data_2JED
# 
_entry.id   2JED 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JED         
PDBE  EBI-31107    
WWPDB D_1290031107 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1XJD 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF PKC-THETA COMPLEXED WITH STAUROSPORINEAT 2A RESOLUTION' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JED 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stark, W.'       1  
'Bitsch, F.'      2  
'Berner, A.'      3  
'Buelens, F.'     4  
'Graff, P.'       5  
'Depersin, H.'    6  
'Geiser, M.'      7  
'Knecht, R.'      8  
'Rahuel, J.'      9  
'Rummel, G.'      10 
'Schlaeppi, J.M.' 11 
'Schmitz, R.'     12 
'Strauss, A.'     13 
'Wagner, J.'      14 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Crystal Structure of the Kinase Domain of the Protein Kinase C Theta in Complex with Nvp-Xaa228' 'To be Published' ?  
?   ? ?    ?      ?  ?         0353 ? ?        ?                         
1       
;Improved Expression of Kinases in Baculovirus-Infected Insect Cells Upon Addition of Specific Kinase Inhibitors to the Culture Helpful for Structural Studies.
;
'Protein Expression Purif.' 56 167 ? 2007 PEXPEJ US 1046-5928 0757 ? 17720535 10.1016/J.PEP.2007.06.008 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Stark, W.'         1  ? 
primary 'Bitsch, F.'        2  ? 
primary 'Berner, A.'        3  ? 
primary 'Buelens, F.'       4  ? 
primary 'Graff, P.'         5  ? 
primary 'Depersin, H.'      6  ? 
primary 'Fendrich, G.'      7  ? 
primary 'Geiser, M.'        8  ? 
primary 'Knecht, R.'        9  ? 
primary 'Rahuel, J.'        10 ? 
primary 'Rummel, G.'        11 ? 
primary 'Schlaeppi, J.M.'   12 ? 
primary 'Schmitz, R.'       13 ? 
primary 'Strauss, A.'       14 ? 
primary 'Wagner, J.'        15 ? 
1       'Strauss, A.'       16 ? 
1       'Fendrich, G.'      17 ? 
1       'Horisberger, M.A.' 18 ? 
1       'Liebetanz, J.'     19 ? 
1       'Meyhack, B.'       20 ? 
1       'Schlaeppi, J.-M.'  21 ? 
1       'Schmitz, R.'       22 ? 
# 
_cell.entry_id           2JED 
_cell.length_a           152.172 
_cell.length_b           152.172 
_cell.length_c           74.837 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JED 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN KINASE C THETA' 41823.965 2   2.7.11.13 YES 'KINASE DOMAIN 361-706' 
'PHOSPHOSERINE 676, PHOSPHOSERINE 695, C540 MODIFIED' 
2 non-polymer syn 
'3-(8-DIMETHYLAMINOMETHYL-6,7,8,9-TETRAHYDRO-PYRIDO[1,2-A]INDOL-10-YL)-4-(1-METHYL-1H-INDOL-3-YL)-PYRROLE-2,5-DIONE' 452.548   2   
?         ?   ?                       ?                                                     
3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   1   ?         ?   ?                       ? 
4 water       nat water 18.015    412 ?         ?   ?                       ?                                                     
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        NPKC-THETA 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EPELNKERPSLQIKLKIEDFELHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPF
LTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKI
ADFGMCKENMLGDAKTNEFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRL(SEP)
FADRALINSMDQNMFRNF(SEP)FMNPGMERLISHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EPELNKERPSLQIKLKIEDFELHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPF
LTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKI
ADFGMCKENMLGDAKTNEFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADR
ALINSMDQNMFRNFSFMNPGMERLISHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   PRO n 
1 3   GLU n 
1 4   LEU n 
1 5   ASN n 
1 6   LYS n 
1 7   GLU n 
1 8   ARG n 
1 9   PRO n 
1 10  SER n 
1 11  LEU n 
1 12  GLN n 
1 13  ILE n 
1 14  LYS n 
1 15  LEU n 
1 16  LYS n 
1 17  ILE n 
1 18  GLU n 
1 19  ASP n 
1 20  PHE n 
1 21  GLU n 
1 22  LEU n 
1 23  HIS n 
1 24  LYS n 
1 25  MET n 
1 26  LEU n 
1 27  GLY n 
1 28  LYS n 
1 29  GLY n 
1 30  SER n 
1 31  PHE n 
1 32  GLY n 
1 33  LYS n 
1 34  VAL n 
1 35  PHE n 
1 36  LEU n 
1 37  ALA n 
1 38  GLU n 
1 39  PHE n 
1 40  LYS n 
1 41  LYS n 
1 42  THR n 
1 43  ASN n 
1 44  GLN n 
1 45  PHE n 
1 46  PHE n 
1 47  ALA n 
1 48  ILE n 
1 49  LYS n 
1 50  ALA n 
1 51  LEU n 
1 52  LYS n 
1 53  LYS n 
1 54  ASP n 
1 55  VAL n 
1 56  VAL n 
1 57  LEU n 
1 58  MET n 
1 59  ASP n 
1 60  ASP n 
1 61  ASP n 
1 62  VAL n 
1 63  GLU n 
1 64  CYS n 
1 65  THR n 
1 66  MET n 
1 67  VAL n 
1 68  GLU n 
1 69  LYS n 
1 70  ARG n 
1 71  VAL n 
1 72  LEU n 
1 73  SER n 
1 74  LEU n 
1 75  ALA n 
1 76  TRP n 
1 77  GLU n 
1 78  HIS n 
1 79  PRO n 
1 80  PHE n 
1 81  LEU n 
1 82  THR n 
1 83  HIS n 
1 84  MET n 
1 85  PHE n 
1 86  CYS n 
1 87  THR n 
1 88  PHE n 
1 89  GLN n 
1 90  THR n 
1 91  LYS n 
1 92  GLU n 
1 93  ASN n 
1 94  LEU n 
1 95  PHE n 
1 96  PHE n 
1 97  VAL n 
1 98  MET n 
1 99  GLU n 
1 100 TYR n 
1 101 LEU n 
1 102 ASN n 
1 103 GLY n 
1 104 GLY n 
1 105 ASP n 
1 106 LEU n 
1 107 MET n 
1 108 TYR n 
1 109 HIS n 
1 110 ILE n 
1 111 GLN n 
1 112 SER n 
1 113 CYS n 
1 114 HIS n 
1 115 LYS n 
1 116 PHE n 
1 117 ASP n 
1 118 LEU n 
1 119 SER n 
1 120 ARG n 
1 121 ALA n 
1 122 THR n 
1 123 PHE n 
1 124 TYR n 
1 125 ALA n 
1 126 ALA n 
1 127 GLU n 
1 128 ILE n 
1 129 ILE n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLN n 
1 134 PHE n 
1 135 LEU n 
1 136 HIS n 
1 137 SER n 
1 138 LYS n 
1 139 GLY n 
1 140 ILE n 
1 141 VAL n 
1 142 TYR n 
1 143 ARG n 
1 144 ASP n 
1 145 LEU n 
1 146 LYS n 
1 147 LEU n 
1 148 ASP n 
1 149 ASN n 
1 150 ILE n 
1 151 LEU n 
1 152 LEU n 
1 153 ASP n 
1 154 LYS n 
1 155 ASP n 
1 156 GLY n 
1 157 HIS n 
1 158 ILE n 
1 159 LYS n 
1 160 ILE n 
1 161 ALA n 
1 162 ASP n 
1 163 PHE n 
1 164 GLY n 
1 165 MET n 
1 166 CYS n 
1 167 LYS n 
1 168 GLU n 
1 169 ASN n 
1 170 MET n 
1 171 LEU n 
1 172 GLY n 
1 173 ASP n 
1 174 ALA n 
1 175 LYS n 
1 176 THR n 
1 177 ASN n 
1 178 GLU n 
1 179 PHE n 
1 180 CYS n 
1 181 GLY n 
1 182 THR n 
1 183 PRO n 
1 184 ASP n 
1 185 TYR n 
1 186 ILE n 
1 187 ALA n 
1 188 PRO n 
1 189 GLU n 
1 190 ILE n 
1 191 LEU n 
1 192 LEU n 
1 193 GLY n 
1 194 GLN n 
1 195 LYS n 
1 196 TYR n 
1 197 ASN n 
1 198 HIS n 
1 199 SER n 
1 200 VAL n 
1 201 ASP n 
1 202 TRP n 
1 203 TRP n 
1 204 SER n 
1 205 PHE n 
1 206 GLY n 
1 207 VAL n 
1 208 LEU n 
1 209 LEU n 
1 210 TYR n 
1 211 GLU n 
1 212 MET n 
1 213 LEU n 
1 214 ILE n 
1 215 GLY n 
1 216 GLN n 
1 217 SER n 
1 218 PRO n 
1 219 PHE n 
1 220 HIS n 
1 221 GLY n 
1 222 GLN n 
1 223 ASP n 
1 224 GLU n 
1 225 GLU n 
1 226 GLU n 
1 227 LEU n 
1 228 PHE n 
1 229 HIS n 
1 230 SER n 
1 231 ILE n 
1 232 ARG n 
1 233 MET n 
1 234 ASP n 
1 235 ASN n 
1 236 PRO n 
1 237 PHE n 
1 238 TYR n 
1 239 PRO n 
1 240 ARG n 
1 241 TRP n 
1 242 LEU n 
1 243 GLU n 
1 244 LYS n 
1 245 GLU n 
1 246 ALA n 
1 247 LYS n 
1 248 ASP n 
1 249 LEU n 
1 250 LEU n 
1 251 VAL n 
1 252 LYS n 
1 253 LEU n 
1 254 PHE n 
1 255 VAL n 
1 256 ARG n 
1 257 GLU n 
1 258 PRO n 
1 259 GLU n 
1 260 LYS n 
1 261 ARG n 
1 262 LEU n 
1 263 GLY n 
1 264 VAL n 
1 265 ARG n 
1 266 GLY n 
1 267 ASP n 
1 268 ILE n 
1 269 ARG n 
1 270 GLN n 
1 271 HIS n 
1 272 PRO n 
1 273 LEU n 
1 274 PHE n 
1 275 ARG n 
1 276 GLU n 
1 277 ILE n 
1 278 ASN n 
1 279 TRP n 
1 280 GLU n 
1 281 GLU n 
1 282 LEU n 
1 283 GLU n 
1 284 ARG n 
1 285 LYS n 
1 286 GLU n 
1 287 ILE n 
1 288 ASP n 
1 289 PRO n 
1 290 PRO n 
1 291 PHE n 
1 292 ARG n 
1 293 PRO n 
1 294 LYS n 
1 295 VAL n 
1 296 LYS n 
1 297 SER n 
1 298 PRO n 
1 299 PHE n 
1 300 ASP n 
1 301 CYS n 
1 302 SER n 
1 303 ASN n 
1 304 PHE n 
1 305 ASP n 
1 306 LYS n 
1 307 GLU n 
1 308 PHE n 
1 309 LEU n 
1 310 ASN n 
1 311 GLU n 
1 312 LYS n 
1 313 PRO n 
1 314 ARG n 
1 315 LEU n 
1 316 SEP n 
1 317 PHE n 
1 318 ALA n 
1 319 ASP n 
1 320 ARG n 
1 321 ALA n 
1 322 LEU n 
1 323 ILE n 
1 324 ASN n 
1 325 SER n 
1 326 MET n 
1 327 ASP n 
1 328 GLN n 
1 329 ASN n 
1 330 MET n 
1 331 PHE n 
1 332 ARG n 
1 333 ASN n 
1 334 PHE n 
1 335 SEP n 
1 336 PHE n 
1 337 MET n 
1 338 ASN n 
1 339 PRO n 
1 340 GLY n 
1 341 MET n 
1 342 GLU n 
1 343 ARG n 
1 344 LEU n 
1 345 ILE n 
1 346 SER n 
1 347 HIS n 
1 348 HIS n 
1 349 HIS n 
1 350 HIS n 
1 351 HIS n 
1 352 HIS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                HUMAN 
_entity_src_nat.pdbx_organism_scientific   'HOMO SAPIENS' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP KPCT_HUMAN 1 ? ? Q04759 ? 
2 PDB 2JED       1 ? ? 2JED   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JED A 1   ? 346 ? Q04759 361 ? 706 ? 361 706 
2 2 2JED A 347 ? 352 ? 2JED   707 ? 712 ? 707 712 
3 1 2JED B 1   ? 346 ? Q04759 361 ? 706 ? 361 706 
4 2 2JED B 347 ? 352 ? 2JED   707 ? 712 ? 707 712 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JED GLU A 21  ? UNP Q04759 ILE 381 'engineered mutation' 381 1 
1 2JED GLU A 178 ? UNP Q04759 THR 538 'engineered mutation' 538 2 
3 2JED GLU B 21  ? UNP Q04759 ILE 381 'engineered mutation' 381 3 
3 2JED GLU B 178 ? UNP Q04759 THR 538 'engineered mutation' 538 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?               'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?               'C6 H13 N O2'     131.173 
LG8 non-polymer         . 
'3-(8-DIMETHYLAMINOMETHYL-6,7,8,9-TETRAHYDRO-PYRIDO[1,2-A]INDOL-10-YL)-4-(1-METHYL-1H-INDOL-3-YL)-PYRROLE-2,5-DIONE' ? 
'C28 H28 N4 O2 2' 452.548 
LYS 'L-peptide linking' y LYSINE ?               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?               'C5 H11 N O2 S'   149.211 
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ?               'C6 H14 O2'       118.174 
PHE 'L-peptide linking' y PHENYLALANINE ?               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?               'C5 H9 N O2'      115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P'    185.072 
SER 'L-peptide linking' y SERINE ?               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2JED 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.14 
_exptl_crystal.density_percent_sol   56 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;VAPOR DIFFUSION AT 4C PROTEIN SOLUTION: 10MG/ML PROTEIN IN 0.2M NACL, 0.05M IMIDAZOLE, 0.001M NAF, 0.05M TCEP, PH = 8.0 RESERVOIR SOLUTION: 0.1 M NA-CACODYLATE PH = 6.5 24% MPD (V/V) 4% PEG8000 (W/V) DROP: 1:1 SMALL ORGANIC MOLECULES LIKE 2,5-HEXANEDIOL AND SULFOBETAINE-195 HAVE A POSITIVE EFFECT ON THE CRYSTAL GROWTH
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-09-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918396 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.918396 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JED 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.32 
_reflns.number_obs                   42831 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.40 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.8 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.32 
_reflns_shell.d_res_low              2.36 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JED 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40693 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.88 
_refine.ls_d_res_high                            2.32 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2131 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               49.20 
_refine.aniso_B[1][1]                            -0.17000 
_refine.aniso_B[2][2]                            -0.17000 
_refine.aniso_B[3][3]                            0.25000 
_refine.aniso_B[1][2]                            -0.08000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1FOT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.257 
_refine.pdbx_overall_ESU_R_Free                  0.198 
_refine.overall_SU_ML                            0.134 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             10.404 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5396 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             412 
_refine_hist.number_atoms_total               5884 
_refine_hist.d_res_high                       2.32 
_refine_hist.d_res_low                        19.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 5624 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.445  1.974  ? 7582 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.128  5.000  ? 645  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.790 24.069 ? 290  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.001 15.059 ? 1020 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.011 15.000 ? 31   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.109  0.200  ? 768  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 4276 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.198  0.200  ? 2324 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.303  0.200  ? 3739 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.148  0.200  ? 400  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.219  0.200  ? 56   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.233  0.200  ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.734  1.500  ? 3333 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.222  2.000  ? 5200 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.861  3.000  ? 2636 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.847  4.500  ? 2382 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.32 
_refine_ls_shell.d_res_low                        2.38 
_refine_ls_shell.number_reflns_R_work             2961 
_refine_ls_shell.R_factor_R_work                  0.2470 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.3440 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             134 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  2JED 
_struct.title                     
'The crystal structure of the kinase domain of the protein kinase C theta in complex with NVP-XAA228 at 2.32A resolution.' 
_struct.pdbx_descriptor           'PROTEIN KINASE C THETA (E.C.2.7.11.13)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JED 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;PHOSPHORYLATION, NUCLEOTIDE-BINDING, SERINE/THREONINE-PROTEIN KINASE, TRANSFERASE, ATP-BINDING, POLYMORPHISM, METAL-BINDING, ZINC, KINASE, PKC THETA, MAGNESIUM, ZINC-FINGER, ALTERNATIVE SPLICING, PHORBOL-ESTER BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 16  ? GLU A 18  ? LYS A 376 GLU A 378 5 ? 3  
HELX_P HELX_P2  2  LYS A 53  ? ASP A 59  ? LYS A 413 ASP A 419 1 ? 7  
HELX_P HELX_P3  3  ASP A 61  ? SER A 73  ? ASP A 421 SER A 433 1 ? 13 
HELX_P HELX_P4  4  LEU A 74  ? HIS A 78  ? LEU A 434 HIS A 438 5 ? 5  
HELX_P HELX_P5  5  ASP A 105 ? HIS A 114 ? ASP A 465 HIS A 474 1 ? 10 
HELX_P HELX_P6  6  ASP A 117 ? LYS A 138 ? ASP A 477 LYS A 498 1 ? 22 
HELX_P HELX_P7  7  LYS A 146 ? ASP A 148 ? LYS A 506 ASP A 508 5 ? 3  
HELX_P HELX_P8  8  THR A 182 ? ILE A 186 ? THR A 542 ILE A 546 5 ? 5  
HELX_P HELX_P9  9  ALA A 187 ? LEU A 192 ? ALA A 547 LEU A 552 1 ? 6  
HELX_P HELX_P10 10 HIS A 198 ? GLY A 215 ? HIS A 558 GLY A 575 1 ? 18 
HELX_P HELX_P11 11 ASP A 223 ? ASP A 234 ? ASP A 583 ASP A 594 1 ? 12 
HELX_P HELX_P12 12 GLU A 243 ? PHE A 254 ? GLU A 603 PHE A 614 1 ? 12 
HELX_P HELX_P13 13 GLU A 257 ? ARG A 261 ? GLU A 617 ARG A 621 5 ? 5  
HELX_P HELX_P14 14 ASP A 267 ? HIS A 271 ? ASP A 627 HIS A 631 5 ? 5  
HELX_P HELX_P15 15 HIS A 271 ? ARG A 275 ? HIS A 631 ARG A 635 5 ? 5  
HELX_P HELX_P16 16 ASN A 278 ? ARG A 284 ? ASN A 638 ARG A 644 1 ? 7  
HELX_P HELX_P17 17 ASP A 319 ? MET A 326 ? ASP A 679 MET A 686 1 ? 8  
HELX_P HELX_P18 18 ASP A 327 ? ARG A 332 ? ASP A 687 ARG A 692 5 ? 6  
HELX_P HELX_P19 19 LYS B 53  ? ASP B 59  ? LYS B 413 ASP B 419 1 ? 7  
HELX_P HELX_P20 20 ASP B 61  ? SER B 73  ? ASP B 421 SER B 433 1 ? 13 
HELX_P HELX_P21 21 LEU B 74  ? HIS B 78  ? LEU B 434 HIS B 438 5 ? 5  
HELX_P HELX_P22 22 ASP B 105 ? HIS B 114 ? ASP B 465 HIS B 474 1 ? 10 
HELX_P HELX_P23 23 ASP B 117 ? LYS B 138 ? ASP B 477 LYS B 498 1 ? 22 
HELX_P HELX_P24 24 LYS B 146 ? ASP B 148 ? LYS B 506 ASP B 508 5 ? 3  
HELX_P HELX_P25 25 THR B 182 ? ILE B 186 ? THR B 542 ILE B 546 5 ? 5  
HELX_P HELX_P26 26 ALA B 187 ? LEU B 192 ? ALA B 547 LEU B 552 1 ? 6  
HELX_P HELX_P27 27 HIS B 198 ? GLY B 215 ? HIS B 558 GLY B 575 1 ? 18 
HELX_P HELX_P28 28 ASP B 223 ? ASP B 234 ? ASP B 583 ASP B 594 1 ? 12 
HELX_P HELX_P29 29 GLU B 243 ? PHE B 254 ? GLU B 603 PHE B 614 1 ? 12 
HELX_P HELX_P30 30 GLU B 257 ? ARG B 261 ? GLU B 617 ARG B 621 5 ? 5  
HELX_P HELX_P31 31 ASP B 267 ? HIS B 271 ? ASP B 627 HIS B 631 5 ? 5  
HELX_P HELX_P32 32 HIS B 271 ? ARG B 275 ? HIS B 631 ARG B 635 5 ? 5  
HELX_P HELX_P33 33 ASN B 278 ? ARG B 284 ? ASN B 638 ARG B 644 1 ? 7  
HELX_P HELX_P34 34 ASP B 327 ? ARG B 332 ? ASP B 687 ARG B 692 5 ? 6  
HELX_P HELX_P35 35 ASN B 338 ? HIS B 348 ? ASN B 698 HIS B 708 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A LEU 315 C ? ? ? 1_555 A SEP 316 N ? ? A LEU 675 A SEP 676 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2 covale both ? A SEP 316 C ? ? ? 1_555 A PHE 317 N ? ? A SEP 676 A PHE 677 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3 covale both ? A PHE 334 C ? ? ? 1_555 A SEP 335 N ? ? A PHE 694 A SEP 695 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale4 covale both ? A SEP 335 C ? ? ? 1_555 A PHE 336 N ? ? A SEP 695 A PHE 696 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale5 covale both ? B LEU 315 C ? ? ? 1_555 B SEP 316 N ? ? B LEU 675 B SEP 676 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale6 covale both ? B SEP 316 C ? ? ? 1_555 B PHE 317 N ? ? B SEP 676 B PHE 677 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale7 covale both ? B PHE 334 C ? ? ? 1_555 B SEP 335 N ? ? B PHE 694 B SEP 695 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8 covale both ? B SEP 335 C ? ? ? 1_555 B PHE 336 N ? ? B SEP 695 B PHE 696 1_555 ? ? ? ? ? ? ? 1.323 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 2 ? 
