1 124 ? 50.987 30.739  -45.988 1.00 27.19 ? 186  GLN B NE2 1 
ATOM   4109 N N   . GLU B 1 125 ? 45.432 32.856  -43.310 1.00 28.63 ? 187  GLU B N   1 
ATOM   4110 C CA  . GLU B 1 125 ? 45.084 33.633  -42.123 1.00 28.36 ? 187  GLU B CA  1 
ATOM   4111 C C   . GLU B 1 125 ? 43.876 33.048  -41.400 1.00 27.85 ? 187  GLU B C   1 
ATOM   4112 O O   . GLU B 1 125 ? 43.871 32.969  -40.167 1.00 27.58 ? 187  GLU B O   1 
ATOM   4113 C CB  . GLU B 1 125 ? 44.822 35.087  -42.527 1.00 28.41 ? 187  GLU B CB  1 
ATOM   4114 C CG  . GLU B 1 125 ? 44.627 36.052  -41.384 1.00 29.19 ? 187  GLU B CG  1 
ATOM   4115 C CD  . GLU B 1 125 ? 44.890 37.504  -41.774 1.00 30.14 ? 187  GLU B CD  1 
ATOM   4116 O OE1 . GLU B 1 125 ? 45.652 37.754  -42.735 1.00 32.51 ? 187  GLU B OE1 1 
ATOM   4117 O OE2 . GLU B 1 125 ? 44.341 38.404  -41.096 1.00 33.72 ? 187  GLU B OE2 1 
ATOM   4118 N N   . GLN B 1 126 ? 42.866 32.626  -42.164 1.00 27.13 ? 188  GLN B N   1 
ATOM   4119 C CA  . GLN B 1 126 ? 41.664 32.037  -41.579 1.00 26.81 ? 188  GLN B CA  1 
ATOM   4120 C C   . GLN B 1 126 ? 41.906 30.613  -41.081 1.00 26.30 ? 188  GLN B C   1 
ATOM   4121 O O   . GLN B 1 126 ? 41.195 30.140  -40.194 1.00 26.08 ? 188  GLN B O   1 
ATOM   4122 C CB  . GLN B 1 126 ? 40.487 32.074  -42.567 1.00 26.75 ? 188  GLN B CB  1 
ATOM   4123 C CG  . GLN B 1 126 ? 39.116 31.957  -41.896 1.00 27.03 ? 188  GLN B CG  1 
ATOM   4124 C CD  . GLN B 1 126 ? 38.850 33.067  -40.875 1.00 27.49 ? 188  GLN B CD  1 
ATOM   4125 O OE1 . GLN B 1 126 ? 39.046 34.245  -41.168 1.00 29.06 ? 188  GLN B OE1 1 
ATOM   4126 N NE2 . GLN B 1 126 ? 38.402 32.692  -39.673 1.00 26.47 ? 188  GLN B NE2 1 
ATOM   4127 N N   . ALA B 1 127 ? 42.912 29.943  -41.646 1.00 25.97 ? 189  ALA B N   1 
ATOM   4128 C CA  . ALA B 1 127 ? 43.323 28.613  -41.193 1.00 25.89 ? 189  ALA B CA  1 
ATOM   4129 C C   . ALA B 1 127 ? 43.950 28.662  -39.794 1.00 25.63 ? 189  ALA B C   1 
ATOM   4130 O O   . ALA B 1 127 ? 43.590 27.882  -38.918 1.00 25.09 ? 189  ALA B O   1 
ATOM   4131 C CB  . ALA B 1 127 ? 44.304 27.985  -42.194 1.00 25.49 ? 189  ALA B CB  1 
ATOM   4132 N N   . VAL B 1 128 ? 44.894 29.577  -39.600 1.00 25.91 ? 190  VAL B N   1 
ATOM   4133 C CA  . VAL B 1 128 ? 45.579 29.738  -38.316 1.00 26.05 ? 190  VAL B CA  1 
ATOM   4134 C C   . VAL B 1 128 ? 44.622 30.258  -37.221 1.00 26.10 ? 190  VAL B C   1 
ATOM   4135 O O   . VAL B 1 128 ? 44.757 29.900  -36.052 1.00 25.89 ? 190  VAL B O   1 
ATOM   4136 C CB  . VAL B 1 128 ? 46.838 30.650  -38.471 1.00 26.13 ? 190  VAL B CB  1 
ATOM   4137 C CG1 . VAL B 1 128 ? 46.455 32.121  -38.584 1.00 25.96 ? 190  VAL B CG1 1 
ATOM   4138 C CG2 . VAL B 1 128 ? 47.807 30.422  -37.328 1.00 26.04 ? 190  VAL B CG2 1 
ATOM   4139 N N   . TRP B 1 129 ? 43.654 31.084  -37.618 1.00 26.48 ? 191  TRP B N   1 
ATOM   4140 C CA  . TRP B 1 129 ? 42.553 31.512  -36.744 1.00 26.57 ? 191  TRP B CA  1 
ATOM   4141 C C   . TRP B 1 129 ? 41.770 30.295  -36.255 1.00 26.72 ? 191  TRP B C   1 
ATOM   4142 O O   . TRP B 1 129 ? 41.617 30.098  -35.053 1.00 26.91 ? 191  TRP B O   1 
ATOM   4143 C CB  . TRP B 1 129 ? 41.605 32.452  -37.499 1.00 26.83 ? 191  TRP B CB  1 
ATOM   4144 C CG  . TRP B 1 129 ? 40.634 33.234  -36.631 1.00 27.09 ? 191  TRP B CG  1 
ATOM   4145 C CD1 . TRP B 1 129 ? 40.080 32.849  -35.435 1.00 27.27 ? 191  TRP B CD1 1 
ATOM   4146 C CD2 . TRP B 1 129 ? 40.081 34.521  -36.926 1.00 27.43 ? 191  TRP B CD2 1 
ATOM   4147 N NE1 . TRP B 1 129 ? 39.241 33.826  -34.963 1.00 27.33 ? 191  TRP B NE1 1 
ATOM   4148 C CE2 . TRP B 1 129 ? 39.218 34.862  -35.859 1.00 27.42 ? 191  TRP B CE2 1 
ATOM   4149 C CE3 . TRP B 1 129 ? 40.235 35.423  -37.985 1.00 27.31 ? 191  TRP B CE3 1 
ATOM   4150 C CZ2 . TRP B 1 129 ? 38.513 36.065  -35.822 1.00 27.41 ? 191  TRP B CZ2 1 
ATOM   4151 C CZ3 . TRP B 1 129 ? 39.540 36.620  -37.944 1.00 27.34 ? 191  TRP B CZ3 1 
ATOM   4152 C CH2 . TRP B 1 129 ? 38.687 36.930  -36.869 1.00 27.47 ? 191  TRP B CH2 1 
ATOM   4153 N N   . ALA B 1 130 ? 41.271 29.485  -37.186 1.00 26.85 ? 192  ALA B N   1 
ATOM   4154 C CA  . ALA B 1 130 ? 40.485 28.299  -36.825 1.00 26.78 ? 192  ALA B CA  1 
ATOM   4155 C C   . ALA B 1 130 ? 41.270 27.391  -35.875 1.00 26.87 ? 192  ALA B C   1 
ATOM   4156 O O   . ALA B 1 130 ? 40.711 26.855  -34.917 1.00 26.77 ? 192  ALA B O   1 
ATOM   4157 C CB  . ALA B 1 130 ? 40.069 27.528  -38.072 1.00 26.65 ? 192  ALA B CB  1 
ATOM   4158 N N   . LEU B 1 131 ? 42.569 27.240  -36.145 1.00 26.78 ? 193  LEU B N   1 
ATOM   4159 C CA  . LEU B 1 131 ? 43.440 26.374  -35.353 1.00 26.59 ? 193  LEU B CA  1 
ATOM   4160 C C   . LEU B 1 131 ? 43.675 26.956  -33.966 1.00 26.68 ? 193  LEU B C   1 
ATOM   4161 O O   . LEU B 1 131 ? 43.891 26.215  -33.008 1.00 26.51 ? 193  LEU B O   1 
ATOM   4162 C CB  . LEU B 1 131 ? 44.773 26.128  -36.079 1.00 26.35 ? 193  LEU B CB  1 
ATOM   4163 C CG  . LEU B 1 131 ? 44.690 25.253  -37.341 1.00 25.55 ? 193  LEU B CG  1 
ATOM   4164 C CD1 . LEU B 1 131 ? 45.905 25.422  -38.222 1.00 24.29 ? 193  LEU B CD1 1 
ATOM   4165 C CD2 . LEU B 1 131 ? 44.490 23.784  -36.988 1.00 25.19 ? 193  LEU B CD2 1 
ATOM   4166 N N   . GLY B 1 132 ? 43.633 28.283  -33.861 1.00 26.93 ? 194  GLY B N   1 
ATOM   4167 C CA  . GLY B 1 132 ? 43.693 28.954  -32.563 1.00 27.15 ? 194  GLY B CA  1 
ATOM   4168 C C   . GLY B 1 132 ? 42.459 28.657  -31.728 1.00 27.30 ? 194  GLY B C   1 
ATOM   4169 O O   . GLY B 1 132 ? 42.556 28.408  -30.526 1.00 27.21 ? 194  GLY B O   1 
ATOM   4170 N N   . ASN B 1 133 ? 41.296 28.687  -32.372 1.00 27.62 ? 195  ASN B N   1 
ATOM   4171 C CA  . ASN B 1 133 ? 40.055 28.271  -31.727 1.00 27.87 ? 195  ASN B CA  1 
ATOM   4172 C C   . ASN B 1 133 ? 40.149 26.825  -31.239 1.00 28.02 ? 195  ASN B C   1 
ATOM   4173 O O   . ASN B 1 133 ? 39.856 26.541  -30.077 1.00 27.67 ? 195  ASN B O   1 
ATOM   4174 C CB  . ASN B 1 133 ? 38.860 28.425  -32.684 1.00 27.96 ? 195  ASN B CB  1 
ATOM   4175 C CG  . ASN B 1 133 ? 38.337 29.852  -32.754 1.00 28.30 ? 195  ASN B CG  1 
ATOM   4176 O OD1 . ASN B 1 133 ? 38.971 30.783  -32.270 1.00 28.99 ? 195  ASN B OD1 1 
ATOM   4177 N ND2 . ASN B 1 133 ? 37.163 30.022  -33.351 1.00 28.62 ? 195  ASN B ND2 1 
ATOM   4178 N N   . ILE B 1 134 ? 40.578 25.926  -32.127 1.00 28.20 ? 196  ILE B N   1 
ATOM   4179 C CA  . ILE B 1 134 ? 40.659 24.496  -31.803 1.00 28.52 ? 196  ILE B CA  1 
ATOM   4180 C C   . ILE B 1 134 ? 41.674 24.253  -30.685 1.00 28.66 ? 196  ILE B C   1 
ATOM   4181 O O   . ILE B 1 134 ? 41.390 23.531  -29.730 1.00 28.30 ? 196  ILE B O   1 
ATOM   4182 C CB  . ILE B 1 134 ? 41.041 23.631  -33.038 1.00 28.31 ? 196  ILE B CB  1 
ATOM   4183 C CG1 . ILE B 1 134 ? 39.945 23.685  -34.109 1.00 28.46 ? 196  ILE B CG1 1 
ATOM   4184 C CG2 . ILE B 1 134 ? 41.268 22.185  -32.627 1.00 27.97 ? 196  ILE B CG2 1 
ATOM   4185 C CD1 . ILE B 1 134 ? 40.365 23.085  -35.447 1.00 28.46 ? 196  ILE B CD1 1 
ATOM   4186 N N   . ALA B 1 135 ? 42.845 24.871  -30.818 1.00 29.10 ? 197  ALA B N   1 
ATOM   4187 C CA  . ALA B 1 135 ? 43.933 24.742  -29.837 1.00 29.74 ? 197  ALA B CA  1 
ATOM   4188 C C   . ALA B 1 135 ? 43.556 25.293  -28.466 1.00 30.36 ? 197  ALA B C   1 
ATOM   4189 O O   . ALA B 1 135 ? 43.890 24.695  -27.440 1.00 30.71 ? 197  ALA B O   1 
ATOM   4190 C CB  . ALA B 1 135 ? 45.185 25.442  -30.341 1.00 29.35 ? 197  ALA B CB  1 
ATOM   4191 N N   . GLY B 1 136 ? 42.854 26.424  -28.455 1.00 30.90 ? 198  GLY B N   1 
ATOM   4192 C CA  . GLY B 1 136 ? 42.426 27.059  -27.212 1.00 31.21 ? 198  GLY B CA  1 
ATOM   4193 C C   . GLY B 1 136 ? 41.190 26.485  -26.531 1.00 31.54 ? 198  GLY B C   1 
ATOM   4194 O O   . GLY B 1 136 ? 40.671 27.096  -25.598 1.00 31.49 ? 198  GLY B O   1 
ATOM   4195 N N   . ASP B 1 137 ? 40.707 25.321  -26.964 1.00 32.05 ? 199  ASP B N   1 
ATOM   4196 C CA  . ASP B 1 137 ? 39.502 24.751  -26.358 1.00 32.27 ? 199  ASP B CA  1 
ATOM   4197 C C   . ASP B 1 137 ? 39.799 23.970  -25.076 1.00 32.71 ? 199  ASP B C   1 
ATOM   4198 O O   . ASP B 1 137 ? 39.178 24.207  -24.031 1.00 33.02 ? 199  ASP B O   1 
ATOM   4199 C CB  . ASP B 1 137 ? 38.765 23.849  -27.339 1.00 32.19 ? 199  ASP B CB  1 
ATOM   4200 C CG  . ASP B 1 137 ? 37.434 23.375  -26.794 1.00 32.48 ? 199  ASP B CG  1 
ATOM   4201 O OD1 . ASP B 1 137 ? 36.861 24.064  -25.917 1.00 33.88 ? 199  ASP B OD1 1 
ATOM   4202 O OD2 . ASP B 1 137 ? 36.956 22.310  -27.237 1.00 33.38 ? 199  ASP B OD2 1 
ATOM   4203 N N   . SER B 1 138 ? 40.727 23.023  -25.167 1.00 32.93 ? 200  SER B N   1 
ATOM   4204 C CA  . SER B 1 138 ? 41.131 22.229  -24.008 1.00 32.88 ? 200  SER B CA  1 
ATOM   4205 C C   . SER B 1 138 ? 42.614 21.907  -24.087 1.00 32.93 ? 200  SER B C   1 
ATOM   4206 O O   . SER B 1 138 ? 43.268 22.173  -25.093 1.00 32.92 ? 200  SER B O   1 
ATOM   4207 C CB  . SER B 1 138 ? 40.306 20.936  -23.921 1.00 33.03 ? 200  SER B CB  1 
ATOM   4208 O OG  . SER B 1 138 ? 40.718 19.974  -24.884 1.00 33.02 ? 200  SER B OG  1 
ATOM   4209 N N   . THR B 1 139 ? 43.144 21.352  -23.008 1.00 32.97 ? 201  THR B N   1 
ATOM   4210 C CA  . THR B 1 139 ? 44.513 20.865  -23.002 1.00 32.84 ? 201  THR B CA  1 
ATOM   4211 C C   . THR B 1 139 ? 44.651 19.712  -24.005 1.00 32.59 ? 201  THR B C   1 
ATOM   4212 O O   . THR B 1 139 ? 45.654 19.617  -24.707 1.00 32.38 ? 201  THR B O   1 
ATOM   4213 C CB  . THR B 1 139 ? 44.946 20.438  -21.577 1.00 32.98 ? 201  THR B CB  1 
ATOM   4214 O OG1 . THR B 1 139 ? 45.394 21.596  -20.856 1.00 33.51 ? 201  THR B OG1 1 
ATOM   4215 C CG2 . THR B 1 139 ? 46.073 19.423  -21.624 1.00 33.27 ? 201  THR B CG2 1 
ATOM   4216 N N   . MET B 1 140 ? 43.631 18.860  -24.086 1.00 32.42 ? 202  MET B N   1 
ATOM   4217 C CA  . MET B 1 140 ? 43.662 17.696  -24.979 1.00 32.27 ? 202  MET B CA  1 
ATOM   4218 C C   . MET B 1 140 ? 43.659 18.092  -26.466 1.00 31.90 ? 202  MET B C   1 
ATOM   4219 O O   . MET B 1 140 ? 44.341 17.465  -27.284 1.00 31.92 ? 202  MET B O   1 
ATOM   4220 C CB  . MET B 1 140 ? 42.495 16.752  -24.672 1.00 32.63 ? 202  MET B CB  1 
ATOM   4221 C CG  . MET B 1 140 ? 42.475 16.223  -23.230 1.00 33.95 ? 202  MET B CG  1 
ATOM   4222 S SD  . MET B 1 140 ? 41.487 17.227  -22.069 1.00 37.02 ? 202  MET B SD  1 
ATOM   4223 C CE  . MET B 1 140 ? 39.886 16.402  -22.178 1.00 36.79 ? 202  MET B CE  1 
ATOM   4224 N N   . CYS B 1 141 ? 42.896 19.132  -26.804 1.00 31.34 ? 203  CYS B N   1 
ATOM   4225 C CA  . CYS B 1 141 ? 42.865 19.677  -28.169 1.00 30.98 ? 203  CYS B CA  1 
ATOM   4226 C C   . CYS B 1 141 ? 44.158 20.391  -28.551 1.00 30.39 ? 203  CYS B C   1 
ATOM   4227 O O   . CYS B 1 141 ? 44.607 20.302  -29.692 1.00 30.42 ? 203  CYS B O   1 
ATOM   4228 C CB  . CYS B 1 141 ? 41.708 20.664  -28.328 1.00 31.04 ? 203  CYS B CB  1 
ATOM   4229 S SG  . CYS B 1 141 ? 40.077 19.913  -28.280 1.00 31.78 ? 203  CYS B SG  1 
ATOM   4230 N N   . ARG B 1 142 ? 44.730 21.115  -27.596 1.00 29.76 ? 204  ARG B N   1 
ATOM   4231 C CA  . ARG B 1 142 ? 45.974 21.853  -27.797 1.00 29.42 ? 204  ARG B CA  1 
ATOM   4232 C C   . ARG B 1 142 ? 47.097 20.916  -28.217 1.00 28.67 ? 204  ARG B C   1 
ATOM   4233 O O   . ARG B 1 142 ? 47.809 21.194  -29.181 1.00 28.35 ? 204  ARG B O   1 
ATOM   4234 C CB  . ARG B 1 142 ? 46.349 22.572  -26.496 1.00 29.56 ? 204  ARG B CB  1 
ATOM   4235 C CG  . ARG B 1 142 ? 47.669 23.341  -26.491 1.00 29.63 ? 204  ARG B CG  1 
ATOM   4236 C CD  . ARG B 1 142 ? 48.129 23.561  -25.058 1.00 30.44 ? 204  ARG B CD  1 
ATOM   4237 N NE  . ARG B 1 142 ? 48.423 22.288  -24.385 1.00 31.75 ? 204  ARG B NE  1 
ATOM   4238 C CZ  . ARG B 1 142 ? 48.415 22.088  -23.061 1.00 32.62 ? 204  ARG B CZ  1 
ATOM   4239 N NH1 . ARG B 1 142 ? 48.119 23.069  -22.213 1.00 32.19 ? 204  ARG B NH1 1 
ATOM   4240 N NH2 . ARG B 1 142 ? 48.697 20.882  -22.579 1.00 32.83 ? 204  ARG B NH2 1 
ATOM   4241 N N   . ASP B 1 143 ? 47.242 19.812  -27.485 1.00 28.14 ? 205  ASP B N   1 
ATOM   4242 C CA  . ASP B 1 143 ? 48.308 18.839  -27.735 1.00 28.00 ? 205  ASP B CA  1 
ATOM   4243 C C   . ASP B 1 143 ? 48.078 18.046  -29.018 1.00 27.64 ? 205  ASP B C   1 
ATOM   4244 O O   . ASP B 1 143 ? 49.036 17.563  -29.610 1.00 27.44 ? 205  ASP B O   1 
ATOM   4245 C CB  . ASP B 1 143 ? 48.471 17.876  -26.546 1.00 27.83 ? 205  ASP B CB  1 
ATOM   4246 C CG  . ASP B 1 143 ? 49.181 18.521  -25.332 1.00 28.59 ? 205  ASP B CG  1 
ATOM   4247 O OD1 . ASP B 1 143 ? 50.029 19.429  -25.503 1.00 27.26 ? 205  ASP B OD1 1 
ATOM   4248 O OD2 . ASP B 1 143 ? 48.895 18.091  -24.191 1.00 29.96 ? 205  ASP B OD2 1 
ATOM   4249 N N   . TYR B 1 144 ? 46.815 17.904  -29.428 1.00 27.34 ? 206  TYR B N   1 
ATOM   4250 C CA  . TYR B 1 144 ? 46.466 17.257  -30.700 1.00 27.28 ? 206  TYR B CA  1 
ATOM   4251 C C   . TYR B 1 144 ? 46.894 18.126  -31.890 1.00 26.96 ? 206  TYR B C   1 
ATOM   4252 O O   . TYR B 1 144 ? 47.535 17.638  -32.816 1.00 27.07 ? 206  TYR B O   1 
ATOM   4253 C CB  . TYR B 1 144 ? 44.963 16.934  -30.747 1.00 27.16 ? 206  TYR B CB  1 
ATOM   4254 C CG  . TYR B 1 144 ? 44.417 16.503  -32.109 1.00 27.34 ? 206  TYR B CG  1 
ATOM   4255 C CD1 . TYR B 1 144 ? 44.883 15.353  -32.746 1.00 27.50 ? 206  TYR B CD1 1 
ATOM   4256 C CD2 . TYR B 1 144 ? 43.405 17.234  -32.741 1.00 27.32 ? 206  TYR B CD2 1 
ATOM   4257 C CE1 . TYR B 1 144 ? 44.373 14.958  -33.987 1.00 27.13 ? 206  TYR B CE1 1 
ATOM   4258 C CE2 . TYR B 1 144 ? 42.890 16.846  -33.976 1.00 26.96 ? 206  TYR B CE2 1 
ATOM   4259 C CZ  . TYR B 1 144 ? 43.376 15.709  -34.596 1.00 27.07 ? 206  TYR B CZ  1 
ATOM   4260 O OH  . TYR B 1 144 ? 42.858 15.324  -35.824 1.00 27.10 ? 206  TYR B OH  1 
ATOM   4261 N N   . VAL B 1 145 ? 46.549 19.409  -31.858 1.00 26.81 ? 207  VAL B N   1 
ATOM   4262 C CA  . VAL B 1 145 ? 47.034 20.361  -32.864 1.00 26.85 ? 207  VAL B CA  1 
ATOM   4263 C C   . VAL B 1 145 ? 48.569 20.407  -32.890 1.00 26.78 ? 207  VAL B C   1 
ATOM   4264 O O   . VAL B 1 145 ? 49.168 20.523  -33.952 1.00 26.45 ? 207  VAL B O   1 
ATOM   4265 C CB  . VAL B 1 145 ? 46.471 21.795  -32.632 1.00 26.87 ? 207  VAL B CB  1 
ATOM   4266 C CG1 . VAL B 1 145 ? 47.143 22.809  -33.564 1.00 26.02 ? 207  VAL B CG1 1 
ATOM   4267 C CG2 . VAL B 1 145 ? 44.958 21.810  -32.832 1.00 26.49 ? 207  VAL B CG2 1 
ATOM   4268 N N   . LEU B 1 146 ? 49.198 20.310  -31.720 1.00 26.88 ? 208  LEU B N   1 
ATOM   4269 C CA  . LEU B 1 146 ? 50.663 20.237  -31.651 1.00 27.00 ? 208  LEU B CA  1 
ATOM   4270 C C   . LEU B 1 146 ? 51.218 18.945  -32.266 1.00 27.07 ? 208  LEU B C   1 
ATOM   4271 O O   . LEU B 1 146 ? 52.146 18.994  -33.075 1.00 26.86 ? 208  LEU B O   1 
ATOM   4272 C CB  . LEU B 1 146 ? 51.163 20.395  -30.208 1.00 27.02 ? 208  LEU B CB  1 
ATOM   4273 C CG  . LEU B 1 146 ? 51.236 21.813  -29.631 1.00 26.36 ? 208  LEU B CG  1 
ATOM   4274 C CD1 . LEU B 1 146 ? 51.609 21.737  -28.165 1.00 24.98 ? 208  LEU B CD1 1 
ATOM   4275 C CD2 . LEU B 1 146 ? 52.225 22.679  -30.401 1.00 24.85 ? 208  LEU B CD2 1 
ATOM   4276 N N   . ASP B 1 147 ? 50.639 17.801  -31.895 1.00 27.33 ? 209  ASP B N   1 
ATOM   4277 C CA  . ASP B 1 147 ? 51.063 16.488  -32.430 1.00 27.27 ? 209  ASP B CA  1 
ATOM   4278 C C   . ASP B 1 147 ? 50.853 16.335  -33.948 1.00 27.08 ? 209  ASP B C   1 
ATOM   4279 O O   . ASP B 1 147 ? 51.467 15.467  -34.563 1.00 26.91 ? 209  ASP B O   1 
ATOM   4280 C CB  . ASP B 1 147 ? 50.364 15.332  -31.691 1.00 27.67 ? 209  ASP B CB  1 
ATOM   4281 C CG  . ASP B 1 147 ? 50.837 15.168  -30.237 1.00 28.86 ? 209  ASP B CG  1 
ATOM   4282 O OD1 . ASP B 1 147 ? 51.879 15.741  -29.848 1.00 30.66 ? 209  ASP B OD1 1 
ATOM   4283 O OD2 . ASP B 1 147 ? 50.155 14.456  -29.470 1.00 30.69 ? 209  ASP B OD2 1 
ATOM   4284 N N   . CYS B 1 148 ? 49.998 17.175  -34.540 1.00 26.85 ? 210  CYS B N   1 
ATOM   4285 C CA  . CYS B 1 148 ? 49.841 17.258  -35.999 1.00 26.70 ? 210  CYS B CA  1 
ATOM   4286 C C   . CYS B 1 148 ? 50.876 18.147  -36.698 1.00 26.41 ? 210  CYS B C   1 
ATOM   4287 O O   . CYS B 1 148 ? 50.779 18.368  -37.901 1.00 26.26 ? 210  CYS B O   1 
ATOM   4288 C CB  . CYS B 1 148 ? 48.446 17.777  -36.348 1.00 26.85 ? 210  CYS B CB  1 
ATOM   4289 S SG  . CYS B 1 148 ? 47.120 16.728  -35.772 1.00 28.03 ? 210  CYS B SG  1 
ATOM   4290 N N   . ASN B 1 149 ? 51.852 18.662  -35.952 1.00 26.19 ? 211  ASN B N   1 
ATOM   4291 C CA  . ASN B 1 149 ? 52.960 19.449  -36.514 1.00 26.06 ? 211  ASN B CA  1 
ATOM   4292 C C   . ASN B 1 149 ? 52.536 20.797  -37.100 1.00 25.64 ? 211  ASN B C   1 
ATOM   4293 O O   . ASN B 1 149 ? 52.978 21.192  -38.177 1.00 25.59 ? 211  ASN B O   1 
ATOM   4294 C CB  . ASN B 1 149 ? 53.749 18.628  -37.537 1.00 26.33 ? 211  ASN B CB  1 
ATOM   4295 C CG  . ASN B 1 149 ? 54.158 17.284  -36.991 1.00 27.30 ? 211  ASN B CG  1 
ATOM   4296 O OD1 . ASN B 1 149 ? 53.781 16.235  -37.527 1.00 30.22 ? 211  ASN B OD1 1 
ATOM   4297 N ND2 . ASN B 1 149 ? 54.912 17.301  -35.899 1.00 27.59 ? 211  ASN B ND2 1 
ATOM   4298 N N   . ILE B 1 150 ? 51.691 21.503  -36.358 1.00 25.38 ? 212  ILE B N   1 
ATOM   4299 C CA  . ILE B 1 150 ? 51.310 22.870  -36.695 1.00 25.10 ? 212  ILE B CA  1 
ATOM   4300 C C   . ILE B 1 150 ? 52.493 23.837  -36.646 1.00 25.12 ? 212  ILE B C   1 
ATOM   4301 O O   . ILE B 1 150 ? 52.547 24.776  -37.436 1.00 25.40 ? 212  ILE B O   1 
ATOM   4302 C CB  . ILE B 1 150 ? 50.226 23.400  -35.740 1.00 24.86 ? 212  ILE B CB  1 
ATOM   4303 C CG1 . ILE B 1 150 ? 49.750 24.789  -36.185 1.00 24.64 ? 212  ILE B CG1 1 
ATOM   4304 C CG2 . ILE B 1 150 ? 50.747 23.427  -34.301 1.00 24.58 ? 212  ILE B CG2 1 
ATOM   4305 C CD1 . ILE B 1 150 ? 48.428 25.213  -35.557 1.00 24.70 ? 212  ILE B CD1 1 
ATOM   4306 N N   . LEU B 1 151 ? 53.440 23.610  -35.739 1.00 24.79 ? 213  LEU B N   1 
ATOM   4307 C CA  . LEU B 1 151 ? 54.439 24.645  -35.431 1.00 24.93 ? 213  LEU B CA  1 
ATOM   4308 C C   . LEU B 1 151 ? 55.328 25.064  -36.619 1.00 24.87 ? 213  LEU B C   1 
ATOM   4309 O O   . LEU B 1 151 ? 55.392 26.250  -36.918 1.00 24.95 ? 213  LEU B O   1 
ATOM   4310 C CB  . LEU B 1 151 ? 55.290 24.268  -34.199 1.00 24.96 ? 213  LEU B CB  1 
ATOM   4311 C CG  . LEU B 1 151 ? 56.073 25.402  -33.524 1.00 24.59 ? 213  LEU B CG  1 
ATOM   4312 C CD1 . LEU B 1 151 ? 55.145 26.539  -33.171 1.00 23.76 ? 213  LEU B CD1 1 
ATOM   4313 C CD2 . LEU B 1 151 ? 56.790 24.894  -32.281 1.00 24.44 ? 213  LEU B CD2 1 
ATOM   4314 N N   . PRO B 1 152 ? 56.018 24.118  -37.286 1.00 24.70 ? 214  PRO B N   1 
ATOM   4315 C CA  . PRO B 1 152 ? 56.844 24.543  -38.431 1.00 25.00 ? 214  PRO B CA  1 
ATOM   4316 C C   . PRO B 1 152 ? 56.165 25.467  -39.477 1.00 25.00 ? 214  PRO B C   1 
ATOM   4317 O O   . PRO B 1 152 ? 56.677 26.558  -39.715 1.00 25.15 ? 214  PRO B O   1 
ATOM   4318 C CB  . PRO B 1 152 ? 57.335 23.219  -39.032 1.00 24.95 ? 214  PRO B CB  1 
ATOM   4319 C CG  . PRO B 1 152 ? 57.318 22.264  -37.875 1.00 24.84 ? 214  PRO B CG  1 
ATOM   4320 C CD  . PRO B 1 152 ? 56.146 22.673  -37.031 1.00 24.91 ? 214  PRO B CD  1 
ATOM   4321 N N   . PRO B 1 153 ? 55.041 25.052  -40.097 1.00 25.09 ? 215  PRO B N   1 
ATOM   4322 C CA  . PRO B 1 153 ? 54.401 26.006  -41.021 1.00 25.16 ? 215  PRO B CA  1 
ATOM   4323 C C   . PRO B 1 153 ? 53.871 27.281  -40.347 1.00 25.38 ? 215  PRO B C   1 
ATOM   4324 O O   . PRO B 1 153 ? 53.848 28.341  -40.965 1.00 25.31 ? 215  PRO B O   1 
ATOM   4325 C CB  . PRO B 1 153 ? 53.245 25.197  -41.626 1.00 25.04 ? 215  PRO B CB  1 
ATOM   4326 C CG  . PRO B 1 153 ? 52.996 24.084  -40.686 1.00 24.82 ? 215  PRO B CG  1 
ATOM   4327 C CD  . PRO B 1 153 ? 54.320 23.765  -40.059 1.00 25.19 ? 215  PRO B CD  1 
ATOM   4328 N N   . LEU B 1 154 ? 53.442 27.176  -39.096 1.00 25.61 ? 216  LEU B N   1 
ATOM   4329 C CA  . LEU B 1 154 ? 52.952 28.340  -38.355 1.00 25.87 ? 216  LEU B CA  1 
ATOM   4330 C C   . LEU B 1 154 ? 54.067 29.381  -38.173 1.00 25.87 ? 216  LEU B C   1 
ATOM   4331 O O   . LEU B 1 154 ? 53.839 30.574  -38.384 1.00 25.05 ? 216  LEU B O   1 
ATOM   4332 C CB  . LEU B 1 154 ? 52.371 27.910  -37.004 1.00 25.53 ? 216  LEU B CB  1 
ATOM   4333 C CG  . LEU B 1 154 ? 51.888 29.017  -36.068 1.00 25.98 ? 216  LEU B CG  1 
ATOM   4334 C CD1 . LEU B 1 154 ? 50.989 29.967  -36.828 1.00 26.60 ? 216  LEU B CD1 1 
ATOM   4335 C CD2 . LEU B 1 154 ? 51.175 28.436  -34.845 1.00 25.76 ? 216  LEU B CD2 1 
ATOM   4336 N N   . LEU B 1 155 ? 55.267 28.915  -37.820 1.00 26.53 ? 217  LEU B N   1 
ATOM   4337 C CA  . LEU B 1 155 ? 56.430 29.795  -37.621 1.00 27.76 ? 217  LEU B CA  1 
ATOM   4338 C C   . LEU B 1 155 ? 56.972 30.382  -38.916 1.00 28.63 ? 217  LEU B C   1 
ATOM   4339 O O   . LEU B 1 155 ? 57.656 31.398  -38.900 1.00 28.81 ? 217  LEU B O   1 
ATOM   4340 C CB  . LEU B 1 155 ? 57.563 29.059  -36.894 1.00 27.32 ? 217  LEU B CB  1 
ATOM   4341 C CG  . LEU B 1 155 ? 57.290 28.590  -35.455 1.00 27.01 ? 217  LEU B CG  1 
ATOM   4342 C CD1 . LEU B 1 155 ? 58.552 27.952  -34.853 1.00 26.18 ? 217  LEU B CD1 1 
ATOM   4343 C CD2 . LEU B 1 155 ? 56.763 29.726  -34.575 1.00 24.66 ? 217  LEU B CD2 1 
ATOM   4344 N N   . GLN B 1 156 ? 56.682 29.731  -40.039 1.00 30.49 ? 218  GLN B N   1 
ATOM   4345 C CA  . GLN B 1 156 ? 57.103 30.238  -41.349 1.00 30.95 ? 218  GLN B CA  1 
ATOM   4346 C C   . GLN B 1 156 ? 56.312 31.485  -41.755 1.00 31.71 ? 218  GLN B C   1 
ATOM   4347 O O   . GLN B 1 156 ? 56.798 32.298  -42.542 1.00 32.04 ? 218  GLN B O   1 
ATOM   4348 C CB  . GLN B 1 156 ? 56.966 29.158  -42.412 1.00 31.14 ? 218  GLN B CB  1 
ATOM   4349 C CG  . GLN B 1 156 ? 57.953 29.317  -43.563 1.00 32.01 ? 218  GLN B CG  1 
ATOM   4350 C CD  . GLN B 1 156 ? 59.393 29.017  -43.169 1.00 33.77 ? 218  GLN B CD  1 
ATOM   4351 O OE1 . GLN B 1 156 ? 59.662 28.401  -42.133 1.00 33.94 ? 218  GLN B OE1 1 
ATOM   4352 N NE2 . GLN B 1 156 ? 60.327 29.445  -44.011 1.00 35.11 ? 218  GLN B NE2 1 
ATOM   4353 N N   . LEU B 1 157 ? 55.111 31.645  -41.200 1.00 32.40 ? 219  LEU B N   1 
ATOM   4354 C CA  . LEU B 1 157 ? 54.284 32.821  -41.467 1.00 33.06 ? 219  LEU B CA  1 
ATOM   4355 C C   . LEU B 1 157 ? 54.974 34.116  -41.043 1.00 33.79 ? 219  LEU B C   1 
ATOM   4356 O O   . LEU B 1 157 ? 54.837 35.139  -41.718 1.00 34.20 ? 219  LEU B O   1 
ATOM   4357 C CB  . LEU B 1 157 ? 52.915 32.697  -40.782 1.00 32.96 ? 219  LEU B CB  1 
ATOM   4358 C CG  . LEU B 1 157 ? 52.027 31.540  -41.260 1.00 32.49 ? 219  LEU B CG  1 
ATOM   4359 C CD1 . LEU B 1 157 ? 50.814 31.388  -40.359 1.00 31.90 ? 219  LEU B CD1 1 
ATOM   4360 C CD2 . LEU B 1 157 ? 51.616 31.746  -42.706 1.00 31.98 ? 219  LEU B CD2 1 
ATOM   4361 N N   . PHE B 1 158 ? 55.718 34.068  -39.937 1.00 34.73 ? 220  PHE B N   1 
ATOM   4362 C CA  . PHE B 1 158 ? 56.515 35.218  -39.474 1.00 35.30 ? 220  PHE B CA  1 
ATOM   4363 C C   . PHE B 1 158 ? 57.765 35.417  -40.319 1.00 36.44 ? 220  PHE B C   1 
ATOM   4364 O O   . PHE B 1 158 ? 58.309 36.526  -40.378 1.00 36.56 ? 220  PHE B O   1 
ATOM   4365 C CB  . PHE B 1 158 ? 56.949 35.049  -38.015 1.00 34.35 ? 220  PHE B CB  1 
ATOM   4366 C CG  . PHE B 1 158 ? 55.820 34.854  -37.077 1.00 33.36 ? 220  PHE B CG  1 
ATOM   4367 C CD1 . PHE B 1 158 ? 55.585 33.615  -36.507 1.00 32.69 ? 220  PHE B CD1 1 
ATOM   4368 C CD2 . PHE B 1 158 ? 54.972 35.899  -36.778 1.00 32.16 ? 220  PHE B CD2 1 
ATOM   4369 C CE1 . PHE B 1 158 ? 54.531 33.429  -35.629 1.00 33.22 ? 220  PHE B CE1 1 
ATOM   4370 C CE2 . PHE B 1 158 ? 53.917 35.716  -35.905 1.00 32.40 ? 220  PHE B CE2 1 
ATOM   4371 C CZ  . PHE B 1 158 ? 53.698 34.479  -35.331 1.00 32.55 ? 220  PHE B CZ  1 
ATOM   4372 N N   . SER B 1 159 ? 58.220 34.338  -40.957 1.00 37.88 ? 221  SER B N   1 
ATOM   4373 C CA  . SER B 1 159 ? 59.436 34.354  -41.772 1.00 38.76 ? 221  SER B CA  1 
ATOM   4374 C C   . SER B 1 159 ? 59.170 34.896  -43.182 1.00 39.67 ? 221  SER B C   1 
ATOM   4375 O O   . SER B 1 159 ? 59.592 34.300  -44.175 1.00 40.04 ? 221  SER B O   1 
ATOM   4376 C CB  . SER B 1 159 ? 60.069 32.947  -41.825 1.00 39.10 ? 221  SER B CB  1 
ATOM   4377 O OG  . SER B 1 159 ? 60.308 32.428  -40.511 1.00 39.40 ? 221  SER B OG  1 
ATOM   4378 N N   . LYS B 1 160 ? 58.437 36.008  -43.244 1.00 40.45 ? 222  LYS B N   1 
ATOM   4379 C CA  . LYS B 1 160 ? 58.359 36.867  -44.423 1.00 40.97 ? 222  LYS B CA  1 
ATOM   4380 C C   . LYS B 1 160 ? 57.533 38.111  -44.097 1.00 41.27 ? 222  LYS B C   1 
ATOM   4381 O O   . LYS B 1 160 ? 56.852 38.172  -43.070 1.00 40.90 ? 222  LYS B O   1 
ATOM   4382 C CB  . LYS B 1 160 ? 57.780 36.148  -45.653 1.00 41.42 ? 222  LYS B CB  1 
ATOM   4383 C CG  . LYS B 1 160 ? 56.529 35.316  -45.400 1.00 42.02 ? 222  LYS B CG  1 
ATOM   4384 C CD  . LYS B 1 160 ? 55.784 35.025  -46.716 1.00 41.81 ? 222  LYS B CD  1 
ATOM   4385 C CE  . LYS B 1 160 ? 54.564 34.122  -46.493 1.00 42.27 ? 222  LYS B CE  1 
ATOM   4386 N NZ  . LYS B 1 160 ? 53.598 34.188  -47.624 1.00 42.27 ? 222  LYS B NZ  1 
ATOM   4387 N N   . GLN B 1 161 ? 57.609 39.093  -44.993 1.00 41.79 ? 223  GLN B N   1 
ATOM   4388 C CA  . GLN B 1 161 ? 56.924 40.379  -44.833 1.00 41.92 ? 223  GLN B CA  1 
ATOM   4389 C C   . GLN B 1 161 ? 55.420 40.220  -45.119 1.00 41.84 ? 223  GLN B C   1 
ATOM   4390 O O   . GLN B 1 161 ? 54.976 40.375  -46.260 1.00 41.55 ? 223  GLN B O   1 
ATOM   4391 C CB  . GLN B 1 161 ? 57.575 41.433  -45.755 1.00 42.24 ? 223  GLN B CB  1 
ATOM   4392 C CG  . GLN B 1 161 ? 59.069 41.723  -45.407 1.00 42.78 ? 223  GLN B CG  1 
ATOM   4393 C CD  . GLN B 1 161 ? 59.806 42.615  -46.429 1.00 42.86 ? 223  GLN B CD  1 
ATOM   4394 O OE1 . GLN B 1 161 ? 60.767 43.311  -46.074 1.00 43.91 ? 223  GLN B OE1 1 
ATOM   4395 N NE2 . GLN B 1 161 ? 59.368 42.587  -47.688 1.00 42.89 ? 223  GLN B NE2 1 
ATOM   4396 N N   . ASN B 1 162 ? 54.655 39.902  -44.063 1.00 41.65 ? 224  ASN B N   1 
ATOM   4397 C CA  . ASN B 1 162 ? 53.215 39.576  -44.171 1.00 41.18 ? 224  ASN B CA  1 
ATOM   4398 C C   . ASN B 1 162 ? 52.315 40.670  -43.614 1.00 40.57 ? 224  ASN B C   1 
ATOM   4399 O O   . ASN B 1 162 ? 52.769 41.541  -42.870 1.00 40.81 ? 224  ASN B O   1 
ATOM   4400 C CB  . ASN B 1 162 ? 52.906 38.252  -43.451 1.00 41.37 ? 224  ASN B CB  1 
ATOM   4401 C CG  . ASN B 1 162 ? 53.378 37.035  -44.232 1.00 42.10 ? 224  ASN B CG  1 
ATOM   4402 O OD1 . ASN B 1 162 ? 53.926 37.161  -45.332 1.00 43.88 ? 224  ASN B OD1 1 
ATOM   4403 N ND2 . ASN B 1 162 ? 53.168 35.849  -43.669 1.00 41.80 ? 224  ASN B ND2 1 
ATOM   4404 N N   . ARG B 1 163 ? 51.036 40.610  -43.975 1.00 39.72 ? 225  ARG B N   1 
ATOM   4405 C CA  . ARG B 1 163 ? 50.039 41.571  -43.496 1.00 39.13 ? 225  ARG B CA  1 
ATOM   4406 C C   . ARG B 1 163 ? 50.023 41.646  -41.951 1.00 38.10 ? 225  ARG B C   1 
ATOM   4407 O O   . ARG B 1 163 ? 50.394 40.688  -41.272 1.00 38.03 ? 225  ARG B O   1 
ATOM   4408 C CB  . ARG B 1 163 ? 48.650 41.210  -44.065 1.00 39.25 ? 225  ARG B CB  1 
ATOM   4409 C CG  . ARG B 1 163 ? 47.489 41.921  -43.388 1.00 39.85 ? 225  ARG B CG  1 
ATOM   4410 C CD  . ARG B 1 163 ? 46.176 41.852  -44.172 1.00 40.42 ? 225  ARG B CD  1 
ATOM   4411 N NE  . ARG B 1 163 ? 45.150 42.669  -43.503 1.00 41.17 ? 225  ARG B NE  1 
ATOM   4412 C CZ  . ARG B 1 163 ? 44.022 43.113  -44.066 1.00 42.05 ? 225  ARG B CZ  1 
ATOM   4413 N NH1 . ARG B 1 163 ? 43.727 42.846  -45.343 1.00 41.70 ? 225  ARG B NH1 1 
ATOM   4414 N NH2 . ARG B 1 163 ? 43.179 43.848  -43.338 1.00 42.19 ? 225  ARG B NH2 1 
ATOM   4415 N N   . LEU B 1 164 ? 49.608 42.788  -41.406 1.00 36.83 ? 226  LEU B N   1 
ATOM   4416 C CA  . LEU B 1 164 ? 49.583 42.990  -39.956 1.00 36.13 ? 226  LEU B CA  1 
ATOM   4417 C C   . LEU B 1 164 ? 48.536 42.137  -39.234 1.00 35.24 ? 226  LEU B C   1 
ATOM   4418 O O   . LEU B 1 164 ? 48.811 41.609  -38.157 1.00 35.43 ? 226  LEU B O   1 
ATOM   4419 C CB  . LEU B 1 164 ? 49.362 44.470  -39.622 1.00 36.19 ? 226  LEU B CB  1 
ATOM   4420 C CG  . LEU B 1 164 ? 49.534 44.890  -38.159 1.00 36.07 ? 226  LEU B CG  1 
ATOM   4421 C CD1 . LEU B 1 164 ? 50.964 44.674  -37.690 1.00 34.67 ? 226  LEU B CD1 1 
ATOM   4422 C CD2 . LEU B 1 164 ? 49.129 46.344  -37.991 1.00 35.94 ? 226  LEU B CD2 1 
ATOM   4423 N N   . THR B 1 165 ? 47.342 42.013  -39.806 1.00 34.20 ? 227  THR B N   1 
ATOM   4424 C CA  . THR B 1 165 ? 46.304 41.133  -39.241 1.00 33.56 ? 227  THR B CA  1 
ATOM   4425 C C   . THR B 1 165 ? 46.729 39.650  -39.229 1.00 32.86 ? 227  THR B C   1 
ATOM   4426 O O   . THR B 1 165 ? 46.227 38.859  -38.425 1.00 32.66 ? 227  THR B O   1 
ATOM   4427 C CB  . THR B 1 165 ? 44.930 41.289  -39.966 1.00 33.50 ? 227  THR B CB  1 
ATOM   4428 O OG1 . THR B 1 165 ? 45.068 40.999  -41.361 1.00 32.98 ? 227  THR B OG1 1 
ATOM   4429 C CG2 . THR B 1 165 ? 44.379 42.701  -39.800 1.00 33.56 ? 227  THR B CG2 1 
ATOM   4430 N N   . MET B 1 166 ? 47.654 39.283  -40.115 1.00 32.14 ? 228  MET B N   1 
ATOM   4431 C CA  . MET B 1 166 ? 48.214 37.932  -40.142 1.00 31.51 ? 228  MET B CA  1 
ATOM   4432 C C   . MET B 1 166 ? 49.179 37.697  -38.983 1.00 30.67 ? 228  MET B C   1 
ATOM   4433 O O   . MET B 1 166 ? 49.157 36.648  -38.339 1.00 30.35 ? 228  MET B O   1 
ATOM   4434 C CB  . MET B 1 166 ? 48.937 37.689  -41.466 1.00 31.73 ? 228  MET B CB  1 
ATOM   4435 C CG  . MET B 1 166 ? 49.875 36.498  -41.451 1.00 32.54 ? 228  MET B CG  1 
ATOM   4436 S SD  . MET B 1 166 ? 48.983 34.948  -41.314 1.00 34.50 ? 228  MET B SD  1 
ATOM   4437 C CE  . MET B 1 166 ? 48.405 34.813  -43.002 1.00 32.47 ? 228  MET B CE  1 
ATOM   4438 N N   . THR B 1 167 ? 50.051 38.671  -38.756 1.00 29.69 ? 229  THR B N   1 
ATOM   4439 C CA  . THR B 1 167 ? 51.002 38.618  -37.658 1.00 29.23 ? 229  THR B CA  1 
ATOM   4440 C C   . THR B 1 167 ? 50.263 38.530  -36.326 1.00 28.41 ? 229  THR B C   1 
ATOM   4441 O O   . THR B 1 167 ? 50.664 37.768  -35.444 1.00 27.84 ? 229  THR B O   1 
ATOM   4442 C CB  . THR B 1 167 ? 51.942 39.848  -37.687 1.00 29.28 ? 229  THR B CB  1 
ATOM   4443 O OG1 . THR B 1 167 ? 52.468 40.015  -39.017 1.00 29.00 ? 229  THR B OG1 1 
ATOM   4444 C CG2 . THR B 1 167 ? 53.081 39.677  -36.709 1.00 29.37 ? 229  THR B CG2 1 
ATOM   4445 N N   . ARG B 1 168 ? 49.171 39.287  -36.202 1.00 27.73 ? 230  ARG B N   1 
ATOM   4446 C CA  . ARG B 1 168 ? 48.349 39.281  -34.991 1.00 27.47 ? 230  ARG B CA  1 
ATOM   4447 C C   . ARG B 1 168 ? 47.705 37.913  -34.786 1.00 26.93 ? 230  ARG B C   1 
ATOM   4448 O O   . ARG B 1 168 ? 47.727 37.358  -33.692 1.00 26.57 ? 230  ARG B O   1 
ATOM   4449 C CB  . ARG B 1 168 ? 47.251 40.348  -35.066 1.00 27.45 ? 230  ARG B CB  1 
ATOM   4450 C CG  . ARG B 1 168 ? 47.722 41.807  -34.958 1.00 27.25 ? 230  ARG B CG  1 
ATOM   4451 C CD  . ARG B 1 168 ? 46.613 42.710  -35.466 1.00 27.78 ? 230  ARG B CD  1 
ATOM   4452 N NE  . ARG B 1 168 ? 46.819 44.140  -35.250 1.00 27.68 ? 230  ARG B NE  1 
ATOM   4453 C CZ  . ARG B 1 168 ? 45.984 45.083  -35.684 1.00 27.30 ? 230  ARG B CZ  1 
ATOM   4454 N NH1 . ARG B 1 168 ? 44.875 44.767  -36.355 1.00 27.10 ? 230  ARG B NH1 1 
ATOM   4455 N NH2 . ARG B 1 168 ? 46.250 46.356  -35.436 1.00 27.89 ? 230  ARG B NH2 1 
ATOM   4456 N N   . ASN B 1 169 ? 47.128 37.378  -35.853 1.00 26.73 ? 231  ASN B N   1 
ATOM   4457 C CA  . ASN B 1 169 ? 46.469 36.073  -35.807 1.00 26.54 ? 231  ASN B CA  1 
ATOM   4458 C C   . ASN B 1 169 ? 47.434 34.942  -35.462 1.00 26.40 ? 231  ASN B C   1 
ATOM   4459 O O   . ASN B 1 169 ? 47.107 34.066  -34.656 1.00 26.44 ? 231  ASN B O   1 
ATOM   4460 C CB  . ASN B 1 169 ? 45.763 35.775  -37.141 1.00 26.88 ? 231  ASN B CB  1 
ATOM   4461 C CG  . ASN B 1 169 ? 44.352 36.351  -37.203 1.00 27.45 ? 231  ASN B CG  1 
ATOM   4462 O OD1 . ASN B 1 169 ? 43.576 36.203  -36.259 1.00 28.13 ? 231  ASN B OD1 1 
ATOM   4463 N ND2 . ASN B 1 169 ? 44.007 36.986  -38.327 1.00 28.01 ? 231  ASN B ND2 1 
ATOM   4464 N N   . ALA B 1 170 ? 48.628 34.981  -36.058 1.00 25.88 ? 232  ALA B N   1 
ATOM   4465 C CA  . ALA B 1 170 ? 49.618 33.919  -35.885 1.00 25.18 ? 232  ALA B CA  1 
ATOM   4466 C C   . ALA B 1 170 ? 50.198 33.880  -34.472 1.00 24.53 ? 232  ALA B C   1 
ATOM   4467 O O   . ALA B 1 170 ? 50.437 32.797  -33.945 1.00 24.09 ? 232  ALA B O   1 
ATOM   4468 C CB  . ALA B 1 170 ? 50.733 34.041  -36.939 1.00 24.86 ? 232  ALA B CB  1 
ATOM   4469 N N   . VAL B 1 171 ? 50.414 35.044  -33.853 1.00 24.42 ? 233  VAL B N   1 
ATOM   4470 C CA  . VAL B 1 171 ? 50.901 35.081  -32.454 1.00 24.29 ? 233  VAL B CA  1 
ATOM   4471 C C   . VAL B 1 171 ? 49.796 34.691  -31.462 1.00 23.72 ? 233  VAL B C   1 
ATOM   4472 O O   . VAL B 1 171 ? 50.057 34.022  -30.469 1.00 22.87 ? 233  VAL B O   1 
ATOM   4473 C CB  . VAL B 1 171 ? 51.503 36.455  -31.998 1.00 24.14 ? 233  VAL B CB  1 
ATOM   4474 C CG1 . VAL B 1 171 ? 52.492 36.212  -30.877 1.00 23.76 ? 233  VAL B CG1 1 
ATOM   4475 C CG2 . VAL B 1 171 ? 52.206 37.174  -33.105 1.00 24.93 ? 233  VAL B CG2 1 
ATOM   4476 N N   . TRP B 1 172 ? 48.571 35.117  -31.736 1.00 23.80 ? 234  TRP B N   1 
ATOM   4477 C CA  . TRP B 1 172 ? 47.433 34.734  -30.915 1.00 24.12 ? 234  TRP B CA  1 
ATOM   4478 C C   . TRP B 1 172 ? 47.299 33.222  -30.908 1.00 24.22 ? 234  TRP B C   1 
ATOM   4479 O O   . TRP B 1 172 ? 47.126 32.616  -29.856 1.00 23.98 ? 234  TRP B O   1 
ATOM   4480 C CB  . TRP B 1 172 ? 46.130 35.381  -31.409 1.00 23.88 ? 234  TRP B CB  1 
ATOM   4481 C CG  . TRP B 1 172 ? 44.934 34.814  -30.705 1.00 24.22 ? 234  TRP B CG  1 
ATOM   4482 C CD1 . TRP B 1 172 ? 44.583 35.011  -29.401 1.00 24.52 ? 234  TRP B CD1 1 
ATOM   4483 C CD2 . TRP B 1 172 ? 43.958 33.920  -31.250 1.00 24.13 ? 234  TRP B CD2 1 
ATOM   4484 N NE1 . TRP B 1 172 ? 43.442 34.313  -29.107 1.00 24.43 ? 234  TRP B NE1 1 
ATOM   4485 C CE2 . TRP B 1 172 ? 43.040 33.630  -30.223 1.00 24.41 ? 234  TRP B CE2 1 
ATOM   4486 C CE3 . TRP B 1 172 ? 43.764 33.344  -32.515 1.00 24.46 ? 234  TRP B CE3 1 
ATOM   4487 C CZ2 . TRP B 1 172 ? 41.946 32.785  -30.415 1.00 23.91 ? 234  TRP B CZ2 1 
ATOM   4488 C CZ3 . TRP B 1 172 ? 42.674 32.510  -32.705 1.00 24.25 ? 234  TRP B CZ3 1 
ATOM   4489 C CH2 . TRP B 1 172 ? 41.781 32.238  -31.659 1.00 24.33 ? 234  TRP B CH2 1 
ATOM   4490 N N   . ALA B 1 173 ? 47.381 32.620  -32.094 1.00 24.89 ? 235  ALA B N   1 
ATOM   4491 C CA  . ALA B 1 173 ? 47.319 31.165  -32.239 1.00 25.28 ? 235  ALA B CA  1 
ATOM   4492 C C   . ALA B 1 173 ? 48.450 30.505  -31.456 1.00 25.75 ? 235  ALA B C   1 
ATOM   4493 O O   . ALA B 1 173 ? 48.234 29.570  -30.682 1.00 25.71 ? 235  ALA B O   1 
ATOM   4494 C CB  . ALA B 1 173 ? 47.394 30.779  -33.704 1.00 25.30 ? 235  ALA B CB  1 
ATOM   4495 N N   . LEU B 1 174 ? 49.649 31.043  -31.637 1.00 26.37 ? 236  LEU B N   1 
ATOM   4496 C CA  . LEU B 1 174 ? 50.846 30.553  -30.982 1.00 26.36 ? 236  LEU B CA  1 
ATOM   4497 C C   . LEU B 1 174 ? 50.728 30.629  -29.464 1.00 26.82 ? 236  LEU B C   1 
ATOM   4498 O O   . LEU B 1 174 ? 51.283 29.783  -28.745 1.00 26.76 ? 236  LEU B O   1 
ATOM   4499 C CB  . LEU B 1 174 ? 52.036 31.382  -31.468 1.00 26.59 ? 236  LEU B CB  1 
ATOM   4500 C CG  . LEU B 1 174 ? 53.437 30.992  -31.027 1.00 26.94 ? 236  LEU B CG  1 
ATOM   4501 C CD1 . LEU B 1 174 ? 53.718 29.524  -31.347 1.00 27.89 ? 236  LEU B CD1 1 
ATOM   4502 C CD2 . LEU B 1 174 ? 54.444 31.919  -31.709 1.00 26.54 ? 236  LEU B CD2 1 
ATOM   4503 N N   . SER B 1 175 ? 49.998 31.626  -28.965 1.00 26.97 ? 237  SER B N   1 
ATOM   4504 C CA  . SER B 1 175 ? 49.884 31.807  -27.521 1.00 27.14 ? 237  SER B CA  1 
ATOM   4505 C C   . SER B 1 175 ? 48.987 30.738  -26.912 1.00 27.59 ? 237  SER B C   1 
ATOM   4506 O O   . SER B 1 175 ? 49.269 30.233  -25.820 1.00 27.54 ? 237  SER B O   1 
ATOM   4507 C CB  . SER B 1 175 ? 49.400 33.220  -27.167 1.00 27.26 ? 237  SER B CB  1 
ATOM   4508 O OG  . SER B 1 175 ? 48.068 33.449  -27.555 1.00 26.60 ? 237  SER B OG  1 
ATOM   4509 N N   . ASN B 1 176 ? 47.924 30.384  -27.634 1.00 27.84 ? 238  ASN B N   1 
ATOM   4510 C CA  . ASN B 1 176 ? 47.086 29.245  -27.277 1.00 28.01 ? 238  ASN B CA  1 
ATOM   4511 C C   . ASN B 1 176 ? 47.830 27.904  -27.322 1.00 28.00 ? 238  ASN B C   1 
ATOM   4512 O O   . ASN B 1 176 ? 47.438 26.966  -26.632 1.00 28.05 ? 238  ASN B O   1 
ATOM   4513 C CB  . ASN B 1 176 ? 45.839 29.183  -28.171 1.00 27.88 ? 238  ASN B CB  1 
ATOM   4514 C CG  . ASN B 1 176 ? 44.745 30.166  -27.742 1.00 28.64 ? 238  ASN B CG  1 
ATOM   4515 O OD1 . ASN B 1 176 ? 44.809 30.766  -26.662 1.00 30.96 ? 238  ASN B OD1 1 
ATOM   4516 N ND2 . ASN B 1 176 ? 43.723 30.320  -28.586 1.00 28.31 ? 238  ASN B ND2 1 
ATOM   4517 N N   . LEU B 1 177 ? 48.892 27.805  -28.122 1.00 28.25 ? 239  LEU B N   1 
ATOM   4518 C CA  . LEU B 1 177 ? 49.722 26.584  -28.144 1.00 28.50 ? 239  LEU B CA  1 
ATOM   4519 C C   . LEU B 1 177 ? 50.574 26.454  -26.869 1.00 28.64 ? 239  LEU B C   1 
ATOM   4520 O O   . LEU B 1 177 ? 50.896 25.343  -26.433 1.00 28.01 ? 239  LEU B O   1 
ATOM   4521 C CB  . LEU B 1 177 ? 50.622 26.533  -29.385 1.00 27.87 ? 239  LEU B CB  1 
ATOM   4522 C CG  . LEU B 1 177 ? 49.938 26.216  -30.717 1.00 28.04 ? 239  LEU B CG  1 
ATOM   4523 C CD1 . LEU B 1 177 ? 50.910 26.390  -31.898 1.00 25.91 ? 239  LEU B CD1 1 
ATOM   4524 C CD2 . LEU B 1 177 ? 49.358 24.804  -30.687 1.00 25.61 ? 239  LEU B CD2 1 
ATOM   4525 N N   . CYS B 1 178 ? 50.930 27.594  -26.285 1.00 29.28 ? 240  CYS B N   1 
ATOM   4526 C CA  . CYS B 1 178 ? 51.737 27.636  -25.062 1.00 30.26 ? 240  CYS B CA  1 
ATOM   4527 C C   . CYS B 1 178 ? 50.890 27.587  -23.791 1.00 30.62 ? 240  CYS B C   1 
ATOM   4528 O O   . CYS B 1 178 ? 51.392 27.317  -22.707 1.00 30.87 ? 240  CYS B O   1 
ATOM   4529 C CB  . CYS B 1 178 ? 52.572 28.912  -25.058 1.00 29.93 ? 240  CYS B CB  1 
ATOM   4530 S SG  . CYS B 1 178 ? 53.586 29.052  -26.496 1.00 31.48 ? 240  CYS B SG  1 
ATOM   4531 N N   . ARG B 1 179 ? 49.603 27.851  -23.949 1.00 31.62 ? 241  ARG B N   1 
ATOM   4532 C CA  . ARG B 1 179 ? 48.698 28.082  -22.837 1.00 32.32 ? 241  ARG B CA  1 
ATOM   4533 C C   . ARG B 1 179 ? 48.345 26.777  -22.146 1.00 32.86 ? 241  ARG B C   1 
ATOM   4534 O O   . ARG B 1 179 ? 48.505 25.708  -22.727 1.00 32.81 ? 241  ARG B O   1 
ATOM   4535 C CB  . ARG B 1 179 ? 47.431 28.731  -23.386 1.00 32.34 ? 241  ARG B CB  1 
ATOM   4536 C CG  . ARG B 1 179 ? 46.492 29.251  -22.359 1.00 32.33 ? 241  ARG B CG  1 
ATOM   4537 C CD  . ARG B 1 179 ? 45.462 30.161  -22.982 1.00 33.23 ? 241  ARG B CD  1 
ATOM   4538 N NE  . ARG B 1 179 ? 44.738 30.879  -21.941 1.00 34.64 ? 241  ARG B NE  1 
ATOM   4539 C CZ  . ARG B 1 179 ? 43.744 31.736  -22.159 1.00 35.84 ? 241  ARG B CZ  1 
ATOM   4540 N NH1 . ARG B 1 179 ? 43.330 32.002  -23.401 1.00 37.13 ? 241  ARG B NH1 1 
ATOM   4541 N NH2 . ARG B 1 179 ? 43.158 32.332  -21.122 1.00 35.38 ? 241  ARG B NH2 1 
ATOM   4542 N N   . GLY B 1 180 ? 47.866 26.875  -20.906 1.00 33.53 ? 242  GLY B N   1 
ATOM   4543 C CA  . GLY B 1 180 ? 47.391 25.710  -20.149 1.00 33.98 ? 242  GLY B CA  1 
ATOM   4544 C C   . GLY B 1 180 ? 48.411 25.240  -19.130 1.00 34.52 ? 242  GLY B C   1 
ATOM   4545 O O   . GLY B 1 180 ? 49.577 25.013  -19.463 1.00 34.66 ? 242  GLY B O   1 
ATOM   4546 N N   . LYS B 1 181 ? 47.957 25.087  -17.889 1.00 35.45 ? 243  LYS B N   1 
ATOM   4547 C CA  . LYS B 1 181 ? 48.825 24.804  -16.743 1.00 35.68 ? 243  LYS B CA  1 
ATOM   4548 C C   . LYS B 1 181 ? 48.703 23.361  -16.229 1.00 35.76 ? 243  LYS B C   1 
ATOM   4549 O O   . LYS B 1 181 ? 49.571 22.896  -15.484 1.00 36.04 ? 243  LYS B O   1 
ATOM   4550 C CB  . LYS B 1 181 ? 48.483 25.782  -15.609 1.00 36.21 ? 243  LYS B CB  1 
ATOM   4551 C CG  . LYS B 1 181 ? 49.634 26.109  -14.658 1.00 36.52 ? 243  LYS B CG  1 
ATOM   4552 C CD  . LYS B 1 181 ? 49.264 27.283  -13.738 1.00 36.81 ? 243  LYS B CD  1 
ATOM   4553 C CE  . LYS B 1 181 ? 50.411 27.635  -12.774 1.00 37.47 ? 243  LYS B CE  1 
ATOM   4554 N NZ  . LYS B 1 181 ? 50.326 29.035  -12.249 1.00 38.02 ? 243  LYS B NZ  1 
ATOM   4555 N N   . SER B 1 182 ? 47.634 22.661  -16.619 1.00 35.49 ? 244  SER B N   1 
ATOM   4556 C CA  . SER B 1 182 ? 47.347 21.328  -16.088 1.00 35.36 ? 244  SER B CA  1 
ATOM   4557 C C   . SER B 1 182 ? 46.729 20.386  -17.136 1.00 34.91 ? 244  SER B C   1 
ATOM   4558 O O   . SER B 1 182 ? 45.513 20.405  -17.351 1.00 34.94 ? 244  SER B O   1 
ATOM   4559 C CB  . SER B 1 182 ? 46.411 21.442  -14.878 1.00 35.34 ? 244  SER B CB  1 
ATOM   4560 O OG  . SER B 1 182 ? 46.935 22.324  -13.893 1.00 35.74 ? 244  SER B OG  1 
ATOM   4561 N N   . PRO B 1 183 ? 47.562 19.567  -17.809 1.00 34.32 ? 245  PRO B N   1 
ATOM   4562 C CA  . PRO B 1 183 ? 49.021 19.592  -17.838 1.00 33.81 ? 245  PRO B CA  1 
ATOM   4563 C C   . PRO B 1 183 ? 49.520 20.690  -18.762 1.00 33.62 ? 245  PRO B C   1 
ATOM   4564 O O   . PRO B 1 183 ? 48.774 21.138  -19.626 1.00 33.63 ? 245  PRO B O   1 
ATOM   4565 C CB  . PRO B 1 183 ? 49.374 18.219  -18.411 1.00 33.82 ? 245  PRO B CB  1 
ATOM   4566 C CG  . PRO B 1 183 ? 48.240 17.895  -19.293 1.00 34.01 ? 245  PRO B CG  1 
ATOM   4567 C CD  . PRO B 1 183 ? 47.028 18.444  -18.599 1.00 34.31 ? 245  PRO B CD  1 
ATOM   4568 N N   . PRO B 1 184 ? 50.771 21.140  -18.581 1.00 33.33 ? 246  PRO B N   1 
ATOM   4569 C CA  . PRO B 1 184 ? 51.307 22.040  -19.604 1.00 33.00 ? 246  PRO B CA  1 
ATOM   4570 C C   . PRO B 1 184 ? 51.686 21.245  -20.850 1.00 32.62 ? 246  PRO B C   1 
ATOM   4571 O O   . PRO B 1 184 ? 51.834 20.019  -20.785 1.00 32.49 ? 246  PRO B O   1 
ATOM   4572 C CB  . PRO B 1 184 ? 52.540 22.658  -18.934 1.00 32.87 ? 246  PRO B CB  1 
ATOM   4573 C CG  . PRO B 1 184 ? 52.980 21.650  -17.935 1.00 33.26 ? 246  PRO B CG  1 
ATOM   4574 C CD  . PRO B 1 184 ? 51.739 20.881  -17.498 1.00 33.44 ? 246  PRO B CD  1 
ATOM   4575 N N   . PRO B 1 185 ? 51.838 21.928  -21.987 1.00 32.31 ? 247  PRO B N   1 
ATOM   4576 C CA  . PRO B 1 185 ? 52.258 21.186  -23.156 1.00 32.14 ? 247  PRO B CA  1 
ATOM   4577 C C   . PRO B 1 185 ? 53.670 20.667  -22.947 1.00 31.95 ? 247  PRO B C   1 
ATOM   4578 O O   . PRO B 1 185 ? 54.398 21.207  -22.114 1.00 32.06 ? 247  PRO B O   1 
ATOM   4579 C CB  . PRO B 1 185 ? 52.211 22.234  -24.274 1.00 32.12 ? 247  PRO B CB  1 
ATOM   4580 C CG  . PRO B 1 185 ? 52.357 23.533  -23.586 1.00 32.22 ? 247  PRO B CG  1 
ATOM   4581 C CD  . PRO B 1 185 ? 51.676 23.364  -22.267 1.00 32.49 ? 247  PRO B CD  1 
ATOM   4582 N N   . GLU B 1 186 ? 54.038 19.613  -23.675 1.00 31.74 ? 248  GLU B N   1 
ATOM   4583 C CA  . GLU B 1 186 ? 55.419 19.144  -23.708 1.00 31.46 ? 248  GLU B CA  1 
ATOM   4584 C C   . GLU B 1 186 ? 56.265 20.305  -24.216 1.00 30.83 ? 248  GLU B C   1 
ATOM   4585 O O   . GLU B 1 186 ? 56.059 20.785  -25.333 1.00 30.88 ? 248  GLU B O   1 
ATOM   4586 C CB  . GLU B 1 186 ? 55.569 17.922  -24.623 1.00 31.61 ? 248  GLU B CB  1 
ATOM   4587 C CG  . GLU B 1 186 ? 56.919 17.215  -24.508 1.00 32.22 ? 248  GLU B CG  1 
ATOM   4588 C CD  . GLU B 1 186 ? 56.999 15.956  -25.367 1.00 33.03 ? 248  GLU B CD  1 
ATOM   4589 O OE1 . GLU B 1 186 ? 56.250 14.981  -25.093 1.00 35.20 ? 248  GLU B OE1 1 
ATOM   4590 O OE2 . GLU B 1 186 ? 57.815 15.944  -26.323 1.00 35.38 ? 248  GLU B OE2 1 
ATOM   4591 N N   . PHE B 1 187 ? 57.187 20.773  -23.378 1.00 29.87 ? 249  PHE B N   1 
ATOM   4592 C CA  . PHE B 1 187 ? 57.975 21.978  -23.668 1.00 29.48 ? 249  PHE B CA  1 
ATOM   4593 C C   . PHE B 1 187 ? 58.753 21.922  -24.998 1.00 29.00 ? 249  PHE B C   1 
ATOM   4594 O O   . PHE B 1 187 ? 58.862 22.929  -25.687 1.00 28.83 ? 249  PHE B O   1 
ATOM   4595 C CB  . PHE B 1 187 ? 58.935 22.261  -22.508 1.00 28.96 ? 249  PHE B CB  1 
ATOM   4596 C CG  . PHE B 1 187 ? 59.411 23.683  -22.449 1.00 28.95 ? 249  PHE B CG  1 
ATOM   4597 C CD1 . PHE B 1 187 ? 58.512 24.716  -22.226 1.00 27.94 ? 249  PHE B CD1 1 
ATOM   4598 C CD2 . PHE B 1 187 ? 60.748 23.987  -22.604 1.00 28.09 ? 249  PHE B CD2 1 
ATOM   4599 C CE1 . PHE B 1 187 ? 58.931 26.017  -22.170 1.00 28.16 ? 249  PHE B CE1 1 
ATOM   4600 C CE2 . PHE B 1 187 ? 61.176 25.295  -22.553 1.00 28.13 ? 249  PHE B CE2 1 
ATOM   4601 C CZ  . PHE B 1 187 ? 60.266 26.312  -22.328 1.00 28.55 ? 249  PHE B CZ  1 
ATOM   4602 N N   . ALA B 1 188 ? 59.282 20.750  -25.343 1.00 28.72 ? 250  ALA B N   1 
ATOM   4603 C CA  . ALA B 1 188 ? 60.052 20.550  -26.583 1.00 28.67 ? 250  ALA B CA  1 
ATOM   4604 C C   . ALA B 1 188 ? 59.227 20.743  -27.854 1.00 28.36 ? 250  ALA B C   1 
ATOM   4605 O O   . ALA B 1 188 ? 59.776 21.045  -28.907 1.00 28.09 ? 250  ALA B O   1 
ATOM   4606 C CB  . ALA B 1 188 ? 60.699 19.176  -26.584 1.00 28.19 ? 250  ALA B CB  1 
ATOM   4607 N N   . LYS B 1 189 ? 57.912 20.561  -27.753 1.00 28.52 ? 251  LYS B N   1 
ATOM   4608 C CA  . LYS B 1 189 ? 57.006 20.786  -28.885 1.00 28.54 ? 251  LYS B CA  1 
ATOM   4609 C C   . LYS B 1 189 ? 56.784 22.260  -29.154 1.00 28.16 ? 251  LYS B C   1 
ATOM   4610 O O   . LYS B 1 189 ? 56.558 22.668  -30.287 1.00 28.16 ? 251  LYS B O   1 
ATOM   4611 C CB  . LYS B 1 189 ? 55.643 20.141  -28.623 1.00 28.75 ? 251  LYS B CB  1 
ATOM   4612 C CG  . LYS B 1 189 ? 55.677 18.622  -28.538 1.00 29.27 ? 251  LYS B CG  1 
ATOM   4613 C CD  . LYS B 1 189 ? 54.298 18.063  -28.190 1.00 29.50 ? 251  LYS B CD  1 
ATOM   4614 C CE  . LYS B 1 189 ? 54.304 16.546  -28.078 1.00 29.43 ? 251  LYS B CE  1 
ATOM   4615 N NZ  . LYS B 1 189 ? 54.543 15.947  -29.410 1.00 30.40 ? 251  LYS B NZ  1 
ATOM   4616 N N   . VAL B 1 190 ? 56.850 23.055  -28.098 1.00 27.83 ? 252  VAL B N   1 
ATOM   4617 C CA  . VAL B 1 190 ? 56.402 24.438  -28.149 1.00 27.81 ? 252  VAL B CA  1 
ATOM   4618 C C   . VAL B 1 190 ? 57.561 25.470  -28.033 1.00 27.58 ? 252  VAL B C   1 
ATOM   4619 O O   . VAL B 1 190 ? 57.485 26.583  -28.563 1.00 27.66 ? 252  VAL B O   1 
ATOM   4620 C CB  . VAL B 1 190 ? 55.297 24.622  -27.081 1.00 27.63 ? 252  VAL B CB  1 
ATOM   4621 C CG1 . VAL B 1 190 ? 55.883 25.013  -25.728 1.00 26.89 ? 252  VAL B CG1 1 
ATOM   4622 C CG2 . VAL B 1 190 ? 54.247 25.598  -27.576 1.00 28.62 ? 252  VAL B CG2 1 
ATOM   4623 N N   . SER B 1 191 ? 58.658 25.064  -27.405 1.00 27.33 ? 253  SER B N   1 
ATOM   4624 C CA  . SER B 1 191 ? 59.845 25.906  -27.288 1.00 27.20 ? 253  SER B CA  1 
ATOM   4625 C C   . SER B 1 191 ? 60.560 26.319  -28.599 1.00 26.90 ? 253  SER B C   1 
ATOM   4626 O O   . SER B 1 191 ? 61.351 27.272  -28.568 1.00 26.66 ? 253  SER B O   1 
ATOM   4627 C CB  . SER B 1 191 ? 60.849 25.241  -26.351 1.00 27.12 ? 253  SER B CB  1 
ATOM   4628 O OG  . SER B 1 191 ? 61.195 23.964  -26.833 1.00 28.36 ? 253  SER B OG  1 
ATOM   4629 N N   . PRO B 1 192 ? 60.331 25.613  -29.741 1.00 26.69 ? 254  PRO B N   1 
ATOM   4630 C CA  . PRO B 1 192 ? 60.893 26.148  -30.999 1.00 26.52 ? 254  PRO B CA  1 
ATOM   4631 C C   . PRO B 1 192 ? 60.441 27.570  -31.413 1.00 26.20 ? 254  PRO B C   1 
ATOM   4632 O O   . PRO B 1 192 ? 61.113 28.208  -32.213 1.00 26.29 ? 254  PRO B O   1 
ATOM   4633 C CB  . PRO B 1 192 ? 60.454 25.116  -32.043 1.00 26.57 ? 254  PRO B CB  1 
ATOM   4634 C CG  . PRO B 1 192 ? 60.234 23.870  -31.284 1.00 26.36 ? 254  PRO B CG  1 
ATOM   4635 C CD  . PRO B 1 192 ? 59.666 24.315  -29.978 1.00 26.96 ? 254  PRO B CD  1 
ATOM   4636 N N   . CYS B 1 193 ? 59.336 28.066  -30.860 1.00 26.35 ? 255  CYS B N   1 
ATOM   4637 C CA  . CYS B 1 193 ? 58.849 29.420  -31.160 1.00 26.22 ? 255  CYS B CA  1 
ATOM   4638 C C   . CYS B 1 193 ? 59.615 30.543  -30.428 1.00 25.99 ? 255  CYS B C   1 
ATOM   4639 O O   . CYS B 1 193 ? 59.437 31.713  -30.740 1.00 25.64 ? 255  CYS B O   1 
ATOM   4640 C CB  . CYS B 1 193 ? 57.363 29.529  -30.825 1.00 26.20 ? 255  CYS B CB  1 
ATOM   4641 S SG  . CYS B 1 193 ? 57.033 29.774  -29.073 1.00 27.46 ? 255  CYS B SG  1 
ATOM   4642 N N   . LEU B 1 194 ? 60.479 30.195  -29.480 1.00 25.76 ? 256  LEU B N   1 
ATOM   4643 C CA  . LEU B 1 194 ? 61.121 31.209  -28.628 1.00 25.85 ? 256  LEU B CA  1 
ATOM   4644 C C   . LEU B 1 194 ? 61.939 32.239  -29.412 1.00 25.72 ? 256  LEU B C   1 
ATOM   4645 O O   . LEU B 1 194 ? 62.025 33.385  -29.008 1.00 26.06 ? 256  LEU B O   1 
ATOM   4646 C CB  . LEU B 1 194 ? 61.965 30.553  -27.520 1.00 25.13 ? 256  LEU B CB  1 
ATOM   4647 C CG  . LEU B 1 194 ? 61.142 30.076  -26.315 1.00 23.87 ? 256  LEU B CG  1 
ATOM   4648 C CD1 . LEU B 1 194 ? 61.931 29.125  -25.451 1.00 24.55 ? 256  LEU B CD1 1 
ATOM   4649 C CD2 . LEU B 1 194 ? 60.710 31.229  -25.489 1.00 23.45 ? 256  LEU B CD2 1 
ATOM   4650 N N   . ASN B 1 195 ? 62.521 31.827  -30.526 1.00 26.07 ? 257  ASN B N   1 
ATOM   4651 C CA  . ASN B 1 195 ? 63.247 32.735  -31.421 1.00 26.21 ? 257  ASN B CA  1 
ATOM   4652 C C   . ASN B 1 195 ? 62.371 33.816  -32.016 1.00 26.09 ? 257  ASN B C   1 
ATOM   4653 O O   . ASN B 1 195 ? 62.737 34.991  -32.013 1.00 26.15 ? 257  ASN B O   1 
ATOM   4654 C CB  . ASN B 1 195 ? 63.873 31.956  -32.577 1.00 26.42 ? 257  ASN B CB  1 
ATOM   4655 C CG  . ASN B 1 195 ? 65.293 31.523  -32.290 1.00 27.54 ? 257  ASN B CG  1 
ATOM   4656 O OD1 . ASN B 1 195 ? 65.859 31.822  -31.228 1.00 30.41 ? 257  ASN B OD1 1 
ATOM   4657 N ND2 . ASN B 1 195 ? 65.885 30.814  -33.244 1.00 28.71 ? 257  ASN B ND2 1 
ATOM   4658 N N   . VAL B 1 196 ? 61.227 33.401  -32.543 1.00 25.48 ? 258  VAL B N   1 