BA ? 6 ? 
BB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 20  ? GLY A 29  ? PHE A 380 GLY A 389 
AA 2 GLY A 32  ? PHE A 39  ? GLY A 392 PHE A 399 
AA 3 PHE A 45  ? LYS A 52  ? PHE A 405 LYS A 412 
AA 4 ASN A 93  ? MET A 98  ? ASN A 453 MET A 458 
AA 5 MET A 84  ? GLN A 89  ? MET A 444 GLN A 449 
AA 6 PHE A 336 ? MET A 337 ? PHE A 696 MET A 697 
AB 1 ILE A 150 ? LEU A 152 ? ILE A 510 LEU A 512 
AB 2 ILE A 158 ? ILE A 160 ? ILE A 518 ILE A 520 
BA 1 PHE B 20  ? GLY B 29  ? PHE B 380 GLY B 389 
BA 2 GLY B 32  ? PHE B 39  ? GLY B 392 PHE B 399 
BA 3 PHE B 45  ? LYS B 52  ? PHE B 405 LYS B 412 
BA 4 ASN B 93  ? GLU B 99  ? ASN B 453 GLU B 459 
BA 5 MET B 84  ? GLN B 89  ? MET B 444 GLN B 449 
BA 6 PHE B 336 ? MET B 337 ? PHE B 696 MET B 697 
BB 1 ILE B 150 ? LEU B 152 ? ILE B 510 LEU B 512 
BB 2 ILE B 158 ? ILE B 160 ? ILE B 518 ILE B 520 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 29  ? N GLY A 389 O GLY A 32  ? O GLY A 392 
AA 2 3 N ALA A 37  ? N ALA A 397 O PHE A 46  ? O PHE A 406 
AA 3 4 N LEU A 51  ? N LEU A 411 O LEU A 94  ? O LEU A 454 
AA 4 5 O VAL A 97  ? O VAL A 457 N PHE A 85  ? N PHE A 445 
AA 5 6 N THR A 87  ? N THR A 447 O PHE A 336 ? O PHE A 696 
AB 1 2 N LEU A 151 ? N LEU A 511 O LYS A 159 ? O LYS A 519 
BA 1 2 N GLY B 29  ? N GLY B 389 O GLY B 32  ? O GLY B 392 
BA 2 3 N ALA B 37  ? N ALA B 397 O PHE B 46  ? O PHE B 406 
BA 3 4 N LEU B 51  ? N LEU B 411 O LEU B 94  ? O LEU B 454 
BA 4 5 O VAL B 97  ? O VAL B 457 N PHE B 85  ? N PHE B 445 
BA 5 6 N THR B 87  ? N THR B 447 O PHE B 336 ? O PHE B 696 
BB 1 2 N LEU B 151 ? N LEU B 511 O LYS B 159 ? O LYS B 519 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LG8 A1701' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE LG8 B1712' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MPD B1713' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LEU A 26  ? LEU A 386  . ? 1_555 ? 
2  AC1 15 GLY A 27  ? GLY A 387  . ? 1_555 ? 
3  AC1 15 PHE A 31  ? PHE A 391  . ? 1_555 ? 
4  AC1 15 VAL A 34  ? VAL A 394  . ? 1_555 ? 
5  AC1 15 ALA A 47  ? ALA A 407  . ? 1_555 ? 
6  AC1 15 GLU A 68  ? GLU A 428  . ? 1_555 ? 
7  AC1 15 THR A 82  ? THR A 442  . ? 1_555 ? 
8  AC1 15 GLU A 99  ? GLU A 459  . ? 1_555 ? 
9  AC1 15 TYR A 100 ? TYR A 460  . ? 1_555 ? 
10 AC1 15 LEU A 101 ? LEU A 461  . ? 1_555 ? 
11 AC1 15 ASP A 105 ? ASP A 465  . ? 1_555 ? 
12 AC1 15 ASP A 148 ? ASP A 508  . ? 1_555 ? 
13 AC1 15 ASP A 162 ? ASP A 522  . ? 1_555 ? 
14 AC1 15 PHE A 304 ? PHE A 664  . ? 1_555 ? 
15 AC1 15 HOH F .   ? HOH A 2195 . ? 1_555 ? 
16 AC2 14 LEU B 26  ? LEU B 386  . ? 1_555 ? 
17 AC2 14 GLY B 27  ? GLY B 387  . ? 1_555 ? 
18 AC2 14 PHE B 31  ? PHE B 391  . ? 1_555 ? 
19 AC2 14 VAL B 34  ? VAL B 394  . ? 1_555 ? 
20 AC2 14 ALA B 47  ? ALA B 407  . ? 1_555 ? 
21 AC2 14 GLU B 68  ? GLU B 428  . ? 1_555 ? 
22 AC2 14 THR B 82  ? THR B 442  . ? 1_555 ? 
23 AC2 14 MET B 98  ? MET B 458  . ? 1_555 ? 
24 AC2 14 GLU B 99  ? GLU B 459  . ? 1_555 ? 
25 AC2 14 TYR B 100 ? TYR B 460  . ? 1_555 ? 
26 AC2 14 LEU B 101 ? LEU B 461  . ? 1_555 ? 
27 AC2 14 ASP B 105 ? ASP B 465  . ? 1_555 ? 
28 AC2 14 ASP B 148 ? ASP B 508  . ? 1_555 ? 
29 AC2 14 LEU B 151 ? LEU B 511  . ? 1_555 ? 
30 AC3 5  PHE A 237 ? PHE A 597  . ? 1_555 ? 
31 AC3 5  MET B 107 ? MET B 467  . ? 1_555 ? 
32 AC3 5  ILE B 110 ? ILE B 470  . ? 1_555 ? 
33 AC3 5  GLU B 211 ? GLU B 571  . ? 1_555 ? 
34 AC3 5  GLY B 215 ? GLY B 575  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JED 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JED 
_atom_sites.fract_transf_matrix[1][1]   0.006572 
_atom_sites.fract_transf_matrix[1][2]   0.003794 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007588 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013362 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 15  ? 71.463 7.622   10.145  1.00 56.86  ? 375  LEU A N   1 
ATOM   2    C CA  . LEU A 1 15  ? 72.379 6.672   9.445   1.00 56.56  ? 375  LEU A CA  1 
ATOM   3    C C   . LEU A 1 15  ? 73.574 7.401   8.814   1.00 56.07  ? 375  LEU A C   1 
ATOM   4    O O   . LEU A 1 15  ? 74.302 8.163   9.485   1.00 55.70  ? 375  LEU A O   1 
ATOM   5    C CB  . LEU A 1 15  ? 71.620 5.898   8.359   1.00 56.69  ? 375  LEU A CB  1 
ATOM   6    C CG  . LEU A 1 15  ? 70.151 5.545   8.604   1.00 57.70  ? 375  LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 15  ? 69.382 5.536   7.282   1.00 57.35  ? 375  LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 15  ? 69.986 4.221   9.371   1.00 57.50  ? 375  LEU A CD2 1 
ATOM   9    N N   . LYS A 1 16  ? 73.747 7.153   7.513   1.00 55.28  ? 376  LYS A N   1 
ATOM   10   C CA  . LYS A 1 16  ? 74.831 7.710   6.713   1.00 54.26  ? 376  LYS A CA  1 
ATOM   11   C C   . LYS A 1 16  ? 74.305 7.913   5.277   1.00 52.94  ? 376  LYS A C   1 
ATOM   12   O O   . LYS A 1 16  ? 73.712 7.005   4.691   1.00 52.66  ? 376  LYS A O   1 
ATOM   13   C CB  . LYS A 1 16  ? 75.996 6.727   6.719   1.00 54.37  ? 376  LYS A CB  1 
ATOM   14   C CG  . LYS A 1 16  ? 77.391 7.319   6.626   1.00 55.94  ? 376  LYS A CG  1 
ATOM   15   C CD  . LYS A 1 16  ? 78.426 6.199   6.796   1.00 57.66  ? 376  LYS A CD  1 
ATOM   16   C CE  . LYS A 1 16  ? 79.792 6.717   7.258   1.00 59.58  ? 376  LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 16  ? 80.575 7.356   6.156   1.00 60.73  ? 376  LYS A NZ  1 
ATOM   18   N N   . ILE A 1 17  ? 74.523 9.105   4.728   1.00 51.22  ? 377  ILE A N   1 
ATOM   19   C CA  . ILE A 1 17  ? 74.170 9.420   3.341   1.00 49.98  ? 377  ILE A CA  1 
ATOM   20   C C   . ILE A 1 17  ? 75.010 8.641   2.302   1.00 49.46  ? 377  ILE A C   1 
ATOM   21   O O   . ILE A 1 17  ? 74.645 8.565   1.123   1.00 49.23  ? 377  ILE A O   1 
ATOM   22   C CB  . ILE A 1 17  ? 74.203 10.980  3.080   1.00 49.68  ? 377  ILE A CB  1 
ATOM   23   C CG1 . ILE A 1 17  ? 73.541 11.348  1.745   1.00 48.86  ? 377  ILE A CG1 1 
ATOM   24   C CG2 . ILE A 1 17  ? 75.629 11.537  3.194   1.00 49.48  ? 377  ILE A CG2 1 
ATOM   25   C CD1 . ILE A 1 17  ? 71.990 11.265  1.740   1.00 46.38  ? 377  ILE A CD1 1 
ATOM   26   N N   . GLU A 1 18  ? 76.129 8.072   2.752   1.00 48.94  ? 378  GLU A N   1 
ATOM   27   C CA  . GLU A 1 18  ? 76.987 7.213   1.922   1.00 48.45  ? 378  GLU A CA  1 
ATOM   28   C C   . GLU A 1 18  ? 76.348 5.845   1.650   1.00 47.89  ? 378  GLU A C   1 
ATOM   29   O O   . GLU A 1 18  ? 76.780 5.112   0.752   1.00 47.48  ? 378  GLU A O   1 
ATOM   30   C CB  . GLU A 1 18  ? 78.367 7.029   2.572   1.00 48.75  ? 378  GLU A CB  1 
ATOM   31   C CG  . GLU A 1 18  ? 79.326 8.221   2.391   1.00 49.38  ? 378  GLU A CG  1 
ATOM   32   C CD  . GLU A 1 18  ? 78.946 9.443   3.232   1.00 50.00  ? 378  GLU A CD  1 
ATOM   33   O OE1 . GLU A 1 18  ? 78.667 9.277   4.449   1.00 49.43  ? 378  GLU A OE1 1 
ATOM   34   O OE2 . GLU A 1 18  ? 78.933 10.572  2.672   1.00 50.22  ? 378  GLU A OE2 1 
ATOM   35   N N   . ASP A 1 19  ? 75.316 5.514   2.429   1.00 47.37  ? 379  ASP A N   1 
ATOM   36   C CA  . ASP A 1 19  ? 74.546 4.279   2.244   1.00 46.91  ? 379  ASP A CA  1 
ATOM   37   C C   . ASP A 1 19  ? 73.607 4.399   1.047   1.00 46.09  ? 379  ASP A C   1 
ATOM   38   O O   . ASP A 1 19  ? 72.982 3.426   0.631   1.00 45.71  ? 379  ASP A O   1 
ATOM   39   C CB  . ASP A 1 19  ? 73.759 3.942   3.520   1.00 47.36  ? 379  ASP A CB  1 
ATOM   40   C CG  . ASP A 1 19  ? 74.671 3.611   4.701   1.00 49.00  ? 379  ASP A CG  1 
ATOM   41   O OD1 . ASP A 1 19  ? 75.605 4.395   4.977   1.00 51.12  ? 379  ASP A OD1 1 
ATOM   42   O OD2 . ASP A 1 19  ? 74.474 2.558   5.353   1.00 51.90  ? 379  ASP A OD2 1 
ATOM   43   N N   . PHE A 1 20  ? 73.540 5.608   0.490   1.00 45.38  ? 380  PHE A N   1 
ATOM   44   C CA  . PHE A 1 20  ? 72.660 5.926   -0.622  1.00 44.59  ? 380  PHE A CA  1 
ATOM   45   C C   . PHE A 1 20  ? 73.463 6.346   -1.845  1.00 44.56  ? 380  PHE A C   1 
ATOM   46   O O   . PHE A 1 20  ? 74.525 6.951   -1.725  1.00 44.79  ? 380  PHE A O   1 
ATOM   47   C CB  . PHE A 1 20  ? 71.722 7.070   -0.233  1.00 44.18  ? 380  PHE A CB  1 
ATOM   48   C CG  . PHE A 1 20  ? 70.802 6.755   0.913   1.00 42.79  ? 380  PHE A CG  1 
ATOM   49   C CD1 . PHE A 1 20  ? 69.553 6.180   0.682   1.00 41.08  ? 380  PHE A CD1 1 
ATOM   50   C CD2 . PHE A 1 20  ? 71.171 7.064   2.224   1.00 42.06  ? 380  PHE A CD2 1 
ATOM   51   C CE1 . PHE A 1 20  ? 68.687 5.910   1.735   1.00 41.04  ? 380  PHE A CE1 1 
ATOM   52   C CE2 . PHE A 1 20  ? 70.315 6.786   3.289   1.00 42.38  ? 380  PHE A CE2 1 
ATOM   53   C CZ  . PHE A 1 20  ? 69.072 6.211   3.045   1.00 42.11  ? 380  PHE A CZ  1 
ATOM   54   N N   . GLU A 1 21  ? 72.955 5.992   -3.017  1.00 44.36  ? 381  GLU A N   1 
ATOM   55   C CA  . GLU A 1 21  ? 73.435 6.537   -4.270  1.00 44.79  ? 381  GLU A CA  1 
ATOM   56   C C   . GLU A 1 21  ? 72.404 7.583   -4.712  1.00 44.32  ? 381  GLU A C   1 
ATOM   57   O O   . GLU A 1 21  ? 71.228 7.271   -4.889  1.00 44.50  ? 381  GLU A O   1 
ATOM   58   C CB  . GLU A 1 21  ? 73.567 5.419   -5.307  1.00 45.11  ? 381  GLU A CB  1 
ATOM   59   C CG  . GLU A 1 21  ? 74.106 5.837   -6.680  1.00 48.21  ? 381  GLU A CG  1 
ATOM   60   C CD  . GLU A 1 21  ? 75.587 6.213   -6.683  1.00 51.82  ? 381  GLU A CD  1 
ATOM   61   O OE1 . GLU A 1 21  ? 76.434 5.481   -6.093  1.00 53.57  ? 381  GLU A OE1 1 
ATOM   62   O OE2 . GLU A 1 21  ? 75.910 7.257   -7.300  1.00 54.00  ? 381  GLU A OE2 1 
ATOM   63   N N   . LEU A 1 22  ? 72.831 8.833   -4.842  1.00 44.03  ? 382  LEU A N   1 
ATOM   64   C CA  . LEU A 1 22  ? 71.928 9.899   -5.302  1.00 43.53  ? 382  LEU A CA  1 
ATOM   65   C C   . LEU A 1 22  ? 71.914 9.944   -6.824  1.00 43.34  ? 382  LEU A C   1 
ATOM   66   O O   . LEU A 1 22  ? 72.859 10.440  -7.438  1.00 43.21  ? 382  LEU A O   1 
ATOM   67   C CB  . LEU A 1 22  ? 72.330 11.254  -4.717  1.00 42.89  ? 382  LEU A CB  1 
ATOM   68   C CG  . LEU A 1 22  ? 72.448 11.406  -3.196  1.00 42.69  ? 382  LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 22  ? 72.869 12.831  -2.860  1.00 42.71  ? 382  LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 22  ? 71.182 11.055  -2.449  1.00 40.50  ? 382  LEU A CD2 1 
ATOM   71   N N   . HIS A 1 23  ? 70.846 9.409   -7.412  1.00 43.33  ? 383  HIS A N   1 
ATOM   72   C CA  . HIS A 1 23  ? 70.704 9.272   -8.867  1.00 43.90  ? 383  HIS A CA  1 
ATOM   73   C C   . HIS A 1 23  ? 70.294 10.562  -9.615  1.00 44.26  ? 383  HIS A C   1 
ATOM   74   O O   . HIS A 1 23  ? 70.867 10.886  -10.664 1.00 44.27  ? 383  HIS A O   1 
ATOM   75   C CB  . HIS A 1 23  ? 69.699 8.161   -9.188  1.00 43.92  ? 383  HIS A CB  1 
ATOM   76   C CG  . HIS A 1 23  ? 70.226 6.779   -8.959  1.00 44.50  ? 383  HIS A CG  1 
ATOM   77   N ND1 . HIS A 1 23  ? 71.067 6.148   -9.851  1.00 45.08  ? 383  HIS A ND1 1 
ATOM   78   C CD2 . HIS A 1 23  ? 70.027 5.903   -7.944  1.00 45.51  ? 383  HIS A CD2 1 
ATOM   79   C CE1 . HIS A 1 23  ? 71.376 4.946   -9.389  1.00 45.92  ? 383  HIS A CE1 1 
ATOM   80   N NE2 . HIS A 1 23  ? 70.756 4.771   -8.234  1.00 46.13  ? 383  HIS A NE2 1 
ATOM   81   N N   . LYS A 1 24  ? 69.287 11.265  -9.087  1.00 44.22  ? 384  LYS A N   1 
ATOM   82   C CA  . LYS A 1 24  ? 68.725 12.464  -9.713  1.00 44.42  ? 384  LYS A CA  1 
ATOM   83   C C   . LYS A 1 24  ? 68.355 13.485  -8.659  1.00 44.30  ? 384  LYS A C   1 
ATOM   84   O O   . LYS A 1 24  ? 68.024 13.125  -7.523  1.00 43.61  ? 384  LYS A O   1 
ATOM   85   C CB  . LYS A 1 24  ? 67.418 12.174  -10.465 1.00 44.55  ? 384  LYS A CB  1 
ATOM   86   C CG  . LYS A 1 24  ? 67.407 11.036  -11.440 1.00 47.04  ? 384  LYS A CG  1 
ATOM   87   C CD  . LYS A 1 24  ? 68.044 11.390  -12.770 1.00 50.99  ? 384  LYS A CD  1 
ATOM   88   C CE  . LYS A 1 24  ? 67.873 10.221  -13.744 1.00 53.02  ? 384  LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 24  ? 66.412 9.862   -13.861 1.00 54.59  ? 384  LYS A NZ  1 
ATOM   90   N N   . MET A 1 25  ? 68.378 14.759  -9.063  1.00 44.38  ? 385  MET A N   1 
ATOM   91   C CA  . MET A 1 25  ? 67.703 15.815  -8.327  1.00 44.61  ? 385  MET A CA  1 
ATOM   92   C C   . MET A 1 25  ? 66.281 15.905  -8.878  1.00 43.36  ? 385  MET A C   1 
ATOM   93   O O   . MET A 1 25  ? 66.079 16.263  -10.041 1.00 42.67  ? 385  MET A O   1 
ATOM   94   C CB  . MET A 1 25  ? 68.432 17.149  -8.511  1.00 44.69  ? 385  MET A CB  1 
ATOM   95   C CG  . MET A 1 25  ? 68.054 18.218  -7.483  1.00 44.91  ? 385  MET A CG  1 
ATOM   96   S SD  . MET A 1 25  ? 68.789 19.803  -7.889  1.00 48.31  ? 385  MET A SD  1 
ATOM   97   C CE  . MET A 1 25  ? 70.537 19.499  -7.563  1.00 49.24  ? 385  MET A CE  1 
ATOM   98   N N   . LEU A 1 26  ? 65.305 15.553  -8.047  1.00 42.53  ? 386  LEU A N   1 
ATOM   99   C CA  . LEU A 1 26  ? 63.901 15.600  -8.451  1.00 42.27  ? 386  LEU A CA  1 
ATOM   100  C C   . LEU A 1 26  ? 63.457 17.052  -8.564  1.00 42.85  ? 386  LEU A C   1 
ATOM   101  O O   . LEU A 1 26  ? 62.777 17.437  -9.528  1.00 42.54  ? 386  LEU A O   1 
ATOM   102  C CB  . LEU A 1 26  ? 63.012 14.794  -7.487  1.00 41.53  ? 386  LEU A CB  1 
ATOM   103  C CG  . LEU A 1 26  ? 63.274 13.280  -7.461  1.00 39.67  ? 386  LEU A CG  1 
ATOM   104  C CD1 . LEU A 1 26  ? 62.586 12.584  -6.285  1.00 37.56  ? 386  LEU A CD1 1 
ATOM   105  C CD2 . LEU A 1 26  ? 62.896 12.590  -8.788  1.00 37.80  ? 386  LEU A CD2 1 
ATOM   106  N N   . GLY A 1 27  ? 63.902 17.866  -7.608  1.00 42.88  ? 387  GLY A N   1 
ATOM   107  C CA  . GLY A 1 27  ? 63.549 19.255  -7.575  1.00 43.03  ? 387  GLY A CA  1 
ATOM   108  C C   . GLY A 1 27  ? 64.331 20.043  -6.545  1.00 44.40  ? 387  GLY A C   1 
ATOM   109  O O   . GLY A 1 27  ? 65.009 19.486  -5.670  1.00 43.87  ? 387  GLY A O   1 
ATOM   110  N N   . LYS A 1 28  ? 64.214 21.358  -6.664  1.00 45.11  ? 388  LYS A N   1 
ATOM   111  C CA  . LYS A 1 28  ? 64.924 22.317  -5.845  1.00 47.12  ? 388  LYS A CA  1 
ATOM   112  C C   . LYS A 1 28  ? 63.973 23.501  -5.615  1.00 47.29  ? 388  LYS A C   1 
ATOM   113  O O   . LYS A 1 28  ? 63.239 23.904  -6.533  1.00 46.95  ? 388  LYS A O   1 
ATOM   114  C CB  . LYS A 1 28  ? 66.168 22.778  -6.601  1.00 47.33  ? 388  LYS A CB  1 
ATOM   115  C CG  . LYS A 1 28  ? 67.193 23.392  -5.720  1.00 51.33  ? 388  LYS A CG  1 
ATOM   116  C CD  . LYS A 1 28  ? 68.230 24.178  -6.485  1.00 54.77  ? 388  LYS A CD  1 
ATOM   117  C CE  . LYS A 1 28  ? 68.837 25.225  -5.545  1.00 58.80  ? 388  LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 28  ? 68.736 24.783  -4.107  1.00 60.44  ? 388  LYS A NZ  1 
ATOM   119  N N   . GLY A 1 29  ? 63.947 24.043  -4.401  1.00 47.56  ? 389  GLY A N   1 
ATOM   120  C CA  . GLY A 1 29  ? 63.023 25.161  -4.136  1.00 47.76  ? 389  GLY A CA  1 
ATOM   121  C C   . GLY A 1 29  ? 62.845 25.521  -2.677  1.00 48.00  ? 389  GLY A C   1 
ATOM   122  O O   . GLY A 1 29  ? 63.766 25.355  -1.874  1.00 48.07  ? 389  GLY A O   1 
ATOM   123  N N   . SER A 1 30  ? 61.649 25.998  -2.333  1.00 48.41  ? 390  SER A N   1 
ATOM   124  C CA  . SER A 1 30  ? 61.317 26.405  -0.955  1.00 48.73  ? 390  SER A CA  1 
ATOM   125  C C   . SER A 1 30  ? 61.402 25.245  0.036   1.00 48.57  ? 390  SER A C   1 
ATOM   126  O O   . SER A 1 30  ? 61.491 25.455  1.247   1.00 48.96  ? 390  SER A O   1 
ATOM   127  C CB  . SER A 1 30  ? 59.930 27.042  -0.904  1.00 48.80  ? 390  SER A CB  1 
ATOM   128  O OG  . SER A 1 30  ? 58.951 26.196  -1.505  1.00 50.71  ? 390  SER A OG  1 
ATOM   129  N N   . PHE A 1 31  ? 61.391 24.025  -0.494  1.00 47.88  ? 391  PHE A N   1 
ATOM   130  C CA  . PHE A 1 31  ? 61.513 22.790  0.298   1.00 47.18  ? 391  PHE A CA  1 
ATOM   131  C C   . PHE A 1 31  ? 62.956 22.285  0.355   1.00 46.99  ? 391  PHE A C   1 
ATOM   132  O O   . PHE A 1 31  ? 63.216 21.214  0.893   1.00 48.00  ? 391  PHE A O   1 
ATOM   133  C CB  . PHE A 1 31  ? 60.617 21.700  -0.311  1.00 46.51  ? 391  PHE A CB  1 
ATOM   134  C CG  . PHE A 1 31  ? 60.715 21.610  -1.812  1.00 44.82  ? 391  PHE A CG  1 
ATOM   135  C CD1 . PHE A 1 31  ? 59.764 22.211  -2.614  1.00 44.25  ? 391  PHE A CD1 1 
ATOM   136  C CD2 . PHE A 1 31  ? 61.787 20.947  -2.414  1.00 44.70  ? 391  PHE A CD2 1 
ATOM   137  C CE1 . PHE A 1 31  ? 59.855 22.149  -4.009  1.00 45.86  ? 391  PHE A CE1 1 
ATOM   138  C CE2 . PHE A 1 31  ? 61.904 20.873  -3.786  1.00 43.99  ? 391  PHE A CE2 1 
ATOM   139  C CZ  . PHE A 1 31  ? 60.932 21.469  -4.597  1.00 45.45  ? 391  PHE A CZ  1 
ATOM   140  N N   . GLY A 1 32  ? 63.891 23.050  -0.209  1.00 46.62  ? 392  GLY A N   1 
ATOM   141  C CA  . GLY A 1 32  ? 65.305 22.667  -0.233  1.00 44.98  ? 392  GLY A CA  1 
ATOM   142  C C   . GLY A 1 32  ? 65.643 21.926  -1.504  1.00 44.09  ? 392  GLY A C   1 
ATOM   143  O O   . GLY A 1 32  ? 65.342 22.388  -2.589  1.00 45.03  ? 392  GLY A O   1 
ATOM   144  N N   . LYS A 1 33  ? 66.265 20.768  -1.363  1.00 43.60  ? 393  LYS A N   1 
ATOM   145  C CA  . LYS A 1 33  ? 66.586 19.885  -2.486  1.00 42.83  ? 393  LYS A CA  1 
ATOM   146  C C   . LYS A 1 33  ? 66.048 18.482  -2.190  1.00 41.36  ? 393  LYS A C   1 
ATOM   147  O O   . LYS A 1 33  ? 66.189 17.982  -1.077  1.00 40.79  ? 393  LYS A O   1 
ATOM   148  C CB  . LYS A 1 33  ? 68.118 19.788  -2.692  1.00 42.65  ? 393  LYS A CB  1 
ATOM   149  C CG  . LYS A 1 33  ? 68.771 20.906  -3.515  1.00 42.91  ? 393  LYS A CG  1 
ATOM   150  C CD  . LYS A 1 33  ? 70.253 20.562  -3.772  1.00 43.81  ? 393  LYS A CD  1 
ATOM   151  C CE  . LYS A 1 33  ? 71.044 21.692  -4.451  1.00 45.24  ? 393  LYS A CE  1 
ATOM   152  N NZ  . LYS A 1 33  ? 72.522 21.336  -4.546  1.00 45.98  ? 393  LYS A NZ  1 
ATOM   153  N N   . VAL A 1 34  ? 65.464 17.848  -3.195  1.00 40.16  ? 394  VAL A N   1 
ATOM   154  C CA  . VAL A 1 34  ? 64.959 16.482  -3.056  1.00 39.01  ? 394  VAL A CA  1 
ATOM   155  C C   . VAL A 1 34  ? 65.569 15.609  -4.153  1.00 38.60  ? 394  VAL A C   1 
ATOM   156  O O   . VAL A 1 34  ? 65.485 15.934  -5.333  1.00 37.37  ? 394  VAL A O   1 
ATOM   157  C CB  . VAL A 1 34  ? 63.400 16.416  -3.054  1.00 38.98  ? 394  VAL A CB  1 
ATOM   158  C CG1 . VAL A 1 34  ? 62.895 14.972  -2.852  1.00 37.39  ? 394  VAL A CG1 1 
ATOM   159  C CG2 . VAL A 1 34  ? 62.820 17.340  -1.976  1.00 38.13  ? 394  VAL A CG2 1 
ATOM   160  N N   . PHE A 1 35  ? 66.219 14.523  -3.730  1.00 38.39  ? 395  PHE A N   1 
ATOM   161  C CA  . PHE A 1 35  ? 66.894 13.607  -4.630  1.00 38.51  ? 395  PHE A CA  1 
ATOM   162  C C   . PHE A 1 35  ? 66.166 12.259  -4.729  1.00 38.86  ? 395  PHE A C   1 
ATOM   163  O O   . PHE A 1 35  ? 65.607 11.768  -3.742  1.00 37.84  ? 395  PHE A O   1 
ATOM   164  C CB  . PHE A 1 35  ? 68.325 13.337  -4.130  1.00 39.10  ? 395  PHE A CB  1 
ATOM   165  C CG  . PHE A 1 35  ? 69.191 14.562  -4.035  1.00 39.20  ? 395  PHE A CG  1 
ATOM   166  C CD1 . PHE A 1 35  ? 69.405 15.184  -2.806  1.00 39.97  ? 395  PHE A CD1 1 
ATOM   167  C CD2 . PHE A 1 35  ? 69.805 15.080  -5.167  1.00 39.61  ? 395  PHE A CD2 1 
ATOM   168  C CE1 . PHE A 1 35  ? 70.225 16.317  -2.709  1.00 41.80  ? 395  PHE A CE1 1 
ATOM   169  C CE2 . PHE A 1 35  ? 70.619 16.206  -5.096  1.00 39.86  ? 395  PHE A CE2 1 
ATOM   170  C CZ  . PHE A 1 35  ? 70.836 16.831  -3.859  1.00 41.12  ? 395  PHE A CZ  1 
ATOM   171  N N   . LEU A 1 36  ? 66.193 11.675  -5.927  1.00 39.39  ? 396  LEU A N   1 
ATOM   172  C CA  . LEU A 1 36  ? 65.969 10.241  -6.098  1.00 40.02  ? 396  LEU A CA  1 
ATOM   173  C C   . LEU A 1 36  ? 67.204 9.460   -5.578  1.00 40.59  ? 396  LEU A C   1 
ATOM   174  O O   . LEU A 1 36  ? 68.300 9.572   -6.127  1.00 40.98  ? 396  LEU A O   1 
ATOM   175  C CB  . LEU A 1 36  ? 65.670 9.887   -7.566  1.00 39.54  ? 396  LEU A CB  1 
ATOM   176  C CG  . LEU A 1 36  ? 65.547 8.372   -7.862  1.00 40.36  ? 396  LEU A CG  1 
ATOM   177  C CD1 . LEU A 1 36  ? 64.510 7.716   -6.958  1.00 38.39  ? 396  LEU A CD1 1 
ATOM   178  C CD2 . LEU A 1 36  ? 65.236 8.110   -9.328  1.00 39.81  ? 396  LEU A CD2 1 
ATOM   179  N N   . ALA A 1 37  ? 67.004 8.675   -4.522  1.00 41.42  ? 397  ALA A N   1 
ATOM   180  C CA  . ALA A 1 37  ? 68.071 7.955   -3.844  1.00 42.11  ? 397  ALA A CA  1 
ATOM   181  C C   . ALA A 1 37  ? 67.806 6.447   -3.772  1.00 43.23  ? 397  ALA A C   1 
ATOM   182  O O   . ALA A 1 37  ? 66.678 6.003   -3.556  1.00 43.47  ? 397  ALA A O   1 
ATOM   183  C CB  . ALA A 1 37  ? 68.270 8.522   -2.449  1.00 41.94  ? 397  ALA A CB  1 
ATOM   184  N N   . GLU A 1 38  ? 68.860 5.665   -3.969  1.00 44.06  ? 398  GLU A N   1 
ATOM   185  C CA  . GLU A 1 38  ? 68.785 4.221   -3.852  1.00 45.16  ? 398  GLU A CA  1 
ATOM   186  C C   . GLU A 1 38  ? 69.637 3.769   -2.663  1.00 45.33  ? 398  GLU A C   1 
ATOM   187  O O   . GLU A 1 38  ? 70.816 4.115   -2.582  1.00 44.60  ? 398  GLU A O   1 
ATOM   188  C CB  . GLU A 1 38  ? 69.279 3.555   -5.143  1.00 45.10  ? 398  GLU A CB  1 
ATOM   189  C CG  . GLU A 1 38  ? 69.154 2.027   -5.147  1.00 46.07  ? 398  GLU A CG  1 
ATOM   190  C CD  . GLU A 1 38  ? 69.647 1.360   -6.432  1.00 46.38  ? 398  GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 38  ? 70.360 2.001   -7.235  1.00 47.90  ? 398  GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 38  ? 69.319 0.170   -6.638  1.00 49.19  ? 398  GLU A OE2 1 
ATOM   193  N N   . PHE A 1 39  ? 69.024 3.029   -1.736  1.00 46.46  ? 399  PHE A N   1 
ATOM   194  C CA  . PHE A 1 39  ? 69.764 2.343   -0.664  1.00 47.87  ? 399  PHE A CA  1 
ATOM   195  C C   . PHE A 1 39  ? 70.657 1.298   -1.324  1.00 48.32  ? 399  PHE A C   1 
ATOM   196  O O   . PHE A 1 39  ? 70.164 0.398   -1.998  1.00 47.97  ? 399  PHE A O   1 
ATOM   197  C CB  . PHE A 1 39  ? 68.807 1.712   0.356   1.00 48.00  ? 399  PHE A CB  1 
ATOM   198  C CG  . PHE A 1 39  ? 69.442 1.434   1.687   1.00 49.29  ? 399  PHE A CG  1 
ATOM   199  C CD1 . PHE A 1 39  ? 69.732 0.128   2.078   1.00 49.88  ? 399  PHE A CD1 1 
ATOM   200  C CD2 . PHE A 1 39  ? 69.772 2.479   2.552   1.00 50.20  ? 399  PHE A CD2 1 
ATOM   201  C CE1 . PHE A 1 39  ? 70.327 -0.135  3.304   1.00 49.91  ? 399  PHE A CE1 1 
ATOM   202  C CE2 . PHE A 1 39  ? 70.378 2.221   3.786   1.00 49.39  ? 399  PHE A CE2 1 
ATOM   203  C CZ  . PHE A 1 39  ? 70.653 0.915   4.158   1.00 49.76  ? 399  PHE A CZ  1 
ATOM   204  N N   . LYS A 1 40  ? 71.967 1.453   -1.140  1.00 50.00  ? 400  LYS A N   1 
ATOM   205  C CA  . LYS A 1 40  ? 73.009 0.782   -1.966  1.00 52.00  ? 400  LYS A CA  1 
ATOM   206  C C   . LYS A 1 40  ? 72.788 -0.608  -2.615  1.00 52.78  ? 400  LYS A C   1 
ATOM   207  O O   . LYS A 1 40  ? 73.135 -0.757  -3.790  1.00 53.60  ? 400  LYS A O   1 
ATOM   208  C CB  . LYS A 1 40  ? 74.433 1.008   -1.429  1.00 52.11  ? 400  LYS A CB  1 
ATOM   209  C CG  . LYS A 1 40  ? 74.902 2.450   -1.721  1.00 53.03  ? 400  LYS A CG  1 
ATOM   210  C CD  . LYS A 1 40  ? 76.335 2.525   -2.201  1.00 54.64  ? 400  LYS A CD  1 
ATOM   211  C CE  . LYS A 1 40  ? 76.680 3.940   -2.661  1.00 56.41  ? 400  LYS A CE  1 
ATOM   212  N NZ  . LYS A 1 40  ? 78.164 4.163   -2.622  1.00 57.05  ? 400  LYS A NZ  1 
ATOM   213  N N   . LYS A 1 41  ? 72.272 -1.651  -1.964  1.00 53.12  ? 401  LYS A N   1 
ATOM   214  C CA  . LYS A 1 41  ? 72.607 -2.309  -0.688  1.00 53.66  ? 401  LYS A CA  1 
ATOM   215  C C   . LYS A 1 41  ? 71.394 -3.205  -0.497  1.00 53.14  ? 401  LYS A C   1 
ATOM   216  O O   . LYS A 1 41  ? 71.474 -4.303  0.051   1.00 53.19  ? 401  LYS A O   1 
ATOM   217  C CB  . LYS A 1 41  ? 72.817 -1.453  0.566   1.00 53.93  ? 401  LYS A CB  1 
ATOM   218  C CG  . LYS A 1 41  ? 73.429 -2.395  1.692   1.00 53.85  ? 401  LYS A CG  1 
ATOM   219  C CD  . LYS A 1 41  ? 73.547 -1.789  3.096   1.00 54.63  ? 401  LYS A CD  1 
ATOM   220  C CE  . LYS A 1 41  ? 74.903 -1.128  3.339   1.00 55.17  ? 401  LYS A CE  1 
ATOM   221  N NZ  . LYS A 1 41  ? 74.752 0.056   4.253   1.00 54.34  ? 401  LYS A NZ  1 
ATOM   222  N N   . THR A 1 42  ? 70.281 -2.693  -1.014  1.00 52.49  ? 402  THR A N   1 
ATOM   223  C CA  . THR A 1 42  ? 68.964 -3.294  -0.947  1.00 51.92  ? 402  THR A CA  1 
ATOM   224  C C   . THR A 1 42  ? 68.232 -2.940  -2.242  1.00 51.11  ? 402  THR A C   1 
ATOM   225  O O   . THR A 1 42  ? 67.279 -3.606  -2.634  1.00 51.00  ? 402  THR A O   1 
ATOM   226  C CB  . THR A 1 42  ? 68.199 -2.753  0.285   1.00 52.27  ? 402  THR A CB  1 
ATOM   227  O OG1 . THR A 1 42  ? 68.582 -3.500  1.452   1.00 52.06  ? 402  THR A OG1 1 
ATOM   228  C CG2 . THR A 1 42  ? 66.711 -2.861  0.099   1.00 52.07  ? 402  THR A CG2 1 
ATOM   229  N N   . ASN A 1 43  ? 68.695 -1.880  -2.904  1.00 50.42  ? 403  ASN A N   1 
ATOM   230  C CA  . ASN A 1 43  ? 68.144 -1.445  -4.197  1.00 49.53  ? 403  ASN A CA  1 
ATOM   231  C C   . ASN A 1 43  ? 66.714 -0.894  -4.101  1.00 48.29  ? 403  ASN A C   1 
ATOM   232  O O   . ASN A 1 43  ? 65.928 -0.964  -5.054  1.00 47.64  ? 403  ASN A O   1 
ATOM   233  C CB  . ASN A 1 43  ? 68.276 -2.559  -5.249  1.00 50.03  ? 403  ASN A CB  1 
ATOM   234  C CG  . ASN A 1 43  ? 69.730 -2.968  -5.488  1.00 51.11  ? 403  ASN A CG  1 
ATOM   235  O OD1 . ASN A 1 43  ? 70.639 -2.132  -5.465  1.00 53.74  ? 403  ASN A OD1 1 
ATOM   236  N ND2 . ASN A 1 43  ? 69.950 -4.251  -5.724  1.00 51.54  ? 403  ASN A ND2 1 
ATOM   237  N N   . GLN A 1 44  ? 66.406 -0.365  -2.918  1.00 46.93  ? 404  GLN A N   1 