ATOM   4659 C CA  . VAL B 1 196 ? 60.282 34.318  -33.139 1.00 25.55 ? 258  VAL B CA  1 
ATOM   4660 C C   . VAL B 1 196 ? 59.739 35.281  -32.074 1.00 25.70 ? 258  VAL B C   1 
ATOM   4661 O O   . VAL B 1 196 ? 59.735 36.488  -32.290 1.00 25.90 ? 258  VAL B O   1 
ATOM   4662 C CB  . VAL B 1 196 ? 59.146 33.547  -33.874 1.00 25.31 ? 258  VAL B CB  1 
ATOM   4663 C CG1 . VAL B 1 196 ? 57.941 34.443  -34.133 1.00 24.60 ? 258  VAL B CG1 1 
ATOM   4664 C CG2 . VAL B 1 196 ? 59.680 32.974  -35.186 1.00 24.90 ? 258  VAL B CG2 1 
ATOM   4665 N N   . LEU B 1 197 ? 59.306 34.748  -30.929 1.00 25.94 ? 259  LEU B N   1 
ATOM   4666 C CA  . LEU B 1 197 ? 58.800 35.566  -29.813 1.00 25.70 ? 259  LEU B CA  1 
ATOM   4667 C C   . LEU B 1 197 ? 59.803 36.650  -29.425 1.00 26.25 ? 259  LEU B C   1 
ATOM   4668 O O   . LEU B 1 197 ? 59.433 37.792  -29.168 1.00 26.44 ? 259  LEU B O   1 
ATOM   4669 C CB  . LEU B 1 197 ? 58.482 34.691  -28.596 1.00 25.62 ? 259  LEU B CB  1 
ATOM   4670 C CG  . LEU B 1 197 ? 57.043 34.260  -28.295 1.00 24.91 ? 259  LEU B CG  1 
ATOM   4671 C CD1 . LEU B 1 197 ? 56.145 34.326  -29.469 1.00 22.07 ? 259  LEU B CD1 1 
ATOM   4672 C CD2 . LEU B 1 197 ? 57.006 32.875  -27.640 1.00 24.56 ? 259  LEU B CD2 1 
ATOM   4673 N N   . SER B 1 198 ? 61.077 36.286  -29.389 1.00 26.30 ? 260  SER B N   1 
ATOM   4674 C CA  . SER B 1 198 ? 62.120 37.221  -29.042 1.00 26.50 ? 260  SER B CA  1 
ATOM   4675 C C   . SER B 1 198 ? 62.175 38.383  -30.013 1.00 26.68 ? 260  SER B C   1 
ATOM   4676 O O   . SER B 1 198 ? 62.272 39.530  -29.604 1.00 26.80 ? 260  SER B O   1 
ATOM   4677 C CB  . SER B 1 198 ? 63.468 36.514  -29.041 1.00 26.85 ? 260  SER B CB  1 
ATOM   4678 O OG  . SER B 1 198 ? 64.455 37.374  -28.538 1.00 28.91 ? 260  SER B OG  1 
ATOM   4679 N N   . TRP B 1 199 ? 62.125 38.072  -31.306 1.00 26.87 ? 261  TRP B N   1 
ATOM   4680 C CA  . TRP B 1 199 ? 62.245 39.070  -32.356 1.00 26.43 ? 261  TRP B CA  1 
ATOM   4681 C C   . TRP B 1 199 ? 60.953 39.913  -32.484 1.00 25.91 ? 261  TRP B C   1 
ATOM   4682 O O   . TRP B 1 199 ? 61.017 41.103  -32.783 1.00 25.06 ? 261  TRP B O   1 
ATOM   4683 C CB  . TRP B 1 199 ? 62.646 38.393  -33.692 1.00 28.30 ? 261  TRP B CB  1 
ATOM   4684 C CG  . TRP B 1 199 ? 63.790 37.338  -33.542 1.00 29.23 ? 261  TRP B CG  1 
ATOM   4685 C CD1 . TRP B 1 199 ? 64.783 37.310  -32.572 1.00 29.75 ? 261  TRP B CD1 1 
ATOM   4686 C CD2 . TRP B 1 199 ? 64.019 36.182  -34.369 1.00 30.10 ? 261  TRP B CD2 1 
ATOM   4687 N NE1 . TRP B 1 199 ? 65.614 36.209  -32.759 1.00 29.44 ? 261  TRP B NE1 1 
ATOM   4688 C CE2 . TRP B 1 199 ? 65.174 35.507  -33.852 1.00 30.96 ? 261  TRP B CE2 1 
ATOM   4689 C CE3 . TRP B 1 199 ? 63.366 35.643  -35.483 1.00 29.41 ? 261  TRP B CE3 1 
ATOM   4690 C CZ2 . TRP B 1 199 ? 65.684 34.326  -34.433 1.00 29.84 ? 261  TRP B CZ2 1 
ATOM   4691 C CZ3 . TRP B 1 199 ? 63.877 34.467  -36.057 1.00 30.00 ? 261  TRP B CZ3 1 
ATOM   4692 C CH2 . TRP B 1 199 ? 65.023 33.825  -35.524 1.00 29.79 ? 261  TRP B CH2 1 
ATOM   4693 N N   . LEU B 1 200 ? 59.794 39.310  -32.212 1.00 25.10 ? 262  LEU B N   1 
ATOM   4694 C CA  . LEU B 1 200 ? 58.512 40.027  -32.234 1.00 24.73 ? 262  LEU B CA  1 
ATOM   4695 C C   . LEU B 1 200 ? 58.394 41.101  -31.152 1.00 24.56 ? 262  LEU B C   1 
ATOM   4696 O O   . LEU B 1 200 ? 57.570 41.984  -31.269 1.00 24.74 ? 262  LEU B O   1 
ATOM   4697 C CB  . LEU B 1 200 ? 57.326 39.050  -32.107 1.00 24.31 ? 262  LEU B CB  1 
ATOM   4698 C CG  . LEU B 1 200 ? 56.927 38.221  -33.344 1.00 24.62 ? 262  LEU B CG  1 
ATOM   4699 C CD1 . LEU B 1 200 ? 55.833 37.217  -32.971 1.00 24.24 ? 262  LEU B CD1 1 
ATOM   4700 C CD2 . LEU B 1 200 ? 56.478 39.098  -34.542 1.00 21.38 ? 262  LEU B CD2 1 
ATOM   4701 N N   . LEU B 1 201 ? 59.202 41.027  -30.095 1.00 24.26 ? 263  LEU B N   1 
ATOM   4702 C CA  . LEU B 1 201 ? 59.217 42.078  -29.081 1.00 24.33 ? 263  LEU B CA  1 
ATOM   4703 C C   . LEU B 1 201 ? 59.801 43.392  -29.587 1.00 24.33 ? 263  LEU B C   1 
ATOM   4704 O O   . LEU B 1 201 ? 59.737 44.384  -28.885 1.00 23.65 ? 263  LEU B O   1 
ATOM   4705 C CB  . LEU B 1 201 ? 59.984 41.627  -27.829 1.00 24.01 ? 263  LEU B CB  1 
ATOM   4706 C CG  . LEU B 1 201 ? 59.418 40.443  -27.052 1.00 23.85 ? 263  LEU B CG  1 
ATOM   4707 C CD1 . LEU B 1 201 ? 60.281 40.171  -25.831 1.00 23.29 ? 263  LEU B CD1 1 
ATOM   4708 C CD2 . LEU B 1 201 ? 57.951 40.650  -26.683 1.00 22.01 ? 263  LEU B CD2 1 
ATOM   4709 N N   . PHE B 1 202 ? 60.375 43.400  -30.790 1.00 24.84 ? 264  PHE B N   1 
ATOM   4710 C CA  . PHE B 1 202 ? 60.835 44.642  -31.432 1.00 25.26 ? 264  PHE B CA  1 
ATOM   4711 C C   . PHE B 1 202 ? 59.778 45.347  -32.290 1.00 25.35 ? 264  PHE B C   1 
ATOM   4712 O O   . PHE B 1 202 ? 59.984 46.488  -32.702 1.00 25.86 ? 264  PHE B O   1 
ATOM   4713 C CB  . PHE B 1 202 ? 62.115 44.382  -32.244 1.00 25.80 ? 264  PHE B CB  1 
ATOM   4714 C CG  . PHE B 1 202 ? 63.300 44.110  -31.374 1.00 26.09 ? 264  PHE B CG  1 
ATOM   4715 C CD1 . PHE B 1 202 ? 63.696 42.813  -31.108 1.00 26.89 ? 264  PHE B CD1 1 
ATOM   4716 C CD2 . PHE B 1 202 ? 63.977 45.155  -30.758 1.00 28.31 ? 264  PHE B CD2 1 
ATOM   4717 C CE1 . PHE B 1 202 ? 64.766 42.543  -30.269 1.00 26.71 ? 264  PHE B CE1 1 
ATOM   4718 C CE2 . PHE B 1 202 ? 65.063 44.893  -29.895 1.00 28.20 ? 264  PHE B CE2 1 
ATOM   4719 C CZ  . PHE B 1 202 ? 65.452 43.573  -29.668 1.00 27.16 ? 264  PHE B CZ  1 
ATOM   4720 N N   . VAL B 1 203 ? 58.658 44.671  -32.536 1.00 25.44 ? 265  VAL B N   1 
ATOM   4721 C CA  . VAL B 1 203 ? 57.522 45.215  -33.298 1.00 25.45 ? 265  VAL B CA  1 
ATOM   4722 C C   . VAL B 1 203 ? 56.766 46.274  -32.467 1.00 25.56 ? 265  VAL B C   1 
ATOM   4723 O O   . VAL B 1 203 ? 56.880 46.304  -31.240 1.00 25.88 ? 265  VAL B O   1 
ATOM   4724 C CB  . VAL B 1 203 ? 56.589 44.049  -33.749 1.00 25.60 ? 265  VAL B CB  1 
ATOM   4725 C CG1 . VAL B 1 203 ? 55.268 44.556  -34.294 1.00 26.85 ? 265  VAL B CG1 1 
ATOM   4726 C CG2 . VAL B 1 203 ? 57.293 43.171  -34.799 1.00 24.48 ? 265  VAL B CG2 1 
ATOM   4727 N N   . SER B 1 204 ? 56.044 47.175  -33.129 1.00 25.36 ? 266  SER B N   1 
ATOM   4728 C CA  . SER B 1 204 ? 55.371 48.285  -32.434 1.00 25.48 ? 266  SER B CA  1 
ATOM   4729 C C   . SER B 1 204 ? 53.857 48.084  -32.229 1.00 25.46 ? 266  SER B C   1 
ATOM   4730 O O   . SER B 1 204 ? 53.256 48.719  -31.357 1.00 26.18 ? 266  SER B O   1 
ATOM   4731 C CB  . SER B 1 204 ? 55.601 49.595  -33.188 1.00 25.57 ? 266  SER B CB  1 
ATOM   4732 O OG  . SER B 1 204 ? 54.875 49.590  -34.395 1.00 26.32 ? 266  SER B OG  1 
ATOM   4733 N N   . ASP B 1 205 ? 53.246 47.214  -33.025 1.00 24.75 ? 267  ASP B N   1 
ATOM   4734 C CA  . ASP B 1 205 ? 51.824 46.927  -32.900 1.00 24.26 ? 267  ASP B CA  1 
ATOM   4735 C C   . ASP B 1 205 ? 51.472 46.404  -31.507 1.00 23.74 ? 267  ASP B C   1 
ATOM   4736 O O   . ASP B 1 205 ? 52.029 45.410  -31.045 1.00 23.49 ? 267  ASP B O   1 
ATOM   4737 C CB  . ASP B 1 205 ? 51.389 45.907  -33.949 1.00 23.89 ? 267  ASP B CB  1 
ATOM   4738 C CG  . ASP B 1 205 ? 49.899 45.685  -33.945 1.00 24.21 ? 267  ASP B CG  1 
ATOM   4739 O OD1 . ASP B 1 205 ? 49.151 46.654  -34.182 1.00 24.79 ? 267  ASP B OD1 1 
ATOM   4740 O OD2 . ASP B 1 205 ? 49.469 44.547  -33.696 1.00 23.95 ? 267  ASP B OD2 1 
ATOM   4741 N N   . THR B 1 206 ? 50.519 47.070  -30.866 1.00 23.50 ? 268  THR B N   1 
ATOM   4742 C CA  . THR B 1 206 ? 50.072 46.719  -29.524 1.00 23.35 ? 268  THR B CA  1 
ATOM   4743 C C   . THR B 1 206 ? 49.530 45.299  -29.421 1.00 23.03 ? 268  THR B C   1 
ATOM   4744 O O   . THR B 1 206 ? 49.837 44.585  -28.460 1.00 22.81 ? 268  THR B O   1 
ATOM   4745 C CB  . THR B 1 206 ? 49.025 47.734  -29.024 1.00 23.22 ? 268  THR B CB  1 
ATOM   4746 O OG1 . THR B 1 206 ? 49.673 48.999  -28.829 1.00 23.28 ? 268  THR B OG1 1 
ATOM   4747 C CG2 . THR B 1 206 ? 48.401 47.294  -27.690 1.00 23.83 ? 268  THR B CG2 1 
ATOM   4748 N N   . ASP B 1 207 ? 48.739 44.890  -30.408 1.00 22.91 ? 269  ASP B N   1 
ATOM   4749 C CA  . ASP B 1 207 ? 48.131 43.555  -30.413 1.00 23.08 ? 269  ASP B CA  1 
ATOM   4750 C C   . ASP B 1 207 ? 49.181 42.441  -30.475 1.00 22.88 ? 269  ASP B C   1 
ATOM   4751 O O   . ASP B 1 207 ? 49.052 41.433  -29.781 1.00 22.84 ? 269  ASP B O   1 
ATOM   4752 C CB  . ASP B 1 207 ? 47.163 43.390  -31.595 1.00 23.51 ? 269  ASP B CB  1 
ATOM   4753 C CG  . ASP B 1 207 ? 45.937 44.284  -31.502 1.00 24.68 ? 269  ASP B CG  1 
ATOM   4754 O OD1 . ASP B 1 207 ? 45.673 44.856  -30.430 1.00 25.71 ? 269  ASP B OD1 1 
ATOM   4755 O OD2 . ASP B 1 207 ? 45.217 44.396  -32.521 1.00 27.60 ? 269  ASP B OD2 1 
ATOM   4756 N N   . VAL B 1 208 ? 50.213 42.629  -31.304 1.00 22.69 ? 270  VAL B N   1 
ATOM   4757 C CA  . VAL B 1 208 ? 51.274 41.629  -31.480 1.00 22.11 ? 270  VAL B CA  1 
ATOM   4758 C C   . VAL B 1 208 ? 52.113 41.477  -30.223 1.00 21.76 ? 270  VAL B C   1 
ATOM   4759 O O   . VAL B 1 208 ? 52.330 40.367  -29.743 1.00 21.77 ? 270  VAL B O   1 
ATOM   4760 C CB  . VAL B 1 208 ? 52.201 41.982  -32.681 1.00 22.24 ? 270  VAL B CB  1 
ATOM   4761 C CG1 . VAL B 1 208 ? 53.408 41.042  -32.738 1.00 21.64 ? 270  VAL B CG1 1 
ATOM   4762 C CG2 . VAL B 1 208 ? 51.424 41.927  -33.999 1.00 21.60 ? 270  VAL B CG2 1 
ATOM   4763 N N   . LEU B 1 209 ? 52.602 42.604  -29.721 1.00 21.57 ? 271  LEU B N   1 
ATOM   4764 C CA  . LEU B 1 209 ? 53.319 42.675  -28.445 1.00 21.28 ? 271  LEU B CA  1 
ATOM   4765 C C   . LEU B 1 209 ? 52.564 41.994  -27.295 1.00 21.09 ? 271  LEU B C   1 
ATOM   4766 O O   . LEU B 1 209 ? 53.128 41.162  -26.587 1.00 21.21 ? 271  LEU B O   1 
ATOM   4767 C CB  . LEU B 1 209 ? 53.578 44.138  -28.071 1.00 21.17 ? 271  LEU B CB  1 
ATOM   4768 C CG  . LEU B 1 209 ? 54.552 44.975  -28.902 1.00 19.57 ? 271  LEU B CG  1 
ATOM   4769 C CD1 . LEU B 1 209 ? 54.566 46.409  -28.404 1.00 16.46 ? 271  LEU B CD1 1 
ATOM   4770 C CD2 . LEU B 1 209 ? 55.930 44.370  -28.828 1.00 19.74 ? 271  LEU B CD2 1 
ATOM   4771 N N   . ALA B 1 210 ? 51.292 42.343  -27.119 1.00 20.99 ? 272  ALA B N   1 
ATOM   4772 C CA  . ALA B 1 210 ? 50.475 41.780  -26.036 1.00 21.04 ? 272  ALA B CA  1 
ATOM   4773 C C   . ALA B 1 210 ? 50.367 40.267  -26.117 1.00 21.09 ? 272  ALA B C   1 
ATOM   4774 O O   . ALA B 1 210 ? 50.490 39.577  -25.104 1.00 21.31 ? 272  ALA B O   1 
ATOM   4775 C CB  . ALA B 1 210 ? 49.085 42.406  -26.025 1.00 20.99 ? 272  ALA B CB  1 
ATOM   4776 N N   . ASP B 1 211 ? 50.154 39.739  -27.320 1.00 21.46 ? 273  ASP B N   1 
ATOM   4777 C CA  . ASP B 1 211 ? 50.140 38.282  -27.508 1.00 21.45 ? 273  ASP B CA  1 
ATOM   4778 C C   . ASP B 1 211 ? 51.526 37.634  -27.415 1.00 21.42 ? 273  ASP B C   1 
ATOM   4779 O O   . ASP B 1 211 ? 51.641 36.520  -26.912 1.00 21.86 ? 273  ASP B O   1 
ATOM   4780 C CB  . ASP B 1 211 ? 49.459 37.910  -28.817 1.00 22.04 ? 273  ASP B CB  1 
ATOM   4781 C CG  . ASP B 1 211 ? 47.949 38.108  -28.769 1.00 23.00 ? 273  ASP B CG  1 
ATOM   4782 O OD1 . ASP B 1 211 ? 47.356 37.934  -27.678 1.00 25.79 ? 273  ASP B OD1 1 
ATOM   4783 O OD2 . ASP B 1 211 ? 47.359 38.440  -29.825 1.00 25.19 ? 273  ASP B OD2 1 
ATOM   4784 N N   . ALA B 1 212 ? 52.572 38.318  -27.882 1.00 21.14 ? 274  ALA B N   1 
ATOM   4785 C CA  . ALA B 1 212 ? 53.939 37.818  -27.722 1.00 20.98 ? 274  ALA B CA  1 
ATOM   4786 C C   . ALA B 1 212 ? 54.247 37.676  -26.235 1.00 21.02 ? 274  ALA B C   1 
ATOM   4787 O O   . ALA B 1 212 ? 54.838 36.684  -25.808 1.00 20.94 ? 274  ALA B O   1 
ATOM   4788 C CB  . ALA B 1 212 ? 54.948 38.743  -28.407 1.00 20.96 ? 274  ALA B CB  1 
ATOM   4789 N N   . CYS B 1 213 ? 53.799 38.654  -25.444 1.00 21.24 ? 275  CYS B N   1 
ATOM   4790 C CA  . CYS B 1 213 ? 53.993 38.650  -23.995 1.00 21.03 ? 275  CYS B CA  1 
ATOM   4791 C C   . CYS B 1 213 ? 53.193 37.588  -23.278 1.00 21.06 ? 275  CYS B C   1 
ATOM   4792 O O   . CYS B 1 213 ? 53.727 36.928  -22.396 1.00 21.60 ? 275  CYS B O   1 
ATOM   4793 C CB  . CYS B 1 213 ? 53.687 40.024  -23.418 1.00 21.43 ? 275  CYS B CB  1 
ATOM   4794 S SG  . CYS B 1 213 ? 54.963 41.210  -23.813 1.00 21.41 ? 275  CYS B SG  1 
ATOM   4795 N N   . TRP B 1 214 ? 51.931 37.392  -23.657 1.00 21.15 ? 276  TRP B N   1 
ATOM   4796 C CA  . TRP B 1 214 ? 51.149 36.307  -23.080 1.00 21.22 ? 276  TRP B CA  1 
ATOM   4797 C C   . TRP B 1 214 ? 51.824 34.980  -23.365 1.00 21.68 ? 276  TRP B C   1 
ATOM   4798 O O   . TRP B 1 214 ? 52.003 34.171  -22.451 1.00 22.98 ? 276  TRP B O   1 
ATOM   4799 C CB  . TRP B 1 214 ? 49.720 36.273  -23.607 1.00 20.87 ? 276  TRP B CB  1 
ATOM   4800 C CG  . TRP B 1 214 ? 48.814 37.227  -22.983 1.00 19.89 ? 276  TRP B CG  1 
ATOM   4801 C CD1 . TRP B 1 214 ? 48.166 38.258  -23.594 1.00 20.43 ? 276  TRP B CD1 1 
ATOM   4802 C CD2 . TRP B 1 214 ? 48.400 37.240  -21.621 1.00 20.62 ? 276  TRP B CD2 1 
ATOM   4803 N NE1 . TRP B 1 214 ? 47.392 38.932  -22.688 1.00 20.60 ? 276  TRP B NE1 1 
ATOM   4804 C CE2 . TRP B 1 214 ? 47.511 38.324  -21.467 1.00 20.61 ? 276  TRP B CE2 1 
ATOM   4805 C CE3 . TRP B 1 214 ? 48.717 36.455  -20.499 1.00 21.17 ? 276  TRP B CE3 1 
ATOM   4806 C CZ2 . TRP B 1 214 ? 46.926 38.641  -20.243 1.00 21.14 ? 276  TRP B CZ2 1 
ATOM   4807 C CZ3 . TRP B 1 214 ? 48.150 36.771  -19.282 1.00 20.53 ? 276  TRP B CZ3 1 
ATOM   4808 C CH2 . TRP B 1 214 ? 47.256 37.855  -19.160 1.00 21.22 ? 276  TRP B CH2 1 
ATOM   4809 N N   . ALA B 1 215 ? 52.214 34.754  -24.614 1.00 21.75 ? 277  ALA B N   1 
ATOM   4810 C CA  . ALA B 1 215 ? 52.915 33.520  -24.980 1.00 21.78 ? 277  ALA B CA  1 
ATOM   4811 C C   . ALA B 1 215 ? 54.120 33.263  -24.064 1.00 21.72 ? 277  ALA B C   1 
ATOM   4812 O O   . ALA B 1 215 ? 54.239 32.196  -23.457 1.00 21.66 ? 277  ALA B O   1 
ATOM   4813 C CB  . ALA B 1 215 ? 53.349 33.567  -26.445 1.00 21.63 ? 277  ALA B CB  1 
ATOM   4814 N N   . LEU B 1 216 ? 54.995 34.260  -23.956 1.00 22.08 ? 278  LEU B N   1 
ATOM   4815 C CA  . LEU B 1 216 ? 56.189 34.179  -23.094 1.00 22.13 ? 278  LEU B CA  1 
ATOM   4816 C C   . LEU B 1 216 ? 55.822 33.903  -21.614 1.00 22.01 ? 278  LEU B C   1 
ATOM   4817 O O   . LEU B 1 216 ? 56.505 33.161  -20.907 1.00 21.08 ? 278  LEU B O   1 
ATOM   4818 C CB  . LEU B 1 216 ? 57.001 35.472  -23.217 1.00 21.70 ? 278  LEU B CB  1 
ATOM   4819 C CG  . LEU B 1 216 ? 57.805 35.609  -24.517 1.00 21.96 ? 278  LEU B CG  1 
ATOM   4820 C CD1 . LEU B 1 216 ? 58.461 36.986  -24.666 1.00 20.38 ? 278  LEU B CD1 1 
ATOM   4821 C CD2 . LEU B 1 216 ? 58.866 34.511  -24.596 1.00 20.26 ? 278  LEU B CD2 1 
ATOM   4822 N N   . SER B 1 217 ? 54.723 34.483  -21.161 1.00 22.69 ? 279  SER B N   1 
ATOM   4823 C CA  . SER B 1 217 ? 54.286 34.289  -19.779 1.00 23.29 ? 279  SER B CA  1 
ATOM   4824 C C   . SER B 1 217 ? 53.845 32.843  -19.531 1.00 23.63 ? 279  SER B C   1 
ATOM   4825 O O   . SER B 1 217 ? 53.988 32.323  -18.424 1.00 24.33 ? 279  SER B O   1 
ATOM   4826 C CB  . SER B 1 217 ? 53.154 35.247  -19.431 1.00 23.08 ? 279  SER B CB  1 
ATOM   4827 O OG  . SER B 1 217 ? 51.903 34.650  -19.644 1.00 23.24 ? 279  SER B OG  1 
ATOM   4828 N N   . TYR B 1 218 ? 53.319 32.201  -20.568 1.00 24.16 ? 280  TYR B N   1 
ATOM   4829 C CA  . TYR B 1 218 ? 52.941 30.789  -20.502 1.00 24.55 ? 280  TYR B CA  1 
ATOM   4830 C C   . TYR B 1 218 ? 54.158 29.881  -20.525 1.00 24.51 ? 280  TYR B C   1 
ATOM   4831 O O   . TYR B 1 218 ? 54.210 28.907  -19.794 1.00 24.50 ? 280  TYR B O   1 
ATOM   4832 C CB  . TYR B 1 218 ? 51.993 30.415  -21.650 1.00 24.86 ? 280  TYR B CB  1 
ATOM   4833 C CG  . TYR B 1 218 ? 50.671 31.187  -21.670 1.00 25.13 ? 280  TYR B CG  1 
ATOM   4834 C CD1 . TYR B 1 218 ? 50.093 31.575  -22.872 1.00 24.74 ? 280  TYR B CD1 1 
ATOM   4835 C CD2 . TYR B 1 218 ? 50.012 31.529  -20.489 1.00 26.14 ? 280  TYR B CD2 1 
ATOM   4836 C CE1 . TYR B 1 218 ? 48.896 32.277  -22.905 1.00 25.74 ? 280  TYR B CE1 1 
ATOM   4837 C CE2 . TYR B 1 218 ? 48.810 32.229  -20.509 1.00 25.57 ? 280  TYR B CE2 1 
ATOM   4838 C CZ  . TYR B 1 218 ? 48.260 32.601  -21.723 1.00 25.58 ? 280  TYR B CZ  1 
ATOM   4839 O OH  . TYR B 1 218 ? 47.070 33.297  -21.752 1.00 26.63 ? 280  TYR B OH  1 
ATOM   4840 N N   . LEU B 1 219 ? 55.134 30.205  -21.361 1.00 24.89 ? 281  LEU B N   1 
ATOM   4841 C CA  . LEU B 1 219 ? 56.357 29.406  -21.469 1.00 25.05 ? 281  LEU B CA  1 
ATOM   4842 C C   . LEU B 1 219 ? 57.245 29.498  -20.226 1.00 25.23 ? 281  LEU B C   1 
ATOM   4843 O O   . LEU B 1 219 ? 58.004 28.588  -19.952 1.00 25.39 ? 281  LEU B O   1 
ATOM   4844 C CB  . LEU B 1 219 ? 57.155 29.829  -22.700 1.00 24.86 ? 281  LEU B CB  1 
ATOM   4845 C CG  . LEU B 1 219 ? 56.492 29.438  -24.019 1.00 24.51 ? 281  LEU B CG  1 
ATOM   4846 C CD1 . LEU B 1 219 ? 56.988 30.303  -25.151 1.00 23.37 ? 281  LEU B CD1 1 
ATOM   4847 C CD2 . LEU B 1 219 ? 56.744 27.969  -24.315 1.00 23.06 ? 281  LEU B CD2 1 
ATOM   4848 N N   . SER B 1 220 ? 57.133 30.592  -19.477 1.00 25.71 ? 282  SER B N   1 
ATOM   4849 C CA  . SER B 1 220 ? 57.974 30.832  -18.291 1.00 25.33 ? 282  SER B CA  1 
ATOM   4850 C C   . SER B 1 220 ? 57.294 30.412  -16.984 1.00 25.30 ? 282  SER B C   1 
ATOM   4851 O O   . SER B 1 220 ? 57.897 30.466  -15.920 1.00 25.62 ? 282  SER B O   1 
ATOM   4852 C CB  . SER B 1 220 ? 58.385 32.298  -18.244 1.00 24.85 ? 282  SER B CB  1 
ATOM   4853 O OG  . SER B 1 220 ? 57.243 33.125  -18.370 1.00 26.54 ? 282  SER B OG  1 
ATOM   4854 N N   . ASP B 1 221 ? 56.047 29.973  -17.072 1.00 25.51 ? 283  ASP B N   1 
ATOM   4855 C CA  . ASP B 1 221 ? 55.302 29.485  -15.922 1.00 25.20 ? 283  ASP B CA  1 
ATOM   4856 C C   . ASP B 1 221 ? 55.661 28.017  -15.691 1.00 24.91 ? 283  ASP B C   1 
ATOM   4857 O O   . ASP B 1 221 ? 55.285 27.164  -16.472 1.00 25.36 ? 283  ASP B O   1 
ATOM   4858 C CB  . ASP B 1 221 ? 53.801 29.641  -16.213 1.00 25.72 ? 283  ASP B CB  1 
ATOM   4859 C CG  . ASP B 1 221 ? 52.912 29.322  -15.021 1.00 27.11 ? 283  ASP B CG  1 
ATOM   4860 O OD1 . ASP B 1 221 ? 53.405 29.133  -13.889 1.00 29.12 ? 283  ASP B OD1 1 
ATOM   4861 O OD2 . ASP B 1 221 ? 51.678 29.260  -15.233 1.00 32.81 ? 283  ASP B OD2 1 
ATOM   4862 N N   . GLY B 1 222 ? 56.376 27.722  -14.613 1.00 24.31 ? 284  GLY B N   1 
ATOM   4863 C CA  . GLY B 1 222 ? 56.859 26.368  -14.368 1.00 23.17 ? 284  GLY B CA  1 
ATOM   4864 C C   . GLY B 1 222 ? 58.290 26.281  -13.860 1.00 22.55 ? 284  GLY B C   1 
ATOM   4865 O O   . GLY B 1 222 ? 58.847 27.269  -13.344 1.00 22.71 ? 284  GLY B O   1 
ATOM   4866 N N   . PRO B 1 223 ? 58.899 25.090  -13.975 1.00 21.39 ? 285  PRO B N   1 
ATOM   4867 C CA  . PRO B 1 223 ? 60.214 24.891  -13.382 1.00 21.22 ? 285  PRO B CA  1 
ATOM   4868 C C   . PRO B 1 223 ? 61.293 25.775  -13.987 1.00 20.68 ? 285  PRO B C   1 
ATOM   4869 O O   . PRO B 1 223 ? 61.077 26.410  -15.017 1.00 19.97 ? 285  PRO B O   1 
ATOM   4870 C CB  . PRO B 1 223 ? 60.510 23.412  -13.652 1.00 21.24 ? 285  PRO B CB  1 
ATOM   4871 C CG  . PRO B 1 223 ? 59.197 22.795  -13.988 1.00 21.42 ? 285  PRO B CG  1 
ATOM   4872 C CD  . PRO B 1 223 ? 58.401 23.871  -14.630 1.00 21.52 ? 285  PRO B CD  1 
ATOM   4873 N N   . ASN B 1 224 ? 62.453 25.786  -13.341 1.00 20.52 ? 286  ASN B N   1 
ATOM   4874 C CA  . ASN B 1 224 ? 63.531 26.701  -13.683 1.00 20.45 ? 286  ASN B CA  1 
ATOM   4875 C C   . ASN B 1 224 ? 64.260 26.329  -14.964 1.00 20.85 ? 286  ASN B C   1 
ATOM   4876 O O   . ASN B 1 224 ? 64.998 27.153  -15.512 1.00 20.94 ? 286  ASN B O   1 
ATOM   4877 C CB  . ASN B 1 224 ? 64.534 26.777  -12.536 1.00 19.80 ? 286  ASN B CB  1 
ATOM   4878 C CG  . ASN B 1 224 ? 63.978 27.485  -11.308 1.00 19.02 ? 286  ASN B CG  1 
ATOM   4879 O OD1 . ASN B 1 224 ? 62.870 28.031  -11.320 1.00 19.31 ? 286  ASN B OD1 1 
ATOM   4880 N ND2 . ASN B 1 224 ? 64.751 27.483  -10.252 1.00 15.60 ? 286  ASN B ND2 1 
ATOM   4881 N N   . ASP B 1 225 ? 64.086 25.093  -15.431 1.00 21.39 ? 287  ASP B N   1 
ATOM   4882 C CA  . ASP B 1 225 ? 64.625 24.701  -16.738 1.00 21.66 ? 287  ASP B CA  1 
ATOM   4883 C C   . ASP B 1 225 ? 63.839 25.329  -17.905 1.00 21.34 ? 287  ASP B C   1 
ATOM   4884 O O   . ASP B 1 225 ? 64.419 25.629  -18.933 1.00 21.51 ? 287  ASP B O   1 
ATOM   4885 C CB  . ASP B 1 225 ? 64.841 23.173  -16.865 1.00 22.31 ? 287  ASP B CB  1 
ATOM   4886 C CG  . ASP B 1 225 ? 63.546 22.344  -16.840 1.00 24.99 ? 287  ASP B CG  1 
ATOM   4887 O OD1 . ASP B 1 225 ? 62.453 22.869  -16.546 1.00 27.90 ? 287  ASP B OD1 1 
ATOM   4888 O OD2 . ASP B 1 225 ? 63.649 21.120  -17.121 1.00 28.14 ? 287  ASP B OD2 1 
ATOM   4889 N N   . LYS B 1 226 ? 62.544 25.575  -17.724 1.00 21.10 ? 288  LYS B N   1 
ATOM   4890 C CA  . LYS B 1 226 ? 61.753 26.332  -18.701 1.00 20.85 ? 288  LYS B CA  1 
ATOM   4891 C C   . LYS B 1 226 ? 62.126 27.816  -18.719 1.00 20.71 ? 288  LYS B C   1 
ATOM   4892 O O   . LYS B 1 226 ? 62.268 28.390  -19.806 1.00 20.60 ? 288  LYS B O   1 
ATOM   4893 C CB  . LYS B 1 226 ? 60.251 26.180  -18.434 1.00 21.40 ? 288  LYS B CB  1 
ATOM   4894 C CG  . LYS B 1 226 ? 59.753 24.745  -18.555 1.00 22.05 ? 288  LYS B CG  1 
ATOM   4895 C CD  . LYS B 1 226 ? 58.229 24.636  -18.630 1.00 22.29 ? 288  LYS B CD  1 
ATOM   4896 C CE  . LYS B 1 226 ? 57.816 23.158  -18.778 1.00 24.80 ? 288  LYS B CE  1 
ATOM   4897 N NZ  . LYS B 1 226 ? 56.344 22.885  -19.021 1.00 25.44 ? 288  LYS B NZ  1 
ATOM   4898 N N   . ILE B 1 227 ? 62.289 28.427  -17.532 1.00 19.44 ? 289  ILE B N   1 
ATOM   4899 C CA  . ILE B 1 227 ? 62.705 29.832  -17.409 1.00 19.14 ? 289  ILE B CA  1 
ATOM   4900 C C   . ILE B 1 227 ? 64.090 30.071  -18.030 1.00 19.19 ? 289  ILE B C   1 
ATOM   4901 O O   . ILE B 1 227 ? 64.343 31.110  -18.635 1.00 19.06 ? 289  ILE B O   1 
ATOM   4902 C CB  . ILE B 1 227 ? 62.736 30.298  -15.917 1.00 19.29 ? 289  ILE B CB  1 
ATOM   4903 C CG1 . ILE B 1 227 ? 61.329 30.262  -15.280 1.00 19.22 ? 289  ILE B CG1 1 
ATOM   4904 C CG2 . ILE B 1 227 ? 63.307 31.669  -15.780 1.00 18.02 ? 289  ILE B CG2 1 
ATOM   4905 C CD1 . ILE B 1 227 ? 61.339 30.413  -13.786 1.00 18.41 ? 289  ILE B CD1 1 
ATOM   4906 N N   . GLN B 1 228 ? 64.994 29.120  -17.838 1.00 19.17 ? 290  GLN B N   1 
ATOM   4907 C CA  . GLN B 1 228 ? 66.294 29.151  -18.467 1.00 19.17 ? 290  GLN B CA  1 
ATOM   4908 C C   . GLN B 1 228 ? 66.189 29.296  -20.000 1.00 18.79 ? 290  GLN B C   1 
ATOM   4909 O O   . GLN B 1 228 ? 66.879 30.118  -20.593 1.00 19.12 ? 290  GLN B O   1 
ATOM   4910 C CB  . GLN B 1 228 ? 67.058 27.879  -18.103 1.00 18.82 ? 290  GLN B CB  1 
ATOM   4911 C CG  . GLN B 1 228 ? 68.400 27.736  -18.774 1.00 20.56 ? 290  GLN B CG  1 
ATOM   4912 C CD  . GLN B 1 228 ? 69.203 26.549  -18.244 1.00 21.28 ? 290  GLN B CD  1 
ATOM   4913 O OE1 . GLN B 1 228 ? 68.671 25.451  -18.076 1.00 25.03 ? 290  GLN B OE1 1 
ATOM   4914 N NE2 . GLN B 1 228 ? 70.490 26.769  -17.987 1.00 23.34 ? 290  GLN B NE2 1 
ATOM   4915 N N   . ALA B 1 229 ? 65.334 28.495  -20.625 1.00 17.93 ? 291  ALA B N   1 
ATOM   4916 C CA  . ALA B 1 229 ? 65.129 28.538  -22.072 1.00 18.17 ? 291  ALA B CA  1 
ATOM   4917 C C   . ALA B 1 229 ? 64.518 29.860  -22.508 1.00 17.90 ? 291  ALA B C   1 
ATOM   4918 O O   . ALA B 1 229 ? 64.822 30.375  -23.572 1.00 17.78 ? 291  ALA B O   1 
ATOM   4919 C CB  . ALA B 1 229 ? 64.228 27.362  -22.531 1.00 17.50 ? 291  ALA B CB  1 
ATOM   4920 N N   . VAL B 1 230 ? 63.641 30.412  -21.687 1.00 18.06 ? 292  VAL B N   1 
ATOM   4921 C CA  . VAL B 1 230 ? 63.056 31.718  -21.979 1.00 17.99 ? 292  VAL B CA  1 
ATOM   4922 C C   . VAL B 1 230 ? 64.110 32.851  -21.863 1.00 18.48 ? 292  VAL B C   1 
ATOM   4923 O O   . VAL B 1 230 ? 64.164 33.741  -22.722 1.00 19.52 ? 292  VAL B O   1 
ATOM   4924 C CB  . VAL B 1 230 ? 61.819 31.953  -21.107 1.00 17.67 ? 292  VAL B CB  1 
ATOM   4925 C CG1 . VAL B 1 230 ? 61.251 33.352  -21.324 1.00 17.30 ? 292  VAL B CG1 1 
ATOM   4926 C CG2 . VAL B 1 230 ? 60.766 30.862  -21.418 1.00 16.47 ? 292  VAL B CG2 1 
ATOM   4927 N N   . ILE B 1 231 ? 64.978 32.792  -20.853 1.00 18.21 ? 293  ILE B N   1 
ATOM   4928 C CA  . ILE B 1 231 ? 66.049 33.795  -20.705 1.00 17.94 ? 293  ILE B CA  1 
ATOM   4929 C C   . ILE B 1 231 ? 67.055 33.680  -21.840 1.00 18.19 ? 293  ILE B C   1 
ATOM   4930 O O   . ILE B 1 231 ? 67.546 34.687  -22.363 1.00 19.07 ? 293  ILE B O   1 
ATOM   4931 C CB  . ILE B 1 231 ? 66.815 33.641  -19.364 1.00 17.95 ? 293  ILE B CB  1 
ATOM   4932 C CG1 . ILE B 1 231 ? 65.917 33.975  -18.190 1.00 16.35 ? 293  ILE B CG1 1 
ATOM   4933 C CG2 . ILE B 1 231 ? 68.074 34.548  -19.320 1.00 17.23 ? 293  ILE B CG2 1 
ATOM   4934 C CD1 . ILE B 1 231 ? 66.572 33.662  -16.851 1.00 17.57 ? 293  ILE B CD1 1 
ATOM   4935 N N   . ASP B 1 232 ? 67.379 32.440  -22.187 1.00 17.74 ? 294  ASP B N   1 
ATOM   4936 C CA  . ASP B 1 232 ? 68.233 32.133  -23.317 1.00 17.24 ? 294  ASP B CA  1 
ATOM   4937 C C   . ASP B 1 232 ? 67.762 32.729  -24.664 1.00 16.58 ? 294  ASP B C   1 
ATOM   4938 O O   . ASP B 1 232 ? 68.591 32.984  -25.515 1.00 14.54 ? 294  ASP B O   1 
ATOM   4939 C CB  . ASP B 1 232 ? 68.383 30.616  -23.456 1.00 17.48 ? 294  ASP B CB  1 
ATOM   4940 C CG  . ASP B 1 232 ? 69.340 30.004  -22.414 1.00 18.71 ? 294  ASP B CG  1 
ATOM   4941 O OD1 . ASP B 1 232 ? 70.036 30.767  -21.708 1.00 19.92 ? 294  ASP B OD1 1 
ATOM   4942 O OD2 . ASP B 1 232 ? 69.389 28.743  -22.312 1.00 20.35 ? 294  ASP B OD2 1 
ATOM   4943 N N   . ALA B 1 233 ? 66.449 32.923  -24.851 1.00 16.14 ? 295  ALA B N   1 
ATOM   4944 C CA  . ALA B 1 233 ? 65.919 33.606  -26.055 1.00 16.29 ? 295  ALA B CA  1 
ATOM   4945 C C   . ALA B 1 233 ? 66.220 35.116  -26.130 1.00 15.94 ? 295  ALA B C   1 
ATOM   4946 O O   . ALA B 1 233 ? 66.031 35.716  -27.175 1.00 15.70 ? 295  ALA B O   1 
ATOM   4947 C CB  . ALA B 1 233 ? 64.415 33.388  -26.192 1.00 16.35 ? 295  ALA B CB  1 
ATOM   4948 N N   . GLY B 1 234 ? 66.658 35.724  -25.033 1.00 16.08 ? 296  GLY B N   1 
ATOM   4949 C CA  . GLY B 1 234 ? 67.032 37.138  -25.005 1.00 16.49 ? 296  GLY B CA  1 
ATOM   4950 C C   . GLY B 1 234 ? 65.910 38.097  -24.627 1.00 16.90 ? 296  GLY B C   1 
ATOM   4951 O O   . GLY B 1 234 ? 66.123 39.319  -24.576 1.00 16.89 ? 296  GLY B O   1 
ATOM   4952 N N   . VAL B 1 235 ? 64.731 37.560  -24.330 1.00 17.43 ? 297  VAL B N   1 
ATOM   4953 C CA  . VAL B 1 235 ? 63.531 38.385  -24.172 1.00 18.05 ? 297  VAL B CA  1 
ATOM   4954 C C   . VAL B 1 235 ? 63.455 39.266  -22.920 1.00 18.68 ? 297  VAL B C   1 
ATOM   4955 O O   . VAL B 1 235 ? 62.573 40.122  -22.827 1.00 19.27 ? 297  VAL B O   1 
ATOM   4956 C CB  . VAL B 1 235 ? 62.261 37.508  -24.217 1.00 18.24 ? 297  VAL B CB  1 
ATOM   4957 C CG1 . VAL B 1 235 ? 62.209 36.773  -25.525 1.00 17.12 ? 297  VAL B CG1 1 
ATOM   4958 C CG2 . VAL B 1 235 ? 62.197 36.516  -23.009 1.00 18.16 ? 297  VAL B CG2 1 
ATOM   4959 N N   . CYS B 1 236 ? 64.373 39.116  -21.970 1.00 20.03 ? 298  CYS B N   1 
ATOM   4960 C CA  . CYS B 1 236 ? 64.175 39.772  -20.673 1.00 20.67 ? 298  CYS B CA  1 
ATOM   4961 C C   . CYS B 1 236 ? 64.217 41.285  -20.738 1.00 20.76 ? 298  CYS B C   1 
ATOM   4962 O O   . CYS B 1 236 ? 63.361 41.935  -20.132 1.00 20.68 ? 298  CYS B O   1 
ATOM   4963 C CB  . CYS B 1 236 ? 65.132 39.232  -19.615 1.00 21.24 ? 298  CYS B CB  1 
ATOM   4964 S SG  . CYS B 1 236 ? 64.537 37.662  -18.951 1.00 24.66 ? 298  CYS B SG  1 
ATOM   4965 N N   . ARG B 1 237 ? 65.181 41.854  -21.466 1.00 20.57 ? 299  ARG B N   1 
ATOM   4966 C CA  . ARG B 1 237 ? 65.288 43.304  -21.515 1.00 20.27 ? 299  ARG B CA  1 
ATOM   4967 C C   . ARG B 1 237 ? 64.067 43.961  -22.164 1.00 19.62 ? 299  ARG B C   1 
ATOM   4968 O O   . ARG B 1 237 ? 63.539 44.917  -21.636 1.00 19.90 ? 299  ARG B O   1 
ATOM   4969 C CB  . ARG B 1 237 ? 66.578 43.775  -22.193 1.00 20.46 ? 299  ARG B CB  1 
ATOM   4970 C CG  . ARG B 1 237 ? 66.805 45.275  -21.993 1.00 20.93 ? 299  ARG B CG  1 
ATOM   4971 C CD  . ARG B 1 237 ? 68.191 45.748  -22.354 1.00 21.63 ? 299  ARG B CD  1 
ATOM   4972 N NE  . ARG B 1 237 ? 69.189 45.335  -21.366 1.00 24.01 ? 299  ARG B NE  1 
ATOM   4973 C CZ  . ARG B 1 237 ? 69.353 45.859  -20.150 1.00 23.56 ? 299  ARG B CZ  1 
ATOM   4974 N NH1 . ARG B 1 237 ? 68.575 46.838  -19.703 1.00 25.09 ? 299  ARG B NH1 1 
ATOM   4975 N NH2 . ARG B 1 237 ? 70.305 45.384  -19.365 1.00 23.23 ? 299  ARG B NH2 1 
ATOM   4976 N N   . ARG B 1 238 ? 63.595 43.440  -23.284 1.00 19.60 ? 300  ARG B N   1 
ATOM   4977 C CA  . ARG B 1 238 ? 62.408 44.001  -23.923 1.00 19.91 ? 300  ARG B CA  1 
ATOM   4978 C C   . ARG B 1 238 ? 61.176 43.830  -23.044 1.00 19.13 ? 300  ARG B C   1 
ATOM   4979 O O   . ARG B 1 238 ? 60.366 44.734  -22.933 1.00 18.92 ? 300  ARG B O   1 
ATOM   4980 C CB  . ARG B 1 238 ? 62.179 43.387  -25.317 1.00 20.03 ? 300  ARG B CB  1 
ATOM   4981 C CG  . ARG B 1 238 ? 63.155 43.889  -26.364 1.00 21.73 ? 300  ARG B CG  1 
ATOM   4982 C CD  . ARG B 1 238 ? 62.940 45.353  -26.671 1.00 24.37 ? 300  ARG B CD  1 
ATOM   4983 N NE  . ARG B 1 238 ? 61.625 45.593  -27.271 1.00 26.08 ? 300  ARG B NE  1 
ATOM   4984 C CZ  . ARG B 1 238 ? 60.794 46.591  -26.952 1.00 26.32 ? 300  ARG B CZ  1 
ATOM   4985 N NH1 . ARG B 1 238 ? 61.112 47.478  -26.017 1.00 26.18 ? 300  ARG B NH1 1 
ATOM   4986 N NH2 . ARG B 1 238 ? 59.615 46.697  -27.565 1.00 25.30 ? 300  ARG B NH2 1 
ATOM   4987 N N   . LEU B 1 239 ? 61.046 42.664  -22.430 1.00 19.42 ? 301  LEU B N   1 
ATOM   4988 C CA  . LEU B 1 239 ? 59.953 42.384  -21.467 1.00 19.95 ? 301  LEU B CA  1 
ATOM   4989 C C   . LEU B 1 239 ? 59.892 43.440  -20.346 1.00 19.87 ? 301  LEU B C   1 
ATOM   4990 O O   . LEU B 1 239 ? 58.827 43.934  -20.025 1.00 19.81 ? 301  LEU B O   1 
ATOM   4991 C CB  . LEU B 1 239 ? 60.132 40.987  -20.846 1.00 20.17 ? 301  LEU B CB  1 
ATOM   4992 C CG  . LEU B 1 239 ? 59.169 39.819  -21.128 1.00 20.78 ? 301  LEU B CG  1 
ATOM   4993 C CD1 . LEU B 1 239 ? 58.398 39.954  -22.412 1.00 20.32 ? 301  LEU B CD1 1 
ATOM   4994 C CD2 . LEU B 1 239 ? 59.919 38.476  -21.022 1.00 20.37 ? 301  LEU B CD2 1 
ATOM   4995 N N   . VAL B 1 240 ? 61.039 43.768  -19.754 1.00 19.76 ? 302  VAL B N   1 
ATOM   4996 C CA  . VAL B 1 240 ? 61.097 44.781  -18.705 1.00 19.73 ? 302  VAL B CA  1 
ATOM   4997 C C   . VAL B 1 240 ? 60.890 46.202  -19.236 1.00 20.09 ? 302  VAL B C   1 
ATOM   4998 O O   . VAL B 1 240 ? 60.376 47.056  -18.512 1.00 19.97 ? 302  VAL B O   1 
ATOM   4999 C CB  . VAL B 1 240 ? 62.414 44.688  -17.882 1.00 19.84 ? 302  VAL B CB  1 
ATOM   5000 C CG1 . VAL B 1 240 ? 62.527 45.837  -16.897 1.00 19.37 ? 302  VAL B CG1 1 
ATOM   5001 C CG2 . VAL B 1 240 ? 62.493 43.342  -17.153 1.00 18.72 ? 302  VAL B CG2 1 
ATOM   5002 N N   . GLU B 1 241 ? 61.267 46.458  -20.491 1.00 20.35 ? 303  GLU B N   1 
ATOM   5003 C CA  . GLU B 1 241 ? 61.000 47.744  -21.116 1.00 20.77 ? 303  GLU B CA  1 
ATOM   5004 C C   . GLU B 1 241 ? 59.502 47.937  -21.389 1.00 20.69 ? 303  GLU B C   1 
ATOM   5005 O O   . GLU B 1 241 ? 59.009 49.048  -21.322 1.00 20.83 ? 303  GLU B O   1 
ATOM   5006 C CB  . GLU B 1 241 ? 61.815 47.900  -22.413 1.00 21.10 ? 303  GLU B CB  1 
ATOM   5007 C CG  . GLU B 1 241 ? 63.308 48.194  -22.154 1.00 22.02 ? 303  GLU B CG  1 
ATOM   5008 C CD  . GLU B 1 241 ? 64.153 48.264  -23.431 1.00 22.90 ? 303  GLU B CD  1 
ATOM   5009 O OE1 . GLU B 1 241 ? 63.609 48.062  -24.542 1.00 22.05 ? 303  GLU B OE1 1 
ATOM   5010 O OE2 . GLU B 1 241 ? 65.379 48.532  -23.319 1.00 26.91 ? 303  GLU B OE2 1 
ATOM   5011 N N   . LEU B 1 242 ? 58.790 46.853  -21.683 1.00 20.75 ? 304  LEU B N   1 
ATOM   5012 C CA  . LEU B 1 242 ? 57.353 46.914  -21.958 1.00 20.97 ? 304  LEU B CA  1 
ATOM   5013 C C   . LEU B 1 242 ? 56.497 47.099  -20.695 1.00 21.18 ? 304  LEU B C   1 
ATOM   5014 O O   . LEU B 1 242 ? 55.303 47.345  -20.813 1.00 20.44 ? 304  LEU B O   1 
ATOM   5015 C CB  . LEU B 1 242 ? 56.879 45.675  -22.752 1.00 20.50 ? 304  LEU B CB  1 
ATOM   5016 C CG  . LEU B 1 242 ? 57.277 45.595  -24.231 1.00 19.94 ? 304  LEU B CG  1 
ATOM   5017 C CD1 . LEU B 1 242 ? 57.024 44.210  -24.828 1.00 19.96 ? 304  LEU B CD1 1 
ATOM   5018 C CD2 . LEU B 1 242 ? 56.581 46.666  -25.060 1.00 19.09 ? 304  LEU B CD2 1 
ATOM   5019 N N   . LEU B 1 243 ? 57.098 46.968  -19.504 1.00 21.98 ? 305  LEU B N   1 
ATOM   5020 C CA  . LEU B 1 243 ? 56.433 47.349  -18.235 1.00 22.20 ? 305  LEU B CA  1 
ATOM   5021 C C   . LEU B 1 243 ? 56.027 48.838  -18.191 1.00 23.04 ? 305  LEU B C   1 
ATOM   5022 O O   . LEU B 1 243 ? 55.077 49.203  -17.498 1.00 23.34 ? 305  LEU B O   1 
ATOM   5023 C CB  . LEU B 1 243 ? 57.328 47.046  -17.029 1.00 22.06 ? 305  LEU B CB  1 
ATOM   5024 C CG  . LEU B 1 243 ? 57.724 45.594  -16.754 1.00 21.03 ? 305  LEU B CG  1 
ATOM   5025 C CD1 . LEU B 1 243 ? 58.634 45.531  -15.537 1.00 20.81 ? 305  LEU B CD1 1 
ATOM   5026 C CD2 . LEU B 1 243 ? 56.516 44.698  -16.561 1.00 18.82 ? 305  LEU B CD2 1 
ATOM   5027 N N   . MET B 1 244 ? 56.765 49.684  -18.923 1.00 23.89 ? 306  MET B N   1 
ATOM   5028 C CA  . MET B 1 244 ? 56.477 51.112  -19.054 1.00 23.92 ? 306  MET B CA  1 
ATOM   5029 C C   . MET B 1 244 ? 55.585 51.458  -20.254 1.00 24.05 ? 306  MET B C   1 
ATOM   5030 O O   . MET B 1 244 ? 55.430 52.622  -20.624 1.00 24.23 ? 306  MET B O   1 
ATOM   5031 C CB  . MET B 1 244 ? 57.789 51.888  -19.131 1.00 24.43 ? 306  MET B CB  1 
ATOM   5032 C CG  . MET B 1 244 ? 58.614 51.828  -17.848 1.00 25.95 ? 306  MET B CG  1 
ATOM   5033 S SD  . MET B 1 244 ? 57.833 52.693  -16.462 1.00 29.34 ? 306  MET B SD  1 
ATOM   5034 C CE  . MET B 1 244 ? 56.626 51.486  -15.959 1.00 28.92 ? 306  MET B CE  1 
ATOM   5035 N N   . HIS B 1 245 ? 54.961 50.459  -20.848 1.00 24.17 ? 307  HIS B N   1 
ATOM   5036 C CA  . HIS B 1 245 ? 54.085 50.711  -21.976 1.00 24.40 ? 307  HIS B CA  1 
ATOM   5037 C C   . HIS B 1 245 ? 52.842 51.488  -21.519 1.00 24.49 ? 307  HIS B C   1 
ATOM   5038 O O   . HIS B 1 245 ? 52.454 51.421  -20.351 1.00 24.61 ? 307  HIS B O   1 
ATOM   5039 C CB  . HIS B 1 245 ? 53.694 49.388  -22.631 1.00 24.19 ? 307  HIS B CB  1 
ATOM   5040 C CG  . HIS B 1 245 ? 53.297 49.521  -24.063 1.00 24.33 ? 307  HIS B CG  1 
ATOM   5041 N ND1 . HIS B 1 245 ? 52.063 49.993  -24.454 1.00 24.08 ? 307  HIS B ND1 1 
ATOM   5042 C CD2 . HIS B 1 245 ? 53.970 49.236  -25.201 1.00 24.37 ? 307  HIS B CD2 1 
ATOM   5043 C CE1 . HIS B 1 245 ? 51.994 50.002  -25.772 1.00 24.33 ? 307  HIS B CE1 1 
ATOM   5044 N NE2 . HIS B 1 245 ? 53.136 49.541  -26.250 1.00 24.66 ? 307  HIS B NE2 1 
ATOM   5045 N N   . ASN B 1 246 ? 52.258 52.231  -22.458 1.00 24.95 ? 308  ASN B N   1 
ATOM   5046 C CA  . ASN B 1 246 ? 51.028 53.019  -22.271 1.00 25.15 ? 308  ASN B CA  1 
ATOM   5047 C C   . ASN B 1 246 ? 49.725 52.209  -22.133 1.00 25.07 ? 308  ASN B C   1 
ATOM   5048 O O   . ASN B 1 246 ? 48.759 52.675  -21.520 1.00 25.13 ? 308  ASN B O   1 
ATOM   5049 C CB  . ASN B 1 246 ? 50.856 53.980  -23.463 1.00 25.59 ? 308  ASN B CB  1 
ATOM   5050 C CG  . ASN B 1 246 ? 51.702 55.252  -23.335 1.00 27.21 ? 308  ASN B CG  1 
ATOM   5051 O OD1 . ASN B 1 246 ? 52.196 55.593  -22.243 1.00 29.61 ? 308  ASN B OD1 1 
ATOM   5052 N ND2 . ASN B 1 246 ? 51.850 55.978  -24.455 1.00 25.68 ? 308  ASN B ND2 1 
ATOM   5053 N N   . ASP B 1 247 ? 49.706 51.008  -22.700 1.00 24.74 ? 309  ASP B N   1 
ATOM   5054 C CA  . ASP B 1 247 ? 48.502 50.189  -22.792 1.00 24.55 ? 309  ASP B CA  1 
ATOM   5055 C C   . ASP B 1 247 ? 48.559 49.008  -21.812 1.00 24.34 ? 309  ASP B C   1 
ATOM   5056 O O   . ASP B 1 247 ? 49.486 48.197  -21.855 1.00 24.16 ? 309  ASP B O   1 
ATOM   5057 C CB  . ASP B 1 247 ? 48.357 49.686  -24.233 1.00 24.70 ? 309  ASP B CB  1 
ATOM   5058 C CG  . ASP B 1 247 ? 46.942 49.243  -24.575 1.00 25.14 ? 309  ASP B CG  1 
ATOM   5059 O OD1 . ASP B 1 247 ? 46.225 48.729  -23.696 1.00 26.20 ? 309  ASP B OD1 1 
ATOM   5060 O OD2 . ASP B 1 247 ? 46.551 49.390  -25.750 1.00 28.44 ? 309  ASP B OD2 1 
ATOM   5061 N N   . TYR B 1 248 ? 47.555 48.915  -20.940 1.00 24.20 ? 310  TYR B N   1 
ATOM   5062 C CA  . TYR B 1 248 ? 47.448 47.809  -19.990 1.00 23.92 ? 310  TYR B CA  1 
ATOM   5063 C C   . TYR B 1 248 ? 47.403 46.446  -20.673 1.00 23.55 ? 310  TYR B C   1 
ATOM   5064 O O   . TYR B 1 248 ? 47.816 45.453  -20.075 1.00 23.93 ? 310  TYR B O   1 
ATOM   5065 C CB  . TYR B 1 248 ? 46.226 47.974  -19.067 1.00 24.28 ? 310  TYR B CB  1 
ATOM   5066 C CG  . TYR B 1 248 ? 46.288 49.185  -18.143 1.00 24.48 ? 310  TYR B CG  1 
ATOM   5067 C CD1 . TYR B 1 248 ? 47.414 49.449  -17.378 1.00 24.40 ? 310  TYR B CD1 1 
ATOM   5068 C CD2 . TYR B 1 248 ? 45.199 50.062  -18.032 1.00 25.94 ? 310  TYR B CD2 1 
ATOM   5069 C CE1 . TYR B 1 248 ? 47.471 50.544  -16.537 1.00 24.82 ? 310  TYR B CE1 1 
ATOM   5070 C CE2 . TYR B 1 248 ? 45.247 51.167  -17.193 1.00 25.26 ? 310  TYR B CE2 1 
ATOM   5071 C CZ  . TYR B 1 248 ? 46.384 51.402  -16.454 1.00 25.15 ? 310  TYR B CZ  1 
ATOM   5072 O OH  . TYR B 1 248 ? 46.436 52.497  -15.627 1.00 26.44 ? 310  TYR B OH  1 
ATOM   5073 N N   . LYS B 1 249 ? 46.930 46.393  -21.916 1.00 22.85 ? 311  LYS B N   1 
ATOM   5074 C CA  . LYS B 1 249 ? 46.940 45.143  -22.681 1.00 22.96 ? 311  LYS B CA  1 
ATOM   5075 C C   . LYS B 1 249 ? 48.341 44.563  -22.861 1.00 22.39 ? 311  LYS B C   1 
ATOM   5076 O O   . LYS B 1 249 ? 48.489 43.356  -23.038 1.00 22.32 ? 311  LYS B O   1 
ATOM   5077 C CB  . LYS B 1 249 ? 46.331 45.335  -24.068 1.00 23.20 ? 311  LYS B CB  1 
ATOM   5078 C CG  . LYS B 1 249 ? 44.825 45.397  -24.076 1.00 23.64 ? 311  LYS B CG  1 
ATOM   5079 C CD  . LYS B 1 249 ? 44.300 45.607  -25.494 1.00 24.17 ? 311  LYS B CD  1 
ATOM   5080 C CE  . LYS B 1 249 ? 42.889 46.227  -25.468 1.00 25.31 ? 311  LYS B CE  1 
ATOM   5081 N NZ  . LYS B 1 249 ? 42.347 46.475  -26.842 1.00 25.10 ? 311  LYS B NZ  1 
ATOM   5082 N N   . VAL B 1 250 ? 49.348 45.431  -22.870 1.00 21.58 ? 312  VAL B N   1 
ATOM   5083 C CA  . VAL B 1 250 ? 50.730 44.999  -22.993 1.00 21.50 ? 312  VAL B CA  1 
ATOM   5084 C C   . VAL B 1 250 ? 51.357 44.820  -21.621 1.00 20.75 ? 312  VAL B C   1 
ATOM   5085 O O   . VAL B 1 250 ? 52.018 43.827  -21.387 1.00 20.83 ? 312  VAL B O   1 
ATOM   5086 C CB  . VAL B 1 250 ? 51.562 45.993  -23.819 1.00 21.34 ? 312  VAL B CB  1 
ATOM   5087 C CG1 . VAL B 1 250 ? 52.976 45.470  -23.975 1.00 21.59 ? 312  VAL B CG1 1 
ATOM   5088 C CG2 . VAL B 1 250 ? 50.929 46.195  -25.167 1.00 20.93 ? 312  VAL B CG2 1 
ATOM   5089 N N   . VAL B 1 251 ? 51.120 45.774  -20.720 1.00 20.51 ? 313  VAL B N   1 
ATOM   5090 C CA  . VAL B 1 251 ? 51.684 45.747  -19.373 1.00 20.48 ? 313  VAL B CA  1 
ATOM   5091 C C   . VAL B 1 251 ? 51.300 44.478  -18.599 1.00 20.42 ? 313  VAL B C   1 
ATOM   5092 O O   . VAL B 1 251 ? 52.160 43.869  -17.969 1.00 19.81 ? 313  VAL B O   1 
ATOM   5093 C CB  . VAL B 1 251 ? 51.258 46.993  -18.539 1.00 20.38 ? 313  VAL B CB  1 
ATOM   5094 C CG1 . VAL B 1 251 ? 51.721 46.873  -17.101 1.00 20.19 ? 313  VAL B CG1 1 
ATOM   5095 C CG2 . VAL B 1 251 ? 51.781 48.296  -19.164 1.00 20.15 ? 313  VAL B CG2 1 
ATOM   5096 N N   . SER B 1 252 ? 50.021 44.079  -18.642 1.00 20.51 ? 314  SER B N   1 
ATOM   5097 C CA  . SER B 1 252 ? 49.566 42.908  -17.871 1.00 20.33 ? 314  SER B CA  1 
ATOM   5098 C C   . SER B 1 252 ? 50.327 41.633  -18.234 1.00 19.99 ? 314  SER B C   1 
ATOM   5099 O O   . SER B 1 252 ? 50.901 41.000  -17.361 1.00 20.95 ? 314  SER B O   1 
ATOM   5100 C CB  . SER B 1 252 ? 48.053 42.670  -18.009 1.00 20.50 ? 314  SER B CB  1 
ATOM   5101 O OG  . SER B 1 252 ? 47.319 43.815  -17.613 1.00 22.39 ? 314  SER B OG  1 
ATOM   5102 N N   . PRO B 1 253 ? 50.339 41.244  -19.516 1.00 19.36 ? 315  PRO B N   1 
ATOM   5103 C CA  . PRO B 1 253 ? 51.101 40.067  -19.851 1.00 18.93 ? 315  PRO B CA  1 
ATOM   5104 C C   . PRO B 1 253 ? 52.596 40.218  -19.684 1.00 18.51 ? 315  PRO B C   1 
ATOM   5105 O O   . PRO B 1 253 ? 53.235 39.272  -19.281 1.00 18.65 ? 315  PRO B O   1 
ATOM   5106 C CB  . PRO B 1 253 ? 50.741 39.822  -21.324 1.00 19.08 ? 315  PRO B CB  1 
ATOM   5107 C CG  . PRO B 1 253 ? 50.306 41.093  -21.848 1.00 18.77 ? 315  PRO B CG  1 
ATOM   5108 C CD  . PRO B 1 253 ? 49.653 41.798  -20.698 1.00 19.50 ? 315  PRO B CD  1 
ATOM   5109 N N   . ALA B 1 254 ? 53.163 41.380  -19.985 1.00 18.78 ? 316  ALA B N   1 
ATOM   5110 C CA  . ALA B 1 254 ? 54.615 41.594  -19.805 1.00 19.03 ? 316  ALA B CA  1 
ATOM   5111 C C   . ALA B 1 254 ? 55.022 41.425  -18.338 1.00 19.48 ? 316  ALA B C   1 
ATOM   5112 O O   . ALA B 1 254 ? 56.064 40.825  -18.035 1.00 19.42 ? 316  ALA B O   1 
ATOM   5113 C CB  . ALA B 1 254 ? 55.034 42.973  -20.322 1.00 18.77 ? 316  ALA B CB  1 
ATOM   5114 N N   . LEU B 1 255 ? 54.191 41.950  -17.434 1.00 20.08 ? 317  LEU B N   1 
ATOM   5115 C CA  . LEU B 1 255 ? 54.417 41.846  -15.983 1.00 20.08 ? 317  LEU B CA  1 
ATOM   5116 C C   . LEU B 1 255 ? 54.280 40.396  -15.500 1.00 20.61 ? 317  LEU B C   1 
ATOM   5117 O O   . LEU B 1 255 ? 54.980 39.982  -14.601 1.00 21.08 ? 317  LEU B O   1 
ATOM   5118 C CB  . LEU B 1 255 ? 53.444 42.771  -15.239 1.00 20.00 ? 317  LEU B CB  1 
ATOM   5119 C CG  . LEU B 1 255 ? 53.509 42.927  -13.715 1.00 19.83 ? 317  LEU B CG  1 
ATOM   5120 C CD1 . LEU B 1 255 ? 54.930 43.280  -13.211 1.00 17.20 ? 317  LEU B CD1 1 
ATOM   5121 C CD2 . LEU B 1 255 ? 52.488 43.990  -13.280 1.00 18.88 ? 317  LEU B CD2 1 
ATOM   5122 N N   . ARG B 1 256 ? 53.381 39.630  -16.114 1.00 21.33 ? 318  ARG B N   1 
ATOM   5123 C CA  . ARG B 1 256 ? 53.252 38.200  -15.846 1.00 20.63 ? 318  ARG B CA  1 
ATOM   5124 C C   . ARG B 1 256 ? 54.532 37.425  -16.201 1.00 20.40 ? 318  ARG B C   1 
ATOM   5125 O O   . ARG B 1 256 ? 55.030 36.619  -15.416 1.00 20.30 ? 318  ARG B O   1 
ATOM   5126 C CB  . ARG B 1 256 ? 52.096 37.651  -16.650 1.00 22.05 ? 318  ARG B CB  1 
ATOM   5127 C CG  . ARG B 1 256 ? 51.489 36.377  -16.126 1.00 23.96 ? 318  ARG B CG  1 
ATOM   5128 C CD  . ARG B 1 256 ? 50.331 36.673  -15.208 1.00 31.33 ? 318  ARG B CD  1 
ATOM   5129 N NE  . ARG B 1 256 ? 49.276 35.659  -15.339 1.00 34.08 ? 318  ARG B NE  1 
ATOM   5130 C CZ  . ARG B 1 256 ? 48.007 35.858  -14.992 1.00 36.25 ? 318  ARG B CZ  1 
ATOM   5131 N NH1 . ARG B 1 256 ? 47.618 37.031  -14.491 1.00 37.07 ? 318  ARG B NH1 1 
ATOM   5132 N NH2 . ARG B 1 256 ? 47.116 34.881  -15.143 1.00 36.72 ? 318  ARG B NH2 1 
ATOM   5133 N N   . ALA B 1 257 ? 55.080 37.688  -17.371 1.00 19.27 ? 319  ALA B N   1 
ATOM   5134 C CA  . ALA B 1 257 ? 56.292 37.028  -17.792 1.00 19.55 ? 319  ALA B CA  1 
ATOM   5135 C C   . ALA B 1 257 ? 57.424 37.349  -16.822 1.00 19.23 ? 319  ALA B C   1 
ATOM   5136 O O   . ALA B 1 257 ? 58.082 36.462  -16.309 1.00 19.79 ? 319  ALA B O   1 
ATOM   5137 C CB  . ALA B 1 257 ? 56.676 37.441  -19.266 1.00 18.62 ? 319  ALA B CB  1 
ATOM   5138 N N   . VAL B 1 258 ? 57.633 38.630  -16.577 1.00 19.39 ? 320  VAL B N   1 
ATOM   5139 C CA  . VAL B 1 258 ? 58.677 39.110  -15.682 1.00 19.42 ? 320  VAL B CA  1 
ATOM   5140 C C   . VAL B 1 258 ? 58.553 38.473  -14.303 1.00 19.77 ? 320  VAL B C   1 
ATOM   5141 O O   . VAL B 1 258 ? 59.526 37.969  -13.746 1.00 19.83 ? 320  VAL B O   1 
ATOM   5142 C CB  . VAL B 1 258 ? 58.610 40.646  -15.569 1.00 19.12 ? 320  VAL B CB  1 
ATOM   5143 C CG1 . VAL B 1 258 ? 59.516 41.172  -14.433 1.00 19.21 ? 320  VAL B CG1 1 
ATOM   5144 C CG2 . VAL B 1 258 ? 58.977 41.283  -16.913 1.00 17.21 ? 320  VAL B CG2 1 
ATOM   5145 N N   . GLY B 1 259 ? 57.339 38.462  -13.777 1.00 19.95 ? 321  GLY B N   1 
ATOM   5146 C CA  . GLY B 1 259 ? 57.080 37.862  -12.488 1.00 19.86 ? 321  GLY B CA  1 
ATOM   5147 C C   . GLY B 1 259 ? 57.342 36.373  -12.448 1.00 19.74 ? 321  GLY B C   1 
ATOM   5148 O O   . GLY B 1 259 ? 57.689 35.827  -11.400 1.00 20.21 ? 321  GLY B O   1 
ATOM   5149 N N   . ASN B 1 260 ? 57.158 35.705  -13.579 1.00 20.13 ? 322  ASN B N   1 
ATOM   5150 C CA  . ASN B 1 260 ? 57.350 34.257  -13.651 1.00 19.73 ? 322  ASN B CA  1 
ATOM   5151 C C   . ASN B 1 260 ? 58.842 33.938  -13.705 1.00 19.34 ? 322  ASN B C   1 
ATOM   5152 O O   . ASN B 1 260 ? 59.297 32.950  -13.143 1.00 19.84 ? 322  ASN B O   1 
ATOM   5153 C CB  . ASN B 1 260 ? 56.624 33.673  -14.864 1.00 20.33 ? 322  ASN B CB  1 
ATOM   5154 C CG  . ASN B 1 260 ? 55.154 33.335  -14.582 1.00 20.75 ? 322  ASN B CG  1 
ATOM   5155 O OD1 . ASN B 1 260 ? 54.733 33.199  -13.428 1.00 22.73 ? 322  ASN B OD1 1 
ATOM   5156 N ND2 . ASN B 1 260 ? 54.378 33.165  -15.655 1.00 20.31 ? 322  ASN B ND2 1 
ATOM   5157 N N   . ILE B 1 261 ? 59.590 34.784  -14.394 1.00 18.53 ? 323  ILE B N   1 
ATOM   5158 C CA  . ILE B 1 261 ? 61.034 34.637  -14.509 1.00 18.81 ? 323  ILE B CA  1 
ATOM   5159 C C   . ILE B 1 261 ? 61.682 34.763  -13.116 1.00 18.32 ? 323  ILE B C   1 
ATOM   5160 O O   . ILE B 1 261 ? 62.539 33.971  -12.765 1.00 17.57 ? 323  ILE B O   1 
ATOM   5161 C CB  . ILE B 1 261 ? 61.612 35.635  -15.567 1.00 18.61 ? 323  ILE B CB  1 
ATOM   5162 C CG1 . ILE B 1 261 ? 61.149 35.224  -16.967 1.00 19.74 ? 323  ILE B CG1 1 
ATOM   5163 C CG2 . ILE B 1 261 ? 63.114 35.698  -15.517 1.00 17.65 ? 323  ILE B CG2 1 
ATOM   5164 C CD1 . ILE B 1 261 ? 61.390 36.277  -18.083 1.00 19.34 ? 323  ILE B CD1 1 
ATOM   5165 N N   . VAL B 1 262 ? 61.223 35.711  -12.307 1.00 18.18 ? 324  VAL B N   1 
ATOM   5166 C CA  . VAL B 1 262 ? 61.763 35.895  -10.957 1.00 17.86 ? 324  VAL B CA  1 
ATOM   5167 C C   . VAL B 1 262 ? 61.277 34.900  -9.912  1.00 18.09 ? 324  VAL B C   1 
ATOM   5168 O O   . VAL B 1 262 ? 61.657 35.029  -8.775  1.00 18.47 ? 324  VAL B O   1 
ATOM   5169 C CB  . VAL B 1 262 ? 61.571 37.332  -10.428 1.00 18.40 ? 324  VAL B CB  1 
ATOM   5170 C CG1 . VAL B 1 262 ? 62.285 38.293  -11.345 1.00 16.57 ? 324  VAL B CG1 1 
ATOM   5171 C CG2 . VAL B 1 262 ? 60.041 37.701  -10.243 1.00 16.30 ? 324  VAL B CG2 1 
ATOM   5172 N N   . THR B 1 263 ? 60.461 33.908  -10.290 1.00 17.59 ? 325  THR B N   1 
ATOM   5173 C CA  . THR B 1 263 ? 60.323 32.695  -9.501  1.00 17.50 ? 325  THR B CA  1 
ATOM   5174 C C   . THR B 1 263 ? 61.541 31.743  -9.731  1.00 18.21 ? 325  THR B C   1 
ATOM   5175 O O   . THR B 1 263 ? 61.680 30.708  -9.055  1.00 17.86 ? 325  THR B O   1 
ATOM   5176 C CB  . THR B 1 263 ? 59.023 31.927  -9.836  1.00 17.29 ? 325  THR B CB  1 
ATOM   5177 O OG1 . THR B 1 263 ? 59.210 31.210  -11.055 1.00 15.27 ? 325  THR B OG1 1 
ATOM   5178 C CG2 . THR B 1 263 ? 57.804 32.884  -9.989  1.00 16.07 ? 325  THR B CG2 1 
ATOM   5179 N N   . GLY B 1 264 ? 62.417 32.096  -10.668 1.00 18.16 ? 326  GLY B N   1 
ATOM   5180 C CA  . GLY B 1 264 ? 63.642 31.355  -10.917 1.00 18.79 ? 326  GLY B CA  1 
ATOM   5181 C C   . GLY B 1 264 ? 64.604 31.441  -9.772  1.00 19.20 ? 326  GLY B C   1 
ATOM   5182 O O   . GLY B 1 264 ? 64.314 32.091  -8.783  1.00 21.11 ? 326  GLY B O   1 
ATOM   5183 N N   . ASP B 1 265 ? 65.760 30.799  -9.889  1.00 20.07 ? 327  ASP B N   1 
ATOM   5184 C CA  . ASP B 1 265 ? 66.798 30.913  -8.857  1.00 20.10 ? 327  ASP B CA  1 
ATOM   5185 C C   . ASP B 1 265 ? 67.404 32.299  -8.847  1.00 20.17 ? 327  ASP B C   1 
ATOM   5186 O O   . ASP B 1 265 ? 66.969 33.166  -9.592  1.00 20.72 ? 327  ASP B O   1 
ATOM   5187 C CB  . ASP B 1 265 ? 67.862 29.813  -9.011  1.00 20.40 ? 327  ASP B CB  1 
ATOM   5188 C CG  . ASP B 1 265 ? 68.709 29.952  -10.267 1.00 21.75 ? 327  ASP B CG  1 
ATOM   5189 O OD1 . ASP B 1 265 ? 68.933 31.082  -10.743 1.00 22.87 ? 327  ASP B OD1 1 
ATOM   5190 O OD2 . ASP B 1 265 ? 69.196 28.898  -10.753 1.00 22.73 ? 327  ASP B OD2 1 
ATOM   5191 N N   . ASP B 1 266 ? 68.411 32.518  -8.018  1.00 20.39 ? 328  ASP B N   1 
ATOM   5192 C CA  . ASP B 1 266 ? 68.957 33.858  -7.811  1.00 20.74 ? 328  ASP B CA  1 
ATOM   5193 C C   . ASP B 1 266 ? 69.609 34.480  -9.047  1.00 20.90 ? 328  ASP B C   1 
ATOM   5194 O O   . ASP B 1 266 ? 69.580 35.703  -9.227  1.00 21.54 ? 328  ASP B O   1 
ATOM   5195 C CB  . ASP B 1 266 ? 69.955 33.836  -6.651  1.00 21.37 ? 328  ASP B CB  1 
ATOM   5196 C CG  . ASP B 1 266 ? 69.278 33.625  -5.285  1.00 23.03 ? 328  ASP B CG  1 
ATOM   5197 O OD1 . ASP B 1 266 ? 68.011 33.540  -5.195  1.00 22.35 ? 328  ASP B OD1 1 
ATOM   5198 O OD2 . ASP B 1 266 ? 70.046 33.548  -4.301  1.00 24.35 ? 328  ASP B OD2 1 
ATOM   5199 N N   . ILE B 1 267 ? 70.174 33.638  -9.897  1.00 20.73 ? 329  ILE B N   1 
ATOM   5200 C CA  . ILE B 1 267 ? 70.818 34.067  -11.126 1.00 20.27 ? 329  ILE B CA  1 
ATOM   5201 C C   . ILE B 1 267 ? 69.789 34.442  -12.155 1.00 19.74 ? 329  ILE B C   1 
ATOM   5202 O O   . ILE B 1 267 ? 69.927 35.445  -12.829 1.00 19.05 ? 329  ILE B O   1 
ATOM   5203 C CB  . ILE B 1 267 ? 71.699 32.969  -11.678 1.00 20.40 ? 329  ILE B CB  1 
ATOM   5204 C CG1 . ILE B 1 267 ? 72.876 32.782  -10.728 1.00 20.70 ? 329  ILE B CG1 1 
ATOM   5205 C CG2 . ILE B 1 267 ? 72.153 33.297  -13.128 1.00 20.97 ? 329  ILE B CG2 1 
ATOM   5206 C CD1 . ILE B 1 267 ? 73.748 31.591  -11.035 1.00 21.06 ? 329  ILE B CD1 1 
ATOM   5207 N N   . GLN B 1 268 ? 68.753 33.620  -12.280 1.00 19.15 ? 330  GLN B N   1 
ATOM   5208 C CA  . GLN B 1 268 ? 67.680 33.923  -13.178 1.00 18.85 ? 330  GLN B CA  1 
ATOM   5209 C C   . GLN B 1 268 ? 67.013 35.226  -12.759 1.00 19.40 ? 330  GLN B C   1 
ATOM   5210 O O   . GLN B 1 268 ? 66.685 36.073  -13.604 1.00 19.20 ? 330  GLN B O   1 
ATOM   5211 C CB  . GLN B 1 268 ? 66.684 32.754  -13.224 1.00 19.65 ? 330  GLN B CB  1 
ATOM   5212 C CG  . GLN B 1 268 ? 67.283 31.462  -13.816 1.00 18.54 ? 330  GLN B CG  1 
ATOM   5213 C CD  . GLN B 1 268 ? 66.331 30.274  -13.819 1.00 18.74 ? 330  GLN B CD  1 
ATOM   5214 O OE1 . GLN B 1 268 ? 65.635 30.027  -12.839 1.00 19.54 ? 330  GLN B OE1 1 
ATOM   5215 N NE2 . GLN B 1 268 ? 66.304 29.527  -14.926 1.00 16.97 ? 330  GLN B NE2 1 
ATOM   5216 N N   . THR B 1 269 ? 66.806 35.417  -11.454 1.00 19.66 ? 331  THR B N   1 
ATOM   5217 C CA  . THR B 1 269 ? 66.174 36.670  -11.000 1.00 19.25 ? 331  THR B CA  1 
ATOM   5218 C C   . THR B 1 269 ? 67.150 37.877  -11.116 1.00 18.87 ? 331  THR B C   1 
ATOM   5219 O O   . THR B 1 269 ? 66.712 38.970  -11.367 1.00 19.01 ? 331  THR B O   1 
ATOM   5220 C CB  . THR B 1 269 ? 65.373 36.554  -9.629  1.00 19.31 ? 331  THR B CB  1 
ATOM   5221 O OG1 . THR B 1 269 ? 65.955 37.365  -8.593  1.00 21.98 ? 331  THR B OG1 1 
ATOM   5222 C CG2 . THR B 1 269 ? 65.199 35.167  -9.191  1.00 16.02 ? 331  THR B CG2 1 
ATOM   5223 N N   . GLN B 1 270 ? 68.460 37.661  -11.053 1.00 19.44 ? 332  GLN B N   1 
ATOM   5224 C CA  . GLN B 1 270 ? 69.413 38.744  -11.298 1.00 19.55 ? 332  GLN B CA  1 
ATOM   5225 C C   . GLN B 1 270 ? 69.313 39.287  -12.732 1.00 19.89 ? 332  GLN B C   1 
ATOM   5226 O O   . GLN B 1 270 ? 69.565 40.463  -12.947 1.00 19.43 ? 332  GLN B O   1 
ATOM   5227 C CB  . GLN B 1 270 ? 70.851 38.294  -11.039 1.00 19.57 ? 332  GLN B CB  1 
ATOM   5228 C CG  . GLN B 1 270 ? 71.866 39.434  -10.934 1.00 20.10 ? 332  GLN B CG  1 
ATOM   5229 C CD  . GLN B 1 270 ? 71.487 40.429  -9.839  1.00 21.72 ? 332  GLN B CD  1 
ATOM   5230 O OE1 . GLN B 1 270 ? 70.975 40.047  -8.790  1.00 20.55 ? 332  GLN B OE1 1 
ATOM   5231 N NE2 . GLN B 1 270 ? 71.695 41.710  -10.108 1.00 21.16 ? 332  GLN B NE2 1 
ATOM   5232 N N   . VAL B 1 271 ? 68.962 38.430  -13.696 1.00 20.33 ? 333  VAL B N   1 
ATOM   5233 C CA  . VAL B 1 271 ? 68.832 38.824  -15.112 1.00 20.27 ? 333  VAL B CA  1 
ATOM   5234 C C   . VAL B 1 271 ? 67.778 39.898  -15.274 1.00 20.56 ? 333  VAL B C   1 
ATOM   5235 O O   . VAL B 1 271 ? 67.956 40.863  -16.033 1.00 20.45 ? 333  VAL B O   1 
ATOM   5236 C CB  . VAL B 1 271 ? 68.441 37.620  -16.025 1.00 20.92 ? 333  VAL B CB  1 
ATOM   5237 C CG1 . VAL B 1 271 ? 67.921 38.108  -17.386 1.00 19.50 ? 333  VAL B CG1 1 
ATOM   5238 C CG2 . VAL B 1 271 ? 69.642 36.651  -16.215 1.00 18.86 ? 333  VAL B CG2 1 
ATOM   5239 N N   . ILE B 1 272 ? 66.677 39.726  -14.555 1.00 19.98 ? 334  ILE B N   1 
ATOM   5240 C CA  . ILE B 1 272 ? 65.614 40.718  -14.533 1.00 19.87 ? 334  ILE B CA  1 
ATOM   5241 C C   . ILE B 1 272 ? 66.018 42.013  -13.822 1.00 20.45 ? 334  ILE B C   1 
ATOM   5242 O O   . ILE B 1 272 ? 65.715 43.096  -14.322 1.00 20.50 ? 334  ILE B O   1 
ATOM   5243 C CB  . ILE B 1 272 ? 64.347 40.160  -13.900 1.00 19.12 ? 334  ILE B CB  1 
ATOM   5244 C CG1 . ILE B 1 272 ? 63.652 39.198  -14.876 1.00 18.48 ? 334  ILE B CG1 1 
ATOM   5245 C CG2 . ILE B 1 272 ? 63.424 41.274  -13.535 1.00 17.36 ? 334  ILE B CG2 1 
ATOM   5246 C CD1 . ILE B 1 272 ? 63.333 39.839  -16.287 1.00 13.16 ? 334  ILE B CD1 1 
ATOM   5247 N N   . LEU B 1 273 ? 66.704 41.899  -12.679 1.00 20.95 ? 335  LEU B N   1 
ATOM   5248 C CA  . LEU B 1 273 ? 67.170 43.063  -11.903 1.00 20.53 ? 335  LEU B CA  1 
ATOM   5249 C C   . LEU B 1 273 ? 68.194 43.909  -12.680 1.00 21.28 ? 335  LEU B C   1 
ATOM   5250 O O   . LEU B 1 273 ? 68.291 45.144  -12.505 1.00 21.12 ? 335  LEU B O   1 
ATOM   5251 C CB  . LEU B 1 273 ? 67.761 42.607  -10.567 1.00 20.94 ? 335  LEU B CB  1 
ATOM   5252 C CG  . LEU B 1 273 ? 66.814 41.913  -9.575  1.00 20.13 ? 335  LEU B CG  1 
ATOM   5253 C CD1 . LEU B 1 273 ? 67.492 41.725  -8.240  1.00 17.96 ? 335  LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 1 273 ? 65.525 42.714  -9.412  1.00 18.57 ? 335  LEU B CD2 1 
ATOM   5255 N N   . ASN B 1 274 ? 68.941 43.231  -13.550 1.00 20.99 ? 336  ASN B N   1 
ATOM   5256 C CA  . ASN B 1 274 ? 69.949 43.857  -14.399 1.00 20.66 ? 336  ASN B CA  1 
ATOM   5257 C C   . ASN B 1 274 ? 69.341 44.711  -15.514 1.00 20.79 ? 336  ASN B C   1 
ATOM   5258 O O   . ASN B 1 274 ? 70.019 45.545  -16.087 1.00 20.12 ? 336  ASN B O   1 
ATOM   5259 C CB  . ASN B 1 274 ? 70.851 42.778  -15.013 1.00 20.47 ? 336  ASN B CB  1 
ATOM   5260 C CG  . ASN B 1 274 ? 71.812 42.179  -14.010 1.00 19.49 ? 336  ASN B CG  1 
ATOM   5261 O OD1 . ASN B 1 274 ? 71.948 42.673  -12.902 1.00 21.19 ? 336  ASN B OD1 1 
ATOM   5262 N ND2 . ASN B 1 274 ? 72.501 41.118  -14.405 1.00 21.06 ? 336  ASN B ND2 1 
ATOM   5263 N N   . CYS B 1 275 ? 68.065 44.496  -15.814 1.00 20.51 ? 337  CYS B N   1 
ATOM   5264 C CA  . CYS B 1 275 ? 67.369 45.277  -16.797 1.00 21.05 ? 337  CYS B CA  1 
ATOM   5265 C C   . CYS B 1 275 ? 66.680 46.494  -16.175 1.00 21.93 ? 337  CYS B C   1 
ATOM   5266 O O   . CYS B 1 275 ? 65.856 47.146  -16.830 1.00 23.55 ? 337  CYS B O   1 
ATOM   5267 C CB  . CYS B 1 275 ? 66.336 44.413  -17.503 1.00 21.16 ? 337  CYS B CB  1 
ATOM   5268 S SG  . CYS B 1 275 ? 66.985 42.935  -18.298 1.00 19.72 ? 337  CYS B SG  1 
ATOM   5269 N N   . SER B 1 276 ? 67.013 46.794  -14.927 1.00 22.11 ? 338  SER B N   1 
ATOM   5270 C CA  . SER B 1 276 ? 66.400 47.868  -14.175 1.00 22.29 ? 338  SER B CA  1 
ATOM   5271 C C   . SER B 1 276 ? 64.878 47.734  -14.019 1.00 22.05 ? 338  SER B C   1 
ATOM   5272 O O   . SER B 1 276 ? 64.144 48.691  -14.202 1.00 22.38 ? 338  SER B O   1 
ATOM   5273 C CB  . SER B 1 276 ? 66.771 49.205  -14.807 1.00 22.59 ? 338  SER B CB  1 
ATOM   5274 O OG  . SER B 1 276 ? 68.178 49.291  -14.959 1.00 24.39 ? 338  SER B OG  1 
ATOM   5275 N N   . ALA B 1 277 ? 64.424 46.549  -13.644 1.00 22.05 ? 339  ALA B N   1 
ATOM   5276 C CA  . ALA B 1 277 ? 63.003 46.291  -13.402 1.00 21.73 ? 339  ALA B CA  1 
ATOM   5277 C C   . ALA B 1 277 ? 62.427 47.068  -12.218 1.00 21.74 ? 339  ALA B C   1 
ATOM   5278 O O   . ALA B 1 277 ? 61.265 47.497  -12.254 1.00 21.07 ? 339  ALA B O   1 
ATOM   5279 C CB  . ALA B 1 277 ? 62.774 44.801  -13.193 1.00 21.13 ? 339  ALA B CB  1 
ATOM   5280 N N   . LEU B 1 278 ? 63.220 47.228  -11.165 1.00 21.86 ? 340  LEU B N   1 
ATOM   5281 C CA  . LEU B 1 278 ? 62.687 47.726  -9.880  1.00 22.14 ? 340  LEU B CA  1 
ATOM   5282 C C   . LEU B 1 278 ? 62.032 49.116  -9.929  1.00 22.07 ? 340  LEU B C   1 
ATOM   5283 O O   . LEU B 1 278 ? 61.027 49.342  -9.265  1.00 21.63 ? 340  LEU B O   1 
ATOM   5284 C CB  . LEU B 1 278 ? 63.751 47.655  -8.785  1.00 22.31 ? 340  LEU B CB  1 
ATOM   5285 C CG  . LEU B 1 278 ? 64.107 46.240  -8.306  1.00 21.25 ? 340  LEU B CG  1 
ATOM   5286 C CD1 . LEU B 1 278 ? 65.241 46.292  -7.318  1.00 22.55 ? 340  LEU B CD1 1 
ATOM   5287 C CD2 . LEU B 1 278 ? 62.930 45.518  -7.674  1.00 21.25 ? 340  LEU B CD2 1 
ATOM   5288 N N   . GLN B 1 279 ? 62.591 50.028  -10.722 1.00 22.80 ? 341  GLN B N   1 
ATOM   5289 C CA  . GLN B 1 279 ? 62.017 51.359  -10.934 1.00 23.52 ? 341  GLN B CA  1 
ATOM   5290 C C   . GLN B 1 279 ? 60.654 51.304  -11.590 1.00 22.85 ? 341  GLN B C   1 
ATOM   5291 O O   . GLN B 1 279 ? 59.787 52.070  -11.238 1.00 23.11 ? 341  GLN B O   1 
ATOM   5292 C CB  . GLN B 1 279 ? 62.910 52.210  -11.839 1.00 24.65 ? 341  GLN B CB  1 
ATOM   5293 C CG  . GLN B 1 279 ? 64.096 52.899  -11.168 1.00 27.11 ? 341  GLN B CG  1 
ATOM   5294 C CD  . GLN B 1 279 ? 64.798 53.883  -12.131 1.00 28.24 ? 341  GLN B CD  1 
ATOM   5295 O OE1 . GLN B 1 279 ? 64.876 53.637  -13.358 1.00 33.48 ? 341  GLN B OE1 1 
ATOM   5296 N NE2 . GLN B 1 279 ? 65.306 55.009  -11.576 1.00 33.08 ? 341  GLN B NE2 1 
ATOM   5297 N N   . SER B 1 280 ? 60.486 50.443  -12.592 1.00 22.56 ? 342  SER B N   1 
ATOM   5298 C CA  . SER B 1 280 ? 59.200 50.297  -13.260 1.00 22.02 ? 342  SER B CA  1 
ATOM   5299 C C   . SER B 1 280 ? 58.211 49.585  -12.369 1.00 21.28 ? 342  SER B C   1 
ATOM   5300 O O   . SER B 1 280 ? 57.042 49.908  -12.374 1.00 20.92 ? 342  SER B O   1 
ATOM   5301 C CB  . SER B 1 280 ? 59.347 49.549  -14.573 1.00 22.01 ? 342  SER B CB  1 
ATOM   5302 O OG  . SER B 1 280 ? 60.385 50.120  -15.343 1.00 23.41 ? 342  SER B OG  1 
ATOM   5303 N N   . LEU B 1 281 ? 58.672 48.601  -11.609 1.00 21.02 ? 343  LEU B N   1 
ATOM   5304 C CA  . LEU B 1 281 ? 57.808 47.946  -10.624 1.00 20.65 ? 343  LEU B CA  1 
ATOM   5305 C C   . LEU B 1 281 ? 57.307 48.915  -9.550  1.00 20.08 ? 343  LEU B C   1 
ATOM   5306 O O   . LEU B 1 281 ? 56.142 48.867  -9.153  1.00 19.60 ? 343  LEU B O   1 
ATOM   5307 C CB  . LEU B 1 281 ? 58.516 46.735  -9.995  1.00 20.43 ? 343  LEU B CB  1 
ATOM   5308 C CG  . LEU B 1 281 ? 58.687 45.572  -10.969 1.00 20.11 ? 343  LEU B CG  1 
ATOM   5309 C CD1 . LEU B 1 281 ? 59.607 44.506  -10.407 1.00 17.85 ? 343  LEU B CD1 1 
ATOM   5310 C CD2 . LEU B 1 281 ? 57.336 44.974  -11.352 1.00 18.20 ? 343  LEU B CD2 1 
ATOM   5311 N N   . LEU B 1 282 ? 58.166 49.817  -9.088  1.00 20.46 ? 344  LEU B N   1 
ATOM   5312 C CA  . LEU B 1 282 ? 57.735 50.833  -8.118  1.00 20.48 ? 344  LEU B CA  1 
ATOM   5313 C C   . LEU B 1 282 ? 56.633 51.690  -8.727  1.00 20.94 ? 344  LEU B C   1 
ATOM   5314 O O   . LEU B 1 282 ? 55.654 52.036  -8.051  1.00 20.98 ? 344  LEU B O   1 
ATOM   5315 C CB  . LEU B 1 282 ? 58.895 51.734  -7.665  1.00 20.31 ? 344  LEU B CB  1 
ATOM   5316 C CG  . LEU B 1 282 ? 58.484 52.959  -6.836  1.00 20.51 ? 344  LEU B CG  1 
ATOM   5317 C CD1 . LEU B 1 282 ? 57.811 52.544  -5.518  1.00 20.72 ? 344  LEU B CD1 1 
ATOM   5318 C CD2 . LEU B 1 282 ? 59.666 53.899  -6.573  1.00 19.99 ? 344  LEU B CD2 1 
ATOM   5319 N N   . HIS B 1 283 ? 56.818 52.048  -10.000 1.00 20.97 ? 345  HIS B N   1 
ATOM   5320 C CA  . HIS B 1 283 ? 55.853 52.856  -10.739 1.00 21.08 ? 345  HIS B CA  1 
ATOM   5321 C C   . HIS B 1 283 ? 54.519 52.118  -10.819 1.00 20.97 ? 345  HIS B C   1 
ATOM   5322 O O   . HIS B 1 283 ? 53.487 52.693  -10.552 1.00 21.94 ? 345  HIS B O   1 
ATOM   5323 C CB  . HIS B 1 283 ? 56.419 53.201  -12.131 1.00 21.35 ? 345  HIS B CB  1 
ATOM   5324 C CG  . HIS B 1 283 ? 55.419 53.778  -13.077 1.00 21.55 ? 345  HIS B CG  1 
ATOM   5325 N ND1 . HIS B 1 283 ? 55.010 55.091  -13.019 1.00 23.36 ? 345  HIS B ND1 1 
ATOM   5326 C CD2 . HIS B 1 283 ? 54.753 53.221  -14.115 1.00 23.57 ? 345  HIS B CD2 1 
ATOM   5327 C CE1 . HIS B 1 283 ? 54.124 55.315  -13.973 1.00 23.74 ? 345  HIS B CE1 1 
ATOM   5328 N NE2 . HIS B 1 283 ? 53.943 54.193  -14.645 1.00 22.84 ? 345  HIS B NE2 1 
ATOM   5329 N N   . LEU B 1 284 ? 54.539 50.833  -11.137 1.00 21.16 ? 346  LEU B N   1 
ATOM   5330 C CA  . LEU B 1 284 ? 53.305 50.051  -11.246 1.00 21.45 ? 346  LEU B CA  1 
ATOM   5331 C C   . LEU B 1 284 ? 52.574 49.814  -9.898  1.00 21.78 ? 346  LEU B C   1 
ATOM   5332 O O   . LEU B 1 284 ? 51.394 49.446  -9.892  1.00 22.03 ? 346  LEU B O   1 
ATOM   5333 C CB  . LEU B 1 284 ? 53.575 48.721  -11.972 1.00 20.93 ? 346  LEU B CB  1 
ATOM   5334 C CG  . LEU B 1 284 ? 54.005 48.836  -13.448 1.00 20.48 ? 346  LEU B CG  1 
ATOM   5335 C CD1 . LEU B 1 284 ? 54.250 47.473  -14.088 1.00 17.68 ? 346  LEU B CD1 1 
ATOM   5336 C CD2 . LEU B 1 284 ? 52.962 49.623  -14.249 1.00 18.49 ? 346  LEU B CD2 1 
ATOM   5337 N N   . LEU B 1 285 ? 53.248 50.031  -8.769  1.00 22.45 ? 347  LEU B N   1 
ATOM   5338 C CA  . LEU B 1 285 ? 52.583 49.952  -7.456  1.00 22.68 ? 347  LEU B CA  1 
ATOM   5339 C C   . LEU B 1 285 ? 51.587 51.101  -7.246  1.00 23.55 ? 347  LEU B C   1 
ATOM   5340 O O   . LEU B 1 285 ? 50.716 51.013  -6.384  1.00 23.67 ? 347  LEU B O   1 
ATOM   5341 C CB  . LEU B 1 285 ? 53.600 49.919  -6.320  1.00 21.93 ? 347  LEU B CB  1 
ATOM   5342 C CG  . LEU B 1 285 ? 54.444 48.650  -6.142  1.00 21.04 ? 347  LEU B CG  1 
ATOM   5343 C CD1 . LEU B 1 285 ? 55.340 48.825  -4.946  1.00 20.01 ? 347  LEU B CD1 1 
ATOM   5344 C CD2 . LEU B 1 285 ? 53.566 47.426  -5.982  1.00 19.51 ? 347  LEU B CD2 1 
ATOM   5345 N N   . SER B 1 286 ? 51.724 52.174  -8.029  1.00 24.80 ? 348  SER B N   1 
ATOM   5346 C CA  . SER B 1 286 ? 50.769 53.303  -8.029  1.00 25.76 ? 348  SER B CA  1 
ATOM   5347 C C   . SER B 1 286 ? 49.645 53.143  -9.053  1.00 26.46 ? 348  SER B C   1 
ATOM   5348 O O   . SER B 1 286 ? 48.816 54.027  -9.192  1.00 27.49 ? 348  SER B O   1 
ATOM   5349 C CB  . SER B 1 286 ? 51.496 54.623  -8.326  1.00 25.89 ? 348  SER B CB  1 
ATOM   5350 O OG  . SER B 1 286 ? 52.406 54.961  -7.291  1.00 25.61 ? 348  SER B OG  1 
ATOM   5351 N N   . SER B 1 287 ? 49.613 52.035  -9.777  1.00 27.37 ? 349  SER B N   1 
ATOM   5352 C CA  . SER B 1 287 ? 48.659 51.881  -10.862 1.00 27.94 ? 349  SER B CA  1 
ATOM   5353 C C   . SER B 1 287 ? 47.240 51.939  -10.317 1.00 28.74 ? 349  SER B C   1 
ATOM   5354 O O   . SER B 1 287 ? 46.960 51.343  -9.279  1.00 28.97 ? 349  SER B O   1 
ATOM   5355 C CB  . SER B 1 287 ? 48.867 50.559  -11.597 1.00 27.90 ? 349  SER B CB  1 
ATOM   5356 O OG  . SER B 1 287 ? 47.994 50.449  -12.711 1.00 28.35 ? 349  SER B OG  1 
ATOM   5357 N N   . PRO B 1 288 ? 46.342 52.666  -11.016 1.00 29.37 ? 350  PRO B N   1 
ATOM   5358 C CA  . PRO B 1 288 ? 44.925 52.662  -10.672 1.00 29.62 ? 350  PRO B CA  1 
ATOM   5359 C C   . PRO B 1 288 ? 44.233 51.357  -11.073 1.00 30.25 ? 350  PRO B C   1 
ATOM   5360 O O   . PRO B 1 288 ? 43.130 51.083  -10.595 1.00 30.89 ? 350  PRO B O   1 
ATOM   5361 C CB  . PRO B 1 288 ? 44.371 53.822  -11.495 1.00 29.66 ? 350  PRO B CB  1 
ATOM   5362 C CG  . PRO B 1 288 ? 45.243 53.865  -12.697 1.00 29.42 ? 350  PRO B CG  1 
ATOM   5363 C CD  . PRO B 1 288 ? 46.614 53.528  -12.184 1.00 29.28 ? 350  PRO B CD  1 
ATOM   5364 N N   . LYS B 1 289 ? 44.851 50.577  -11.961 1.00 30.51 ? 351  LYS B N   1 
ATOM   5365 C CA  . LYS B 1 289 ? 44.364 49.229  -12.246 1.00 30.52 ? 351  LYS B CA  1 
ATOM   5366 C C   . LYS B 1 289 ? 44.856 48.313  -11.129 1.00 30.55 ? 351  LYS B C   1 
ATOM   5367 O O   . LYS B 1 289 ? 46.061 48.137  -10.939 1.00 30.47 ? 351  LYS B O   1 
ATOM   5368 C CB  . LYS B 1 289 ? 44.821 48.730  -13.609 1.00 30.69 ? 351  LYS B CB  1 
ATOM   5369 C CG  . LYS B 1 289 ? 44.107 47.449  -14.048 1.00 31.03 ? 351  LYS B CG  1 
ATOM   5370 C CD  . LYS B 1 289 ? 44.123 47.280  -15.563 1.00 31.47 ? 351  LYS B CD  1 
ATOM   5371 C CE  . LYS B 1 289 ? 43.591 45.908  -16.003 1.00 32.54 ? 351  LYS B CE  1 
ATOM   5372 N NZ  . LYS B 1 289 ? 44.660 44.926  -16.418 1.00 33.12 ? 351  LYS B NZ  1 
ATOM   5373 N N   . GLU B 1 290 ? 43.900 47.767  -10.381 1.00 30.59 ? 352  GLU B N   1 
ATOM   5374 C CA  . GLU B 1 290 ? 44.165 47.059  -9.133  1.00 29.96 ? 352  GLU B CA  1 
ATOM   5375 C C   . GLU B 1 290 ? 44.933 45.770  -9.400  1.00 29.60 ? 352  GLU B C   1 
ATOM   5376 O O   . GLU B 1 290 ? 45.804 45.388  -8.611  1.00 30.05 ? 352  GLU B O   1 
ATOM   5377 C CB  . GLU B 1 290 ? 42.844 46.754  -8.419  1.00 30.36 ? 352  GLU B CB  1 
ATOM   5378 C CG  . GLU B 1 290 ? 42.965 46.249  -6.979  1.00 31.58 ? 352  GLU B CG  1 
ATOM   5379 C CD  . GLU B 1 290 ? 43.573 47.263  -6.023  1.00 33.71 ? 352  GLU B CD  1 
ATOM   5380 O OE1 . GLU B 1 290 ? 43.414 48.482  -6.253  1.00 35.83 ? 352  GLU B OE1 1 
ATOM   5381 O OE2 . GLU B 1 290 ? 44.214 46.835  -5.040  1.00 34.91 ? 352  GLU B OE2 1 
ATOM   5382 N N   . SER B 1 291 ? 44.637 45.126  -10.527 1.00 28.51 ? 353  SER B N   1 
ATOM   5383 C CA  . SER B 1 291 ? 45.262 43.858  -10.854 1.00 27.84 ? 353  SER B CA  1 
ATOM   5384 C C   . SER B 1 291 ? 46.743 44.041  -11.188 1.00 26.90 ? 353  SER B C   1 
ATOM   5385 O O   . SER B 1 291 ? 47.541 43.149  -10.937 1.00 26.83 ? 353  SER B O   1 
ATOM   5386 C CB  . SER B 1 291 ? 44.499 43.132  -11.975 1.00 27.96 ? 353  SER B CB  1 
ATOM   5387 O OG  . SER B 1 291 ? 44.836 43.604  -13.268 1.00 29.46 ? 353  SER B OG  1 
ATOM   5388 N N   . ILE B 1 292 ? 47.110 45.202  -11.729 1.00 25.78 ? 354  ILE B N   1 
ATOM   5389 C CA  . ILE B 1 292 ? 48.522 45.504  -12.004 1.00 25.27 ? 354  ILE B CA  1 
ATOM   5390 C C   . ILE B 1 292 ? 49.317 45.782  -10.720 1.00 24.54 ? 354  ILE B C   1 
ATOM   5391 O O   . ILE B 1 292 ? 50.454 45.345  -10.581 1.00 24.44 ? 354  ILE B O   1 
ATOM   5392 C CB  . ILE B 1 292 ? 48.656 46.657  -13.045 1.00 24.94 ? 354  ILE B CB  1 
ATOM   5393 C CG1 . ILE B 1 292 ? 48.353 46.095  -14.442 1.00 25.06 ? 354  ILE B CG1 1 
ATOM   5394 C CG2 . ILE B 1 292 ? 50.047 47.280  -13.013 1.00 25.05 ? 354  ILE B CG2 1 
ATOM   5395 C CD1 . ILE B 1 292 ? 48.825 46.930  -15.561 1.00 25.05 ? 354  ILE B CD1 1 
ATOM   5396 N N   . LYS B 1 293 ? 48.708 46.497  -9.785  1.00 24.24 ? 355  LYS B N   1 
ATOM   5397 C CA  . LYS B 1 293 ? 49.290 46.736  -8.460  1.00 24.33 ? 355  LYS B CA  1 
ATOM   5398 C C   . LYS B 1 293 ? 49.668 45.415  -7.761  1.00 24.00 ? 355  LYS B C   1 
ATOM   5399 O O   . LYS B 1 293 ? 50.779 45.250  -7.270  1.00 23.77 ? 355  LYS B O   1 
ATOM   5400 C CB  . LYS B 1 293 ? 48.292 47.512  -7.600  1.00 24.05 ? 355  LYS B CB  1 
ATOM   5401 C CG  . LYS B 1 293 ? 48.927 48.349  -6.573  1.00 24.69 ? 355  LYS B CG  1 
ATOM   5402 C CD  . LYS B 1 293 ? 47.923 48.864  -5.592  1.00 24.94 ? 355  LYS B CD  1 
ATOM   5403 C CE  . LYS B 1 293 ? 47.146 50.042  -6.120  1.00 26.05 ? 355  LYS B CE  1 
ATOM   5404 N NZ  . LYS B 1 293 ? 46.313 50.575  -5.014  1.00 26.41 ? 355  LYS B NZ  1 
ATOM   5405 N N   . LYS B 1 294 ? 48.729 44.480  -7.762  1.00 23.93 ? 356  LYS B N   1 
ATOM   5406 C CA  . LYS B 1 294 ? 48.896 43.175  -7.147  1.00 23.82 ? 356  LYS B CA  1 
ATOM   5407 C C   . LYS B 1 294 ? 49.988 42.337  -7.806  1.00 23.46 ? 356  LYS B C   1 
ATOM   5408 O O   . LYS B 1 294 ? 50.772 41.695  -7.100  1.00 22.71 ? 356  LYS B O   1 
ATOM   5409 C CB  . LYS B 1 294 ? 47.549 42.438  -7.187  1.00 24.36 ? 356  LYS B CB  1 
ATOM   5410 C CG  . LYS B 1 294 ? 47.593 40.946  -6.942  1.00 24.67 ? 356  LYS B CG  1 
ATOM   5411 C CD  . LYS B 1 294 ? 46.174 40.382  -6.882  1.00 25.38 ? 356  LYS B CD  1 
ATOM   5412 C CE  . LYS B 1 294 ? 46.150 38.885  -7.217  1.00 27.03 ? 356  LYS B CE  1 
ATOM   5413 N NZ  . LYS B 1 294 ? 44.970 38.182  -6.579  1.00 27.35 ? 356  LYS B NZ  1 
ATOM   5414 N N   . GLU B 1 295 ? 50.012 42.321  -9.146  1.00 22.99 ? 357  GLU B N   1 
ATOM   5415 C CA  . GLU B 1 295 ? 51.022 41.607  -9.919  1.00 22.85 ? 357  GLU B CA  1 
ATOM   5416 C C   . GLU B 1 295 ? 52.403 42.211  -9.703  1.00 21.54 ? 357  GLU B C   1 
ATOM   5417 O O   . GLU B 1 295 ? 53.407 41.506  -9.674  1.00 21.38 ? 357  GLU B O   1 
ATOM   5418 C CB  . GLU B 1 295 ? 50.688 41.642  -11.426 1.00 23.40 ? 357  GLU B CB  1 
ATOM   5419 C CG  . GLU B 1 295 ? 49.627 40.648  -11.893 1.00 25.40 ? 357  GLU B CG  1 
ATOM   5420 C CD  . GLU B 1 295 ? 49.273 40.785  -13.400 1.00 27.68 ? 357  GLU B CD  1 
ATOM   5421 O OE1 . GLU B 1 295 ? 50.197 40.881  -14.279 1.00 31.21 ? 357  GLU B OE1 1 
ATOM   5422 O OE2 . GLU B 1 295 ? 48.040 40.792  -13.696 1.00 33.36 ? 357  GLU B OE2 1 
ATOM   5423 N N   . ALA B 1 296 ? 52.468 43.526  -9.575  1.00 20.94 ? 358  ALA B N   1 
ATOM   5424 C CA  . ALA B 1 296 ? 53.709 44.180  -9.158  1.00 20.30 ? 358  ALA B CA  1 
ATOM   5425 C C   . ALA B 1 296 ? 54.113 43.722  -7.755  1.00 19.89 ? 358  ALA B C   1 
ATOM   5426 O O   . ALA B 1 296 ? 55.264 43.400  -7.541  1.00 20.06 ? 358  ALA B O   1 
ATOM   5427 C CB  . ALA B 1 296 ? 53.567 45.666  -9.204  1.00 20.08 ? 358  ALA B CB  1 
ATOM   5428 N N   . CYS B 1 297 ? 53.166 43.666  -6.809  1.00 19.63 ? 359  CYS B N   1 
ATOM   5429 C CA  . CYS B 1 297 ? 53.464 43.198  -5.445  1.00 18.78 ? 359  CYS B CA  1 
ATOM   5430 C C   . CYS B 1 297 ? 53.967 41.759  -5.455  1.00 18.01 ? 359  CYS B C   1 
ATOM   5431 O O   . CYS B 1 297 ? 54.930 41.428  -4.762  1.00 16.90 ? 359  CYS B O   1 
ATOM   5432 C CB  . CYS B 1 297 ? 52.237 43.305  -4.540  1.00 19.34 ? 359  CYS B CB  1 
ATOM   5433 S SG  . CYS B 1 297 ? 51.809 44.967  -4.005  1.00 20.17 ? 359  CYS B SG  1 
ATOM   5434 N N   . TRP B 1 298 ? 53.297 40.911  -6.232  1.00 17.40 ? 360  TRP B N   1 
ATOM   5435 C CA  . TRP B 1 298 ? 53.692 39.496  -6.424  1.00 17.30 ? 360  TRP B CA  1 
ATOM   5436 C C   . TRP B 1 298 ? 55.097 39.324  -7.037  1.00 16.56 ? 360  TRP B C   1 
ATOM   5437 O O   . TRP B 1 298 ? 55.882 38.492  -6.590  1.00 17.03 ? 360  TRP B O   1 
ATOM   5438 C CB  . TRP B 1 298 ? 52.633 38.785  -7.286  1.00 17.44 ? 360  TRP B CB  1 
ATOM   5439 C CG  . TRP B 1 298 ? 53.069 37.491  -7.895  1.00 17.30 ? 360  TRP B CG  1 
ATOM   5440 C CD1 . TRP B 1 298 ? 53.346 36.329  -7.242  1.00 17.42 ? 360  TRP B CD1 1 
ATOM   5441 C CD2 . TRP B 1 298 ? 53.252 37.223  -9.286  1.00 17.55 ? 360  TRP B CD2 1 
ATOM   5442 N NE1 . TRP B 1 298 ? 53.700 35.359  -8.138  1.00 17.76 ? 360  TRP B NE1 1 
ATOM   5443 C CE2 . TRP B 1 298 ? 53.659 35.883  -9.401  1.00 17.58 ? 360  TRP B CE2 1 
ATOM   5444 C CE3 . TRP B 1 298 ? 53.135 37.995  -10.448 1.00 18.13 ? 360  TRP B CE3 1 
ATOM   5445 C CZ2 . TRP B 1 298 ? 53.940 35.289  -10.637 1.00 18.01 ? 360  TRP B CZ2 1 
ATOM   5446 C CZ3 . TRP B 1 298 ? 53.414 37.407  -11.673 1.00 17.68 ? 360  TRP B CZ3 1 
ATOM   5447 C CH2 . TRP B 1 298 ? 53.814 36.070  -11.756 1.00 17.61 ? 360  TRP B CH2 1 
ATOM   5448 N N   . THR B 1 299 ? 55.400 40.118  -8.053  1.00 16.55 ? 361  THR B N   1 
ATOM   5449 C CA  . THR B 1 299 ? 56.709 40.128  -8.689  1.00 16.57 ? 361  THR B CA  1 
ATOM   5450 C C   . THR B 1 299 ? 57.789 40.511  -7.693  1.00 16.27 ? 361  THR B C   1 
ATOM   5451 O O   . THR B 1 299 ? 58.757 39.792  -7.562  1.00 16.63 ? 361  THR B O   1 
ATOM   5452 C CB  . THR B 1 299 ? 56.708 41.044  -9.922  1.00 16.62 ? 361  THR B CB  1 
ATOM   5453 O OG1 . THR B 1 299 ? 55.793 40.513  -10.872 1.00 16.87 ? 361  THR B OG1 1 
ATOM   5454 C CG2 . THR B 1 299 ? 58.069 41.114  -10.574 1.00 15.93 ? 361  THR B CG2 1 
ATOM   5455 N N   . ILE B 1 300 ? 57.604 41.609  -6.962  1.00 16.33 ? 362  ILE B N   1 
ATOM   5456 C CA  . ILE B 1 300 ? 58.554 42.050  -5.917  1.00 16.17 ? 362  ILE B CA  1 
ATOM   5457 C C   . ILE B 1 300 ? 58.778 41.002  -4.801  1.00 16.41 ? 362  ILE B C   1 
ATOM   5458 O O   . ILE B 1 300 ? 59.907 40.812  -4.332  1.00 15.85 ? 362  ILE B O   1 
ATOM   5459 C CB  . ILE B 1 300 ? 58.111 43.392  -5.284  1.00 17.11 ? 362  ILE B CB  1 
ATOM   5460 C CG1 . ILE B 1 300 ? 58.182 44.522  -6.336  1.00 17.34 ? 362  ILE B CG1 1 
ATOM   5461 C CG2 . ILE B 1 300 ? 58.968 43.741  -4.042  1.00 15.73 ? 362  ILE B CG2 1 
ATOM   5462 C CD1 . ILE B 1 300 ? 57.133 45.663  -6.098  1.00 16.85 ? 362  ILE B CD1 1 
ATOM   5463 N N   . SER B 1 301 ? 57.722 40.305  -4.402  1.00 15.13 ? 363  SER B N   1 
ATOM   5464 C CA  . SER B 1 301 ? 57.818 39.276  -3.388  1.00 15.45 ? 363  SER B CA  1 
ATOM   5465 C C   . SER B 1 301 ? 58.689 38.093  -3.777  1.00 15.57 ? 363  SER B C   1 
ATOM   5466 O O   . SER B 1 301 ? 59.231 37.399  -2.902  1.00 15.95 ? 363  SER B O   1 
ATOM   5467 C CB  . SER B 1 301 ? 56.428 38.761  -3.020  1.00 15.33 ? 363  SER B CB  1 
ATOM   5468 O OG  . SER B 1 301 ? 56.004 37.756  -3.910  1.00 16.11 ? 363  SER B OG  1 
ATOM   5469 N N   . ASN B 1 302 ? 58.777 37.821  -5.079  1.00 15.88 ? 364  ASN B N   1 
ATOM   5470 C CA  . ASN B 1 302 ? 59.599 36.742  -5.587  1.00 15.49 ? 364  ASN B CA  1 
ATOM   5471 C C   . ASN B 1 302 ? 61.051 37.203  -5.694  1.00 15.91 ? 364  ASN B C   1 
ATOM   5472 O O   . ASN B 1 302 ? 61.943 36.393  -5.656  1.00 16.67 ? 364  ASN B O   1 
ATOM   5473 C CB  . ASN B 1 302 ? 59.068 36.225  -6.937  1.00 15.24 ? 364  ASN B CB  1 
ATOM   5474 C CG  . ASN B 1 302 ? 57.813 35.362  -6.795  1.00 15.24 ? 364  ASN B CG  1 
ATOM   5475 O OD1 . ASN B 1 302 ? 57.686 34.591  -5.869  1.00 12.87 ? 364  ASN B OD1 1 
ATOM   5476 N ND2 . ASN B 1 302 ? 56.895 35.489  -7.735  1.00 16.51 ? 364  ASN B ND2 1 
ATOM   5477 N N   . ILE B 1 303 ? 61.277 38.506  -5.825  1.00 16.38 ? 365  ILE B N   1 
ATOM   5478 C CA  . ILE B 1 303 ? 62.627 39.094  -5.766  1.00 16.14 ? 365  ILE B CA  1 
ATOM   5479 C C   . ILE B 1 303 ? 63.118 39.160  -4.299  1.00 16.38 ? 365  ILE B C   1 
ATOM   5480 O O   . ILE B 1 303 ? 64.236 38.767  -3.989  1.00 16.59 ? 365  ILE B O   1 
ATOM   5481 C CB  . ILE B 1 303 ? 62.649 40.476  -6.423  1.00 16.30 ? 365  ILE B CB  1 
ATOM   5482 C CG1 . ILE B 1 303 ? 62.265 40.337  -7.904  1.00 15.31 ? 365  ILE B CG1 1 
ATOM   5483 C CG2 . ILE B 1 303 ? 64.047 41.166  -6.251  1.00 16.68 ? 365  ILE B CG2 1 
ATOM   5484 C CD1 . ILE B 1 303 ? 62.195 41.637  -8.630  1.00 15.60 ? 365  ILE B CD1 1 
ATOM   5485 N N   . THR B 1 304 ? 62.266 39.569  -3.385  1.00 15.62 ? 366  THR B N   1 
ATOM   5486 C CA  . THR B 1 304 ? 62.663 39.598  -1.978  1.00 15.96 ? 366  THR B CA  1 
ATOM   5487 C C   . THR B 1 304 ? 62.810 38.220  -1.371  1.00 15.86 ? 366  THR B C   1 
ATOM   5488 O O   . THR B 1 304 ? 63.347 38.109  -0.274  1.00 15.78 ? 366  THR B O   1 
ATOM   5489 C CB  . THR B 1 304 ? 61.721 40.439  -1.082  1.00 15.93 ? 366  THR B CB  1 
ATOM   5490 O OG1 . THR B 1 304 ? 60.451 39.802  -0.983  1.00 16.60 ? 366  THR B OG1 1 
ATOM   5491 C CG2 . THR B 1 304 ? 61.569 41.824  -1.631  1.00 13.92 ? 366  THR B CG2 1 
ATOM   5492 N N   . ALA B 1 305 ? 62.343 37.184  -2.077  1.00 15.56 ? 367  ALA B N   1 
ATOM   5493 C CA  . ALA B 1 305 ? 62.649 35.794  -1.736  1.00 16.29 ? 367  ALA B CA  1 
ATOM   5494 C C   . ALA B 1 305 ? 64.073 35.364  -2.118  1.00 16.77 ? 367  ALA B C   1 
ATOM   5495 O O   . ALA B 1 305 ? 64.430 34.213  -1.913  1.00 18.30 ? 367  ALA B O   1 
ATOM   5496 C CB  . ALA B 1 305 ? 61.641 34.846  -2.387  1.00 15.28 ? 367  ALA B CB  1 
ATOM   5497 N N   . GLY B 1 306 ? 64.865 36.270  -2.687  1.00 17.74 ? 368  GLY B N   1 
ATOM   5498 C CA  . GLY B 1 306 ? 66.239 35.993  -3.139  1.00 18.15 ? 368  GLY B CA  1 
ATOM   5499 C C   . GLY B 1 306 ? 67.304 36.349  -2.116  1.00 18.37 ? 368  GLY B C   1 
ATOM   5500 O O   . GLY B 1 306 ? 67.041 36.335  -0.949  1.00 18.84 ? 368  GLY B O   1 
ATOM   5501 N N   . ASN B 1 307 ? 68.511 36.677  -2.558  1.00 19.29 ? 369  ASN B N   1 
ATOM   5502 C CA  . ASN B 1 307 ? 69.640 36.836  -1.634  1.00 19.51 ? 369  ASN B CA  1 
ATOM   5503 C C   . ASN B 1 307 ? 69.715 38.234  -1.076  1.00 19.93 ? 369  ASN B C   1 
ATOM   5504 O O   . ASN B 1 307 ? 68.930 39.093  -1.453  1.00 19.89 ? 369  ASN B O   1 
ATOM   5505 C CB  . ASN B 1 307 ? 70.970 36.402  -2.285  1.00 19.63 ? 369  ASN B CB  1 
ATOM   5506 C CG  . ASN B 1 307 ? 71.401 37.279  -3.429  1.00 20.59 ? 369  ASN B CG  1 
ATOM   5507 O OD1 . ASN B 1 307 ? 71.237 38.495  -3.404  1.00 23.64 ? 369  ASN B OD1 1 
ATOM   5508 N ND2 . ASN B 1 307 ? 71.962 36.661  -4.456  1.00 19.71 ? 369  ASN B ND2 1 
ATOM   5509 N N   . ARG B 1 308 ? 70.681 38.470  -0.193  1.00 20.50 ? 370  ARG B N   1 
ATOM   5510 C CA  . ARG B 1 308 ? 70.796 39.746  0.501   1.00 20.77 ? 370  ARG B CA  1 
ATOM   5511 C C   . ARG B 1 308 ? 71.053 40.960  -0.355  1.00 20.52 ? 370  ARG B C   1 
ATOM   5512 O O   . ARG B 1 308 ? 70.600 42.062  -0.028  1.00 20.47 ? 370  ARG B O   1 
ATOM   5513 C CB  . ARG B 1 308 ? 71.933 39.686  1.483   1.00 21.43 ? 370  ARG B CB  1 
ATOM   5514 C CG  . ARG B 1 308 ? 71.662 38.795  2.586   1.00 23.61 ? 370  ARG B CG  1 
ATOM   5515 C CD  . ARG B 1 308 ? 71.750 39.548  3.873   1.00 25.70 ? 370  ARG B CD  1 
ATOM   5516 N NE  . ARG B 1 308 ? 71.454 38.619  4.948   1.00 25.61 ? 370  ARG B NE  1 
ATOM   5517 C CZ  . ARG B 1 308 ? 72.280 38.291  5.923   1.00 27.49 ? 370  ARG B CZ  1 
ATOM   5518 N NH1 . ARG B 1 308 ? 73.498 38.835  6.025   1.00 29.03 ? 370  ARG B NH1 1 
ATOM   5519 N NH2 . ARG B 1 308 ? 71.858 37.428  6.824   1.00 27.59 ? 370  ARG B NH2 1 
ATOM   5520 N N   . ALA B 1 309 ? 71.851 40.786  -1.398  1.00 20.30 ? 371  ALA B N   1 
ATOM   5521 C CA  . ALA B 1 309 ? 72.130 41.880  -2.323  1.00 19.88 ? 371  ALA B CA  1 
ATOM   5522 C C   . ALA B 1 309 ? 70.861 42.231  -3.078  1.00 19.79 ? 371  ALA B C   1 
ATOM   5523 O O   . ALA B 1 309 ? 70.639 43.403  -3.399  1.00 20.36 ? 371  ALA B O   1 
ATOM   5524 C CB  . ALA B 1 309 ? 73.209 41.495  -3.267  1.00 19.92 ? 371  ALA B CB  1 
ATOM   5525 N N   . GLN B 1 310 ? 70.049 41.214  -3.382  1.00 19.56 ? 372  GLN B N   1 
ATOM   5526 C CA  . GLN B 1 310 ? 68.774 41.410  -4.084  1.00 19.31 ? 372  GLN B CA  1 
ATOM   5527 C C   . GLN B 1 310 ? 67.715 42.075  -3.189  1.00 19.51 ? 372  GLN B C   1 
ATOM   5528 O O   . GLN B 1 310 ? 66.970 42.942  -3.652  1.00 21.17 ? 372  GLN B O   1 
ATOM   5529 C CB  . GLN B 1 310 ? 68.267 40.097  -4.695  1.00 19.00 ? 372  GLN B CB  1 
ATOM   5530 C CG  . GLN B 1 310 ? 69.203 39.557  -5.808  1.00 19.31 ? 372  GLN B CG  1 
ATOM   5531 C CD  . GLN B 1 310 ? 68.833 38.189  -6.355  1.00 18.10 ? 372  GLN B CD  1 
ATOM   5532 O OE1 . GLN B 1 310 ? 68.346 37.355  -5.636  1.00 18.04 ? 372  GLN B OE1 1 
ATOM   5533 N NE2 . GLN B 1 310 ? 69.099 37.953  -7.635  1.00 13.54 ? 372  GLN B NE2 1 
ATOM   5534 N N   . ILE B 1 311 ? 67.631 41.695  -1.918  1.00 19.07 ? 373  ILE B N   1 
ATOM   5535 C CA  . ILE B 1 311 ? 66.783 42.435  -0.965  1.00 18.39 ? 373  ILE B CA  1 
ATOM   5536 C C   . ILE B 1 311 ? 67.236 43.910  -0.871  1.00 18.52 ? 373  ILE B C   1 
ATOM   5537 O O   . ILE B 1 311 ? 66.411 44.811  -0.815  1.00 18.19 ? 373  ILE B O   1 
ATOM   5538 C CB  . ILE B 1 311 ? 66.803 41.795  0.443   1.00 18.50 ? 373  ILE B CB  1 
ATOM   5539 C CG1 . ILE B 1 311 ? 66.213 40.382  0.423   1.00 18.32 ? 373  ILE B CG1 1 
ATOM   5540 C CG2 . ILE B 1 311 ? 66.053 42.651  1.469   1.00 17.83 ? 373  ILE B CG2 1 
ATOM   5541 C CD1 . ILE B 1 311 ? 66.520 39.590  1.695   1.00 16.24 ? 373  ILE B CD1 1 
ATOM   5542 N N   . GLN B 1 312 ? 68.543 44.150  -0.859  1.00 18.37 ? 374  GLN B N   1 
ATOM   5543 C CA  . GLN B 1 312 ? 69.075 45.514  -0.829  1.00 19.22 ? 374  GLN B CA  1 
ATOM   5544 C C   . GLN B 1 312 ? 68.759 46.364  -2.073  1.00 19.93 ? 374  GLN B C   1 
ATOM   5545 O O   . GLN B 1 312 ? 68.639 47.584  -1.975  1.00 21.23 ? 374  GLN B O   1 
ATOM   5546 C CB  . GLN B 1 312 ? 70.590 45.490  -0.582  1.00 19.40 ? 374  GLN B CB  1 
ATOM   5547 C CG  . GLN B 1 312 ? 71.205 46.853  -0.181  1.00 18.60 ? 374  GLN B CG  1 
ATOM   5548 C CD  . GLN B 1 312 ? 70.704 47.359  1.170   1.00 18.76 ? 374  GLN B CD  1 
ATOM   5549 O OE1 . GLN B 1 312 ? 70.697 46.627  2.160   1.00 20.14 ? 374  GLN B OE1 1 
ATOM   5550 N NE2 . GLN B 1 312 ? 70.276 48.616  1.209   1.00 15.20 ? 374  GLN B NE2 1 
ATOM   5551 N N   . THR B 1 313 ? 68.608 45.742  -3.238  1.00 20.75 ? 375  THR B N   1 
ATOM   5552 C CA  . THR B 1 313 ? 68.219 46.463  -4.449  1.00 20.23 ? 375  THR B CA  1 
ATOM   5553 C C   . THR B 1 313 ? 66.797 46.985  -4.331  1.00 20.18 ? 375  THR B C   1 
ATOM   5554 O O   . THR B 1 313 ? 66.468 48.052  -4.859  1.00 20.38 ? 375  THR B O   1 
ATOM   5555 C CB  . THR B 1 313 ? 68.349 45.572  -5.740  1.00 20.85 ? 375  THR B CB  1 
ATOM   5556 O OG1 . THR B 1 313 ? 69.634 44.935  -5.785  1.00 23.30 ? 375  THR B OG1 1 
ATOM   5557 C CG2 . THR B 1 313 ? 68.269 46.434  -6.976  1.00 22.24 ? 375  THR B CG2 1 
ATOM   5558 N N   . VAL B 1 314 ? 65.937 46.217  -3.667  1.00 19.45 ? 376  VAL B N   1 
ATOM   5559 C CA  . VAL B 1 314 ? 64.554 46.620  -3.458  1.00 19.16 ? 376  VAL B CA  1 
ATOM   5560 C C   . VAL B 1 314 ? 64.521 47.766  -2.440  1.00 19.34 ? 376  VAL B C   1 
ATOM   5561 O O   . VAL B 1 314 ? 63.735 48.714  -2.579  1.00 19.96 ? 376  VAL B O   1 
ATOM   5562 C CB  . VAL B 1 314 ? 63.703 45.412  -2.988  1.00 18.72 ? 376  VAL B CB  1 
ATOM   5563 C CG1 . VAL B 1 314 ? 62.273 45.801  -2.768  1.00 18.01 ? 376  VAL B CG1 1 
ATOM   5564 C CG2 . VAL B 1 314 ? 63.810 44.271  -3.995  1.00 17.06 ? 376  VAL B CG2 1 
ATOM   5565 N N   . ILE B 1 315 ? 65.374 47.674  -1.412  1.00 19.61 ? 377  ILE B N   1 
ATOM   5566 C CA  . ILE B 1 315 ? 65.503 48.721  -0.390  1.00 19.94 ? 377  ILE B CA  1 
ATOM   5567 C C   . ILE B 1 315 ? 65.952 49.990  -1.076  1.00 20.92 ? 377  ILE B C   1 
ATOM   5568 O O   . ILE B 1 315 ? 65.276 51.013  -0.970  1.00 21.30 ? 377  ILE B O   1 
ATOM   5569 C CB  . ILE B 1 315 ? 66.494 48.313  0.743   1.00 19.97 ? 377  ILE B CB  1 
ATOM   5570 C CG1 . ILE B 1 315 ? 65.825 47.278  1.658   1.00 18.84 ? 377  ILE B CG1 1 
ATOM   5571 C CG2 . ILE B 1 315 ? 66.975 49.521  1.547   1.00 18.87 ? 377  ILE B CG2 1 
ATOM   5572 C CD1 . ILE B 1 315 ? 66.725 46.730  2.714   1.00 19.83 ? 377  ILE B CD1 1 
ATOM   5573 N N   . ASP B 1 316 ? 67.062 49.905  -1.822  1.00 21.71 ? 378  ASP B N   1 
ATOM   5574 C CA  . ASP B 1 316 ? 67.629 51.062  -2.560  1.00 22.04 ? 378  ASP B CA  1 
ATOM   5575 C C   . ASP B 1 316 ? 66.699 51.663  -3.619  1.00 22.11 ? 378  ASP B C   1 
ATOM   5576 O O   . ASP B 1 316 ? 66.876 52.802  -4.024  1.00 22.43 ? 378  ASP B O   1 
ATOM   5577 C CB  . ASP B 1 316 ? 68.944 50.684  -3.260  1.00 22.90 ? 378  ASP B CB  1 
ATOM   5578 C CG  . ASP B 1 316 ? 70.080 50.324  -2.276  1.00 24.66 ? 378  ASP B CG  1 
ATOM   5579 O OD1 . ASP B 1 316 ? 70.101 50.783  -1.112  1.00 26.30 ? 378  ASP B OD1 1 
ATOM   5580 O OD2 . ASP B 1 316 ? 70.988 49.576  -2.709  1.00 30.47 ? 378  ASP B OD2 1 
ATOM   5581 N N   . ALA B 1 317 ? 65.710 50.904  -4.067  1.00 22.03 ? 379  ALA B N   1 
ATOM   5582 C CA  . ALA B 1 317 ? 64.774 51.374  -5.077  1.00 21.41 ? 379  ALA B CA  1 
ATOM   5583 C C   . ALA B 1 317 ? 63.577 52.096  -4.457  1.00 21.16 ? 379  ALA B C   1 
ATOM   5584 O O   . ALA B 1 317 ? 62.671 52.518  -5.177  1.00 22.14 ? 379  ALA B O   1 
ATOM   5585 C CB  . ALA B 1 317 ? 64.306 50.208  -5.901  1.00 21.29 ? 379  ALA B CB  1 
ATOM   5586 N N   . ASN B 1 318 ? 63.575 52.228  -3.128  1.00 21.13 ? 380  ASN B N   1 
ATOM   5587 C CA  . ASN B 1 318 ? 62.514 52.887  -2.358  1.00 20.73 ? 380  ASN B CA  1 
ATOM   5588 C C   . ASN B 1 318 ? 61.148 52.202  -2.497  1.00 20.06 ? 380  ASN B C   1 
ATOM   5589 O O   . ASN B 1 318 ? 60.107 52.854  -2.555  1.00 19.76 ? 380  ASN B O   1 
ATOM   5590 C CB  . ASN B 1 318 ? 62.426 54.364  -2.740  1.00 21.76 ? 380  ASN B CB  1 
ATOM   5591 C CG  . ASN B 1 318 ? 63.761 55.072  -2.614  1.00 25.45 ? 380  ASN B CG  1 
ATOM   5592 O OD1 . ASN B 1 318 ? 64.385 55.054  -1.548  1.00 31.23 ? 380  ASN B OD1 1 
ATOM   5593 N ND2 . ASN B 1 318 ? 64.216 55.700  -3.708  1.00 31.89 ? 380  ASN B ND2 1 
ATOM   5594 N N   . ILE B 1 319 ? 61.168 50.876  -2.553  1.00 19.32 ? 381  ILE B N   1 
ATOM   5595 C CA  . ILE B 1 319 ? 59.960 50.099  -2.784  1.00 19.05 ? 381  ILE B CA  1 
ATOM   5596 C C   . ILE B 1 319 ? 59.190 49.828  -1.494  1.00 18.55 ? 381  ILE B C   1 
ATOM   5597 O O   . ILE B 1 319 ? 57.965 49.842  -1.494  1.00 18.17 ? 381  ILE B O   1 
ATOM   5598 C CB  . ILE B 1 319 ? 60.275 48.796  -3.575  1.00 18.76 ? 381  ILE B CB  1 
ATOM   5599 C CG1 . ILE B 1 319 ? 60.245 49.106  -5.085  1.00 18.74 ? 381  ILE B CG1 1 
ATOM   5600 C CG2 . ILE B 1 319 ? 59.287 47.684  -3.207  1.00 19.03 ? 381  ILE B CG2 1 
ATOM   5601 C CD1 . ILE B 1 319 ? 60.949 48.119  -5.960  1.00 18.15 ? 381  ILE B CD1 1 
ATOM   5602 N N   . PHE B 1 320 ? 59.900 49.660  -0.380  1.00 18.24 ? 382  PHE B N   1 
ATOM   5603 C CA  . PHE B 1 320 ? 59.255 49.204  0.862   1.00 17.89 ? 382  PHE B CA  1 
ATOM   5604 C C   . PHE B 1 320 ? 58.218 50.147  1.474   1.00 17.90 ? 382  PHE B C   1 
ATOM   5605 O O   . PHE B 1 320 ? 57.174 49.661  1.955   1.00 17.94 ? 382  PHE B O   1 
ATOM   5606 C CB  . PHE B 1 320 ? 60.298 48.735  1.881   1.00 17.74 ? 382  PHE B CB  1 
ATOM   5607 C CG  . PHE B 1 320 ? 60.853 47.374  1.567   1.00 17.36 ? 382  PHE B CG  1 
ATOM   5608 C CD1 . PHE B 1 320 ? 62.102 47.224  1.008   1.00 17.96 ? 382  PHE B CD1 1 
ATOM   5609 C CD2 . PHE B 1 320 ? 60.099 46.238  1.810   1.00 18.72 ? 382  PHE B CD2 1 
ATOM   5610 C CE1 . PHE B 1 320 ? 62.606 45.965  0.717   1.00 17.78 ? 382  PHE B CE1 1 
ATOM   5611 C CE2 . PHE B 1 320 ? 60.590 44.978  1.519   1.00 18.21 ? 382  PHE B CE2 1 
ATOM   5612 C CZ  . PHE B 1 320 ? 61.842 44.843  0.958   1.00 17.42 ? 382  PHE B CZ  1 
ATOM   5613 N N   . PRO B 1 321 ? 58.456 51.486  1.440   1.00 17.36 ? 383  PRO B N   1 
ATOM   5614 C CA  . PRO B 1 321 ? 57.396 52.396  1.882   1.00 16.96 ? 383  PRO B CA  1 
ATOM   5615 C C   . PRO B 1 321 ? 56.075 52.171  1.148   1.00 16.91 ? 383  PRO B C   1 
ATOM   5616 O O   . PRO B 1 321 ? 55.014 52.208  1.760   1.00 16.56 ? 383  PRO B O   1 
ATOM   5617 C CB  . PRO B 1 321 ? 57.967 53.772  1.554   1.00 16.84 ? 383  PRO B CB  1 
ATOM   5618 C CG  . PRO B 1 321 ? 59.449 53.582  1.639   1.00 16.77 ? 383  PRO B CG  1 
ATOM   5619 C CD  . PRO B 1 321 ? 59.665 52.233  1.038   1.00 17.22 ? 383  PRO B CD  1 
ATOM   5620 N N   . ALA B 1 322 ? 56.155 51.941  -0.161  1.00 17.24 ? 384  ALA B N   1 
ATOM   5621 C CA  . ALA B 1 322 ? 54.995 51.618  -0.986  1.00 17.58 ? 384  ALA B CA  1 
ATOM   5622 C C   . ALA B 1 322 ? 54.310 50.312  -0.571  1.00 17.76 ? 384  ALA B C   1 
ATOM   5623 O O   . ALA B 1 322 ? 53.099 50.242  -0.521  1.00 18.31 ? 384  ALA B O   1 
ATOM   5624 C CB  . ALA B 1 322 ? 55.418 51.542  -2.487  1.00 17.11 ? 384  ALA B CB  1 
ATOM   5625 N N   . LEU B 1 323 ? 55.082 49.260  -0.325  1.00 18.49 ? 385  LEU B N   1 
ATOM   5626 C CA  . LEU B 1 323 ? 54.494 47.977  0.096   1.00 18.40 ? 385  LEU B CA  1 
ATOM   5627 C C   . LEU B 1 323 ? 53.785 48.029  1.432   1.00 18.44 ? 385  LEU B C   1 
ATOM   5628 O O   . LEU B 1 323 ? 52.754 47.390  1.601   1.00 17.91 ? 385  LEU B O   1 
ATOM   5629 C CB  . LEU B 1 323 ? 55.551 46.882  0.165   1.00 18.38 ? 385  LEU B CB  1 
ATOM   5630 C CG  . LEU B 1 323 ? 56.156 46.490  -1.174  1.00 18.26 ? 385  LEU B CG  1 
ATOM   5631 C CD1 . LEU B 1 323 ? 57.342 45.565  -0.936  1.00 17.28 ? 385  LEU B CD1 1 
ATOM   5632 C CD2 . LEU B 1 323 ? 55.111 45.869  -2.085  1.00 17.22 ? 385  LEU B CD2 1 
ATOM   5633 N N   . ILE B 1 324 ? 54.358 48.758  2.388   1.00 18.94 ? 386  ILE B N   1 
ATOM   5634 C CA  . ILE B 1 324 ? 53.794 48.882  3.732   1.00 18.96 ? 386  ILE B CA  1 
ATOM   5635 C C   . ILE B 1 324 ? 52.507 49.700  3.672   1.00 19.79 ? 386  ILE B C   1 
ATOM   5636 O O   . ILE B 1 324 ? 51.560 49.436  4.407   1.00 19.64 ? 386  ILE B O   1 
ATOM   5637 C CB  . ILE B 1 324 ? 54.813 49.519  4.713   1.00 19.37 ? 386  ILE B CB  1 
ATOM   5638 C CG1 . ILE B 1 324 ? 56.053 48.625  4.844   1.00 17.45 ? 386  ILE B CG1 1 
ATOM   5639 C CG2 . ILE B 1 324 ? 54.178 49.788  6.076   1.00 18.14 ? 386  ILE B CG2 1 
ATOM   5640 C CD1 . ILE B 1 324 ? 56.896 48.966  5.951   1.00 18.98 ? 386  ILE B CD1 1 
ATOM   5641 N N   . SER B 1 325 ? 52.481 50.683  2.785   1.00 20.28 ? 387  SER B N   1 
ATOM   5642 C CA  . SER B 1 325 ? 51.267 51.434  2.510   1.00 21.18 ? 387  SER B CA  1 
ATOM   5643 C C   . SER B 1 325 ? 50.180 50.489  1.969   1.00 21.62 ? 387  SER B C   1 
ATOM   5644 O O   . SER B 1 325 ? 49.098 50.403  2.527   1.00 21.01 ? 387  SER B O   1 
ATOM   5645 C CB  . SER B 1 325 ? 51.576 52.545  1.506   1.00 21.38 ? 387  SER B CB  1 
ATOM   5646 O OG  . SER B 1 325 ? 50.435 53.344  1.258   1.00 22.38 ? 387  SER B OG  1 
ATOM   5647 N N   . ILE B 1 326 ? 50.492 49.763  0.891   1.00 22.52 ? 388  ILE B N   1 
ATOM   5648 C CA  . ILE B 1 326 ? 49.570 48.753  0.338   1.00 22.75 ? 388  ILE B CA  1 
ATOM   5649 C C   . ILE B 1 326 ? 49.084 47.744  1.400   1.00 23.76 ? 388  ILE B C   1 
ATOM   5650 O O   . ILE B 1 326 ? 47.896 47.463  1.511   1.00 23.70 ? 388  ILE B O   1 
ATOM   5651 C CB  . ILE B 1 326 ? 50.214 47.986  -0.837  1.00 22.39 ? 388  ILE B CB  1 
ATOM   5652 C CG1 . ILE B 1 326 ? 50.377 48.899  -2.058  1.00 21.68 ? 388  ILE B CG1 1 
ATOM   5653 C CG2 . ILE B 1 326 ? 49.364 46.780  -1.224  1.00 22.13 ? 388  ILE B CG2 1 
ATOM   5654 C CD1 . ILE B 1 326 ? 51.130 48.299  -3.166  1.00 20.56 ? 388  ILE B CD1 1 
ATOM   5655 N N   . LEU B 1 327 ? 50.015 47.229  2.192   1.00 25.32 ? 389  LEU B N   1 
ATOM   5656 C CA  . LEU B 1 327 ? 49.734 46.171  3.163   1.00 26.28 ? 389  LEU B CA  1 
ATOM   5657 C C   . LEU B 1 327 ? 48.750 46.586  4.266   1.00 27.54 ? 389  LEU B C   1 
ATOM   5658 O O   . LEU B 1 327 ? 48.191 45.726  4.950   1.00 28.35 ? 389  LEU B O   1 
ATOM   5659 C CB  . LEU B 1 327 ? 51.052 45.667  3.761   1.00 26.20 ? 389  LEU B CB  1 
ATOM   5660 C CG  . LEU B 1 327 ? 51.030 44.506  4.751   1.00 26.58 ? 389  LEU B CG  1 
ATOM   5661 C CD1 . LEU B 1 327 ? 50.575 43.230  4.087   1.00 27.00 ? 389  LEU B CD1 1 
ATOM   5662 C CD2 . LEU B 1 327 ? 52.426 44.345  5.385   1.00 26.36 ? 389  LEU B CD2 1 
ATOM   5663 N N   . GLN B 1 328 ? 48.509 47.886  4.437   1.00 28.69 ? 390  GLN B N   1 
ATOM   5664 C CA  . GLN B 1 328 ? 47.476 48.345  5.384   1.00 29.27 ? 390  GLN B CA  1 
ATOM   5665 C C   . GLN B 1 328 ? 46.259 49.040  4.745   1.00 29.55 ? 390  GLN B C   1 
ATOM   5666 O O   . GLN B 1 328 ? 45.233 49.173  5.396   1.00 30.11 ? 390  GLN B O   1 
ATOM   5667 C CB  . GLN B 1 328 ? 48.105 49.241  6.459   1.00 29.93 ? 390  GLN B CB  1 
ATOM   5668 C CG  . GLN B 1 328 ? 48.502 50.623  5.979   1.00 30.74 ? 390  GLN B CG  1 
ATOM   5669 C CD  . GLN B 1 328 ? 49.724 51.172  6.696   1.00 30.98 ? 390  GLN B CD  1 
ATOM   5670 O OE1 . GLN B 1 328 ? 50.599 51.754  6.056   1.00 34.39 ? 390  GLN B OE1 1 
ATOM   5671 N NE2 . GLN B 1 328 ? 49.792 50.998  8.024   1.00 31.97 ? 390  GLN B NE2 1 
ATOM   5672 N N   . THR B 1 329 ? 46.349 49.453  3.483   1.00 29.68 ? 391  THR B N   1 
ATOM   5673 C CA  . THR B 1 329 ? 45.261 50.213  2.842   1.00 29.57 ? 391  THR B CA  1 
ATOM   5674 C C   . THR B 1 329 ? 44.591 49.518  1.634   1.00 29.27 ? 391  THR B C   1 
ATOM   5675 O O   . THR B 1 329 ? 43.440 49.815  1.321   1.00 29.43 ? 391  THR B O   1 
ATOM   5676 C CB  . THR B 1 329 ? 45.775 51.595  2.372   1.00 29.91 ? 391  THR B CB  1 
ATOM   5677 O OG1 . THR B 1 329 ? 46.566 51.432  1.186   1.00 31.00 ? 391  THR B OG1 1 
ATOM   5678 C CG2 . THR B 1 329 ? 46.628 52.273  3.472   1.00 30.84 ? 391  THR B CG2 1 
ATOM   5679 N N   . ALA B 1 330 ? 45.294 48.613  0.952   1.00 28.76 ? 392  ALA B N   1 
ATOM   5680 C CA  . ALA B 1 330 ? 44.760 47.991  -0.277  1.00 28.38 ? 392  ALA B CA  1 
ATOM   5681 C C   . ALA B 1 330 ? 43.727 46.899  0.005   1.00 27.98 ? 392  ALA B C   1 
ATOM   5682 O O   . ALA B 1 330 ? 43.519 46.504  1.148   1.00 28.32 ? 392  ALA B O   1 
ATOM   5683 C CB  . ALA B 1 330 ? 45.896 47.424  -1.123  1.00 28.37 ? 392  ALA B CB  1 
ATOM   5684 N N   . GLU B 1 331 ? 43.088 46.411  -1.054  1.00 27.78 ? 393  GLU B N   1 
ATOM   5685 C CA  . GLU B 1 331 ? 42.119 45.324  -0.932  1.00 27.07 ? 393  GLU B CA  1 
ATOM   5686 C C   . GLU B 1 331 ? 42.829 43.986  -0.742  1.00 26.44 ? 393  GLU B C   1 
ATOM   5687 O O   . GLU B 1 331 ? 44.003 43.833  -1.099  1.00 25.53 ? 393  GLU B O   1 
ATOM   5688 C CB  . GLU B 1 331 ? 41.168 45.296  -2.133  1.00 27.15 ? 393  GLU B CB  1 
ATOM   5689 C CG  . GLU B 1 331 ? 41.752 44.824  -3.445  1.00 27.74 ? 393  GLU B CG  1 
ATOM   5690 C CD  . GLU B 1 331 ? 40.731 44.867  -4.592  1.00 27.91 ? 393  GLU B CD  1 
ATOM   5691 O OE1 . GLU B 1 331 ? 39.845 45.752  -4.567  1.00 29.85 ? 393  GLU B OE1 1 
ATOM   5692 O OE2 . GLU B 1 331 ? 40.815 44.024  -5.515  1.00 27.06 ? 393  GLU B OE2 1 
ATOM   5693 N N   . PHE B 1 332 ? 42.097 43.019  -0.196  1.00 25.70 ? 394  PHE B N   1 
ATOM   5694 C CA  . PHE B 1 332 ? 42.706 41.862  0.453   1.00 25.11 ? 394  PHE B CA  1 
ATOM   5695 C C   . PHE B 1 332 ? 43.668 41.007  -0.385  1.00 24.33 ? 394  PHE B C   1 
ATOM   5696 O O   . PHE B 1 332 ? 44.646 40.480  0.153   1.00 23.64 ? 394  PHE B O   1 
ATOM   5697 C CB  . PHE B 1 332 ? 41.641 40.960  1.050   1.00 25.62 ? 394  PHE B CB  1 
ATOM   5698 C CG  . PHE B 1 332 ? 42.208 39.750  1.723   1.00 26.14 ? 394  PHE B CG  1 
ATOM   5699 C CD1 . PHE B 1 332 ? 42.890 39.872  2.922   1.00 27.53 ? 394  PHE B CD1 1 
ATOM   5700 C CD2 . PHE B 1 332 ? 42.107 38.494  1.136   1.00 27.54 ? 394  PHE B CD2 1 
ATOM   5701 C CE1 . PHE B 1 332 ? 43.434 38.757  3.543   1.00 27.72 ? 394  PHE B CE1 1 
ATOM   5702 C CE2 . PHE B 1 332 ? 42.651 37.374  1.747   1.00 27.16 ? 394  PHE B CE2 1 
ATOM   5703 C CZ  . PHE B 1 332 ? 43.312 37.503  2.953   1.00 27.15 ? 394  PHE B CZ  1 
ATOM   5704 N N   . ARG B 1 333 ? 43.387 40.834  -1.673  1.00 23.26 ? 395  ARG B N   1 
ATOM   5705 C CA  . ARG B 1 333 ? 44.268 40.027  -2.527  1.00 22.69 ? 395  ARG B CA  1 
ATOM   5706 C C   . ARG B 1 333 ? 45.556 40.740  -2.837  1.00 20.99 ? 395  ARG B C   1 
ATOM   5707 O O   . ARG B 1 333 ? 46.580 40.102  -2.985  1.00 21.16 ? 395  ARG B O   1 
ATOM   5708 C CB  . ARG B 1 333 ? 43.582 39.646  -3.833  1.00 23.05 ? 395  ARG B CB  1 
ATOM   5709 C CG  . ARG B 1 333 ? 42.467 38.673  -3.632  1.00 23.93 ? 395  ARG B CG  1 
ATOM   5710 C CD  . ARG B 1 333 ? 41.818 38.349  -4.933  1.00 25.60 ? 395  ARG B CD  1 
ATOM   5711 N NE  . ARG B 1 333 ? 40.621 37.547  -4.723  1.00 28.79 ? 395  ARG B NE  1 
ATOM   5712 C CZ  . ARG B 1 333 ? 39.763 37.226  -5.686  1.00 30.59 ? 395  ARG B CZ  1 
ATOM   5713 N NH1 . ARG B 1 333 ? 39.978 37.637  -6.941  1.00 31.81 ? 395  ARG B NH1 1 
ATOM   5714 N NH2 . ARG B 1 333 ? 38.688 36.494  -5.397  1.00 30.95 ? 395  ARG B NH2 1 
ATOM   5715 N N   . THR B 1 334 ? 45.507 42.060  -2.940  1.00 19.34 ? 396  THR B N   1 
ATOM   5716 C CA  . THR B 1 334 ? 46.718 42.844  -3.094  1.00 18.79 ? 396  THR B CA  1 
ATOM   5717 C C   . THR B 1 334 ? 47.519 42.818  -1.798  1.00 18.09 ? 396  THR B C   1 
ATOM   5718 O O   . THR B 1 334 ? 48.741 42.711  -1.836  1.00 17.38 ? 396  THR B O   1 
ATOM   5719 C CB  . THR B 1 334 ? 46.400 44.288  -3.489  1.00 18.08 ? 396  THR B CB  1 
ATOM   5720 O OG1 . THR B 1 334 ? 45.581 44.273  -4.655  1.00 18.18 ? 396  THR B OG1 1 
ATOM   5721 C CG2 . THR B 1 334 ? 47.668 45.072  -3.776  1.00 18.21 ? 396  THR B CG2 1 
ATOM   5722 N N   . ARG B 1 335 ? 46.819 42.903  -0.661  1.00 17.63 ? 397  ARG B N   1 
ATOM   5723 C CA  . ARG B 1 335 ? 47.447 42.853  0.663   1.00 17.51 ? 397  ARG B CA  1 
ATOM   5724 C C   . ARG B 1 335 ? 48.228 41.577  0.860   1.00 16.12 ? 397  ARG B C   1 
ATOM   5725 O O   . ARG B 1 335 ? 49.326 41.620  1.366   1.00 15.09 ? 397  ARG B O   1 
ATOM   5726 C CB  . ARG B 1 335 ? 46.420 42.963  1.812   1.00 17.52 ? 397  ARG B CB  1 
ATOM   5727 C CG  . ARG B 1 335 ? 45.813 44.368  2.048   1.00 19.46 ? 397  ARG B CG  1 
ATOM   5728 C CD  . ARG B 1 335 ? 45.561 44.635  3.556   1.00 20.52 ? 397  ARG B CD  1 
ATOM   5729 N NE  . ARG B 1 335 ? 44.537 43.779  4.153   1.00 21.54 ? 397  ARG B NE  1 
ATOM   5730 C CZ  . ARG B 1 335 ? 44.432 43.484  5.456   1.00 23.07 ? 397  ARG B CZ  1 
ATOM   5731 N NH1 . ARG B 1 335 ? 45.311 43.935  6.360   1.00 24.20 ? 397  ARG B NH1 1 
ATOM   5732 N NH2 . ARG B 1 335 ? 43.438 42.700  5.869   1.00 24.31 ? 397  ARG B NH2 1 
ATOM   5733 N N   . LYS B 1 336 ? 47.648 40.446  0.474   1.00 15.62 ? 398  LYS B N   1 
ATOM   5734 C CA  . LYS B 1 336 ? 48.308 39.153  0.647   1.00 15.30 ? 398  LYS B CA  1 
ATOM   5735 C C   . LYS B 1 336 ? 49.665 39.091  -0.064  1.00 13.86 ? 398  LYS B C   1 
ATOM   5736 O O   . LYS B 1 336 ? 50.602 38.490  0.445   1.00 13.62 ? 398  LYS B O   1 
ATOM   5737 C CB  . LYS B 1 336 ? 47.393 38.000  0.188   1.00 15.93 ? 398  LYS B CB  1 
ATOM   5738 C CG  . LYS B 1 336 ? 48.066 36.602  0.274   1.00 16.91 ? 398  LYS B CG  1 
ATOM   5739 C CD  . LYS B 1 336 ? 47.050 35.434  0.296   1.00 18.22 ? 398  LYS B CD  1 
ATOM   5740 C CE  . LYS B 1 336 ? 47.747 34.044  0.305   1.00 20.13 ? 398  LYS B CE  1 
ATOM   5741 N NZ  . LYS B 1 336 ? 48.325 33.685  -1.050  1.00 21.18 ? 398  LYS B NZ  1 
ATOM   5742 N N   . GLU B 1 337 ? 49.767 39.745  -1.220  1.00 12.89 ? 399  GLU B N   1 
ATOM   5743 C CA  . GLU B 1 337 ? 50.980 39.745  -2.026  1.00 11.86 ? 399  GLU B CA  1 
ATOM   5744 C C   . GLU B 1 337 ? 52.060 40.647  -1.447  1.00 10.96 ? 399  GLU B C   1 
ATOM   5745 O O   . GLU B 1 337 ? 53.225 40.295  -1.449  1.00 10.41 ? 399  GLU B O   1 
ATOM   5746 C CB  . GLU B 1 337 ? 50.647 40.174  -3.456  1.00 12.14 ? 399  GLU B CB  1 
ATOM   5747 C CG  . GLU B 1 337 ? 49.724 39.208  -4.225  1.00 12.25 ? 399  GLU B CG  1 
ATOM   5748 C CD  . GLU B 1 337 ? 50.229 37.772  -4.233  1.00 14.42 ? 399  GLU B CD  1 
ATOM   5749 O OE1 . GLU B 1 337 ? 51.465 37.574  -4.307  1.00 13.75 ? 399  GLU B OE1 1 
ATOM   5750 O OE2 . GLU B 1 337 ? 49.393 36.836  -4.146  1.00 14.37 ? 399  GLU B OE2 1 
ATOM   5751 N N   . ALA B 1 338 ? 51.665 41.819  -0.950  1.00 10.29 ? 400  ALA B N   1 
ATOM   5752 C CA  . ALA B 1 338 ? 52.553 42.705  -0.193  1.00 9.20  ? 400  ALA B CA  1 
ATOM   5753 C C   . ALA B 1 338 ? 53.084 42.035  1.081   1.00 8.20  ? 400  ALA B C   1 
ATOM   5754 O O   . ALA B 1 338 ? 54.229 42.242  1.465   1.00 6.30  ? 400  ALA B O   1 
ATOM   5755 C CB  . ALA B 1 338 ? 51.827 43.986  0.155   1.00 9.59  ? 400  ALA B CB  1 
ATOM   5756 N N   . ALA B 1 339 ? 52.251 41.215  1.708   1.00 6.87  ? 401  ALA B N   1 
ATOM   5757 C CA  . ALA B 1 339 ? 52.621 40.502  2.937   1.00 6.76  ? 401  ALA B CA  1 
ATOM   5758 C C   . ALA B 1 339 ? 53.744 39.507  2.654   1.00 6.16  ? 401  ALA B C   1 
ATOM   5759 O O   . ALA B 1 339 ? 54.714 39.386  3.413   1.00 6.73  ? 401  ALA B O   1 
ATOM   5760 C CB  . ALA B 1 339 ? 51.370 39.787  3.523   1.00 6.27  ? 401  ALA B CB  1 