ATOM   238  C CA  . GLN A 1 44  ? 65.151 0.290   -2.632  1.00 46.16  ? 404  GLN A CA  1 
ATOM   239  C C   . GLN A 1 44  ? 65.343 1.771   -2.851  1.00 45.13  ? 404  GLN A C   1 
ATOM   240  O O   . GLN A 1 44  ? 66.375 2.350   -2.471  1.00 45.23  ? 404  GLN A O   1 
ATOM   241  C CB  . GLN A 1 44  ? 64.723 0.051   -1.188  1.00 46.28  ? 404  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 44  ? 63.722 -1.075  -1.009  1.00 48.88  ? 404  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 44  ? 63.678 -1.597  0.419   1.00 52.45  ? 404  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 44  ? 64.623 -1.420  1.196   1.00 53.74  ? 404  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 44  ? 62.580 -2.252  0.770   1.00 54.07  ? 404  GLN A NE2 1 
ATOM   246  N N   . PHE A 1 45  ? 64.331 2.384   -3.445  1.00 43.62  ? 405  PHE A N   1 
ATOM   247  C CA  . PHE A 1 45  ? 64.393 3.777   -3.819  1.00 42.11  ? 405  PHE A CA  1 
ATOM   248  C C   . PHE A 1 45  ? 63.614 4.623   -2.835  1.00 41.89  ? 405  PHE A C   1 
ATOM   249  O O   . PHE A 1 45  ? 62.595 4.190   -2.299  1.00 42.10  ? 405  PHE A O   1 
ATOM   250  C CB  . PHE A 1 45  ? 63.895 3.945   -5.244  1.00 41.67  ? 405  PHE A CB  1 
ATOM   251  C CG  . PHE A 1 45  ? 64.839 3.392   -6.276  1.00 41.08  ? 405  PHE A CG  1 
ATOM   252  C CD1 . PHE A 1 45  ? 64.724 2.078   -6.713  1.00 39.52  ? 405  PHE A CD1 1 
ATOM   253  C CD2 . PHE A 1 45  ? 65.851 4.192   -6.809  1.00 41.79  ? 405  PHE A CD2 1 
ATOM   254  C CE1 . PHE A 1 45  ? 65.591 1.562   -7.675  1.00 40.86  ? 405  PHE A CE1 1 
ATOM   255  C CE2 . PHE A 1 45  ? 66.728 3.693   -7.772  1.00 41.14  ? 405  PHE A CE2 1 
ATOM   256  C CZ  . PHE A 1 45  ? 66.600 2.370   -8.206  1.00 41.36  ? 405  PHE A CZ  1 
ATOM   257  N N   . PHE A 1 46  ? 64.123 5.829   -2.591  1.00 41.42  ? 406  PHE A N   1 
ATOM   258  C CA  . PHE A 1 46  ? 63.559 6.765   -1.633  1.00 40.77  ? 406  PHE A CA  1 
ATOM   259  C C   . PHE A 1 46  ? 63.662 8.152   -2.225  1.00 40.28  ? 406  PHE A C   1 
ATOM   260  O O   . PHE A 1 46  ? 64.345 8.340   -3.222  1.00 40.22  ? 406  PHE A O   1 
ATOM   261  C CB  . PHE A 1 46  ? 64.331 6.716   -0.305  1.00 40.81  ? 406  PHE A CB  1 
ATOM   262  C CG  . PHE A 1 46  ? 64.294 5.368   0.370   1.00 41.81  ? 406  PHE A CG  1 
ATOM   263  C CD1 . PHE A 1 46  ? 65.301 4.432   0.141   1.00 39.50  ? 406  PHE A CD1 1 
ATOM   264  C CD2 . PHE A 1 46  ? 63.251 5.032   1.229   1.00 42.53  ? 406  PHE A CD2 1 
ATOM   265  C CE1 . PHE A 1 46  ? 65.259 3.190   0.743   1.00 40.58  ? 406  PHE A CE1 1 
ATOM   266  C CE2 . PHE A 1 46  ? 63.219 3.786   1.850   1.00 41.76  ? 406  PHE A CE2 1 
ATOM   267  C CZ  . PHE A 1 46  ? 64.220 2.868   1.601   1.00 40.71  ? 406  PHE A CZ  1 
ATOM   268  N N   . ALA A 1 47  ? 62.967 9.116   -1.632  1.00 39.60  ? 407  ALA A N   1 
ATOM   269  C CA  . ALA A 1 47  ? 63.196 10.516  -1.956  1.00 39.48  ? 407  ALA A CA  1 
ATOM   270  C C   . ALA A 1 47  ? 63.901 11.088  -0.739  1.00 39.59  ? 407  ALA A C   1 
ATOM   271  O O   . ALA A 1 47  ? 63.535 10.761  0.400   1.00 40.70  ? 407  ALA A O   1 
ATOM   272  C CB  . ALA A 1 47  ? 61.886 11.248  -2.228  1.00 39.00  ? 407  ALA A CB  1 
ATOM   273  N N   . ILE A 1 48  ? 64.946 11.876  -0.945  1.00 38.74  ? 408  ILE A N   1 
ATOM   274  C CA  . ILE A 1 48  ? 65.663 12.415  0.201   1.00 38.45  ? 408  ILE A CA  1 
ATOM   275  C C   . ILE A 1 48  ? 65.690 13.912  0.094   1.00 38.29  ? 408  ILE A C   1 
ATOM   276  O O   . ILE A 1 48  ? 66.197 14.444  -0.877  1.00 38.01  ? 408  ILE A O   1 
ATOM   277  C CB  . ILE A 1 48  ? 67.121 11.848  0.351   1.00 38.51  ? 408  ILE A CB  1 
ATOM   278  C CG1 . ILE A 1 48  ? 67.102 10.364  0.732   1.00 38.22  ? 408  ILE A CG1 1 
ATOM   279  C CG2 . ILE A 1 48  ? 67.905 12.632  1.411   1.00 37.90  ? 408  ILE A CG2 1 
ATOM   280  C CD1 . ILE A 1 48  ? 68.498 9.770   1.000   1.00 38.35  ? 408  ILE A CD1 1 
ATOM   281  N N   . LYS A 1 49  ? 65.094 14.569  1.084   1.00 38.65  ? 409  LYS A N   1 
ATOM   282  C CA  . LYS A 1 49  ? 65.149 16.003  1.245   1.00 38.58  ? 409  LYS A CA  1 
ATOM   283  C C   . LYS A 1 49  ? 66.429 16.317  1.984   1.00 39.12  ? 409  LYS A C   1 
ATOM   284  O O   . LYS A 1 49  ? 66.703 15.755  3.051   1.00 38.47  ? 409  LYS A O   1 
ATOM   285  C CB  . LYS A 1 49  ? 63.941 16.499  2.037   1.00 38.69  ? 409  LYS A CB  1 
ATOM   286  C CG  . LYS A 1 49  ? 63.952 18.001  2.405   1.00 39.47  ? 409  LYS A CG  1 
ATOM   287  C CD  . LYS A 1 49  ? 62.857 18.302  3.439   1.00 39.05  ? 409  LYS A CD  1 
ATOM   288  C CE  . LYS A 1 49  ? 63.019 19.663  4.078   1.00 38.98  ? 409  LYS A CE  1 
ATOM   289  N NZ  . LYS A 1 49  ? 62.310 20.699  3.324   1.00 39.54  ? 409  LYS A NZ  1 
ATOM   290  N N   . ALA A 1 50  ? 67.219 17.213  1.396   1.00 39.69  ? 410  ALA A N   1 
ATOM   291  C CA  . ALA A 1 50  ? 68.496 17.640  1.975   1.00 39.81  ? 410  ALA A CA  1 
ATOM   292  C C   . ALA A 1 50  ? 68.460 19.149  2.262   1.00 39.47  ? 410  ALA A C   1 
ATOM   293  O O   . ALA A 1 50  ? 68.007 19.929  1.441   1.00 39.43  ? 410  ALA A O   1 
ATOM   294  C CB  . ALA A 1 50  ? 69.625 17.297  1.029   1.00 39.66  ? 410  ALA A CB  1 
ATOM   295  N N   . LEU A 1 51  ? 68.893 19.535  3.454   1.00 39.40  ? 411  LEU A N   1 
ATOM   296  C CA  . LEU A 1 51  ? 69.039 20.947  3.820   1.00 39.05  ? 411  LEU A CA  1 
ATOM   297  C C   . LEU A 1 51  ? 70.464 21.225  4.284   1.00 38.85  ? 411  LEU A C   1 
ATOM   298  O O   . LEU A 1 51  ? 71.067 20.388  4.960   1.00 38.46  ? 411  LEU A O   1 
ATOM   299  C CB  . LEU A 1 51  ? 68.072 21.326  4.954   1.00 38.63  ? 411  LEU A CB  1 
ATOM   300  C CG  . LEU A 1 51  ? 66.554 21.343  4.742   1.00 39.10  ? 411  LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 51  ? 65.842 21.704  6.059   1.00 36.54  ? 411  LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 51  ? 66.164 22.319  3.615   1.00 37.47  ? 411  LEU A CD2 1 
ATOM   303  N N   . LYS A 1 52  ? 70.988 22.395  3.906   1.00 39.09  ? 412  LYS A N   1 
ATOM   304  C CA  . LYS A 1 52  ? 72.224 22.942  4.463   1.00 39.23  ? 412  LYS A CA  1 
ATOM   305  C C   . LYS A 1 52  ? 71.920 23.692  5.762   1.00 39.29  ? 412  LYS A C   1 
ATOM   306  O O   . LYS A 1 52  ? 71.117 24.614  5.767   1.00 39.75  ? 412  LYS A O   1 
ATOM   307  C CB  . LYS A 1 52  ? 72.903 23.904  3.470   1.00 39.56  ? 412  LYS A CB  1 
ATOM   308  C CG  . LYS A 1 52  ? 73.274 23.341  2.089   1.00 39.72  ? 412  LYS A CG  1 
ATOM   309  C CD  . LYS A 1 52  ? 74.142 22.086  2.164   1.00 40.14  ? 412  LYS A CD  1 
ATOM   310  C CE  . LYS A 1 52  ? 75.523 22.396  2.696   1.00 40.59  ? 412  LYS A CE  1 
ATOM   311  N NZ  . LYS A 1 52  ? 76.446 21.226  2.639   1.00 40.91  ? 412  LYS A NZ  1 
ATOM   312  N N   . LYS A 1 53  ? 72.576 23.315  6.854   1.00 39.36  ? 413  LYS A N   1 
ATOM   313  C CA  . LYS A 1 53  ? 72.356 23.948  8.159   1.00 39.27  ? 413  LYS A CA  1 
ATOM   314  C C   . LYS A 1 53  ? 72.672 25.467  8.236   1.00 39.89  ? 413  LYS A C   1 
ATOM   315  O O   . LYS A 1 53  ? 72.021 26.211  8.979   1.00 39.71  ? 413  LYS A O   1 
ATOM   316  C CB  . LYS A 1 53  ? 73.173 23.217  9.215   1.00 38.85  ? 413  LYS A CB  1 
ATOM   317  C CG  . LYS A 1 53  ? 72.612 21.888  9.677   1.00 37.28  ? 413  LYS A CG  1 
ATOM   318  C CD  . LYS A 1 53  ? 73.565 21.298  10.733  1.00 35.17  ? 413  LYS A CD  1 
ATOM   319  C CE  . LYS A 1 53  ? 72.978 20.072  11.406  1.00 34.02  ? 413  LYS A CE  1 
ATOM   320  N NZ  . LYS A 1 53  ? 73.891 19.493  12.430  1.00 30.43  ? 413  LYS A NZ  1 
ATOM   321  N N   . ASP A 1 54  ? 73.697 25.911  7.508   1.00 40.25  ? 414  ASP A N   1 
ATOM   322  C CA  . ASP A 1 54  ? 74.043 27.333  7.441   1.00 40.48  ? 414  ASP A CA  1 
ATOM   323  C C   . ASP A 1 54  ? 72.989 28.126  6.650   1.00 40.73  ? 414  ASP A C   1 
ATOM   324  O O   . ASP A 1 54  ? 72.689 29.274  6.989   1.00 40.76  ? 414  ASP A O   1 
ATOM   325  C CB  . ASP A 1 54  ? 75.438 27.534  6.842   1.00 40.42  ? 414  ASP A CB  1 
ATOM   326  C CG  . ASP A 1 54  ? 75.573 26.942  5.444   1.00 42.05  ? 414  ASP A CG  1 
ATOM   327  O OD1 . ASP A 1 54  ? 75.146 25.785  5.226   1.00 45.31  ? 414  ASP A OD1 1 
ATOM   328  O OD2 . ASP A 1 54  ? 76.103 27.633  4.551   1.00 43.21  ? 414  ASP A OD2 1 
ATOM   329  N N   . VAL A 1 55  ? 72.430 27.502  5.610   1.00 40.54  ? 415  VAL A N   1 
ATOM   330  C CA  . VAL A 1 55  ? 71.394 28.127  4.780   1.00 40.46  ? 415  VAL A CA  1 
ATOM   331  C C   . VAL A 1 55  ? 70.109 28.274  5.597   1.00 40.67  ? 415  VAL A C   1 
ATOM   332  O O   . VAL A 1 55  ? 69.469 29.321  5.578   1.00 40.69  ? 415  VAL A O   1 
ATOM   333  C CB  . VAL A 1 55  ? 71.147 27.320  3.466   1.00 40.52  ? 415  VAL A CB  1 
ATOM   334  C CG1 . VAL A 1 55  ? 69.889 27.798  2.742   1.00 38.96  ? 415  VAL A CG1 1 
ATOM   335  C CG2 . VAL A 1 55  ? 72.364 27.434  2.544   1.00 39.83  ? 415  VAL A CG2 1 
ATOM   336  N N   . VAL A 1 56  ? 69.770 27.220  6.335   1.00 40.94  ? 416  VAL A N   1 
ATOM   337  C CA  . VAL A 1 56  ? 68.656 27.219  7.283   1.00 41.06  ? 416  VAL A CA  1 
ATOM   338  C C   . VAL A 1 56  ? 68.782 28.316  8.336   1.00 41.69  ? 416  VAL A C   1 
ATOM   339  O O   . VAL A 1 56  ? 67.798 28.979  8.648   1.00 41.67  ? 416  VAL A O   1 
ATOM   340  C CB  . VAL A 1 56  ? 68.483 25.827  7.945   1.00 40.80  ? 416  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 56  ? 67.481 25.871  9.092   1.00 40.27  ? 416  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 56  ? 68.041 24.816  6.905   1.00 39.62  ? 416  VAL A CG2 1 
ATOM   343  N N   . LEU A 1 57  ? 69.991 28.522  8.858   1.00 42.54  ? 417  LEU A N   1 
ATOM   344  C CA  . LEU A 1 57  ? 70.252 29.591  9.838   1.00 43.45  ? 417  LEU A CA  1 
ATOM   345  C C   . LEU A 1 57  ? 70.236 31.013  9.241   1.00 43.80  ? 417  LEU A C   1 
ATOM   346  O O   . LEU A 1 57  ? 69.718 31.942  9.864   1.00 43.80  ? 417  LEU A O   1 
ATOM   347  C CB  . LEU A 1 57  ? 71.554 29.324  10.583  1.00 43.18  ? 417  LEU A CB  1 
ATOM   348  C CG  . LEU A 1 57  ? 71.810 30.027  11.918  1.00 44.63  ? 417  LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 57  ? 70.714 29.719  12.939  1.00 45.92  ? 417  LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 57  ? 73.194 29.644  12.474  1.00 43.28  ? 417  LEU A CD2 1 
ATOM   351  N N   . MET A 1 58  ? 70.808 31.171  8.049   1.00 44.45  ? 418  MET A N   1 
ATOM   352  C CA  . MET A 1 58  ? 70.687 32.406  7.270   1.00 45.54  ? 418  MET A CA  1 
ATOM   353  C C   . MET A 1 58  ? 69.205 32.789  7.035   1.00 46.45  ? 418  MET A C   1 
ATOM   354  O O   . MET A 1 58  ? 68.796 33.927  7.328   1.00 46.02  ? 418  MET A O   1 
ATOM   355  C CB  . MET A 1 58  ? 71.419 32.272  5.920   1.00 45.41  ? 418  MET A CB  1 
ATOM   356  C CG  . MET A 1 58  ? 72.948 32.197  6.004   1.00 45.54  ? 418  MET A CG  1 
ATOM   357  S SD  . MET A 1 58  ? 73.753 33.690  6.610   1.00 45.48  ? 418  MET A SD  1 
ATOM   358  C CE  . MET A 1 58  ? 73.755 34.707  5.121   1.00 45.42  ? 418  MET A CE  1 
ATOM   359  N N   . ASP A 1 59  ? 68.418 31.830  6.534   1.00 47.19  ? 419  ASP A N   1 
ATOM   360  C CA  . ASP A 1 59  ? 66.982 32.023  6.239   1.00 48.80  ? 419  ASP A CA  1 
ATOM   361  C C   . ASP A 1 59  ? 66.127 32.178  7.499   1.00 49.42  ? 419  ASP A C   1 
ATOM   362  O O   . ASP A 1 59  ? 64.947 32.489  7.406   1.00 49.85  ? 419  ASP A O   1 
ATOM   363  C CB  . ASP A 1 59  ? 66.420 30.868  5.375   1.00 48.40  ? 419  ASP A CB  1 
ATOM   364  C CG  . ASP A 1 59  ? 67.014 30.828  3.954   1.00 50.57  ? 419  ASP A CG  1 
ATOM   365  O OD1 . ASP A 1 59  ? 67.834 31.707  3.614   1.00 53.15  ? 419  ASP A OD1 1 
ATOM   366  O OD2 . ASP A 1 59  ? 66.659 29.914  3.158   1.00 53.48  ? 419  ASP A OD2 1 
ATOM   367  N N   . ASP A 1 60  ? 66.725 31.949  8.667   1.00 50.54  ? 420  ASP A N   1 
ATOM   368  C CA  . ASP A 1 60  ? 66.023 32.023  9.958   1.00 51.68  ? 420  ASP A CA  1 
ATOM   369  C C   . ASP A 1 60  ? 64.904 30.974  10.057  1.00 51.97  ? 420  ASP A C   1 
ATOM   370  O O   . ASP A 1 60  ? 63.806 31.269  10.538  1.00 52.07  ? 420  ASP A O   1 
ATOM   371  C CB  . ASP A 1 60  ? 65.486 33.446  10.203  1.00 51.94  ? 420  ASP A CB  1 
ATOM   372  C CG  . ASP A 1 60  ? 65.243 33.749  11.679  1.00 53.29  ? 420  ASP A CG  1 
ATOM   373  O OD1 . ASP A 1 60  ? 66.026 33.288  12.548  1.00 53.70  ? 420  ASP A OD1 1 
ATOM   374  O OD2 . ASP A 1 60  ? 64.263 34.473  11.961  1.00 54.77  ? 420  ASP A OD2 1 
ATOM   375  N N   . ASP A 1 61  ? 65.214 29.749  9.626   1.00 52.30  ? 421  ASP A N   1 
ATOM   376  C CA  . ASP A 1 61  ? 64.231 28.669  9.470   1.00 52.81  ? 421  ASP A CA  1 
ATOM   377  C C   . ASP A 1 61  ? 64.494 27.416  10.312  1.00 53.02  ? 421  ASP A C   1 
ATOM   378  O O   . ASP A 1 61  ? 64.110 26.305  9.919   1.00 53.00  ? 421  ASP A O   1 
ATOM   379  C CB  . ASP A 1 61  ? 64.144 28.275  7.994   1.00 52.72  ? 421  ASP A CB  1 
ATOM   380  C CG  . ASP A 1 61  ? 63.229 29.182  7.206   1.00 54.65  ? 421  ASP A CG  1 
ATOM   381  O OD1 . ASP A 1 61  ? 62.508 30.000  7.827   1.00 56.55  ? 421  ASP A OD1 1 
ATOM   382  O OD2 . ASP A 1 61  ? 63.219 29.080  5.960   1.00 56.70  ? 421  ASP A OD2 1 
ATOM   383  N N   . VAL A 1 62  ? 65.146 27.592  11.457  1.00 53.38  ? 422  VAL A N   1 
ATOM   384  C CA  . VAL A 1 62  ? 65.497 26.477  12.345  1.00 53.83  ? 422  VAL A CA  1 
ATOM   385  C C   . VAL A 1 62  ? 64.251 25.826  12.948  1.00 54.61  ? 422  VAL A C   1 
ATOM   386  O O   . VAL A 1 62  ? 64.144 24.598  12.983  1.00 54.59  ? 422  VAL A O   1 
ATOM   387  C CB  . VAL A 1 62  ? 66.485 26.915  13.465  1.00 53.28  ? 422  VAL A CB  1 
ATOM   388  C CG1 . VAL A 1 62  ? 66.581 25.868  14.550  1.00 52.89  ? 422  VAL A CG1 1 
ATOM   389  C CG2 . VAL A 1 62  ? 67.851 27.179  12.880  1.00 52.87  ? 422  VAL A CG2 1 
ATOM   390  N N   . GLU A 1 63  ? 63.316 26.657  13.409  1.00 55.54  ? 423  GLU A N   1 
ATOM   391  C CA  . GLU A 1 63  ? 62.071 26.177  14.003  1.00 56.54  ? 423  GLU A CA  1 
ATOM   392  C C   . GLU A 1 63  ? 61.140 25.550  12.959  1.00 56.62  ? 423  GLU A C   1 
ATOM   393  O O   . GLU A 1 63  ? 60.414 24.609  13.268  1.00 57.04  ? 423  GLU A O   1 
ATOM   394  C CB  . GLU A 1 63  ? 61.365 27.306  14.766  1.00 56.94  ? 423  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 63  ? 60.132 26.859  15.582  1.00 59.05  ? 423  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 63  ? 60.447 25.762  16.604  1.00 61.34  ? 423  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 63  ? 61.492 25.853  17.299  1.00 61.64  ? 423  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 63  ? 59.639 24.812  16.711  1.00 61.47  ? 423  GLU A OE2 1 
ATOM   399  N N   . CYS A 1 64  ? 61.171 26.089  11.739  1.00 56.42  ? 424  CYS A N   1 
ATOM   400  C CA  . CYS A 1 64  ? 60.481 25.537  10.568  1.00 56.61  ? 424  CYS A CA  1 
ATOM   401  C C   . CYS A 1 64  ? 60.897 24.119  10.238  1.00 55.13  ? 424  CYS A C   1 
ATOM   402  O O   . CYS A 1 64  ? 60.073 23.288  9.861   1.00 54.90  ? 424  CYS A O   1 
ATOM   403  C CB  . CYS A 1 64  ? 60.824 26.366  9.336   1.00 56.82  ? 424  CYS A CB  1 
ATOM   404  S SG  . CYS A 1 64  ? 59.646 27.586  8.964   1.00 62.56  ? 424  CYS A SG  1 
ATOM   405  N N   . THR A 1 65  ? 62.203 23.893  10.304  1.00 53.68  ? 425  THR A N   1 
ATOM   406  C CA  . THR A 1 65  ? 62.802 22.614  10.013  1.00 52.41  ? 425  THR A CA  1 
ATOM   407  C C   . THR A 1 65  ? 62.347 21.590  11.047  1.00 51.40  ? 425  THR A C   1 
ATOM   408  O O   . THR A 1 65  ? 62.011 20.462  10.691  1.00 51.11  ? 425  THR A O   1 
ATOM   409  C CB  . THR A 1 65  ? 64.345 22.752  10.014  1.00 52.51  ? 425  THR A CB  1 
ATOM   410  O OG1 . THR A 1 65  ? 64.729 23.683  8.992   1.00 52.94  ? 425  THR A OG1 1 
ATOM   411  C CG2 . THR A 1 65  ? 65.032 21.417  9.768   1.00 52.02  ? 425  THR A CG2 1 
ATOM   412  N N   . MET A 1 66  ? 62.326 21.999  12.317  1.00 50.22  ? 426  MET A N   1 
ATOM   413  C CA  . MET A 1 66  ? 61.986 21.103  13.421  1.00 49.51  ? 426  MET A CA  1 
ATOM   414  C C   . MET A 1 66  ? 60.509 20.725  13.429  1.00 49.06  ? 426  MET A C   1 
ATOM   415  O O   . MET A 1 66  ? 60.178 19.575  13.713  1.00 48.82  ? 426  MET A O   1 
ATOM   416  C CB  . MET A 1 66  ? 62.400 21.699  14.766  1.00 49.57  ? 426  MET A CB  1 
ATOM   417  C CG  . MET A 1 66  ? 63.920 21.860  14.938  1.00 49.51  ? 426  MET A CG  1 
ATOM   418  S SD  . MET A 1 66  ? 64.836 20.306  14.751  1.00 49.81  ? 426  MET A SD  1 
ATOM   419  C CE  . MET A 1 66  ? 64.189 19.363  16.132  1.00 48.78  ? 426  MET A CE  1 
ATOM   420  N N   . VAL A 1 67  ? 59.639 21.693  13.113  1.00 48.43  ? 427  VAL A N   1 
ATOM   421  C CA  . VAL A 1 67  ? 58.197 21.457  12.965  1.00 47.80  ? 427  VAL A CA  1 
ATOM   422  C C   . VAL A 1 67  ? 57.943 20.449  11.842  1.00 47.41  ? 427  VAL A C   1 
ATOM   423  O O   . VAL A 1 67  ? 57.172 19.520  12.012  1.00 47.21  ? 427  VAL A O   1 
ATOM   424  C CB  . VAL A 1 67  ? 57.402 22.786  12.706  1.00 47.94  ? 427  VAL A CB  1 
ATOM   425  C CG1 . VAL A 1 67  ? 55.959 22.506  12.261  1.00 46.77  ? 427  VAL A CG1 1 
ATOM   426  C CG2 . VAL A 1 67  ? 57.422 23.681  13.945  1.00 47.48  ? 427  VAL A CG2 1 
ATOM   427  N N   . GLU A 1 68  ? 58.616 20.629  10.708  1.00 47.17  ? 428  GLU A N   1 
ATOM   428  C CA  . GLU A 1 68  ? 58.463 19.729  9.569   1.00 47.53  ? 428  GLU A CA  1 
ATOM   429  C C   . GLU A 1 68  ? 58.846 18.297  9.942   1.00 46.64  ? 428  GLU A C   1 
ATOM   430  O O   . GLU A 1 68  ? 58.152 17.365  9.567   1.00 46.99  ? 428  GLU A O   1 
ATOM   431  C CB  . GLU A 1 68  ? 59.251 20.224  8.344   1.00 47.12  ? 428  GLU A CB  1 
ATOM   432  C CG  . GLU A 1 68  ? 59.151 19.299  7.122   1.00 48.16  ? 428  GLU A CG  1 
ATOM   433  C CD  . GLU A 1 68  ? 59.633 19.931  5.822   1.00 49.83  ? 428  GLU A CD  1 
ATOM   434  O OE1 . GLU A 1 68  ? 60.369 20.945  5.858   1.00 54.48  ? 428  GLU A OE1 1 
ATOM   435  O OE2 . GLU A 1 68  ? 59.264 19.417  4.744   1.00 53.81  ? 428  GLU A OE2 1 
ATOM   436  N N   . LYS A 1 69  ? 59.939 18.138  10.684  1.00 45.90  ? 429  LYS A N   1 
ATOM   437  C CA  . LYS A 1 69  ? 60.396 16.839  11.191  1.00 44.71  ? 429  LYS A CA  1 
ATOM   438  C C   . LYS A 1 69  ? 59.419 16.209  12.197  1.00 44.44  ? 429  LYS A C   1 
ATOM   439  O O   . LYS A 1 69  ? 59.136 15.007  12.129  1.00 44.38  ? 429  LYS A O   1 
ATOM   440  C CB  . LYS A 1 69  ? 61.808 16.988  11.799  1.00 44.79  ? 429  LYS A CB  1 
ATOM   441  C CG  . LYS A 1 69  ? 62.365 15.754  12.500  1.00 43.74  ? 429  LYS A CG  1 
ATOM   442  C CD  . LYS A 1 69  ? 62.092 15.811  13.996  1.00 44.46  ? 429  LYS A CD  1 
ATOM   443  C CE  . LYS A 1 69  ? 62.425 14.496  14.680  1.00 45.64  ? 429  LYS A CE  1 
ATOM   444  N NZ  . LYS A 1 69  ? 62.158 14.527  16.144  1.00 45.74  ? 429  LYS A NZ  1 
ATOM   445  N N   . ARG A 1 70  ? 58.925 17.010  13.136  1.00 44.15  ? 430  ARG A N   1 
ATOM   446  C CA  . ARG A 1 70  ? 57.929 16.546  14.094  1.00 44.45  ? 430  ARG A CA  1 
ATOM   447  C C   . ARG A 1 70  ? 56.608 16.124  13.438  1.00 44.80  ? 430  ARG A C   1 
ATOM   448  O O   . ARG A 1 70  ? 56.049 15.091  13.807  1.00 45.32  ? 430  ARG A O   1 
ATOM   449  C CB  . ARG A 1 70  ? 57.672 17.594  15.176  1.00 44.32  ? 430  ARG A CB  1 
ATOM   450  C CG  . ARG A 1 70  ? 58.806 17.746  16.183  1.00 44.63  ? 430  ARG A CG  1 
ATOM   451  C CD  . ARG A 1 70  ? 58.364 18.543  17.411  1.00 44.84  ? 430  ARG A CD  1 
ATOM   452  N NE  . ARG A 1 70  ? 58.018 19.933  17.106  1.00 43.78  ? 430  ARG A NE  1 
ATOM   453  C CZ  . ARG A 1 70  ? 58.828 20.977  17.279  1.00 45.03  ? 430  ARG A CZ  1 
ATOM   454  N NH1 . ARG A 1 70  ? 60.060 20.819  17.760  1.00 45.12  ? 430  ARG A NH1 1 
ATOM   455  N NH2 . ARG A 1 70  ? 58.399 22.196  16.982  1.00 44.74  ? 430  ARG A NH2 1 
ATOM   456  N N   . VAL A 1 71  ? 56.118 16.914  12.478  1.00 44.96  ? 431  VAL A N   1 
ATOM   457  C CA  . VAL A 1 71  ? 54.899 16.582  11.719  1.00 45.26  ? 431  VAL A CA  1 
ATOM   458  C C   . VAL A 1 71  ? 55.115 15.317  10.885  1.00 45.66  ? 431  VAL A C   1 
ATOM   459  O O   . VAL A 1 71  ? 54.298 14.399  10.929  1.00 45.71  ? 431  VAL A O   1 
ATOM   460  C CB  . VAL A 1 71  ? 54.426 17.755  10.804  1.00 45.11  ? 431  VAL A CB  1 
ATOM   461  C CG1 . VAL A 1 71  ? 53.286 17.314  9.917   1.00 44.46  ? 431  VAL A CG1 1 
ATOM   462  C CG2 . VAL A 1 71  ? 54.012 18.967  11.636  1.00 44.42  ? 431  VAL A CG2 1 
ATOM   463  N N   . LEU A 1 72  ? 56.229 15.259  10.151  1.00 46.16  ? 432  LEU A N   1 
ATOM   464  C CA  . LEU A 1 72  ? 56.586 14.057  9.385   1.00 46.60  ? 432  LEU A CA  1 
ATOM   465  C C   . LEU A 1 72  ? 56.713 12.792  10.254  1.00 47.05  ? 432  LEU A C   1 
ATOM   466  O O   . LEU A 1 72  ? 56.471 11.691  9.765   1.00 47.53  ? 432  LEU A O   1 
ATOM   467  C CB  . LEU A 1 72  ? 57.856 14.280  8.559   1.00 46.25  ? 432  LEU A CB  1 
ATOM   468  C CG  . LEU A 1 72  ? 57.734 15.145  7.300   1.00 46.46  ? 432  LEU A CG  1 
ATOM   469  C CD1 . LEU A 1 72  ? 59.123 15.498  6.747   1.00 46.49  ? 432  LEU A CD1 1 
ATOM   470  C CD2 . LEU A 1 72  ? 56.858 14.489  6.229   1.00 46.62  ? 432  LEU A CD2 1 
ATOM   471  N N   . SER A 1 73  ? 57.073 12.965  11.529  1.00 47.69  ? 433  SER A N   1 
ATOM   472  C CA  . SER A 1 73  ? 57.125 11.883  12.525  1.00 48.34  ? 433  SER A CA  1 
ATOM   473  C C   . SER A 1 73  ? 55.788 11.195  12.771  1.00 48.42  ? 433  SER A C   1 
ATOM   474  O O   . SER A 1 73  ? 55.757 10.031  13.164  1.00 48.63  ? 433  SER A O   1 
ATOM   475  C CB  . SER A 1 73  ? 57.614 12.418  13.863  1.00 48.10  ? 433  SER A CB  1 
ATOM   476  O OG  . SER A 1 73  ? 58.962 12.799  13.764  1.00 50.79  ? 433  SER A OG  1 
ATOM   477  N N   . LEU A 1 74  ? 54.695 11.930  12.570  1.00 48.53  ? 434  LEU A N   1 
ATOM   478  C CA  . LEU A 1 74  ? 53.338 11.422  12.799  1.00 48.52  ? 434  LEU A CA  1 
ATOM   479  C C   . LEU A 1 74  ? 52.744 10.820  11.528  1.00 47.89  ? 434  LEU A C   1 
ATOM   480  O O   . LEU A 1 74  ? 51.757 10.100  11.587  1.00 47.84  ? 434  LEU A O   1 
ATOM   481  C CB  . LEU A 1 74  ? 52.427 12.571  13.262  1.00 48.93  ? 434  LEU A CB  1 
ATOM   482  C CG  . LEU A 1 74  ? 52.124 12.875  14.730  1.00 49.06  ? 434  LEU A CG  1 
ATOM   483  C CD1 . LEU A 1 74  ? 53.234 12.471  15.671  1.00 50.99  ? 434  LEU A CD1 1 
ATOM   484  C CD2 . LEU A 1 74  ? 51.808 14.343  14.880  1.00 50.05  ? 434  LEU A CD2 1 
ATOM   485  N N   . ALA A 1 75  ? 53.354 11.126  10.384  1.00 47.21  ? 435  ALA A N   1 
ATOM   486  C CA  . ALA A 1 75  ? 52.700 10.947  9.082   1.00 46.38  ? 435  ALA A CA  1 
ATOM   487  C C   . ALA A 1 75  ? 52.463 9.491   8.680   1.00 45.74  ? 435  ALA A C   1 
ATOM   488  O O   . ALA A 1 75  ? 51.505 9.209   7.951   1.00 45.41  ? 435  ALA A O   1 
ATOM   489  C CB  . ALA A 1 75  ? 53.442 11.731  7.970   1.00 45.92  ? 435  ALA A CB  1 
ATOM   490  N N   . TRP A 1 76  ? 53.314 8.582   9.171   1.00 45.32  ? 436  TRP A N   1 
ATOM   491  C CA  . TRP A 1 76  ? 53.202 7.135   8.903   1.00 45.14  ? 436  TRP A CA  1 
ATOM   492  C C   . TRP A 1 76  ? 51.878 6.536   9.416   1.00 44.80  ? 436  TRP A C   1 
ATOM   493  O O   . TRP A 1 76  ? 51.478 5.443   9.017   1.00 45.19  ? 436  TRP A O   1 
ATOM   494  C CB  . TRP A 1 76  ? 54.392 6.380   9.535   1.00 45.45  ? 436  TRP A CB  1 
ATOM   495  C CG  . TRP A 1 76  ? 54.442 6.536   11.035  1.00 45.33  ? 436  TRP A CG  1 
ATOM   496  C CD1 . TRP A 1 76  ? 55.180 7.444   11.737  1.00 45.41  ? 436  TRP A CD1 1 
ATOM   497  C CD2 . TRP A 1 76  ? 53.691 5.793   12.007  1.00 45.66  ? 436  TRP A CD2 1 
ATOM   498  N NE1 . TRP A 1 76  ? 54.947 7.308   13.082  1.00 45.59  ? 436  TRP A NE1 1 
ATOM   499  C CE2 . TRP A 1 76  ? 54.036 6.303   13.277  1.00 46.33  ? 436  TRP A CE2 1 
ATOM   500  C CE3 . TRP A 1 76  ? 52.772 4.737   11.929  1.00 46.08  ? 436  TRP A CE3 1 
ATOM   501  C CZ2 . TRP A 1 76  ? 53.495 5.790   14.464  1.00 46.51  ? 436  TRP A CZ2 1 
ATOM   502  C CZ3 . TRP A 1 76  ? 52.223 4.240   13.104  1.00 45.51  ? 436  TRP A CZ3 1 
ATOM   503  C CH2 . TRP A 1 76  ? 52.592 4.764   14.356  1.00 45.92  ? 436  TRP A CH2 1 
ATOM   504  N N   . GLU A 1 77  ? 51.232 7.248   10.334  1.00 44.49  ? 437  GLU A N   1 
ATOM   505  C CA  . GLU A 1 77  ? 49.961 6.843   10.939  1.00 44.45  ? 437  GLU A CA  1 
ATOM   506  C C   . GLU A 1 77  ? 48.764 7.045   9.989   1.00 43.35  ? 437  GLU A C   1 
ATOM   507  O O   . GLU A 1 77  ? 47.677 6.507   10.208  1.00 43.77  ? 437  GLU A O   1 
ATOM   508  C CB  . GLU A 1 77  ? 49.773 7.623   12.246  1.00 44.15  ? 437  GLU A CB  1 
ATOM   509  C CG  . GLU A 1 77  ? 48.475 7.369   13.000  1.00 46.12  ? 437  GLU A CG  1 
ATOM   510  C CD  . GLU A 1 77  ? 48.539 7.837   14.451  1.00 46.54  ? 437  GLU A CD  1 
ATOM   511  O OE1 . GLU A 1 77  ? 49.633 8.272   14.903  1.00 49.69  ? 437  GLU A OE1 1 
ATOM   512  O OE2 . GLU A 1 77  ? 47.492 7.761   15.137  1.00 48.58  ? 437  GLU A OE2 1 
ATOM   513  N N   . HIS A 1 78  ? 48.960 7.812   8.927   1.00 42.54  ? 438  HIS A N   1 
ATOM   514  C CA  . HIS A 1 78  ? 47.892 8.022   7.964   1.00 41.61  ? 438  HIS A CA  1 
ATOM   515  C C   . HIS A 1 78  ? 48.316 7.639   6.542   1.00 41.40  ? 438  HIS A C   1 