ATOM   5761 N N   . TRP B 1 340 ? 53.618 38.797  1.534   1.00 5.73  ? 402  TRP B N   1 
ATOM   5762 C CA  . TRP B 1 340 ? 54.657 37.869  1.081   1.00 4.40  ? 402  TRP B CA  1 
ATOM   5763 C C   . TRP B 1 340 ? 55.938 38.617  0.788   1.00 3.93  ? 402  TRP B C   1 
ATOM   5764 O O   . TRP B 1 340 ? 57.018 38.110  1.072   1.00 4.95  ? 402  TRP B O   1 
ATOM   5765 C CB  . TRP B 1 340 ? 54.211 37.137  -0.184  1.00 4.39  ? 402  TRP B CB  1 
ATOM   5766 C CG  . TRP B 1 340 ? 53.483 35.837  0.031   1.00 3.67  ? 402  TRP B CG  1 
ATOM   5767 C CD1 . TRP B 1 340 ? 52.159 35.622  -0.112  1.00 3.83  ? 402  TRP B CD1 1 
ATOM   5768 C CD2 . TRP B 1 340 ? 54.063 34.578  0.387   1.00 3.03  ? 402  TRP B CD2 1 
ATOM   5769 N NE1 . TRP B 1 340 ? 51.862 34.311  0.151   1.00 4.55  ? 402  TRP B NE1 1 
ATOM   5770 C CE2 . TRP B 1 340 ? 53.017 33.646  0.455   1.00 4.37  ? 402  TRP B CE2 1 
ATOM   5771 C CE3 . TRP B 1 340 ? 55.367 34.153  0.669   1.00 4.09  ? 402  TRP B CE3 1 
ATOM   5772 C CZ2 . TRP B 1 340 ? 53.226 32.309  0.786   1.00 4.58  ? 402  TRP B CZ2 1 
ATOM   5773 C CZ3 . TRP B 1 340 ? 55.580 32.825  1.002   1.00 4.43  ? 402  TRP B CZ3 1 
ATOM   5774 C CH2 . TRP B 1 340 ? 54.518 31.917  1.054   1.00 4.49  ? 402  TRP B CH2 1 
ATOM   5775 N N   . ALA B 1 341 ? 55.827 39.813  0.210   1.00 2.78  ? 403  ALA B N   1 
ATOM   5776 C CA  . ALA B 1 341 ? 57.015 40.631  -0.088  1.00 2.95  ? 403  ALA B CA  1 
ATOM   5777 C C   . ALA B 1 341 ? 57.804 41.013  1.147   1.00 2.09  ? 403  ALA B C   1 
ATOM   5778 O O   . ALA B 1 341 ? 59.027 40.867  1.162   1.00 2.27  ? 403  ALA B O   1 
ATOM   5779 C CB  . ALA B 1 341 ? 56.671 41.877  -0.924  1.00 2.00  ? 403  ALA B CB  1 
ATOM   5780 N N   . ILE B 1 342 ? 57.120 41.499  2.171   1.00 2.32  ? 404  ILE B N   1 
ATOM   5781 C CA  . ILE B 1 342 ? 57.763 41.881  3.431   1.00 2.24  ? 404  ILE B CA  1 
ATOM   5782 C C   . ILE B 1 342 ? 58.349 40.679  4.193   1.00 2.00  ? 404  ILE B C   1 
ATOM   5783 O O   . ILE B 1 342 ? 59.477 40.749  4.703   1.00 2.84  ? 404  ILE B O   1 
ATOM   5784 C CB  . ILE B 1 342 ? 56.801 42.610  4.370   1.00 3.26  ? 404  ILE B CB  1 
ATOM   5785 C CG1 . ILE B 1 342 ? 56.226 43.878  3.708   1.00 4.14  ? 404  ILE B CG1 1 
ATOM   5786 C CG2 . ILE B 1 342 ? 57.501 42.895  5.700   1.00 2.00  ? 404  ILE B CG2 1 
ATOM   5787 C CD1 . ILE B 1 342 ? 57.260 44.896  3.363   1.00 8.69  ? 404  ILE B CD1 1 
ATOM   5788 N N   . THR B 1 343 ? 57.619 39.579  4.233   1.00 2.00  ? 405  THR B N   1 
ATOM   5789 C CA  . THR B 1 343 ? 58.032 38.418  4.993   1.00 2.00  ? 405  THR B CA  1 
ATOM   5790 C C   . THR B 1 343 ? 59.256 37.732  4.384   1.00 2.00  ? 405  THR B C   1 
ATOM   5791 O O   . THR B 1 343 ? 60.103 37.226  5.110   1.00 2.00  ? 405  THR B O   1 
ATOM   5792 C CB  . THR B 1 343 ? 56.870 37.401  5.099   1.00 2.00  ? 405  THR B CB  1 
ATOM   5793 O OG1 . THR B 1 343 ? 55.885 37.887  6.027   1.00 2.00  ? 405  THR B OG1 1 
ATOM   5794 C CG2 . THR B 1 343 ? 57.366 36.021  5.538   1.00 2.00  ? 405  THR B CG2 1 
ATOM   5795 N N   . ASN B 1 344 ? 59.338 37.713  3.046   1.00 2.00  ? 406  ASN B N   1 
ATOM   5796 C CA  . ASN B 1 344 ? 60.446 37.099  2.356   1.00 2.00  ? 406  ASN B CA  1 
ATOM   5797 C C   . ASN B 1 344 ? 61.698 37.953  2.577   1.00 2.00  ? 406  ASN B C   1 
ATOM   5798 O O   . ASN B 1 344 ? 62.770 37.432  2.737   1.00 2.00  ? 406  ASN B O   1 
ATOM   5799 C CB  . ASN B 1 344 ? 60.151 36.937  0.856   1.00 2.00  ? 406  ASN B CB  1 
ATOM   5800 C CG  . ASN B 1 344 ? 59.144 35.863  0.555   1.00 2.00  ? 406  ASN B CG  1 
ATOM   5801 O OD1 . ASN B 1 344 ? 58.831 35.034  1.400   1.00 2.00  ? 406  ASN B OD1 1 
ATOM   5802 N ND2 . ASN B 1 344 ? 58.626 35.868  -0.657  1.00 2.00  ? 406  ASN B ND2 1 
ATOM   5803 N N   . ALA B 1 345 ? 61.550 39.266  2.599   1.00 2.00  ? 407  ALA B N   1 
ATOM   5804 C CA  . ALA B 1 345 ? 62.649 40.169  2.947   1.00 2.00  ? 407  ALA B CA  1 
ATOM   5805 C C   . ALA B 1 345 ? 63.152 39.917  4.394   1.00 2.00  ? 407  ALA B C   1 
ATOM   5806 O O   . ALA B 1 345 ? 64.370 39.880  4.648   1.00 2.00  ? 407  ALA B O   1 
ATOM   5807 C CB  . ALA B 1 345 ? 62.214 41.614  2.764   1.00 2.00  ? 407  ALA B CB  1 
ATOM   5808 N N   . THR B 1 346 ? 62.230 39.714  5.330   1.00 2.00  ? 408  THR B N   1 
ATOM   5809 C CA  . THR B 1 346 ? 62.604 39.478  6.739   1.00 2.02  ? 408  THR B CA  1 
ATOM   5810 C C   . THR B 1 346 ? 63.267 38.114  6.897   1.00 2.24  ? 408  THR B C   1 
ATOM   5811 O O   . THR B 1 346 ? 64.056 37.897  7.789   1.00 3.61  ? 408  THR B O   1 
ATOM   5812 C CB  . THR B 1 346 ? 61.405 39.554  7.685   1.00 2.01  ? 408  THR B CB  1 
ATOM   5813 O OG1 . THR B 1 346 ? 60.576 38.421  7.465   1.00 2.00  ? 408  THR B OG1 1 
ATOM   5814 C CG2 . THR B 1 346 ? 60.596 40.845  7.494   1.00 2.00  ? 408  THR B CG2 1 
ATOM   5815 N N   . SER B 1 347 ? 62.955 37.199  5.997   1.00 2.72  ? 409  SER B N   1 
ATOM   5816 C CA  . SER B 1 347 ? 63.562 35.868  5.992   1.00 2.27  ? 409  SER B CA  1 
ATOM   5817 C C   . SER B 1 347 ? 64.956 35.792  5.424   1.00 2.00  ? 409  SER B C   1 
ATOM   5818 O O   . SER B 1 347 ? 65.773 34.994  5.871   1.00 2.42  ? 409  SER B O   1 
ATOM   5819 C CB  . SER B 1 347 ? 62.655 34.943  5.205   1.00 2.56  ? 409  SER B CB  1 
ATOM   5820 O OG  . SER B 1 347 ? 63.405 34.023  4.468   1.00 4.91  ? 409  SER B OG  1 
ATOM   5821 N N   . GLY B 1 348 ? 65.235 36.561  4.386   1.00 2.00  ? 410  GLY B N   1 
ATOM   5822 C CA  . GLY B 1 348 ? 66.581 36.576  3.809   1.00 2.00  ? 410  GLY B CA  1 
ATOM   5823 C C   . GLY B 1 348 ? 67.442 37.719  4.294   1.00 2.00  ? 410  GLY B C   1 
ATOM   5824 O O   . GLY B 1 348 ? 68.639 37.767  4.003   1.00 2.00  ? 410  GLY B O   1 
ATOM   5825 N N   . GLY B 1 349 ? 66.845 38.644  5.026   1.00 2.00  ? 411  GLY B N   1 
ATOM   5826 C CA  . GLY B 1 349 ? 67.474 39.900  5.399   1.00 2.00  ? 411  GLY B CA  1 
ATOM   5827 C C   . GLY B 1 349 ? 68.448 39.912  6.567   1.00 2.00  ? 411  GLY B C   1 
ATOM   5828 O O   . GLY B 1 349 ? 68.372 39.081  7.476   1.00 2.00  ? 411  GLY B O   1 
ATOM   5829 N N   . SER B 1 350 ? 69.377 40.875  6.508   1.00 2.00  ? 412  SER B N   1 
ATOM   5830 C CA  . SER B 1 350 ? 70.307 41.181  7.586   1.00 2.00  ? 412  SER B CA  1 
ATOM   5831 C C   . SER B 1 350 ? 69.641 41.925  8.722   1.00 2.00  ? 412  SER B C   1 
ATOM   5832 O O   . SER B 1 350 ? 68.624 42.559  8.525   1.00 2.66  ? 412  SER B O   1 
ATOM   5833 C CB  . SER B 1 350 ? 71.416 42.069  7.050   1.00 2.00  ? 412  SER B CB  1 
ATOM   5834 O OG  . SER B 1 350 ? 70.943 43.381  6.861   1.00 2.00  ? 412  SER B OG  1 
ATOM   5835 N N   . ALA B 1 351 ? 70.264 41.923  9.898   1.00 2.30  ? 413  ALA B N   1 
ATOM   5836 C CA  . ALA B 1 351 ? 69.714 42.637  11.047  1.00 2.00  ? 413  ALA B CA  1 
ATOM   5837 C C   . ALA B 1 351 ? 69.450 44.080  10.671  1.00 2.00  ? 413  ALA B C   1 
ATOM   5838 O O   . ALA B 1 351 ? 68.396 44.616  10.945  1.00 2.09  ? 413  ALA B O   1 
ATOM   5839 C CB  . ALA B 1 351 ? 70.676 42.564  12.212  1.00 2.00  ? 413  ALA B CB  1 
ATOM   5840 N N   . GLU B 1 352 ? 70.430 44.702  10.024  1.00 2.47  ? 414  GLU B N   1 
ATOM   5841 C CA  . GLU B 1 352 ? 70.322 46.088  9.584   1.00 2.53  ? 414  GLU B CA  1 
ATOM   5842 C C   . GLU B 1 352 ? 69.187 46.314  8.551   1.00 2.00  ? 414  GLU B C   1 
ATOM   5843 O O   . GLU B 1 352 ? 68.573 47.378  8.543   1.00 2.00  ? 414  GLU B O   1 
ATOM   5844 C CB  . GLU B 1 352 ? 71.647 46.550  8.999   1.00 3.35  ? 414  GLU B CB  1 
ATOM   5845 C CG  . GLU B 1 352 ? 72.860 46.472  9.962   1.00 6.93  ? 414  GLU B CG  1 
ATOM   5846 C CD  . GLU B 1 352 ? 73.560 45.076  10.027  1.00 12.76 ? 414  GLU B CD  1 
ATOM   5847 O OE1 . GLU B 1 352 ? 73.428 44.242  9.086   1.00 12.42 ? 414  GLU B OE1 1 
ATOM   5848 O OE2 . GLU B 1 352 ? 74.276 44.825  11.039  1.00 18.09 ? 414  GLU B OE2 1 
ATOM   5849 N N   . GLN B 1 353 ? 68.923 45.321  7.693   1.00 2.00  ? 415  GLN B N   1 
ATOM   5850 C CA  . GLN B 1 353 ? 67.859 45.422  6.707   1.00 2.00  ? 415  GLN B CA  1 
ATOM   5851 C C   . GLN B 1 353 ? 66.516 45.308  7.394   1.00 2.00  ? 415  GLN B C   1 
ATOM   5852 O O   . GLN B 1 353 ? 65.614 46.091  7.093   1.00 2.69  ? 415  GLN B O   1 
ATOM   5853 C CB  . GLN B 1 353 ? 67.996 44.366  5.586   1.00 2.00  ? 415  GLN B CB  1 
ATOM   5854 C CG  . GLN B 1 353 ? 69.099 44.662  4.602   1.00 2.00  ? 415  GLN B CG  1 
ATOM   5855 C CD  . GLN B 1 353 ? 69.370 43.516  3.604   1.00 2.00  ? 415  GLN B CD  1 
ATOM   5856 O OE1 . GLN B 1 353 ? 69.271 42.328  3.925   1.00 2.00  ? 415  GLN B OE1 1 
ATOM   5857 N NE2 . GLN B 1 353 ? 69.714 43.884  2.405   1.00 2.00  ? 415  GLN B NE2 1 
ATOM   5858 N N   . ILE B 1 354 ? 66.377 44.356  8.320   1.00 2.00  ? 416  ILE B N   1 
ATOM   5859 C CA  . ILE B 1 354 ? 65.135 44.241  9.153   1.00 2.38  ? 416  ILE B CA  1 
ATOM   5860 C C   . ILE B 1 354 ? 64.854 45.498  9.969   1.00 2.13  ? 416  ILE B C   1 
ATOM   5861 O O   . ILE B 1 354 ? 63.719 45.979  10.001  1.00 2.00  ? 416  ILE B O   1 
ATOM   5862 C CB  . ILE B 1 354 ? 65.172 43.000  10.102  1.00 3.22  ? 416  ILE B CB  1 
ATOM   5863 C CG1 . ILE B 1 354 ? 64.599 41.801  9.369   1.00 4.29  ? 416  ILE B CG1 1 
ATOM   5864 C CG2 . ILE B 1 354 ? 64.378 43.219  11.382  1.00 2.03  ? 416  ILE B CG2 1 
ATOM   5865 C CD1 . ILE B 1 354 ? 65.254 41.590  8.008   1.00 4.99  ? 416  ILE B CD1 1 
ATOM   5866 N N   . LYS B 1 355 ? 65.891 46.050  10.591  1.00 2.00  ? 417  LYS B N   1 
ATOM   5867 C CA  . LYS B 1 355 ? 65.766 47.318  11.333  1.00 2.01  ? 417  LYS B CA  1 
ATOM   5868 C C   . LYS B 1 355 ? 65.117 48.446  10.524  1.00 2.00  ? 417  LYS B C   1 
ATOM   5869 O O   . LYS B 1 355 ? 64.258 49.173  11.030  1.00 2.00  ? 417  LYS B O   1 
ATOM   5870 C CB  . LYS B 1 355 ? 67.147 47.745  11.842  1.00 2.34  ? 417  LYS B CB  1 
ATOM   5871 C CG  . LYS B 1 355 ? 67.241 49.098  12.524  1.00 3.52  ? 417  LYS B CG  1 
ATOM   5872 C CD  . LYS B 1 355 ? 68.711 49.324  13.048  1.00 2.03  ? 417  LYS B CD  1 
ATOM   5873 C CE  . LYS B 1 355 ? 69.097 50.809  13.016  1.00 5.61  ? 417  LYS B CE  1 
ATOM   5874 N NZ  . LYS B 1 355 ? 70.542 51.154  13.537  1.00 5.23  ? 417  LYS B NZ  1 
ATOM   5875 N N   . TYR B 1 356 ? 65.513 48.598  9.264   1.00 2.84  ? 418  TYR B N   1 
ATOM   5876 C CA  . TYR B 1 356 ? 64.980 49.655  8.392   1.00 2.47  ? 418  TYR B CA  1 
ATOM   5877 C C   . TYR B 1 356 ? 63.529 49.398  8.082   1.00 2.00  ? 418  TYR B C   1 
ATOM   5878 O O   . TYR B 1 356 ? 62.699 50.302  8.129   1.00 2.00  ? 418  TYR B O   1 
ATOM   5879 C CB  . TYR B 1 356 ? 65.804 49.742  7.103   1.00 4.21  ? 418  TYR B CB  1 
ATOM   5880 C CG  . TYR B 1 356 ? 65.171 50.496  5.958   1.00 4.84  ? 418  TYR B CG  1 
ATOM   5881 C CD1 . TYR B 1 356 ? 65.258 51.869  5.856   1.00 5.18  ? 418  TYR B CD1 1 
ATOM   5882 C CD2 . TYR B 1 356 ? 64.508 49.800  4.936   1.00 9.02  ? 418  TYR B CD2 1 
ATOM   5883 C CE1 . TYR B 1 356 ? 64.694 52.543  4.745   1.00 7.61  ? 418  TYR B CE1 1 
ATOM   5884 C CE2 . TYR B 1 356 ? 63.931 50.457  3.845   1.00 8.07  ? 418  TYR B CE2 1 
ATOM   5885 C CZ  . TYR B 1 356 ? 64.029 51.820  3.757   1.00 8.58  ? 418  TYR B CZ  1 
ATOM   5886 O OH  . TYR B 1 356 ? 63.438 52.423  2.669   1.00 10.54 ? 418  TYR B OH  1 
ATOM   5887 N N   . LEU B 1 357 ? 63.204 48.145  7.824   1.00 2.07  ? 419  LEU B N   1 
ATOM   5888 C CA  . LEU B 1 357 ? 61.770 47.773  7.626   1.00 2.00  ? 419  LEU B CA  1 
ATOM   5889 C C   . LEU B 1 357 ? 60.922 48.055  8.836   1.00 2.46  ? 419  LEU B C   1 
ATOM   5890 O O   . LEU B 1 357 ? 59.764 48.496  8.709   1.00 2.00  ? 419  LEU B O   1 
ATOM   5891 C CB  . LEU B 1 357 ? 61.612 46.307  7.227   1.00 2.00  ? 419  LEU B CB  1 
ATOM   5892 C CG  . LEU B 1 357 ? 62.046 45.944  5.792   1.00 3.91  ? 419  LEU B CG  1 
ATOM   5893 C CD1 . LEU B 1 357 ? 62.290 44.418  5.604   1.00 2.16  ? 419  LEU B CD1 1 
ATOM   5894 C CD2 . LEU B 1 357 ? 61.002 46.458  4.818   1.00 5.29  ? 419  LEU B CD2 1 
ATOM   5895 N N   . VAL B 1 358 ? 61.468 47.769  10.023  1.00 2.32  ? 420  VAL B N   1 
ATOM   5896 C CA  . VAL B 1 358 ? 60.742 48.037  11.267  1.00 2.00  ? 420  VAL B CA  1 
ATOM   5897 C C   . VAL B 1 358 ? 60.557 49.539  11.478  1.00 2.00  ? 420  VAL B C   1 
ATOM   5898 O O   . VAL B 1 358 ? 59.464 49.982  11.873  1.00 2.00  ? 420  VAL B O   1 
ATOM   5899 C CB  . VAL B 1 358 ? 61.431 47.406  12.489  1.00 2.00  ? 420  VAL B CB  1 
ATOM   5900 C CG1 . VAL B 1 358 ? 60.854 47.979  13.779  1.00 2.00  ? 420  VAL B CG1 1 
ATOM   5901 C CG2 . VAL B 1 358 ? 61.264 45.887  12.457  1.00 2.00  ? 420  VAL B CG2 1 
ATOM   5902 N N   . GLU B 1 359 ? 61.639 50.302  11.232  1.00 2.00  ? 421  GLU B N   1 
ATOM   5903 C CA  . GLU B 1 359 ? 61.593 51.769  11.196  1.00 2.00  ? 421  GLU B CA  1 
ATOM   5904 C C   . GLU B 1 359 ? 60.573 52.365  10.219  1.00 2.00  ? 421  GLU B C   1 
ATOM   5905 O O   . GLU B 1 359 ? 60.101 53.470  10.433  1.00 2.00  ? 421  GLU B O   1 
ATOM   5906 C CB  . GLU B 1 359 ? 62.985 52.351  10.847  1.00 2.00  ? 421  GLU B CB  1 
ATOM   5907 C CG  . GLU B 1 359 ? 63.991 52.241  11.979  1.00 2.00  ? 421  GLU B CG  1 
ATOM   5908 C CD  . GLU B 1 359 ? 65.415 52.640  11.599  1.00 2.66  ? 421  GLU B CD  1 
ATOM   5909 O OE1 . GLU B 1 359 ? 65.770 52.642  10.401  1.00 4.76  ? 421  GLU B OE1 1 
ATOM   5910 O OE2 . GLU B 1 359 ? 66.203 52.913  12.514  1.00 7.61  ? 421  GLU B OE2 1 
ATOM   5911 N N   . LEU B 1 360 ? 60.291 51.683  9.111   1.00 2.78  ? 422  LEU B N   1 
ATOM   5912 C CA  . LEU B 1 360 ? 59.234 52.129  8.179   1.00 2.94  ? 422  LEU B CA  1 
ATOM   5913 C C   . LEU B 1 360 ? 57.849 51.716  8.614   1.00 3.33  ? 422  LEU B C   1 
ATOM   5914 O O   . LEU B 1 360 ? 56.851 52.139  8.007   1.00 3.67  ? 422  LEU B O   1 
ATOM   5915 C CB  . LEU B 1 360 ? 59.454 51.578  6.777   1.00 3.31  ? 422  LEU B CB  1 
ATOM   5916 C CG  . LEU B 1 360 ? 60.651 52.061  5.987   1.00 3.82  ? 422  LEU B CG  1 
ATOM   5917 C CD1 . LEU B 1 360 ? 60.625 51.326  4.642   1.00 4.95  ? 422  LEU B CD1 1 
ATOM   5918 C CD2 . LEU B 1 360 ? 60.684 53.587  5.802   1.00 2.33  ? 422  LEU B CD2 1 
ATOM   5919 N N   . GLY B 1 361 ? 57.761 50.896  9.653   1.00 3.89  ? 423  GLY B N   1 
ATOM   5920 C CA  . GLY B 1 361 ? 56.463 50.581  10.273  1.00 4.23  ? 423  GLY B CA  1 
ATOM   5921 C C   . GLY B 1 361 ? 55.870 49.245  9.881   1.00 4.48  ? 423  GLY B C   1 
ATOM   5922 O O   . GLY B 1 361 ? 54.646 49.074  9.912   1.00 4.19  ? 423  GLY B O   1 
ATOM   5923 N N   . CYS B 1 362 ? 56.710 48.264  9.546   1.00 4.44  ? 424  CYS B N   1 
ATOM   5924 C CA  . CYS B 1 362 ? 56.161 46.977  9.083   1.00 5.25  ? 424  CYS B CA  1 
ATOM   5925 C C   . CYS B 1 362 ? 55.588 46.075  10.166  1.00 5.05  ? 424  CYS B C   1 
ATOM   5926 O O   . CYS B 1 362 ? 54.865 45.130  9.837   1.00 5.40  ? 424  CYS B O   1 
ATOM   5927 C CB  . CYS B 1 362 ? 57.198 46.162  8.318   1.00 6.12  ? 424  CYS B CB  1 
ATOM   5928 S SG  . CYS B 1 362 ? 58.343 45.338  9.450   1.00 10.21 ? 424  CYS B SG  1 
ATOM   5929 N N   . ILE B 1 363 ? 55.902 46.296  11.450  1.00 4.83  ? 425  ILE B N   1 
ATOM   5930 C CA  . ILE B 1 363 ? 55.390 45.354  12.478  1.00 4.44  ? 425  ILE B CA  1 
ATOM   5931 C C   . ILE B 1 363 ? 53.863 45.431  12.601  1.00 3.53  ? 425  ILE B C   1 
ATOM   5932 O O   . ILE B 1 363 ? 53.184 44.421  12.513  1.00 3.85  ? 425  ILE B O   1 
ATOM   5933 C CB  . ILE B 1 363 ? 56.078 45.532  13.838  1.00 4.67  ? 425  ILE B CB  1 
ATOM   5934 C CG1 . ILE B 1 363 ? 57.464 44.874  13.796  1.00 4.62  ? 425  ILE B CG1 1 
ATOM   5935 C CG2 . ILE B 1 363 ? 55.247 44.873  14.970  1.00 4.51  ? 425  ILE B CG2 1 
ATOM   5936 C CD1 . ILE B 1 363 ? 58.310 45.206  14.964  1.00 3.67  ? 425  ILE B CD1 1 
ATOM   5937 N N   . LYS B 1 364 ? 53.337 46.637  12.765  1.00 3.58  ? 426  LYS B N   1 
ATOM   5938 C CA  . LYS B 1 364 ? 51.894 46.849  12.886  1.00 4.65  ? 426  LYS B CA  1 
ATOM   5939 C C   . LYS B 1 364 ? 51.046 46.105  11.825  1.00 5.02  ? 426  LYS B C   1 
ATOM   5940 O O   . LYS B 1 364 ? 50.357 45.204  12.182  1.00 6.57  ? 426  LYS B O   1 
ATOM   5941 C CB  . LYS B 1 364 ? 51.590 48.335  12.904  1.00 4.26  ? 426  LYS B CB  1 
ATOM   5942 C CG  . LYS B 1 364 ? 50.098 48.671  12.990  1.00 2.89  ? 426  LYS B CG  1 
ATOM   5943 C CD  . LYS B 1 364 ? 49.495 48.040  14.168  1.00 2.65  ? 426  LYS B CD  1 
ATOM   5944 C CE  . LYS B 1 364 ? 47.989 48.393  14.274  1.00 2.50  ? 426  LYS B CE  1 
ATOM   5945 N NZ  . LYS B 1 364 ? 47.462 47.583  15.352  1.00 2.00  ? 426  LYS B NZ  1 
ATOM   5946 N N   . PRO B 1 365 ? 51.125 46.441  10.519  1.00 6.32  ? 427  PRO B N   1 
ATOM   5947 C CA  . PRO B 1 365 ? 50.317 45.696  9.536   1.00 6.68  ? 427  PRO B CA  1 
ATOM   5948 C C   . PRO B 1 365 ? 50.523 44.169  9.514   1.00 7.51  ? 427  PRO B C   1 
ATOM   5949 O O   . PRO B 1 365 ? 49.580 43.464  9.245   1.00 7.68  ? 427  PRO B O   1 
ATOM   5950 C CB  . PRO B 1 365 ? 50.738 46.295  8.197   1.00 7.10  ? 427  PRO B CB  1 
ATOM   5951 C CG  . PRO B 1 365 ? 52.036 46.923  8.436   1.00 6.49  ? 427  PRO B CG  1 
ATOM   5952 C CD  . PRO B 1 365 ? 51.952 47.447  9.849   1.00 7.03  ? 427  PRO B CD  1 
ATOM   5953 N N   . LEU B 1 366 ? 51.721 43.657  9.811   1.00 7.36  ? 428  LEU B N   1 
ATOM   5954 C CA  . LEU B 1 366 ? 51.865 42.207  9.978   1.00 7.39  ? 428  LEU B CA  1 
ATOM   5955 C C   . LEU B 1 366 ? 51.040 41.673  11.158  1.00 7.79  ? 428  LEU B C   1 
ATOM   5956 O O   . LEU B 1 366 ? 50.450 40.592  11.051  1.00 7.09  ? 428  LEU B O   1 
ATOM   5957 C CB  . LEU B 1 366 ? 53.322 41.803  10.183  1.00 8.03  ? 428  LEU B CB  1 
ATOM   5958 C CG  . LEU B 1 366 ? 54.252 41.905  8.982   1.00 8.36  ? 428  LEU B CG  1 
ATOM   5959 C CD1 . LEU B 1 366 ? 55.634 41.503  9.409   1.00 10.08 ? 428  LEU B CD1 1 
ATOM   5960 C CD2 . LEU B 1 366 ? 53.776 41.046  7.774   1.00 7.91  ? 428  LEU B CD2 1 
ATOM   5961 N N   . CYS B 1 367 ? 50.999 42.417  12.272  1.00 7.42  ? 429  CYS B N   1 
ATOM   5962 C CA  . CYS B 1 367 ? 50.232 42.003  13.435  1.00 7.64  ? 429  CYS B CA  1 
ATOM   5963 C C   . CYS B 1 367 ? 48.752 42.072  13.101  1.00 8.30  ? 429  CYS B C   1 
ATOM   5964 O O   . CYS B 1 367 ? 47.997 41.191  13.480  1.00 7.51  ? 429  CYS B O   1 
ATOM   5965 C CB  . CYS B 1 367 ? 50.553 42.845  14.685  1.00 7.58  ? 429  CYS B CB  1 
ATOM   5966 S SG  . CYS B 1 367 ? 52.204 42.470  15.411  1.00 4.03  ? 429  CYS B SG  1 
ATOM   5967 N N   . ASP B 1 368 ? 48.336 43.109  12.382  1.00 9.18  ? 430  ASP B N   1 
ATOM   5968 C CA  . ASP B 1 368 ? 46.943 43.183  11.944  1.00 10.28 ? 430  ASP B CA  1 
ATOM   5969 C C   . ASP B 1 368 ? 46.543 41.966  11.087  1.00 11.06 ? 430  ASP B C   1 
ATOM   5970 O O   . ASP B 1 368 ? 45.365 41.591  11.069  1.00 10.65 ? 430  ASP B O   1 
ATOM   5971 C CB  . ASP B 1 368 ? 46.659 44.483  11.178  1.00 10.79 ? 430  ASP B CB  1 
ATOM   5972 C CG  . ASP B 1 368 ? 46.498 45.707  12.106  1.00 14.08 ? 430  ASP B CG  1 
ATOM   5973 O OD1 . ASP B 1 368 ? 46.278 45.542  13.332  1.00 15.83 ? 430  ASP B OD1 1 
ATOM   5974 O OD2 . ASP B 1 368 ? 46.567 46.854  11.591  1.00 18.46 ? 430  ASP B OD2 1 
ATOM   5975 N N   . LEU B 1 369 ? 47.498 41.328  10.403  1.00 11.36 ? 431  LEU B N   1 
ATOM   5976 C CA  . LEU B 1 369 ? 47.144 40.196  9.522   1.00 11.84 ? 431  LEU B CA  1 
ATOM   5977 C C   . LEU B 1 369 ? 46.832 38.930  10.304  1.00 12.92 ? 431  LEU B C   1 
ATOM   5978 O O   . LEU B 1 369 ? 46.158 38.023  9.770   1.00 12.97 ? 431  LEU B O   1 
ATOM   5979 C CB  . LEU B 1 369 ? 48.236 39.936  8.479   1.00 11.74 ? 431  LEU B CB  1 
ATOM   5980 C CG  . LEU B 1 369 ? 48.356 41.004  7.393   1.00 10.30 ? 431  LEU B CG  1 
ATOM   5981 C CD1 . LEU B 1 369 ? 49.556 40.761  6.559   1.00 10.88 ? 431  LEU B CD1 1 
ATOM   5982 C CD2 . LEU B 1 369 ? 47.068 41.064  6.541   1.00 10.95 ? 431  LEU B CD2 1 
ATOM   5983 N N   . LEU B 1 370 ? 47.291 38.877  11.562  1.00 13.11 ? 432  LEU B N   1 
ATOM   5984 C CA  . LEU B 1 370 ? 47.066 37.721  12.451  1.00 14.01 ? 432  LEU B CA  1 
ATOM   5985 C C   . LEU B 1 370 ? 45.617 37.511  12.853  1.00 14.73 ? 432  LEU B C   1 
ATOM   5986 O O   . LEU B 1 370 ? 45.271 36.456  13.342  1.00 14.02 ? 432  LEU B O   1 
ATOM   5987 C CB  . LEU B 1 370 ? 47.918 37.833  13.726  1.00 13.35 ? 432  LEU B CB  1 
ATOM   5988 C CG  . LEU B 1 370 ? 49.431 37.835  13.518  1.00 12.37 ? 432  LEU B CG  1 
ATOM   5989 C CD1 . LEU B 1 370 ? 50.165 38.000  14.851  1.00 9.90  ? 432  LEU B CD1 1 
ATOM   5990 C CD2 . LEU B 1 370 ? 49.859 36.568  12.784  1.00 9.04  ? 432  LEU B CD2 1 
ATOM   5991 N N   . THR B 1 371 ? 44.778 38.513  12.630  1.00 16.81 ? 433  THR B N   1 
ATOM   5992 C CA  . THR B 1 371 ? 43.383 38.479  13.031  1.00 18.81 ? 433  THR B CA  1 
ATOM   5993 C C   . THR B 1 371 ? 42.453 38.154  11.867  1.00 20.25 ? 433  THR B C   1 
ATOM   5994 O O   . THR B 1 371 ? 41.255 37.966  12.071  1.00 20.99 ? 433  THR B O   1 
ATOM   5995 C CB  . THR B 1 371 ? 42.960 39.861  13.548  1.00 19.35 ? 433  THR B CB  1 
ATOM   5996 O OG1 . THR B 1 371 ? 43.031 40.800  12.461  1.00 20.66 ? 433  THR B OG1 1 
ATOM   5997 C CG2 . THR B 1 371 ? 43.875 40.340  14.689  1.00 19.65 ? 433  THR B CG2 1 
ATOM   5998 N N   . VAL B 1 372 ? 42.992 38.126  10.649  1.00 21.64 ? 434  VAL B N   1 
ATOM   5999 C CA  . VAL B 1 372 ? 42.174 37.972  9.453   1.00 22.48 ? 434  VAL B CA  1 
ATOM   6000 C C   . VAL B 1 372 ? 41.869 36.503  9.231   1.00 23.40 ? 434  VAL B C   1 
ATOM   6001 O O   . VAL B 1 372 ? 42.719 35.635  9.453   1.00 23.39 ? 434  VAL B O   1 
ATOM   6002 C CB  . VAL B 1 372 ? 42.844 38.579  8.189   1.00 22.96 ? 434  VAL B CB  1 
ATOM   6003 C CG1 . VAL B 1 372 ? 43.248 40.028  8.440   1.00 22.62 ? 434  VAL B CG1 1 
ATOM   6004 C CG2 . VAL B 1 372 ? 44.048 37.745  7.748   1.00 22.22 ? 434  VAL B CG2 1 
ATOM   6005 N N   . MET B 1 373 ? 40.647 36.232  8.794   1.00 24.47 ? 435  MET B N   1 
ATOM   6006 C CA  . MET B 1 373 ? 40.177 34.862  8.639   1.00 25.13 ? 435  MET B CA  1 
ATOM   6007 C C   . MET B 1 373 ? 40.608 34.281  7.287   1.00 25.19 ? 435  MET B C   1 
ATOM   6008 O O   . MET B 1 373 ? 39.785 34.077  6.403   1.00 25.34 ? 435  MET B O   1 
ATOM   6009 C CB  . MET B 1 373 ? 38.654 34.806  8.809   1.00 26.44 ? 435  MET B CB  1 
ATOM   6010 C CG  . MET B 1 373 ? 38.161 35.240  10.208  1.00 29.08 ? 435  MET B CG  1 
ATOM   6011 S SD  . MET B 1 373 ? 38.379 33.964  11.488  1.00 35.77 ? 435  MET B SD  1 
ATOM   6012 C CE  . MET B 1 373 ? 40.028 34.301  12.139  1.00 34.45 ? 435  MET B CE  1 
ATOM   6013 N N   . ASP B 1 374 ? 41.918 34.051  7.149   1.00 24.81 ? 436  ASP B N   1 
ATOM   6014 C CA  . ASP B 1 374 ? 42.521 33.317  6.028   1.00 24.10 ? 436  ASP B CA  1 
ATOM   6015 C C   . ASP B 1 374 ? 43.826 32.719  6.562   1.00 23.51 ? 436  ASP B C   1 
ATOM   6016 O O   . ASP B 1 374 ? 44.777 33.446  6.828   1.00 23.27 ? 436  ASP B O   1 
ATOM   6017 C CB  . ASP B 1 374 ? 42.808 34.247  4.840   1.00 24.66 ? 436  ASP B CB  1 
ATOM   6018 C CG  . ASP B 1 374 ? 43.553 33.546  3.690   1.00 25.76 ? 436  ASP B CG  1 
ATOM   6019 O OD1 . ASP B 1 374 ? 42.977 32.623  3.069   1.00 30.44 ? 436  ASP B OD1 1 
ATOM   6020 O OD2 . ASP B 1 374 ? 44.709 33.928  3.383   1.00 28.77 ? 436  ASP B OD2 1 
ATOM   6021 N N   . SER B 1 375 ? 43.865 31.400  6.738   1.00 22.34 ? 437  SER B N   1 
ATOM   6022 C CA  . SER B 1 375 ? 45.015 30.742  7.368   1.00 21.28 ? 437  SER B CA  1 
ATOM   6023 C C   . SER B 1 375 ? 46.345 31.011  6.657   1.00 20.14 ? 437  SER B C   1 
ATOM   6024 O O   . SER B 1 375 ? 47.386 31.077  7.290   1.00 19.74 ? 437  SER B O   1 
ATOM   6025 C CB  . SER B 1 375 ? 44.787 29.231  7.452   1.00 21.25 ? 437  SER B CB  1 
ATOM   6026 O OG  . SER B 1 375 ? 45.225 28.598  6.267   1.00 22.06 ? 437  SER B OG  1 
ATOM   6027 N N   . LYS B 1 376 ? 46.302 31.160  5.342   1.00 19.11 ? 438  LYS B N   1 
ATOM   6028 C CA  . LYS B 1 376 ? 47.518 31.318  4.555   1.00 18.43 ? 438  LYS B CA  1 
ATOM   6029 C C   . LYS B 1 376 ? 48.196 32.657  4.819   1.00 17.24 ? 438  LYS B C   1 
ATOM   6030 O O   . LYS B 1 376 ? 49.409 32.728  4.941   1.00 16.63 ? 438  LYS B O   1 
ATOM   6031 C CB  . LYS B 1 376 ? 47.197 31.185  3.069   1.00 18.71 ? 438  LYS B CB  1 
ATOM   6032 C CG  . LYS B 1 376 ? 46.638 29.802  2.665   1.00 19.55 ? 438  LYS B CG  1 
ATOM   6033 C CD  . LYS B 1 376 ? 46.306 29.754  1.173   1.00 19.52 ? 438  LYS B CD  1 
ATOM   6034 C CE  . LYS B 1 376 ? 46.288 28.334  0.636   1.00 21.08 ? 438  LYS B CE  1 
ATOM   6035 N NZ  . LYS B 1 376 ? 46.583 28.315  -0.832  1.00 20.93 ? 438  LYS B NZ  1 
ATOM   6036 N N   . ILE B 1 377 ? 47.411 33.727  4.893   1.00 16.24 ? 439  ILE B N   1 
ATOM   6037 C CA  . ILE B 1 377 ? 47.975 35.054  5.147   1.00 15.46 ? 439  ILE B CA  1 
ATOM   6038 C C   . ILE B 1 377 ? 48.481 35.108  6.593   1.00 13.91 ? 439  ILE B C   1 
ATOM   6039 O O   . ILE B 1 377 ? 49.495 35.715  6.863   1.00 12.47 ? 439  ILE B O   1 
ATOM   6040 C CB  . ILE B 1 377 ? 46.958 36.206  4.858   1.00 15.57 ? 439  ILE B CB  1 
ATOM   6041 C CG1 . ILE B 1 377 ? 47.668 37.457  4.341   1.00 16.54 ? 439  ILE B CG1 1 
ATOM   6042 C CG2 . ILE B 1 377 ? 46.178 36.552  6.090   1.00 15.46 ? 439  ILE B CG2 1 
ATOM   6043 C CD1 . ILE B 1 377 ? 46.687 38.598  3.957   1.00 16.52 ? 439  ILE B CD1 1 
ATOM   6044 N N   . VAL B 1 378 ? 47.773 34.446  7.509   1.00 13.08 ? 440  VAL B N   1 
ATOM   6045 C CA  . VAL B 1 378 ? 48.223 34.342  8.907   1.00 12.02 ? 440  VAL B CA  1 
ATOM   6046 C C   . VAL B 1 378 ? 49.579 33.637  9.022   1.00 11.44 ? 440  VAL B C   1 
ATOM   6047 O O   . VAL B 1 378 ? 50.435 34.094  9.767   1.00 11.74 ? 440  VAL B O   1 
ATOM   6048 C CB  . VAL B 1 378 ? 47.152 33.682  9.798   1.00 11.83 ? 440  VAL B CB  1 
ATOM   6049 C CG1 . VAL B 1 378 ? 47.675 33.484  11.217  1.00 11.12 ? 440  VAL B CG1 1 
ATOM   6050 C CG2 . VAL B 1 378 ? 45.881 34.537  9.819   1.00 9.13  ? 440  VAL B CG2 1 
ATOM   6051 N N   . GLN B 1 379 ? 49.797 32.563  8.264   1.00 10.65 ? 441  GLN B N   1 
ATOM   6052 C CA  . GLN B 1 379 ? 51.070 31.834  8.308   1.00 10.36 ? 441  GLN B CA  1 
ATOM   6053 C C   . GLN B 1 379 ? 52.232 32.692  7.825   1.00 9.47  ? 441  GLN B C   1 
ATOM   6054 O O   . GLN B 1 379 ? 53.356 32.555  8.302   1.00 10.03 ? 441  GLN B O   1 
ATOM   6055 C CB  . GLN B 1 379 ? 51.011 30.589  7.415   1.00 11.30 ? 441  GLN B CB  1 
ATOM   6056 C CG  . GLN B 1 379 ? 50.118 29.445  7.908   1.00 14.88 ? 441  GLN B CG  1 
ATOM   6057 C CD  . GLN B 1 379 ? 50.898 28.260  8.491   1.00 19.45 ? 441  GLN B CD  1 
ATOM   6058 O OE1 . GLN B 1 379 ? 51.927 28.434  9.172   1.00 23.81 ? 441  GLN B OE1 1 
ATOM   6059 N NE2 . GLN B 1 379 ? 50.397 27.047  8.237   1.00 20.53 ? 441  GLN B NE2 1 
ATOM   6060 N N   . VAL B 1 380 ? 51.956 33.535  6.832   1.00 8.19  ? 442  VAL B N   1 
ATOM   6061 C CA  . VAL B 1 380 ? 52.939 34.408  6.219   1.00 7.19  ? 442  VAL B CA  1 
ATOM   6062 C C   . VAL B 1 380 ? 53.309 35.526  7.191   1.00 6.75  ? 442  VAL B C   1 
ATOM   6063 O O   . VAL B 1 380 ? 54.479 35.828  7.366   1.00 6.08  ? 442  VAL B O   1 
ATOM   6064 C CB  . VAL B 1 380 ? 52.423 34.936  4.822   1.00 7.26  ? 442  VAL B CB  1 
ATOM   6065 C CG1 . VAL B 1 380 ? 53.198 36.098  4.317   1.00 4.38  ? 442  VAL B CG1 1 
ATOM   6066 C CG2 . VAL B 1 380 ? 52.430 33.804  3.802   1.00 7.09  ? 442  VAL B CG2 1 
ATOM   6067 N N   . ALA B 1 381 ? 52.315 36.124  7.840   1.00 6.23  ? 443  ALA B N   1 
ATOM   6068 C CA  . ALA B 1 381 ? 52.568 37.147  8.861   1.00 5.99  ? 443  ALA B CA  1 
ATOM   6069 C C   . ALA B 1 381 ? 53.342 36.616  10.091  1.00 5.12  ? 443  ALA B C   1 
ATOM   6070 O O   . ALA B 1 381 ? 54.293 37.244  10.544  1.00 4.27  ? 443  ALA B O   1 
ATOM   6071 C CB  . ALA B 1 381 ? 51.258 37.769  9.297   1.00 6.03  ? 443  ALA B CB  1 
ATOM   6072 N N   . LEU B 1 382 ? 52.941 35.461  10.620  1.00 4.56  ? 444  LEU B N   1 
ATOM   6073 C CA  . LEU B 1 382 ? 53.687 34.837  11.710  1.00 4.74  ? 444  LEU B CA  1 
ATOM   6074 C C   . LEU B 1 382 ? 55.137 34.615  11.341  1.00 3.84  ? 444  LEU B C   1 
ATOM   6075 O O   . LEU B 1 382 ? 56.031 34.866  12.144  1.00 4.79  ? 444  LEU B O   1 
ATOM   6076 C CB  . LEU B 1 382 ? 53.087 33.487  12.108  1.00 5.12  ? 444  LEU B CB  1 
ATOM   6077 C CG  . LEU B 1 382 ? 51.905 33.505  13.063  1.00 6.09  ? 444  LEU B CG  1 
ATOM   6078 C CD1 . LEU B 1 382 ? 51.318 32.096  13.148  1.00 8.04  ? 444  LEU B CD1 1 
ATOM   6079 C CD2 . LEU B 1 382 ? 52.308 34.055  14.448  1.00 4.16  ? 444  LEU B CD2 1 
ATOM   6080 N N   . ASN B 1 383 ? 55.373 34.127  10.136  1.00 3.26  ? 445  ASN B N   1 
ATOM   6081 C CA  . ASN B 1 383 ? 56.749 33.896  9.672   1.00 3.12  ? 445  ASN B CA  1 
ATOM   6082 C C   . ASN B 1 383 ? 57.548 35.195  9.631   1.00 3.23  ? 445  ASN B C   1 
ATOM   6083 O O   . ASN B 1 383 ? 58.736 35.202  9.946   1.00 4.63  ? 445  ASN B O   1 
ATOM   6084 C CB  . ASN B 1 383 ? 56.758 33.199  8.309   1.00 2.40  ? 445  ASN B CB  1 
ATOM   6085 C CG  . ASN B 1 383 ? 58.152 32.853  7.849   1.00 3.21  ? 445  ASN B CG  1 
ATOM   6086 O OD1 . ASN B 1 383 ? 58.683 33.464  6.921   1.00 2.00  ? 445  ASN B OD1 1 
ATOM   6087 N ND2 . ASN B 1 383 ? 58.783 31.898  8.536   1.00 3.10  ? 445  ASN B ND2 1 
ATOM   6088 N N   . GLY B 1 384 ? 56.917 36.308  9.266   1.00 2.97  ? 446  GLY B N   1 
ATOM   6089 C CA  . GLY B 1 384 ? 57.629 37.599  9.267   1.00 3.06  ? 446  GLY B CA  1 
ATOM   6090 C C   . GLY B 1 384 ? 58.037 38.091  10.634  1.00 3.01  ? 446  GLY B C   1 
ATOM   6091 O O   . GLY B 1 384 ? 59.196 38.449  10.879  1.00 4.53  ? 446  GLY B O   1 
ATOM   6092 N N   . LEU B 1 385 ? 57.073 38.089  11.539  1.00 3.12  ? 447  LEU B N   1 
ATOM   6093 C CA  . LEU B 1 385 ? 57.273 38.396  12.948  1.00 2.50  ? 447  LEU B CA  1 
ATOM   6094 C C   . LEU B 1 385 ? 58.306 37.496  13.622  1.00 2.76  ? 447  LEU B C   1 
ATOM   6095 O O   . LEU B 1 385 ? 59.123 37.962  14.416  1.00 2.30  ? 447  LEU B O   1 
ATOM   6096 C CB  . LEU B 1 385 ? 55.936 38.289  13.656  1.00 2.36  ? 447  LEU B CB  1 
ATOM   6097 C CG  . LEU B 1 385 ? 54.932 39.369  13.199  1.00 2.29  ? 447  LEU B CG  1 
ATOM   6098 C CD1 . LEU B 1 385 ? 53.560 39.095  13.736  1.00 2.00  ? 447  LEU B CD1 1 
ATOM   6099 C CD2 . LEU B 1 385 ? 55.438 40.758  13.644  1.00 2.00  ? 447  LEU B CD2 1 
ATOM   6100 N N   . GLU B 1 386 ? 58.284 36.211  13.298  1.00 3.73  ? 448  GLU B N   1 
ATOM   6101 C CA  . GLU B 1 386 ? 59.308 35.260  13.788  1.00 3.74  ? 448  GLU B CA  1 
ATOM   6102 C C   . GLU B 1 386 ? 60.704 35.643  13.359  1.00 2.89  ? 448  GLU B C   1 
ATOM   6103 O O   . GLU B 1 386 ? 61.613 35.623  14.155  1.00 3.39  ? 448  GLU B O   1 
ATOM   6104 C CB  . GLU B 1 386 ? 59.021 33.847  13.299  1.00 4.02  ? 448  GLU B CB  1 
ATOM   6105 C CG  . GLU B 1 386 ? 59.991 32.835  13.861  1.00 6.19  ? 448  GLU B CG  1 
ATOM   6106 C CD  . GLU B 1 386 ? 59.684 31.409  13.446  1.00 9.46  ? 448  GLU B CD  1 
ATOM   6107 O OE1 . GLU B 1 386 ? 58.821 31.202  12.539  1.00 16.90 ? 448  GLU B OE1 1 
ATOM   6108 O OE2 . GLU B 1 386 ? 60.332 30.499  14.037  1.00 16.41 ? 448  GLU B OE2 1 
ATOM   6109 N N   . ASN B 1 387 ? 60.874 36.003  12.092  1.00 3.02  ? 449  ASN B N   1 
ATOM   6110 C CA  . ASN B 1 387 ? 62.176 36.410  11.575  1.00 2.00  ? 449  ASN B CA  1 
ATOM   6111 C C   . ASN B 1 387 ? 62.680 37.700  12.189  1.00 2.00  ? 449  ASN B C   1 
ATOM   6112 O O   . ASN B 1 387 ? 63.863 37.839  12.513  1.00 2.00  ? 449  ASN B O   1 
ATOM   6113 C CB  . ASN B 1 387 ? 62.084 36.585  10.065  1.00 2.64  ? 449  ASN B CB  1 
ATOM   6114 C CG  . ASN B 1 387 ? 61.980 35.274  9.322   1.00 2.17  ? 449  ASN B CG  1 
ATOM   6115 O OD1 . ASN B 1 387 ? 62.569 34.288  9.713   1.00 5.94  ? 449  ASN B OD1 1 
ATOM   6116 N ND2 . ASN B 1 387 ? 61.275 35.279  8.212   1.00 4.84  ? 449  ASN B ND2 1 
ATOM   6117 N N   . ILE B 1 388 ? 61.765 38.656  12.313  1.00 2.00  ? 450  ILE B N   1 
ATOM   6118 C CA  . ILE B 1 388 ? 62.003 39.920  12.986  1.00 2.00  ? 450  ILE B CA  1 
ATOM   6119 C C   . ILE B 1 388 ? 62.428 39.685  14.429  1.00 2.00  ? 450  ILE B C   1 
ATOM   6120 O O   . ILE B 1 388 ? 63.492 40.144  14.846  1.00 2.11  ? 450  ILE B O   1 
ATOM   6121 C CB  . ILE B 1 388 ? 60.731 40.814  12.895  1.00 2.00  ? 450  ILE B CB  1 
ATOM   6122 C CG1 . ILE B 1 388 ? 60.598 41.361  11.462  1.00 2.54  ? 450  ILE B CG1 1 
ATOM   6123 C CG2 . ILE B 1 388 ? 60.752 41.949  13.917  1.00 2.00  ? 450  ILE B CG2 1 
ATOM   6124 C CD1 . ILE B 1 388 ? 59.357 42.142  11.176  1.00 2.00  ? 450  ILE B CD1 1 
ATOM   6125 N N   . LEU B 1 389 ? 61.638 38.941  15.193  1.00 2.00  ? 451  LEU B N   1 
ATOM   6126 C CA  . LEU B 1 389 ? 62.026 38.635  16.578  1.00 2.75  ? 451  LEU B CA  1 
ATOM   6127 C C   . LEU B 1 389 ? 63.343 37.899  16.705  1.00 2.84  ? 451  LEU B C   1 
ATOM   6128 O O   . LEU B 1 389 ? 64.093 38.153  17.632  1.00 2.00  ? 451  LEU B O   1 
ATOM   6129 C CB  . LEU B 1 389 ? 60.965 37.815  17.299  1.00 2.13  ? 451  LEU B CB  1 
ATOM   6130 C CG  . LEU B 1 389 ? 59.685 38.548  17.714  1.00 3.04  ? 451  LEU B CG  1 
ATOM   6131 C CD1 . LEU B 1 389 ? 58.598 37.523  17.831  1.00 3.62  ? 451  LEU B CD1 1 
ATOM   6132 C CD2 . LEU B 1 389 ? 59.840 39.336  18.984  1.00 2.00  ? 451  LEU B CD2 1 
ATOM   6133 N N   . ARG B 1 390 ? 63.606 36.953  15.808  1.00 4.73  ? 452  ARG B N   1 
ATOM   6134 C CA  . ARG B 1 390 ? 64.916 36.254  15.817  1.00 6.12  ? 452  ARG B CA  1 
ATOM   6135 C C   . ARG B 1 390 ? 66.052 37.261  15.722  1.00 6.64  ? 452  ARG B C   1 
ATOM   6136 O O   . ARG B 1 390 ? 67.005 37.172  16.477  1.00 7.43  ? 452  ARG B O   1 
ATOM   6137 C CB  . ARG B 1 390 ? 65.013 35.223  14.682  1.00 5.83  ? 452  ARG B CB  1 
ATOM   6138 C CG  . ARG B 1 390 ? 66.399 34.544  14.496  1.00 6.14  ? 452  ARG B CG  1 
ATOM   6139 C CD  . ARG B 1 390 ? 66.390 33.547  13.299  1.00 8.69  ? 452  ARG B CD  1 
ATOM   6140 N NE  . ARG B 1 390 ? 65.966 34.194  12.047  1.00 11.08 ? 452  ARG B NE  1 
ATOM   6141 C CZ  . ARG B 1 390 ? 66.772 34.801  11.170  1.00 12.70 ? 452  ARG B CZ  1 
ATOM   6142 N NH1 . ARG B 1 390 ? 68.097 34.857  11.353  1.00 11.05 ? 452  ARG B NH1 1 
ATOM   6143 N NH2 . ARG B 1 390 ? 66.231 35.372  10.090  1.00 13.38 ? 452  ARG B NH2 1 
ATOM   6144 N N   . LEU B 1 391 ? 65.948 38.216  14.799  1.00 8.08  ? 453  LEU B N   1 
ATOM   6145 C CA  . LEU B 1 391 ? 66.981 39.239  14.624  1.00 9.86  ? 453  LEU B CA  1 
ATOM   6146 C C   . LEU B 1 391 ? 67.067 40.190  15.830  1.00 11.31 ? 453  LEU B C   1 
ATOM   6147 O O   . LEU B 1 391 ? 68.119 40.734  16.119  1.00 10.77 ? 453  LEU B O   1 
ATOM   6148 C CB  . LEU B 1 391 ? 66.759 40.020  13.317  1.00 9.87  ? 453  LEU B CB  1 
ATOM   6149 C CG  . LEU B 1 391 ? 67.193 39.287  12.034  1.00 9.14  ? 453  LEU B CG  1 
ATOM   6150 C CD1 . LEU B 1 391 ? 66.606 39.895  10.789  1.00 8.11  ? 453  LEU B CD1 1 
ATOM   6151 C CD2 . LEU B 1 391 ? 68.706 39.249  11.922  1.00 9.14  ? 453  LEU B CD2 1 
ATOM   6152 N N   . GLY B 1 392 ? 65.950 40.385  16.531  1.00 13.16 ? 454  GLY B N   1 
ATOM   6153 C CA  . GLY B 1 392 ? 65.941 41.140  17.780  1.00 14.38 ? 454  GLY B CA  1 
ATOM   6154 C C   . GLY B 1 392 ? 66.662 40.453  18.932  1.00 15.76 ? 454  GLY B C   1 
ATOM   6155 O O   . GLY B 1 392 ? 67.243 41.122  19.774  1.00 14.68 ? 454  GLY B O   1 
ATOM   6156 N N   . GLU B 1 393 ? 66.609 39.122  18.985  1.00 17.87 ? 455  GLU B N   1 
ATOM   6157 C CA  . GLU B 1 393 ? 67.326 38.371  20.029  1.00 19.75 ? 455  GLU B CA  1 
ATOM   6158 C C   . GLU B 1 393 ? 68.807 38.480  19.844  1.00 20.92 ? 455  GLU B C   1 
ATOM   6159 O O   . GLU B 1 393 ? 69.548 38.457  20.823  1.00 21.66 ? 455  GLU B O   1 
ATOM   6160 C CB  . GLU B 1 393 ? 66.975 36.888  20.040  1.00 20.37 ? 455  GLU B CB  1 
ATOM   6161 C CG  . GLU B 1 393 ? 65.634 36.567  20.668  1.00 22.30 ? 455  GLU B CG  1 
ATOM   6162 C CD  . GLU B 1 393 ? 65.621 36.593  22.189  1.00 25.00 ? 455  GLU B CD  1 
ATOM   6163 O OE1 . GLU B 1 393 ? 65.629 35.488  22.791  1.00 26.76 ? 455  GLU B OE1 1 
ATOM   6164 O OE2 . GLU B 1 393 ? 65.584 37.699  22.784  1.00 26.74 ? 455  GLU B OE2 1 
ATOM   6165 N N   . GLN B 1 394 ? 69.244 38.571  18.596  1.00 22.38 ? 456  GLN B N   1 
ATOM   6166 C CA  . GLN B 1 394 ? 70.653 38.793  18.322  1.00 24.00 ? 456  GLN B CA  1 
ATOM   6167 C C   . GLN B 1 394 ? 71.106 40.020  19.110  1.00 24.82 ? 456  GLN B C   1 
ATOM   6168 O O   . GLN B 1 394 ? 71.991 39.920  19.962  1.00 25.03 ? 456  GLN B O   1 
ATOM   6169 C CB  . GLN B 1 394 ? 70.914 38.958  16.816  1.00 24.35 ? 456  GLN B CB  1 
ATOM   6170 C CG  . GLN B 1 394 ? 71.108 37.614  16.054  1.00 25.41 ? 456  GLN B CG  1 
ATOM   6171 C CD  . GLN B 1 394 ? 71.232 37.796  14.526  1.00 25.70 ? 456  GLN B CD  1 
ATOM   6172 O OE1 . GLN B 1 394 ? 71.770 38.808  14.040  1.00 27.45 ? 456  GLN B OE1 1 
ATOM   6173 N NE2 . GLN B 1 394 ? 70.732 36.809  13.768  1.00 27.43 ? 456  GLN B NE2 1 
ATOM   6174 N N   . GLU B 1 395 ? 70.453 41.152  18.849  1.00 26.23 ? 457  GLU B N   1 
ATOM   6175 C CA  . GLU B 1 395 ? 70.702 42.421  19.557  1.00 26.42 ? 457  GLU B CA  1 
ATOM   6176 C C   . GLU B 1 395 ? 70.605 42.358  21.106  1.00 26.80 ? 457  GLU B C   1 
ATOM   6177 O O   . GLU B 1 395 ? 71.446 42.923  21.806  1.00 26.80 ? 457  GLU B O   1 
ATOM   6178 C CB  . GLU B 1 395 ? 69.742 43.482  19.020  1.00 26.75 ? 457  GLU B CB  1 
ATOM   6179 C CG  . GLU B 1 395 ? 69.958 44.866  19.591  1.00 27.77 ? 457  GLU B CG  1 
ATOM   6180 C CD  . GLU B 1 395 ? 71.304 45.451  19.227  1.00 31.00 ? 457  GLU B CD  1 
ATOM   6181 O OE1 . GLU B 1 395 ? 71.858 45.036  18.180  1.00 35.03 ? 457  GLU B OE1 1 
ATOM   6182 O OE2 . GLU B 1 395 ? 71.804 46.336  19.972  1.00 31.57 ? 457  GLU B OE2 1 
ATOM   6183 N N   . ALA B 1 396 ? 69.599 41.661  21.628  1.00 27.10 ? 458  ALA B N   1 
ATOM   6184 C CA  . ALA B 1 396 ? 69.387 41.527  23.078  1.00 27.63 ? 458  ALA B CA  1 
ATOM   6185 C C   . ALA B 1 396 ? 70.615 41.016  23.856  1.00 28.35 ? 458  ALA B C   1 
ATOM   6186 O O   . ALA B 1 396 ? 70.963 41.559  24.917  1.00 28.63 ? 458  ALA B O   1 
ATOM   6187 C CB  . ALA B 1 396 ? 68.200 40.615  23.345  1.00 27.47 ? 458  ALA B CB  1 
ATOM   6188 N N   . LYS B 1 397 ? 71.248 39.962  23.339  1.00 28.90 ? 459  LYS B N   1 
ATOM   6189 C CA  . LYS B 1 397 ? 72.431 39.366  23.974  1.00 29.18 ? 459  LYS B CA  1 
ATOM   6190 C C   . LYS B 1 397 ? 73.688 40.170  23.626  1.00 29.24 ? 459  LYS B C   1 
ATOM   6191 O O   . LYS B 1 397 ? 74.580 40.337  24.464  1.00 29.42 ? 459  LYS B O   1 
ATOM   6192 C CB  . LYS B 1 397 ? 72.590 37.903  23.540  1.00 29.48 ? 459  LYS B CB  1 
ATOM   6193 C CG  . LYS B 1 397 ? 71.437 37.003  23.997  1.00 30.25 ? 459  LYS B CG  1 
ATOM   6194 C CD  . LYS B 1 397 ? 71.282 35.750  23.130  1.00 30.26 ? 459  LYS B CD  1 
ATOM   6195 C CE  . LYS B 1 397 ? 69.803 35.369  22.965  1.00 30.89 ? 459  LYS B CE  1 
ATOM   6196 N NZ  . LYS B 1 397 ? 69.592 34.241  22.001  1.00 30.91 ? 459  LYS B NZ  1 
ATOM   6197 N N   . ARG B 1 398 ? 73.735 40.661  22.387  1.00 29.18 ? 460  ARG B N   1 
ATOM   6198 C CA  . ARG B 1 398 ? 74.822 41.500  21.881  1.00 28.97 ? 460  ARG B CA  1 
ATOM   6199 C C   . ARG B 1 398 ? 75.134 42.689  22.804  1.00 28.35 ? 460  ARG B C   1 
ATOM   6200 O O   . ARG B 1 398 ? 76.249 42.771  23.333  1.00 28.06 ? 460  ARG B O   1 
ATOM   6201 C CB  . ARG B 1 398 ? 74.444 41.977  20.482  1.00 29.21 ? 460  ARG B CB  1 
ATOM   6202 C CG  . ARG B 1 398 ? 75.445 42.842  19.729  1.00 30.08 ? 460  ARG B CG  1 
ATOM   6203 C CD  . ARG B 1 398 ? 74.729 43.405  18.471  1.00 31.54 ? 460  ARG B CD  1 
ATOM   6204 N NE  . ARG B 1 398 ? 74.929 44.836  18.231  1.00 34.20 ? 460  ARG B NE  1 
ATOM   6205 C CZ  . ARG B 1 398 ? 74.645 45.814  19.097  1.00 35.87 ? 460  ARG B CZ  1 
ATOM   6206 N NH1 . ARG B 1 398 ? 74.171 45.550  20.309  1.00 36.26 ? 460  ARG B NH1 1 
ATOM   6207 N NH2 . ARG B 1 398 ? 74.856 47.084  18.755  1.00 35.98 ? 460  ARG B NH2 1 
ATOM   6208 N N   . ASN B 1 399 ? 74.164 43.595  23.008  1.00 27.53 ? 461  ASN B N   1 
ATOM   6209 C CA  . ASN B 1 399 ? 74.369 44.759  23.918  1.00 26.88 ? 461  ASN B CA  1 
ATOM   6210 C C   . ASN B 1 399 ? 74.072 44.453  25.402  1.00 25.98 ? 461  ASN B C   1 
ATOM   6211 O O   . ASN B 1 399 ? 74.007 45.361  26.234  1.00 26.05 ? 461  ASN B O   1 
ATOM   6212 C CB  . ASN B 1 399 ? 73.616 46.022  23.414  1.00 26.90 ? 461  ASN B CB  1 
ATOM   6213 C CG  . ASN B 1 399 ? 73.757 47.236  24.353  1.00 27.13 ? 461  ASN B CG  1 
ATOM   6214 O OD1 . ASN B 1 399 ? 74.867 47.628  24.732  1.00 26.27 ? 461  ASN B OD1 1 
ATOM   6215 N ND2 . ASN B 1 399 ? 72.629 47.841  24.705  1.00 25.37 ? 461  ASN B ND2 1 
ATOM   6216 N N   . GLY B 1 400 ? 73.893 43.171  25.724  1.00 24.90 ? 462  GLY B N   1 
ATOM   6217 C CA  . GLY B 1 400 ? 73.899 42.697  27.110  1.00 23.92 ? 462  GLY B CA  1 
ATOM   6218 C C   . GLY B 1 400 ? 72.708 43.092  27.965  1.00 23.06 ? 462  GLY B C   1 
ATOM   6219 O O   . GLY B 1 400 ? 72.620 42.673  29.122  1.00 22.84 ? 462  GLY B O   1 
ATOM   6220 N N   . THR B 1 401 ? 71.795 43.895  27.409  1.00 21.92 ? 463  THR B N   1 
ATOM   6221 C CA  . THR B 1 401 ? 70.625 44.365  28.149  1.00 20.77 ? 463  THR B CA  1 
ATOM   6222 C C   . THR B 1 401 ? 69.670 43.203  28.366  1.00 19.70 ? 463  THR B C   1 
ATOM   6223 O O   . THR B 1 401 ? 69.010 43.126  29.399  1.00 19.82 ? 463  THR B O   1 
ATOM   6224 C CB  . THR B 1 401 ? 69.883 45.502  27.414  1.00 20.72 ? 463  THR B CB  1 
ATOM   6225 O OG1 . THR B 1 401 ? 69.507 45.063  26.103  1.00 21.70 ? 463  THR B OG1 1 
ATOM   6226 C CG2 . THR B 1 401 ? 70.759 46.744  27.306  1.00 20.54 ? 463  THR B CG2 1 
ATOM   6227 N N   . GLY B 1 402 ? 69.611 42.297  27.389  1.00 18.43 ? 464  GLY B N   1 
ATOM   6228 C CA  . GLY B 1 402 ? 68.735 41.132  27.458  1.00 16.95 ? 464  GLY B CA  1 
ATOM   6229 C C   . GLY B 1 402 ? 67.355 41.481  26.956  1.00 15.91 ? 464  GLY B C   1 
ATOM   6230 O O   . GLY B 1 402 ? 66.408 40.696  27.132  1.00 16.19 ? 464  GLY B O   1 
ATOM   6231 N N   . ILE B 1 403 ? 67.237 42.656  26.323  1.00 13.93 ? 465  ILE B N   1 
ATOM   6232 C CA  . ILE B 1 403 ? 65.948 43.142  25.831  1.00 12.49 ? 465  ILE B CA  1 
ATOM   6233 C C   . ILE B 1 403 ? 65.948 43.150  24.308  1.00 10.87 ? 465  ILE B C   1 
ATOM   6234 O O   . ILE B 1 403 ? 66.746 43.809  23.652  1.00 10.16 ? 465  ILE B O   1 
ATOM   6235 C CB  . ILE B 1 403 ? 65.583 44.537  26.393  1.00 12.39 ? 465  ILE B CB  1 
ATOM   6236 C CG1 . ILE B 1 403 ? 65.576 44.514  27.924  1.00 12.55 ? 465  ILE B CG1 1 
ATOM   6237 C CG2 . ILE B 1 403 ? 64.212 44.959  25.933  1.00 12.91 ? 465  ILE B CG2 1 
ATOM   6238 C CD1 . ILE B 1 403 ? 65.845 45.841  28.540  1.00 12.04 ? 465  ILE B CD1 1 
ATOM   6239 N N   . ASN B 1 404 ? 65.026 42.377  23.763  1.00 9.65  ? 466  ASN B N   1 
ATOM   6240 C CA  . ASN B 1 404 ? 64.771 42.332  22.352  1.00 8.61  ? 466  ASN B CA  1 
ATOM   6241 C C   . ASN B 1 404 ? 63.944 43.546  21.983  1.00 7.77  ? 466  ASN B C   1 
ATOM   6242 O O   . ASN B 1 404 ? 62.800 43.640  22.413  1.00 8.31  ? 466  ASN B O   1 
ATOM   6243 C CB  . ASN B 1 404 ? 63.965 41.052  22.093  1.00 8.82  ? 466  ASN B CB  1 
ATOM   6244 C CG  . ASN B 1 404 ? 63.727 40.787  20.637  1.00 7.75  ? 466  ASN B CG  1 
ATOM   6245 O OD1 . ASN B 1 404 ? 63.283 41.656  19.888  1.00 8.45  ? 466  ASN B OD1 1 
ATOM   6246 N ND2 . ASN B 1 404 ? 63.991 39.565  20.229  1.00 6.86  ? 466  ASN B ND2 1 
ATOM   6247 N N   . PRO B 1 405 ? 64.465 44.452  21.129  1.00 6.66  ? 467  PRO B N   1 
ATOM   6248 C CA  . PRO B 1 405 ? 63.681 45.669  20.849  1.00 5.87  ? 467  PRO B CA  1 
ATOM   6249 C C   . PRO B 1 405 ? 62.322 45.404  20.211  1.00 5.40  ? 467  PRO B C   1 
ATOM   6250 O O   . PRO B 1 405 ? 61.406 46.233  20.311  1.00 5.04  ? 467  PRO B O   1 
ATOM   6251 C CB  . PRO B 1 405 ? 64.544 46.426  19.858  1.00 5.09  ? 467  PRO B CB  1 
ATOM   6252 C CG  . PRO B 1 405 ? 65.446 45.428  19.283  1.00 5.88  ? 467  PRO B CG  1 
ATOM   6253 C CD  . PRO B 1 405 ? 65.708 44.429  20.346  1.00 6.22  ? 467  PRO B CD  1 
ATOM   6254 N N   . TYR B 1 406 ? 62.179 44.273  19.541  1.00 4.73  ? 468  TYR B N   1 
ATOM   6255 C CA  . TYR B 1 406 ? 60.937 44.033  18.808  1.00 4.01  ? 468  TYR B CA  1 
ATOM   6256 C C   . TYR B 1 406 ? 59.788 43.498  19.662  1.00 3.95  ? 468  TYR B C   1 
ATOM   6257 O O   . TYR B 1 406 ? 58.622 43.507  19.217  1.00 4.66  ? 468  TYR B O   1 
ATOM   6258 C CB  . TYR B 1 406 ? 61.212 43.206  17.542  1.00 3.23  ? 468  TYR B CB  1 
ATOM   6259 C CG  . TYR B 1 406 ? 62.300 43.819  16.693  1.00 2.85  ? 468  TYR B CG  1 
ATOM   6260 C CD1 . TYR B 1 406 ? 62.244 45.147  16.307  1.00 4.70  ? 468  TYR B CD1 1 
ATOM   6261 C CD2 . TYR B 1 406 ? 63.442 43.095  16.350  1.00 3.47  ? 468  TYR B CD2 1 
ATOM   6262 C CE1 . TYR B 1 406 ? 63.285 45.727  15.544  1.00 4.15  ? 468  TYR B CE1 1 
ATOM   6263 C CE2 . TYR B 1 406 ? 64.471 43.664  15.595  1.00 2.90  ? 468  TYR B CE2 1 
ATOM   6264 C CZ  . TYR B 1 406 ? 64.386 44.974  15.196  1.00 3.62  ? 468  TYR B CZ  1 
ATOM   6265 O OH  . TYR B 1 406 ? 65.401 45.526  14.453  1.00 2.54  ? 468  TYR B OH  1 
ATOM   6266 N N   . CYS B 1 407 ? 60.071 43.066  20.889  1.00 4.32  ? 469  CYS B N   1 
ATOM   6267 C CA  . CYS B 1 407 ? 59.008 42.637  21.801  1.00 4.21  ? 469  CYS B CA  1 
ATOM   6268 C C   . CYS B 1 407 ? 58.037 43.771  22.147  1.00 3.76  ? 469  CYS B C   1 
ATOM   6269 O O   . CYS B 1 407 ? 56.849 43.601  21.982  1.00 3.55  ? 469  CYS B O   1 
ATOM   6270 C CB  . CYS B 1 407 ? 59.580 41.999  23.081  1.00 4.88  ? 469  CYS B CB  1 
ATOM   6271 S SG  . CYS B 1 407 ? 60.409 40.402  22.790  1.00 4.86  ? 469  CYS B SG  1 
ATOM   6272 N N   . ALA B 1 408 ? 58.528 44.923  22.599  1.00 3.52  ? 470  ALA B N   1 
ATOM   6273 C CA  . ALA B 1 408 ? 57.632 46.046  22.965  1.00 4.03  ? 470  ALA B CA  1 
ATOM   6274 C C   . ALA B 1 408 ? 56.791 46.541  21.789  1.00 4.22  ? 470  ALA B C   1 
ATOM   6275 O O   . ALA B 1 408 ? 55.581 46.831  21.937  1.00 4.46  ? 470  ALA B O   1 
ATOM   6276 C CB  . ALA B 1 408 ? 58.407 47.180  23.600  1.00 3.48  ? 470  ALA B CB  1 
ATOM   6277 N N   . LEU B 1 409 ? 57.412 46.584  20.613  1.00 4.72  ? 471  LEU B N   1 
ATOM   6278 C CA  . LEU B 1 409 ? 56.727 46.926  19.351  1.00 4.86  ? 471  LEU B CA  1 
ATOM   6279 C C   . LEU B 1 409 ? 55.631 45.958  18.954  1.00 5.48  ? 471  LEU B C   1 
ATOM   6280 O O   . LEU B 1 409 ? 54.546 46.366  18.534  1.00 5.50  ? 471  LEU B O   1 
ATOM   6281 C CB  . LEU B 1 409 ? 57.743 46.990  18.229  1.00 4.75  ? 471  LEU B CB  1 
ATOM   6282 C CG  . LEU B 1 409 ? 58.703 48.175  18.385  1.00 3.87  ? 471  LEU B CG  1 
ATOM   6283 C CD1 . LEU B 1 409 ? 59.695 48.201  17.252  1.00 2.00  ? 471  LEU B CD1 1 
ATOM   6284 C CD2 . LEU B 1 409 ? 57.871 49.461  18.396  1.00 2.00  ? 471  LEU B CD2 1 
ATOM   6285 N N   . ILE B 1 410 ? 55.916 44.668  19.053  1.00 6.02  ? 472  ILE B N   1 
ATOM   6286 C CA  . ILE B 1 410 ? 54.877 43.667  18.818  1.00 6.49  ? 472  ILE B CA  1 
ATOM   6287 C C   . ILE B 1 410 ? 53.754 43.764  19.839  1.00 6.68  ? 472  ILE B C   1 
ATOM   6288 O O   . ILE B 1 410 ? 52.595 43.684  19.462  1.00 8.24  ? 472  ILE B O   1 
ATOM   6289 C CB  . ILE B 1 410 ? 55.451 42.240  18.748  1.00 6.41  ? 472  ILE B CB  1 
ATOM   6290 C CG1 . ILE B 1 410 ? 56.328 42.137  17.500  1.00 6.22  ? 472  ILE B CG1 1 
ATOM   6291 C CG2 . ILE B 1 410 ? 54.292 41.185  18.731  1.00 5.89  ? 472  ILE B CG2 1 
ATOM   6292 C CD1 . ILE B 1 410 ? 56.782 40.784  17.149  1.00 6.44  ? 472  ILE B CD1 1 
ATOM   6293 N N   . GLU B 1 411 ? 54.083 43.946  21.114  1.00 7.17  ? 473  GLU B N   1 
ATOM   6294 C CA  . GLU B 1 411 ? 53.075 44.253  22.152  1.00 7.75  ? 473  GLU B CA  1 
ATOM   6295 C C   . GLU B 1 411 ? 52.221 45.492  21.850  1.00 7.40  ? 473  GLU B C   1 
ATOM   6296 O O   . GLU B 1 411 ? 50.994 45.454  21.974  1.00 7.92  ? 473  GLU B O   1 
ATOM   6297 C CB  . GLU B 1 411 ? 53.718 44.419  23.543  1.00 8.05  ? 473  GLU B CB  1 
ATOM   6298 C CG  . GLU B 1 411 ? 53.768 43.144  24.363  1.00 10.31 ? 473  GLU B CG  1 
ATOM   6299 C CD  . GLU B 1 411 ? 54.729 43.162  25.556  1.00 10.41 ? 473  GLU B CD  1 
ATOM   6300 O OE1 . GLU B 1 411 ? 54.824 42.114  26.222  1.00 16.64 ? 473  GLU B OE1 1 
ATOM   6301 O OE2 . GLU B 1 411 ? 55.402 44.168  25.834  1.00 14.20 ? 473  GLU B OE2 1 
ATOM   6302 N N   . GLU B 1 412 ? 52.854 46.591  21.474  1.00 7.16  ? 474  GLU B N   1 
ATOM   6303 C CA  . GLU B 1 412 ? 52.100 47.783  21.071  1.00 7.60  ? 474  GLU B CA  1 
ATOM   6304 C C   . GLU B 1 412 ? 51.202 47.533  19.882  1.00 7.50  ? 474  GLU B C   1 
ATOM   6305 O O   . GLU B 1 412 ? 50.129 48.093  19.810  1.00 7.13  ? 474  GLU B O   1 
ATOM   6306 C CB  . GLU B 1 412 ? 53.031 48.950  20.686  1.00 7.16  ? 474  GLU B CB  1 
ATOM   6307 C CG  . GLU B 1 412 ? 53.539 49.727  21.831  1.00 8.14  ? 474  GLU B CG  1 
ATOM   6308 C CD  . GLU B 1 412 ? 52.427 50.243  22.707  1.00 8.31  ? 474  GLU B CD  1 
ATOM   6309 O OE1 . GLU B 1 412 ? 51.770 51.210  22.284  1.00 6.94  ? 474  GLU B OE1 1 
ATOM   6310 O OE2 . GLU B 1 412 ? 52.245 49.684  23.816  1.00 9.76  ? 474  GLU B OE2 1 
ATOM   6311 N N   . ALA B 1 413 ? 51.687 46.742  18.923  1.00 7.52  ? 475  ALA B N   1 