ATOM   516  O O   . HIS A 1 78  ? 49.433 7.952   6.143   1.00 42.12  ? 438  HIS A O   1 
ATOM   517  C CB  . HIS A 1 78  ? 47.364 9.458   8.019   1.00 41.10  ? 438  HIS A CB  1 
ATOM   518  C CG  . HIS A 1 78  ? 46.021 9.597   7.382   1.00 40.57  ? 438  HIS A CG  1 
ATOM   519  N ND1 . HIS A 1 78  ? 44.846 9.435   8.086   1.00 40.35  ? 438  HIS A ND1 1 
ATOM   520  C CD2 . HIS A 1 78  ? 45.664 9.786   6.094   1.00 37.58  ? 438  HIS A CD2 1 
ATOM   521  C CE1 . HIS A 1 78  ? 43.822 9.547   7.265   1.00 36.73  ? 438  HIS A CE1 1 
ATOM   522  N NE2 . HIS A 1 78  ? 44.290 9.751   6.049   1.00 40.47  ? 438  HIS A NE2 1 
ATOM   523  N N   . PRO A 1 79  ? 47.436 6.939   5.786   1.00 41.14  ? 439  PRO A N   1 
ATOM   524  C CA  . PRO A 1 79  ? 47.734 6.534   4.406   1.00 40.82  ? 439  PRO A CA  1 
ATOM   525  C C   . PRO A 1 79  ? 47.856 7.660   3.364   1.00 41.26  ? 439  PRO A C   1 
ATOM   526  O O   . PRO A 1 79  ? 48.514 7.457   2.329   1.00 42.04  ? 439  PRO A O   1 
ATOM   527  C CB  . PRO A 1 79  ? 46.550 5.610   4.047   1.00 40.74  ? 439  PRO A CB  1 
ATOM   528  C CG  . PRO A 1 79  ? 45.461 5.998   4.961   1.00 39.94  ? 439  PRO A CG  1 
ATOM   529  C CD  . PRO A 1 79  ? 46.120 6.417   6.230   1.00 40.95  ? 439  PRO A CD  1 
ATOM   530  N N   . PHE A 1 80  ? 47.238 8.822   3.616   1.00 40.72  ? 440  PHE A N   1 
ATOM   531  C CA  . PHE A 1 80  ? 47.157 9.882   2.612   1.00 39.77  ? 440  PHE A CA  1 
ATOM   532  C C   . PHE A 1 80  ? 48.139 11.034  2.825   1.00 40.86  ? 440  PHE A C   1 
ATOM   533  O O   . PHE A 1 80  ? 48.004 12.105  2.200   1.00 40.92  ? 440  PHE A O   1 
ATOM   534  C CB  . PHE A 1 80  ? 45.709 10.382  2.441   1.00 39.68  ? 440  PHE A CB  1 
ATOM   535  C CG  . PHE A 1 80  ? 44.718 9.294   2.110   1.00 37.35  ? 440  PHE A CG  1 
ATOM   536  C CD1 . PHE A 1 80  ? 45.020 8.310   1.170   1.00 35.94  ? 440  PHE A CD1 1 
ATOM   537  C CD2 . PHE A 1 80  ? 43.481 9.251   2.737   1.00 39.07  ? 440  PHE A CD2 1 
ATOM   538  C CE1 . PHE A 1 80  ? 44.114 7.299   0.872   1.00 37.14  ? 440  PHE A CE1 1 
ATOM   539  C CE2 . PHE A 1 80  ? 42.549 8.227   2.437   1.00 38.97  ? 440  PHE A CE2 1 
ATOM   540  C CZ  . PHE A 1 80  ? 42.872 7.256   1.505   1.00 37.52  ? 440  PHE A CZ  1 
ATOM   541  N N   . LEU A 1 81  ? 49.123 10.803  3.695   1.00 41.30  ? 441  LEU A N   1 
ATOM   542  C CA  . LEU A 1 81  ? 50.266 11.680  3.873   1.00 42.40  ? 441  LEU A CA  1 
ATOM   543  C C   . LEU A 1 81  ? 51.526 10.955  3.412   1.00 43.33  ? 441  LEU A C   1 
ATOM   544  O O   . LEU A 1 81  ? 51.662 9.748   3.578   1.00 43.08  ? 441  LEU A O   1 
ATOM   545  C CB  . LEU A 1 81  ? 50.446 12.097  5.339   1.00 41.98  ? 441  LEU A CB  1 
ATOM   546  C CG  . LEU A 1 81  ? 49.268 12.638  6.152   1.00 42.80  ? 441  LEU A CG  1 
ATOM   547  C CD1 . LEU A 1 81  ? 49.710 12.860  7.595   1.00 40.04  ? 441  LEU A CD1 1 
ATOM   548  C CD2 . LEU A 1 81  ? 48.690 13.931  5.542   1.00 41.96  ? 441  LEU A CD2 1 
ATOM   549  N N   . THR A 1 82  ? 52.432 11.716  2.824   1.00 44.47  ? 442  THR A N   1 
ATOM   550  C CA  . THR A 1 82  ? 53.752 11.264  2.428   1.00 46.23  ? 442  THR A CA  1 
ATOM   551  C C   . THR A 1 82  ? 54.486 10.682  3.661   1.00 46.38  ? 442  THR A C   1 
ATOM   552  O O   . THR A 1 82  ? 54.573 11.355  4.696   1.00 47.14  ? 442  THR A O   1 
ATOM   553  C CB  . THR A 1 82  ? 54.472 12.491  1.785   1.00 47.27  ? 442  THR A CB  1 
ATOM   554  O OG1 . THR A 1 82  ? 55.523 12.062  0.911   1.00 53.27  ? 442  THR A OG1 1 
ATOM   555  C CG2 . THR A 1 82  ? 55.013 13.443  2.850   1.00 45.20  ? 442  THR A CG2 1 
ATOM   556  N N   . HIS A 1 83  ? 54.953 9.422   3.593   1.00 45.72  ? 443  HIS A N   1 
ATOM   557  C CA  . HIS A 1 83  ? 55.664 8.804   4.734   1.00 45.52  ? 443  HIS A CA  1 
ATOM   558  C C   . HIS A 1 83  ? 57.167 9.124   4.843   1.00 44.96  ? 443  HIS A C   1 
ATOM   559  O O   . HIS A 1 83  ? 57.908 9.096   3.856   1.00 44.22  ? 443  HIS A O   1 
ATOM   560  C CB  . HIS A 1 83  ? 55.461 7.270   4.820   1.00 45.49  ? 443  HIS A CB  1 
ATOM   561  C CG  . HIS A 1 83  ? 54.035 6.850   5.020   1.00 46.31  ? 443  HIS A CG  1 
ATOM   562  N ND1 . HIS A 1 83  ? 53.644 5.528   5.022   1.00 47.39  ? 443  HIS A ND1 1 
ATOM   563  C CD2 . HIS A 1 83  ? 52.900 7.576   5.179   1.00 46.45  ? 443  HIS A CD2 1 
ATOM   564  C CE1 . HIS A 1 83  ? 52.337 5.458   5.204   1.00 46.94  ? 443  HIS A CE1 1 
ATOM   565  N NE2 . HIS A 1 83  ? 51.860 6.688   5.291   1.00 46.97  ? 443  HIS A NE2 1 
ATOM   566  N N   . MET A 1 84  ? 57.592 9.414   6.067   1.00 44.80  ? 444  MET A N   1 
ATOM   567  C CA  . MET A 1 84  ? 59.007 9.605   6.383   1.00 44.97  ? 444  MET A CA  1 
ATOM   568  C C   . MET A 1 84  ? 59.550 8.376   7.120   1.00 44.57  ? 444  MET A C   1 
ATOM   569  O O   . MET A 1 84  ? 58.991 7.937   8.124   1.00 44.02  ? 444  MET A O   1 
ATOM   570  C CB  . MET A 1 84  ? 59.205 10.887  7.202   1.00 45.52  ? 444  MET A CB  1 
ATOM   571  C CG  . MET A 1 84  ? 60.665 11.243  7.515   1.00 46.30  ? 444  MET A CG  1 
ATOM   572  S SD  . MET A 1 84  ? 61.069 10.863  9.222   1.00 54.47  ? 444  MET A SD  1 
ATOM   573  C CE  . MET A 1 84  ? 60.535 12.372  10.035  1.00 54.21  ? 444  MET A CE  1 
ATOM   574  N N   . PHE A 1 85  ? 60.636 7.820   6.598   1.00 44.79  ? 445  PHE A N   1 
ATOM   575  C CA  . PHE A 1 85  ? 61.258 6.630   7.180   1.00 45.18  ? 445  PHE A CA  1 
ATOM   576  C C   . PHE A 1 85  ? 62.321 6.957   8.224   1.00 45.29  ? 445  PHE A C   1 
ATOM   577  O O   . PHE A 1 85  ? 62.339 6.353   9.288   1.00 45.57  ? 445  PHE A O   1 
ATOM   578  C CB  . PHE A 1 85  ? 61.823 5.722   6.091   1.00 44.84  ? 445  PHE A CB  1 
ATOM   579  C CG  . PHE A 1 85  ? 60.798 5.291   5.086   1.00 45.94  ? 445  PHE A CG  1 
ATOM   580  C CD1 . PHE A 1 85  ? 60.920 5.652   3.761   1.00 44.04  ? 445  PHE A CD1 1 
ATOM   581  C CD2 . PHE A 1 85  ? 59.697 4.524   5.475   1.00 48.08  ? 445  PHE A CD2 1 
ATOM   582  C CE1 . PHE A 1 85  ? 59.993 5.244   2.832   1.00 43.32  ? 445  PHE A CE1 1 
ATOM   583  C CE2 . PHE A 1 85  ? 58.742 4.130   4.548   1.00 47.25  ? 445  PHE A CE2 1 
ATOM   584  C CZ  . PHE A 1 85  ? 58.895 4.488   3.220   1.00 45.08  ? 445  PHE A CZ  1 
ATOM   585  N N   . CYS A 1 86  ? 63.203 7.905   7.921   1.00 45.46  ? 446  CYS A N   1 
ATOM   586  C CA  . CYS A 1 86  ? 64.142 8.392   8.925   1.00 45.92  ? 446  CYS A CA  1 
ATOM   587  C C   . CYS A 1 86  ? 64.719 9.781   8.674   1.00 44.83  ? 446  CYS A C   1 
ATOM   588  O O   . CYS A 1 86  ? 64.727 10.299  7.572   1.00 44.09  ? 446  CYS A O   1 
ATOM   589  C CB  . CYS A 1 86  ? 65.279 7.394   9.171   1.00 46.21  ? 446  CYS A CB  1 
ATOM   590  S SG  . CYS A 1 86  ? 66.247 7.023   7.707   1.00 50.73  ? 446  CYS A SG  1 
ATOM   591  N N   . THR A 1 87  ? 65.242 10.326  9.760   1.00 44.62  ? 447  THR A N   1 
ATOM   592  C CA  . THR A 1 87  ? 65.767 11.650  9.856   1.00 44.41  ? 447  THR A CA  1 
ATOM   593  C C   . THR A 1 87  ? 67.146 11.558  10.528  1.00 44.16  ? 447  THR A C   1 
ATOM   594  O O   . THR A 1 87  ? 67.303 10.934  11.580  1.00 43.64  ? 447  THR A O   1 
ATOM   595  C CB  . THR A 1 87  ? 64.752 12.502  10.641  1.00 44.38  ? 447  THR A CB  1 
ATOM   596  O OG1 . THR A 1 87  ? 64.150 13.467  9.761   1.00 46.11  ? 447  THR A OG1 1 
ATOM   597  C CG2 . THR A 1 87  ? 65.384 13.205  11.733  1.00 44.83  ? 447  THR A CG2 1 
ATOM   598  N N   . PHE A 1 88  ? 68.155 12.146  9.891   1.00 43.90  ? 448  PHE A N   1 
ATOM   599  C CA  . PHE A 1 88  ? 69.510 12.185  10.469  1.00 43.37  ? 448  PHE A CA  1 
ATOM   600  C C   . PHE A 1 88  ? 70.268 13.408  9.972   1.00 43.21  ? 448  PHE A C   1 
ATOM   601  O O   . PHE A 1 88  ? 69.912 14.011  8.953   1.00 42.84  ? 448  PHE A O   1 
ATOM   602  C CB  . PHE A 1 88  ? 70.300 10.881  10.208  1.00 42.74  ? 448  PHE A CB  1 
ATOM   603  C CG  . PHE A 1 88  ? 70.561 10.606  8.752   1.00 42.37  ? 448  PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 88  ? 71.764 10.973  8.166   1.00 42.14  ? 448  PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 88  ? 69.599 9.993   7.965   1.00 40.69  ? 448  PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 88  ? 71.997 10.728  6.821   1.00 42.03  ? 448  PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 88  ? 69.834 9.741   6.623   1.00 40.17  ? 448  PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 88  ? 71.023 10.113  6.050   1.00 40.18  ? 448  PHE A CZ  1 
ATOM   609  N N   . GLN A 1 89  ? 71.315 13.769  10.704  1.00 43.17  ? 449  GLN A N   1 
ATOM   610  C CA  . GLN A 1 89  ? 72.053 14.978  10.415  1.00 43.12  ? 449  GLN A CA  1 
ATOM   611  C C   . GLN A 1 89  ? 73.559 14.751  10.379  1.00 43.88  ? 449  GLN A C   1 
ATOM   612  O O   . GLN A 1 89  ? 74.079 13.807  10.979  1.00 43.60  ? 449  GLN A O   1 
ATOM   613  C CB  . GLN A 1 89  ? 71.701 16.055  11.448  1.00 43.22  ? 449  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 89  ? 72.144 15.716  12.876  1.00 42.33  ? 449  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 89  ? 71.660 16.730  13.873  1.00 42.45  ? 449  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 89  ? 72.048 17.897  13.826  1.00 42.52  ? 449  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 89  ? 70.806 16.298  14.786  1.00 41.08  ? 449  GLN A NE2 1 
ATOM   618  N N   . THR A 1 90  ? 74.242 15.639  9.663   1.00 44.46  ? 450  THR A N   1 
ATOM   619  C CA  . THR A 1 90  ? 75.704 15.700  9.620   1.00 44.81  ? 450  THR A CA  1 
ATOM   620  C C   . THR A 1 90  ? 76.107 17.052  10.228  1.00 44.09  ? 450  THR A C   1 
ATOM   621  O O   . THR A 1 90  ? 75.235 17.818  10.663  1.00 43.84  ? 450  THR A O   1 
ATOM   622  C CB  . THR A 1 90  ? 76.192 15.515  8.146   1.00 45.23  ? 450  THR A CB  1 
ATOM   623  O OG1 . THR A 1 90  ? 76.071 14.131  7.788   1.00 46.73  ? 450  THR A OG1 1 
ATOM   624  C CG2 . THR A 1 90  ? 77.651 15.933  7.954   1.00 47.33  ? 450  THR A CG2 1 
ATOM   625  N N   . LYS A 1 91  ? 77.410 17.342  10.287  1.00 43.17  ? 451  LYS A N   1 
ATOM   626  C CA  . LYS A 1 91  ? 77.866 18.671  10.694  1.00 42.41  ? 451  LYS A CA  1 
ATOM   627  C C   . LYS A 1 91  ? 77.258 19.804  9.838   1.00 41.64  ? 451  LYS A C   1 
ATOM   628  O O   . LYS A 1 91  ? 76.880 20.847  10.367  1.00 41.28  ? 451  LYS A O   1 
ATOM   629  C CB  . LYS A 1 91  ? 79.395 18.769  10.714  1.00 42.18  ? 451  LYS A CB  1 
ATOM   630  C CG  . LYS A 1 91  ? 79.885 19.899  11.605  1.00 42.18  ? 451  LYS A CG  1 
ATOM   631  C CD  . LYS A 1 91  ? 81.388 20.101  11.516  1.00 42.83  ? 451  LYS A CD  1 
ATOM   632  C CE  . LYS A 1 91  ? 81.839 21.073  12.580  1.00 42.59  ? 451  LYS A CE  1 
ATOM   633  N NZ  . LYS A 1 91  ? 83.007 21.845  12.109  1.00 44.07  ? 451  LYS A NZ  1 
ATOM   634  N N   . GLU A 1 92  ? 77.162 19.579  8.531   1.00 40.99  ? 452  GLU A N   1 
ATOM   635  C CA  . GLU A 1 92  ? 76.669 20.585  7.592   1.00 40.94  ? 452  GLU A CA  1 
ATOM   636  C C   . GLU A 1 92  ? 75.213 20.383  7.149   1.00 39.90  ? 452  GLU A C   1 
ATOM   637  O O   . GLU A 1 92  ? 74.527 21.348  6.799   1.00 40.47  ? 452  GLU A O   1 
ATOM   638  C CB  . GLU A 1 92  ? 77.520 20.588  6.328   1.00 40.69  ? 452  GLU A CB  1 
ATOM   639  C CG  . GLU A 1 92  ? 79.008 20.515  6.514   1.00 42.10  ? 452  GLU A CG  1 
ATOM   640  C CD  . GLU A 1 92  ? 79.754 20.804  5.212   1.00 42.99  ? 452  GLU A CD  1 
ATOM   641  O OE1 . GLU A 1 92  ? 79.133 20.683  4.121   1.00 45.67  ? 452  GLU A OE1 1 
ATOM   642  O OE2 . GLU A 1 92  ? 80.955 21.167  5.287   1.00 47.05  ? 452  GLU A OE2 1 
ATOM   643  N N   . ASN A 1 93  ? 74.762 19.133  7.152   1.00 38.59  ? 453  ASN A N   1 
ATOM   644  C CA  . ASN A 1 93  ? 73.562 18.720  6.444   1.00 37.30  ? 453  ASN A CA  1 
ATOM   645  C C   . ASN A 1 93  ? 72.429 18.184  7.336   1.00 37.07  ? 453  ASN A C   1 
ATOM   646  O O   . ASN A 1 93  ? 72.675 17.584  8.375   1.00 36.61  ? 453  ASN A O   1 
ATOM   647  C CB  . ASN A 1 93  ? 73.909 17.638  5.413   1.00 37.05  ? 453  ASN A CB  1 
ATOM   648  C CG  . ASN A 1 93  ? 74.962 18.073  4.392   1.00 36.86  ? 453  ASN A CG  1 
ATOM   649  O OD1 . ASN A 1 93  ? 74.778 19.026  3.649   1.00 38.16  ? 453  ASN A OD1 1 
ATOM   650  N ND2 . ASN A 1 93  ? 76.054 17.324  4.322   1.00 39.05  ? 453  ASN A ND2 1 
ATOM   651  N N   . LEU A 1 94  ? 71.187 18.402  6.903   1.00 36.75  ? 454  LEU A N   1 
ATOM   652  C CA  . LEU A 1 94  ? 70.020 17.703  7.459   1.00 37.17  ? 454  LEU A CA  1 
ATOM   653  C C   . LEU A 1 94  ? 69.375 16.858  6.366   1.00 37.10  ? 454  LEU A C   1 
ATOM   654  O O   . LEU A 1 94  ? 69.180 17.341  5.265   1.00 37.69  ? 454  LEU A O   1 