ATOM   6312 C CA  . ALA B 1 413 ? 50.969 46.525  17.673  1.00 8.23  ? 475  ALA B CA  1 
ATOM   6313 C C   . ALA B 1 413 ? 49.781 45.576  17.840  1.00 8.71  ? 475  ALA B C   1 
ATOM   6314 O O   . ALA B 1 413 ? 48.733 45.805  17.269  1.00 8.70  ? 475  ALA B O   1 
ATOM   6315 C CB  . ALA B 1 413 ? 51.935 46.015  16.579  1.00 6.71  ? 475  ALA B CB  1 
ATOM   6316 N N   . TYR B 1 414 ? 49.966 44.516  18.627  1.00 9.67  ? 476  TYR B N   1 
ATOM   6317 C CA  . TYR B 1 414 ? 49.064 43.376  18.649  1.00 9.90  ? 476  TYR B CA  1 
ATOM   6318 C C   . TYR B 1 414 ? 48.161 43.372  19.892  1.00 10.15 ? 476  TYR B C   1 
ATOM   6319 O O   . TYR B 1 414 ? 47.016 42.956  19.820  1.00 9.96  ? 476  TYR B O   1 
ATOM   6320 C CB  . TYR B 1 414 ? 49.933 42.123  18.590  1.00 11.22 ? 476  TYR B CB  1 
ATOM   6321 C CG  . TYR B 1 414 ? 49.209 40.809  18.386  1.00 11.42 ? 476  TYR B CG  1 
ATOM   6322 C CD1 . TYR B 1 414 ? 48.179 40.676  17.458  1.00 11.63 ? 476  TYR B CD1 1 
ATOM   6323 C CD2 . TYR B 1 414 ? 49.597 39.682  19.100  1.00 11.91 ? 476  TYR B CD2 1 
ATOM   6324 C CE1 . TYR B 1 414 ? 47.544 39.462  17.274  1.00 11.79 ? 476  TYR B CE1 1 
ATOM   6325 C CE2 . TYR B 1 414 ? 48.971 38.476  18.928  1.00 13.11 ? 476  TYR B CE2 1 
ATOM   6326 C CZ  . TYR B 1 414 ? 47.938 38.369  18.023  1.00 13.34 ? 476  TYR B CZ  1 
ATOM   6327 O OH  . TYR B 1 414 ? 47.331 37.146  17.867  1.00 14.28 ? 476  TYR B OH  1 
ATOM   6328 N N   . GLY B 1 415 ? 48.679 43.861  21.015  1.00 10.34 ? 477  GLY B N   1 
ATOM   6329 C CA  . GLY B 1 415 ? 47.897 44.055  22.237  1.00 11.18 ? 477  GLY B CA  1 
ATOM   6330 C C   . GLY B 1 415 ? 48.295 43.074  23.325  1.00 11.36 ? 477  GLY B C   1 
ATOM   6331 O O   . GLY B 1 415 ? 48.618 41.922  23.042  1.00 10.92 ? 477  GLY B O   1 
ATOM   6332 N N   . LEU B 1 416 ? 48.274 43.540  24.569  1.00 12.22 ? 478  LEU B N   1 
ATOM   6333 C CA  . LEU B 1 416 ? 48.593 42.709  25.739  1.00 12.69 ? 478  LEU B CA  1 
ATOM   6334 C C   . LEU B 1 416 ? 47.640 41.535  25.929  1.00 13.16 ? 478  LEU B C   1 
ATOM   6335 O O   . LEU B 1 416 ? 48.056 40.456  26.323  1.00 13.36 ? 478  LEU B O   1 
ATOM   6336 C CB  . LEU B 1 416 ? 48.543 43.541  27.018  1.00 13.16 ? 478  LEU B CB  1 
ATOM   6337 C CG  . LEU B 1 416 ? 49.719 44.427  27.406  1.00 14.19 ? 478  LEU B CG  1 
ATOM   6338 C CD1 . LEU B 1 416 ? 49.759 44.508  28.928  1.00 14.53 ? 478  LEU B CD1 1 
ATOM   6339 C CD2 . LEU B 1 416 ? 51.040 43.914  26.853  1.00 16.01 ? 478  LEU B CD2 1 
ATOM   6340 N N   . ASP B 1 417 ? 46.352 41.757  25.694  1.00 13.86 ? 479  ASP B N   1 
ATOM   6341 C CA  . ASP B 1 417 ? 45.342 40.708  25.890  1.00 13.94 ? 479  ASP B CA  1 
ATOM   6342 C C   . ASP B 1 417 ? 45.591 39.513  24.961  1.00 13.75 ? 479  ASP B C   1 
ATOM   6343 O O   . ASP B 1 417 ? 45.362 38.367  25.329  1.00 13.54 ? 479  ASP B O   1 
ATOM   6344 C CB  . ASP B 1 417 ? 43.930 41.283  25.683  1.00 14.69 ? 479  ASP B CB  1 
ATOM   6345 C CG  . ASP B 1 417 ? 43.410 42.048  26.916  1.00 18.38 ? 479  ASP B CG  1 
ATOM   6346 O OD1 . ASP B 1 417 ? 44.231 42.593  27.708  1.00 23.24 ? 479  ASP B OD1 1 
ATOM   6347 O OD2 . ASP B 1 417 ? 42.163 42.090  27.120  1.00 23.17 ? 479  ASP B OD2 1 
ATOM   6348 N N   . LYS B 1 418 ? 46.077 39.774  23.750  1.00 13.71 ? 480  LYS B N   1 
ATOM   6349 C CA  . LYS B 1 418 ? 46.408 38.691  22.826  1.00 13.09 ? 480  LYS B CA  1 
ATOM   6350 C C   . LYS B 1 418 ? 47.753 38.037  23.141  1.00 11.98 ? 480  LYS B C   1 
ATOM   6351 O O   . LYS B 1 418 ? 47.880 36.828  23.037  1.00 11.53 ? 480  LYS B O   1 
ATOM   6352 C CB  . LYS B 1 418 ? 46.362 39.206  21.396  1.00 13.89 ? 480  LYS B CB  1 
ATOM   6353 C CG  . LYS B 1 418 ? 44.949 39.462  20.942  1.00 14.75 ? 480  LYS B CG  1 
ATOM   6354 C CD  . LYS B 1 418 ? 44.891 39.927  19.510  1.00 15.68 ? 480  LYS B CD  1 
ATOM   6355 C CE  . LYS B 1 418 ? 43.448 39.891  19.016  1.00 18.57 ? 480  LYS B CE  1 
ATOM   6356 N NZ  . LYS B 1 418 ? 43.016 38.464  18.782  1.00 21.43 ? 480  LYS B NZ  1 
ATOM   6357 N N   . ILE B 1 419 ? 48.751 38.823  23.535  1.00 11.09 ? 481  ILE B N   1 
ATOM   6358 C CA  . ILE B 1 419 ? 50.049 38.265  23.921  1.00 11.20 ? 481  ILE B CA  1 
ATOM   6359 C C   . ILE B 1 419 ? 49.952 37.400  25.184  1.00 10.94 ? 481  ILE B C   1 
ATOM   6360 O O   . ILE B 1 419 ? 50.563 36.345  25.245  1.00 10.59 ? 481  ILE B O   1 
ATOM   6361 C CB  . ILE B 1 419 ? 51.113 39.363  24.178  1.00 11.28 ? 481  ILE B CB  1 
ATOM   6362 C CG1 . ILE B 1 419 ? 51.421 40.160  22.904  1.00 10.80 ? 481  ILE B CG1 1 
ATOM   6363 C CG2 . ILE B 1 419 ? 52.386 38.742  24.770  1.00 11.20 ? 481  ILE B CG2 1 
ATOM   6364 C CD1 . ILE B 1 419 ? 51.983 39.330  21.770  1.00 10.81 ? 481  ILE B CD1 1 
ATOM   6365 N N   . GLU B 1 420 ? 49.175 37.845  26.177  1.00 10.93 ? 482  GLU B N   1 
ATOM   6366 C CA  . GLU B 1 420 ? 49.023 37.116  27.426  1.00 11.25 ? 482  GLU B CA  1 
ATOM   6367 C C   . GLU B 1 420 ? 48.292 35.811  27.198  1.00 11.06 ? 482  GLU B C   1 
ATOM   6368 O O   . GLU B 1 420 ? 48.663 34.809  27.772  1.00 11.13 ? 482  GLU B O   1 
ATOM   6369 C CB  . GLU B 1 420 ? 48.314 37.969  28.480  1.00 11.41 ? 482  GLU B CB  1 
ATOM   6370 C CG  . GLU B 1 420 ? 49.206 39.093  29.001  1.00 12.74 ? 482  GLU B CG  1 
ATOM   6371 C CD  . GLU B 1 420 ? 48.502 40.068  29.927  1.00 13.33 ? 482  GLU B CD  1 
ATOM   6372 O OE1 . GLU B 1 420 ? 47.258 40.012  30.053  1.00 17.55 ? 482  GLU B OE1 1 
ATOM   6373 O OE2 . GLU B 1 420 ? 49.208 40.899  30.537  1.00 15.85 ? 482  GLU B OE2 1 
ATOM   6374 N N   . PHE B 1 421 ? 47.276 35.817  26.335  1.00 11.06 ? 483  PHE B N   1 
ATOM   6375 C CA  . PHE B 1 421 ? 46.603 34.593  25.920  1.00 10.62 ? 483  PHE B CA  1 
ATOM   6376 C C   . PHE B 1 421 ? 47.602 33.568  25.359  1.00 10.56 ? 483  PHE B C   1 
ATOM   6377 O O   . PHE B 1 421 ? 47.554 32.387  25.710  1.00 10.83 ? 483  PHE B O   1 
ATOM   6378 C CB  . PHE B 1 421 ? 45.522 34.920  24.885  1.00 11.37 ? 483  PHE B CB  1 
ATOM   6379 C CG  . PHE B 1 421 ? 44.870 33.705  24.276  1.00 11.23 ? 483  PHE B CG  1 
ATOM   6380 C CD1 . PHE B 1 421 ? 43.815 33.084  24.900  1.00 13.15 ? 483  PHE B CD1 1 
ATOM   6381 C CD2 . PHE B 1 421 ? 45.315 33.193  23.075  1.00 14.00 ? 483  PHE B CD2 1 
ATOM   6382 C CE1 . PHE B 1 421 ? 43.218 31.972  24.344  1.00 12.73 ? 483  PHE B CE1 1 
ATOM   6383 C CE2 . PHE B 1 421 ? 44.723 32.088  22.514  1.00 14.00 ? 483  PHE B CE2 1 
ATOM   6384 C CZ  . PHE B 1 421 ? 43.674 31.471  23.161  1.00 12.32 ? 483  PHE B CZ  1 
ATOM   6385 N N   . LEU B 1 422 ? 48.519 34.032  24.513  1.00 10.01 ? 484  LEU B N   1 
ATOM   6386 C CA  . LEU B 1 422 ? 49.497 33.174  23.846  1.00 9.57  ? 484  LEU B CA  1 
ATOM   6387 C C   . LEU B 1 422 ? 50.678 32.783  24.734  1.00 9.34  ? 484  LEU B C   1 
ATOM   6388 O O   . LEU B 1 422 ? 51.389 31.840  24.419  1.00 9.47  ? 484  LEU B O   1 
ATOM   6389 C CB  . LEU B 1 422 ? 50.003 33.846  22.563  1.00 9.26  ? 484  LEU B CB  1 
ATOM   6390 C CG  . LEU B 1 422 ? 48.988 33.935  21.425  1.00 9.69  ? 484  LEU B CG  1 
ATOM   6391 C CD1 . LEU B 1 422 ? 49.558 34.707  20.211  1.00 9.44  ? 484  LEU B CD1 1 
ATOM   6392 C CD2 . LEU B 1 422 ? 48.545 32.536  21.011  1.00 7.18  ? 484  LEU B CD2 1 
ATOM   6393 N N   . GLN B 1 423 ? 50.878 33.507  25.832  1.00 9.21  ? 485  GLN B N   1 
ATOM   6394 C CA  . GLN B 1 423 ? 51.909 33.188  26.825  1.00 9.10  ? 485  GLN B CA  1 
ATOM   6395 C C   . GLN B 1 423 ? 51.540 31.994  27.725  1.00 8.91  ? 485  GLN B C   1 
ATOM   6396 O O   . GLN B 1 423 ? 52.417 31.351  28.289  1.00 8.47  ? 485  GLN B O   1 
ATOM   6397 C CB  . GLN B 1 423 ? 52.188 34.407  27.716  1.00 9.25  ? 485  GLN B CB  1 
ATOM   6398 C CG  . GLN B 1 423 ? 53.059 35.486  27.079  1.00 9.13  ? 485  GLN B CG  1 
ATOM   6399 C CD  . GLN B 1 423 ? 53.493 36.531  28.095  1.00 9.05  ? 485  GLN B CD  1 
ATOM   6400 O OE1 . GLN B 1 423 ? 52.755 37.464  28.400  1.00 8.40  ? 485  GLN B OE1 1 
ATOM   6401 N NE2 . GLN B 1 423 ? 54.685 36.361  28.634  1.00 8.34  ? 485  GLN B NE2 1 
ATOM   6402 N N   . SER B 1 424 ? 50.246 31.712  27.855  1.00 8.85  ? 486  SER B N   1 
ATOM   6403 C CA  . SER B 1 424 ? 49.766 30.591  28.651  1.00 8.72  ? 486  SER B CA  1 
ATOM   6404 C C   . SER B 1 424 ? 49.960 29.248  27.953  1.00 8.67  ? 486  SER B C   1 
ATOM   6405 O O   . SER B 1 424 ? 49.351 28.985  26.912  1.00 8.35  ? 486  SER B O   1 
ATOM   6406 C CB  . SER B 1 424 ? 48.284 30.757  28.972  1.00 8.65  ? 486  SER B CB  1 
ATOM   6407 O OG  . SER B 1 424 ? 47.731 29.509  29.367  1.00 9.82  ? 486  SER B OG  1 
ATOM   6408 N N   . HIS B 1 425 ? 50.789 28.393  28.556  1.00 8.59  ? 487  HIS B N   1 
ATOM   6409 C CA  . HIS B 1 425 ? 51.025 27.049  28.056  1.00 8.37  ? 487  HIS B CA  1 
ATOM   6410 C C   . HIS B 1 425 ? 49.800 26.166  28.291  1.00 8.15  ? 487  HIS B C   1 
ATOM   6411 O O   . HIS B 1 425 ? 49.583 25.210  27.559  1.00 7.74  ? 487  HIS B O   1 
ATOM   6412 C CB  . HIS B 1 425 ? 52.256 26.434  28.718  1.00 8.66  ? 487  HIS B CB  1 
ATOM   6413 C CG  . HIS B 1 425 ? 52.712 25.162  28.079  1.00 9.33  ? 487  HIS B CG  1 
ATOM   6414 N ND1 . HIS B 1 425 ? 52.982 24.020  28.802  1.00 11.79 ? 487  HIS B ND1 1 
ATOM   6415 C CD2 . HIS B 1 425 ? 52.939 24.847  26.782  1.00 11.74 ? 487  HIS B CD2 1 
ATOM   6416 C CE1 . HIS B 1 425 ? 53.355 23.056  27.976  1.00 11.80 ? 487  HIS B CE1 1 
ATOM   6417 N NE2 . HIS B 1 425 ? 53.337 23.531  26.745  1.00 12.25 ? 487  HIS B NE2 1 
ATOM   6418 N N   . GLU B 1 426 ? 49.002 26.500  29.302  1.00 7.92  ? 488  GLU B N   1 
ATOM   6419 C CA  . GLU B 1 426 ? 47.713 25.844  29.525  1.00 7.99  ? 488  GLU B CA  1 
ATOM   6420 C C   . GLU B 1 426 ? 46.786 26.034  28.328  1.00 7.13  ? 488  GLU B C   1 
ATOM   6421 O O   . GLU B 1 426 ? 46.178 25.070  27.856  1.00 6.24  ? 488  GLU B O   1 
ATOM   6422 C CB  . GLU B 1 426 ? 47.032 26.385  30.780  1.00 8.08  ? 488  GLU B CB  1 
ATOM   6423 C CG  . GLU B 1 426 ? 47.665 25.970  32.089  1.00 9.46  ? 488  GLU B CG  1 
ATOM   6424 C CD  . GLU B 1 426 ? 46.998 26.668  33.281  1.00 10.93 ? 488  GLU B CD  1 
ATOM   6425 O OE1 . GLU B 1 426 ? 46.811 27.907  33.204  1.00 16.83 ? 488  GLU B OE1 1 
ATOM   6426 O OE2 . GLU B 1 426 ? 46.647 25.991  34.280  1.00 14.20 ? 488  GLU B OE2 1 
ATOM   6427 N N   . ASN B 1 427 ? 46.677 27.274  27.844  1.00 6.87  ? 489  ASN B N   1 
ATOM   6428 C CA  . ASN B 1 427 ? 45.925 27.550  26.620  1.00 6.62  ? 489  ASN B CA  1 
ATOM   6429 C C   . ASN B 1 427 ? 46.486 26.771  25.446  1.00 6.08  ? 489  ASN B C   1 
ATOM   6430 O O   . ASN B 1 427 ? 45.735 26.201  24.677  1.00 5.46  ? 489  ASN B O   1 
ATOM   6431 C CB  . ASN B 1 427 ? 45.922 29.035  26.287  1.00 6.95  ? 489  ASN B CB  1 
ATOM   6432 C CG  . ASN B 1 427 ? 45.053 29.843  27.221  1.00 7.18  ? 489  ASN B CG  1 
ATOM   6433 O OD1 . ASN B 1 427 ? 44.195 29.305  27.901  1.00 7.54  ? 489  ASN B OD1 1 
ATOM   6434 N ND2 . ASN B 1 427 ? 45.268 31.152  27.249  1.00 7.84  ? 489  ASN B ND2 1 
ATOM   6435 N N   . GLN B 1 428 ? 47.808 26.722  25.320  1.00 6.35  ? 490  GLN B N   1 
ATOM   6436 C CA  . GLN B 1 428 ? 48.444 25.954  24.242  1.00 6.45  ? 490  GLN B CA  1 
ATOM   6437 C C   . GLN B 1 428 ? 48.050 24.484  24.303  1.00 6.25  ? 490  GLN B C   1 
ATOM   6438 O O   . GLN B 1 428 ? 47.739 23.880  23.283  1.00 5.71  ? 490  GLN B O   1 
ATOM   6439 C CB  . GLN B 1 428 ? 49.962 26.089  24.289  1.00 6.29  ? 490  GLN B CB  1 
ATOM   6440 C CG  . GLN B 1 428 ? 50.697 25.083  23.394  1.00 7.36  ? 490  GLN B CG  1 
ATOM   6441 C CD  . GLN B 1 428 ? 52.110 25.515  23.029  1.00 8.01  ? 490  GLN B CD  1 
ATOM   6442 O OE1 . GLN B 1 428 ? 52.565 25.269  21.913  1.00 14.18 ? 490  GLN B OE1 1 
ATOM   6443 N NE2 . GLN B 1 428 ? 52.804 26.168  23.955  1.00 10.43 ? 490  GLN B NE2 1 
ATOM   6444 N N   . GLU B 1 429 ? 48.069 23.919  25.510  1.00 6.47  ? 491  GLU B N   1 
ATOM   6445 C CA  . GLU B 1 429 ? 47.714 22.513  25.729  1.00 6.79  ? 491  GLU B CA  1 
ATOM   6446 C C   . GLU B 1 429 ? 46.263 22.187  25.346  1.00 6.13  ? 491  GLU B C   1 
ATOM   6447 O O   . GLU B 1 429 ? 45.993 21.159  24.719  1.00 5.89  ? 491  GLU B O   1 
ATOM   6448 C CB  . GLU B 1 429 ? 47.962 22.127  27.190  1.00 7.03  ? 491  GLU B CB  1 
ATOM   6449 C CG  . GLU B 1 429 ? 49.442 22.021  27.575  1.00 8.36  ? 491  GLU B CG  1 
ATOM   6450 C CD  . GLU B 1 429 ? 49.659 21.609  29.044  1.00 8.36  ? 491  GLU B CD  1 
ATOM   6451 O OE1 . GLU B 1 429 ? 48.849 21.991  29.931  1.00 7.67  ? 491  GLU B OE1 1 
ATOM   6452 O OE2 . GLU B 1 429 ? 50.664 20.899  29.295  1.00 12.34 ? 491  GLU B OE2 1 
ATOM   6453 N N   . ILE B 1 430 ? 45.344 23.054  25.750  1.00 6.04  ? 492  ILE B N   1 
ATOM   6454 C CA  . ILE B 1 430 ? 43.918 22.920  25.436  1.00 6.10  ? 492  ILE B CA  1 
ATOM   6455 C C   . ILE B 1 430 ? 43.629 22.927  23.931  1.00 5.45  ? 492  ILE B C   1 
ATOM   6456 O O   . ILE B 1 430 ? 42.873 22.093  23.434  1.00 4.01  ? 492  ILE B O   1 
ATOM   6457 C CB  . ILE B 1 430 ? 43.126 24.062  26.099  1.00 6.17  ? 492  ILE B CB  1 
ATOM   6458 C CG1 . ILE B 1 430 ? 42.836 23.731  27.549  1.00 6.16  ? 492  ILE B CG1 1 
ATOM   6459 C CG2 . ILE B 1 430 ? 41.831 24.355  25.354  1.00 7.04  ? 492  ILE B CG2 1 
ATOM   6460 C CD1 . ILE B 1 430 ? 42.334 24.936  28.288  1.00 6.89  ? 492  ILE B CD1 1 
ATOM   6461 N N   . TYR B 1 431 ? 44.237 23.868  23.220  1.00 5.89  ? 493  TYR B N   1 
ATOM   6462 C CA  . TYR B 1 431 ? 44.048 23.995  21.761  1.00 6.33  ? 493  TYR B CA  1 
ATOM   6463 C C   . TYR B 1 431 ? 44.587 22.785  21.013  1.00 6.46  ? 493  TYR B C   1 
ATOM   6464 O O   . TYR B 1 431 ? 43.880 22.181  20.197  1.00 6.25  ? 493  TYR B O   1 
ATOM   6465 C CB  . TYR B 1 431 ? 44.659 25.304  21.226  1.00 7.17  ? 493  TYR B CB  1 
ATOM   6466 C CG  . TYR B 1 431 ? 43.683 26.451  21.307  1.00 7.51  ? 493  TYR B CG  1 
ATOM   6467 C CD1 . TYR B 1 431 ? 43.501 27.151  22.493  1.00 8.12  ? 493  TYR B CD1 1 
ATOM   6468 C CD2 . TYR B 1 431 ? 42.890 26.792  20.215  1.00 8.01  ? 493  TYR B CD2 1 
ATOM   6469 C CE1 . TYR B 1 431 ? 42.576 28.183  22.586  1.00 8.19  ? 493  TYR B CE1 1 
ATOM   6470 C CE2 . TYR B 1 431 ? 41.970 27.832  20.291  1.00 7.56  ? 493  TYR B CE2 1 
ATOM   6471 C CZ  . TYR B 1 431 ? 41.818 28.521  21.473  1.00 8.55  ? 493  TYR B CZ  1 
ATOM   6472 O OH  . TYR B 1 431 ? 40.902 29.549  21.561  1.00 9.30  ? 493  TYR B OH  1 
ATOM   6473 N N   . GLN B 1 432 ? 45.819 22.404  21.327  1.00 6.67  ? 494  GLN B N   1 
ATOM   6474 C CA  . GLN B 1 432 ? 46.401 21.204  20.763  1.00 6.34  ? 494  GLN B CA  1 
ATOM   6475 C C   . GLN B 1 432 ? 45.514 19.979  20.952  1.00 5.97  ? 494  GLN B C   1 
ATOM   6476 O O   . GLN B 1 432 ? 45.356 19.187  20.029  1.00 6.40  ? 494  GLN B O   1 
ATOM   6477 C CB  . GLN B 1 432 ? 47.785 20.948  21.365  1.00 6.94  ? 494  GLN B CB  1 
ATOM   6478 C CG  . GLN B 1 432 ? 48.442 19.672  20.841  1.00 9.47  ? 494  GLN B CG  1 
ATOM   6479 C CD  . GLN B 1 432 ? 49.879 19.874  20.370  1.00 16.02 ? 494  GLN B CD  1 
ATOM   6480 O OE1 . GLN B 1 432 ? 50.821 19.403  21.022  1.00 21.04 ? 494  GLN B OE1 1 
ATOM   6481 N NE2 . GLN B 1 432 ? 50.055 20.569  19.226  1.00 18.49 ? 494  GLN B NE2 1 
ATOM   6482 N N   . LYS B 1 433 ? 44.944 19.824  22.145  1.00 5.35  ? 495  LYS B N   1 
ATOM   6483 C CA  . LYS B 1 433 ? 44.075 18.691  22.457  1.00 4.77  ? 495  LYS B CA  1 
ATOM   6484 C C   . LYS B 1 433 ? 42.811 18.755  21.619  1.00 3.79  ? 495  LYS B C   1 
ATOM   6485 O O   . LYS B 1 433 ? 42.377 17.754  21.075  1.00 3.09  ? 495  LYS B O   1 
ATOM   6486 C CB  . LYS B 1 433 ? 43.685 18.716  23.942  1.00 5.15  ? 495  LYS B CB  1 
ATOM   6487 C CG  . LYS B 1 433 ? 43.505 17.361  24.591  1.00 7.24  ? 495  LYS B CG  1 
ATOM   6488 C CD  . LYS B 1 433 ? 42.629 16.404  23.787  1.00 8.25  ? 495  LYS B CD  1 
ATOM   6489 C CE  . LYS B 1 433 ? 42.322 15.153  24.587  1.00 9.88  ? 495  LYS B CE  1 
ATOM   6490 N NZ  . LYS B 1 433 ? 43.428 14.116  24.586  1.00 11.34 ? 495  LYS B NZ  1 
ATOM   6491 N N   . ALA B 1 434 ? 42.213 19.943  21.546  1.00 3.25  ? 496  ALA B N   1 
ATOM   6492 C CA  . ALA B 1 434 ? 40.975 20.157  20.806  1.00 3.32  ? 496  ALA B CA  1 
ATOM   6493 C C   . ALA B 1 434 ? 41.151 19.830  19.317  1.00 3.08  ? 496  ALA B C   1 
ATOM   6494 O O   . ALA B 1 434 ? 40.336 19.114  18.731  1.00 3.29  ? 496  ALA B O   1 
ATOM   6495 C CB  . ALA B 1 434 ? 40.492 21.599  20.993  1.00 2.78  ? 496  ALA B CB  1 
ATOM   6496 N N   . PHE B 1 435 ? 42.242 20.318  18.737  1.00 2.86  ? 497  PHE B N   1 
ATOM   6497 C CA  . PHE B 1 435 ? 42.558 20.086  17.329  1.00 3.08  ? 497  PHE B CA  1 
ATOM   6498 C C   . PHE B 1 435 ? 42.771 18.614  17.047  1.00 3.12  ? 497  PHE B C   1 
ATOM   6499 O O   . PHE B 1 435 ? 42.221 18.085  16.078  1.00 2.74  ? 497  PHE B O   1 
ATOM   6500 C CB  . PHE B 1 435 ? 43.827 20.838  16.916  1.00 3.30  ? 497  PHE B CB  1 
ATOM   6501 C CG  . PHE B 1 435 ? 43.632 22.307  16.697  1.00 3.28  ? 497  PHE B CG  1 
ATOM   6502 C CD1 . PHE B 1 435 ? 44.349 23.233  17.430  1.00 3.65  ? 497  PHE B CD1 1 
ATOM   6503 C CD2 . PHE B 1 435 ? 42.766 22.771  15.707  1.00 4.92  ? 497  PHE B CD2 1 
ATOM   6504 C CE1 . PHE B 1 435 ? 44.187 24.605  17.198  1.00 3.74  ? 497  PHE B CE1 1 
ATOM   6505 C CE2 . PHE B 1 435 ? 42.601 24.131  15.480  1.00 4.32  ? 497  PHE B CE2 1 
ATOM   6506 C CZ  . PHE B 1 435 ? 43.306 25.042  16.235  1.00 3.58  ? 497  PHE B CZ  1 
ATOM   6507 N N   . ASP B 1 436 ? 43.585 17.955  17.876  1.00 3.14  ? 498  ASP B N   1 
ATOM   6508 C CA  . ASP B 1 436 ? 43.859 16.523  17.697  1.00 3.22  ? 498  ASP B CA  1 
ATOM   6509 C C   . ASP B 1 436 ? 42.601 15.689  17.883  1.00 2.73  ? 498  ASP B C   1 
ATOM   6510 O O   . ASP B 1 436 ? 42.406 14.684  17.197  1.00 2.77  ? 498  ASP B O   1 
ATOM   6511 C CB  . ASP B 1 436 ? 44.913 16.021  18.686  1.00 3.69  ? 498  ASP B CB  1 
ATOM   6512 C CG  . ASP B 1 436 ? 46.318 16.521  18.378  1.00 6.15  ? 498  ASP B CG  1 
ATOM   6513 O OD1 . ASP B 1 436 ? 46.625 16.875  17.216  1.00 10.00 ? 498  ASP B OD1 1 
ATOM   6514 O OD2 . ASP B 1 436 ? 47.139 16.547  19.317  1.00 9.61  ? 498  ASP B OD2 1 
ATOM   6515 N N   . LEU B 1 437 ? 41.751 16.093  18.811  1.00 2.47  ? 499  LEU B N   1 
ATOM   6516 C CA  . LEU B 1 437 ? 40.581 15.288  19.136  1.00 2.60  ? 499  LEU B CA  1 
ATOM   6517 C C   . LEU B 1 437 ? 39.632 15.303  17.964  1.00 2.34  ? 499  LEU B C   1 
ATOM   6518 O O   . LEU B 1 437 ? 39.258 14.254  17.474  1.00 2.00  ? 499  LEU B O   1 
ATOM   6519 C CB  . LEU B 1 437 ? 39.887 15.793  20.401  1.00 2.28  ? 499  LEU B CB  1 
ATOM   6520 C CG  . LEU B 1 437 ? 38.803 14.878  20.967  1.00 2.54  ? 499  LEU B CG  1 
ATOM   6521 C CD1 . LEU B 1 437 ? 39.337 13.459  21.149  1.00 2.00  ? 499  LEU B CD1 1 
ATOM   6522 C CD2 . LEU B 1 437 ? 38.288 15.438  22.277  1.00 2.32  ? 499  LEU B CD2 1 
ATOM   6523 N N   . ILE B 1 438 ? 39.281 16.498  17.498  1.00 2.99  ? 500  ILE B N   1 
ATOM   6524 C CA  . ILE B 1 438 ? 38.341 16.654  16.385  1.00 3.65  ? 500  ILE B CA  1 
ATOM   6525 C C   . ILE B 1 438 ? 38.890 16.109  15.050  1.00 4.07  ? 500  ILE B C   1 
ATOM   6526 O O   . ILE B 1 438 ? 38.175 15.433  14.325  1.00 4.39  ? 500  ILE B O   1 
ATOM   6527 C CB  . ILE B 1 438 ? 37.878 18.119  16.205  1.00 3.48  ? 500  ILE B CB  1 
ATOM   6528 C CG1 . ILE B 1 438 ? 36.825 18.512  17.249  1.00 4.04  ? 500  ILE B CG1 1 
ATOM   6529 C CG2 . ILE B 1 438 ? 37.244 18.293  14.852  1.00 3.35  ? 500  ILE B CG2 1 
ATOM   6530 C CD1 . ILE B 1 438 ? 37.116 18.090  18.641  1.00 3.41  ? 500  ILE B CD1 1 
ATOM   6531 N N   . GLU B 1 439 ? 40.151 16.363  14.733  1.00 4.50  ? 501  GLU B N   1 
ATOM   6532 C CA  . GLU B 1 439 ? 40.704 15.857  13.475  1.00 5.33  ? 501  GLU B CA  1 
ATOM   6533 C C   . GLU B 1 439 ? 40.808 14.336  13.445  1.00 5.48  ? 501  GLU B C   1 
ATOM   6534 O O   . GLU B 1 439 ? 40.768 13.743  12.383  1.00 6.28  ? 501  GLU B O   1 
ATOM   6535 C CB  . GLU B 1 439 ? 42.060 16.509  13.167  1.00 5.30  ? 501  GLU B CB  1 
ATOM   6536 C CG  . GLU B 1 439 ? 41.924 18.005  12.885  1.00 6.34  ? 501  GLU B CG  1 
ATOM   6537 C CD  . GLU B 1 439 ? 43.243 18.769  12.914  1.00 7.10  ? 501  GLU B CD  1 
ATOM   6538 O OE1 . GLU B 1 439 ? 44.312 18.143  12.766  1.00 9.34  ? 501  GLU B OE1 1 
ATOM   6539 O OE2 . GLU B 1 439 ? 43.200 20.011  13.076  1.00 8.85  ? 501  GLU B OE2 1 
ATOM   6540 N N   . HIS B 1 440 ? 40.932 13.703  14.603  1.00 5.77  ? 502  HIS B N   1 
ATOM   6541 C CA  . HIS B 1 440 ? 40.938 12.242  14.685  1.00 5.78  ? 502  HIS B CA  1 
ATOM   6542 C C   . HIS B 1 440 ? 39.543 11.629  14.500  1.00 6.02  ? 502  HIS B C   1 
ATOM   6543 O O   . HIS B 1 440 ? 39.381 10.621  13.809  1.00 6.21  ? 502  HIS B O   1 
ATOM   6544 C CB  . HIS B 1 440 ? 41.499 11.804  16.035  1.00 5.71  ? 502  HIS B CB  1 
ATOM   6545 C CG  . HIS B 1 440 ? 41.581 10.315  16.200  1.00 5.76  ? 502  HIS B CG  1 
ATOM   6546 N ND1 . HIS B 1 440 ? 42.644 9.570   15.735  1.00 5.63  ? 502  HIS B ND1 1 
ATOM   6547 C CD2 . HIS B 1 440 ? 40.739 9.439   16.792  1.00 5.52  ? 502  HIS B CD2 1 
ATOM   6548 C CE1 . HIS B 1 440 ? 42.451 8.299   16.036  1.00 6.85  ? 502  HIS B CE1 1 
ATOM   6549 N NE2 . HIS B 1 440 ? 41.301 8.192   16.677  1.00 6.52  ? 502  HIS B NE2 1 
ATOM   6550 N N   . TYR B 1 441 ? 38.533 12.224  15.122  1.00 5.71  ? 503  TYR B N   1 
ATOM   6551 C CA  . TYR B 1 441 ? 37.203 11.636  15.103  1.00 6.06  ? 503  TYR B CA  1 
ATOM   6552 C C   . TYR B 1 441 ? 36.300 12.173  14.010  1.00 6.48  ? 503  TYR B C   1 
ATOM   6553 O O   . TYR B 1 441 ? 35.458 11.447  13.528  1.00 6.37  ? 503  TYR B O   1 
ATOM   6554 C CB  . TYR B 1 441 ? 36.547 11.792  16.469  1.00 4.61  ? 503  TYR B CB  1 
ATOM   6555 C CG  . TYR B 1 441 ? 37.183 10.906  17.505  1.00 3.32  ? 503  TYR B CG  1 
ATOM   6556 C CD1 . TYR B 1 441 ? 38.090 11.408  18.420  1.00 2.00  ? 503  TYR B CD1 1 
ATOM   6557 C CD2 . TYR B 1 441 ? 36.902 9.562   17.541  1.00 2.00  ? 503  TYR B CD2 1 
ATOM   6558 C CE1 . TYR B 1 441 ? 38.672 10.585  19.368  1.00 2.50  ? 503  TYR B CE1 1 
ATOM   6559 C CE2 . TYR B 1 441 ? 37.484 8.731   18.480  1.00 2.86  ? 503  TYR B CE2 1 
ATOM   6560 C CZ  . TYR B 1 441 ? 38.372 9.245   19.392  1.00 2.00  ? 503  TYR B CZ  1 
ATOM   6561 O OH  . TYR B 1 441 ? 38.945 8.407   20.326  1.00 2.00  ? 503  TYR B OH  1 
ATOM   6562 N N   . PHE B 1 442 ? 36.479 13.432  13.622  1.00 8.07  ? 504  PHE B N   1 
ATOM   6563 C CA  . PHE B 1 442 ? 35.657 14.056  12.583  1.00 9.67  ? 504  PHE B CA  1 
ATOM   6564 C C   . PHE B 1 442 ? 36.347 14.103  11.214  1.00 11.27 ? 504  PHE B C   1 
ATOM   6565 O O   . PHE B 1 442 ? 35.671 14.199  10.200  1.00 11.13 ? 504  PHE B O   1 
ATOM   6566 C CB  . PHE B 1 442 ? 35.245 15.469  13.001  1.00 8.85  ? 504  PHE B CB  1 
ATOM   6567 C CG  . PHE B 1 442 ? 34.301 15.496  14.165  1.00 8.27  ? 504  PHE B CG  1 
ATOM   6568 C CD1 . PHE B 1 442 ? 34.767 15.313  15.455  1.00 7.40  ? 504  PHE B CD1 1 
ATOM   6569 C CD2 . PHE B 1 442 ? 32.946 15.680  13.969  1.00 7.80  ? 504  PHE B CD2 1 
ATOM   6570 C CE1 . PHE B 1 442 ? 33.895 15.307  16.529  1.00 7.26  ? 504  PHE B CE1 1 
ATOM   6571 C CE2 . PHE B 1 442 ? 32.075 15.686  15.029  1.00 7.46  ? 504  PHE B CE2 1 
ATOM   6572 C CZ  . PHE B 1 442 ? 32.552 15.507  16.315  1.00 7.46  ? 504  PHE B CZ  1 
ATOM   6573 N N   . GLY B 1 443 ? 37.678 14.043  11.200  1.00 13.62 ? 505  GLY B N   1 
ATOM   6574 C CA  . GLY B 1 443 ? 38.464 14.097  9.967   1.00 15.54 ? 505  GLY B CA  1 
ATOM   6575 C C   . GLY B 1 443 ? 38.984 15.495  9.691   1.00 17.44 ? 505  GLY B C   1 
ATOM   6576 O O   . GLY B 1 443 ? 38.349 16.473  10.063  1.00 17.49 ? 505  GLY B O   1 
ATOM   6577 N N   . THR B 1 444 ? 40.148 15.585  9.049   1.00 19.80 ? 506  THR B N   1 
ATOM   6578 C CA  . THR B 1 444 ? 40.754 16.870  8.687   1.00 21.75 ? 506  THR B CA  1 
ATOM   6579 C C   . THR B 1 444 ? 40.109 17.394  7.418   1.00 23.86 ? 506  THR B C   1 
ATOM   6580 O O   . THR B 1 444 ? 40.045 16.670  6.424   1.00 24.47 ? 506  THR B O   1 
ATOM   6581 C CB  . THR B 1 444 ? 42.274 16.731  8.419   1.00 21.69 ? 506  THR B CB  1 
ATOM   6582 O OG1 . THR B 1 444 ? 42.875 15.951  9.459   1.00 21.80 ? 506  THR B OG1 1 
ATOM   6583 C CG2 . THR B 1 444 ? 42.945 18.090  8.362   1.00 20.47 ? 506  THR B CG2 1 
ATOM   6584 N N   . GLU B 1 445 ? 39.653 18.647  7.431   1.00 26.15 ? 507  GLU B N   1 
ATOM   6585 C CA  . GLU B 1 445 ? 38.921 19.177  6.282   1.00 27.96 ? 507  GLU B CA  1 
ATOM   6586 C C   . GLU B 1 445 ? 39.859 19.805  5.270   1.00 29.57 ? 507  GLU B C   1 
ATOM   6587 O O   . GLU B 1 445 ? 40.709 20.634  5.624   1.00 29.82 ? 507  GLU B O   1 
ATOM   6588 C CB  . GLU B 1 445 ? 37.822 20.155  6.696   1.00 28.53 ? 507  GLU B CB  1 
ATOM   6589 C CG  . GLU B 1 445 ? 36.590 19.460  7.289   1.00 29.86 ? 507  GLU B CG  1 
ATOM   6590 C CD  . GLU B 1 445 ? 35.796 18.641  6.271   1.00 31.79 ? 507  GLU B CD  1 
ATOM   6591 O OE1 . GLU B 1 445 ? 35.389 19.220  5.239   1.00 33.66 ? 507  GLU B OE1 1 
ATOM   6592 O OE2 . GLU B 1 445 ? 35.567 17.425  6.511   1.00 32.02 ? 507  GLU B OE2 1 
ATOM   6593 N N   . ASP B 1 446 ? 39.613 19.408  4.012   1.00 31.60 ? 508  ASP B N   1 
ATOM   6594 C CA  . ASP B 1 446 ? 40.467 19.583  2.811   1.00 32.45 ? 508  ASP B CA  1 
ATOM   6595 C C   . ASP B 1 446 ? 41.208 20.912  2.620   1.00 33.59 ? 508  ASP B C   1 
ATOM   6596 O O   . ASP B 1 446 ? 42.259 20.925  1.976   1.00 33.85 ? 508  ASP B O   1 
ATOM   6597 C CB  . ASP B 1 446 ? 39.618 19.314  1.544   1.00 32.92 ? 508  ASP B CB  1 
ATOM   6598 C CG  . ASP B 1 446 ? 40.424 18.697  0.398   1.00 33.00 ? 508  ASP B CG  1 
ATOM   6599 O OD1 . ASP B 1 446 ? 41.554 19.163  0.113   1.00 36.07 ? 508  ASP B OD1 1 
ATOM   6600 O OD2 . ASP B 1 446 ? 39.912 17.742  -0.237  1.00 34.85 ? 508  ASP B OD2 1 
ATOM   6601 N N   . GLU B 1 447 ? 40.658 22.013  3.139   1.00 34.69 ? 509  GLU B N   1 
ATOM   6602 C CA  . GLU B 1 447 ? 41.330 23.335  3.151   1.00 35.31 ? 509  GLU B CA  1 
ATOM   6603 C C   . GLU B 1 447 ? 40.817 24.252  2.034   1.00 35.70 ? 509  GLU B C   1 
ATOM   6604 O O   . GLU B 1 447 ? 40.958 25.478  2.113   1.00 35.90 ? 509  GLU B O   1 
ATOM   6605 C CB  . GLU B 1 447 ? 42.870 23.218  3.059   1.00 35.72 ? 509  GLU B CB  1 
ATOM   6606 C CG  . GLU B 1 447 ? 43.547 22.428  4.212   1.00 36.86 ? 509  GLU B CG  1 
ATOM   6607 C CD  . GLU B 1 447 ? 44.915 21.860  3.830   1.00 36.88 ? 509  GLU B CD  1 
ATOM   6608 O OE1 . GLU B 1 447 ? 45.921 22.189  4.515   1.00 38.98 ? 509  GLU B OE1 1 
ATOM   6609 O OE2 . GLU B 1 447 ? 44.979 21.083  2.847   1.00 38.74 ? 509  GLU B OE2 1 
ATOM   6610 N N   . SER C 2 12  ? 70.075 25.643  7.033   1.00 26.35 ? 688  SER D N   1 
ATOM   6611 C CA  . SER C 2 12  ? 70.873 25.564  5.772   1.00 26.34 ? 688  SER D CA  1 
ATOM   6612 C C   . SER C 2 12  ? 70.559 26.727  4.830   1.00 26.28 ? 688  SER D C   1 
ATOM   6613 O O   . SER C 2 12  ? 69.535 27.407  4.969   1.00 26.30 ? 688  SER D O   1 
ATOM   6614 C CB  . SER C 2 12  ? 70.623 24.229  5.053   1.00 26.33 ? 688  SER D CB  1 
ATOM   6615 O OG  . SER C 2 12  ? 69.310 24.162  4.517   1.00 26.63 ? 688  SER D OG  1 
ATOM   6616 N N   . ALA C 2 13  ? 71.449 26.929  3.859   1.00 26.17 ? 689  ALA D N   1 
ATOM   6617 C CA  . ALA C 2 13  ? 71.283 27.961  2.832   1.00 26.03 ? 689  ALA D CA  1 
ATOM   6618 C C   . ALA C 2 13  ? 70.163 27.635  1.829   1.00 26.03 ? 689  ALA D C   1 
ATOM   6619 O O   . ALA C 2 13  ? 69.734 28.510  1.063   1.00 26.22 ? 689  ALA D O   1 
ATOM   6620 C CB  . ALA C 2 13  ? 72.607 28.180  2.093   1.00 26.11 ? 689  ALA D CB  1 
ATOM   6621 N N   . VAL C 2 14  ? 69.705 26.378  1.837   1.00 25.73 ? 690  VAL D N   1 
ATOM   6622 C CA  . VAL C 2 14  ? 68.630 25.898  0.956   1.00 25.19 ? 690  VAL D CA  1 
ATOM   6623 C C   . VAL C 2 14  ? 67.243 26.187  1.553   1.00 24.68 ? 690  VAL D C   1 
ATOM   6624 O O   . VAL C 2 14  ? 66.321 26.583  0.829   1.00 24.40 ? 690  VAL D O   1 
ATOM   6625 C CB  . VAL C 2 14  ? 68.782 24.362  0.694   1.00 25.37 ? 690  VAL D CB  1 
ATOM   6626 C CG1 . VAL C 2 14  ? 67.650 23.828  -0.183  1.00 25.51 ? 690  VAL D CG1 1 
ATOM   6627 C CG2 . VAL C 2 14  ? 70.147 24.052  0.066   1.00 25.08 ? 690  VAL D CG2 1 
ATOM   6628 N N   . LEU C 2 15  ? 67.110 25.983  2.868   1.00 24.17 ? 691  LEU D N   1 
ATOM   6629 C CA  . LEU C 2 15  ? 65.839 26.189  3.589   1.00 23.82 ? 691  LEU D CA  1 
ATOM   6630 C C   . LEU C 2 15  ? 65.383 27.647  3.628   1.00 23.59 ? 691  LEU D C   1 
ATOM   6631 O O   . LEU C 2 15  ? 64.193 27.921  3.796   1.00 23.34 ? 691  LEU D O   1 
ATOM   6632 C CB  . LEU C 2 15  ? 65.920 25.644  5.015   1.00 23.49 ? 691  LEU D CB  1 
ATOM   6633 C CG  . LEU C 2 15  ? 65.729 24.135  5.144   1.00 22.84 ? 691  LEU D CG  1 
ATOM   6634 C CD1 . LEU C 2 15  ? 66.152 23.685  6.530   1.00 22.30 ? 691  LEU D CD1 1 
ATOM   6635 C CD2 . LEU C 2 15  ? 64.286 23.725  4.842   1.00 20.57 ? 691  LEU D CD2 1 
ATOM   6636 N N   . ARG C 2 16  ? 66.335 28.566  3.475   1.00 23.59 ? 692  ARG D N   1 
ATOM   6637 C CA  . ARG C 2 16  ? 66.050 29.986  3.262   1.00 23.32 ? 692  ARG D CA  1 
ATOM   6638 C C   . ARG C 2 16  ? 64.947 30.192  2.218   1.00 22.88 ? 692  ARG D C   1 
ATOM   6639 O O   . ARG C 2 16  ? 64.149 31.112  2.352   1.00 24.05 ? 692  ARG D O   1 
ATOM   6640 C CB  . ARG C 2 16  ? 67.327 30.707  2.804   1.00 23.88 ? 692  ARG D CB  1 
ATOM   6641 C CG  . ARG C 2 16  ? 67.223 32.238  2.650   1.00 24.19 ? 692  ARG D CG  1 
ATOM   6642 C CD  . ARG C 2 16  ? 67.972 32.696  1.402   1.00 25.16 ? 692  ARG D CD  1 
ATOM   6643 N NE  . ARG C 2 16  ? 68.086 34.152  1.277   1.00 26.20 ? 692  ARG D NE  1 
ATOM   6644 C CZ  . ARG C 2 16  ? 68.916 34.917  1.985   1.00 27.54 ? 692  ARG D CZ  1 
ATOM   6645 N NH1 . ARG C 2 16  ? 69.718 34.395  2.912   1.00 28.33 ? 692  ARG D NH1 1 
ATOM   6646 N NH2 . ARG C 2 16  ? 68.942 36.228  1.774   1.00 28.12 ? 692  ARG D NH2 1 
ATOM   6647 N N   . GLY C 2 17  ? 64.894 29.336  1.200   1.00 21.14 ? 693  GLY D N   1 
ATOM   6648 C CA  . GLY C 2 17  ? 63.927 29.481  0.133   1.00 20.30 ? 693  GLY D CA  1 
ATOM   6649 C C   . GLY C 2 17  ? 62.558 28.896  0.386   1.00 18.98 ? 693  GLY D C   1 
ATOM   6650 O O   . GLY C 2 17  ? 61.719 28.918  -0.508  1.00 18.40 ? 693  GLY D O   1 
ATOM   6651 N N   . PHE C 2 18  ? 62.336 28.370  1.586   1.00 18.40 ? 694  PHE D N   1 
ATOM   6652 C CA  . PHE C 2 18  ? 61.096 27.669  1.932   1.00 18.33 ? 694  PHE D CA  1 
ATOM   6653 C C   . PHE C 2 18  ? 60.458 28.261  3.179   1.00 17.79 ? 694  PHE D C   1 
ATOM   6654 O O   . PHE C 2 18  ? 61.148 28.700  4.089   1.00 17.47 ? 694  PHE D O   1 
ATOM   6655 C CB  . PHE C 2 18  ? 61.367 26.175  2.129   1.00 17.80 ? 694  PHE D CB  1 
ATOM   6656 C CG  . PHE C 2 18  ? 61.911 25.516  0.913   1.00 17.81 ? 694  PHE D CG  1 
ATOM   6657 C CD1 . PHE C 2 18  ? 63.255 25.609  0.612   1.00 17.76 ? 694  PHE D CD1 1 
ATOM   6658 C CD2 . PHE C 2 18  ? 61.078 24.852  0.035   1.00 17.13 ? 694  PHE D CD2 1 
ATOM   6659 C CE1 . PHE C 2 18  ? 63.766 25.031  -0.531  1.00 17.39 ? 694  PHE D CE1 1 
ATOM   6660 C CE2 . PHE C 2 18  ? 61.582 24.280  -1.098  1.00 16.67 ? 694  PHE D CE2 1 
ATOM   6661 C CZ  . PHE C 2 18  ? 62.928 24.372  -1.384  1.00 17.45 ? 694  PHE D CZ  1 
ATOM   6662 N N   . LEU C 2 19  ? 59.134 28.312  3.175   1.00 17.56 ? 695  LEU D N   1 
ATOM   6663 C CA  . LEU C 2 19  ? 58.375 28.674  4.343   1.00 17.95 ? 695  LEU D CA  1 
ATOM   6664 C C   . LEU C 2 19  ? 58.003 27.365  5.019   1.00 17.88 ? 695  LEU D C   1 
ATOM   6665 O O   . LEU C 2 19  ? 57.461 26.470  4.383   1.00 17.17 ? 695  LEU D O   1 
ATOM   6666 C CB  . LEU C 2 19  ? 57.129 29.469  3.941   1.00 18.14 ? 695  LEU D CB  1 
ATOM   6667 C CG  . LEU C 2 19  ? 56.118 29.795  5.038   1.00 18.19 ? 695  LEU D CG  1 
ATOM   6668 C CD1 . LEU C 2 19  ? 56.807 30.411  6.238   1.00 18.66 ? 695  LEU D CD1 1 
ATOM   6669 C CD2 . LEU C 2 19  ? 55.010 30.716  4.537   1.00 18.60 ? 695  LEU D CD2 1 
ATOM   6670 N N   . ILE C 2 20  ? 58.333 27.257  6.303   1.00 18.14 ? 696  ILE D N   1 
ATOM   6671 C CA  . ILE C 2 20  ? 57.982 26.105  7.117   1.00 18.27 ? 696  ILE D CA  1 
ATOM   6672 C C   . ILE C 2 20  ? 56.571 26.321  7.691   1.00 18.67 ? 696  ILE D C   1 
ATOM   6673 O O   . ILE C 2 20  ? 56.308 27.271  8.439   1.00 18.59 ? 696  ILE D O   1 
ATOM   6674 C CB  . ILE C 2 20  ? 59.047 25.866  8.224   1.00 18.43 ? 696  ILE D CB  1 
ATOM   6675 C CG1 . ILE C 2 20  ? 60.404 25.533  7.571   1.00 18.22 ? 696  ILE D CG1 1 
ATOM   6676 C CG2 . ILE C 2 20  ? 58.618 24.757  9.200   1.00 17.76 ? 696  ILE D CG2 1 
ATOM   6677 C CD1 . ILE C 2 20  ? 61.555 25.426  8.552   1.00 18.17 ? 696  ILE D CD1 1 
ATOM   6678 N N   . LEU C 2 21  ? 55.679 25.407  7.325   1.00 19.00 ? 697  LEU D N   1 
ATOM   6679 C CA  . LEU C 2 21  ? 54.250 25.529  7.572   1.00 19.08 ? 697  LEU D CA  1 
ATOM   6680 C C   . LEU C 2 21  ? 53.833 24.882  8.881   1.00 19.41 ? 697  LEU D C   1 
ATOM   6681 O O   . LEU C 2 21  ? 52.859 25.311  9.495   1.00 20.30 ? 697  LEU D O   1 
ATOM   6682 C CB  . LEU C 2 21  ? 53.487 24.934  6.376   1.00 18.85 ? 697  LEU D CB  1 
ATOM   6683 C CG  . LEU C 2 21  ? 53.711 25.755  5.101   1.00 19.22 ? 697  LEU D CG  1 
ATOM   6684 C CD1 . LEU C 2 21  ? 53.261 25.014  3.847   1.00 18.18 ? 697  LEU D CD1 1 
ATOM   6685 C CD2 . LEU C 2 21  ? 53.014 27.110  5.231   1.00 18.21 ? 697  LEU D CD2 1 
ATOM   6686 N N   . GLY C 2 22  ? 54.581 23.876  9.331   1.00 19.67 ? 698  GLY D N   1 
ATOM   6687 C CA  . GLY C 2 22  ? 54.317 23.224  10.615  1.00 19.55 ? 698  GLY D CA  1 
ATOM   6688 C C   . GLY C 2 22  ? 55.011 21.880  10.722  1.00 19.81 ? 698  GLY D C   1 
ATOM   6689 O O   . GLY C 2 22  ? 56.048 21.671  10.092  1.00 19.86 ? 698  GLY D O   1 
ATOM   6690 N N   . LYS C 2 23  ? 54.444 20.970  11.517  1.00 20.05 ? 699  LYS D N   1 
ATOM   6691 C CA  . LYS C 2 23  ? 54.978 19.612  11.652  1.00 20.32 ? 699  LYS D CA  1 
ATOM   6692 C C   . LYS C 2 23  ? 54.557 18.774  10.449  1.00 20.36 ? 699  LYS D C   1 
ATOM   6693 O O   . LYS C 2 23  ? 53.701 19.200  9.665   1.00 19.99 ? 699  LYS D O   1 
ATOM   6694 C CB  . LYS C 2 23  ? 54.479 18.937  12.942  1.00 20.47 ? 699  LYS D CB  1 
ATOM   6695 C CG  . LYS C 2 23  ? 55.113 19.466  14.231  1.00 20.93 ? 699  LYS D CG  1 
ATOM   6696 C CD  . LYS C 2 23  ? 54.621 18.693  15.459  1.00 20.76 ? 699  LYS D CD  1 
ATOM   6697 C CE  . LYS C 2 23  ? 55.122 19.308  16.766  1.00 21.10 ? 699  LYS D CE  1 
ATOM   6698 N NZ  . LYS C 2 23  ? 54.470 18.692  17.971  1.00 21.36 ? 699  LYS D NZ  1 
ATOM   6699 N N   . GLU C 2 24  ? 55.146 17.580  10.329  1.00 20.67 ? 700  GLU D N   1 
ATOM   6700 C CA  . GLU C 2 24  ? 54.796 16.628  9.273   1.00 20.81 ? 700  GLU D CA  1 
ATOM   6701 C C   . GLU C 2 24  ? 53.286 16.493  9.135   1.00 20.87 ? 700  GLU D C   1 
ATOM   6702 O O   . GLU C 2 24  ? 52.582 16.327  10.132  1.00 20.62 ? 700  GLU D O   1 
ATOM   6703 C CB  . GLU C 2 24  ? 55.392 15.232  9.538   1.00 20.89 ? 700  GLU D CB  1 
ATOM   6704 C CG  . GLU C 2 24  ? 55.215 14.263  8.339   1.00 21.10 ? 700  GLU D CG  1 
ATOM   6705 C CD  . GLU C 2 24  ? 55.701 12.832  8.579   1.00 21.21 ? 700  GLU D CD  1 
ATOM   6706 O OE1 . GLU C 2 24  ? 56.055 12.156  7.584   1.00 21.62 ? 700  GLU D OE1 1 
ATOM   6707 O OE2 . GLU C 2 24  ? 55.716 12.377  9.741   1.00 22.59 ? 700  GLU D OE2 1 
ATOM   6708 N N   . ASP C 2 25  ? 52.803 16.584  7.896   1.00 20.94 ? 701  ASP D N   1 
ATOM   6709 C CA  . ASP C 2 25  ? 51.396 16.348  7.577   1.00 21.14 ? 701  ASP D CA  1 
ATOM   6710 C C   . ASP C 2 25  ? 51.352 15.226  6.545   1.00 21.20 ? 701  ASP D C   1 
ATOM   6711 O O   . ASP C 2 25  ? 51.603 15.448  5.363   1.00 21.04 ? 701  ASP D O   1 
ATOM   6712 C CB  . ASP C 2 25  ? 50.734 17.628  7.045   1.00 21.06 ? 701  ASP D CB  1 
ATOM   6713 C CG  . ASP C 2 25  ? 49.244 17.452  6.755   1.00 20.84 ? 701  ASP D CG  1 
ATOM   6714 O OD1 . ASP C 2 25  ? 48.790 16.302  6.607   1.00 19.90 ? 701  ASP D OD1 1 
ATOM   6715 O OD2 . ASP C 2 25  ? 48.528 18.469  6.654   1.00 20.20 ? 701  ASP D OD2 1 
ATOM   6716 N N   . ARG C 2 26  ? 51.021 14.025  7.008   1.00 21.46 ? 702  ARG D N   1 
ATOM   6717 C CA  . ARG C 2 26  ? 51.141 12.815  6.195   1.00 21.82 ? 702  ARG D CA  1 
ATOM   6718 C C   . ARG C 2 26  ? 50.235 12.796  4.961   1.00 21.91 ? 702  ARG D C   1 
ATOM   6719 O O   . ARG C 2 26  ? 50.414 11.953  4.086   1.00 22.21 ? 702  ARG D O   1 
ATOM   6720 C CB  . ARG C 2 26  ? 50.914 11.572  7.058   1.00 21.87 ? 702  ARG D CB  1 
ATOM   6721 C CG  . ARG C 2 26  ? 52.011 11.385  8.093   1.00 22.20 ? 702  ARG D CG  1 
ATOM   6722 C CD  . ARG C 2 26  ? 51.889 10.090  8.891   1.00 22.60 ? 702  ARG D CD  1 
ATOM   6723 N NE  . ARG C 2 26  ? 52.862 10.092  9.982   1.00 22.95 ? 702  ARG D NE  1 
ATOM   6724 C CZ  . ARG C 2 26  ? 52.860 9.270   11.030  1.00 24.33 ? 702  ARG D CZ  1 
ATOM   6725 N NH1 . ARG C 2 26  ? 51.929 8.322   11.175  1.00 24.47 ? 702  ARG D NH1 1 
ATOM   6726 N NH2 . ARG C 2 26  ? 53.810 9.401   11.952  1.00 24.80 ? 702  ARG D NH2 1 
ATOM   6727 N N   . ARG C 2 27  ? 49.290 13.734  4.881   1.00 21.80 ? 703  ARG D N   1 
ATOM   6728 C CA  . ARG C 2 27  ? 48.489 13.931  3.671   1.00 21.43 ? 703  ARG D CA  1 
ATOM   6729 C C   . ARG C 2 27  ? 49.332 14.359  2.467   1.00 21.36 ? 703  ARG D C   1 
ATOM   6730 O O   . ARG C 2 27  ? 48.884 14.223  1.336   1.00 21.43 ? 703  ARG D O   1 
ATOM   6731 C CB  . ARG C 2 27  ? 47.398 14.986  3.900   1.00 21.39 ? 703  ARG D CB  1 
ATOM   6732 C CG  . ARG C 2 27  ? 46.381 14.662  4.991   1.00 20.93 ? 703  ARG D CG  1 
ATOM   6733 C CD  . ARG C 2 27  ? 45.263 15.712  5.052   1.00 20.81 ? 703  ARG D CD  1 
ATOM   6734 N NE  . ARG C 2 27  ? 45.768 17.051  5.369   1.00 20.15 ? 703  ARG D NE  1 
ATOM   6735 C CZ  . ARG C 2 27  ? 45.027 18.157  5.438   1.00 19.75 ? 703  ARG D CZ  1 
ATOM   6736 N NH1 . ARG C 2 27  ? 43.716 18.122  5.216   1.00 19.03 ? 703  ARG D NH1 1 
ATOM   6737 N NH2 . ARG C 2 27  ? 45.606 19.312  5.731   1.00 19.28 ? 703  ARG D NH2 1 
ATOM   6738 N N   . TYR C 2 28  ? 50.533 14.888  2.712   1.00 21.26 ? 704  TYR D N   1 
ATOM   6739 C CA  . TYR C 2 28  ? 51.419 15.374  1.649   1.00 21.33 ? 704  TYR D CA  1 
ATOM   6740 C C   . TYR C 2 28  ? 52.561 14.405  1.278   1.00 21.59 ? 704  TYR D C   1 
ATOM   6741 O O   . TYR C 2 28  ? 53.550 14.806  0.657   1.00 22.13 ? 704  TYR D O   1 
ATOM   6742 C CB  . TYR C 2 28  ? 51.972 16.769  2.026   1.00 20.86 ? 704  TYR D CB  1 
ATOM   6743 C CG  . TYR C 2 28  ? 50.890 17.834  2.045   1.00 20.48 ? 704  TYR D CG  1 
ATOM   6744 C CD1 . TYR C 2 28  ? 50.175 18.113  3.217   1.00 19.56 ? 704  TYR D CD1 1 
ATOM   6745 C CD2 . TYR C 2 28  ? 50.542 18.521  0.884   1.00 18.97 ? 704  TYR D CD2 1 
ATOM   6746 C CE1 . TYR C 2 28  ? 49.168 19.064  3.237   1.00 19.25 ? 704  TYR D CE1 1 
ATOM   6747 C CE2 . TYR C 2 28  ? 49.529 19.474  0.895   1.00 19.95 ? 704  TYR D CE2 1 
ATOM   6748 C CZ  . TYR C 2 28  ? 48.849 19.741  2.077   1.00 19.95 ? 704  TYR D CZ  1 
ATOM   6749 O OH  . TYR C 2 28  ? 47.846 20.680  2.091   1.00 20.37 ? 704  TYR D OH  1 
ATOM   6750 N N   . GLY C 2 29  ? 52.414 13.133  1.639   1.00 22.08 ? 705  GLY D N   1 
ATOM   6751 C CA  . GLY C 2 29  ? 53.375 12.087  1.250   1.00 21.92 ? 705  GLY D CA  1 
ATOM   6752 C C   . GLY C 2 29  ? 54.549 11.943  2.208   1.00 22.00 ? 705  GLY D C   1 
ATOM   6753 O O   . GLY C 2 29  ? 54.707 12.754  3.130   1.00 22.24 ? 705  GLY D O   1 
ATOM   6754 N N   . PRO C 2 30  ? 55.382 10.904  2.004   1.00 21.56 ? 706  PRO D N   1 
ATOM   6755 C CA  . PRO C 2 30  ? 56.552 10.705  2.863   1.00 21.34 ? 706  PRO D CA  1 
ATOM   6756 C C   . PRO C 2 30  ? 57.572 11.839  2.763   1.00 20.92 ? 706  PRO D C   1 
ATOM   6757 O O   . PRO C 2 30  ? 57.567 12.597  1.801   1.00 20.84 ? 706  PRO D O   1 
ATOM   6758 C CB  . PRO C 2 30  ? 57.148 9.381   2.359   1.00 21.30 ? 706  PRO D CB  1 
ATOM   6759 C CG  . PRO C 2 30  ? 56.624 9.215   0.981   1.00 21.61 ? 706  PRO D CG  1 
ATOM   6760 C CD  . PRO C 2 30  ? 55.272 9.860   0.970   1.00 21.69 ? 706  PRO D CD  1 
ATOM   6761 N N   . ALA C 2 31  ? 58.436 11.935  3.766   1.00 20.72 ? 707  ALA D N   1 
ATOM   6762 C CA  . ALA C 2 31  ? 59.422 12.998  3.862   1.00 20.70 ? 707  ALA D CA  1 
ATOM   6763 C C   . ALA C 2 31  ? 60.425 12.973  2.709   1.00 20.68 ? 707  ALA D C   1 
ATOM   6764 O O   . ALA C 2 31  ? 61.086 11.964  2.480   1.00 20.84 ? 707  ALA D O   1 
ATOM   6765 C CB  . ALA C 2 31  ? 60.157 12.900  5.192   1.00 20.46 ? 707  ALA D CB  1 
ATOM   6766 N N   . LEU C 2 32  ? 60.525 14.087  1.984   1.00 20.71 ? 708  LEU D N   1 
ATOM   6767 C CA  . LEU C 2 32  ? 61.560 14.260  0.957   1.00 20.72 ? 708  LEU D CA  1 
ATOM   6768 C C   . LEU C 2 32  ? 62.919 14.497  1.609   1.00 20.72 ? 708  LEU D C   1 
ATOM   6769 O O   . LEU C 2 32  ? 62.999 14.868  2.777   1.00 20.63 ? 708  LEU D O   1 
ATOM   6770 C CB  . LEU C 2 32  ? 61.236 15.451  0.048   1.00 20.51 ? 708  LEU D CB  1 
ATOM   6771 C CG  . LEU C 2 32  ? 60.015 15.335  -0.860  1.00 20.50 ? 708  LEU D CG  1 
ATOM   6772 C CD1 . LEU C 2 32  ? 59.713 16.676  -1.498  1.00 21.08 ? 708  LEU D CD1 1 
ATOM   6773 C CD2 . LEU C 2 32  ? 60.228 14.264  -1.921  1.00 20.55 ? 708  LEU D CD2 1 
ATOM   6774 N N   . SER C 2 33  ? 63.987 14.275  0.850   1.00 20.85 ? 709  SER D N   1 
ATOM   6775 C CA  . SER C 2 33  ? 65.328 14.627  1.298   1.00 20.99 ? 709  SER D CA  1 
ATOM   6776 C C   . SER C 2 33  ? 65.531 16.117  1.066   1.00 21.04 ? 709  SER D C   1 
ATOM   6777 O O   . SER C 2 33  ? 64.749 16.748  0.357   1.00 21.01 ? 709  SER D O   1 
ATOM   6778 C CB  . SER C 2 33  ? 66.382 13.822  0.536   1.00 21.09 ? 709  SER D CB  1 
ATOM   6779 O OG  . SER C 2 33  ? 66.510 14.277  -0.802  1.00 21.34 ? 709  SER D OG  1 
ATOM   6780 N N   . ILE C 2 34  ? 66.581 16.678  1.657   1.00 21.23 ? 710  ILE D N   1 
ATOM   6781 C CA  . ILE C 2 34  ? 66.886 18.101  1.481   1.00 21.39 ? 710  ILE D CA  1 
ATOM   6782 C C   . ILE C 2 34  ? 67.433 18.396  0.066   1.00 21.39 ? 710  ILE D C   1 
ATOM   6783 O O   . ILE C 2 34  ? 67.342 19.517  -0.425  1.00 21.15 ? 710  ILE D O   1 
ATOM   6784 C CB  . ILE C 2 34  ? 67.867 18.602  2.581   1.00 21.40 ? 710  ILE D CB  1 
ATOM   6785 C CG1 . ILE C 2 34  ? 67.506 20.024  3.030   1.00 21.31 ? 710  ILE D CG1 1 
ATOM   6786 C CG2 . ILE C 2 34  ? 69.323 18.504  2.105   1.00 21.59 ? 710  ILE D CG2 1 
ATOM   6787 C CD1 . ILE C 2 34  ? 68.045 20.386  4.407   1.00 21.55 ? 710  ILE D CD1 1 
ATOM   6788 N N   . ASN C 2 35  ? 67.996 17.382  -0.585  1.00 21.79 ? 711  ASN D N   1 
ATOM   6789 C CA  . ASN C 2 35  ? 68.406 17.509  -1.984  1.00 21.98 ? 711  ASN D CA  1 
ATOM   6790 C C   . ASN C 2 35  ? 67.187 17.474  -2.914  1.00 22.11 ? 711  ASN D C   1 
ATOM   6791 O O   . ASN C 2 35  ? 67.133 18.207  -3.903  1.00 22.14 ? 711  ASN D O   1 
ATOM   6792 C CB  . ASN C 2 35  ? 69.398 16.410  -2.360  1.00 22.19 ? 711  ASN D CB  1 
ATOM   6793 C CG  . ASN C 2 35  ? 70.621 16.386  -1.452  1.00 22.65 ? 711  ASN D CG  1 
ATOM   6794 O OD1 . ASN C 2 35  ? 70.541 16.721  -0.267  1.00 23.84 ? 711  ASN D OD1 1 
ATOM   6795 N ND2 . ASN C 2 35  ? 71.757 15.980  -2.004  1.00 22.81 ? 711  ASN D ND2 1 
ATOM   6796 N N   . GLU C 2 36  ? 66.200 16.644  -2.573  1.00 22.16 ? 712  GLU D N   1 
ATOM   6797 C CA  . GLU C 2 36  ? 64.980 16.494  -3.377  1.00 22.11 ? 712  GLU D CA  1 
ATOM   6798 C C   . GLU C 2 36  ? 64.082 17.736  -3.378  1.00 22.15 ? 712  GLU D C   1 
ATOM   6799 O O   . GLU C 2 36  ? 63.221 17.861  -4.251  1.00 21.77 ? 712  GLU D O   1 
ATOM   6800 C CB  . GLU C 2 36  ? 64.165 15.272  -2.911  1.00 22.09 ? 712  GLU D CB  1 
ATOM   6801 C CG  . GLU C 2 36  ? 64.750 13.920  -3.318  1.00 21.65 ? 712  GLU D CG  1 
ATOM   6802 C CD  . GLU C 2 36  ? 64.227 12.746  -2.472  1.00 22.13 ? 712  GLU D CD  1 
ATOM   6803 O OE1 . GLU C 2 36  ? 63.045 12.758  -2.067  1.00 21.43 ? 712  GLU D OE1 1 
ATOM   6804 O OE2 . GLU C 2 36  ? 65.002 11.792  -2.222  1.00 22.74 ? 712  GLU D OE2 1 
ATOM   6805 N N   . LEU C 2 37  ? 64.273 18.633  -2.403  1.00 22.44 ? 713  LEU D N   1 
ATOM   6806 C CA  . LEU C 2 37  ? 63.448 19.846  -2.269  1.00 22.80 ? 713  LEU D CA  1 
ATOM   6807 C C   . LEU C 2 37  ? 63.509 20.784  -3.462  1.00 23.08 ? 713  LEU D C   1 
ATOM   6808 O O   . LEU C 2 37  ? 62.524 21.454  -3.762  1.00 23.41 ? 713  LEU D O   1 
ATOM   6809 C CB  . LEU C 2 37  ? 63.833 20.664  -1.024  1.00 22.94 ? 713  LEU D CB  1 
ATOM   6810 C CG  . LEU C 2 37  ? 63.031 20.519  0.267   1.00 22.09 ? 713  LEU D CG  1 
ATOM   6811 C CD1 . LEU C 2 37  ? 63.443 21.646  1.197   1.00 21.23 ? 713  LEU D CD1 1 
ATOM   6812 C CD2 . LEU C 2 37  ? 61.526 20.539  0.021   1.00 21.84 ? 713  LEU D CD2 1 
ATOM   6813 N N   . SER C 2 38  ? 64.666 20.864  -4.115  1.00 23.31 ? 714  SER D N   1 
ATOM   6814 C CA  . SER C 2 38  ? 64.803 21.704  -5.299  1.00 23.56 ? 714  SER D CA  1 
ATOM   6815 C C   . SER C 2 38  ? 63.808 21.316  -6.408  1.00 23.84 ? 714  SER D C   1 
ATOM   6816 O O   . SER C 2 38  ? 63.378 22.176  -7.175  1.00 24.20 ? 714  SER D O   1 
ATOM   6817 C CB  . SER C 2 38  ? 66.243 21.684  -5.830  1.00 23.52 ? 714  SER D CB  1 
ATOM   6818 O OG  . SER C 2 38  ? 66.753 20.365  -5.924  1.00 23.71 ? 714  SER D OG  1 
ATOM   6819 N N   . ASN C 2 39  ? 63.426 20.042  -6.473  1.00 23.83 ? 715  ASN D N   1 
ATOM   6820 C CA  . ASN C 2 39  ? 62.470 19.576  -7.480  1.00 24.12 ? 715  ASN D CA  1 
ATOM   6821 C C   . ASN C 2 39  ? 61.001 19.822  -7.122  1.00 24.27 ? 715  ASN D C   1 
ATOM   6822 O O   . ASN C 2 39  ? 60.121 19.534  -7.925  1.00 24.65 ? 715  ASN D O   1 
ATOM   6823 C CB  . ASN C 2 39  ? 62.670 18.082  -7.759  1.00 24.12 ? 715  ASN D CB  1 
ATOM   6824 C CG  . ASN C 2 39  ? 63.978 17.777  -8.467  1.00 24.33 ? 715  ASN D CG  1 
ATOM   6825 O OD1 . ASN C 2 39  ? 64.451 16.642  -8.423  1.00 24.27 ? 715  ASN D OD1 1 
ATOM   6826 N ND2 . ASN C 2 39  ? 64.561 18.775  -9.133  1.00 24.23 ? 715  ASN D ND2 1 
ATOM   6827 N N   . LEU C 2 40  ? 60.729 20.344  -5.929  1.00 24.51 ? 716  LEU D N   1 
ATOM   6828 C CA  . LEU C 2 40  ? 59.352 20.575  -5.491  1.00 24.35 ? 716  LEU D CA  1 
ATOM   6829 C C   . LEU C 2 40  ? 58.727 21.678  -6.347  1.00 24.49 ? 716  LEU D C   1 
ATOM   6830 O O   . LEU C 2 40  ? 59.302 22.766  -6.500  1.00 24.10 ? 716  LEU D O   1 
ATOM   6831 C CB  . LEU C 2 40  ? 59.300 20.948  -4.004  1.00 24.41 ? 716  LEU D CB  1 
ATOM   6832 C CG  . LEU C 2 40  ? 57.918 21.247  -3.393  1.00 24.42 ? 716  LEU D CG  1 
ATOM   6833 C CD1 . LEU C 2 40  ? 56.995 20.020  -3.445  1.00 25.53 ? 716  LEU D CD1 1 
ATOM   6834 C CD2 . LEU C 2 40  ? 58.052 21.751  -1.959  1.00 24.02 ? 716  LEU D CD2 1 
ATOM   6835 N N   . ALA C 2 41  ? 57.558 21.380  -6.913  1.00 24.41 ? 717  ALA D N   1 
ATOM   6836 C CA  . ALA C 2 41  ? 56.833 22.336  -7.734  1.00 24.35 ? 717  ALA D CA  1 
ATOM   6837 C C   . ALA C 2 41  ? 56.517 23.586  -6.924  1.00 24.45 ? 717  ALA D C   1 
ATOM   6838 O O   . ALA C 2 41  ? 56.080 23.503  -5.776  1.00 24.02 ? 717  ALA D O   1 
ATOM   6839 C CB  . ALA C 2 41  ? 55.552 21.723  -8.285  1.00 24.21 ? 717  ALA D CB  1 
ATOM   6840 N N   . LYS C 2 42  ? 56.794 24.738  -7.529  1.00 24.24 ? 718  LYS D N   1 
ATOM   6841 C CA  . LYS C 2 42  ? 56.367 26.016  -7.000  1.00 24.11 ? 718  LYS D CA  1 
ATOM   6842 C C   . LYS C 2 42  ? 54.870 25.925  -6.709  1.00 24.41 ? 718  LYS D C   1 
ATOM   6843 O O   . LYS C 2 42  ? 54.085 25.519  -7.563  1.00 24.80 ? 718  LYS D O   1 
ATOM   6844 C CB  . LYS C 2 42  ? 56.647 27.135  -8.013  1.00 23.77 ? 718  LYS D CB  1 
ATOM   6845 C CG  . LYS C 2 42  ? 58.144 27.421  -8.253  1.00 23.07 ? 718  LYS D CG  1 
ATOM   6846 C CD  . LYS C 2 42  ? 58.400 28.030  -9.637  1.00 23.19 ? 718  LYS D CD  1 
ATOM   6847 C CE  . LYS C 2 42  ? 59.866 27.905  -10.068 1.00 22.58 ? 718  LYS D CE  1 
ATOM   6848 N NZ  . LYS C 2 42  ? 60.178 28.589  -11.350 1.00 21.19 ? 718  LYS D NZ  1 
ATOM   6849 N N   . GLY C 2 43  ? 54.479 26.269  -5.494  1.00 24.63 ? 719  GLY D N   1 
ATOM   6850 C CA  . GLY C 2 43  ? 53.070 26.337  -5.148  1.00 24.68 ? 719  GLY D CA  1 
ATOM   6851 C C   . GLY C 2 43  ? 52.480 25.121  -4.452  1.00 24.88 ? 719  GLY D C   1 
ATOM   6852 O O   . GLY C 2 43  ? 51.380 25.232  -3.896  1.00 25.59 ? 719  GLY D O   1 
ATOM   6853 N N   . GLU C 2 44  ? 53.158 23.966  -4.476  1.00 24.74 ? 720  GLU D N   1 
ATOM   6854 C CA  . GLU C 2 44  ? 52.709 22.842  -3.640  1.00 24.54 ? 720  GLU D CA  1 
ATOM   6855 C C   . GLU C 2 44  ? 53.500 22.692  -2.311  1.00 23.96 ? 720  GLU D C   1 
ATOM   6856 O O   . GLU C 2 44  ? 54.480 23.411  -2.055  1.00 23.45 ? 720  GLU D O   1 
ATOM   6857 C CB  . GLU C 2 44  ? 52.579 21.510  -4.412  1.00 24.99 ? 720  GLU D CB  1 
ATOM   6858 C CG  . GLU C 2 44  ? 53.535 21.221  -5.555  1.00 26.07 ? 720  GLU D CG  1 
ATOM   6859 C CD  . GLU C 2 44  ? 53.404 19.764  -6.050  1.00 26.18 ? 720  GLU D CD  1 
ATOM   6860 O OE1 . GLU C 2 44  ? 53.209 18.863  -5.201  1.00 28.17 ? 720  GLU D OE1 1 
ATOM   6861 O OE2 . GLU C 2 44  ? 53.501 19.504  -7.279  1.00 28.68 ? 720  GLU D OE2 1 
ATOM   6862 N N   . LYS C 2 45  ? 53.015 21.794  -1.455  1.00 22.99 ? 721  LYS D N   1 
ATOM   6863 C CA  . LYS C 2 45  ? 53.590 21.582  -0.135  1.00 22.65 ? 721  LYS D CA  1 
ATOM   6864 C C   . LYS C 2 45  ? 54.148 20.181  -0.056  1.00 22.12 ? 721  LYS D C   1 
ATOM   6865 O O   . LYS C 2 45  ? 53.612 19.268  -0.665  1.00 22.16 ? 721  LYS D O   1 
ATOM   6866 C CB  . LYS C 2 45  ? 52.532 21.797  0.955   1.00 22.47 ? 721  LYS D CB  1 
ATOM   6867 C CG  . LYS C 2 45  ? 51.863 23.175  0.902   1.00 22.55 ? 721  LYS D CG  1 
ATOM   6868 C CD  . LYS C 2 45  ? 50.769 23.335  1.933   1.00 22.35 ? 721  LYS D CD  1 
ATOM   6869 C CE  . LYS C 2 45  ? 49.970 24.620  1.727   1.00 22.19 ? 721  LYS D CE  1 
ATOM   6870 N NZ  . LYS C 2 45  ? 48.662 24.604  2.497   1.00 23.15 ? 721  LYS D NZ  1 
ATOM   6871 N N   . ALA C 2 46  ? 55.235 20.024  0.688   1.00 21.83 ? 722  ALA D N   1 
ATOM   6872 C CA  . ALA C 2 46  ? 55.855 18.720  0.875   1.00 21.49 ? 722  ALA D CA  1 
ATOM   6873 C C   . ALA C 2 46  ? 56.537 18.597  2.239   1.00 21.13 ? 722  ALA D C   1 
ATOM   6874 O O   . ALA C 2 46  ? 56.986 19.588  2.821   1.00 21.04 ? 722  ALA D O   1 
ATOM   6875 C CB  . ALA C 2 46  ? 56.851 18.459  -0.227  1.00 21.21 ? 722  ALA D CB  1 
ATOM   6876 N N   . ASN C 2 47  ? 56.621 17.365  2.727   1.00 20.61 ? 723  ASN D N   1 
ATOM   6877 C CA  . ASN C 2 47  ? 57.349 17.063  3.952   1.00 20.82 ? 723  ASN D CA  1 
ATOM   6878 C C   . ASN C 2 47  ? 58.832 16.887  3.651   1.00 20.78 ? 723  ASN D C   1 
ATOM   6879 O O   . ASN C 2 47  ? 59.190 16.318  2.618   1.00 20.80 ? 723  ASN D O   1 
ATOM   6880 C CB  . ASN C 2 47  ? 56.784 15.804  4.632   1.00 20.46 ? 723  ASN D CB  1 
ATOM   6881 C CG  . ASN C 2 47  ? 55.347 15.984  5.088   1.00 19.97 ? 723  ASN D CG  1 
ATOM   6882 O OD1 . ASN C 2 47  ? 55.037 16.905  5.845   1.00 20.20 ? 723  ASN D OD1 1 
ATOM   6883 N ND2 . ASN C 2 47  ? 54.464 15.117  4.624   1.00 18.47 ? 723  ASN D ND2 1 
ATOM   6884 N N   . VAL C 2 48  ? 59.678 17.376  4.561   1.00 21.00 ? 724  VAL D N   1 
ATOM   6885 C CA  . VAL C 2 48  ? 61.142 17.293  4.437   1.00 20.95 ? 724  VAL D CA  1 
ATOM   6886 C C   . VAL C 2 48  ? 61.777 16.814  5.739   1.00 20.88 ? 724  VAL D C   1 
ATOM   6887 O O   . VAL C 2 48  ? 61.439 17.312  6.814   1.00 20.36 ? 724  VAL D O   1 
ATOM   6888 C CB  . VAL C 2 48  ? 61.781 18.674  4.157   1.00 21.05 ? 724  VAL D CB  1 
ATOM   6889 C CG1 . VAL C 2 48  ? 63.077 18.508  3.374   1.00 20.47 ? 724  VAL D CG1 1 
ATOM   6890 C CG2 . VAL C 2 48  ? 60.811 19.585  3.436   1.00 21.40 ? 724  VAL D CG2 1 
ATOM   6891 N N   . LEU C 2 49  ? 62.714 15.871  5.633   1.00 21.02 ? 725  LEU D N   1 
ATOM   6892 C CA  . LEU C 2 49  ? 63.528 15.459  6.770   1.00 21.28 ? 725  LEU D CA  1 
ATOM   6893 C C   . LEU C 2 49  ? 64.657 16.477  6.965   1.00 21.56 ? 725  LEU D C   1 
ATOM   6894 O O   . LEU C 2 49  ? 65.661 16.442  6.251   1.00 21.67 ? 725  LEU D O   1 
ATOM   6895 C CB  . LEU C 2 49  ? 64.094 14.046  6.553   1.00 21.20 ? 725  LEU D CB  1 
ATOM   6896 C CG  . LEU C 2 49  ? 64.870 13.420  7.713   1.00 21.00 ? 725  LEU D CG  1 
ATOM   6897 C CD1 . LEU C 2 49  ? 63.961 13.195  8.905   1.00 20.65 ? 725  LEU D CD1 1 
ATOM   6898 C CD2 . LEU C 2 49  ? 65.507 12.115  7.274   1.00 21.10 ? 725  LEU D CD2 1 
ATOM   6899 N N   . ILE C 2 50  ? 64.482 17.380  7.931   1.00 21.93 ? 726  ILE D N   1 
ATOM   6900 C CA  . ILE C 2 50  ? 65.510 18.380  8.267   1.00 21.98 ? 726  ILE D CA  1 
ATOM   6901 C C   . ILE C 2 50  ? 66.635 17.754  9.092   1.00 22.04 ? 726  ILE D C   1 
ATOM   6902 O O   . ILE C 2 50  ? 67.722 18.318  9.203   1.00 22.00 ? 726  ILE D O   1 
ATOM   6903 C CB  . ILE C 2 50  ? 64.925 19.586  9.051   1.00 22.19 ? 726  ILE D CB  1 
ATOM   6904 C CG1 . ILE C 2 50  ? 63.710 20.169  8.331   1.00 22.00 ? 726  ILE D CG1 1 
ATOM   6905 C CG2 . ILE C 2 50  ? 65.975 20.682  9.212   1.00 22.30 ? 726  ILE D CG2 1 
ATOM   6906 C CD1 . ILE C 2 50  ? 63.971 20.478  6.875   1.00 22.78 ? 726  ILE D CD1 1 
ATOM   6907 N N   . GLY C 2 51  ? 66.364 16.589  9.669   1.00 22.08 ? 727  GLY D N   1 
ATOM   6908 C CA  . GLY C 2 51  ? 67.368 15.839  10.401  1.00 22.16 ? 727  GLY D CA  1 
ATOM   6909 C C   . GLY C 2 51  ? 66.697 14.848  11.322  1.00 22.30 ? 727  GLY D C   1 
ATOM   6910 O O   . GLY C 2 51  ? 65.472 14.706  11.299  1.00 22.57 ? 727  GLY D O   1 
ATOM   6911 N N   . GLN C 2 52  ? 67.508 14.162  12.124  1.00 22.26 ? 728  GLN D N   1 
ATOM   6912 C CA  . GLN C 2 52  ? 67.029 13.259  13.173  1.00 22.20 ? 728  GLN D CA  1 
ATOM   6913 C C   . GLN C 2 52  ? 65.650 12.637  12.842  1.00 22.31 ? 728  GLN D C   1 
ATOM   6914 O O   . GLN C 2 52  ? 65.536 11.875  11.873  1.00 22.50 ? 728  GLN D O   1 
ATOM   6915 C CB  . GLN C 2 52  ? 67.055 13.994  14.528  1.00 22.26 ? 728  GLN D CB  1 
ATOM   6916 C CG  . GLN C 2 52  ? 66.478 15.417  14.500  1.00 21.75 ? 728  GLN D CG  1 
ATOM   6917 C CD  . GLN C 2 52  ? 66.343 16.032  15.879  1.00 21.84 ? 728  GLN D CD  1 
ATOM   6918 O OE1 . GLN C 2 52  ? 66.917 15.539  16.850  1.00 22.48 ? 728  GLN D OE1 1 
ATOM   6919 N NE2 . GLN C 2 52  ? 65.581 17.115  15.973  1.00 20.80 ? 728  GLN D NE2 1 
ATOM   6920 N N   . GLY C 2 53  ? 64.628 12.936  13.647  1.00 22.15 ? 729  GLY D N   1 
ATOM   6921 C CA  . GLY C 2 53  ? 63.243 12.594  13.334  1.00 21.85 ? 729  GLY D CA  1 
ATOM   6922 C C   . GLY C 2 53  ? 62.462 13.884  13.217  1.00 21.71 ? 729  GLY D C   1 
ATOM   6923 O O   . GLY C 2 53  ? 61.280 13.944  13.553  1.00 21.80 ? 729  GLY D O   1 
ATOM   6924 N N   . ASP C 2 54  ? 63.145 14.918  12.729  1.00 21.51 ? 730  ASP D N   1 
ATOM   6925 C CA  . ASP C 2 54  ? 62.589 16.256  12.605  1.00 21.03 ? 730  ASP D CA  1 
ATOM   6926 C C   . ASP C 2 54  ? 62.123 16.438  11.166  1.00 20.62 ? 730  ASP D C   1 
ATOM   6927 O O   . ASP C 2 54  ? 62.879 16.893  10.305  1.00 20.61 ? 730  ASP D O   1 
ATOM   6928 C CB  . ASP C 2 54  ? 63.651 17.298  12.990  1.00 21.24 ? 730  ASP D CB  1 
ATOM   6929 C CG  . ASP C 2 54  ? 63.079 18.697  13.191  1.00 21.75 ? 730  ASP D CG  1 
ATOM   6930 O OD1 . ASP C 2 54  ? 61.929 18.967  12.780  1.00 22.89 ? 730  ASP D OD1 1 
ATOM   6931 O OD2 . ASP C 2 54  ? 63.797 19.540  13.771  1.00 23.22 ? 730  ASP D OD2 1 
ATOM   6932 N N   . VAL C 2 55  ? 60.875 16.053  10.919  1.00 20.02 ? 731  VAL D N   1 
ATOM   6933 C CA  . VAL C 2 55  ? 60.245 16.222  9.619   1.00 19.49 ? 731  VAL D CA  1 
ATOM   6934 C C   . VAL C 2 55  ? 59.248 17.368  9.706   1.00 19.25 ? 731  VAL D C   1 
ATOM   6935 O O   . VAL C 2 55  ? 58.348 17.347  10.551  1.00 19.45 ? 731  VAL D O   1 
ATOM   6936 C CB  . VAL C 2 55  ? 59.521 14.943  9.178   1.00 19.38 ? 731  VAL D CB  1 
ATOM   6937 C CG1 . VAL C 2 55  ? 58.787 15.165  7.872   1.00 18.84 ? 731  VAL D CG1 1 
ATOM   6938 C CG2 . VAL C 2 55  ? 60.511 13.795  9.051   1.00 19.52 ? 731  VAL D CG2 1 
ATOM   6939 N N   . VAL C 2 56  ? 59.425 18.362  8.835   1.00 18.65 ? 732  VAL D N   1 
ATOM   6940 C CA  . VAL C 2 56  ? 58.564 19.540  8.776   1.00 18.22 ? 732  VAL D CA  1 
ATOM   6941 C C   . VAL C 2 56  ? 57.895 19.642  7.409   1.00 17.85 ? 732  VAL D C   1 
ATOM   6942 O O   . VAL C 2 56  ? 58.388 19.083  6.431   1.00 17.63 ? 732  VAL D O   1 
ATOM   6943 C CB  . VAL C 2 56  ? 59.354 20.844  9.064   1.00 18.05 ? 732  VAL D CB  1 
ATOM   6944 C CG1 . VAL C 2 56  ? 59.900 20.823  10.480  1.00 17.54 ? 732  VAL D CG1 1 
ATOM   6945 C CG2 . VAL C 2 56  ? 60.487 21.054  8.052   1.00 17.66 ? 732  VAL D CG2 1 
ATOM   6946 N N   . LEU C 2 57  ? 56.764 20.342  7.362   1.00 17.45 ? 733  LEU D N   1 
ATOM   6947 C CA  . LEU C 2 57  ? 56.056 20.617  6.113   1.00 17.41 ? 733  LEU D CA  1 
ATOM   6948 C C   . LEU C 2 57  ? 56.459 21.998  5.598   1.00 17.57 ? 733  LEU D C   1 
ATOM   6949 O O   . LEU C 2 57  ? 56.501 22.965  6.360   1.00 17.44 ? 733  LEU D O   1 
ATOM   6950 C CB  . LEU C 2 57  ? 54.544 20.560  6.327   1.00 17.49 ? 733  LEU D CB  1 
ATOM   6951 C CG  . LEU C 2 57  ? 53.634 20.785  5.113   1.00 16.94 ? 733  LEU D CG  1 
ATOM   6952 C CD1 . LEU C 2 57  ? 53.704 19.639  4.159   1.00 15.09 ? 733  LEU D CD1 1 
ATOM   6953 C CD2 . LEU C 2 57  ? 52.208 20.999  5.575   1.00 16.84 ? 733  LEU D CD2 1 
ATOM   6954 N N   . VAL C 2 58  ? 56.755 22.083  4.302   1.00 17.35 ? 734  VAL D N   1 
ATOM   6955 C CA  . VAL C 2 58  ? 57.218 23.321  3.706   1.00 17.43 ? 734  VAL D CA  1 
ATOM   6956 C C   . VAL C 2 58  ? 56.588 23.578  2.351   1.00 17.89 ? 734  VAL D C   1 
ATOM   6957 O O   . VAL C 2 58  ? 56.036 22.684  1.715   1.00 18.03 ? 734  VAL D O   1 
ATOM   6958 C CB  . VAL C 2 58  ? 58.730 23.287  3.488   1.00 17.20 ? 734  VAL D CB  1 
ATOM   6959 C CG1 . VAL C 2 58  ? 59.446 23.066  4.802   1.00 16.21 ? 734  VAL D CG1 1 
ATOM   6960 C CG2 . VAL C 2 58  ? 59.099 22.196  2.446   1.00 16.40 ? 734  VAL D CG2 1 
ATOM   6961 N N   . MET C 2 59  ? 56.684 24.826  1.921   1.00 18.65 ? 735  MET D N   1 
ATOM   6962 C CA  . MET C 2 59  ? 56.492 25.191  0.525   1.00 18.92 ? 735  MET D CA  1 
ATOM   6963 C C   . MET C 2 59  ? 57.584 26.188  0.141   1.00 18.74 ? 735  MET D C   1 
ATOM   6964 O O   . MET C 2 59  ? 58.172 26.831  1.004   1.00 19.12 ? 735  MET D O   1 
ATOM   6965 C CB  . MET C 2 59  ? 55.125 25.848  0.337   1.00 19.01 ? 735  MET D CB  1 
ATOM   6966 C CG  . MET C 2 59  ? 54.971 27.162  1.085   1.00 19.57 ? 735  MET D CG  1 
ATOM   6967 S SD  . MET C 2 59  ? 53.365 27.946  0.845   1.00 20.98 ? 735  MET D SD  1 
ATOM   6968 C CE  . MET C 2 59  ? 53.453 28.511  -0.842  1.00 20.25 ? 735  MET D CE  1 
ATOM   6969 N N   . LYS C 2 60  ? 57.824 26.315  -1.162  1.00 18.80 ? 736  LYS D N   1 
ATOM   6970 C CA  . LYS C 2 60  ? 58.701 27.344  -1.719  1.00 18.13 ? 736  LYS D CA  1 
ATOM   6971 C C   . LYS C 2 60  ? 58.167 28.769  -1.544  1.00 17.28 ? 736  LYS D C   1 
ATOM   6972 O O   . LYS C 2 60  ? 56.982 29.028  -1.726  1.00 16.26 ? 736  LYS D O   1 
ATOM   6973 C CB  . LYS C 2 60  ? 58.967 27.063  -3.205  1.00 18.52 ? 736  LYS D CB  1 
ATOM   6974 C CG  . LYS C 2 60  ? 59.996 25.964  -3.428  1.00 18.45 ? 736  LYS D CG  1 
ATOM   6975 C CD  . LYS C 2 60  ? 60.393 25.798  -4.890  1.00 18.75 ? 736  LYS D CD  1 
ATOM   6976 C CE  . LYS C 2 60  ? 61.362 24.604  -5.057  1.00 18.78 ? 736  LYS D CE  1 
ATOM   6977 N NZ  . LYS C 2 60  ? 61.492 24.121  -6.460  1.00 18.66 ? 736  LYS D NZ  1 
ATOM   6978 N N   . ARG C 2 61  ? 59.088 29.690  -1.235  1.00 17.20 ? 737  ARG D N   1 
ATOM   6979 C CA  . ARG C 2 61  ? 58.797 31.113  -1.139  1.00 16.94 ? 737  ARG D CA  1 
ATOM   6980 C C   . ARG C 2 61  ? 58.554 31.750  -2.494  1.00 16.68 ? 737  ARG D C   1 
ATOM   6981 O O   . ARG C 2 61  ? 57.873 32.763  -2.593  1.00 16.90 ? 737  ARG D O   1 
ATOM   6982 C CB  . ARG C 2 61  ? 59.944 31.842  -0.440  1.00 16.68 ? 737  ARG D CB  1 
ATOM   6983 C CG  . ARG C 2 61  ? 60.060 31.489  1.012   1.00 16.32 ? 737  ARG D CG  1 
ATOM   6984 C CD  . ARG C 2 61  ? 61.136 32.303  1.701   1.00 15.82 ? 737  ARG D CD  1 
ATOM   6985 N NE  . ARG C 2 61  ? 61.240 31.898  3.105   1.00 15.83 ? 737  ARG D NE  1 
ATOM   6986 C CZ  . ARG C 2 61  ? 60.490 32.370  4.103   1.00 15.18 ? 737  ARG D CZ  1 
ATOM   6987 N NH1 . ARG C 2 61  ? 59.568 33.308  3.893   1.00 13.52 ? 737  ARG D NH1 1 
ATOM   6988 N NH2 . ARG C 2 61  ? 60.671 31.893  5.332   1.00 13.85 ? 737  ARG D NH2 1 
ATOM   6989 N N   . LYS C 2 62  ? 59.149 31.193  -3.535  1.00 16.99 ? 738  LYS D N   1 
ATOM   6990 C CA  . LYS C 2 62  ? 58.937 31.712  -4.889  1.00 17.16 ? 738  LYS D CA  1 
ATOM   6991 C C   . LYS C 2 62  ? 57.693 31.049  -5.462  1.00 17.17 ? 738  LYS D C   1 
ATOM   6992 O O   . LYS C 2 62  ? 57.622 29.844  -5.519  1.00 18.54 ? 738  LYS D O   1 
ATOM   6993 C CB  . LYS C 2 62  ? 60.186 31.497  -5.757  1.00 16.62 ? 738  LYS D CB  1 
ATOM   6994 C CG  . LYS C 2 62  ? 61.192 32.636  -5.576  1.00 16.66 ? 738  LYS D CG  1 
ATOM   6995 C CD  . LYS C 2 62  ? 62.590 32.283  -5.973  1.00 15.67 ? 738  LYS D CD  1 
ATOM   6996 C CE  . LYS C 2 62  ? 63.581 33.406  -5.707  1.00 16.03 ? 738  LYS D CE  1 
ATOM   6997 N NZ  . LYS C 2 62  ? 63.722 34.487  -6.725  1.00 13.38 ? 738  LYS D NZ  1 
ATOM   6998 N N   . ARG C 2 63  ? 56.700 31.852  -5.822  1.00 17.50 ? 739  ARG D N   1 
ATOM   6999 C CA  . ARG C 2 63  ? 55.367 31.375  -6.222  1.00 17.33 ? 739  ARG D CA  1 
ATOM   7000 C C   . ARG C 2 63  ? 55.012 31.856  -7.612  1.00 17.81 ? 739  ARG D C   1 
ATOM   7001 O O   . ARG C 2 63  ? 55.322 32.998  -7.958  1.00 17.21 ? 739  ARG D O   1 
ATOM   7002 C CB  . ARG C 2 63  ? 54.323 31.938  -5.262  1.00 16.97 ? 739  ARG D CB  1 
ATOM   7003 C CG  . ARG C 2 63  ? 54.548 31.609  -3.789  1.00 16.79 ? 739  ARG D CG  1 
ATOM   7004 C CD  . ARG C 2 63  ? 53.724 32.521  -2.885  1.00 15.25 ? 739  ARG D CD  1 
ATOM   7005 N NE  . ARG C 2 63  ? 54.138 33.913  -3.068  1.00 12.68 ? 739  ARG D NE  1 
ATOM   7006 C CZ  . ARG C 2 63  ? 53.329 34.918  -3.389  1.00 12.88 ? 739  ARG D CZ  1 
ATOM   7007 N NH1 . ARG C 2 63  ? 52.015 34.739  -3.529  1.00 10.71 ? 739  ARG D NH1 1 
ATOM   7008 N NH2 . ARG C 2 63  ? 53.856 36.129  -3.558  1.00 13.91 ? 739  ARG D NH2 1 
ATOM   7009 N N   . ASP C 2 64  ? 54.369 31.020  -8.429  1.00 18.99 ? 740  ASP D N   1 
ATOM   7010 C CA  . ASP C 2 64  ? 53.962 31.502  -9.766  1.00 19.86 ? 740  ASP D CA  1 
ATOM   7011 C C   . ASP C 2 64  ? 52.469 31.845  -9.868  1.00 20.10 ? 740  ASP D C   1 
ATOM   7012 O O   . ASP C 2 64  ? 51.755 31.771  -8.871  1.00 20.43 ? 740  ASP D O   1 
ATOM   7013 C CB  . ASP C 2 64  ? 54.501 30.637  -10.953 1.00 20.90 ? 740  ASP D CB  1 
ATOM   7014 C CG  . ASP C 2 64  ? 54.212 29.163  -10.823 1.00 23.08 ? 740  ASP D CG  1 
ATOM   7015 O OD1 . ASP C 2 64  ? 53.296 28.778  -10.055 1.00 27.35 ? 740  ASP D OD1 1 
ATOM   7016 O OD2 . ASP C 2 64  ? 54.905 28.386  -11.539 1.00 26.30 ? 740  ASP D OD2 1 
ATOM   7017 N N   . SER C 2 65  ? 52.034 32.287  -11.052 1.00 20.64 ? 741  SER D N   1 
ATOM   7018 C CA  . SER C 2 65  ? 50.629 32.604  -11.324 1.00 20.75 ? 741  SER D CA  1 
ATOM   7019 C C   . SER C 2 65  ? 49.671 31.586  -10.698 1.00 20.97 ? 741  SER D C   1 
ATOM   7020 O O   . SER C 2 65  ? 48.449 31.698  -10.829 1.00 21.46 ? 741  SER D O   1 
ATOM   7021 C CB  . SER C 2 65  ? 50.395 32.667  -12.834 1.00 21.02 ? 741  SER D CB  1 
ATOM   7022 O OG  . SER C 2 65  ? 51.381 33.457  -13.484 1.00 21.32 ? 741  SER D OG  1 
ATOM   7023 N N   . GLN C 2 72  ? 40.726 34.962  -17.963 1.00 61.49 ? 748  GLN D N   1 
ATOM   7024 C CA  . GLN C 2 72  ? 42.010 35.661  -17.999 1.00 61.62 ? 748  GLN D CA  1 
ATOM   7025 C C   . GLN C 2 72  ? 42.157 36.498  -19.282 1.00 61.46 ? 748  GLN D C   1 
ATOM   7026 O O   . GLN C 2 72  ? 42.347 37.715  -19.211 1.00 61.70 ? 748  GLN D O   1 
ATOM   7027 C CB  . GLN C 2 72  ? 43.162 34.662  -17.858 1.00 61.81 ? 748  GLN D CB  1 
ATOM   7028 C CG  . GLN C 2 72  ? 43.034 33.727  -16.644 1.00 62.25 ? 748  GLN D CG  1 
ATOM   7029 C CD  . GLN C 2 72  ? 44.385 33.206  -16.140 1.00 62.52 ? 748  GLN D CD  1 
ATOM   7030 O OE1 . GLN C 2 72  ? 45.348 33.071  -16.910 1.00 63.87 ? 748  GLN D OE1 1 
ATOM   7031 N NE2 . GLN C 2 72  ? 44.460 32.916  -14.840 1.00 62.47 ? 748  GLN D NE2 1 
ATOM   7032 N N   . THR C 2 73  ? 42.094 35.834  -20.439 1.00 61.00 ? 749  THR D N   1 
ATOM   7033 C CA  . THR C 2 73  ? 41.879 36.486  -21.744 1.00 60.53 ? 749  THR D CA  1 
ATOM   7034 C C   . THR C 2 73  ? 40.984 35.585  -22.606 1.00 60.25 ? 749  THR D C   1 
ATOM   7035 O O   . THR C 2 73  ? 40.749 34.424  -22.254 1.00 60.27 ? 749  THR D O   1 
ATOM   7036 C CB  . THR C 2 73  ? 43.203 36.807  -22.504 1.00 60.52 ? 749  THR D CB  1 
ATOM   7037 O OG1 . THR C 2 73  ? 44.142 35.735  -22.346 1.00 60.32 ? 749  THR D OG1 1 
ATOM   7038 C CG2 . THR C 2 73  ? 43.818 38.087  -21.983 1.00 60.43 ? 749  THR D CG2 1 
ATOM   7039 N N   . ALA C 2 74  ? 40.478 36.119  -23.718 1.00 59.71 ? 750  ALA D N   1 
ATOM   7040 C CA  . ALA C 2 74  ? 39.570 35.363  -24.591 1.00 59.30 ? 750  ALA D CA  1 
ATOM   7041 C C   . ALA C 2 74  ? 40.284 34.172  -25.255 1.00 58.97 ? 750  ALA D C   1 
ATOM   7042 O O   . ALA C 2 74  ? 41.103 34.344  -26.170 1.00 58.95 ? 750  ALA D O   1 
ATOM   7043 C CB  . ALA C 2 74  ? 38.944 36.276  -25.649 1.00 59.25 ? 750  ALA D CB  1 
ATOM   7044 N N   . THR C 2 75  ? 39.953 32.971  -24.779 1.00 58.32 ? 751  THR D N   1 
ATOM   7045 C CA  . THR C 2 75  ? 40.524 31.718  -25.281 1.00 57.72 ? 751  THR D CA  1 
ATOM   7046 C C   . THR C 2 75  ? 40.070 31.383  -26.715 1.00 57.15 ? 751  THR D C   1 
ATOM   7047 O O   . THR C 2 75  ? 40.746 30.648  -27.437 1.00 56.77 ? 751  THR D O   1 
ATOM   7048 C CB  . THR C 2 75  ? 40.181 30.545  -24.316 1.00 57.72 ? 751  THR D CB  1 
ATOM   7049 O OG1 . THR C 2 75  ? 41.028 29.426  -24.592 1.00 57.80 ? 751  THR D OG1 1 
ATOM   7050 C CG2 . THR C 2 75  ? 38.709 30.131  -24.429 1.00 57.47 ? 751  THR D CG2 1 
ATOM   7051 N N   . LYS C 2 76  ? 38.922 31.926  -27.109 1.00 56.60 ? 752  LYS D N   1 
ATOM   7052 C CA  . LYS C 2 76  ? 38.400 31.784  -28.464 1.00 56.26 ? 752  LYS D CA  1 
ATOM   7053 C C   . LYS C 2 76  ? 37.878 33.122  -28.956 1.00 55.91 ? 752  LYS D C   1 
ATOM   7054 O O   . LYS C 2 76  ? 37.684 34.049  -28.168 1.00 55.79 ? 752  LYS D O   1 
ATOM   7055 C CB  . LYS C 2 76  ? 37.271 30.754  -28.491 1.00 56.08 ? 752  LYS D CB  1 
ATOM   7056 C CG  . LYS C 2 76  ? 37.742 29.321  -28.360 1.00 55.92 ? 752  LYS D CG  1 
ATOM   7057 C CD  . LYS C 2 76  ? 36.583 28.391  -28.097 1.00 56.04 ? 752  LYS D CD  1 
ATOM   7058 C CE  . LYS C 2 76  ? 37.000 26.941  -28.214 1.00 55.84 ? 752  LYS D CE  1 
ATOM   7059 N NZ  . LYS C 2 76  ? 35.853 26.024  -27.978 1.00 55.73 ? 752  LYS D NZ  1 
ATOM   7060 N N   . ARG C 2 77  ? 37.655 33.221  -30.263 1.00 55.59 ? 753  ARG D N   1 
ATOM   7061 C CA  . ARG C 2 77  ? 37.037 34.413  -30.836 1.00 55.48 ? 753  ARG D CA  1 
ATOM   7062 C C   . ARG C 2 77  ? 36.413 34.153  -32.207 1.00 55.32 ? 753  ARG D C   1 
ATOM   7063 O O   . ARG C 2 77  ? 36.702 33.148  -32.853 1.00 55.32 ? 753  ARG D O   1 
ATOM   7064 C CB  . ARG C 2 77  ? 38.027 35.583  -30.876 1.00 55.43 ? 753  ARG D CB  1 
ATOM   7065 C CG  . ARG C 2 77  ? 39.451 35.219  -31.188 1.00 55.26 ? 753  ARG D CG  1 
ATOM   7066 C CD  . ARG C 2 77  ? 40.372 36.417  -30.986 1.00 55.43 ? 753  ARG D CD  1 
ATOM   7067 N NE  . ARG C 2 77  ? 41.308 36.552  -32.100 1.00 55.75 ? 753  ARG D NE  1 
ATOM   7068 C CZ  . ARG C 2 77  ? 41.020 37.104  -33.281 1.00 55.68 ? 753  ARG D CZ  1 
ATOM   7069 N NH1 . ARG C 2 77  ? 39.813 37.611  -33.532 1.00 55.80 ? 753  ARG D NH1 1 
ATOM   7070 N NH2 . ARG C 2 77  ? 41.953 37.155  -34.223 1.00 55.15 ? 753  ARG D NH2 1 
ATOM   7071 N N   . ILE C 2 78  ? 35.555 35.080  -32.628 1.00 55.18 ? 754  ILE D N   1 
ATOM   7072 C CA  . ILE C 2 78  ? 34.656 34.883  -33.763 1.00 55.09 ? 754  ILE D CA  1 
ATOM   7073 C C   . ILE C 2 78  ? 34.895 35.973  -34.799 1.00 54.98 ? 754  ILE D C   1 
ATOM   7074 O O   . ILE C 2 78  ? 35.060 37.141  -34.440 1.00 54.96 ? 754  ILE D O   1 
ATOM   7075 C CB  . ILE C 2 78  ? 33.168 34.964  -33.322 1.00 55.04 ? 754  ILE D CB  1 
ATOM   7076 C CG1 . ILE C 2 78  ? 33.005 34.602  -31.838 1.00 55.27 ? 754  ILE D CG1 1 
ATOM   7077 C CG2 . ILE C 2 78  ? 32.308 34.069  -34.192 1.00 54.74 ? 754  ILE D CG2 1 
ATOM   7078 C CD1 . ILE C 2 78  ? 31.569 34.650  -31.336 1.00 55.33 ? 754  ILE D CD1 1 
ATOM   7079 N N   . ARG C 2 79  ? 34.922 35.597  -36.076 1.00 54.83 ? 755  ARG D N   1 
ATOM   7080 C CA  . ARG C 2 79  ? 35.000 36.582  -37.154 1.00 54.83 ? 755  ARG D CA  1 
ATOM   7081 C C   . ARG C 2 79  ? 33.592 37.001  -37.558 1.00 54.90 ? 755  ARG D C   1 
ATOM   7082 O O   . ARG C 2 79  ? 32.675 36.183  -37.549 1.00 54.96 ? 755  ARG D O   1 
ATOM   7083 C CB  . ARG C 2 79  ? 35.750 36.040  -38.371 1.00 54.69 ? 755  ARG D CB  1 
ATOM   7084 C CG  . ARG C 2 79  ? 35.888 37.086  -39.475 1.00 54.61 ? 755  ARG D CG  1 
ATOM   7085 C CD  . ARG C 2 79  ? 36.858 36.693  -40.570 1.00 54.32 ? 755  ARG D CD  1 
ATOM   7086 N NE  . ARG C 2 79  ? 36.872 37.694  -41.635 1.00 53.77 ? 755  ARG D NE  1 
ATOM   7087 C CZ  . ARG C 2 79  ? 37.833 37.833  -42.547 1.00 53.38 ? 755  ARG D CZ  1 
ATOM   7088 N NH1 . ARG C 2 79  ? 38.900 37.041  -42.555 1.00 53.04 ? 755  ARG D NH1 1 
ATOM   7089 N NH2 . ARG C 2 79  ? 37.726 38.785  -43.463 1.00 53.49 ? 755  ARG D NH2 1 
ATOM   7090 N N   . MET C 2 80  ? 33.431 38.277  -37.911 1.00 54.98 ? 756  MET D N   1 
ATOM   7091 C CA  . MET C 2 80  ? 32.124 38.838  -38.256 1.00 55.08 ? 756  MET D CA  1 
ATOM   7092 C C   . MET C 2 80  ? 32.270 39.881  -39.356 1.00 55.11 ? 756  MET D C   1 
ATOM   7093 O O   . MET C 2 80  ? 33.282 40.576  -39.422 1.00 55.14 ? 756  MET D O   1 
ATOM   7094 C CB  . MET C 2 80  ? 31.484 39.480  -37.024 1.00 55.16 ? 756  MET D CB  1 
ATOM   7095 C CG  . MET C 2 80  ? 31.630 38.661  -35.746 1.00 55.26 ? 756  MET D CG  1 
ATOM   7096 S SD  . MET C 2 80  ? 30.728 39.340  -34.348 1.00 55.36 ? 756  MET D SD  1 
ATOM   7097 C CE  . MET C 2 80  ? 31.727 38.729  -32.986 1.00 55.35 ? 756  MET D CE  1 
ATOM   7098 N N   . VAL D 2 10  ? 46.497 47.182  43.033  1.00 31.14 ? 686  VAL E N   1 
ATOM   7099 C CA  . VAL D 2 10  ? 45.086 47.589  42.771  1.00 31.06 ? 686  VAL E CA  1 
ATOM   7100 C C   . VAL D 2 10  ? 44.958 49.118  42.734  1.00 31.09 ? 686  VAL E C   1 
ATOM   7101 O O   . VAL D 2 10  ? 45.045 49.729  41.661  1.00 31.03 ? 686  VAL E O   1 
ATOM   7102 C CB  . VAL D 2 10  ? 44.108 46.970  43.816  1.00 31.19 ? 686  VAL E CB  1 
ATOM   7103 C CG1 . VAL D 2 10  ? 43.650 45.585  43.371  1.00 31.10 ? 686  VAL E CG1 1 
ATOM   7104 C CG2 . VAL D 2 10  ? 44.752 46.905  45.205  1.00 31.28 ? 686  VAL E CG2 1 
ATOM   7105 N N   . GLU D 2 11  ? 44.774 49.728  43.906  1.00 30.95 ? 687  GLU E N   1 
ATOM   7106 C CA  . GLU D 2 11  ? 44.610 51.178  44.022  1.00 30.74 ? 687  GLU E CA  1 
ATOM   7107 C C   . GLU D 2 11  ? 45.950 51.905  43.884  1.00 30.35 ? 687  GLU E C   1 
ATOM   7108 O O   . GLU D 2 11  ? 46.072 52.849  43.102  1.00 30.49 ? 687  GLU E O   1 
ATOM   7109 C CB  . GLU D 2 11  ? 43.966 51.515  45.372  1.00 30.83 ? 687  GLU E CB  1 
ATOM   7110 C CG  . GLU D 2 11  ? 43.697 52.997  45.613  1.00 31.02 ? 687  GLU E CG  1 
ATOM   7111 C CD  . GLU D 2 11  ? 43.161 53.246  47.010  1.00 31.46 ? 687  GLU E CD  1 
ATOM   7112 O OE1 . GLU D 2 11  ? 43.791 54.019  47.765  1.00 32.72 ? 687  GLU E OE1 1 
ATOM   7113 O OE2 . GLU D 2 11  ? 42.124 52.644  47.365  1.00 32.17 ? 687  GLU E OE2 1 
ATOM   7114 N N   . SER D 2 12  ? 46.944 51.461  44.652  1.00 29.85 ? 688  SER E N   1 
ATOM   7115 C CA  . SER D 2 12  ? 48.272 52.087  44.664  1.00 29.34 ? 688  SER E CA  1 
ATOM   7116 C C   . SER D 2 12  ? 49.098 51.787  43.404  1.00 28.81 ? 688  SER E C   1 
ATOM   7117 O O   . SER D 2 12  ? 50.036 52.519  43.096  1.00 28.89 ? 688  SER E O   1 
ATOM   7118 C CB  . SER D 2 12  ? 49.049 51.673  45.923  1.00 29.48 ? 688  SER E CB  1 
ATOM   7119 O OG  . SER D 2 12  ? 49.066 50.266  46.077  1.00 29.18 ? 688  SER E OG  1 
ATOM   7120 N N   . ALA D 2 13  ? 48.752 50.721  42.681  1.00 28.06 ? 689  ALA E N   1 
ATOM   7121 C CA  . ALA D 2 13  ? 49.351 50.448  41.362  1.00 27.46 ? 689  ALA E CA  1 
ATOM   7122 C C   . ALA D 2 13  ? 48.933 51.507  40.331  1.00 26.87 ? 689  ALA E C   1 
ATOM   7123 O O   . ALA D 2 13  ? 49.684 51.800  39.400  1.00 26.97 ? 689  ALA E O   1 
ATOM   7124 C CB  . ALA D 2 13  ? 48.974 49.051  40.874  1.00 27.47 ? 689  ALA E CB  1 
ATOM   7125 N N   . VAL D 2 14  ? 47.735 52.071  40.510  1.00 26.01 ? 690  VAL E N   1 
ATOM   7126 C CA  . VAL D 2 14  ? 47.255 53.192  39.697  1.00 25.15 ? 690  VAL E CA  1 
ATOM   7127 C C   . VAL D 2 14  ? 47.815 54.496  40.262  1.00 24.47 ? 690  VAL E C   1 
ATOM   7128 O O   . VAL D 2 14  ? 48.436 55.276  39.533  1.00 24.32 ? 690  VAL E O   1 
ATOM   7129 C CB  . VAL D 2 14  ? 45.697 53.256  39.654  1.00 25.13 ? 690  VAL E CB  1 
ATOM   7130 C CG1 . VAL D 2 14  ? 45.211 54.485  38.910  1.00 24.99 ? 690  VAL E CG1 1 
ATOM   7131 C CG2 . VAL D 2 14  ? 45.129 52.009  39.003  1.00 25.27 ? 690  VAL E CG2 1 
ATOM   7132 N N   . LEU D 2 15  ? 47.619 54.711  41.565  1.00 23.43 ? 691  LEU E N   1 
ATOM   7133 C CA  . LEU D 2 15  ? 48.030 55.963  42.211  1.00 22.70 ? 691  LEU E CA  1 
ATOM   7134 C C   . LEU D 2 15  ? 49.547 56.183  42.189  1.00 21.73 ? 691  LEU E C   1 
ATOM   7135 O O   . LEU D 2 15  ? 50.003 57.316  42.259  1.00 21.77 ? 691  LEU E O   1 
ATOM   7136 C CB  . LEU D 2 15  ? 47.467 56.071  43.641  1.00 22.75 ? 691  LEU E CB  1 
ATOM   7137 C CG  . LEU D 2 15  ? 45.944 56.271  43.747  1.00 23.00 ? 691  LEU E CG  1 
ATOM   7138 C CD1 . LEU D 2 15  ? 45.516 56.470  45.187  1.00 23.39 ? 691  LEU E CD1 1 
ATOM   7139 C CD2 . LEU D 2 15  ? 45.456 57.438  42.901  1.00 22.56 ? 691  LEU E CD2 1 
ATOM   7140 N N   . ARG D 2 16  ? 50.329 55.120  42.053  1.00 20.76 ? 692  ARG E N   1 
ATOM   7141 C CA  . ARG D 2 16  ? 51.761 55.276  41.823  1.00 20.12 ? 692  ARG E CA  1 
ATOM   7142 C C   . ARG D 2 16  ? 52.039 56.386  40.800  1.00 19.33 ? 692  ARG E C   1 
ATOM   7143 O O   . ARG D 2 16  ? 52.948 57.199  41.000  1.00 19.75 ? 692  ARG E O   1 
ATOM   7144 C CB  . ARG D 2 16  ? 52.379 53.972  41.328  1.00 20.29 ? 692  ARG E CB  1 
ATOM   7145 C CG  . ARG D 2 16  ? 53.828 54.107  40.851  1.00 20.84 ? 692  ARG E CG  1 
ATOM   7146 C CD  . ARG D 2 16  ? 54.387 52.762  40.402  1.00 21.05 ? 692  ARG E CD  1 
ATOM   7147 N NE  . ARG D 2 16  ? 55.787 52.854  39.968  1.00 21.61 ? 692  ARG E NE  1 
ATOM   7148 C CZ  . ARG D 2 16  ? 56.826 52.241  40.552  1.00 22.16 ? 692  ARG E CZ  1 
ATOM   7149 N NH1 . ARG D 2 16  ? 56.673 51.454  41.618  1.00 22.11 ? 692  ARG E NH1 1 
ATOM   7150 N NH2 . ARG D 2 16  ? 58.044 52.415  40.061  1.00 22.25 ? 692  ARG E NH2 1 
ATOM   7151 N N   . GLY D 2 17  ? 51.272 56.400  39.708  1.00 17.34 ? 693  GLY E N   1 
ATOM   7152 C CA  . GLY D 2 17  ? 51.479 57.361  38.628  1.00 16.46 ? 693  GLY E CA  1 
ATOM   7153 C C   . GLY D 2 17  ? 50.771 58.696  38.741  1.00 14.74 ? 693  GLY E C   1 
ATOM   7154 O O   . GLY D 2 17  ? 50.662 59.408  37.750  1.00 13.74 ? 693  GLY E O   1 
ATOM   7155 N N   . PHE D 2 18  ? 50.317 59.054  39.943  1.00 14.19 ? 694  PHE E N   1 
ATOM   7156 C CA  . PHE D 2 18  ? 49.540 60.288  40.168  1.00 13.69 ? 694  PHE E CA  1 
ATOM   7157 C C   . PHE D 2 18  ? 50.057 61.018  41.371  1.00 13.13 ? 694  PHE E C   1 
ATOM   7158 O O   . PHE D 2 18  ? 50.236 60.397  42.411  1.00 13.13 ? 694  PHE E O   1 
ATOM   7159 C CB  . PHE D 2 18  ? 48.077 59.955  40.430  1.00 13.93 ? 694  PHE E CB  1 
ATOM   7160 C CG  . PHE D 2 18  ? 47.336 59.506  39.225  1.00 14.53 ? 694  PHE E CG  1 
ATOM   7161 C CD1 . PHE D 2 18  ? 47.375 58.184  38.837  1.00 14.50 ? 694  PHE E CD1 1 
ATOM   7162 C CD2 . PHE D 2 18  ? 46.586 60.404  38.480  1.00 15.12 ? 694  PHE E CD2 1 
ATOM   7163 C CE1 . PHE D 2 18  ? 46.699 57.757  37.719  1.00 14.12 ? 694  PHE E CE1 1 
ATOM   7164 C CE2 . PHE D 2 18  ? 45.915 59.978  37.360  1.00 13.23 ? 694  PHE E CE2 1 
ATOM   7165 C CZ  . PHE D 2 18  ? 45.976 58.664  36.979  1.00 13.73 ? 694  PHE E CZ  1 
ATOM   7166 N N   . LEU D 2 19  ? 50.310 62.319  41.248  1.00 12.98 ? 695  LEU E N   1 
ATOM   7167 C CA  . LEU D 2 19  ? 50.696 63.149  42.385  1.00 13.06 ? 695  LEU E CA  1 
ATOM   7168 C C   . LEU D 2 19  ? 49.458 63.659  43.087  1.00 13.06 ? 695  LEU E C   1 
ATOM   7169 O O   . LEU D 2 19  ? 48.590 64.289  42.452  1.00 12.26 ? 695  LEU E O   1 
ATOM   7170 C CB  . LEU D 2 19  ? 51.531 64.335  41.924  1.00 13.53 ? 695  LEU E CB  1 
ATOM   7171 C CG  . LEU D 2 19  ? 51.970 65.383  42.951  1.00 13.67 ? 695  LEU E CG  1 
ATOM   7172 C CD1 . LEU D 2 19  ? 52.562 64.740  44.157  1.00 15.62 ? 695  LEU E CD1 1 
ATOM   7173 C CD2 . LEU D 2 19  ? 52.990 66.338  42.343  1.00 14.24 ? 695  LEU E CD2 1 
ATOM   7174 N N   . ILE D 2 20  ? 49.357 63.364  44.386  1.00 12.57 ? 696  ILE E N   1 
ATOM   7175 C CA  . ILE D 2 20  ? 48.214 63.816  45.188  1.00 12.91 ? 696  ILE E CA  1 
ATOM   7176 C C   . ILE D 2 20  ? 48.479 65.256  45.619  1.00 12.86 ? 696  ILE E C   1 
ATOM   7177 O O   . ILE D 2 20  ? 49.458 65.523  46.297  1.00 14.07 ? 696  ILE E O   1 
ATOM   7178 C CB  . ILE D 2 20  ? 48.007 62.917  46.429  1.00 12.82 ? 696  ILE E CB  1 
ATOM   7179 C CG1 . ILE D 2 20  ? 47.726 61.471  45.992  1.00 13.50 ? 696  ILE E CG1 1 
ATOM   7180 C CG2 . ILE D 2 20  ? 46.878 63.456  47.302  1.00 12.13 ? 696  ILE E CG2 1 
ATOM   7181 C CD1 . ILE D 2 20  ? 47.776 60.475  47.118  1.00 13.15 ? 696  ILE E CD1 1 
ATOM   7182 N N   . LEU D 2 21  ? 47.614 66.178  45.216  1.00 13.03 ? 697  LEU E N   1 
ATOM   7183 C CA  . LEU D 2 21  ? 47.838 67.608  45.417  1.00 12.60 ? 697  LEU E CA  1 
ATOM   7184 C C   . LEU D 2 21  ? 47.225 68.123  46.713  1.00 12.84 ? 697  LEU E C   1 
ATOM   7185 O O   . LEU D 2 21  ? 47.762 69.044  47.338  1.00 13.36 ? 697  LEU E O   1 
ATOM   7186 C CB  . LEU D 2 21  ? 47.272 68.379  44.234  1.00 12.54 ? 697  LEU E CB  1 
ATOM   7187 C CG  . LEU D 2 21  ? 47.915 68.030  42.895  1.00 11.81 ? 697  LEU E CG  1 
ATOM   7188 C CD1 . LEU D 2 21  ? 46.969 68.430  41.799  1.00 11.47 ? 697  LEU E CD1 1 
ATOM   7189 C CD2 . LEU D 2 21  ? 49.262 68.739  42.771  1.00 10.59 ? 697  LEU E CD2 1 
ATOM   7190 N N   . GLY D 2 22  ? 46.112 67.520  47.120  1.00 12.47 ? 698  GLY E N   1 
ATOM   7191 C CA  . GLY D 2 22  ? 45.468 67.848  48.385  1.00 12.15 ? 698  GLY E CA  1 
ATOM   7192 C C   . GLY D 2 22  ? 44.098 67.203  48.484  1.00 11.97 ? 698  GLY E C   1 
ATOM   7193 O O   . GLY D 2 22  ? 43.816 66.254  47.778  1.00 11.41 ? 698  GLY E O   1 
ATOM   7194 N N   . LYS D 2 23  ? 43.247 67.712  49.364  1.00 12.21 ? 699  LYS E N   1 
ATOM   7195 C CA  . LYS D 2 23  ? 41.927 67.134  49.562  1.00 12.83 ? 699  LYS E CA  1 
ATOM   7196 C C   . LYS D 2 23  ? 40.998 67.638  48.468  1.00 13.04 ? 699  LYS E C   1 
ATOM   7197 O O   . LYS D 2 23  ? 41.388 68.490  47.665  1.00 12.50 ? 699  LYS E O   1 
ATOM   7198 C CB  . LYS D 2 23  ? 41.381 67.487  50.958  1.00 12.82 ? 699  LYS E CB  1 
ATOM   7199 C CG  . LYS D 2 23  ? 42.146 66.835  52.108  1.00 12.77 ? 699  LYS E CG  1 
ATOM   7200 C CD  . LYS D 2 23  ? 41.769 67.444  53.458  1.00 13.39 ? 699  LYS E CD  1 
ATOM   7201 C CE  . LYS D 2 23  ? 42.552 66.811  54.614  1.00 13.60 ? 699  LYS E CE  1 
ATOM   7202 N NZ  . LYS D 2 23  ? 41.992 67.192  55.954  1.00 13.90 ? 699  LYS E NZ  1 
ATOM   7203 N N   . GLU D 2 24  ? 39.771 67.112  48.444  1.00 13.60 ? 700  GLU E N   1 
ATOM   7204 C CA  . GLU D 2 24  ? 38.791 67.480  47.429  1.00 14.01 ? 700  GLU E CA  1 
ATOM   7205 C C   . GLU D 2 24  ? 38.769 69.002  47.240  1.00 14.57 ? 700  GLU E C   1 
ATOM   7206 O O   . GLU D 2 24  ? 38.656 69.762  48.205  1.00 14.09 ? 700  GLU E O   1 
ATOM   7207 C CB  . GLU D 2 24  ? 37.384 66.965  47.807  1.00 14.43 ? 700  GLU E CB  1 
ATOM   7208 C CG  . GLU D 2 24  ? 36.236 67.502  46.923  1.00 13.72 ? 700  GLU E CG  1 
ATOM   7209 C CD  . GLU D 2 24  ? 35.032 66.556  46.820  1.00 14.72 ? 700  GLU E CD  1 
ATOM   7210 O OE1 . GLU D 2 24  ? 34.527 66.363  45.683  1.00 15.04 ? 700  GLU E OE1 1 
ATOM   7211 O OE2 . GLU D 2 24  ? 34.578 66.025  47.867  1.00 15.54 ? 700  GLU E OE2 1 
ATOM   7212 N N   . ASP D 2 25  ? 38.908 69.422  45.987  1.00 15.14 ? 701  ASP E N   1 
ATOM   7213 C CA  . ASP D 2 25  ? 38.763 70.816  45.574  1.00 15.34 ? 701  ASP E CA  1 
ATOM   7214 C C   . ASP D 2 25  ? 37.537 70.851  44.656  1.00 15.74 ? 701  ASP E C   1 
ATOM   7215 O O   . ASP D 2 25  ? 37.614 70.457  43.490  1.00 15.55 ? 701  ASP E O   1 
ATOM   7216 C CB  . ASP D 2 25  ? 40.045 71.232  44.838  1.00 15.38 ? 701  ASP E CB  1 
ATOM   7217 C CG  . ASP D 2 25  ? 40.138 72.723  44.578  1.00 15.46 ? 701  ASP E CG  1 
ATOM   7218 O OD1 . ASP D 2 25  ? 39.107 73.417  44.580  1.00 12.85 ? 701  ASP E OD1 1 
ATOM   7219 O OD2 . ASP D 2 25  ? 41.275 73.195  44.345  1.00 17.85 ? 701  ASP E OD2 1 
ATOM   7220 N N   . ARG D 2 26  ? 36.397 71.306  45.177  1.00 16.35 ? 702  ARG E N   1 
ATOM   7221 C CA  . ARG D 2 26  ? 35.118 71.155  44.459  1.00 16.93 ? 702  ARG E CA  1 
ATOM   7222 C C   . ARG D 2 26  ? 35.074 71.786  43.062  1.00 17.25 ? 702  ARG E C   1 
ATOM   7223 O O   . ARG D 2 26  ? 34.243 71.393  42.239  1.00 17.44 ? 702  ARG E O   1 
ATOM   7224 C CB  . ARG D 2 26  ? 33.933 71.665  45.297  1.00 17.07 ? 702  ARG E CB  1 
ATOM   7225 C CG  . ARG D 2 26  ? 33.512 70.699  46.402  1.00 17.56 ? 702  ARG E CG  1 
ATOM   7226 C CD  . ARG D 2 26  ? 32.070 70.916  46.846  1.00 18.17 ? 702  ARG E CD  1 
ATOM   7227 N NE  . ARG D 2 26  ? 31.764 70.156  48.059  1.00 18.85 ? 702  ARG E NE  1 
ATOM   7228 C CZ  . ARG D 2 26  ? 30.712 70.364  48.854  1.00 19.94 ? 702  ARG E CZ  1 
ATOM   7229 N NH1 . ARG D 2 26  ? 29.821 71.321  48.587  1.00 21.07 ? 702  ARG E NH1 1 
ATOM   7230 N NH2 . ARG D 2 26  ? 30.545 69.607  49.936  1.00 19.90 ? 702  ARG E NH2 1 
ATOM   7231 N N   . ARG D 2 27  ? 35.964 72.737  42.785  1.00 17.35 ? 703  ARG E N   1 
ATOM   7232 C CA  . ARG D 2 27  ? 35.942 73.444  41.500  1.00 17.46 ? 703  ARG E CA  1 
ATOM   7233 C C   . ARG D 2 27  ? 36.562 72.683  40.329  1.00 17.54 ? 703  ARG E C   1 
ATOM   7234 O O   . ARG D 2 27  ? 36.623 73.209  39.218  1.00 17.98 ? 703  ARG E O   1 
ATOM   7235 C CB  . ARG D 2 27  ? 36.593 74.820  41.639  1.00 17.90 ? 703  ARG E CB  1 
ATOM   7236 C CG  . ARG D 2 27  ? 38.092 74.814  41.809  1.00 17.50 ? 703  ARG E CG  1 
ATOM   7237 C CD  . ARG D 2 27  ? 38.545 76.034  42.628  1.00 18.02 ? 703  ARG E CD  1 
ATOM   7238 N NE  . ARG D 2 27  ? 39.936 75.884  43.032  1.00 18.37 ? 703  ARG E NE  1 
ATOM   7239 C CZ  . ARG D 2 27  ? 40.763 76.880  43.324  1.00 18.22 ? 703  ARG E CZ  1 
ATOM   7240 N NH1 . ARG D 2 27  ? 40.370 78.147  43.262  1.00 18.66 ? 703  ARG E NH1 1 
ATOM   7241 N NH2 . ARG D 2 27  ? 42.007 76.587  43.670  1.00 19.04 ? 703  ARG E NH2 1 
ATOM   7242 N N   . TYR D 2 28  ? 37.009 71.455  40.574  1.00 17.11 ? 704  TYR E N   1 
ATOM   7243 C CA  . TYR D 2 28  ? 37.487 70.571  39.518  1.00 17.11 ? 704  TYR E CA  1 
ATOM   7244 C C   . TYR D 2 28  ? 36.517 69.416  39.237  1.00 17.16 ? 704  TYR E C   1 
ATOM   7245 O O   . TYR D 2 28  ? 36.905 68.406  38.645  1.00 17.41 ? 704  TYR E O   1 
ATOM   7246 C CB  . TYR D 2 28  ? 38.860 70.018  39.893  1.00 16.24 ? 704  TYR E CB  1 
ATOM   7247 C CG  . TYR D 2 28  ? 39.969 71.045  39.845  1.00 15.96 ? 704  TYR E CG  1 
ATOM   7248 C CD1 . TYR D 2 28  ? 40.380 71.715  40.996  1.00 15.48 ? 704  TYR E CD1 1 
ATOM   7249 C CD2 . TYR D 2 28  ? 40.610 71.344  38.649  1.00 14.19 ? 704  TYR E CD2 1 
ATOM   7250 C CE1 . TYR D 2 28  ? 41.408 72.652  40.948  1.00 15.83 ? 704  TYR E CE1 1 
ATOM   7251 C CE2 . TYR D 2 28  ? 41.623 72.282  38.591  1.00 14.60 ? 704  TYR E CE2 1 
ATOM   7252 C CZ  . TYR D 2 28  ? 42.027 72.927  39.739  1.00 15.21 ? 704  TYR E CZ  1 
ATOM   7253 O OH  . TYR D 2 28  ? 43.043 73.854  39.671  1.00 15.06 ? 704  TYR E OH  1 
ATOM   7254 N N   . GLY D 2 29  ? 35.269 69.565  39.676  1.00 17.40 ? 705  GLY E N   1 
ATOM   7255 C CA  . GLY D 2 29  ? 34.194 68.628  39.345  1.00 17.59 ? 705  GLY E CA  1 
ATOM   7256 C C   . GLY D 2 29  ? 33.945 67.542  40.377  1.00 17.70 ? 705  GLY E C   1 
ATOM   7257 O O   . GLY D 2 29  ? 34.700 67.423  41.344  1.00 17.86 ? 705  GLY E O   1 
ATOM   7258 N N   . PRO D 2 30  ? 32.864 66.756  40.189  1.00 17.87 ? 706  PRO E N   1 
ATOM   7259 C CA  . PRO D 2 30  ? 32.600 65.564  41.002  1.00 17.72 ? 706  PRO E CA  1 
ATOM   7260 C C   . PRO D 2 30  ? 33.737 64.542  40.951  1.00 17.80 ? 706  PRO E C   1 
ATOM   7261 O O   . PRO D 2 30  ? 34.532 64.541  40.011  1.00 18.11 ? 706  PRO E O   1 
ATOM   7262 C CB  . PRO D 2 30  ? 31.310 64.988  40.388  1.00 17.73 ? 706  PRO E CB  1 
ATOM   7263 C CG  . PRO D 2 30  ? 31.171 65.634  39.057  1.00 17.68 ? 706  PRO E CG  1 
ATOM   7264 C CD  . PRO D 2 30  ? 31.788 66.984  39.205  1.00 17.80 ? 706  PRO E CD  1 
ATOM   7265 N N   . ALA D 2 31  ? 33.814 63.689  41.972  1.00 17.69 ? 707  ALA E N   1 
ATOM   7266 C CA  . ALA D 2 31  ? 34.920 62.737  42.106  1.00 17.22 ? 707  ALA E CA  1 
ATOM   7267 C C   . ALA D 2 31  ? 34.821 61.604  41.087  1.00 17.14 ? 707  ALA E C   1 
ATOM   7268 O O   . ALA D 2 31  ? 33.720 61.120  40.780  1.00 16.84 ? 707  ALA E O   1 
ATOM   7269 C CB  . ALA D 2 31  ? 34.973 62.173  43.528  1.00 17.09 ? 707  ALA E CB  1 
ATOM   7270 N N   . LEU D 2 32  ? 35.981 61.212  40.555  1.00 16.99 ? 708  LEU E N   1 
ATOM   7271 C CA  . LEU D 2 32  ? 36.117 60.068  39.660  1.00 17.08 ? 708  LEU E CA  1 
ATOM   7272 C C   . LEU D 2 32  ? 36.376 58.804  40.477  1.00 17.30 ? 708  LEU E C   1 
ATOM   7273 O O   . LEU D 2 32  ? 36.759 58.887  41.643  1.00 17.38 ? 708  LEU E O   1 
ATOM   7274 C CB  . LEU D 2 32  ? 37.291 60.275  38.711  1.00 16.91 ? 708  LEU E CB  1 
ATOM   7275 C CG  . LEU D 2 32  ? 37.256 61.411  37.686  1.00 16.75 ? 708  LEU E CG  1 
ATOM   7276 C CD1 . LEU D 2 32  ? 38.606 61.506  36.988  1.00 16.25 ? 708  LEU E CD1 1 
ATOM   7277 C CD2 . LEU D 2 32  ? 36.147 61.209  36.672  1.00 16.46 ? 708  LEU E CD2 1 
ATOM   7278 N N   . SER D 2 33  ? 36.166 57.637  39.870  1.00 17.39 ? 709  SER E N   1 
ATOM   7279 C CA  . SER D 2 33  ? 36.577 56.379  40.490  1.00 17.49 ? 709  SER E CA  1 
ATOM   7280 C C   . SER D 2 33  ? 38.040 56.135  40.142  1.00 17.53 ? 709  SER E C   1 
ATOM   7281 O O   . SER D 2 33  ? 38.607 56.847  39.317  1.00 17.28 ? 709  SER E O   1 
ATOM   7282 C CB  . SER D 2 33  ? 35.722 55.216  39.994  1.00 17.89 ? 709  SER E CB  1 
ATOM   7283 O OG  . SER D 2 33  ? 36.217 54.700  38.770  1.00 18.47 ? 709  SER E OG  1 
ATOM   7284 N N   . ILE D 2 34  ? 38.649 55.133  40.764  1.00 17.51 ? 710  ILE E N   1 
ATOM   7285 C CA  . ILE D 2 34  ? 40.028 54.767  40.442  1.00 17.63 ? 710  ILE E CA  1 
ATOM   7286 C C   . ILE D 2 34  ? 40.113 54.266  38.990  1.00 17.72 ? 710  ILE E C   1 
ATOM   7287 O O   . ILE D 2 34  ? 41.120 54.469  38.309  1.00 17.94 ? 710  ILE E O   1 
ATOM   7288 C CB  . ILE D 2 34  ? 40.571 53.695  41.418  1.00 17.65 ? 710  ILE E CB  1 
ATOM   7289 C CG1 . ILE D 2 34  ? 40.650 54.250  42.848  1.00 17.76 ? 710  ILE E CG1 1 
ATOM   7290 C CG2 . ILE D 2 34  ? 41.941 53.201  40.979  1.00 17.63 ? 710  ILE E CG2 1 
ATOM   7291 C CD1 . ILE D 2 34  ? 41.721 55.295  43.052  1.00 16.92 ? 710  ILE E CD1 1 
ATOM   7292 N N   . ASN D 2 35  ? 39.040 53.636  38.515  1.00 17.84 ? 711  ASN E N   1 
ATOM   7293 C CA  . ASN D 2 35  ? 38.978 53.131  37.140  1.00 17.76 ? 711  ASN E CA  1 
ATOM   7294 C C   . ASN D 2 35  ? 38.823 54.217  36.062  1.00 17.68 ? 711  ASN E C   1 
ATOM   7295 O O   . ASN D 2 35  ? 39.300 54.034  34.941  1.00 18.14 ? 711  ASN E O   1 
ATOM   7296 C CB  . ASN D 2 35  ? 37.852 52.099  37.008  1.00 18.03 ? 711  ASN E CB  1 
ATOM   7297 C CG  . ASN D 2 35  ? 38.107 50.851  37.833  1.00 18.40 ? 711  ASN E CG  1 
ATOM   7298 O OD1 . ASN D 2 35  ? 39.143 50.193  37.689  1.00 18.85 ? 711  ASN E OD1 1 
ATOM   7299 N ND2 . ASN D 2 35  ? 37.158 50.515  38.701  1.00 18.89 ? 711  ASN E ND2 1 
ATOM   7300 N N   . GLU D 2 36  ? 38.157 55.327  36.393  1.00 17.21 ? 712  GLU E N   1 
ATOM   7301 C CA  . GLU D 2 36  ? 38.035 56.473  35.474  1.00 17.07 ? 712  GLU E CA  1 
ATOM   7302 C C   . GLU D 2 36  ? 39.337 57.281  35.396  1.00 16.43 ? 712  GLU E C   1 
ATOM   7303 O O   . GLU D 2 36  ? 39.531 58.119  34.509  1.00 16.01 ? 712  GLU E O   1 
ATOM   7304 C CB  . GLU D 2 36  ? 36.921 57.423  35.930  1.00 17.09 ? 712  GLU E CB  1 
ATOM   7305 C CG  . GLU D 2 36  ? 35.502 56.869  35.895  1.00 18.07 ? 712  GLU E CG  1 
ATOM   7306 C CD  . GLU D 2 36  ? 34.448 57.974  35.978  1.00 18.44 ? 712  GLU E CD  1 
ATOM   7307 O OE1 . GLU D 2 36  ? 33.635 57.980  36.935  1.00 19.23 ? 712  GLU E OE1 1 
ATOM   7308 O OE2 . GLU D 2 36  ? 34.444 58.848  35.080  1.00 20.97 ? 712  GLU E OE2 1 
ATOM   7309 N N   . LEU D 2 37  ? 40.222 57.021  36.347  1.00 15.96 ? 713  LEU E N   1 
ATOM   7310 C CA  . LEU D 2 37  ? 41.393 57.837  36.567  1.00 15.70 ? 713  LEU E CA  1 
ATOM   7311 C C   . LEU D 2 37  ? 42.400 57.734  35.426  1.00 15.36 ? 713  LEU E C   1 
ATOM   7312 O O   . LEU D 2 37  ? 43.098 58.694  35.109  1.00 15.79 ? 713  LEU E O   1 
ATOM   7313 C CB  . LEU D 2 37  ? 42.029 57.419  37.900  1.00 15.81 ? 713  LEU E CB  1 
ATOM   7314 C CG  . LEU D 2 37  ? 42.904 58.444  38.621  1.00 15.62 ? 713  LEU E CG  1 
ATOM   7315 C CD1 . LEU D 2 37  ? 42.178 59.781  38.781  1.00 13.87 ? 713  LEU E CD1 1 
ATOM   7316 C CD2 . LEU D 2 37  ? 43.387 57.891  39.968  1.00 15.31 ? 713  LEU E CD2 1 
ATOM   7317 N N   . SER D 2 38  ? 42.475 56.572  34.804  1.00 15.08 ? 714  SER E N   1 
ATOM   7318 C CA  . SER D 2 38  ? 43.360 56.367  33.655  1.00 15.07 ? 714  SER E CA  1 
ATOM   7319 C C   . SER D 2 38  ? 42.969 57.182  32.410  1.00 15.14 ? 714  SER E C   1 
ATOM   7320 O O   . SER D 2 38  ? 43.786 57.349  31.504  1.00 15.20 ? 714  SER E O   1 
ATOM   7321 C CB  . SER D 2 38  ? 43.396 54.886  33.288  1.00 14.84 ? 714  SER E CB  1 
ATOM   7322 O OG  . SER D 2 38  ? 42.091 54.397  33.055  1.00 15.34 ? 714  SER E OG  1 
ATOM   7323 N N   . ASN D 2 39  ? 41.721 57.652  32.353  1.00 14.75 ? 715  ASN E N   1 
ATOM   7324 C CA  . ASN D 2 39  ? 41.262 58.523  31.276  1.00 14.49 ? 715  ASN E CA  1 
ATOM   7325 C C   . ASN D 2 39  ? 41.456 60.014  31.557  1.00 14.31 ? 715  ASN E C   1 
ATOM   7326 O O   . ASN D 2 39  ? 41.150 60.834  30.701  1.00 14.77 ? 715  ASN E O   1 
ATOM   7327 C CB  . ASN D 2 39  ? 39.782 58.264  30.992  1.00 14.88 ? 715  ASN E CB  1 
ATOM   7328 C CG  . ASN D 2 39  ? 39.506 56.820  30.708  1.00 15.20 ? 715  ASN E CG  1 
ATOM   7329 O OD1 . ASN D 2 39  ? 38.838 56.149  31.485  1.00 17.89 ? 715  ASN E OD1 1 
ATOM   7330 N ND2 . ASN D 2 39  ? 40.053 56.314  29.611  1.00 15.82 ? 715  ASN E ND2 1 
ATOM   7331 N N   . LEU D 2 40  ? 41.939 60.376  32.742  1.00 13.75 ? 716  LEU E N   1 
ATOM   7332 C CA  . LEU D 2 40  ? 42.217 61.771  33.038  1.00 13.51 ? 716  LEU E CA  1 
ATOM   7333 C C   . LEU D 2 40  ? 43.285 62.271  32.082  1.00 13.41 ? 716  LEU E C   1 
ATOM   7334 O O   . LEU D 2 40  ? 44.309 61.617  31.890  1.00 13.48 ? 716  LEU E O   1 
ATOM   7335 C CB  . LEU D 2 40  ? 42.710 61.950  34.475  1.00 13.29 ? 716  LEU E CB  1 
ATOM   7336 C CG  . LEU D 2 40  ? 43.061 63.380  34.893  1.00 12.88 ? 716  LEU E CG  1 
ATOM   7337 C CD1 . LEU D 2 40  ? 41.746 64.192  35.034  1.00 11.79 ? 716  LEU E CD1 1 
ATOM   7338 C CD2 . LEU D 2 40  ? 43.882 63.385  36.166  1.00 12.38 ? 716  LEU E CD2 1 
ATOM   7339 N N   . ALA D 2 41  ? 43.049 63.440  31.500  1.00 13.61 ? 717  ALA E N   1 
ATOM   7340 C CA  . ALA D 2 41  ? 43.982 64.047  30.551  1.00 13.81 ? 717  ALA E CA  1 
ATOM   7341 C C   . ALA D 2 41  ? 45.339 64.319  31.205  1.00 13.50 ? 717  ALA E C   1 
ATOM   7342 O O   . ALA D 2 41  ? 45.411 64.637  32.380  1.00 14.44 ? 717  ALA E O   1 
ATOM   7343 C CB  . ALA D 2 41  ? 43.361 65.340  29.990  1.00 13.23 ? 717  ALA E CB  1 
ATOM   7344 N N   . LYS D 2 42  ? 46.424 64.141  30.473  1.00 13.88 ? 718  LYS E N   1 
ATOM   7345 C CA  . LYS D 2 42  ? 47.737 64.489  31.002  1.00 13.59 ? 718  LYS E CA  1 
ATOM   7346 C C   . LYS D 2 42  ? 47.681 65.994  31.222  1.00 13.88 ? 718  LYS E C   1 
ATOM   7347 O O   . LYS D 2 42  ? 47.166 66.713  30.395  1.00 14.07 ? 718  LYS E O   1 
ATOM   7348 C CB  . LYS D 2 42  ? 48.853 64.110  30.031  1.00 13.63 ? 718  LYS E CB  1 
ATOM   7349 C CG  . LYS D 2 42  ? 49.192 62.596  29.981  1.00 12.40 ? 718  LYS E CG  1 
ATOM   7350 C CD  . LYS D 2 42  ? 49.624 62.175  28.590  1.00 13.34 ? 718  LYS E CD  1 
ATOM   7351 C CE  . LYS D 2 42  ? 49.673 60.660  28.420  1.00 12.55 ? 718  LYS E CE  1 
ATOM   7352 N NZ  . LYS D 2 42  ? 50.127 60.275  27.074  1.00 8.97  ? 718  LYS E NZ  1 
ATOM   7353 N N   . GLY D 2 43  ? 48.153 66.457  32.369  1.00 14.06 ? 719  GLY E N   1 
ATOM   7354 C CA  . GLY D 2 43  ? 48.181 67.878  32.663  1.00 13.95 ? 719  GLY E CA  1 
ATOM   7355 C C   . GLY D 2 43  ? 46.959 68.458  33.376  1.00 13.85 ? 719  GLY E C   1 
ATOM   7356 O O   . GLY D 2 43  ? 47.049 69.565  33.865  1.00 13.53 ? 719  GLY E O   1 
ATOM   7357 N N   . GLU D 2 44  ? 45.836 67.737  33.441  1.00 13.70 ? 720  GLU E N   1 
ATOM   7358 C CA  . GLU D 2 44  ? 44.647 68.248  34.122  1.00 14.23 ? 720  GLU E CA  1 
ATOM   7359 C C   . GLU D 2 44  ? 44.550 67.678  35.544  1.00 13.75 ? 720  GLU E C   1 
ATOM   7360 O O   . GLU D 2 44  ? 45.192 66.685  35.877  1.00 13.69 ? 720  GLU E O   1 
ATOM   7361 C CB  . GLU D 2 44  ? 43.366 67.949  33.331  1.00 14.90 ? 720  GLU E CB  1 
ATOM   7362 C CG  . GLU D 2 44  ? 43.411 68.306  31.825  1.00 17.52 ? 720  GLU E CG  1 
ATOM   7363 C CD  . GLU D 2 44  ? 43.446 69.804  31.508  1.00 21.60 ? 720  GLU E CD  1 
ATOM   7364 O OE1 . GLU D 2 44  ? 43.080 70.632  32.374  1.00 23.54 ? 720  GLU E OE1 1 
ATOM   7365 O OE2 . GLU D 2 44  ? 43.816 70.157  30.360  1.00 24.49 ? 720  GLU E OE2 1 
ATOM   7366 N N   . LYS D 2 45  ? 43.740 68.315  36.376  1.00 13.05 ? 721  LYS E N   1 
ATOM   7367 C CA  . LYS D 2 45  ? 43.571 67.875  37.757  1.00 12.71 ? 721  LYS E CA  1 
ATOM   7368 C C   . LYS D 2 45  ? 42.156 67.371  37.960  1.00 11.86 ? 721  LYS E C   1 
ATOM   7369 O O   . LYS D 2 45  ? 41.240 67.806  37.294  1.00 11.29 ? 721  LYS E O   1 
ATOM   7370 C CB  . LYS D 2 45  ? 43.880 69.008  38.726  1.00 12.39 ? 721  LYS E CB  1 
ATOM   7371 C CG  . LYS D 2 45  ? 45.242 69.658  38.518  1.00 11.71 ? 721  LYS E CG  1 
ATOM   7372 C CD  . LYS D 2 45  ? 45.485 70.756  39.537  1.00 13.58 ? 721  LYS E CD  1 
ATOM   7373 C CE  . LYS D 2 45  ? 46.833 71.439  39.338  1.00 15.05 ? 721  LYS E CE  1 
ATOM   7374 N NZ  . LYS D 2 45  ? 47.182 71.633  37.894  1.00 16.82 ? 721  LYS E NZ  1 
ATOM   7375 N N   . ALA D 2 46  ? 41.989 66.427  38.870  1.00 11.68 ? 722  ALA E N   1 
ATOM   7376 C CA  . ALA D 2 46  ? 40.689 65.845  39.089  1.00 12.05 ? 722  ALA E CA  1 
ATOM   7377 C C   . ALA D 2 46  ? 40.551 65.275  40.495  1.00 12.01 ? 722  ALA E C   1 
ATOM   7378 O O   . ALA D 2 46  ? 41.527 64.927  41.124  1.00 11.92 ? 722  ALA E O   1 
ATOM   7379 C CB  . ALA D 2 46  ? 40.423 64.783  38.059  1.00 11.49 ? 722  ALA E CB  1 
ATOM   7380 N N   . ASN D 2 47  ? 39.317 65.201  40.984  1.00 12.42 ? 723  ASN E N   1 
ATOM   7381 C CA  . ASN D 2 47  ? 39.051 64.570  42.277  1.00 12.55 ? 723  ASN E CA  1 
ATOM   7382 C C   . ASN D 2 47  ? 38.806 63.077  42.067  1.00 12.90 ? 723  ASN E C   1 
ATOM   7383 O O   . ASN D 2 47  ? 38.134 62.700  41.103  1.00 12.08 ? 723  ASN E O   1 
ATOM   7384 C CB  . ASN D 2 47  ? 37.855 65.229  42.956  1.00 12.67 ? 723  ASN E CB  1 
ATOM   7385 C CG  . ASN D 2 47  ? 38.119 66.676  43.322  1.00 12.28 ? 723  ASN E CG  1 
ATOM   7386 O OD1 . ASN D 2 47  ? 39.120 66.981  43.965  1.00 12.84 ? 723  ASN E OD1 1 
ATOM   7387 N ND2 . ASN D 2 47  ? 37.235 67.574  42.900  1.00 10.53 ? 723  ASN E ND2 1 
ATOM   7388 N N   . VAL D 2 48  ? 39.405 62.241  42.925  1.00 13.23 ? 724  VAL E N   1 
ATOM   7389 C CA  . VAL D 2 48  ? 39.141 60.786  42.947  1.00 13.38 ? 724  VAL E CA  1 
ATOM   7390 C C   . VAL D 2 48  ? 38.729 60.337  44.329  1.00 13.28 ? 724  VAL E C   1 
ATOM   7391 O O   . VAL D 2 48  ? 39.237 60.851  45.312  1.00 13.17 ? 724  VAL E O   1 
ATOM   7392 C CB  . VAL D 2 48  ? 40.375 59.874  42.571  1.00 13.23 ? 724  VAL E CB  1 
ATOM   7393 C CG1 . VAL D 2 48  ? 40.213 59.292  41.185  1.00 13.41 ? 724  VAL E CG1 1 
ATOM   7394 C CG2 . VAL D 2 48  ? 41.719 60.586  42.749  1.00 12.99 ? 724  VAL E CG2 1 
ATOM   7395 N N   . LEU D 2 49  ? 37.843 59.348  44.389  1.00 13.68 ? 725  LEU E N   1 
ATOM   7396 C CA  . LEU D 2 49  ? 37.543 58.654  45.639  1.00 14.11 ? 725  LEU E CA  1 
ATOM   7397 C C   . LEU D 2 49  ? 38.627 57.592  45.853  1.00 14.49 ? 725  LEU E C   1 
ATOM   7398 O O   . LEU D 2 49  ? 38.743 56.642  45.067  1.00 14.65 ? 725  LEU E O   1 
ATOM   7399 C CB  . LEU D 2 49  ? 36.152 58.014  45.596  1.00 13.89 ? 725  LEU E CB  1 
ATOM   7400 C CG  . LEU D 2 49  ? 35.555 57.648  46.956  1.00 13.92 ? 725  LEU E CG  1 
ATOM   7401 C CD1 . LEU D 2 49  ? 35.099 58.897  47.689  1.00 13.56 ? 725  LEU E CD1 1 
ATOM   7402 C CD2 . LEU D 2 49  ? 34.396 56.685  46.794  1.00 13.75 ? 725  LEU E CD2 1 
ATOM   7403 N N   . ILE D 2 50  ? 39.438 57.789  46.893  1.00 14.86 ? 726  ILE E N   1 
ATOM   7404 C CA  . ILE D 2 50  ? 40.523 56.873  47.247  1.00 15.28 ? 726  ILE E CA  1 
ATOM   7405 C C   . ILE D 2 50  ? 40.017 55.829  48.236  1.00 15.44 ? 726  ILE E C   1 
ATOM   7406 O O   . ILE D 2 50  ? 40.699 54.842  48.506  1.00 15.46 ? 726  ILE E O   1 
ATOM   7407 C CB  . ILE D 2 50  ? 41.741 57.656  47.846  1.00 15.57 ? 726  ILE E CB  1 
ATOM   7408 C CG1 . ILE D 2 50  ? 42.276 58.658  46.840  1.00 15.88 ? 726  ILE E CG1 1 
ATOM   7409 C CG2 . ILE D 2 50  ? 42.878 56.743  48.209  1.00 15.37 ? 726  ILE E CG2 1 
ATOM   7410 C CD1 . ILE D 2 50  ? 42.739 58.035  45.558  1.00 17.82 ? 726  ILE E CD1 1 
ATOM   7411 N N   . GLY D 2 51  ? 38.811 56.047  48.756  1.00 15.76 ? 727  GLY E N   1 
ATOM   7412 C CA  . GLY D 2 51  ? 38.208 55.159  49.735  1.00 16.09 ? 727  GLY E CA  1 
ATOM   7413 C C   . GLY D 2 51  ? 37.137 55.870  50.544  1.00 16.39 ? 727  GLY E C   1 
ATOM   7414 O O   . GLY D 2 51  ? 36.935 57.076  50.394  1.00 16.62 ? 727  GLY E O   1 