ATOM   655  C CB  . LEU A 1 94  ? 68.989 18.694  8.017   1.00 36.80  ? 454  LEU A CB  1 
ATOM   656  C CG  . LEU A 1 94  ? 69.458 19.629  9.134   1.00 36.45  ? 454  LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 94  ? 68.610 20.884  9.110   1.00 35.42  ? 454  LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 94  ? 69.430 18.950  10.516  1.00 33.45  ? 454  LEU A CD2 1 
ATOM   659  N N   . PHE A 1 95  ? 69.045 15.606  6.679   1.00 38.01  ? 455  PHE A N   1 
ATOM   660  C CA  . PHE A 1 95  ? 68.465 14.661  5.712   1.00 38.37  ? 455  PHE A CA  1 
ATOM   661  C C   . PHE A 1 95  ? 67.149 14.061  6.204   1.00 38.59  ? 455  PHE A C   1 
ATOM   662  O O   . PHE A 1 95  ? 67.050 13.653  7.354   1.00 38.39  ? 455  PHE A O   1 
ATOM   663  C CB  . PHE A 1 95  ? 69.448 13.525  5.400   1.00 38.62  ? 455  PHE A CB  1 
ATOM   664  C CG  . PHE A 1 95  ? 70.741 13.985  4.778   1.00 38.60  ? 455  PHE A CG  1 
ATOM   665  C CD1 . PHE A 1 95  ? 70.761 14.510  3.493   1.00 37.94  ? 455  PHE A CD1 1 
ATOM   666  C CD2 . PHE A 1 95  ? 71.947 13.870  5.480   1.00 38.77  ? 455  PHE A CD2 1 
ATOM   667  C CE1 . PHE A 1 95  ? 71.959 14.926  2.909   1.00 37.95  ? 455  PHE A CE1 1 
ATOM   668  C CE2 . PHE A 1 95  ? 73.147 14.277  4.911   1.00 38.57  ? 455  PHE A CE2 1 
ATOM   669  C CZ  . PHE A 1 95  ? 73.151 14.810  3.620   1.00 39.07  ? 455  PHE A CZ  1 
ATOM   670  N N   . PHE A 1 96  ? 66.144 14.028  5.325   1.00 39.42  ? 456  PHE A N   1 
ATOM   671  C CA  . PHE A 1 96  ? 64.863 13.357  5.595   1.00 40.12  ? 456  PHE A CA  1 
ATOM   672  C C   . PHE A 1 96  ? 64.716 12.258  4.552   1.00 40.70  ? 456  PHE A C   1 
ATOM   673  O O   . PHE A 1 96  ? 64.640 12.554  3.363   1.00 40.85  ? 456  PHE A O   1 
ATOM   674  C CB  . PHE A 1 96  ? 63.658 14.304  5.428   1.00 40.14  ? 456  PHE A CB  1 
ATOM   675  C CG  . PHE A 1 96  ? 63.755 15.623  6.184   1.00 41.49  ? 456  PHE A CG  1 
ATOM   676  C CD1 . PHE A 1 96  ? 64.743 16.574  5.872   1.00 42.34  ? 456  PHE A CD1 1 
ATOM   677  C CD2 . PHE A 1 96  ? 62.817 15.936  7.171   1.00 41.46  ? 456  PHE A CD2 1 
ATOM   678  C CE1 . PHE A 1 96  ? 64.813 17.803  6.558   1.00 42.19  ? 456  PHE A CE1 1 
ATOM   679  C CE2 . PHE A 1 96  ? 62.869 17.159  7.851   1.00 41.32  ? 456  PHE A CE2 1 
ATOM   680  C CZ  . PHE A 1 96  ? 63.865 18.097  7.541   1.00 41.23  ? 456  PHE A CZ  1 
ATOM   681  N N   . VAL A 1 97  ? 64.664 10.996  4.976   1.00 41.50  ? 457  VAL A N   1 
ATOM   682  C CA  . VAL A 1 97  ? 64.451 9.902   4.027   1.00 42.01  ? 457  VAL A CA  1 
ATOM   683  C C   . VAL A 1 97  ? 62.958 9.564   3.890   1.00 42.94  ? 457  VAL A C   1 
ATOM   684  O O   . VAL A 1 97  ? 62.322 9.071   4.833   1.00 42.93  ? 457  VAL A O   1 
ATOM   685  C CB  . VAL A 1 97  ? 65.314 8.661   4.359   1.00 41.99  ? 457  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 97  ? 65.047 7.544   3.361   1.00 41.77  ? 457  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 97  ? 66.807 9.022   4.364   1.00 41.11  ? 457  VAL A CG2 1 
ATOM   688  N N   . MET A 1 98  ? 62.423 9.819   2.694   1.00 43.81  ? 458  MET A N   1 
ATOM   689  C CA  . MET A 1 98  ? 60.987 9.744   2.410   1.00 44.71  ? 458  MET A CA  1 
ATOM   690  C C   . MET A 1 98  ? 60.645 8.648   1.412   1.00 44.97  ? 458  MET A C   1 
ATOM   691  O O   . MET A 1 98  ? 61.482 8.235   0.616   1.00 44.92  ? 458  MET A O   1 
ATOM   692  C CB  . MET A 1 98  ? 60.483 11.054  1.772   1.00 44.75  ? 458  MET A CB  1 
ATOM   693  C CG  . MET A 1 98  ? 60.968 12.349  2.397   1.00 46.75  ? 458  MET A CG  1 
ATOM   694  S SD  . MET A 1 98  ? 60.211 12.552  4.009   1.00 52.17  ? 458  MET A SD  1 
ATOM   695  C CE  . MET A 1 98  ? 58.495 12.766  3.511   1.00 48.69  ? 458  MET A CE  1 
ATOM   696  N N   . GLU A 1 99  ? 59.387 8.225   1.455   1.00 45.11  ? 459  GLU A N   1 
ATOM   697  C CA  . GLU A 1 99  ? 58.715 7.489   0.389   1.00 45.99  ? 459  GLU A CA  1 
ATOM   698  C C   . GLU A 1 99  ? 58.916 8.205   -0.960  1.00 44.50  ? 459  GLU A C   1 
ATOM   699  O O   . GLU A 1 99  ? 58.711 9.415   -1.060  1.00 43.91  ? 459  GLU A O   1 
ATOM   700  C CB  . GLU A 1 99  ? 57.221 7.501   0.730   1.00 46.12  ? 459  GLU A CB  1 
ATOM   701  C CG  . GLU A 1 99  ? 56.348 6.422   0.141   1.00 49.00  ? 459  GLU A CG  1 
ATOM   702  C CD  . GLU A 1 99  ? 54.851 6.616   0.504   1.00 48.90  ? 459  GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 99  ? 54.491 7.631   1.151   1.00 48.52  ? 459  GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 99  ? 54.036 5.728   0.147   1.00 54.58  ? 459  GLU A OE2 1 
ATOM   705  N N   . TYR A 1 100 ? 59.307 7.448   -1.985  1.00 43.64  ? 460  TYR A N   1 
ATOM   706  C CA  . TYR A 1 100 ? 59.450 7.943   -3.350  1.00 43.01  ? 460  TYR A CA  1 
ATOM   707  C C   . TYR A 1 100 ? 58.169 7.768   -4.152  1.00 43.75  ? 460  TYR A C   1 
ATOM   708  O O   . TYR A 1 100 ? 57.695 6.654   -4.336  1.00 44.88  ? 460  TYR A O   1 
ATOM   709  C CB  . TYR A 1 100 ? 60.582 7.220   -4.068  1.00 41.81  ? 460  TYR A CB  1 
ATOM   710  C CG  . TYR A 1 100 ? 60.777 7.610   -5.526  1.00 40.64  ? 460  TYR A CG  1 
ATOM   711  C CD1 . TYR A 1 100 ? 60.883 8.949   -5.905  1.00 39.87  ? 460  TYR A CD1 1 
ATOM   712  C CD2 . TYR A 1 100 ? 60.908 6.639   -6.522  1.00 38.15  ? 460  TYR A CD2 1 
ATOM   713  C CE1 . TYR A 1 100 ? 61.074 9.313   -7.242  1.00 38.03  ? 460  TYR A CE1 1 
ATOM   714  C CE2 . TYR A 1 100 ? 61.121 7.002   -7.864  1.00 37.31  ? 460  TYR A CE2 1 
ATOM   715  C CZ  . TYR A 1 100 ? 61.209 8.342   -8.210  1.00 38.27  ? 460  TYR A CZ  1 
ATOM   716  O OH  . TYR A 1 100 ? 61.417 8.723   -9.528  1.00 38.69  ? 460  TYR A OH  1 
ATOM   717  N N   . LEU A 1 101 ? 57.635 8.879   -4.649  1.00 43.51  ? 461  LEU A N   1 
ATOM   718  C CA  . LEU A 1 101 ? 56.405 8.898   -5.414  1.00 43.10  ? 461  LEU A CA  1 
ATOM   719  C C   . LEU A 1 101 ? 56.661 9.504   -6.786  1.00 42.81  ? 461  LEU A C   1 
ATOM   720  O O   . LEU A 1 101 ? 56.688 10.725  -6.927  1.00 43.03  ? 461  LEU A O   1 
ATOM   721  C CB  . LEU A 1 101 ? 55.318 9.687   -4.636  1.00 43.31  ? 461  LEU A CB  1 
ATOM   722  C CG  . LEU A 1 101 ? 55.075 9.095   -3.225  1.00 44.47  ? 461  LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 101 ? 54.625 10.123  -2.182  1.00 43.20  ? 461  LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 101 ? 54.133 7.886   -3.292  1.00 44.58  ? 461  LEU A CD2 1 
ATOM   725  N N   . ASN A 1 102 ? 56.845 8.675   -7.809  1.00 42.14  ? 462  ASN A N   1 
ATOM   726  C CA  . ASN A 1 102 ? 57.013 9.252   -9.140  1.00 42.12  ? 462  ASN A CA  1 
ATOM   727  C C   . ASN A 1 102 ? 55.749 9.259   -9.995  1.00 41.80  ? 462  ASN A C   1 
ATOM   728  O O   . ASN A 1 102 ? 55.813 9.531   -11.195 1.00 41.68  ? 462  ASN A O   1 
ATOM   729  C CB  . ASN A 1 102 ? 58.207 8.659   -9.901  1.00 42.38  ? 462  ASN A CB  1 
ATOM   730  C CG  . ASN A 1 102 ? 58.083 7.166   -10.105 1.00 42.97  ? 462  ASN A CG  1 
ATOM   731  O OD1 . ASN A 1 102 ? 57.352 6.495   -9.379  1.00 42.64  ? 462  ASN A OD1 1 
ATOM   732  N ND2 . ASN A 1 102 ? 58.787 6.645   -11.099 1.00 41.36  ? 462  ASN A ND2 1 
ATOM   733  N N   . GLY A 1 103 ? 54.611 9.004   -9.352  1.00 41.63  ? 463  GLY A N   1 
ATOM   734  C CA  . GLY A 1 103 ? 53.314 9.010   -10.004 1.00 42.28  ? 463  GLY A CA  1 
ATOM   735  C C   . GLY A 1 103 ? 52.784 10.365  -10.426 1.00 43.01  ? 463  GLY A C   1 
ATOM   736  O O   . GLY A 1 103 ? 51.782 10.442  -11.144 1.00 43.45  ? 463  GLY A O   1 
ATOM   737  N N   . GLY A 1 104 ? 53.447 11.436  -9.995  1.00 43.44  ? 464  GLY A N   1 
ATOM   738  C CA  . GLY A 1 104 ? 53.096 12.781  -10.432 1.00 44.37  ? 464  GLY A CA  1 
ATOM   739  C C   . GLY A 1 104 ? 52.204 13.487  -9.433  1.00 45.03  ? 464  GLY A C   1 
ATOM   740  O O   . GLY A 1 104 ? 51.495 12.839  -8.646  1.00 46.44  ? 464  GLY A O   1 
ATOM   741  N N   . ASP A 1 105 ? 52.230 14.811  -9.467  1.00 44.50  ? 465  ASP A N   1 
ATOM   742  C CA  . ASP A 1 105 ? 51.351 15.635  -8.649  1.00 45.10  ? 465  ASP A CA  1 
ATOM   743  C C   . ASP A 1 105 ? 50.109 16.032  -9.451  1.00 45.08  ? 465  ASP A C   1 
ATOM   744  O O   . ASP A 1 105 ? 50.122 15.976  -10.684 1.00 44.00  ? 465  ASP A O   1 
ATOM   745  C CB  . ASP A 1 105 ? 52.116 16.863  -8.143  1.00 45.43  ? 465  ASP A CB  1 
ATOM   746  C CG  . ASP A 1 105 ? 52.760 17.636  -9.274  1.00 47.15  ? 465  ASP A CG  1 
ATOM   747  O OD1 . ASP A 1 105 ? 53.836 17.209  -9.780  1.00 49.28  ? 465  ASP A OD1 1 
ATOM   748  O OD2 . ASP A 1 105 ? 52.160 18.646  -9.692  1.00 48.54  ? 465  ASP A OD2 1 
ATOM   749  N N   . LEU A 1 106 ? 49.033 16.399  -8.746  1.00 45.95  ? 466  LEU A N   1 
ATOM   750  C CA  . LEU A 1 106 ? 47.739 16.757  -9.370  1.00 46.23  ? 466  LEU A CA  1 
ATOM   751  C C   . LEU A 1 106 ? 47.814 17.972  -10.304 1.00 46.90  ? 466  LEU A C   1 
ATOM   752  O O   . LEU A 1 106 ? 47.136 18.011  -11.329 1.00 47.26  ? 466  LEU A O   1 
ATOM   753  C CB  . LEU A 1 106 ? 46.632 16.931  -8.305  1.00 45.96  ? 466  LEU A CB  1 
ATOM   754  C CG  . LEU A 1 106 ? 46.078 15.665  -7.594  1.00 45.67  ? 466  LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 106 ? 44.827 15.961  -6.746  1.00 41.37  ? 466  LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 106 ? 45.775 14.527  -8.555  1.00 42.94  ? 466  LEU A CD2 1 
ATOM   757  N N   . MET A 1 107 ? 48.679 18.937  -9.984  1.00 47.67  ? 467  MET A N   1 
ATOM   758  C CA  . MET A 1 107 ? 48.913 20.084  -10.869 1.00 47.98  ? 467  MET A CA  1 
ATOM   759  C C   . MET A 1 107 ? 49.438 19.623  -12.215 1.00 47.33  ? 467  MET A C   1 
ATOM   760  O O   . MET A 1 107 ? 48.939 20.053  -13.261 1.00 47.74  ? 467  MET A O   1 
ATOM   761  C CB  . MET A 1 107 ? 49.908 21.064  -10.232 1.00 48.98  ? 467  MET A CB  1 
ATOM   762  C CG  . MET A 1 107 ? 50.110 22.405  -10.972 1.00 54.17  ? 467  MET A CG  1 
ATOM   763  S SD  . MET A 1 107 ? 48.566 23.312  -11.236 1.00 66.26  ? 467  MET A SD  1 
ATOM   764  C CE  . MET A 1 107 ? 48.107 23.713  -9.553  1.00 67.31  ? 467  MET A CE  1 
ATOM   765  N N   . TYR A 1 108 ? 50.449 18.756  -12.197 1.00 45.68  ? 468  TYR A N   1 
ATOM   766  C CA  . TYR A 1 108 ? 51.003 18.224  -13.432 1.00 45.28  ? 468  TYR A CA  1 
ATOM   767  C C   . TYR A 1 108 ? 49.968 17.451  -14.259 1.00 45.30  ? 468  TYR A C   1 
ATOM   768  O O   . TYR A 1 108 ? 49.864 17.625  -15.460 1.00 44.39  ? 468  TYR A O   1 
ATOM   769  C CB  . TYR A 1 108 ? 52.210 17.331  -13.141 1.00 45.07  ? 468  TYR A CB  1 
ATOM   770  C CG  . TYR A 1 108 ? 53.003 16.998  -14.377 1.00 44.88  ? 468  TYR A CG  1 
ATOM   771  C CD1 . TYR A 1 108 ? 54.040 17.822  -14.781 1.00 43.22  ? 468  TYR A CD1 1 
ATOM   772  C CD2 . TYR A 1 108 ? 52.701 15.874  -15.158 1.00 45.06  ? 468  TYR A CD2 1 
ATOM   773  C CE1 . TYR A 1 108 ? 54.781 17.555  -15.911 1.00 42.94  ? 468  TYR A CE1 1 
ATOM   774  C CE2 . TYR A 1 108 ? 53.455 15.594  -16.319 1.00 46.65  ? 468  TYR A CE2 1 
ATOM   775  C CZ  . TYR A 1 108 ? 54.502 16.448  -16.665 1.00 45.28  ? 468  TYR A CZ  1 
ATOM   776  O OH  . TYR A 1 108 ? 55.273 16.219  -17.788 1.00 47.33  ? 468  TYR A OH  1 
ATOM   777  N N   . HIS A 1 109 ? 49.222 16.579  -13.599 1.00 46.68  ? 469  HIS A N   1 
ATOM   778  C CA  . HIS A 1 109 ? 48.192 15.796  -14.255 1.00 48.50  ? 469  HIS A CA  1 
ATOM   779  C C   . HIS A 1 109 ? 47.048 16.639  -14.806 1.00 50.05  ? 469  HIS A C   1 
ATOM   780  O O   . HIS A 1 109 ? 46.545 16.338  -15.880 1.00 51.52  ? 469  HIS A O   1 
ATOM   781  C CB  . HIS A 1 109 ? 47.651 14.749  -13.299 1.00 47.51  ? 469  HIS A CB  1 
ATOM   782  C CG  . HIS A 1 109 ? 48.589 13.609  -13.083 1.00 48.62  ? 469  HIS A CG  1 
ATOM   783  N ND1 . HIS A 1 109 ? 49.010 12.789  -14.110 1.00 47.89  ? 469  HIS A ND1 1 
ATOM   784  C CD2 . HIS A 1 109 ? 49.176 13.138  -11.958 1.00 45.19  ? 469  HIS A CD2 1 
ATOM   785  C CE1 . HIS A 1 109 ? 49.810 11.862  -13.625 1.00 45.89  ? 469  HIS A CE1 1 
ATOM   786  N NE2 . HIS A 1 109 ? 49.919 12.046  -12.324 1.00 45.82  ? 469  HIS A NE2 1 
ATOM   787  N N   . ILE A 1 110 ? 46.644 17.682  -14.086 1.00 51.38  ? 470  ILE A N   1 
ATOM   788  C CA  . ILE A 1 110 ? 45.552 18.536  -14.551 1.00 53.10  ? 470  ILE A CA  1 
ATOM   789  C C   . ILE A 1 110 ? 45.917 19.379  -15.788 1.00 54.93  ? 470  ILE A C   1 
ATOM   790  O O   . ILE A 1 110 ? 45.040 19.734  -16.568 1.00 55.03  ? 470  ILE A O   1 
ATOM   791  C CB  . ILE A 1 110 ? 44.935 19.381  -13.389 1.00 52.97  ? 470  ILE A CB  1 
ATOM   792  C CG1 . ILE A 1 110 ? 43.425 19.567  -13.605 1.00 52.76  ? 470  ILE A CG1 1 