ATOM   7415 N N   . GLN D 2 52  ? 36.451 55.106  51.390  1.00 16.55 ? 728  GLN E N   1 
ATOM   7416 C CA  . GLN D 2 52  ? 35.432 55.618  52.324  1.00 16.81 ? 728  GLN E CA  1 
ATOM   7417 C C   . GLN D 2 52  ? 34.849 57.006  51.948  1.00 16.89 ? 728  GLN E C   1 
ATOM   7418 O O   . GLN D 2 52  ? 34.212 57.135  50.895  1.00 17.06 ? 728  GLN E O   1 
ATOM   7419 C CB  . GLN D 2 52  ? 35.982 55.560  53.766  1.00 17.03 ? 728  GLN E CB  1 
ATOM   7420 C CG  . GLN D 2 52  ? 37.421 56.097  53.944  1.00 17.09 ? 728  GLN E CG  1 
ATOM   7421 C CD  . GLN D 2 52  ? 37.981 55.852  55.350  1.00 17.25 ? 728  GLN E CD  1 
ATOM   7422 O OE1 . GLN D 2 52  ? 37.271 55.402  56.260  1.00 17.03 ? 728  GLN E OE1 1 
ATOM   7423 N NE2 . GLN D 2 52  ? 39.264 56.152  55.526  1.00 17.77 ? 728  GLN E NE2 1 
ATOM   7424 N N   . GLY D 2 53  ? 35.041 58.022  52.796  1.00 16.75 ? 729  GLY E N   1 
ATOM   7425 C CA  . GLY D 2 53  ? 34.657 59.397  52.473  1.00 16.39 ? 729  GLY E CA  1 
ATOM   7426 C C   . GLY D 2 53  ? 35.879 60.231  52.126  1.00 16.33 ? 729  GLY E C   1 
ATOM   7427 O O   . GLY D 2 53  ? 35.883 61.450  52.329  1.00 16.73 ? 729  GLY E O   1 
ATOM   7428 N N   . ASP D 2 54  ? 36.910 59.575  51.586  1.00 15.80 ? 730  ASP E N   1 
ATOM   7429 C CA  . ASP D 2 54  ? 38.210 60.198  51.344  1.00 15.04 ? 730  ASP E CA  1 
ATOM   7430 C C   . ASP D 2 54  ? 38.379 60.520  49.844  1.00 14.40 ? 730  ASP E C   1 
ATOM   7431 O O   . ASP D 2 54  ? 38.726 59.660  49.036  1.00 13.91 ? 730  ASP E O   1 
ATOM   7432 C CB  . ASP D 2 54  ? 39.327 59.275  51.868  1.00 15.29 ? 730  ASP E CB  1 
ATOM   7433 C CG  . ASP D 2 54  ? 40.725 59.887  51.738  1.00 16.50 ? 730  ASP E CG  1 
ATOM   7434 O OD1 . ASP D 2 54  ? 40.858 61.134  51.747  1.00 18.97 ? 730  ASP E OD1 1 
ATOM   7435 O OD2 . ASP D 2 54  ? 41.705 59.113  51.630  1.00 18.18 ? 730  ASP E OD2 1 
ATOM   7436 N N   . VAL D 2 55  ? 38.098 61.774  49.495  1.00 13.61 ? 731  VAL E N   1 
ATOM   7437 C CA  . VAL D 2 55  ? 38.229 62.285  48.145  1.00 12.88 ? 731  VAL E CA  1 
ATOM   7438 C C   . VAL D 2 55  ? 39.434 63.217  48.113  1.00 12.47 ? 731  VAL E C   1 
ATOM   7439 O O   . VAL D 2 55  ? 39.616 64.032  49.015  1.00 12.15 ? 731  VAL E O   1 
ATOM   7440 C CB  . VAL D 2 55  ? 36.961 63.049  47.718  1.00 12.79 ? 731  VAL E CB  1 
ATOM   7441 C CG1 . VAL D 2 55  ? 37.104 63.578  46.296  1.00 12.19 ? 731  VAL E CG1 1 
ATOM   7442 C CG2 . VAL D 2 55  ? 35.733 62.148  47.841  1.00 12.51 ? 731  VAL E CG2 1 
ATOM   7443 N N   . VAL D 2 56  ? 40.244 63.085  47.063  1.00 12.17 ? 732  VAL E N   1 
ATOM   7444 C CA  . VAL D 2 56  ? 41.589 63.669  46.989  1.00 11.72 ? 732  VAL E CA  1 
ATOM   7445 C C   . VAL D 2 56  ? 41.811 64.230  45.587  1.00 11.28 ? 732  VAL E C   1 
ATOM   7446 O O   . VAL D 2 56  ? 41.296 63.669  44.630  1.00 11.63 ? 732  VAL E O   1 
ATOM   7447 C CB  . VAL D 2 56  ? 42.635 62.576  47.329  1.00 11.79 ? 732  VAL E CB  1 
ATOM   7448 C CG1 . VAL D 2 56  ? 43.916 62.781  46.612  1.00 12.63 ? 732  VAL E CG1 1 
ATOM   7449 C CG2 . VAL D 2 56  ? 42.879 62.507  48.838  1.00 11.77 ? 732  VAL E CG2 1 
ATOM   7450 N N   . LEU D 2 57  ? 42.555 65.329  45.460  1.00 10.87 ? 733  LEU E N   1 
ATOM   7451 C CA  . LEU D 2 57  ? 42.868 65.923  44.150  1.00 10.76 ? 733  LEU E CA  1 
ATOM   7452 C C   . LEU D 2 57  ? 44.229 65.428  43.675  1.00 10.87 ? 733  LEU E C   1 
ATOM   7453 O O   . LEU D 2 57  ? 45.215 65.460  44.439  1.00 10.49 ? 733  LEU E O   1 
ATOM   7454 C CB  . LEU D 2 57  ? 42.862 67.458  44.208  1.00 11.32 ? 733  LEU E CB  1 
ATOM   7455 C CG  . LEU D 2 57  ? 42.926 68.291  42.910  1.00 11.00 ? 733  LEU E CG  1 
ATOM   7456 C CD1 . LEU D 2 57  ? 41.585 68.328  42.212  1.00 9.92  ? 733  LEU E CD1 1 
ATOM   7457 C CD2 . LEU D 2 57  ? 43.369 69.732  43.211  1.00 10.76 ? 733  LEU E CD2 1 
ATOM   7458 N N   . VAL D 2 58  ? 44.258 64.975  42.418  1.00 10.01 ? 734  VAL E N   1 
ATOM   7459 C CA  . VAL D 2 58  ? 45.433 64.369  41.799  1.00 10.01 ? 734  VAL E CA  1 
ATOM   7460 C C   . VAL D 2 58  ? 45.658 64.943  40.409  1.00 9.81  ? 734  VAL E C   1 
ATOM   7461 O O   . VAL D 2 58  ? 44.780 65.612  39.828  1.00 9.72  ? 734  VAL E O   1 
ATOM   7462 C CB  . VAL D 2 58  ? 45.274 62.835  41.652  1.00 9.58  ? 734  VAL E CB  1 
ATOM   7463 C CG1 . VAL D 2 58  ? 44.989 62.218  42.977  1.00 10.00 ? 734  VAL E CG1 1 
ATOM   7464 C CG2 . VAL D 2 58  ? 44.160 62.476  40.669  1.00 9.74  ? 734  VAL E CG2 1 
ATOM   7465 N N   . MET D 2 59  ? 46.861 64.712  39.907  1.00 9.64  ? 735  MET E N   1 
ATOM   7466 C CA  . MET D 2 59  ? 47.190 64.890  38.494  1.00 9.28  ? 735  MET E CA  1 
ATOM   7467 C C   . MET D 2 59  ? 48.158 63.769  38.139  1.00 8.67  ? 735  MET E C   1 
ATOM   7468 O O   . MET D 2 59  ? 48.772 63.187  39.027  1.00 7.36  ? 735  MET E O   1 
ATOM   7469 C CB  . MET D 2 59  ? 47.823 66.272  38.239  1.00 10.04 ? 735  MET E CB  1 
ATOM   7470 C CG  . MET D 2 59  ? 49.195 66.479  38.902  1.00 9.82  ? 735  MET E CG  1 
ATOM   7471 S SD  . MET D 2 59  ? 49.972 68.070  38.592  1.00 10.84 ? 735  MET E SD  1 
ATOM   7472 C CE  . MET D 2 59  ? 50.371 67.950  36.849  1.00 5.25  ? 735  MET E CE  1 
ATOM   7473 N N   . LYS D 2 60  ? 48.276 63.449  36.848  1.00 8.81  ? 736  LYS E N   1 
ATOM   7474 C CA  . LYS D 2 60  ? 49.228 62.437  36.399  1.00 8.18  ? 736  LYS E CA  1 
ATOM   7475 C C   . LYS D 2 60  ? 50.657 62.940  36.518  1.00 8.29  ? 736  LYS E C   1 
ATOM   7476 O O   . LYS D 2 60  ? 50.932 64.100  36.266  1.00 8.59  ? 736  LYS E O   1 
ATOM   7477 C CB  . LYS D 2 60  ? 48.943 61.996  34.955  1.00 8.13  ? 736  LYS E CB  1 
ATOM   7478 C CG  . LYS D 2 60  ? 47.737 61.069  34.811  1.00 7.83  ? 736  LYS E CG  1 
ATOM   7479 C CD  . LYS D 2 60  ? 47.545 60.611  33.392  1.00 8.12  ? 736  LYS E CD  1 
ATOM   7480 C CE  . LYS D 2 60  ? 46.275 59.736  33.239  1.00 8.69  ? 736  LYS E CE  1 
ATOM   7481 N NZ  . LYS D 2 60  ? 45.925 59.427  31.804  1.00 7.33  ? 736  LYS E NZ  1 
ATOM   7482 N N   . ARG D 2 61  ? 51.574 62.042  36.878  1.00 9.11  ? 737  ARG E N   1 
ATOM   7483 C CA  . ARG D 2 61  ? 53.003 62.340  36.888  1.00 8.87  ? 737  ARG E CA  1 
ATOM   7484 C C   . ARG D 2 61  ? 53.609 62.529  35.503  1.00 9.69  ? 737  ARG E C   1 
ATOM   7485 O O   . ARG D 2 61  ? 54.612 63.259  35.331  1.00 10.35 ? 737  ARG E O   1 
ATOM   7486 C CB  . ARG D 2 61  ? 53.732 61.219  37.593  1.00 8.77  ? 737  ARG E CB  1 
ATOM   7487 C CG  . ARG D 2 61  ? 53.518 61.203  39.101  1.00 7.77  ? 737  ARG E CG  1 
ATOM   7488 C CD  . ARG D 2 61  ? 54.550 60.316  39.767  1.00 7.67  ? 737  ARG E CD  1 
ATOM   7489 N NE  . ARG D 2 61  ? 54.278 60.196  41.176  1.00 7.14  ? 737  ARG E NE  1 
ATOM   7490 C CZ  . ARG D 2 61  ? 54.609 61.092  42.098  1.00 6.61  ? 737  ARG E CZ  1 
ATOM   7491 N NH1 . ARG D 2 61  ? 55.299 62.174  41.785  1.00 7.66  ? 737  ARG E NH1 1 
ATOM   7492 N NH2 . ARG D 2 61  ? 54.230 60.890  43.354  1.00 8.61  ? 737  ARG E NH2 1 
ATOM   7493 N N   . LYS D 2 62  ? 53.025 61.841  34.520  1.00 10.46 ? 738  LYS E N   1 
ATOM   7494 C CA  . LYS D 2 62  ? 53.431 61.968  33.114  1.00 9.82  ? 738  LYS E CA  1 
ATOM   7495 C C   . LYS D 2 62  ? 52.779 63.186  32.481  1.00 10.28 ? 738  LYS E C   1 
ATOM   7496 O O   . LYS D 2 62  ? 51.555 63.318  32.460  1.00 10.46 ? 738  LYS E O   1 
ATOM   7497 C CB  . LYS D 2 62  ? 53.110 60.693  32.328  1.00 10.24 ? 738  LYS E CB  1 
ATOM   7498 C CG  . LYS D 2 62  ? 54.206 59.658  32.496  1.00 8.61  ? 738  LYS E CG  1 
ATOM   7499 C CD  . LYS D 2 62  ? 53.737 58.265  32.309  1.00 8.73  ? 738  LYS E CD  1 
ATOM   7500 C CE  . LYS D 2 62  ? 54.867 57.272  32.551  1.00 10.27 ? 738  LYS E CE  1 
ATOM   7501 N NZ  . LYS D 2 62  ? 55.930 57.252  31.536  1.00 9.31  ? 738  LYS E NZ  1 
ATOM   7502 N N   . ARG D 2 63  ? 53.610 64.100  32.000  1.00 10.07 ? 739  ARG E N   1 
ATOM   7503 C CA  . ARG D 2 63  ? 53.133 65.402  31.551  1.00 9.64  ? 739  ARG E CA  1 
ATOM   7504 C C   . ARG D 2 63  ? 53.502 65.660  30.100  1.00 9.68  ? 739  ARG E C   1 
ATOM   7505 O O   . ARG D 2 63  ? 54.649 65.488  29.701  1.00 9.06  ? 739  ARG E O   1 
ATOM   7506 C CB  . ARG D 2 63  ? 53.746 66.490  32.420  1.00 9.61  ? 739  ARG E CB  1 
ATOM   7507 C CG  . ARG D 2 63  ? 53.447 66.373  33.905  1.00 9.01  ? 739  ARG E CG  1 
ATOM   7508 C CD  . ARG D 2 63  ? 54.295 67.340  34.700  1.00 7.86  ? 739  ARG E CD  1 
ATOM   7509 N NE  . ARG D 2 63  ? 55.709 67.025  34.562  1.00 6.21  ? 739  ARG E NE  1 
ATOM   7510 C CZ  . ARG D 2 63  ? 56.671 67.894  34.249  1.00 7.29  ? 739  ARG E CZ  1 
ATOM   7511 N NH1 . ARG D 2 63  ? 56.425 69.195  34.075  1.00 8.24  ? 739  ARG E NH1 1 
ATOM   7512 N NH2 . ARG D 2 63  ? 57.912 67.452  34.135  1.00 6.86  ? 739  ARG E NH2 1 
ATOM   7513 N N   . ASP D 2 64  ? 52.512 66.058  29.318  1.00 10.48 ? 740  ASP E N   1 
ATOM   7514 C CA  . ASP D 2 64  ? 52.679 66.451  27.914  1.00 11.37 ? 740  ASP E CA  1 
ATOM   7515 C C   . ASP D 2 64  ? 53.359 67.823  27.799  1.00 11.19 ? 740  ASP E C   1 
ATOM   7516 O O   . ASP D 2 64  ? 53.484 68.536  28.772  1.00 10.59 ? 740  ASP E O   1 
ATOM   7517 C CB  . ASP D 2 64  ? 51.290 66.550  27.237  1.00 12.84 ? 740  ASP E CB  1 
ATOM   7518 C CG  . ASP D 2 64  ? 50.827 65.238  26.589  1.00 16.17 ? 740  ASP E CG  1 
ATOM   7519 O OD1 . ASP D 2 64  ? 51.683 64.401  26.178  1.00 18.71 ? 740  ASP E OD1 1 
ATOM   7520 O OD2 . ASP D 2 64  ? 49.573 65.091  26.437  1.00 21.03 ? 740  ASP E OD2 1 
ATOM   7521 N N   . SER D 2 65  ? 53.778 68.178  26.584  1.00 11.55 ? 741  SER E N   1 
ATOM   7522 C CA  . SER D 2 65  ? 54.282 69.526  26.252  1.00 11.72 ? 741  SER E CA  1 
ATOM   7523 C C   . SER D 2 65  ? 53.152 70.549  26.085  1.00 11.80 ? 741  SER E C   1 
ATOM   7524 O O   . SER D 2 65  ? 52.821 71.299  27.008  1.00 12.81 ? 741  SER E O   1 
ATOM   7525 C CB  . SER D 2 65  ? 55.040 69.464  24.949  1.00 11.56 ? 741  SER E CB  1 
ATOM   7526 O OG  . SER D 2 65  ? 54.153 69.052  23.918  1.00 11.70 ? 741  SER E OG  1 
ATOM   7527 N N   . THR D 2 73  ? 57.247 77.677  16.676  1.00 43.76 ? 749  THR E N   1 
ATOM   7528 C CA  . THR D 2 73  ? 57.513 77.852  15.249  1.00 43.56 ? 749  THR E CA  1 
ATOM   7529 C C   . THR D 2 73  ? 56.492 78.768  14.561  1.00 43.58 ? 749  THR E C   1 
ATOM   7530 O O   . THR D 2 73  ? 55.482 79.143  15.169  1.00 43.44 ? 749  THR E O   1 
ATOM   7531 C CB  . THR D 2 73  ? 57.550 76.494  14.535  1.00 43.85 ? 749  THR E CB  1 
ATOM   7532 O OG1 . THR D 2 73  ? 56.357 75.744  14.822  1.00 44.12 ? 749  THR E OG1 1 
ATOM   7533 C CG2 . THR D 2 73  ? 58.754 75.717  15.002  1.00 43.94 ? 749  THR E CG2 1 
ATOM   7534 N N   . ALA D 2 74  ? 56.771 79.123  13.299  1.00 43.17 ? 750  ALA E N   1 
ATOM   7535 C CA  . ALA D 2 74  ? 55.914 80.031  12.522  1.00 42.68 ? 750  ALA E CA  1 
ATOM   7536 C C   . ALA D 2 74  ? 54.642 79.331  12.048  1.00 42.40 ? 750  ALA E C   1 
ATOM   7537 O O   . ALA D 2 74  ? 54.707 78.322  11.342  1.00 42.87 ? 750  ALA E O   1 
ATOM   7538 C CB  . ALA D 2 74  ? 56.673 80.588  11.324  1.00 42.67 ? 750  ALA E CB  1 
ATOM   7539 N N   . THR D 2 75  ? 53.490 79.879  12.424  1.00 41.66 ? 751  THR E N   1 
ATOM   7540 C CA  . THR D 2 75  ? 52.201 79.326  12.003  1.00 41.09 ? 751  THR E CA  1 
ATOM   7541 C C   . THR D 2 75  ? 51.832 79.667  10.547  1.00 40.44 ? 751  THR E C   1 
ATOM   7542 O O   . THR D 2 75  ? 51.147 78.891  9.888   1.00 40.28 ? 751  THR E O   1 
ATOM   7543 C CB  . THR D 2 75  ? 51.055 79.783  12.929  1.00 41.19 ? 751  THR E CB  1 
ATOM   7544 O OG1 . THR D 2 75  ? 49.849 79.118  12.538  1.00 41.29 ? 751  THR E OG1 1 
ATOM   7545 C CG2 . THR D 2 75  ? 50.846 81.306  12.860  1.00 41.58 ? 751  THR E CG2 1 
ATOM   7546 N N   . LYS D 2 76  ? 52.275 80.824  10.059  1.00 39.69 ? 752  LYS E N   1 
ATOM   7547 C CA  . LYS D 2 76  ? 52.032 81.228  8.677   1.00 39.18 ? 752  LYS E CA  1 
ATOM   7548 C C   . LYS D 2 76  ? 53.297 81.752  8.023   1.00 38.84 ? 752  LYS E C   1 
ATOM   7549 O O   . LYS D 2 76  ? 54.234 82.164  8.704   1.00 38.55 ? 752  LYS E O   1 
ATOM   7550 C CB  . LYS D 2 76  ? 50.955 82.303  8.618   1.00 38.93 ? 752  LYS E CB  1 
ATOM   7551 C CG  . LYS D 2 76  ? 49.595 81.838  9.090   1.00 38.86 ? 752  LYS E CG  1 
ATOM   7552 C CD  . LYS D 2 76  ? 48.510 82.786  8.627   1.00 38.54 ? 752  LYS E CD  1 
ATOM   7553 C CE  . LYS D 2 76  ? 47.182 82.504  9.290   1.00 38.37 ? 752  LYS E CE  1 
ATOM   7554 N NZ  . LYS D 2 76  ? 46.163 83.547  8.947   1.00 38.48 ? 752  LYS E NZ  1 
ATOM   7555 N N   . ARG D 2 77  ? 53.315 81.729  6.692   1.00 38.65 ? 753  ARG E N   1 
ATOM   7556 C CA  . ARG D 2 77  ? 54.466 82.196  5.919   1.00 38.71 ? 753  ARG E CA  1 
ATOM   7557 C C   . ARG D 2 77  ? 54.014 82.957  4.674   1.00 38.65 ? 753  ARG E C   1 
ATOM   7558 O O   . ARG D 2 77  ? 53.038 82.575  4.024   1.00 38.53 ? 753  ARG E O   1 
ATOM   7559 C CB  . ARG D 2 77  ? 55.355 81.016  5.510   1.00 38.64 ? 753  ARG E CB  1 
ATOM   7560 C CG  . ARG D 2 77  ? 55.829 80.162  6.676   1.00 38.68 ? 753  ARG E CG  1 
ATOM   7561 C CD  . ARG D 2 77  ? 56.933 79.186  6.282   1.00 38.92 ? 753  ARG E CD  1 
ATOM   7562 N NE  . ARG D 2 77  ? 56.564 78.333  5.151   1.00 39.05 ? 753  ARG E NE  1 
ATOM   7563 C CZ  . ARG D 2 77  ? 56.959 78.497  3.887   1.00 39.04 ? 753  ARG E CZ  1 
ATOM   7564 N NH1 . ARG D 2 77  ? 57.760 79.501  3.535   1.00 40.11 ? 753  ARG E NH1 1 
ATOM   7565 N NH2 . ARG D 2 77  ? 56.547 77.643  2.957   1.00 37.97 ? 753  ARG E NH2 1 
ATOM   7566 N N   . ILE D 2 78  ? 54.730 84.034  4.355   1.00 38.61 ? 754  ILE E N   1 
ATOM   7567 C CA  . ILE D 2 78  ? 54.430 84.863  3.185   1.00 38.59 ? 754  ILE E CA  1 
ATOM   7568 C C   . ILE D 2 78  ? 55.526 84.665  2.141   1.00 38.56 ? 754  ILE E C   1 
ATOM   7569 O O   . ILE D 2 78  ? 56.707 84.547  2.482   1.00 38.34 ? 754  ILE E O   1 
ATOM   7570 C CB  . ILE D 2 78  ? 54.300 86.372  3.569   1.00 38.59 ? 754  ILE E CB  1 
ATOM   7571 C CG1 . ILE D 2 78  ? 53.659 87.177  2.434   1.00 38.34 ? 754  ILE E CG1 1 
ATOM   7572 C CG2 . ILE D 2 78  ? 55.652 86.967  3.963   1.00 38.58 ? 754  ILE E CG2 1 
ATOM   7573 C CD1 . ILE D 2 78  ? 53.656 88.672  2.673   1.00 38.38 ? 754  ILE E CD1 1 
ATOM   7574 N N   . ARG D 2 79  ? 55.134 84.603  0.873   1.00 38.65 ? 755  ARG E N   1 
ATOM   7575 C CA  . ARG D 2 79  ? 56.105 84.472  -0.203  1.00 38.83 ? 755  ARG E CA  1 
ATOM   7576 C C   . ARG D 2 79  ? 56.497 85.858  -0.689  1.00 38.87 ? 755  ARG E C   1 
ATOM   7577 O O   . ARG D 2 79  ? 55.634 86.701  -0.922  1.00 38.66 ? 755  ARG E O   1 
ATOM   7578 C CB  . ARG D 2 79  ? 55.558 83.640  -1.362  1.00 38.73 ? 755  ARG E CB  1 
ATOM   7579 C CG  . ARG D 2 79  ? 56.586 83.446  -2.461  1.00 38.81 ? 755  ARG E CG  1 
ATOM   7580 C CD  . ARG D 2 79  ? 56.189 82.404  -3.478  1.00 38.93 ? 755  ARG E CD  1 
ATOM   7581 N NE  . ARG D 2 79  ? 57.163 82.363  -4.569  1.00 38.99 ? 755  ARG E NE  1 
ATOM   7582 C CZ  . ARG D 2 79  ? 57.354 81.332  -5.394  1.00 39.33 ? 755  ARG E CZ  1 
ATOM   7583 N NH1 . ARG D 2 79  ? 56.641 80.215  -5.282  1.00 39.60 ? 755  ARG E NH1 1 
ATOM   7584 N NH2 . ARG D 2 79  ? 58.277 81.416  -6.348  1.00 39.53 ? 755  ARG E NH2 1 
ATOM   7585 N N   . MET D 2 80  ? 57.802 86.076  -0.840  1.00 39.16 ? 756  MET E N   1 
ATOM   7586 C CA  . MET D 2 80  ? 58.344 87.360  -1.278  1.00 39.55 ? 756  MET E CA  1 
ATOM   7587 C C   . MET D 2 80  ? 59.261 87.188  -2.489  1.00 39.61 ? 756  MET E C   1 
ATOM   7588 O O   . MET D 2 80  ? 59.610 86.064  -2.854  1.00 39.77 ? 756  MET E O   1 
ATOM   7589 C CB  . MET D 2 80  ? 59.101 88.014  -0.124  1.00 39.61 ? 756  MET E CB  1 
ATOM   7590 C CG  . MET D 2 80  ? 58.195 88.469  1.011   1.00 39.79 ? 756  MET E CG  1 
ATOM   7591 S SD  . MET D 2 80  ? 59.032 88.492  2.595   1.00 40.37 ? 756  MET E SD  1 
ATOM   7592 C CE  . MET D 2 80  ? 59.224 86.732  2.923   1.00 39.88 ? 756  MET E CE  1 
ATOM   7593 N N   . ALA D 2 81  ? 59.637 88.305  -3.111  1.00 39.66 ? 757  ALA E N   1 
ATOM   7594 C CA  . ALA D 2 81  ? 60.511 88.285  -4.287  1.00 39.77 ? 757  ALA E CA  1 
ATOM   7595 C C   . ALA D 2 81  ? 61.977 88.392  -3.868  1.00 39.90 ? 757  ALA E C   1 
ATOM   7596 O O   . ALA D 2 81  ? 62.843 88.738  -4.675  1.00 40.19 ? 757  ALA E O   1 
ATOM   7597 C CB  . ALA D 2 81  ? 60.139 89.418  -5.254  1.00 39.69 ? 757  ALA E CB  1 
HETATM 7598 O O   . HOH E 3 .   ? 46.118 100.467 -6.067  1.00 44.30 ? 2001 HOH A O   1 
HETATM 7599 O O   . HOH E 3 .   ? 56.568 95.851  -10.352 1.00 44.46 ? 2002 HOH A O   1 
HETATM 7600 O O   . HOH E 3 .   ? 48.295 101.247 -4.744  1.00 48.57 ? 2003 HOH A O   1 
HETATM 7601 O O   . HOH E 3 .   ? 53.930 90.584  6.123   1.00 49.21 ? 2004 HOH A O   1 
HETATM 7602 O O   . HOH E 3 .   ? 33.906 93.062  -1.857  1.00 48.83 ? 2005 HOH A O   1 
HETATM 7603 O O   . HOH E 3 .   ? 40.734 73.148  -19.409 1.00 55.79 ? 2006 HOH A O   1 
HETATM 7604 O O   . HOH E 3 .   ? 69.316 45.883  37.657  1.00 42.90 ? 2007 HOH A O   1 
HETATM 7605 O O   . HOH E 3 .   ? 43.330 67.052  -5.871  1.00 38.85 ? 2008 HOH A O   1 
HETATM 7606 O O   . HOH E 3 .   ? 48.666 70.320  -18.432 1.00 48.47 ? 2009 HOH A O   1 
HETATM 7607 O O   . HOH E 3 .   ? 60.549 52.218  17.415  1.00 25.86 ? 2010 HOH A O   1 
HETATM 7608 O O   . HOH E 3 .   ? 65.818 47.253  32.067  1.00 28.17 ? 2011 HOH A O   1 
HETATM 7609 O O   . HOH E 3 .   ? 73.182 55.102  28.988  1.00 36.57 ? 2012 HOH A O   1 
HETATM 7610 O O   . HOH E 3 .   ? 32.486 77.119  2.497   1.00 40.75 ? 2013 HOH A O   1 
HETATM 7611 O O   . HOH E 3 .   ? 41.629 65.413  4.745   1.00 30.91 ? 2014 HOH A O   1 
HETATM 7612 O O   . HOH E 3 .   ? 40.468 65.473  -2.037  1.00 53.47 ? 2015 HOH A O   1 
HETATM 7613 O O   . HOH E 3 .   ? 46.947 59.719  -0.883  1.00 34.81 ? 2016 HOH A O   1 
HETATM 7614 O O   . HOH E 3 .   ? 48.428 65.265  -5.443  1.00 36.65 ? 2017 HOH A O   1 
HETATM 7615 O O   . HOH E 3 .   ? 66.684 46.706  36.595  1.00 28.33 ? 2018 HOH A O   1 
HETATM 7616 O O   . HOH E 3 .   ? 62.022 45.696  38.817  1.00 30.68 ? 2019 HOH A O   1 
HETATM 7617 O O   . HOH E 3 .   ? 52.217 59.153  -0.057  1.00 46.91 ? 2020 HOH A O   1 
HETATM 7618 O O   . HOH E 3 .   ? 65.861 47.693  40.787  1.00 45.13 ? 2021 HOH A O   1 
HETATM 7619 O O   . HOH E 3 .   ? 41.745 63.488  6.248   1.00 35.94 ? 2022 HOH A O   1 
HETATM 7620 O O   . HOH E 3 .   ? 73.806 73.969  61.811  1.00 40.53 ? 2023 HOH A O   1 
HETATM 7621 O O   . HOH E 3 .   ? 56.263 75.349  52.879  1.00 37.13 ? 2024 HOH A O   1 
HETATM 7622 O O   . HOH E 3 .   ? 51.252 58.468  5.440   1.00 40.37 ? 2025 HOH A O   1 
HETATM 7623 O O   . HOH E 3 .   ? 54.354 53.477  8.799   1.00 21.76 ? 2026 HOH A O   1 
HETATM 7624 O O   . HOH E 3 .   ? 54.599 56.836  0.349   1.00 46.69 ? 2027 HOH A O   1 
HETATM 7625 O O   . HOH E 3 .   ? 70.405 66.503  8.210   1.00 32.98 ? 2028 HOH A O   1 
HETATM 7626 O O   . HOH E 3 .   ? 67.248 62.736  1.174   1.00 32.03 ? 2029 HOH A O   1 
HETATM 7627 O O   . HOH E 3 .   ? 68.925 69.776  1.950   1.00 42.10 ? 2030 HOH A O   1 
HETATM 7628 O O   . HOH E 3 .   ? 70.770 70.135  5.598   1.00 52.81 ? 2031 HOH A O   1 
HETATM 7629 O O   . HOH E 3 .   ? 73.349 70.662  10.251  1.00 46.11 ? 2032 HOH A O   1 
HETATM 7630 O O   . HOH E 3 .   ? 48.704 68.454  19.699  1.00 37.80 ? 2033 HOH A O   1 
HETATM 7631 O O   . HOH E 3 .   ? 54.351 74.241  18.322  1.00 51.32 ? 2034 HOH A O   1 
HETATM 7632 O O   . HOH E 3 .   ? 46.235 58.198  27.978  1.00 19.48 ? 2035 HOH A O   1 
HETATM 7633 O O   . HOH E 3 .   ? 49.977 57.482  30.547  1.00 12.03 ? 2036 HOH A O   1 
HETATM 7634 O O   . HOH E 3 .   ? 41.868 63.534  18.644  1.00 52.77 ? 2037 HOH A O   1 
HETATM 7635 O O   . HOH E 3 .   ? 46.872 64.024  19.178  1.00 33.25 ? 2038 HOH A O   1 
HETATM 7636 O O   . HOH E 3 .   ? 44.428 64.251  17.218  1.00 32.13 ? 2039 HOH A O   1 
HETATM 7637 O O   . HOH E 3 .   ? 49.781 53.729  12.956  1.00 35.99 ? 2040 HOH A O   1 
HETATM 7638 O O   . HOH E 3 .   ? 58.262 53.171  16.694  1.00 5.33  ? 2041 HOH A O   1 
HETATM 7639 O O   . HOH E 3 .   ? 48.134 52.107  15.002  1.00 44.60 ? 2042 HOH A O   1 
HETATM 7640 O O   . HOH E 3 .   ? 54.949 48.793  13.618  1.00 15.45 ? 2043 HOH A O   1 
HETATM 7641 O O   . HOH E 3 .   ? 54.083 48.735  16.798  1.00 20.13 ? 2044 HOH A O   1 
HETATM 7642 O O   . HOH E 3 .   ? 62.356 55.380  13.026  1.00 14.57 ? 2045 HOH A O   1 
HETATM 7643 O O   . HOH E 3 .   ? 64.188 49.224  17.223  1.00 24.50 ? 2046 HOH A O   1 
HETATM 7644 O O   . HOH E 3 .   ? 63.881 50.098  14.796  1.00 29.79 ? 2047 HOH A O   1 
HETATM 7645 O O   . HOH E 3 .   ? 70.344 59.598  19.786  1.00 22.97 ? 2048 HOH A O   1 
HETATM 7646 O O   . HOH E 3 .   ? 69.828 53.893  16.807  1.00 27.87 ? 2049 HOH A O   1 
HETATM 7647 O O   . HOH E 3 .   ? 72.023 67.212  19.528  1.00 27.73 ? 2050 HOH A O   1 
HETATM 7648 O O   . HOH E 3 .   ? 73.824 66.682  12.414  1.00 36.93 ? 2051 HOH A O   1 
HETATM 7649 O O   . HOH E 3 .   ? 69.653 76.161  10.534  1.00 53.36 ? 2052 HOH A O   1 
HETATM 7650 O O   . HOH E 3 .   ? 62.656 73.591  14.445  1.00 29.16 ? 2053 HOH A O   1 
HETATM 7651 O O   . HOH E 3 .   ? 54.810 69.642  20.424  1.00 23.58 ? 2054 HOH A O   1 
HETATM 7652 O O   . HOH E 3 .   ? 47.985 52.747  28.406  1.00 31.72 ? 2055 HOH A O   1 
HETATM 7653 O O   . HOH E 3 .   ? 52.356 51.449  32.861  1.00 34.63 ? 2056 HOH A O   1 
HETATM 7654 O O   . HOH E 3 .   ? 56.856 54.242  32.105  1.00 18.10 ? 2057 HOH A O   1 
HETATM 7655 O O   . HOH E 3 .   ? 57.716 47.452  30.217  1.00 31.08 ? 2058 HOH A O   1 
HETATM 7656 O O   . HOH E 3 .   ? 65.928 49.736  29.314  1.00 37.93 ? 2059 HOH A O   1 
HETATM 7657 O O   . HOH E 3 .   ? 64.041 49.197  31.634  1.00 33.22 ? 2060 HOH A O   1 
HETATM 7658 O O   . HOH E 3 .   ? 68.052 54.291  26.924  1.00 12.52 ? 2061 HOH A O   1 
HETATM 7659 O O   . HOH E 3 .   ? 67.157 47.247  21.833  1.00 32.72 ? 2062 HOH A O   1 
HETATM 7660 O O   . HOH E 3 .   ? 70.431 55.806  19.278  1.00 34.20 ? 2063 HOH A O   1 
HETATM 7661 O O   . HOH E 3 .   ? 69.129 51.298  21.345  1.00 27.08 ? 2064 HOH A O   1 
HETATM 7662 O O   . HOH E 3 .   ? 72.608 56.416  22.409  1.00 36.56 ? 2065 HOH A O   1 
HETATM 7663 O O   . HOH E 3 .   ? 76.063 60.442  26.917  1.00 34.26 ? 2066 HOH A O   1 
HETATM 7664 O O   . HOH E 3 .   ? 71.183 54.654  26.732  1.00 24.99 ? 2067 HOH A O   1 
HETATM 7665 O O   . HOH E 3 .   ? 75.724 66.112  30.425  1.00 37.24 ? 2068 HOH A O   1 
HETATM 7666 O O   . HOH E 3 .   ? 77.335 70.105  24.951  1.00 37.50 ? 2069 HOH A O   1 
HETATM 7667 O O   . HOH E 3 .   ? 72.883 70.893  22.688  1.00 33.40 ? 2070 HOH A O   1 
HETATM 7668 O O   . HOH E 3 .   ? 66.354 78.913  25.188  1.00 37.42 ? 2071 HOH A O   1 
HETATM 7669 O O   . HOH E 3 .   ? 69.773 77.635  33.988  1.00 40.08 ? 2072 HOH A O   1 
HETATM 7670 O O   . HOH E 3 .   ? 75.149 70.191  33.429  1.00 44.40 ? 2073 HOH A O   1 
HETATM 7671 O O   . HOH E 3 .   ? 53.392 56.848  35.434  1.00 19.49 ? 2074 HOH A O   1 
HETATM 7672 O O   . HOH E 3 .   ? 57.976 56.086  39.176  1.00 16.91 ? 2075 HOH A O   1 
HETATM 7673 O O   . HOH E 3 .   ? 60.296 47.481  32.038  1.00 36.80 ? 2076 HOH A O   1 
HETATM 7674 O O   . HOH E 3 .   ? 60.033 45.667  35.015  1.00 31.75 ? 2077 HOH A O   1 
HETATM 7675 O O   . HOH E 3 .   ? 62.753 46.674  43.681  1.00 45.24 ? 2078 HOH A O   1 
HETATM 7676 O O   . HOH E 3 .   ? 57.827 49.083  39.377  1.00 24.79 ? 2079 HOH A O   1 
HETATM 7677 O O   . HOH E 3 .   ? 67.228 48.185  34.551  1.00 16.58 ? 2080 HOH A O   1 
HETATM 7678 O O   . HOH E 3 .   ? 60.661 46.935  37.182  1.00 19.54 ? 2081 HOH A O   1 
HETATM 7679 O O   . HOH E 3 .   ? 72.044 51.416  42.386  1.00 34.27 ? 2082 HOH A O   1 
HETATM 7680 O O   . HOH E 3 .   ? 71.408 52.950  31.160  1.00 17.25 ? 2083 HOH A O   1 
HETATM 7681 O O   . HOH E 3 .   ? 69.582 49.015  34.117  1.00 31.14 ? 2084 HOH A O   1 
HETATM 7682 O O   . HOH E 3 .   ? 74.794 57.463  29.420  1.00 37.23 ? 2085 HOH A O   1 
HETATM 7683 O O   . HOH E 3 .   ? 75.994 63.166  35.156  1.00 24.99 ? 2086 HOH A O   1 
HETATM 7684 O O   . HOH E 3 .   ? 77.043 54.994  37.626  1.00 53.72 ? 2087 HOH A O   1 
HETATM 7685 O O   . HOH E 3 .   ? 77.533 55.118  40.377  1.00 51.45 ? 2088 HOH A O   1 
HETATM 7686 O O   . HOH E 3 .   ? 75.010 71.748  35.390  1.00 46.42 ? 2089 HOH A O   1 
HETATM 7687 O O   . HOH E 3 .   ? 67.474 73.794  44.758  1.00 34.88 ? 2090 HOH A O   1 
HETATM 7688 O O   . HOH E 3 .   ? 72.482 72.757  47.482  1.00 29.06 ? 2091 HOH A O   1 
HETATM 7689 O O   . HOH E 3 .   ? 64.168 77.656  31.380  1.00 34.28 ? 2092 HOH A O   1 
HETATM 7690 O O   . HOH E 3 .   ? 59.433 74.478  33.531  1.00 35.04 ? 2093 HOH A O   1 
HETATM 7691 O O   . HOH E 3 .   ? 53.634 71.475  37.298  1.00 43.36 ? 2094 HOH A O   1 
HETATM 7692 O O   . HOH E 3 .   ? 55.741 56.885  40.083  1.00 27.87 ? 2095 HOH A O   1 
HETATM 7693 O O   . HOH E 3 .   ? 66.444 48.402  43.599  1.00 32.31 ? 2096 HOH A O   1 
HETATM 7694 O O   . HOH E 3 .   ? 66.929 46.639  45.592  1.00 37.13 ? 2097 HOH A O   1 
HETATM 7695 O O   . HOH E 3 .   ? 72.186 52.326  47.153  1.00 24.87 ? 2098 HOH A O   1 
HETATM 7696 O O   . HOH E 3 .   ? 69.347 45.618  49.202  1.00 44.74 ? 2099 HOH A O   1 
HETATM 7697 O O   . HOH E 3 .   ? 72.830 58.531  38.003  1.00 22.31 ? 2100 HOH A O   1 
HETATM 7698 O O   . HOH E 3 .   ? 70.845 64.074  50.176  1.00 10.48 ? 2101 HOH A O   1 
HETATM 7699 O O   . HOH E 3 .   ? 76.253 53.047  50.249  1.00 33.49 ? 2102 HOH A O   1 
HETATM 7700 O O   . HOH E 3 .   ? 74.460 53.545  47.035  1.00 26.79 ? 2103 HOH A O   1 
HETATM 7701 O O   . HOH E 3 .   ? 73.117 68.473  47.343  1.00 24.72 ? 2104 HOH A O   1 
HETATM 7702 O O   . HOH E 3 .   ? 71.863 76.865  52.360  1.00 38.25 ? 2105 HOH A O   1 
HETATM 7703 O O   . HOH E 3 .   ? 66.978 74.597  52.542  1.00 30.65 ? 2106 HOH A O   1 
HETATM 7704 O O   . HOH E 3 .   ? 70.431 74.144  46.464  1.00 31.15 ? 2107 HOH A O   1 
HETATM 7705 O O   . HOH E 3 .   ? 57.903 78.754  49.185  1.00 40.14 ? 2108 HOH A O   1 
HETATM 7706 O O   . HOH E 3 .   ? 55.603 76.791  37.670  1.00 58.15 ? 2109 HOH A O   1 
HETATM 7707 O O   . HOH E 3 .   ? 53.355 67.583  47.737  1.00 23.76 ? 2110 HOH A O   1 
HETATM 7708 O O   . HOH E 3 .   ? 53.292 60.046  46.533  1.00 27.58 ? 2111 HOH A O   1 
HETATM 7709 O O   . HOH E 3 .   ? 58.799 54.544  46.035  1.00 27.85 ? 2112 HOH A O   1 
HETATM 7710 O O   . HOH E 3 .   ? 54.240 58.356  50.437  1.00 36.98 ? 2113 HOH A O   1 
HETATM 7711 O O   . HOH E 3 .   ? 62.001 49.158  48.746  1.00 23.44 ? 2114 HOH A O   1 
HETATM 7712 O O   . HOH E 3 .   ? 69.969 53.137  55.352  1.00 37.48 ? 2115 HOH A O   1 
HETATM 7713 O O   . HOH E 3 .   ? 68.644 50.159  51.393  1.00 38.92 ? 2116 HOH A O   1 
HETATM 7714 O O   . HOH E 3 .   ? 66.651 51.097  62.515  1.00 39.58 ? 2117 HOH A O   1 
HETATM 7715 O O   . HOH E 3 .   ? 68.003 54.243  61.168  1.00 34.54 ? 2118 HOH A O   1 
HETATM 7716 O O   . HOH E 3 .   ? 67.262 60.912  61.848  1.00 14.94 ? 2119 HOH A O   1 
HETATM 7717 O O   . HOH E 3 .   ? 70.495 60.760  59.083  1.00 16.53 ? 2120 HOH A O   1 
HETATM 7718 O O   . HOH E 3 .   ? 69.716 55.492  53.844  1.00 35.71 ? 2121 HOH A O   1 
HETATM 7719 O O   . HOH E 3 .   ? 66.250 54.346  51.427  1.00 18.87 ? 2122 HOH A O   1 
HETATM 7720 O O   . HOH E 3 .   ? 67.712 64.109  64.796  1.00 30.65 ? 2123 HOH A O   1 
HETATM 7721 O O   . HOH E 3 .   ? 72.506 72.087  62.420  1.00 35.33 ? 2124 HOH A O   1 
HETATM 7722 O O   . HOH E 3 .   ? 57.229 76.850  54.760  1.00 53.27 ? 2125 HOH A O   1 
HETATM 7723 O O   . HOH E 3 .   ? 47.516 74.107  57.753  1.00 36.07 ? 2126 HOH A O   1 
HETATM 7724 O O   . HOH E 3 .   ? 41.434 75.298  62.278  1.00 47.50 ? 2127 HOH A O   1 
HETATM 7725 O O   . HOH E 3 .   ? 34.814 79.445  57.368  1.00 53.61 ? 2128 HOH A O   1 
HETATM 7726 O O   . HOH E 3 .   ? 29.082 83.631  57.218  1.00 36.55 ? 2129 HOH A O   1 
HETATM 7727 O O   . HOH E 3 .   ? 32.963 87.017  47.731  1.00 49.44 ? 2130 HOH A O   1 
HETATM 7728 O O   . HOH E 3 .   ? 43.491 79.067  44.233  1.00 38.81 ? 2131 HOH A O   1 
HETATM 7729 O O   . HOH F 3 .   ? 58.146 21.650  -33.672 1.00 37.03 ? 2001 HOH B O   1 
HETATM 7730 O O   . HOH F 3 .   ? 51.680 23.042  -43.882 1.00 39.66 ? 2002 HOH B O   1 
HETATM 7731 O O   . HOH F 3 .   ? 51.644 26.725  -52.078 1.00 38.87 ? 2003 HOH B O   1 
HETATM 7732 O O   . HOH F 3 .   ? 68.057 39.399  -20.805 1.00 22.35 ? 2004 HOH B O   1 
HETATM 7733 O O   . HOH F 3 .   ? 40.672 39.478  -39.757 1.00 48.17 ? 2005 HOH B O   1 
HETATM 7734 O O   . HOH F 3 .   ? 63.486 49.686  -18.177 1.00 31.11 ? 2006 HOH B O   1 
HETATM 7735 O O   . HOH F 3 .   ? 65.066 29.379  -6.032  1.00 21.99 ? 2007 HOH B O   1 
HETATM 7736 O O   . HOH F 3 .   ? 73.505 44.220  -6.295  1.00 40.98 ? 2008 HOH B O   1 
HETATM 7737 O O   . HOH F 3 .   ? 53.379 21.140  -33.615 1.00 30.34 ? 2009 HOH B O   1 
HETATM 7738 O O   . HOH F 3 .   ? 54.393 20.233  -40.599 1.00 49.72 ? 2010 HOH B O   1 
HETATM 7739 O O   . HOH F 3 .   ? 59.288 26.758  -39.479 1.00 34.79 ? 2011 HOH B O   1 
HETATM 7740 O O   . HOH F 3 .   ? 45.354 26.192  -25.316 1.00 39.09 ? 2012 HOH B O   1 
HETATM 7741 O O   . HOH F 3 .   ? 55.586 21.317  -32.320 1.00 40.26 ? 2013 HOH B O   1 
HETATM 7742 O O   . HOH F 3 .   ? 49.244 48.339  25.434  1.00 39.71 ? 2014 HOH B O   1 
HETATM 7743 O O   . HOH F 3 .   ? 48.113 51.497  24.874  1.00 31.58 ? 2015 HOH B O   1 
HETATM 7744 O O   . HOH F 3 .   ? 60.916 30.563  -33.307 1.00 37.32 ? 2016 HOH B O   1 
HETATM 7745 O O   . HOH F 3 .   ? 66.265 33.430  -29.663 1.00 34.59 ? 2017 HOH B O   1 
HETATM 7746 O O   . HOH F 3 .   ? 63.758 40.306  -27.427 1.00 22.05 ? 2018 HOH B O   1 
HETATM 7747 O O   . HOH F 3 .   ? 50.232 48.636  -35.512 1.00 45.69 ? 2019 HOH B O   1 
HETATM 7748 O O   . HOH F 3 .   ? 62.175 24.870  -10.313 1.00 27.49 ? 2020 HOH B O   1 
HETATM 7749 O O   . HOH F 3 .   ? 66.206 29.110  -25.620 1.00 26.81 ? 2021 HOH B O   1 
HETATM 7750 O O   . HOH F 3 .   ? 66.743 37.270  -21.533 1.00 8.82  ? 2022 HOH B O   1 
HETATM 7751 O O   . HOH F 3 .   ? 71.263 33.210  -21.714 1.00 24.20 ? 2023 HOH B O   1 
HETATM 7752 O O   . HOH F 3 .   ? 70.917 33.688  -24.991 1.00 16.91 ? 2024 HOH B O   1 
HETATM 7753 O O   . HOH F 3 .   ? 67.867 40.662  -22.931 1.00 32.34 ? 2025 HOH B O   1 
HETATM 7754 O O   . HOH F 3 .   ? 65.007 41.535  -25.047 1.00 17.95 ? 2026 HOH B O   1 
HETATM 7755 O O   . HOH F 3 .   ? 70.135 42.594  -23.542 1.00 32.80 ? 2027 HOH B O   1 
HETATM 7756 O O   . HOH F 3 .   ? 71.400 42.656  -20.850 1.00 23.94 ? 2028 HOH B O   1 
HETATM 7757 O O   . HOH F 3 .   ? 60.954 49.291  -17.854 1.00 14.77 ? 2029 HOH B O   1 
HETATM 7758 O O   . HOH F 3 .   ? 66.678 48.470  -21.271 1.00 31.26 ? 2030 HOH B O   1 
HETATM 7759 O O   . HOH F 3 .   ? 53.511 51.129  -17.650 1.00 26.32 ? 2031 HOH B O   1 
HETATM 7760 O O   . HOH F 3 .   ? 45.604 51.116  -20.863 1.00 38.48 ? 2032 HOH B O   1 
HETATM 7761 O O   . HOH F 3 .   ? 46.317 41.774  -22.917 1.00 40.69 ? 2033 HOH B O   1 
HETATM 7762 O O   . HOH F 3 .   ? 63.210 29.040  -7.835  1.00 19.93 ? 2034 HOH B O   1 
HETATM 7763 O O   . HOH F 3 .   ? 72.609 33.807  -4.515  1.00 25.86 ? 2035 HOH B O   1 
HETATM 7764 O O   . HOH F 3 .   ? 69.772 30.393  -6.218  1.00 24.27 ? 2036 HOH B O   1 
HETATM 7765 O O   . HOH F 3 .   ? 66.266 35.215  -6.148  1.00 21.20 ? 2037 HOH B O   1 
HETATM 7766 O O   . HOH F 3 .   ? 69.080 33.120  -1.671  1.00 25.02 ? 2038 HOH B O   1 
HETATM 7767 O O   . HOH F 3 .   ? 66.130 31.144  -4.736  1.00 33.09 ? 2039 HOH B O   1 
HETATM 7768 O O   . HOH F 3 .   ? 73.576 36.152  -8.532  1.00 29.35 ? 2040 HOH B O   1 
HETATM 7769 O O   . HOH F 3 .   ? 71.411 44.120  -8.509  1.00 28.32 ? 2041 HOH B O   1 
HETATM 7770 O O   . HOH F 3 .   ? 72.061 41.589  -6.472  1.00 37.35 ? 2042 HOH B O   1 
HETATM 7771 O O   . HOH F 3 .   ? 66.329 46.452  -11.109 1.00 16.07 ? 2043 HOH B O   1 
HETATM 7772 O O   . HOH F 3 .   ? 72.691 45.655  -11.939 1.00 44.50 ? 2044 HOH B O   1 
HETATM 7773 O O   . HOH F 3 .   ? 72.448 46.179  -16.203 1.00 28.01 ? 2045 HOH B O   1 
HETATM 7774 O O   . HOH F 3 .   ? 69.504 48.572  -17.174 1.00 33.93 ? 2046 HOH B O   1 
HETATM 7775 O O   . HOH F 3 .   ? 65.953 50.018  -11.279 1.00 26.37 ? 2047 HOH B O   1 
HETATM 7776 O O   . HOH F 3 .   ? 50.304 52.475  -3.683  1.00 51.04 ? 2048 HOH B O   1 
HETATM 7777 O O   . HOH F 3 .   ? 54.680 54.171  -6.839  1.00 31.28 ? 2049 HOH B O   1 
HETATM 7778 O O   . HOH F 3 .   ? 46.828 42.825  -14.603 1.00 35.57 ? 2050 HOH B O   1 
HETATM 7779 O O   . HOH F 3 .   ? 66.596 32.549  -1.790  1.00 76.62 ? 2051 HOH B O   1 
HETATM 7780 O O   . HOH F 3 .   ? 63.994 31.545  -2.765  1.00 15.27 ? 2052 HOH B O   1 
HETATM 7781 O O   . HOH F 3 .   ? 65.078 36.165  0.914   1.00 19.00 ? 2053 HOH B O   1 
HETATM 7782 O O   . HOH F 3 .   ? 73.526 39.495  -6.137  1.00 29.09 ? 2054 HOH B O   1 
HETATM 7783 O O   . HOH F 3 .   ? 72.429 36.049  0.881   1.00 39.07 ? 2055 HOH B O   1 
HETATM 7784 O O   . HOH F 3 .   ? 72.840 45.162  -3.679  1.00 15.77 ? 2056 HOH B O   1 
HETATM 7785 O O   . HOH F 3 .   ? 73.966 38.663  -1.215  1.00 24.90 ? 2057 HOH B O   1 
HETATM 7786 O O   . HOH F 3 .   ? 69.844 49.886  4.858   1.00 32.32 ? 2058 HOH B O   1 
HETATM 7787 O O   . HOH F 3 .   ? 67.753 49.572  -6.673  1.00 31.57 ? 2059 HOH B O   1 
HETATM 7788 O O   . HOH F 3 .   ? 62.772 50.734  0.172   1.00 25.28 ? 2060 HOH B O   1 
HETATM 7789 O O   . HOH F 3 .   ? 73.342 49.627  -0.984  1.00 48.17 ? 2061 HOH B O   1 
HETATM 7790 O O   . HOH F 3 .   ? 71.885 47.594  -4.188  1.00 38.38 ? 2062 HOH B O   1 
HETATM 7791 O O   . HOH F 3 .   ? 63.894 53.223  -8.022  1.00 37.22 ? 2063 HOH B O   1 
HETATM 7792 O O   . HOH F 3 .   ? 66.020 54.314  0.429   1.00 46.80 ? 2064 HOH B O   1 
HETATM 7793 O O   . HOH F 3 .   ? 54.509 53.448  4.178   1.00 22.11 ? 2065 HOH B O   1 
HETATM 7794 O O   . HOH F 3 .   ? 43.243 42.564  -5.661  1.00 36.42 ? 2066 HOH B O   1 
HETATM 7795 O O   . HOH F 3 .   ? 50.226 31.767  -1.610  1.00 53.02 ? 2067 HOH B O   1 
HETATM 7796 O O   . HOH F 3 .   ? 73.034 44.180  5.632   1.00 31.80 ? 2068 HOH B O   1 
HETATM 7797 O O   . HOH F 3 .   ? 72.136 40.309  10.519  1.00 29.71 ? 2069 HOH B O   1 
HETATM 7798 O O   . HOH F 3 .   ? 69.447 50.140  9.323   1.00 30.95 ? 2070 HOH B O   1 
HETATM 7799 O O   . HOH F 3 .   ? 57.362 48.520  12.753  1.00 14.67 ? 2071 HOH B O   1 
HETATM 7800 O O   . HOH F 3 .   ? 61.000 56.060  10.721  1.00 13.00 ? 2072 HOH B O   1 
HETATM 7801 O O   . HOH F 3 .   ? 67.803 52.128  9.185   1.00 22.70 ? 2073 HOH B O   1 
HETATM 7802 O O   . HOH F 3 .   ? 56.717 53.991  5.818   1.00 26.46 ? 2074 HOH B O   1 
HETATM 7803 O O   . HOH F 3 .   ? 52.859 50.857  9.938   1.00 12.30 ? 2075 HOH B O   1 
HETATM 7804 O O   . HOH F 3 .   ? 47.666 44.567  7.785   1.00 30.42 ? 2076 HOH B O   1 
HETATM 7805 O O   . HOH F 3 .   ? 45.969 34.458  16.079  1.00 42.98 ? 2077 HOH B O   1 
HETATM 7806 O O   . HOH F 3 .   ? 39.256 39.260  7.899   1.00 48.00 ? 2078 HOH B O   1 
HETATM 7807 O O   . HOH F 3 .   ? 50.134 29.834  2.977   1.00 48.26 ? 2079 HOH B O   1 
HETATM 7808 O O   . HOH F 3 .   ? 54.272 30.780  10.155  1.00 31.92 ? 2080 HOH B O   1 
HETATM 7809 O O   . HOH F 3 .   ? 63.499 31.534  13.903  1.00 34.00 ? 2081 HOH B O   1 
HETATM 7810 O O   . HOH F 3 .   ? 63.734 32.919  11.710  1.00 30.59 ? 2082 HOH B O   1 
HETATM 7811 O O   . HOH F 3 .   ? 70.019 45.338  15.062  1.00 29.70 ? 2083 HOH B O   1 
HETATM 7812 O O   . HOH F 3 .   ? 69.609 47.879  20.127  1.00 31.69 ? 2084 HOH B O   1 
HETATM 7813 O O   . HOH F 3 .   ? 71.140 45.037  23.974  1.00 34.47 ? 2085 HOH B O   1 
HETATM 7814 O O   . HOH F 3 .   ? 61.084 45.287  23.989  1.00 22.83 ? 2086 HOH B O   1 
HETATM 7815 O O   . HOH F 3 .   ? 63.098 40.887  25.997  1.00 38.18 ? 2087 HOH B O   1 
HETATM 7816 O O   . HOH F 3 .   ? 61.497 48.621  21.539  1.00 22.46 ? 2088 HOH B O   1 
HETATM 7817 O O   . HOH F 3 .   ? 67.279 44.040  13.511  1.00 27.96 ? 2089 HOH B O   1 
HETATM 7818 O O   . HOH F 3 .   ? 58.132 45.876  27.066  1.00 40.40 ? 2090 HOH B O   1 
HETATM 7819 O O   . HOH F 3 .   ? 54.171 40.376  28.722  1.00 51.99 ? 2091 HOH B O   1 
HETATM 7820 O O   . HOH F 3 .   ? 50.209 50.452  25.263  1.00 16.64 ? 2092 HOH B O   1 
HETATM 7821 O O   . HOH F 3 .   ? 48.572 24.590  20.351  1.00 21.29 ? 2093 HOH B O   1 
HETATM 7822 O O   . HOH F 3 .   ? 48.338 21.742  32.677  1.00 37.43 ? 2094 HOH B O   1 
HETATM 7823 O O   . HOH F 3 .   ? 44.295 13.811  15.271  1.00 35.46 ? 2095 HOH B O   1 
HETATM 7824 O O   . HOH F 3 .   ? 45.348 16.638  9.729   1.00 46.60 ? 2096 HOH B O   1 
HETATM 7825 O O   . HOH F 3 .   ? 41.071 12.902  8.125   1.00 56.89 ? 2097 HOH B O   1 
HETATM 7826 O O   . HOH F 3 .   ? 36.118 14.317  6.980   1.00 39.92 ? 2098 HOH B O   1 
HETATM 7827 O O   . HOH G 3 .   ? 57.913 20.514  -11.641 1.00 40.08 ? 2001 HOH D O   1 
HETATM 7828 O O   . HOH G 3 .   ? 65.800 27.425  -2.351  1.00 41.50 ? 2002 HOH D O   1 
HETATM 7829 O O   . HOH G 3 .   ? 62.082 29.875  -2.888  1.00 21.58 ? 2003 HOH D O   1 
HETATM 7830 O O   . HOH G 3 .   ? 60.167 29.271  7.309   1.00 22.55 ? 2004 HOH D O   1 
HETATM 7831 O O   . HOH G 3 .   ? 56.225 14.931  1.000   1.00 35.09 ? 2005 HOH D O   1 
HETATM 7832 O O   . HOH G 3 .   ? 65.099 25.198  -7.310  1.00 36.17 ? 2006 HOH D O   1 
HETATM 7833 O O   . HOH G 3 .   ? 60.118 20.901  -10.308 1.00 35.88 ? 2007 HOH D O   1 
HETATM 7834 O O   . HOH G 3 .   ? 57.485 24.540  -10.667 1.00 13.82 ? 2008 HOH D O   1 
HETATM 7835 O O   . HOH G 3 .   ? 55.569 28.187  -4.139  1.00 27.92 ? 2009 HOH D O   1 
HETATM 7836 O O   . HOH G 3 .   ? 56.187 24.680  -3.198  1.00 28.04 ? 2010 HOH D O   1 
HETATM 7837 O O   . HOH G 3 .   ? 62.608 26.036  -8.005  1.00 20.47 ? 2011 HOH D O   1 
HETATM 7838 O O   . HOH G 3 .   ? 56.849 35.020  -3.066  1.00 20.03 ? 2012 HOH D O   1 
HETATM 7839 O O   . HOH G 3 .   ? 53.021 28.834  -7.624  1.00 40.31 ? 2013 HOH D O   1 
HETATM 7840 O O   . HOH G 3 .   ? 35.535 37.234  -30.719 1.00 52.01 ? 2014 HOH D O   1 
HETATM 7841 O O   . HOH H 3 .   ? 46.880 56.179  34.089  1.00 36.28 ? 2001 HOH E O   1 
HETATM 7842 O O   . HOH H 3 .   ? 51.401 54.004  36.529  1.00 40.87 ? 2002 HOH E O   1 
HETATM 7843 O O   . HOH H 3 .   ? 47.146 55.421  31.659  1.00 36.62 ? 2003 HOH E O   1 
HETATM 7844 O O   . HOH H 3 .   ? 53.942 53.840  37.458  1.00 50.96 ? 2004 HOH E O   1 
HETATM 7845 O O   . HOH H 3 .   ? 51.632 58.895  35.233  1.00 22.41 ? 2005 HOH E O   1 
HETATM 7846 O O   . HOH H 3 .   ? 51.755 58.775  44.145  1.00 37.22 ? 2006 HOH E O   1 
HETATM 7847 O O   . HOH H 3 .   ? 52.094 60.316  42.045  1.00 36.69 ? 2007 HOH E O   1 
HETATM 7848 O O   . HOH H 3 .   ? 51.380 61.355  45.518  1.00 23.92 ? 2008 HOH E O   1 
HETATM 7849 O O   . HOH H 3 .   ? 36.821 65.494  39.337  1.00 29.92 ? 2009 HOH E O   1 
HETATM 7850 O O   . HOH H 3 .   ? 32.920 61.743  37.346  1.00 58.60 ? 2010 HOH E O   1 
HETATM 7851 O O   . HOH H 3 .   ? 44.535 56.580  28.045  1.00 32.96 ? 2011 HOH E O   1 
HETATM 7852 O O   . HOH H 3 .   ? 42.491 60.833  28.291  1.00 19.77 ? 2012 HOH E O   1 
HETATM 7853 O O   . HOH H 3 .   ? 41.814 58.538  27.759  1.00 34.56 ? 2013 HOH E O   1 
HETATM 7854 O O   . HOH H 3 .   ? 45.221 60.831  28.833  1.00 18.36 ? 2014 HOH E O   1 
HETATM 7855 O O   . HOH H 3 .   ? 46.090 63.141  27.546  1.00 11.42 ? 2015 HOH E O   1 
HETATM 7856 O O   . HOH H 3 .   ? 50.146 65.266  33.700  1.00 27.76 ? 2016 HOH E O   1 
HETATM 7857 O O   . HOH H 3 .   ? 46.490 64.789  34.892  1.00 20.04 ? 2017 HOH E O   1 
HETATM 7858 O O   . HOH H 3 .   ? 42.790 70.808  35.282  1.00 23.24 ? 2018 HOH E O   1 
HETATM 7859 O O   . HOH H 3 .   ? 32.200 55.363  49.087  1.00 56.61 ? 2019 HOH E O   1 
HETATM 7860 O O   . HOH H 3 .   ? 47.581 58.006  30.424  1.00 24.50 ? 2020 HOH E O   1 
HETATM 7861 O O   . HOH H 3 .   ? 57.097 64.291  34.731  1.00 19.78 ? 2021 HOH E O   1 
HETATM 7862 O O   . HOH H 3 .   ? 50.322 67.480  29.977  1.00 39.48 ? 2022 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   63  ?   ?   ?   A . n 
A 1 2   ALA 2   64  ?   ?   ?   A . n 
A 1 3   MET 3   65  ?   ?   ?   A . n 
A 1 4   GLY 4   66  ?   ?   ?   A . n 
A 1 5   PHE 5   67  ?   ?   ?   A . n 
A 1 6   HIS 6   68  ?   ?   ?   A . n 
A 1 7   GLU 7   69  ?   ?   ?   A . n 
A 1 8   ALA 8   70  ?   ?   ?   A . n 
A 1 9   GLN 9   71  ?   ?   ?   A . n 
A 1 10  ILE 10  72  ?   ?   ?   A . n 
A 1 11  ASN 11  73  ?   ?   ?   A . n 
A 1 12  ASN 12  74  ?   ?   ?   A . n 
A 1 13  MET 13  75  ?   ?   ?   A . n 
A 1 14  GLU 14  76  ?   ?   ?   A . n 
A 1 15  MET 15  77  ?   ?   ?   A . n 
A 1 16  ALA 16  78  ?   ?   ?   A . n 
A 1 17  PRO 17  79  ?   ?   ?   A . n 
A 1 18  GLY 18  80  ?   ?   ?   A . n 
A 1 19  GLY 19  81  ?   ?   ?   A . n 
A 1 20  VAL 20  82  ?   ?   ?   A . n 
A 1 21  ILE 21  83  ?   ?   ?   A . n 
A 1 22  THR 22  84  84  THR THR A . n 
A 1 23  SER 23  85  85  SER SER A . n 
A 1 24  ASP 24  86  86  ASP ASP A . n 
A 1 25  MET 25  87  87  MET MET A . n 
A 1 26  ILE 26  88  88  ILE ILE A . n 
A 1 27  GLU 27  89  89  GLU GLU A . n 
A 1 28  MET 28  90  90  MET MET A . n 
A 1 29  ILE 29  91  91  ILE ILE A . n 
A 1 30  PHE 30  92  92  PHE PHE A . n 
A 1 31  SER 31  93  93  SER SER A . n 
A 1 32  LYS 32  94  94  LYS LYS A . n 
A 1 33  SER 33  95  95  SER SER A . n 
A 1 34  PRO 34  96  96  PRO PRO A . n 
A 1 35  GLU 35  97  97  GLU GLU A . n 
A 1 36  GLN 36  98  98  GLN GLN A . n 
A 1 37  GLN 37  99  99  GLN GLN A . n 
A 1 38  LEU 38  100 100 LEU LEU A . n 
A 1 39  SER 39  101 101 SER SER A . n 
A 1 40  ALA 40  102 102 ALA ALA A . n 
A 1 41  THR 41  103 103 THR THR A . n 
A 1 42  GLN 42  104 104 GLN GLN A . n 
A 1 43  LYS 43  105 105 LYS LYS A . n 
A 1 44  PHE 44  106 106 PHE PHE A . n 
A 1 45  ARG 45  107 107 ARG ARG A . n 
A 1 46  LYS 46  108 108 LYS LYS A . n 
A 1 47  LEU 47  109 109 LEU LEU A . n 
A 1 48  LEU 48  110 110 LEU LEU A . n 
A 1 49  SER 49  111 111 SER SER A . n 
A 1 50  LYS 50  112 112 LYS LYS A . n 
A 1 51  GLU 51  113 113 GLU GLU A . n 
A 1 52  PRO 52  114 114 PRO PRO A . n 
A 1 53  ASN 53  115 115 ASN ASN A . n 
A 1 54  PRO 54  116 116 PRO PRO A . n 
A 1 55  PRO 55  117 117 PRO PRO A . n 
A 1 56  ILE 56  118 118 ILE ILE A . n 
A 1 57  ASP 57  119 119 ASP ASP A . n 
A 1 58  GLU 58  120 120 GLU GLU A . n 
A 1 59  VAL 59  121 121 VAL VAL A . n 
A 1 60  ILE 60  122 122 ILE ILE A . n 
A 1 61  SER 61  123 123 SER SER A . n 
A 1 62  THR 62  124 124 THR THR A . n 
A 1 63  PRO 63  125 125 PRO PRO A . n 
A 1 64  GLY 64  126 126 GLY GLY A . n 
A 1 65  VAL 65  127 127 VAL VAL A . n 
A 1 66  VAL 66  128 128 VAL VAL A . n 
A 1 67  ALA 67  129 129 ALA ALA A . n 
A 1 68  ARG 68  130 130 ARG ARG A . n 
A 1 69  PHE 69  131 131 PHE PHE A . n 
A 1 70  VAL 70  132 132 VAL VAL A . n 
A 1 71  GLU 71  133 133 GLU GLU A . n 
A 1 72  PHE 72  134 134 PHE PHE A . n 
A 1 73  LEU 73  135 135 LEU LEU A . n 
A 1 74  LYS 74  136 136 LYS LYS A . n 
A 1 75  ARG 75  137 137 ARG ARG A . n 
A 1 76  LYS 76  138 138 LYS LYS A . n 
A 1 77  GLU 77  139 139 GLU GLU A . n 
A 1 78  ASN 78  140 140 ASN ASN A . n 
A 1 79  CYS 79  141 141 CYS CYS A . n 
A 1 80  THR 80  142 142 THR THR A . n 
A 1 81  LEU 81  143 143 LEU LEU A . n 
A 1 82  GLN 82  144 144 GLN GLN A . n 
A 1 83  PHE 83  145 145 PHE PHE A . n 
A 1 84  GLU 84  146 146 GLU GLU A . n 
A 1 85  SER 85  147 147 SER SER A . n 
A 1 86  ALA 86  148 148 ALA ALA A . n 
A 1 87  TRP 87  149 149 TRP TRP A . n 
A 1 88  VAL 88  150 150 VAL VAL A . n 
A 1 89  LEU 89  151 151 LEU LEU A . n 
A 1 90  THR 90  152 152 THR THR A . n 
A 1 91  ASN 91  153 153 ASN ASN A . n 
A 1 92  ILE 92  154 154 ILE ILE A . n 
A 1 93  ALA 93  155 155 ALA ALA A . n 
A 1 94  SER 94  156 156 SER SER A . n 
A 1 95  GLY 95  157 157 GLY GLY A . n 
A 1 96  ASN 96  158 158 ASN ASN A . n 
A 1 97  SER 97  159 159 SER SER A . n 
A 1 98  LEU 98  160 160 LEU LEU A . n 
A 1 99  GLN 99  161 161 GLN GLN A . n 
A 1 100 THR 100 162 162 THR THR A . n 
A 1 101 ARG 101 163 163 ARG ARG A . n 
A 1 102 ILE 102 164 164 ILE ILE A . n 
A 1 103 VAL 103 165 165 VAL VAL A . n 
A 1 104 ILE 104 166 166 ILE ILE A . n 
A 1 105 GLN 105 167 167 GLN GLN A . n 
A 1 106 ALA 106 168 168 ALA ALA A . n 
A 1 107 GLY 107 169 169 GLY GLY A . n 
A 1 108 ALA 108 170 170 ALA ALA A . n 
A 1 109 VAL 109 171 171 VAL VAL A . n 
A 1 110 PRO 110 172 172 PRO PRO A . n 
A 1 111 ILE 111 173 173 ILE ILE A . n 
A 1 112 PHE 112 174 174 PHE PHE A . n 
A 1 113 ILE 113 175 175 ILE ILE A . n 
A 1 114 GLU 114 176 176 GLU GLU A . n 
A 1 115 LEU 115 177 177 LEU LEU A . n 
A 1 116 LEU 116 178 178 LEU LEU A . n 
A 1 117 SER 117 179 179 SER SER A . n 
A 1 118 SER 118 180 180 SER SER A . n 
A 1 119 GLU 119 181 181 GLU GLU A . n 
A 1 120 PHE 120 182 182 PHE PHE A . n 
A 1 121 GLU 121 183 183 GLU GLU A . n 
A 1 122 ASP 122 184 184 ASP ASP A . n 
A 1 123 VAL 123 185 185 VAL VAL A . n 
A 1 124 GLN 124 186 186 GLN GLN A . n 
A 1 125 GLU 125 187 187 GLU GLU A . n 
A 1 126 GLN 126 188 188 GLN GLN A . n 
A 1 127 ALA 127 189 189 ALA ALA A . n 
A 1 128 VAL 128 190 190 VAL VAL A . n 
A 1 129 TRP 129 191 191 TRP TRP A . n 
A 1 130 ALA 130 192 192 ALA ALA A . n 
A 1 131 LEU 131 193 193 LEU LEU A . n 
A 1 132 GLY 132 194 194 GLY GLY A . n 
A 1 133 ASN 133 195 195 ASN ASN A . n 
A 1 134 ILE 134 196 196 ILE ILE A . n 
A 1 135 ALA 135 197 197 ALA ALA A . n 
A 1 136 GLY 136 198 198 GLY GLY A . n 
A 1 137 ASP 137 199 199 ASP ASP A . n 
A 1 138 SER 138 200 200 SER SER A . n 
A 1 139 THR 139 201 201 THR THR A . n 
A 1 140 MET 140 202 202 MET MET A . n 
A 1 141 CYS 141 203 203 CYS CYS A . n 
A 1 142 ARG 142 204 204 ARG ARG A . n 
A 1 143 ASP 143 205 205 ASP ASP A . n 
A 1 144 TYR 144 206 206 TYR TYR A . n 
A 1 145 VAL 145 207 207 VAL VAL A . n 
A 1 146 LEU 146 208 208 LEU LEU A . n 
A 1 147 ASP 147 209 209 ASP ASP A . n 
A 1 148 CYS 148 210 210 CYS CYS A . n 
A 1 149 ASN 149 211 211 ASN ASN A . n 
A 1 150 ILE 150 212 212 ILE ILE A . n 
A 1 151 LEU 151 213 213 LEU LEU A . n 
A 1 152 PRO 152 214 214 PRO PRO A . n 
A 1 153 PRO 153 215 215 PRO PRO A . n 
A 1 154 LEU 154 216 216 LEU LEU A . n 
A 1 155 LEU 155 217 217 LEU LEU A . n 
A 1 156 GLN 156 218 218 GLN GLN A . n 
A 1 157 LEU 157 219 219 LEU LEU A . n 
A 1 158 PHE 158 220 220 PHE PHE A . n 
A 1 159 SER 159 221 221 SER SER A . n 
A 1 160 LYS 160 222 222 LYS LYS A . n 
A 1 161 GLN 161 223 223 GLN GLN A . n 
A 1 162 ASN 162 224 224 ASN ASN A . n 
A 1 163 ARG 163 225 225 ARG ARG A . n 
A 1 164 LEU 164 226 226 LEU LEU A . n 
A 1 165 THR 165 227 227 THR THR A . n 
A 1 166 MET 166 228 228 MET MET A . n 
A 1 167 THR 167 229 229 THR THR A . n 
A 1 168 ARG 168 230 230 ARG ARG A . n 
A 1 169 ASN 169 231 231 ASN ASN A . n 
A 1 170 ALA 170 232 232 ALA ALA A . n 
A 1 171 VAL 171 233 233 VAL VAL A . n 
A 1 172 TRP 172 234 234 TRP TRP A . n 
A 1 173 ALA 173 235 235 ALA ALA A . n 
A 1 174 LEU 174 236 236 LEU LEU A . n 
A 1 175 SER 175 237 237 SER SER A . n 
A 1 176 ASN 176 238 238 ASN ASN A . n 
A 1 177 LEU 177 239 239 LEU LEU A . n 
A 1 178 CYS 178 240 240 CYS CYS A . n 
A 1 179 ARG 179 241 241 ARG ARG A . n 
A 1 180 GLY 180 242 242 GLY GLY A . n 
A 1 181 LYS 181 243 243 LYS LYS A . n 
A 1 182 SER 182 244 244 SER SER A . n 
A 1 183 PRO 183 245 245 PRO PRO A . n 
A 1 184 PRO 184 246 246 PRO PRO A . n 
A 1 185 PRO 185 247 247 PRO PRO A . n 
A 1 186 GLU 186 248 248 GLU GLU A . n 
A 1 187 PHE 187 249 249 PHE PHE A . n 
A 1 188 ALA 188 250 250 ALA ALA A . n 
A 1 189 LYS 189 251 251 LYS LYS A . n 
A 1 190 VAL 190 252 252 VAL VAL A . n 
A 1 191 SER 191 253 253 SER SER A . n 
A 1 192 PRO 192 254 254 PRO PRO A . n 
A 1 193 CYS 193 255 255 CYS CYS A . n 
A 1 194 LEU 194 256 256 LEU LEU A . n 
A 1 195 ASN 195 257 257 ASN ASN A . n 
A 1 196 VAL 196 258 258 VAL VAL A . n 
A 1 197 LEU 197 259 259 LEU LEU A . n 
A 1 198 SER 198 260 260 SER SER A . n 
A 1 199 TRP 199 261 261 TRP TRP A . n 
A 1 200 LEU 200 262 262 LEU LEU A . n 
A 1 201 LEU 201 263 263 LEU LEU A . n 
A 1 202 PHE 202 264 264 PHE PHE A . n 
A 1 203 VAL 203 265 265 VAL VAL A . n 
A 1 204 SER 204 266 266 SER SER A . n 
A 1 205 ASP 205 267 267 ASP ASP A . n 
A 1 206 THR 206 268 268 THR THR A . n 
A 1 207 ASP 207 269 269 ASP ASP A . n 
A 1 208 VAL 208 270 270 VAL VAL A . n 
A 1 209 LEU 209 271 271 LEU LEU A . n 
A 1 210 ALA 210 272 272 ALA ALA A . n 
A 1 211 ASP 211 273 273 ASP ASP A . n 
A 1 212 ALA 212 274 274 ALA ALA A . n 
A 1 213 CYS 213 275 275 CYS CYS A . n 
A 1 214 TRP 214 276 276 TRP TRP A . n 
A 1 215 ALA 215 277 277 ALA ALA A . n 
A 1 216 LEU 216 278 278 LEU LEU A . n 
A 1 217 SER 217 279 279 SER SER A . n 
A 1 218 TYR 218 280 280 TYR TYR A . n 
A 1 219 LEU 219 281 281 LEU LEU A . n 
A 1 220 SER 220 282 282 SER SER A . n 
A 1 221 ASP 221 283 283 ASP ASP A . n 
A 1 222 GLY 222 284 284 GLY GLY A . n 
A 1 223 PRO 223 285 285 PRO PRO A . n 
A 1 224 ASN 224 286 286 ASN ASN A . n 
A 1 225 ASP 225 287 287 ASP ASP A . n 
A 1 226 LYS 226 288 288 LYS LYS A . n 
A 1 227 ILE 227 289 289 ILE ILE A . n 
A 1 228 GLN 228 290 290 GLN GLN A . n 
A 1 229 ALA 229 291 291 ALA ALA A . n 
A 1 230 VAL 230 292 292 VAL VAL A . n 
A 1 231 ILE 231 293 293 ILE ILE A . n 
A 1 232 ASP 232 294 294 ASP ASP A . n 
A 1 233 ALA 233 295 295 ALA ALA A . n 
A 1 234 GLY 234 296 296 GLY GLY A . n 
A 1 235 VAL 235 297 297 VAL VAL A . n 
A 1 236 CYS 236 298 298 CYS CYS A . n 
A 1 237 ARG 237 299 299 ARG ARG A . n 
A 1 238 ARG 238 300 300 ARG ARG A . n 
A 1 239 LEU 239 301 301 LEU LEU A . n 
A 1 240 VAL 240 302 302 VAL VAL A . n 
A 1 241 GLU 241 303 303 GLU GLU A . n 
A 1 242 LEU 242 304 304 LEU LEU A . n 
A 1 243 LEU 243 305 305 LEU LEU A . n 
A 1 244 MET 244 306 306 MET MET A . n 
A 1 245 HIS 245 307 307 HIS HIS A . n 
A 1 246 ASN 246 308 308 ASN ASN A . n 
A 1 247 ASP 247 309 309 ASP ASP A . n 
A 1 248 TYR 248 310 310 TYR TYR A . n 
A 1 249 LYS 249 311 311 LYS LYS A . n 
A 1 250 VAL 250 312 312 VAL VAL A . n 
A 1 251 VAL 251 313 313 VAL VAL A . n 
A 1 252 SER 252 314 314 SER SER A . n 
A 1 253 PRO 253 315 315 PRO PRO A . n 
A 1 254 ALA 254 316 316 ALA ALA A . n 
A 1 255 LEU 255 317 317 LEU LEU A . n 
A 1 256 ARG 256 318 318 ARG ARG A . n 
A 1 257 ALA 257 319 319 ALA ALA A . n 
A 1 258 VAL 258 320 320 VAL VAL A . n 
A 1 259 GLY 259 321 321 GLY GLY A . n 
A 1 260 ASN 260 322 322 ASN ASN A . n 
A 1 261 ILE 261 323 323 ILE ILE A . n 
A 1 262 VAL 262 324 324 VAL VAL A . n 
A 1 263 THR 263 325 325 THR THR A . n 
A 1 264 GLY 264 326 326 GLY GLY A . n 
A 1 265 ASP 265 327 327 ASP ASP A . n 
A 1 266 ASP 266 328 328 ASP ASP A . n 
A 1 267 ILE 267 329 329 ILE ILE A . n 
A 1 268 GLN 268 330 330 GLN GLN A . n 
A 1 269 THR 269 331 331 THR THR A . n 
A 1 270 GLN 270 332 332 GLN GLN A . n 
A 1 271 VAL 271 333 333 VAL VAL A . n 
A 1 272 ILE 272 334 334 ILE ILE A . n 
A 1 273 LEU 273 335 335 LEU LEU A . n 
A 1 274 ASN 274 336 336 ASN ASN A . n 
A 1 275 CYS 275 337 337 CYS CYS A . n 
A 1 276 SER 276 338 338 SER SER A . n 
A 1 277 ALA 277 339 339 ALA ALA A . n 
A 1 278 LEU 278 340 340 LEU LEU A . n 
A 1 279 GLN 279 341 341 GLN GLN A . n 
A 1 280 SER 280 342 342 SER SER A . n 
A 1 281 LEU 281 343 343 LEU LEU A . n 
A 1 282 LEU 282 344 344 LEU LEU A . n 
A 1 283 HIS 283 345 345 HIS HIS A . n 
A 1 284 LEU 284 346 346 LEU LEU A . n 
A 1 285 LEU 285 347 347 LEU LEU A . n 
A 1 286 SER 286 348 348 SER SER A . n 
A 1 287 SER 287 349 349 SER SER A . n 
A 1 288 PRO 288 350 350 PRO PRO A . n 
A 1 289 LYS 289 351 351 LYS LYS A . n 
A 1 290 GLU 290 352 352 GLU GLU A . n 
A 1 291 SER 291 353 353 SER SER A . n 
A 1 292 ILE 292 354 354 ILE ILE A . n 
A 1 293 LYS 293 355 355 LYS LYS A . n 
A 1 294 LYS 294 356 356 LYS LYS A . n 
A 1 295 GLU 295 357 357 GLU GLU A . n 
A 1 296 ALA 296 358 358 ALA ALA A . n 
A 1 297 CYS 297 359 359 CYS CYS A . n 
A 1 298 TRP 298 360 360 TRP TRP A . n 
A 1 299 THR 299 361 361 THR THR A . n 
A 1 300 ILE 300 362 362 ILE ILE A . n 
A 1 301 SER 301 363 363 SER SER A . n 
A 1 302 ASN 302 364 364 ASN ASN A . n 
A 1 303 ILE 303 365 365 ILE ILE A . n 
A 1 304 THR 304 366 366 THR THR A . n 
A 1 305 ALA 305 367 367 ALA ALA A . n 
A 1 306 GLY 306 368 368 GLY GLY A . n 
A 1 307 ASN 307 369 369 ASN ASN A . n 
A 1 308 ARG 308 370 370 ARG ARG A . n 
A 1 309 ALA 309 371 371 ALA ALA A . n 
A 1 310 GLN 310 372 372 GLN GLN A . n 
A 1 311 ILE 311 373 373 ILE ILE A . n 
A 1 312 GLN 312 374 374 GLN GLN A . n 
A 1 313 THR 313 375 375 THR THR A . n 
A 1 314 VAL 314 376 376 VAL VAL A . n 
A 1 315 ILE 315 377 377 ILE ILE A . n 
A 1 316 ASP 316 378 378 ASP ASP A . n 
A 1 317 ALA 317 379 379 ALA ALA A . n 
A 1 318 ASN 318 380 380 ASN ASN A . n 
A 1 319 ILE 319 381 381 ILE ILE A . n 
A 1 320 PHE 320 382 382 PHE PHE A . n 
A 1 321 PRO 321 383 383 PRO PRO A . n 
A 1 322 ALA 322 384 384 ALA ALA A . n 
A 1 323 LEU 323 385 385 LEU LEU A . n 
A 1 324 ILE 324 386 386 ILE ILE A . n 
A 1 325 SER 325 387 387 SER SER A . n 
A 1 326 ILE 326 388 388 ILE ILE A . n 
A 1 327 LEU 327 389 389 LEU LEU A . n 
A 1 328 GLN 328 390 390 GLN GLN A . n 
A 1 329 THR 329 391 391 THR THR A . n 
A 1 330 ALA 330 392 392 ALA ALA A . n 
A 1 331 GLU 331 393 393 GLU GLU A . n 
A 1 332 PHE 332 394 394 PHE PHE A . n 
A 1 333 ARG 333 395 395 ARG ARG A . n 
A 1 334 THR 334 396 396 THR THR A . n 
A 1 335 ARG 335 397 397 ARG ARG A . n 
A 1 336 LYS 336 398 398 LYS LYS A . n 
A 1 337 GLU 337 399 399 GLU GLU A . n 
A 1 338 ALA 338 400 400 ALA ALA A . n 
A 1 339 ALA 339 401 401 ALA ALA A . n 
A 1 340 TRP 340 402 402 TRP TRP A . n 
A 1 341 ALA 341 403 403 ALA ALA A . n 
A 1 342 ILE 342 404 404 ILE ILE A . n 
A 1 343 THR 343 405 405 THR THR A . n 
A 1 344 ASN 344 406 406 ASN ASN A . n 
A 1 345 ALA 345 407 407 ALA ALA A . n 
A 1 346 THR 346 408 408 THR THR A . n 
A 1 347 SER 347 409 409 SER SER A . n 
A 1 348 GLY 348 410 410 GLY GLY A . n 
A 1 349 GLY 349 411 411 GLY GLY A . n 
A 1 350 SER 350 412 412 SER SER A . n 
A 1 351 ALA 351 413 413 ALA ALA A . n 
A 1 352 GLU 352 414 414 GLU GLU A . n 
A 1 353 GLN 353 415 415 GLN GLN A . n 
A 1 354 ILE 354 416 416 ILE ILE A . n 
A 1 355 LYS 355 417 417 LYS LYS A . n 
A 1 356 TYR 356 418 418 TYR TYR A . n 
A 1 357 LEU 357 419 419 LEU LEU A . n 
A 1 358 VAL 358 420 420 VAL VAL A . n 
A 1 359 GLU 359 421 421 GLU GLU A . n 
A 1 360 LEU 360 422 422 LEU LEU A . n 
A 1 361 GLY 361 423 423 GLY GLY A . n 
A 1 362 CYS 362 424 424 CYS CYS A . n 
A 1 363 ILE 363 425 425 ILE ILE A . n 
A 1 364 LYS 364 426 426 LYS LYS A . n 
A 1 365 PRO 365 427 427 PRO PRO A . n 
A 1 366 LEU 366 428 428 LEU LEU A . n 
A 1 367 CYS 367 429 429 CYS CYS A . n 
A 1 368 ASP 368 430 430 ASP ASP A . n 
A 1 369 LEU 369 431 431 LEU LEU A . n 
A 1 370 LEU 370 432 432 LEU LEU A . n 
A 1 371 THR 371 433 433 THR THR A . n 
A 1 372 VAL 372 434 434 VAL VAL A . n 
A 1 373 MET 373 435 435 MET MET A . n 
A 1 374 ASP 374 436 436 ASP ASP A . n 
A 1 375 SER 375 437 437 SER SER A . n 
A 1 376 LYS 376 438 438 LYS LYS A . n 
A 1 377 ILE 377 439 439 ILE ILE A . n 
A 1 378 VAL 378 440 440 VAL VAL A . n 
A 1 379 GLN 379 441 441 GLN GLN A . n 
A 1 380 VAL 380 442 442 VAL VAL A . n 
A 1 381 ALA 381 443 443 ALA ALA A . n 
A 1 382 LEU 382 444 444 LEU LEU A . n 
A 1 383 ASN 383 445 445 ASN ASN A . n 
A 1 384 GLY 384 446 446 GLY GLY A . n 
A 1 385 LEU 385 447 447 LEU LEU A . n 
A 1 386 GLU 386 448 448 GLU GLU A . n 
A 1 387 ASN 387 449 449 ASN ASN A . n 
A 1 388 ILE 388 450 450 ILE ILE A . n 
A 1 389 LEU 389 451 451 LEU LEU A . n 
A 1 390 ARG 390 452 452 ARG ARG A . n 
A 1 391 LEU 391 453 453 LEU LEU A . n 
A 1 392 GLY 392 454 454 GLY GLY A . n 
A 1 393 GLU 393 455 455 GLU GLU A . n 
A 1 394 GLN 394 456 456 GLN GLN A . n 
A 1 395 GLU 395 457 457 GLU GLU A . n 
A 1 396 ALA 396 458 458 ALA ALA A . n 
A 1 397 LYS 397 459 459 LYS LYS A . n 
A 1 398 ARG 398 460 460 ARG ARG A . n 
A 1 399 ASN 399 461 461 ASN ASN A . n 
A 1 400 GLY 400 462 462 GLY GLY A . n 
A 1 401 THR 401 463 463 THR THR A . n 
A 1 402 GLY 402 464 464 GLY GLY A . n 
A 1 403 ILE 403 465 465 ILE ILE A . n 
A 1 404 ASN 404 466 466 ASN ASN A . n 
A 1 405 PRO 405 467 467 PRO PRO A . n 
A 1 406 TYR 406 468 468 TYR TYR A . n 
A 1 407 CYS 407 469 469 CYS CYS A . n 
A 1 408 ALA 408 470 470 ALA ALA A . n 
A 1 409 LEU 409 471 471 LEU LEU A . n 
A 1 410 ILE 410 472 472 ILE ILE A . n 
A 1 411 GLU 411 473 473 GLU GLU A . n 
A 1 412 GLU 412 474 474 GLU GLU A . n 
A 1 413 ALA 413 475 475 ALA ALA A . n 
A 1 414 TYR 414 476 476 TYR TYR A . n 
A 1 415 GLY 415 477 477 GLY GLY A . n 
A 1 416 LEU 416 478 478 LEU LEU A . n 
A 1 417 ASP 417 479 479 ASP ASP A . n 
A 1 418 LYS 418 480 480 LYS LYS A . n 
A 1 419 ILE 419 481 481 ILE ILE A . n 
A 1 420 GLU 420 482 482 GLU GLU A . n 
A 1 421 PHE 421 483 483 PHE PHE A . n 
A 1 422 LEU 422 484 484 LEU LEU A . n 
A 1 423 GLN 423 485 485 GLN GLN A . n 
A 1 424 SER 424 486 486 SER SER A . n 
A 1 425 HIS 425 487 487 HIS HIS A . n 
A 1 426 GLU 426 488 488 GLU GLU A . n 
A 1 427 ASN 427 489 489 ASN ASN A . n 
A 1 428 GLN 428 490 490 GLN GLN A . n 
A 1 429 GLU 429 491 491 GLU GLU A . n 
A 1 430 ILE 430 492 492 ILE ILE A . n 
A 1 431 TYR 431 493 493 TYR TYR A . n 
A 1 432 GLN 432 494 494 GLN GLN A . n 
A 1 433 LYS 433 495 495 LYS LYS A . n 
A 1 434 ALA 434 496 496 ALA ALA A . n 
A 1 435 PHE 435 497 497 PHE PHE A . n 
A 1 436 ASP 436 498 498 ASP ASP A . n 
A 1 437 LEU 437 499 499 LEU LEU A . n 
A 1 438 ILE 438 500 500 ILE ILE A . n 
A 1 439 GLU 439 501 501 GLU GLU A . n 
A 1 440 HIS 440 502 502 HIS HIS A . n 
A 1 441 TYR 441 503 503 TYR TYR A . n 
A 1 442 PHE 442 504 504 PHE PHE A . n 
A 1 443 GLY 443 505 505 GLY GLY A . n 
A 1 444 THR 444 506 506 THR THR A . n 
A 1 445 GLU 445 507 507 GLU GLU A . n 
A 1 446 ASP 446 508 ?   ?   ?   A . n 
A 1 447 GLU 447 509 ?   ?   ?   A . n 
A 1 448 ASP 448 510 ?   ?   ?   A . n 
A 1 449 SER 449 511 ?   ?   ?   A . n 
A 1 450 SER 450 512 ?   ?   ?   A . n 
B 1 1   GLY 1   63  ?   ?   ?   B . n 
B 1 2   ALA 2   64  ?   ?   ?   B . n 
B 1 3   MET 3   65  ?   ?   ?   B . n 
B 1 4   GLY 4   66  ?   ?   ?   B . n 
B 1 5   PHE 5   67  ?   ?   ?   B . n 
B 1 6   HIS 6   68  ?   ?   ?   B . n 
B 1 7   GLU 7   69  ?   ?   ?   B . n 
B 1 8   ALA 8   70  ?   ?   ?   B . n 
B 1 9   GLN 9   71  ?   ?   ?   B . n 
B 1 10  ILE 10  72  ?   ?   ?   B . n 
B 1 11  ASN 11  73  ?   ?   ?   B . n 
B 1 12  ASN 12  74  ?   ?   ?   B . n 
B 1 13  MET 13  75  ?   ?   ?   B . n 
B 1 14  GLU 14  76  ?   ?   ?   B . n 
B 1 15  MET 15  77  ?   ?   ?   B . n 
B 1 16  ALA 16  78  ?   ?   ?   B . n 
B 1 17  PRO 17  79  ?   ?   ?   B . n 
B 1 18  GLY 18  80  ?   ?   ?   B . n 
B 1 19  GLY 19  81  ?   ?   ?   B . n 
B 1 20  VAL 20  82  ?   ?   ?   B . n 
B 1 21  ILE 21  83  ?   ?   ?   B . n 
B 1 22  THR 22  84  84  THR THR B . n 
B 1 23  SER 23  85  85  SER SER B . n 
B 1 24  ASP 24  86  86  ASP ASP B . n 
B 1 25  MET 25  87  87  MET MET B . n 
B 1 26  ILE 26  88  88  ILE ILE B . n 
B 1 27  GLU 27  89  89  GLU GLU B . n 
B 1 28  MET 28  90  90  MET MET B . n 
B 1 29  ILE 29  91  91  ILE ILE B . n 
B 1 30  PHE 30  92  92  PHE PHE B . n 
B 1 31  SER 31  93  93  SER SER B . n 
B 1 32  LYS 32  94  94  LYS LYS B . n 
B 1 33  SER 33  95  95  SER SER B . n 
B 1 34  PRO 34  96  96  PRO PRO B . n 
B 1 35  GLU 35  97  97  GLU GLU B . n 
B 1 36  GLN 36  98  98  GLN GLN B . n 
B 1 37  GLN 37  99  99  GLN GLN B . n 
B 1 38  LEU 38  100 100 LEU LEU B . n 
B 1 39  SER 39  101 101 SER SER B . n 
B 1 40  ALA 40  102 102 ALA ALA B . n 
B 1 41  THR 41  103 103 THR THR B . n 
B 1 42  GLN 42  104 104 GLN GLN B . n 
B 1 43  LYS 43  105 105 LYS LYS B . n 
B 1 44  PHE 44  106 106 PHE PHE B . n 
B 1 45  ARG 45  107 107 ARG ARG B . n 
B 1 46  LYS 46  108 108 LYS LYS B . n 
B 1 47  LEU 47  109 109 LEU LEU B . n 
B 1 48  LEU 48  110 110 LEU LEU B . n 
B 1 49  SER 49  111 111 SER SER B . n 
B 1 50  LYS 50  112 112 LYS LYS B . n 
B 1 51  GLU 51  113 113 GLU GLU B . n 
B 1 52  PRO 52  114 114 PRO PRO B . n 
B 1 53  ASN 53  115 115 ASN ASN B . n 
B 1 54  PRO 54  116 116 PRO PRO B . n 
B 1 55  PRO 55  117 117 PRO PRO B . n 
B 1 56  ILE 56  118 118 ILE ILE B . n 
B 1 57  ASP 57  119 119 ASP ASP B . n 
B 1 58  GLU 58  120 120 GLU GLU B . n 
B 1 59  VAL 59  121 121 VAL VAL B . n 
B 1 60  ILE 60  122 122 ILE ILE B . n 
B 1 61  SER 61  123 123 SER SER B . n 
B 1 62  THR 62  124 124 THR THR B . n 
B 1 63  PRO 63  125 125 PRO PRO B . n 
B 1 64  GLY 64  126 126 GLY GLY B . n 
B 1 65  VAL 65  127 127 VAL VAL B . n 
B 1 66  VAL 66  128 128 VAL VAL B . n 
B 1 67  ALA 67  129 129 ALA ALA B . n 
B 1 68  ARG 68  130 130 ARG ARG B . n 
B 1 69  PHE 69  131 131 PHE PHE B . n 
B 1 70  VAL 70  132 132 VAL VAL B . n 
B 1 71  GLU 71  133 133 GLU GLU B . n 
B 1 72  PHE 72  134 134 PHE PHE B . n 
B 1 73  LEU 73  135 135 LEU LEU B . n 
B 1 74  LYS 74  136 136 LYS LYS B . n 
B 1 75  ARG 75  137 137 ARG ARG B . n 
B 1 76  LYS 76  138 138 LYS LYS B . n 
B 1 77  GLU 77  139 139 GLU GLU B . n 
B 1 78  ASN 78  140 140 ASN ASN B . n 
B 1 79  CYS 79  141 141 CYS CYS B . n 
B 1 80  THR 80  142 142 THR THR B . n 
B 1 81  LEU 81  143 143 LEU LEU B . n 
B 1 82  GLN 82  144 144 GLN GLN B . n 
B 1 83  PHE 83  145 145 PHE PHE B . n 
B 1 84  GLU 84  146 146 GLU GLU B . n 
B 1 85  SER 85  147 147 SER SER B . n 
B 1 86  ALA 86  148 148 ALA ALA B . n 
B 1 87  TRP 87  149 149 TRP TRP B . n 
B 1 88  VAL 88  150 150 VAL VAL B . n 
B 1 89  LEU 89  151 151 LEU LEU B . n 
B 1 90  THR 90  152 152 THR THR B . n 
B 1 91  ASN 91  153 153 ASN ASN B . n 
B 1 92  ILE 92  154 154 ILE ILE B . n 
B 1 93  ALA 93  155 155 ALA ALA B . n 
B 1 94  SER 94  156 156 SER SER B . n 
B 1 95  GLY 95  157 157 GLY GLY B . n 
B 1 96  ASN 96  158 158 ASN ASN B . n 
B 1 97  SER 97  159 159 SER SER B . n 
B 1 98  LEU 98  160 160 LEU LEU B . n 
B 1 99  GLN 99  161 161 GLN GLN B . n 
B 1 100 THR 100 162 162 THR THR B . n 
B 1 101 ARG 101 163 163 ARG ARG B . n 
B 1 102 ILE 102 164 164 ILE ILE B . n 
B 1 103 VAL 103 165 165 VAL VAL B . n 
B 1 104 ILE 104 166 166 ILE ILE B . n 
B 1 105 GLN 105 167 167 GLN GLN B . n 
B 1 106 ALA 106 168 168 ALA ALA B . n 
B 1 107 GLY 107 169 169 GLY GLY B . n 
B 1 108 ALA 108 170 170 ALA ALA B . n 
B 1 109 VAL 109 171 171 VAL VAL B . n 
B 1 110 PRO 110 172 172 PRO PRO B . n 
B 1 111 ILE 111 173 173 ILE ILE B . n 
B 1 112 PHE 112 174 174 PHE PHE B . n 
B 1 113 ILE 113 175 175 ILE ILE B . n 
B 1 114 GLU 114 176 176 GLU GLU B . n 
B 1 115 LEU 115 177 177 LEU LEU B . n 
B 1 116 LEU 116 178 178 LEU LEU B . n 
B 1 117 SER 117 179 179 SER SER B . n 
B 1 118 SER 118 180 180 SER SER B . n 
B 1 119 GLU 119 181 181 GLU GLU B . n 
B 1 120 PHE 120 182 182 PHE PHE B . n 
B 1 121 GLU 121 183 183 GLU GLU B . n 
B 1 122 ASP 122 184 184 ASP ASP B . n 
B 1 123 VAL 123 185 185 VAL VAL B . n 
B 1 124 GLN 124 186 186 GLN GLN B . n 
B 1 125 GLU 125 187 187 GLU GLU B . n 
B 1 126 GLN 126 188 188 GLN GLN B . n 
B 1 127 ALA 127 189 189 ALA ALA B . n 
B 1 128 VAL 128 190 190 VAL VAL B . n 
B 1 129 TRP 129 191 191 TRP TRP B . n 
B 1 130 ALA 130 192 192 ALA ALA B . n 
B 1 131 LEU 131 193 193 LEU LEU B . n 
B 1 132 GLY 132 194 194 GLY GLY B . n 
B 1 133 ASN 133 195 195 ASN ASN B . n 
B 1 134 ILE 134 196 196 ILE ILE B . n 
B 1 135 ALA 135 197 197 ALA ALA B . n 
B 1 136 GLY 136 198 198 GLY GLY B . n 
B 1 137 ASP 137 199 199 ASP ASP B . n 
B 1 138 SER 138 200 200 SER SER B . n 
B 1 139 THR 139 201 201 THR THR B . n 
B 1 140 MET 140 202 202 MET MET B . n 
B 1 141 CYS 141 203 203 CYS CYS B . n 
B 1 142 ARG 142 204 204 ARG ARG B . n 
B 1 143 ASP 143 205 205 ASP ASP B . n 
B 1 144 TYR 144 206 206 TYR TYR B . n 
B 1 145 VAL 145 207 207 VAL VAL B . n 
B 1 146 LEU 146 208 208 LEU LEU B . n 
B 1 147 ASP 147 209 209 ASP ASP B . n 
B 1 148 CYS 148 210 210 CYS CYS B . n 
B 1 149 ASN 149 211 211 ASN ASN B . n 
B 1 150 ILE 150 212 212 ILE ILE B . n 
B 1 151 LEU 151 213 213 LEU LEU B . n 
B 1 152 PRO 152 214 214 PRO PRO B . n 
B 1 153 PRO 153 215 215 PRO PRO B . n 
B 1 154 LEU 154 216 216 LEU LEU B . n 
B 1 155 LEU 155 217 217 LEU LEU B . n 
B 1 156 GLN 156 218 218 GLN GLN B . n 
B 1 157 LEU 157 219 219 LEU LEU B . n 
B 1 158 PHE 158 220 220 PHE PHE B . n 
B 1 159 SER 159 221 221 SER SER B . n 
B 1 160 LYS 160 222 222 LYS LYS B . n 
B 1 161 GLN 161 223 223 GLN GLN B . n 
B 1 162 ASN 162 224 224 ASN ASN B . n 
B 1 163 ARG 163 225 225 ARG ARG B . n 
B 1 164 LEU 164 226 226 LEU LEU B . n 
B 1 165 THR 165 227 227 THR THR B . n 
B 1 166 MET 166 228 228 MET MET B . n 
B 1 167 THR 167 229 229 THR THR B . n 
B 1 168 ARG 168 230 230 ARG ARG B . n 
B 1 169 ASN 169 231 231 ASN ASN B . n 
B 1 170 ALA 170 232 232 ALA ALA B . n 
B 1 171 VAL 171 233 233 VAL VAL B . n 
B 1 172 TRP 172 234 234 TRP TRP B . n 
B 1 173 ALA 173 235 235 ALA ALA B . n 
B 1 174 LEU 174 236 236 LEU LEU B . n 
B 1 175 SER 175 237 237 SER SER B . n 
B 1 176 ASN 176 238 238 ASN ASN B . n 
B 1 177 LEU 177 239 239 LEU LEU B . n 
B 1 178 CYS 178 240 240 CYS CYS B . n 
B 1 179 ARG 179 241 241 ARG ARG B . n 
B 1 180 GLY 180 242 242 GLY GLY B . n 
B 1 181 LYS 181 243 243 LYS LYS B . n 
B 1 182 SER 182 244 244 SER SER B . n 
B 1 183 PRO 183 245 245 PRO PRO B . n 
B 1 184 PRO 184 246 246 PRO PRO B . n 
B 1 185 PRO 185 247 247 PRO PRO B . n 
B 1 186 GLU 186 248 248 GLU GLU B . n 
B 1 187 PHE 187 249 249 PHE PHE B . n 
B 1 188 ALA 188 250 250 ALA ALA B . n 
B 1 189 LYS 189 251 251 LYS LYS B . n 
B 1 190 VAL 190 252 252 VAL VAL B . n 
B 1 191 SER 191 253 253 SER SER B . n 
B 1 192 PRO 192 254 254 PRO PRO B . n 
B 1 193 CYS 193 255 255 CYS CYS B . n 
B 1 194 LEU 194 256 256 LEU LEU B . n 
B 1 195 ASN 195 257 257 ASN ASN B . n 
B 1 196 VAL 196 258 258 VAL VAL B . n 
B 1 197 LEU 197 259 259 LEU LEU B . n 
B 1 198 SER 198 260 260 SER SER B . n 
B 1 199 TRP 199 261 261 TRP TRP B . n 
B 1 200 LEU 200 262 262 LEU LEU B . n 
B 1 201 LEU 201 263 263 LEU LEU B . n 
B 1 202 PHE 202 264 264 PHE PHE B . n 
B 1 203 VAL 203 265 265 VAL VAL B . n 
B 1 204 SER 204 266 266 SER SER B . n 
B 1 205 ASP 205 267 267 ASP ASP B . n 
B 1 206 THR 206 268 268 THR THR B . n 
B 1 207 ASP 207 269 269 ASP ASP B . n 
B 1 208 VAL 208 270 270 VAL VAL B . n 
B 1 209 LEU 209 271 271 LEU LEU B . n 
B 1 210 ALA 210 272 272 ALA ALA B . n 
B 1 211 ASP 211 273 273 ASP ASP B . n 
B 1 212 ALA 212 274 274 ALA ALA B . n 
B 1 213 CYS 213 275 275 CYS CYS B . n 
B 1 214 TRP 214 276 276 TRP TRP B . n 
B 1 215 ALA 215 277 277 ALA ALA B . n 
B 1 216 LEU 216 278 278 LEU LEU B . n 
B 1 217 SER 217 279 279 SER SER B . n 
B 1 218 TYR 218 280 280 TYR TYR B . n 
B 1 219 LEU 219 281 281 LEU LEU B . n 
B 1 220 SER 220 282 282 SER SER B . n 
B 1 221 ASP 221 283 283 ASP ASP B . n 
B 1 222 GLY 222 284 284 GLY GLY B . n 
B 1 223 PRO 223 285 285 PRO PRO B . n 
B 1 224 ASN 224 286 286 ASN ASN B . n 
B 1 225 ASP 225 287 287 ASP ASP B . n 
B 1 226 LYS 226 288 288 LYS LYS B . n 
B 1 227 ILE 227 289 289 ILE ILE B . n 
B 1 228 GLN 228 290 290 GLN GLN B . n 
B 1 229 ALA 229 291 291 ALA ALA B . n 
B 1 230 VAL 230 292 292 VAL VAL B . n 
B 1 231 ILE 231 293 293 ILE ILE B . n 
B 1 232 ASP 232 294 294 ASP ASP B . n 
B 1 233 ALA 233 295 295 ALA ALA B . n 
B 1 234 GLY 234 296 296 GLY GLY B . n 
B 1 235 VAL 235 297 297 VAL VAL B . n 
B 1 236 CYS 236 298 298 CYS CYS B . n 
B 1 237 ARG 237 299 299 ARG ARG B . n 
B 1 238 ARG 238 300 300 ARG ARG B . n 
B 1 239 LEU 239 301 301 LEU LEU B . n 
B 1 240 VAL 240 302 302 VAL VAL B . n 
B 1 241 GLU 241 303 303 GLU GLU B . n 
B 1 242 LEU 242 304 304 LEU LEU B . n 
B 1 243 LEU 243 305 305 LEU LEU B . n 
B 1 244 MET 244 306 306 MET MET B . n 
B 1 245 HIS 245 307 307 HIS HIS B . n 
B 1 246 ASN 246 308 308 ASN ASN B . n 
B 1 247 ASP 247 309 309 ASP ASP B . n 
B 1 248 TYR 248 310 310 TYR TYR B . n 
B 1 249 LYS 249 311 311 LYS LYS B . n 
B 1 250 VAL 250 312 312 VAL VAL B . n 
B 1 251 VAL 251 313 313 VAL VAL B . n 
B 1 252 SER 252 314 314 SER SER B . n 
B 1 253 PRO 253 315 315 PRO PRO B . n 
B 1 254 ALA 254 316 316 ALA ALA B . n 
B 1 255 LEU 255 317 317 LEU LEU B . n 
B 1 256 ARG 256 318 318 ARG ARG B . n 
B 1 257 ALA 257 319 319 ALA ALA B . n 
B 1 258 VAL 258 320 320 VAL VAL B . n 
B 1 259 GLY 259 321 321 GLY GLY B . n 
B 1 260 ASN 260 322 322 ASN ASN B . n 
B 1 261 ILE 261 323 323 ILE ILE B . n 
B 1 262 VAL 262 324 324 VAL VAL B . n 
B 1 263 THR 263 325 325 THR THR B . n 
B 1 264 GLY 264 326 326 GLY GLY B . n 
B 1 265 ASP 265 327 327 ASP ASP B . n 
B 1 266 ASP 266 328 328 ASP ASP B . n 
B 1 267 ILE 267 329 329 ILE ILE B . n 
B 1 268 GLN 268 330 330 GLN GLN B . n 
B 1 269 THR 269 331 331 THR THR B . n 
B 1 270 GLN 270 332 332 GLN GLN B . n 
B 1 271 VAL 271 333 333 VAL VAL B . n 
B 1 272 ILE 272 334 334 ILE ILE B . n 
B 1 273 LEU 273 335 335 LEU LEU B . n 
B 1 274 ASN 274 336 336 ASN ASN B . n 
B 1 275 CYS 275 337 337 CYS CYS B . n 
B 1 276 SER 276 338 338 SER SER B . n 
B 1 277 ALA 277 339 339 ALA ALA B . n 
B 1 278 LEU 278 340 340 LEU LEU B . n 
B 1 279 GLN 279 341 341 GLN GLN B . n 
B 1 280 SER 280 342 342 SER SER B . n 
B 1 281 LEU 281 343 343 LEU LEU B . n 
B 1 282 LEU 282 344 344 LEU LEU B . n 
B 1 283 HIS 283 345 345 HIS HIS B . n 
B 1 284 LEU 284 346 346 LEU LEU B . n 
B 1 285 LEU 285 347 347 LEU LEU B . n 
B 1 286 SER 286 348 348 SER SER B . n 
B 1 287 SER 287 349 349 SER SER B . n 
B 1 288 PRO 288 350 350 PRO PRO B . n 
B 1 289 LYS 289 351 351 LYS LYS B . n 
B 1 290 GLU 290 352 352 GLU GLU B . n 
B 1 291 SER 291 353 353 SER SER B . n 
B 1 292 ILE 292 354 354 ILE ILE B . n 
B 1 293 LYS 293 355 355 LYS LYS B . n 
B 1 294 LYS 294 356 356 LYS LYS B . n 
B 1 295 GLU 295 357 357 GLU GLU B . n 
B 1 296 ALA 296 358 358 ALA ALA B . n 
B 1 297 CYS 297 359 359 CYS CYS B . n 
B 1 298 TRP 298 360 360 TRP TRP B . n 
B 1 299 THR 299 361 361 THR THR B . n 
B 1 300 ILE 300 362 362 ILE ILE B . n 
B 1 301 SER 301 363 363 SER SER B . n 
B 1 302 ASN 302 364 364 ASN ASN B . n 
B 1 303 ILE 303 365 365 ILE ILE B . n 
B 1 304 THR 304 366 366 THR THR B . n 
B 1 305 ALA 305 367 367 ALA ALA B . n 
B 1 306 GLY 306 368 368 GLY GLY B . n 
B 1 307 ASN 307 369 369 ASN ASN B . n 
B 1 308 ARG 308 370 370 ARG ARG B . n 
B 1 309 ALA 309 371 371 ALA ALA B . n 
B 1 310 GLN 310 372 372 GLN GLN B . n 
B 1 311 ILE 311 373 373 ILE ILE B . n 
B 1 312 GLN 312 374 374 GLN GLN B . n 
B 1 313 THR 313 375 375 THR THR B . n 
B 1 314 VAL 314 376 376 VAL VAL B . n 
B 1 315 ILE 315 377 377 ILE ILE B . n 
B 1 316 ASP 316 378 378 ASP ASP B . n 
B 1 317 ALA 317 379 379 ALA ALA B . n 
B 1 318 ASN 318 380 380 ASN ASN B . n 
B 1 319 ILE 319 381 381 ILE ILE B . n 
B 1 320 PHE 320 382 382 PHE PHE B . n 
B 1 321 PRO 321 383 383 PRO PRO B . n 
B 1 322 ALA 322 384 384 ALA ALA B . n 
B 1 323 LEU 323 385 385 LEU LEU B . n 
B 1 324 ILE 324 386 386 ILE ILE B . n 
B 1 325 SER 325 387 387 SER SER B . n 
B 1 326 ILE 326 388 388 ILE ILE B . n 
B 1 327 LEU 327 389 389 LEU LEU B . n 
B 1 328 GLN 328 390 390 GLN GLN B . n 
B 1 329 THR 329 391 391 THR THR B . n 
B 1 330 ALA 330 392 392 ALA ALA B . n 
B 1 331 GLU 331 393 393 GLU GLU B . n 
B 1 332 PHE 332 394 394 PHE PHE B . n 
B 1 333 ARG 333 395 395 ARG ARG B . n 
B 1 334 THR 334 396 396 THR THR B . n 
B 1 335 ARG 335 397 397 ARG ARG B . n 
B 1 336 LYS 336 398 398 LYS LYS B . n 
B 1 337 GLU 337 399 399 GLU GLU B . n 
B 1 338 ALA 338 400 400 ALA ALA B . n 
B 1 339 ALA 339 401 401 ALA ALA B . n 
B 1 340 TRP 340 402 402 TRP TRP B . n 
B 1 341 ALA 341 403 403 ALA ALA B . n 
B 1 342 ILE 342 404 404 ILE ILE B . n 
B 1 343 THR 343 405 405 THR THR B . n 
B 1 344 ASN 344 406 406 ASN ASN B . n 
B 1 345 ALA 345 407 407 ALA ALA B . n 
B 1 346 THR 346 408 408 THR THR B . n 
B 1 347 SER 347 409 409 SER SER B . n 
B 1 348 GLY 348 410 410 GLY GLY B . n 
B 1 349 GLY 349 411 411 GLY GLY B . n 
B 1 350 SER 350 412 412 SER SER B . n 
B 1 351 ALA 351 413 413 ALA ALA B . n 
B 1 352 GLU 352 414 414 GLU GLU B . n 
B 1 353 GLN 353 415 415 GLN GLN B . n 
B 1 354 ILE 354 416 416 ILE ILE B . n 
B 1 355 LYS 355 417 417 LYS LYS B . n 
B 1 356 TYR 356 418 418 TYR TYR B . n 
B 1 357 LEU 357 419 419 LEU LEU B . n 
B 1 358 VAL 358 420 420 VAL VAL B . n 
B 1 359 GLU 359 421 421 GLU GLU B . n 
B 1 360 LEU 360 422 422 LEU LEU B . n 
B 1 361 GLY 361 423 423 GLY GLY B . n 
B 1 362 CYS 362 424 424 CYS CYS B . n 
B 1 363 ILE 363 425 425 ILE ILE B . n 
B 1 364 LYS 364 426 426 LYS LYS B . n 
B 1 365 PRO 365 427 427 PRO PRO B . n 
B 1 366 LEU 366 428 428 LEU LEU B . n 
B 1 367 CYS 367 429 429 CYS CYS B . n 
B 1 368 ASP 368 430 430 ASP ASP B . n 
B 1 369 LEU 369 431 431 LEU LEU B . n 
B 1 370 LEU 370 432 432 LEU LEU B . n 
B 1 371 THR 371 433 433 THR THR B . n 
B 1 372 VAL 372 434 434 VAL VAL B . n 
B 1 373 MET 373 435 435 MET MET B . n 
B 1 374 ASP 374 436 436 ASP ASP B . n 
B 1 375 SER 375 437 437 SER SER B . n 
B 1 376 LYS 376 438 438 LYS LYS B . n 
B 1 377 ILE 377 439 439 ILE ILE B . n 
B 1 378 VAL 378 440 440 VAL VAL B . n 
B 1 379 GLN 379 441 441 GLN GLN B . n 
B 1 380 VAL 380 442 442 VAL VAL B . n 
B 1 381 ALA 381 443 443 ALA ALA B . n 
B 1 382 LEU 382 444 444 LEU LEU B . n 
B 1 383 ASN 383 445 445 ASN ASN B . n 
B 1 384 GLY 384 446 446 GLY GLY B . n 
B 1 385 LEU 385 447 447 LEU LEU B . n 
B 1 386 GLU 386 448 448 GLU GLU B . n 
B 1 387 ASN 387 449 449 ASN ASN B . n 
B 1 388 ILE 388 450 450 ILE ILE B . n 
B 1 389 LEU 389 451 451 LEU LEU B . n 
B 1 390 ARG 390 452 452 ARG ARG B . n 
B 1 391 LEU 391 453 453 LEU LEU B . n 
B 1 392 GLY 392 454 454 GLY GLY B . n 
B 1 393 GLU 393 455 455 GLU GLU B . n 
B 1 394 GLN 394 456 456 GLN GLN B . n 
B 1 395 GLU 395 457 457 GLU GLU B . n 
B 1 396 ALA 396 458 458 ALA ALA B . n 
B 1 397 LYS 397 459 459 LYS LYS B . n 
B 1 398 ARG 398 460 460 ARG ARG B . n 
B 1 399 ASN 399 461 461 ASN ASN B . n 
B 1 400 GLY 400 462 462 GLY GLY B . n 
B 1 401 THR 401 463 463 THR THR B . n 
B 1 402 GLY 402 464 464 GLY GLY B . n 
B 1 403 ILE 403 465 465 ILE ILE B . n 
B 1 404 ASN 404 466 466 ASN ASN B . n 
B 1 405 PRO 405 467 467 PRO PRO B . n 
B 1 406 TYR 406 468 468 TYR TYR B . n 
B 1 407 CYS 407 469 469 CYS CYS B . n 
B 1 408 ALA 408 470 470 ALA ALA B . n 
B 1 409 LEU 409 471 471 LEU LEU B . n 
B 1 410 ILE 410 472 472 ILE ILE B . n 
B 1 411 GLU 411 473 473 GLU GLU B . n 
B 1 412 GLU 412 474 474 GLU GLU B . n 
B 1 413 ALA 413 475 475 ALA ALA B . n 
B 1 414 TYR 414 476 476 TYR TYR B . n 
B 1 415 GLY 415 477 477 GLY GLY B . n 
B 1 416 LEU 416 478 478 LEU LEU B . n 
B 1 417 ASP 417 479 479 ASP ASP B . n 
B 1 418 LYS 418 480 480 LYS LYS B . n 
B 1 419 ILE 419 481 481 ILE ILE B . n 
B 1 420 GLU 420 482 482 GLU GLU B . n 
B 1 421 PHE 421 483 483 PHE PHE B . n 
B 1 422 LEU 422 484 484 LEU LEU B . n 
B 1 423 GLN 423 485 485 GLN GLN B . n 
B 1 424 SER 424 486 486 SER SER B . n 
B 1 425 HIS 425 487 487 HIS HIS B . n 
B 1 426 GLU 426 488 488 GLU GLU B . n 
B 1 427 ASN 427 489 489 ASN ASN B . n 
B 1 428 GLN 428 490 490 GLN GLN B . n 
B 1 429 GLU 429 491 491 GLU GLU B . n 
B 1 430 ILE 430 492 492 ILE ILE B . n 
B 1 431 TYR 431 493 493 TYR TYR B . n 
B 1 432 GLN 432 494 494 GLN GLN B . n 
B 1 433 LYS 433 495 495 LYS LYS B . n 
B 1 434 ALA 434 496 496 ALA ALA B . n 
B 1 435 PHE 435 497 497 PHE PHE B . n 
B 1 436 ASP 436 498 498 ASP ASP B . n 
B 1 437 LEU 437 499 499 LEU LEU B . n 
B 1 438 ILE 438 500 500 ILE ILE B . n 
B 1 439 GLU 439 501 501 GLU GLU B . n 
B 1 440 HIS 440 502 502 HIS HIS B . n 
B 1 441 TYR 441 503 503 TYR TYR B . n 
B 1 442 PHE 442 504 504 PHE PHE B . n 
B 1 443 GLY 443 505 505 GLY GLY B . n 
B 1 444 THR 444 506 506 THR THR B . n 
B 1 445 GLU 445 507 507 GLU GLU B . n 
B 1 446 ASP 446 508 508 ASP ASP B . n 
B 1 447 GLU 447 509 509 GLU GLU B . n 
B 1 448 ASP 448 510 ?   ?   ?   B . n 
B 1 449 SER 449 511 ?   ?   ?   B . n 
B 1 450 SER 450 512 ?   ?   ?   B . n 
C 2 1   GLY 1   677 ?   ?   ?   D . n 
C 2 2   ASP 2   678 ?   ?   ?   D . n 
C 2 3   PRO 3   679 ?   ?   ?   D . n 
C 2 4   ASP 4   680 ?   ?   ?   D . n 
C 2 5   GLU 5   681 ?   ?   ?   D . n 
C 2 6   SER 6   682 ?   ?   ?   D . n 
C 2 7   THR 7   683 ?   ?   ?   D . n 
C 2 8   SER 8   684 ?   ?   ?   D . n 
C 2 9   GLY 9   685 ?   ?   ?   D . n 
C 2 10  VAL 10  686 ?   ?   ?   D . n 
C 2 11  GLU 11  687 ?   ?   ?   D . n 
C 2 12  SER 12  688 688 SER SER D . n 
C 2 13  ALA 13  689 689 ALA ALA D . n 
C 2 14  VAL 14  690 690 VAL VAL D . n 
C 2 15  LEU 15  691 691 LEU LEU D . n 
C 2 16  ARG 16  692 692 ARG ARG D . n 
C 2 17  GLY 17  693 693 GLY GLY D . n 
C 2 18  PHE 18  694 694 PHE PHE D . n 
C 2 19  LEU 19  695 695 LEU LEU D . n 
C 2 20  ILE 20  696 696 ILE ILE D . n 
C 2 21  LEU 21  697 697 LEU LEU D . n 
C 2 22  GLY 22  698 698 GLY GLY D . n 
C 2 23  LYS 23  699 699 LYS LYS D . n 
C 2 24  GLU 24  700 700 GLU GLU D . n 
C 2 25  ASP 25  701 701 ASP ASP D . n 
C 2 26  ARG 26  702 702 ARG ARG D . n 
C 2 27  ARG 27  703 703 ARG ARG D . n 
C 2 28  TYR 28  704 704 TYR TYR D . n 
C 2 29  GLY 29  705 705 GLY GLY D . n 
C 2 30  PRO 30  706 706 PRO PRO D . n 
C 2 31  ALA 31  707 707 ALA ALA D . n 
C 2 32  LEU 32  708 708 LEU LEU D . n 
C 2 33  SER 33  709 709 SER SER D . n 
C 2 34  ILE 34  710 710 ILE ILE D . n 
C 2 35  ASN 35  711 711 ASN ASN D . n 
C 2 36  GLU 36  712 712 GLU GLU D . n 
C 2 37  LEU 37  713 713 LEU LEU D . n 
C 2 38  SER 38  714 714 SER SER D . n 
C 2 39  ASN 39  715 715 ASN ASN D . n 
C 2 40  LEU 40  716 716 LEU LEU D . n 
C 2 41  ALA 41  717 717 ALA ALA D . n 
C 2 42  LYS 42  718 718 LYS LYS D . n 
C 2 43  GLY 43  719 719 GLY GLY D . n 
C 2 44  GLU 44  720 720 GLU GLU D . n 
C 2 45  LYS 45  721 721 LYS LYS D . n 
C 2 46  ALA 46  722 722 ALA ALA D . n 
C 2 47  ASN 47  723 723 ASN ASN D . n 
C 2 48  VAL 48  724 724 VAL VAL D . n 
C 2 49  LEU 49  725 725 LEU LEU D . n 
C 2 50  ILE 50  726 726 ILE ILE D . n 
C 2 51  GLY 51  727 727 GLY GLY D . n 
C 2 52  GLN 52  728 728 GLN GLN D . n 
C 2 53  GLY 53  729 729 GLY GLY D . n 
C 2 54  ASP 54  730 730 ASP ASP D . n 
C 2 55  VAL 55  731 731 VAL VAL D . n 
C 2 56  VAL 56  732 732 VAL VAL D . n 
C 2 57  LEU 57  733 733 LEU LEU D . n 
C 2 58  VAL 58  734 734 VAL VAL D . n 
C 2 59  MET 59  735 735 MET MET D . n 
C 2 60  LYS 60  736 736 LYS LYS D . n 
C 2 61  ARG 61  737 737 ARG ARG D . n 
C 2 62  LYS 62  738 738 LYS LYS D . n 
C 2 63  ARG 63  739 739 ARG ARG D . n 
C 2 64  ASP 64  740 740 ASP ASP D . n 
C 2 65  SER 65  741 741 SER SER D . n 
C 2 66  SER 66  742 ?   ?   ?   D . n 
C 2 67  ILE 67  743 ?   ?   ?   D . n 
C 2 68  LEU 68  744 ?   ?   ?   D . n 
C 2 69  THR 69  745 ?   ?   ?   D . n 
C 2 70  ASP 70  746 ?   ?   ?   D . n 
C 2 71  SER 71  747 ?   ?   ?   D . n 
C 2 72  GLN 72  748 748 GLN GLN D . n 
C 2 73  THR 73  749 749 THR THR D . n 
C 2 74  ALA 74  750 750 ALA ALA D . n 
C 2 75  THR 75  751 751 THR THR D . n 
C 2 76  LYS 76  752 752 LYS LYS D . n 
C 2 77  ARG 77  753 753 ARG ARG D . n 
C 2 78  ILE 78  754 754 ILE ILE D . n 
C 2 79  ARG 79  755 755 ARG ARG D . n 
C 2 80  MET 80  756 756 MET MET D . n 
C 2 81  ALA 81  757 ?   ?   ?   D . n 
C 2 82  ILE 82  758 ?   ?   ?   D . n 
C 2 83  ASN 83  759 ?   ?   ?   D . n 
D 2 1   GLY 1   677 ?   ?   ?   E . n 
D 2 2   ASP 2   678 ?   ?   ?   E . n 
D 2 3   PRO 3   679 ?   ?   ?   E . n 
D 2 4   ASP 4   680 ?   ?   ?   E . n 
D 2 5   GLU 5   681 ?   ?   ?   E . n 
D 2 6   SER 6   682 ?   ?   ?   E . n 
D 2 7   THR 7   683 ?   ?   ?   E . n 
D 2 8   SER 8   684 ?   ?   ?   E . n 
D 2 9   GLY 9   685 ?   ?   ?   E . n 
D 2 10  VAL 10  686 686 VAL VAL E . n 
D 2 11  GLU 11  687 687 GLU GLU E . n 
D 2 12  SER 12  688 688 SER SER E . n 
D 2 13  ALA 13  689 689 ALA ALA E . n 
D 2 14  VAL 14  690 690 VAL VAL E . n 
D 2 15  LEU 15  691 691 LEU LEU E . n 
D 2 16  ARG 16  692 692 ARG ARG E . n 
D 2 17  GLY 17  693 693 GLY GLY E . n 
D 2 18  PHE 18  694 694 PHE PHE E . n 
D 2 19  LEU 19  695 695 LEU LEU E . n 
D 2 20  ILE 20  696 696 ILE ILE E . n 
D 2 21  LEU 21  697 697 LEU LEU E . n 
D 2 22  GLY 22  698 698 GLY GLY E . n 
D 2 23  LYS 23  699 699 LYS LYS E . n 
D 2 24  GLU 24  700 700 GLU GLU E . n 
D 2 25  ASP 25  701 701 ASP ASP E . n 
D 2 26  ARG 26  702 702 ARG ARG E . n 
D 2 27  ARG 27  703 703 ARG ARG E . n 
D 2 28  TYR 28  704 704 TYR TYR E . n 
D 2 29  GLY 29  705 705 GLY GLY E . n 
D 2 30  PRO 30  706 706 PRO PRO E . n 
D 2 31  ALA 31  707 707 ALA ALA E . n 
D 2 32  LEU 32  708 708 LEU LEU E . n 
D 2 33  SER 33  709 709 SER SER E . n 
D 2 34  ILE 34  710 710 ILE ILE E . n 
D 2 35  ASN 35  711 711 ASN ASN E . n 
D 2 36  GLU 36  712 712 GLU GLU E . n 
D 2 37  LEU 37  713 713 LEU LEU E . n 
D 2 38  SER 38  714 714 SER SER E . n 
D 2 39  ASN 39  715 715 ASN ASN E . n 
D 2 40  LEU 40  716 716 LEU LEU E . n 
D 2 41  ALA 41  717 717 ALA ALA E . n 
D 2 42  LYS 42  718 718 LYS LYS E . n 
D 2 43  GLY 43  719 719 GLY GLY E . n 
D 2 44  GLU 44  720 720 GLU GLU E . n 
D 2 45  LYS 45  721 721 LYS LYS E . n 
D 2 46  ALA 46  722 722 ALA ALA E . n 
D 2 47  ASN 47  723 723 ASN ASN E . n 
D 2 48  VAL 48  724 724 VAL VAL E . n 
D 2 49  LEU 49  725 725 LEU LEU E . n 
D 2 50  ILE 50  726 726 ILE ILE E . n 
D 2 51  GLY 51  727 727 GLY GLY E . n 
D 2 52  GLN 52  728 728 GLN GLN E . n 
D 2 53  GLY 53  729 729 GLY GLY E . n 
D 2 54  ASP 54  730 730 ASP ASP E . n 
D 2 55  VAL 55  731 731 VAL VAL E . n 
D 2 56  VAL 56  732 732 VAL VAL E . n 
D 2 57  LEU 57  733 733 LEU LEU E . n 
D 2 58  VAL 58  734 734 VAL VAL E . n 
D 2 59  MET 59  735 735 MET MET E . n 
D 2 60  LYS 60  736 736 LYS LYS E . n 
D 2 61  ARG 61  737 737 ARG ARG E . n 
D 2 62  LYS 62  738 738 LYS LYS E . n 
D 2 63  ARG 63  739 739 ARG ARG E . n 
D 2 64  ASP 64  740 740 ASP ASP E . n 
D 2 65  SER 65  741 741 SER SER E . n 
D 2 66  SER 66  742 ?   ?   ?   E . n 
D 2 67  ILE 67  743 ?   ?   ?   E . n 
D 2 68  LEU 68  744 ?   ?   ?   E . n 
D 2 69  THR 69  745 ?   ?   ?   E . n 
D 2 70  ASP 70  746 ?   ?   ?   E . n 
D 2 71  SER 71  747 ?   ?   ?   E . n 
D 2 72  GLN 72  748 ?   ?   ?   E . n 
D 2 73  THR 73  749 749 THR THR E . n 
D 2 74  ALA 74  750 750 ALA ALA E . n 
D 2 75  THR 75  751 751 THR THR E . n 
D 2 76  LYS 76  752 752 LYS LYS E . n 
D 2 77  ARG 77  753 753 ARG ARG E . n 
D 2 78  ILE 78  754 754 ILE ILE E . n 
D 2 79  ARG 79  755 755 ARG ARG E . n 
D 2 80  MET 80  756 756 MET MET E . n 
D 2 81  ALA 81  757 757 ALA ALA E . n 
D 2 82  ILE 82  758 ?   ?   ?   E . n 
D 2 83  ASN 83  759 ?   ?   ?   E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   2001 2001 HOH HOH A . 
E 3 HOH 2   2002 2002 HOH HOH A . 
E 3 HOH 3   2003 2003 HOH HOH A . 
E 3 HOH 4   2004 2004 HOH HOH A . 
E 3 HOH 5   2005 2005 HOH HOH A . 
E 3 HOH 6   2006 2006 HOH HOH A . 
E 3 HOH 7   2007 2007 HOH HOH A . 
E 3 HOH 8   2008 2008 HOH HOH A . 
E 3 HOH 9   2009 2009 HOH HOH A . 
E 3 HOH 10  2010 2010 HOH HOH A . 
E 3 HOH 11  2011 2011 HOH HOH A . 
E 3 HOH 12  2012 2012 HOH HOH A . 
E 3 HOH 13  2013 2013 HOH HOH A . 
E 3 HOH 14  2014 2014 HOH HOH A . 
E 3 HOH 15  2015 2015 HOH HOH A . 
E 3 HOH 16  2016 2016 HOH HOH A . 
E 3 HOH 17  2017 2017 HOH HOH A . 
E 3 HOH 18  2018 2018 HOH HOH A . 
E 3 HOH 19  2019 2019 HOH HOH A . 
E 3 HOH 20  2020 2020 HOH HOH A . 
E 3 HOH 21  2021 2021 HOH HOH A . 
E 3 HOH 22  2022 2022 HOH HOH A . 
E 3 HOH 23  2023 2023 HOH HOH A . 
E 3 HOH 24  2024 2024 HOH HOH A . 
E 3 HOH 25  2025 2025 HOH HOH A . 
E 3 HOH 26  2026 2026 HOH HOH A . 
E 3 HOH 27  2027 2027 HOH HOH A . 
E 3 HOH 28  2028 2028 HOH HOH A . 
E 3 HOH 29  2029 2029 HOH HOH A . 
E 3 HOH 30  2030 2030 HOH HOH A . 
E 3 HOH 31  2031 2031 HOH HOH A . 
E 3 HOH 32  2032 2032 HOH HOH A . 
E 3 HOH 33  2033 2033 HOH HOH A . 
E 3 HOH 34  2034 2034 HOH HOH A . 
E 3 HOH 35  2035 2035 HOH HOH A . 
E 3 HOH 36  2036 2036 HOH HOH A . 
E 3 HOH 37  2037 2037 HOH HOH A . 
E 3 HOH 38  2038 2038 HOH HOH A . 
E 3 HOH 39  2039 2039 HOH HOH A . 
E 3 HOH 40  2040 2040 HOH HOH A . 
E 3 HOH 41  2041 2041 HOH HOH A . 
E 3 HOH 42  2042 2042 HOH HOH A . 
E 3 HOH 43  2043 2043 HOH HOH A . 
E 3 HOH 44  2044 2044 HOH HOH A . 
E 3 HOH 45  2045 2045 HOH HOH A . 
E 3 HOH 46  2046 2046 HOH HOH A . 
E 3 HOH 47  2047 2047 HOH HOH A . 
E 3 HOH 48  2048 2048 HOH HOH A . 
E 3 HOH 49  2049 2049 HOH HOH A . 
E 3 HOH 50  2050 2050 HOH HOH A . 
E 3 HOH 51  2051 2051 HOH HOH A . 
E 3 HOH 52  2052 2052 HOH HOH A . 
E 3 HOH 53  2053 2053 HOH HOH A . 
E 3 HOH 54  2054 2054 HOH HOH A . 
E 3 HOH 55  2055 2055 HOH HOH A . 
E 3 HOH 56  2056 2056 HOH HOH A . 
E 3 HOH 57  2057 2057 HOH HOH A . 
E 3 HOH 58  2058 2058 HOH HOH A . 
E 3 HOH 59  2059 2059 HOH HOH A . 
E 3 HOH 60  2060 2060 HOH HOH A . 
E 3 HOH 61  2061 2061 HOH HOH A . 
E 3 HOH 62  2062 2062 HOH HOH A . 
E 3 HOH 63  2063 2063 HOH HOH A . 
E 3 HOH 64  2064 2064 HOH HOH A . 
E 3 HOH 65  2065 2065 HOH HOH A . 
E 3 HOH 66  2066 2066 HOH HOH A . 
E 3 HOH 67  2067 2067 HOH HOH A . 
E 3 HOH 68  2068 2068 HOH HOH A . 
E 3 HOH 69  2069 2069 HOH HOH A . 
E 3 HOH 70  2070 2070 HOH HOH A . 
E 3 HOH 71  2071 2071 HOH HOH A . 
E 3 HOH 72  2072 2072 HOH HOH A . 
E 3 HOH 73  2073 2073 HOH HOH A . 
E 3 HOH 74  2074 2074 HOH HOH A . 
E 3 HOH 75  2075 2075 HOH HOH A . 
E 3 HOH 76  2076 2076 HOH HOH A . 
E 3 HOH 77  2077 2077 HOH HOH A . 
E 3 HOH 78  2078 2078 HOH HOH A . 
E 3 HOH 79  2079 2079 HOH HOH A . 
E 3 HOH 80  2080 2080 HOH HOH A . 
E 3 HOH 81  2081 2081 HOH HOH A . 
E 3 HOH 82  2082 2082 HOH HOH A . 
E 3 HOH 83  2083 2083 HOH HOH A . 
E 3 HOH 84  2084 2084 HOH HOH A . 
E 3 HOH 85  2085 2085 HOH HOH A . 
E 3 HOH 86  2086 2086 HOH HOH A . 
E 3 HOH 87  2087 2087 HOH HOH A . 
E 3 HOH 88  2088 2088 HOH HOH A . 
E 3 HOH 89  2089 2089 HOH HOH A . 
E 3 HOH 90  2090 2090 HOH HOH A . 
E 3 HOH 91  2091 2091 HOH HOH A . 
E 3 HOH 92  2092 2092 HOH HOH A . 
E 3 HOH 93  2093 2093 HOH HOH A . 
E 3 HOH 94  2094 2094 HOH HOH A . 
E 3 HOH 95  2095 2095 HOH HOH A . 
E 3 HOH 96  2096 2096 HOH HOH A . 
E 3 HOH 97  2097 2097 HOH HOH A . 
E 3 HOH 98  2098 2098 HOH HOH A . 
E 3 HOH 99  2099 2099 HOH HOH A . 
E 3 HOH 100 2100 2100 HOH HOH A . 
E 3 HOH 101 2101 2101 HOH HOH A . 
E 3 HOH 102 2102 2102 HOH HOH A . 
E 3 HOH 103 2103 2103 HOH HOH A . 
E 3 HOH 104 2104 2104 HOH HOH A . 
E 3 HOH 105 2105 2105 HOH HOH A . 
E 3 HOH 106 2106 2106 HOH HOH A . 
E 3 HOH 107 2107 2107 HOH HOH A . 
E 3 HOH 108 2108 2108 HOH HOH A . 
E 3 HOH 109 2109 2109 HOH HOH A . 
E 3 HOH 110 2110 2110 HOH HOH A . 
E 3 HOH 111 2111 2111 HOH HOH A . 
E 3 HOH 112 2112 2112 HOH HOH A . 
E 3 HOH 113 2113 2113 HOH HOH A . 
E 3 HOH 114 2114 2114 HOH HOH A . 
E 3 HOH 115 2115 2115 HOH HOH A . 
E 3 HOH 116 2116 2116 HOH HOH A . 
E 3 HOH 117 2117 2117 HOH HOH A . 
E 3 HOH 118 2118 2118 HOH HOH A . 
E 3 HOH 119 2119 2119 HOH HOH A . 
E 3 HOH 120 2120 2120 HOH HOH A . 
E 3 HOH 121 2121 2121 HOH HOH A . 
E 3 HOH 122 2122 2122 HOH HOH A . 
E 3 HOH 123 2123 2123 HOH HOH A . 
E 3 HOH 124 2124 2124 HOH HOH A . 
E 3 HOH 125 2125 2125 HOH HOH A . 
E 3 HOH 126 2126 2126 HOH HOH A . 
E 3 HOH 127 2127 2127 HOH HOH A . 
E 3 HOH 128 2128 2128 HOH HOH A . 
E 3 HOH 129 2129 2129 HOH HOH A . 
E 3 HOH 130 2130 2130 HOH HOH A . 
E 3 HOH 131 2131 2131 HOH HOH A . 
F 3 HOH 1   2001 2001 HOH HOH B . 
F 3 HOH 2   2002 2002 HOH HOH B . 
F 3 HOH 3   2003 2003 HOH HOH B . 
F 3 HOH 4   2004 2004 HOH HOH B . 
F 3 HOH 5   2005 2005 HOH HOH B . 
F 3 HOH 6   2006 2006 HOH HOH B . 
F 3 HOH 7   2007 2007 HOH HOH B . 
F 3 HOH 8   2008 2008 HOH HOH B . 
F 3 HOH 9   2009 2009 HOH HOH B . 
F 3 HOH 10  2010 2010 HOH HOH B . 
F 3 HOH 11  2011 2011 HOH HOH B . 
F 3 HOH 12  2012 2012 HOH HOH B . 
F 3 HOH 13  2013 2013 HOH HOH B . 
F 3 HOH 14  2014 2014 HOH HOH B . 
F 3 HOH 15  2015 2015 HOH HOH B . 
F 3 HOH 16  2016 2016 HOH HOH B . 
F 3 HOH 17  2017 2017 HOH HOH B . 
F 3 HOH 18  2018 2018 HOH HOH B . 
F 3 HOH 19  2019 2019 HOH HOH B . 
F 3 HOH 20  2020 2020 HOH HOH B . 
F 3 HOH 21  2021 2021 HOH HOH B . 
F 3 HOH 22  2022 2022 HOH HOH B . 
F 3 HOH 23  2023 2023 HOH HOH B . 
F 3 HOH 24  2024 2024 HOH HOH B . 
F 3 HOH 25  2025 2025 HOH HOH B . 
F 3 HOH 26  2026 2026 HOH HOH B . 
F 3 HOH 27  2027 2027 HOH HOH B . 
F 3 HOH 28  2028 2028 HOH HOH B . 
F 3 HOH 29  2029 2029 HOH HOH B . 
F 3 HOH 30  2030 2030 HOH HOH B . 
F 3 HOH 31  2031 2031 HOH HOH B . 
F 3 HOH 32  2032 2032 HOH HOH B . 
F 3 HOH 33  2033 2033 HOH HOH B . 
F 3 HOH 34  2034 2034 HOH HOH B . 
F 3 HOH 35  2035 2035 HOH HOH B . 
F 3 HOH 36  2036 2036 HOH HOH B . 
F 3 HOH 37  2037 2037 HOH HOH B . 
F 3 HOH 38  2038 2038 HOH HOH B . 
F 3 HOH 39  2039 2039 HOH HOH B . 
F 3 HOH 40  2040 2040 HOH HOH B . 
F 3 HOH 41  2041 2041 HOH HOH B . 
F 3 HOH 42  2042 2042 HOH HOH B . 
F 3 HOH 43  2043 2043 HOH HOH B . 
F 3 HOH 44  2044 2044 HOH HOH B . 
F 3 HOH 45  2045 2045 HOH HOH B . 
F 3 HOH 46  2046 2046 HOH HOH B . 
F 3 HOH 47  2047 2047 HOH HOH B . 
F 3 HOH 48  2048 2048 HOH HOH B . 
F 3 HOH 49  2049 2049 HOH HOH B . 
F 3 HOH 50  2050 2050 HOH HOH B . 
F 3 HOH 51  2051 2051 HOH HOH B . 
F 3 HOH 52  2052 2052 HOH HOH B . 
F 3 HOH 53  2053 2053 HOH HOH B . 
F 3 HOH 54  2054 2054 HOH HOH B . 
F 3 HOH 55  2055 2055 HOH HOH B . 
F 3 HOH 56  2056 2056 HOH HOH B . 
F 3 HOH 57  2057 2057 HOH HOH B . 
F 3 HOH 58  2058 2058 HOH HOH B . 
F 3 HOH 59  2059 2059 HOH HOH B . 
F 3 HOH 60  2060 2060 HOH HOH B . 
F 3 HOH 61  2061 2061 HOH HOH B . 
F 3 HOH 62  2062 2062 HOH HOH B . 
F 3 HOH 63  2063 2063 HOH HOH B . 
F 3 HOH 64  2064 2064 HOH HOH B . 
F 3 HOH 65  2065 2065 HOH HOH B . 
F 3 HOH 66  2066 2066 HOH HOH B . 
F 3 HOH 67  2067 2067 HOH HOH B . 
F 3 HOH 68  2068 2068 HOH HOH B . 
F 3 HOH 69  2069 2069 HOH HOH B . 
F 3 HOH 70  2070 2070 HOH HOH B . 
F 3 HOH 71  2071 2071 HOH HOH B . 
F 3 HOH 72  2072 2072 HOH HOH B . 
F 3 HOH 73  2073 2073 HOH HOH B . 
F 3 HOH 74  2074 2074 HOH HOH B . 
F 3 HOH 75  2075 2075 HOH HOH B . 
F 3 HOH 76  2076 2076 HOH HOH B . 
F 3 HOH 77  2077 2077 HOH HOH B . 
F 3 HOH 78  2078 2078 HOH HOH B . 
F 3 HOH 79  2079 2079 HOH HOH B . 
F 3 HOH 80  2080 2080 HOH HOH B . 
F 3 HOH 81  2081 2081 HOH HOH B . 
F 3 HOH 82  2082 2082 HOH HOH B . 
F 3 HOH 83  2083 2083 HOH HOH B . 
F 3 HOH 84  2084 2084 HOH HOH B . 
F 3 HOH 85  2085 2085 HOH HOH B . 
F 3 HOH 86  2086 2086 HOH HOH B . 
F 3 HOH 87  2087 2087 HOH HOH B . 
F 3 HOH 88  2088 2088 HOH HOH B . 
F 3 HOH 89  2089 2089 HOH HOH B . 
F 3 HOH 90  2090 2090 HOH HOH B . 
F 3 HOH 91  2091 2091 HOH HOH B . 
F 3 HOH 92  2092 2092 HOH HOH B . 
F 3 HOH 93  2093 2093 HOH HOH B . 
F 3 HOH 94  2094 2094 HOH HOH B . 
F 3 HOH 95  2095 2095 HOH HOH B . 
F 3 HOH 96  2096 2096 HOH HOH B . 
F 3 HOH 97  2097 2097 HOH HOH B . 
F 3 HOH 98  2098 2098 HOH HOH B . 
G 3 HOH 1   2001 2001 HOH HOH D . 
G 3 HOH 2   2002 2002 HOH HOH D . 
G 3 HOH 3   2003 2003 HOH HOH D . 
G 3 HOH 4   2004 2004 HOH HOH D . 
G 3 HOH 5   2005 2005 HOH HOH D . 
G 3 HOH 6   2006 2006 HOH HOH D . 
G 3 HOH 7   2007 2007 HOH HOH D . 
G 3 HOH 8   2008 2008 HOH HOH D . 
G 3 HOH 9   2009 2009 HOH HOH D . 
G 3 HOH 10  2010 2010 HOH HOH D . 
G 3 HOH 11  2011 2011 HOH HOH D . 
G 3 HOH 12  2012 2012 HOH HOH D . 
G 3 HOH 13  2013 2013 HOH HOH D . 
G 3 HOH 14  2014 2014 HOH HOH D . 
H 3 HOH 1   2001 2001 HOH HOH E . 
H 3 HOH 2   2002 2002 HOH HOH E . 
H 3 HOH 3   2003 2003 HOH HOH E . 
H 3 HOH 4   2004 2004 HOH HOH E . 
H 3 HOH 5   2005 2005 HOH HOH E . 
H 3 HOH 6   2006 2006 HOH HOH E . 
H 3 HOH 7   2007 2007 HOH HOH E . 
H 3 HOH 8   2008 2008 HOH HOH E . 
H 3 HOH 9   2009 2009 HOH HOH E . 
H 3 HOH 10  2010 2010 HOH HOH E . 
H 3 HOH 11  2011 2011 HOH HOH E . 
H 3 HOH 12  2012 2012 HOH HOH E . 
H 3 HOH 13  2013 2013 HOH HOH E . 
H 3 HOH 14  2014 2014 HOH HOH E . 
H 3 HOH 15  2015 2015 HOH HOH E . 
H 3 HOH 16  2016 2016 HOH HOH E . 
H 3 HOH 17  2017 2017 HOH HOH E . 
H 3 HOH 18  2018 2018 HOH HOH E . 
H 3 HOH 19  2019 2019 HOH HOH E . 
H 3 HOH 20  2020 2020 HOH HOH E . 
H 3 HOH 21  2021 2021 HOH HOH E . 
H 3 HOH 22  2022 2022 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,H 
2 1 B,C,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3230  ? 
1 MORE         4     ? 
1 'SSA (A^2)'  23340 ? 
2 'ABSA (A^2)' 3430  ? 
2 MORE         7     ? 
2 'SSA (A^2)'  23720 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-27 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2019-10-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Data collection'           
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_database_status      
2 3 'Structure model' pdbx_struct_assembly      
3 3 'Structure model' pdbx_struct_assembly_gen  
4 3 'Structure model' pdbx_struct_assembly_prop 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.status_code_sf' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 50.1660 75.5330 2.3490   0.4228 0.1760 0.0344 0.1289  -0.1214 0.1103  2.2868  2.1945  3.3045  
-0.8061 0.6359  -1.6061 -0.0437 0.4770  0.5576  -0.3652 -0.0073 0.1454  -0.9949 -0.2863 0.0511 
'X-RAY DIFFRACTION' 2 ? refined 61.3160 65.7210 43.7290  0.2331 0.1812 0.0577 0.0024  -0.0202 0.0287  1.1563  1.0932  1.3740  
-0.1700 -0.4281 1.2024  -0.1119 -0.0762 -0.0403 0.3140  0.0694  0.0050  -0.2907 0.0173  0.0425 
'X-RAY DIFFRACTION' 3 ? refined 47.0600 33.1370 -28.8390 0.2033 0.3393 0.0282 -0.0353 -0.0403 -0.1531 1.3511  1.4069  4.1821  
0.1947  0.6174  1.3848  -0.0753 0.2427  -0.1873 -0.3137 -0.2993 0.4283  0.0141  -0.9861 0.3746 
'X-RAY DIFFRACTION' 4 ? refined 53.7680 36.2780 14.2080  0.2111 0.2230 0.0622 -0.0142 0.0147  -0.0072 1.5357  3.1510  1.2696  
1.1879  -0.7076 -0.2931 -0.0358 -0.0832 -0.1187 0.2291  0.0118  -0.1378 0.3143  0.0583  0.0240 
'X-RAY DIFFRACTION' 5 ? refined 58.8800 21.7780 1.6680   0.4305 0.0319 0.1091 -0.0132 0.1613  0.0225  5.1279  12.9164 16.3221 
3.7247  -4.5615 -2.0105 -0.5201 -0.3180 -1.0365 0.5292  -0.0624 -0.6888 1.7664  0.2831  0.5826 
'X-RAY DIFFRACTION' 6 ? refined 43.7710 62.2670 40.1540  0.1486 0.2049 0.1513 0.0797  0.0494  -0.0740 10.3317 4.2889  16.2995 
-2.2681 -3.2040 3.3134  -0.0380 -0.3449 -0.5210 0.4099  -0.4023 0.8803  0.4060  -1.3646 0.4403 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 47  ? ? A 281 ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 E 749 ? ? E 757 ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 282 ? ? A 470 ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 B 47  ? ? B 356 ? ? ? ? 
'X-RAY DIFFRACTION' 5 3 D 748 ? ? D 756 ? ? ? ? 
'X-RAY DIFFRACTION' 6 4 B 357 ? ? B 472 ? ? ? ? 
'X-RAY DIFFRACTION' 7 5 D 688 ? ? D 741 ? ? ? ? 
'X-RAY DIFFRACTION' 8 6 E 686 ? ? E 741 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2JDQ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;ADDITIONAL GLYCINE AT N-TERMINUS DUE TO CLONING (CHAINS DE)
ADDITIONAL GLYCINE-ALANINE-METHIONINE AT N-TERMINUS DUE TO
CLONING (CHAINS AB)
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   E PHE 694 ? ? O  E HOH 2007 ? ? 1.90 
2 1 OD1 A ASP 209 ? ? NZ A LYS 251  ? ? 2.13 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_1             333 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_2             333 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.675 
_pdbx_validate_rmsd_bond.bond_target_value         1.524 
_pdbx_validate_rmsd_bond.bond_deviation            0.151 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.021 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 115 ? ? 26.75  85.04   
2  1 SER A 221 ? ? -69.72 3.40    
3  1 GLN A 223 ? ? -68.14 91.22   
4  1 ASP A 327 ? ? -54.74 -174.02 
5  1 ASN A 336 ? ? -63.02 1.04    
6  1 ASN B 115 ? ? -31.37 127.74  
7  1 SER B 221 ? ? -82.18 45.90   
8  1 ASP B 327 ? ? -69.48 -176.01 
9  1 GLN D 728 ? ? 28.59  -116.56 
10 1 GLN E 728 ? ? 20.06  -117.47 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 63  ? A GLY 1   
2  1 Y 1 A ALA 64  ? A ALA 2   
3  1 Y 1 A MET 65  ? A MET 3   
4  1 Y 1 A GLY 66  ? A GLY 4   
5  1 Y 1 A PHE 67  ? A PHE 5   
6  1 Y 1 A HIS 68  ? A HIS 6   
7  1 Y 1 A GLU 69  ? A GLU 7   
8  1 Y 1 A ALA 70  ? A ALA 8   
9  1 Y 1 A GLN 71  ? A GLN 9   
10 1 Y 1 A ILE 72  ? A ILE 10  
11 1 Y 1 A ASN 73  ? A ASN 11  
12 1 Y 1 A ASN 74  ? A ASN 12  
13 1 Y 1 A MET 75  ? A MET 13  
14 1 Y 1 A GLU 76  ? A GLU 14  
15 1 Y 1 A MET 77  ? A MET 15  
16 1 Y 1 A ALA 78  ? A ALA 16  
17 1 Y 1 A PRO 79  ? A PRO 17  
18 1 Y 1 A GLY 80  ? A GLY 18  
19 1 Y 1 A GLY 81  ? A GLY 19  
20 1 Y 1 A VAL 82  ? A VAL 20  
21 1 Y 1 A ILE 83  ? A ILE 21  
22 1 Y 1 A ASP 508 ? A ASP 446 
23 1 Y 1 A GLU 509 ? A GLU 447 
24 1 Y 1 A ASP 510 ? A ASP 448 
25 1 Y 1 A SER 511 ? A SER 449 
26 1 Y 1 A SER 512 ? A SER 450 
27 1 Y 1 B GLY 63  ? B GLY 1   
28 1 Y 1 B ALA 64  ? B ALA 2   
29 1 Y 1 B MET 65  ? B MET 3   
30 1 Y 1 B GLY 66  ? B GLY 4   
31 1 Y 1 B PHE 67  ? B PHE 5   
32 1 Y 1 B HIS 68  ? B HIS 6   
33 1 Y 1 B GLU 69  ? B GLU 7   
34 1 Y 1 B ALA 70  ? B ALA 8   
35 1 Y 1 B GLN 71  ? B GLN 9   
36 1 Y 1 B ILE 72  ? B ILE 10  
37 1 Y 1 B ASN 73  ? B ASN 11  
38 1 Y 1 B ASN 74  ? B ASN 12  
39 1 Y 1 B MET 75  ? B MET 13  
40 1 Y 1 B GLU 76  ? B GLU 14  
41 1 Y 1 B MET 77  ? B MET 15  
42 1 Y 1 B ALA 78  ? B ALA 16  
43 1 Y 1 B PRO 79  ? B PRO 17  
44 1 Y 1 B GLY 80  ? B GLY 18  
45 1 Y 1 B GLY 81  ? B GLY 19  
46 1 Y 1 B VAL 82  ? B VAL 20  
47 1 Y 1 B ILE 83  ? B ILE 21  
48 1 Y 1 B ASP 510 ? B ASP 448 
49 1 Y 1 B SER 511 ? B SER 449 
50 1 Y 1 B SER 512 ? B SER 450 
51 1 Y 1 D GLY 677 ? C GLY 1   
52 1 Y 1 D ASP 678 ? C ASP 2   
53 1 Y 1 D PRO 679 ? C PRO 3   
54 1 Y 1 D ASP 680 ? C ASP 4   
55 1 Y 1 D GLU 681 ? C GLU 5   
56 1 Y 1 D SER 682 ? C SER 6   
57 1 Y 1 D THR 683 ? C THR 7   
58 1 Y 1 D SER 684 ? C SER 8   
59 1 Y 1 D GLY 685 ? C GLY 9   
60 1 Y 1 D VAL 686 ? C VAL 10  
61 1 Y 1 D GLU 687 ? C GLU 11  
62 1 Y 1 D SER 742 ? C SER 66  
63 1 Y 1 D ILE 743 ? C ILE 67  
64 1 Y 1 D LEU 744 ? C LEU 68  
65 1 Y 1 D THR 745 ? C THR 69  
66 1 Y 1 D ASP 746 ? C ASP 70  
67 1 Y 1 D SER 747 ? C SER 71  
68 1 Y 1 D ALA 757 ? C ALA 81  
69 1 Y 1 D ILE 758 ? C ILE 82  
70 1 Y 1 D ASN 759 ? C ASN 83  
71 1 Y 1 E GLY 677 ? D GLY 1   
72 1 Y 1 E ASP 678 ? D ASP 2   
73 1 Y 1 E PRO 679 ? D PRO 3   
74 1 Y 1 E ASP 680 ? D ASP 4   
75 1 Y 1 E GLU 681 ? D GLU 5   
76 1 Y 1 E SER 682 ? D SER 6   
77 1 Y 1 E THR 683 ? D THR 7   
78 1 Y 1 E SER 684 ? D SER 8   
79 1 Y 1 E GLY 685 ? D GLY 9   
80 1 Y 1 E SER 742 ? D SER 66  
81 1 Y 1 E ILE 743 ? D ILE 67  
82 1 Y 1 E LEU 744 ? D LEU 68  
83 1 Y 1 E THR 745 ? D THR 69  
84 1 Y 1 E ASP 746 ? D ASP 70  
85 1 Y 1 E SER 747 ? D SER 71  
86 1 Y 1 E GLN 748 ? D GLN 72  
87 1 Y 1 E ILE 758 ? D ILE 82  
88 1 Y 1 E ASN 759 ? D ASN 83  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#