ATOM   793  C CG2 . ILE A 1 110 ? 45.680 20.697  -13.171 1.00 50.95  ? 470  ILE A CG2 1 
ATOM   794  C CD1 . ILE A 1 110 ? 42.754 20.302  -12.449 1.00 52.59  ? 470  ILE A CD1 1 
ATOM   795  N N   . GLN A 1 111 ? 47.208 19.669  -15.977 1.00 57.09  ? 471  GLN A N   1 
ATOM   796  C CA  . GLN A 1 111 ? 47.694 20.374  -17.173 1.00 58.93  ? 471  GLN A CA  1 
ATOM   797  C C   . GLN A 1 111 ? 47.372 19.618  -18.454 1.00 59.89  ? 471  GLN A C   1 
ATOM   798  O O   . GLN A 1 111 ? 47.033 20.210  -19.470 1.00 60.85  ? 471  GLN A O   1 
ATOM   799  C CB  . GLN A 1 111 ? 49.197 20.636  -17.091 1.00 59.15  ? 471  GLN A CB  1 
ATOM   800  C CG  . GLN A 1 111 ? 49.609 21.517  -15.921 1.00 61.83  ? 471  GLN A CG  1 
ATOM   801  C CD  . GLN A 1 111 ? 48.623 22.648  -15.650 1.00 65.60  ? 471  GLN A CD  1 
ATOM   802  O OE1 . GLN A 1 111 ? 48.047 22.735  -14.562 1.00 68.01  ? 471  GLN A OE1 1 
ATOM   803  N NE2 . GLN A 1 111 ? 48.416 23.517  -16.647 1.00 68.50  ? 471  GLN A NE2 1 
ATOM   804  N N   . SER A 1 112 ? 47.460 18.298  -18.398 1.00 60.72  ? 472  SER A N   1 
ATOM   805  C CA  . SER A 1 112 ? 47.166 17.469  -19.557 1.00 61.32  ? 472  SER A CA  1 
ATOM   806  C C   . SER A 1 112 ? 45.673 17.495  -19.879 1.00 60.66  ? 472  SER A C   1 
ATOM   807  O O   . SER A 1 112 ? 45.286 17.747  -21.020 1.00 62.14  ? 472  SER A O   1 
ATOM   808  C CB  . SER A 1 112 ? 47.631 16.025  -19.294 1.00 62.22  ? 472  SER A CB  1 
ATOM   809  O OG  . SER A 1 112 ? 48.789 16.009  -18.443 1.00 64.33  ? 472  SER A OG  1 
ATOM   810  N N   . CYS A 1 113 ? 44.821 17.266  -18.884 1.00 58.97  ? 473  CYS A N   1 
ATOM   811  C CA  . CYS A 1 113 ? 43.386 17.132  -19.168 1.00 57.39  ? 473  CYS A CA  1 
ATOM   812  C C   . CYS A 1 113 ? 42.541 18.393  -18.960 1.00 55.38  ? 473  CYS A C   1 
ATOM   813  O O   . CYS A 1 113 ? 41.354 18.391  -19.282 1.00 54.95  ? 473  CYS A O   1 
ATOM   814  C CB  . CYS A 1 113 ? 42.798 15.958  -18.372 1.00 57.87  ? 473  CYS A CB  1 
ATOM   815  S SG  . CYS A 1 113 ? 43.054 16.120  -16.620 1.00 59.48  ? 473  CYS A SG  1 
ATOM   816  N N   . HIS A 1 114 ? 43.157 19.452  -18.419 1.00 53.63  ? 474  HIS A N   1 
ATOM   817  C CA  . HIS A 1 114 ? 42.516 20.761  -18.139 1.00 51.50  ? 474  HIS A CA  1 
ATOM   818  C C   . HIS A 1 114 ? 41.708 20.781  -16.838 1.00 49.88  ? 474  HIS A C   1 
ATOM   819  O O   . HIS A 1 114 ? 41.894 21.662  -16.007 1.00 48.94  ? 474  HIS A O   1 
ATOM   820  C CB  . HIS A 1 114 ? 41.688 21.287  -19.321 1.00 52.05  ? 474  HIS A CB  1 
ATOM   821  C CG  . HIS A 1 114 ? 41.080 22.640  -19.074 1.00 55.17  ? 474  HIS A CG  1 
ATOM   822  N ND1 . HIS A 1 114 ? 41.826 23.806  -19.069 1.00 56.31  ? 474  HIS A ND1 1 
ATOM   823  C CD2 . HIS A 1 114 ? 39.806 23.009  -18.797 1.00 56.02  ? 474  HIS A CD2 1 
ATOM   824  C CE1 . HIS A 1 114 ? 41.035 24.830  -18.792 1.00 56.97  ? 474  HIS A CE1 1 
ATOM   825  N NE2 . HIS A 1 114 ? 39.805 24.375  -18.630 1.00 56.49  ? 474  HIS A NE2 1 
ATOM   826  N N   . LYS A 1 115 ? 40.801 19.822  -16.678 1.00 48.44  ? 475  LYS A N   1 
ATOM   827  C CA  . LYS A 1 115 ? 40.038 19.669  -15.430 1.00 47.64  ? 475  LYS A CA  1 
ATOM   828  C C   . LYS A 1 115 ? 39.760 18.193  -15.203 1.00 46.30  ? 475  LYS A C   1 
ATOM   829  O O   . LYS A 1 115 ? 39.809 17.415  -16.133 1.00 46.24  ? 475  LYS A O   1 
ATOM   830  C CB  . LYS A 1 115 ? 38.727 20.480  -15.468 1.00 47.78  ? 475  LYS A CB  1 
ATOM   831  C CG  . LYS A 1 115 ? 37.757 20.062  -16.530 1.00 49.17  ? 475  LYS A CG  1 
ATOM   832  C CD  . LYS A 1 115 ? 36.761 21.169  -16.788 1.00 57.29  ? 475  LYS A CD  1 
ATOM   833  C CE  . LYS A 1 115 ? 35.950 20.886  -18.020 1.00 59.83  ? 475  LYS A CE  1 
ATOM   834  N NZ  . LYS A 1 115 ? 35.778 22.172  -18.737 1.00 66.53  ? 475  LYS A NZ  1 
ATOM   835  N N   . PHE A 1 116 ? 39.468 17.811  -13.974 1.00 45.69  ? 476  PHE A N   1 
ATOM   836  C CA  . PHE A 1 116 ? 39.163 16.406  -13.669 1.00 45.47  ? 476  PHE A CA  1 
ATOM   837  C C   . PHE A 1 116 ? 37.661 16.186  -13.793 1.00 46.29  ? 476  PHE A C   1 
ATOM   838  O O   . PHE A 1 116 ? 36.868 17.110  -13.513 1.00 46.82  ? 476  PHE A O   1 
ATOM   839  C CB  . PHE A 1 116 ? 39.631 16.056  -12.254 1.00 44.13  ? 476  PHE A CB  1 
ATOM   840  C CG  . PHE A 1 116 ? 41.106 16.090  -12.089 1.00 42.13  ? 476  PHE A CG  1 
ATOM   841  C CD1 . PHE A 1 116 ? 41.948 15.652  -13.113 1.00 42.48  ? 476  PHE A CD1 1 
ATOM   842  C CD2 . PHE A 1 116 ? 41.672 16.554  -10.918 1.00 42.52  ? 476  PHE A CD2 1 
ATOM   843  C CE1 . PHE A 1 116 ? 43.357 15.670  -12.954 1.00 41.17  ? 476  PHE A CE1 1 
ATOM   844  C CE2 . PHE A 1 116 ? 43.069 16.590  -10.755 1.00 40.81  ? 476  PHE A CE2 1 
ATOM   845  C CZ  . PHE A 1 116 ? 43.902 16.136  -11.788 1.00 40.71  ? 476  PHE A CZ  1 
ATOM   846  N N   . ASP A 1 117 ? 37.243 14.996  -14.208 1.00 46.59  ? 477  ASP A N   1 
ATOM   847  C CA  . ASP A 1 117 ? 35.804 14.735  -14.227 1.00 47.97  ? 477  ASP A CA  1 
ATOM   848  C C   . ASP A 1 117 ? 35.256 14.627  -12.820 1.00 47.11  ? 477  ASP A C   1 
ATOM   849  O O   . ASP A 1 117 ? 35.994 14.366  -11.879 1.00 47.44  ? 477  ASP A O   1 
ATOM   850  C CB  . ASP A 1 117 ? 35.437 13.550  -15.081 1.00 48.81  ? 477  ASP A CB  1 
ATOM   851  C CG  . ASP A 1 117 ? 36.018 12.265  -14.583 1.00 54.00  ? 477  ASP A CG  1 
ATOM   852  O OD1 . ASP A 1 117 ? 35.667 11.817  -13.459 1.00 58.24  ? 477  ASP A OD1 1 
ATOM   853  O OD2 . ASP A 1 117 ? 36.817 11.676  -15.344 1.00 61.68  ? 477  ASP A OD2 1 
ATOM   854  N N   . LEU A 1 118 ? 33.965 14.885  -12.690 1.00 46.87  ? 478  LEU A N   1 
ATOM   855  C CA  . LEU A 1 118 ? 33.294 15.009  -11.406 1.00 46.05  ? 478  LEU A CA  1 
ATOM   856  C C   . LEU A 1 118 ? 33.610 13.888  -10.407 1.00 45.44  ? 478  LEU A C   1 
ATOM   857  O O   . LEU A 1 118 ? 33.876 14.164  -9.240  1.00 45.36  ? 478  LEU A O   1 
ATOM   858  C CB  . LEU A 1 118 ? 31.763 15.128  -11.631 1.00 45.99  ? 478  LEU A CB  1 
ATOM   859  C CG  . LEU A 1 118 ? 30.906 15.163  -10.351 1.00 45.48  ? 478  LEU A CG  1 
ATOM   860  C CD1 . LEU A 1 118 ? 31.155 16.455  -9.579  1.00 44.95  ? 478  LEU A CD1 1 
ATOM   861  C CD2 . LEU A 1 118 ? 29.423 14.983  -10.653 1.00 46.40  ? 478  LEU A CD2 1 
ATOM   862  N N   . SER A 1 119 ? 33.561 12.629  -10.848 1.00 45.48  ? 479  SER A N   1 
ATOM   863  C CA  . SER A 1 119 ? 33.798 11.511  -9.936  1.00 45.81  ? 479  SER A CA  1 
ATOM   864  C C   . SER A 1 119 ? 35.266 11.405  -9.519  1.00 45.06  ? 479  SER A C   1 
ATOM   865  O O   . SER A 1 119 ? 35.583 11.029  -8.383  1.00 45.48  ? 479  SER A O   1 
ATOM   866  C CB  . SER A 1 119 ? 33.268 10.184  -10.529 1.00 47.02  ? 479  SER A CB  1 
ATOM   867  O OG  . SER A 1 119 ? 33.993 9.820   -11.691 1.00 51.60  ? 479  SER A OG  1 
ATOM   868  N N   . ARG A 1 120 ? 36.159 11.761  -10.431 1.00 44.14  ? 480  ARG A N   1 
ATOM   869  C CA  . ARG A 1 120 ? 37.576 11.841  -10.136 1.00 43.82  ? 480  ARG A CA  1 
ATOM   870  C C   . ARG A 1 120 ? 37.897 12.956  -9.128  1.00 44.10  ? 480  ARG A C   1 
ATOM   871  O O   . ARG A 1 120 ? 38.557 12.689  -8.113  1.00 44.74  ? 480  ARG A O   1 
ATOM   872  C CB  . ARG A 1 120 ? 38.346 12.014  -11.442 1.00 43.48  ? 480  ARG A CB  1 
ATOM   873  C CG  . ARG A 1 120 ? 39.832 12.137  -11.287 1.00 44.81  ? 480  ARG A CG  1 
ATOM   874  C CD  . ARG A 1 120 ? 40.577 11.837  -12.575 1.00 44.09  ? 480  ARG A CD  1 
ATOM   875  N NE  . ARG A 1 120 ? 42.018 11.882  -12.320 1.00 46.96  ? 480  ARG A NE  1 
ATOM   876  C CZ  . ARG A 1 120 ? 42.943 12.069  -13.257 1.00 46.33  ? 480  ARG A CZ  1 
ATOM   877  N NH1 . ARG A 1 120 ? 42.581 12.229  -14.515 1.00 45.43  ? 480  ARG A NH1 1 
ATOM   878  N NH2 . ARG A 1 120 ? 44.231 12.109  -12.926 1.00 48.55  ? 480  ARG A NH2 1 
ATOM   879  N N   . ALA A 1 121 ? 37.423 14.185  -9.398  1.00 43.06  ? 481  ALA A N   1 
ATOM   880  C CA  . ALA A 1 121 ? 37.565 15.302  -8.460  1.00 42.83  ? 481  ALA A CA  1 
ATOM   881  C C   . ALA A 1 121 ? 36.964 15.012  -7.074  1.00 42.87  ? 481  ALA A C   1 
ATOM   882  O O   . ALA A 1 121 ? 37.537 15.404  -6.025  1.00 42.55  ? 481  ALA A O   1 
ATOM   883  C CB  . ALA A 1 121 ? 36.966 16.596  -9.058  1.00 41.27  ? 481  ALA A CB  1 
ATOM   884  N N   . THR A 1 122 ? 35.816 14.325  -7.075  1.00 43.07  ? 482  THR A N   1 
ATOM   885  C CA  . THR A 1 122 ? 35.100 13.930  -5.830  1.00 43.45  ? 482  THR A CA  1 
ATOM   886  C C   . THR A 1 122 ? 35.908 12.968  -4.985  1.00 43.29  ? 482  THR A C   1 
ATOM   887  O O   . THR A 1 122 ? 35.936 13.079  -3.760  1.00 43.99  ? 482  THR A O   1 
ATOM   888  C CB  . THR A 1 122 ? 33.712 13.309  -6.152  1.00 43.64  ? 482  THR A CB  1 
ATOM   889  O OG1 . THR A 1 122 ? 32.916 14.305  -6.797  1.00 44.09  ? 482  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 122 ? 32.975 12.838  -4.887  1.00 44.24  ? 482  THR A CG2 1 
ATOM   891  N N   . PHE A 1 123 ? 36.577 12.029  -5.644  1.00 43.38  ? 483  PHE A N   1 
ATOM   892  C CA  . PHE A 1 123 ? 37.421 11.052  -4.965  1.00 43.05  ? 483  PHE A CA  1 
ATOM   893  C C   . PHE A 1 123 ? 38.665 11.727  -4.342  1.00 43.21  ? 483  PHE A C   1 
ATOM   894  O O   . PHE A 1 123 ? 38.997 11.461  -3.180  1.00 43.70  ? 483  PHE A O   1 
ATOM   895  C CB  . PHE A 1 123 ? 37.809 9.932   -5.943  1.00 42.27  ? 483  PHE A CB  1 
ATOM   896  C CG  . PHE A 1 123 ? 38.904 9.036   -5.440  1.00 43.11  ? 483  PHE A CG  1 
ATOM   897  C CD1 . PHE A 1 123 ? 38.598 7.835   -4.792  1.00 44.48  ? 483  PHE A CD1 1 
ATOM   898  C CD2 . PHE A 1 123 ? 40.254 9.378   -5.631  1.00 43.22  ? 483  PHE A CD2 1 
ATOM   899  C CE1 . PHE A 1 123 ? 39.612 6.986   -4.327  1.00 43.93  ? 483  PHE A CE1 1 
ATOM   900  C CE2 . PHE A 1 123 ? 41.274 8.536   -5.175  1.00 43.42  ? 483  PHE A CE2 1 
ATOM   901  C CZ  . PHE A 1 123 ? 40.953 7.351   -4.520  1.00 43.80  ? 483  PHE A CZ  1 
ATOM   902  N N   . TYR A 1 124 ? 39.357 12.570  -5.114  1.00 43.42  ? 484  TYR A N   1 
ATOM   903  C CA  . TYR A 1 124 ? 40.507 13.346  -4.576  1.00 43.36  ? 484  TYR A CA  1 
ATOM   904  C C   . TYR A 1 124 ? 40.094 14.236  -3.416  1.00 43.06  ? 484  TYR A C   1 
ATOM   905  O O   . TYR A 1 124 ? 40.759 14.246  -2.390  1.00 44.30  ? 484  TYR A O   1 
ATOM   906  C CB  . TYR A 1 124 ? 41.206 14.173  -5.664  1.00 43.25  ? 484  TYR A CB  1 
ATOM   907  C CG  . TYR A 1 124 ? 41.841 13.360  -6.777  1.00 41.95  ? 484  TYR A CG  1 
ATOM   908  C CD1 . TYR A 1 124 ? 42.439 12.126  -6.521  1.00 42.53  ? 484  TYR A CD1 1 
ATOM   909  C CD2 . TYR A 1 124 ? 41.893 13.862  -8.070  1.00 41.78  ? 484  TYR A CD2 1 
ATOM   910  C CE1 . TYR A 1 124 ? 43.011 11.378  -7.552  1.00 42.49  ? 484  TYR A CE1 1 
ATOM   911  C CE2 . TYR A 1 124 ? 42.458 13.156  -9.085  1.00 42.56  ? 484  TYR A CE2 1 
ATOM   912  C CZ  . TYR A 1 124 ? 43.023 11.900  -8.832  1.00 42.84  ? 484  TYR A CZ  1 
ATOM   913  O OH  . TYR A 1 124 ? 43.581 11.184  -9.894  1.00 43.25  ? 484  TYR A OH  1 
ATOM   914  N N   . ALA A 1 125 ? 38.986 14.953  -3.567  1.00 43.24  ? 485  ALA A N   1 
ATOM   915  C CA  . ALA A 1 125 ? 38.435 15.796  -2.497  1.00 43.07  ? 485  ALA A CA  1 
ATOM   916  C C   . ALA A 1 125 ? 38.186 15.013  -1.229  1.00 43.31  ? 485  ALA A C   1 
ATOM   917  O O   . ALA A 1 125 ? 38.528 15.480  -0.138  1.00 44.00  ? 485  ALA A O   1 
ATOM   918  C CB  . ALA A 1 125 ? 37.134 16.500  -2.958  1.00 42.57  ? 485  ALA A CB  1 
ATOM   919  N N   . ALA A 1 126 ? 37.603 13.822  -1.369  1.00 43.39  ? 486  ALA A N   1 
ATOM   920  C CA  . ALA A 1 126 ? 37.312 12.953  -0.228  1.00 43.57  ? 486  ALA A CA  1 
ATOM   921  C C   . ALA A 1 126 ? 38.550 12.424  0.513   1.00 43.97  ? 486  ALA A C   1 
ATOM   922  O O   . ALA A 1 126 ? 38.594 12.457  1.747   1.00 44.23  ? 486  ALA A O   1 
ATOM   923  C CB  . ALA A 1 126 ? 36.370 11.817  -0.641  1.00 43.25  ? 486  ALA A CB  1 
ATOM   924  N N   . GLU A 1 127 ? 39.556 11.967  -0.221  1.00 44.30  ? 487  GLU A N   1 
ATOM   925  C CA  . GLU A 1 127 ? 40.829 11.551  0.396   1.00 45.67  ? 487  GLU A CA  1 
ATOM   926  C C   . GLU A 1 127 ? 41.582 12.715  1.069   1.00 45.33  ? 487  GLU A C   1 
ATOM   927  O O   . GLU A 1 127 ? 42.194 12.542  2.123   1.00 45.60  ? 487  GLU A O   1 
ATOM   928  C CB  . GLU A 1 127 ? 41.748 10.841  -0.636  1.00 45.57  ? 487  GLU A CB  1 
ATOM   929  C CG  . GLU A 1 127 ? 41.123 9.594   -1.320  1.00 46.20  ? 487  GLU A CG  1 
ATOM   930  C CD  . GLU A 1 127 ? 42.151 8.517   -1.714  1.00 48.18  ? 487  GLU A CD  1 
ATOM   931  O OE1 . GLU A 1 127 ? 41.851 7.300   -1.546  1.00 51.51  ? 487  GLU A OE1 1 
ATOM   932  O OE2 . GLU A 1 127 ? 43.258 8.868   -2.182  1.00 52.74  ? 487  GLU A OE2 1 
ATOM   933  N N   . ILE A 1 128 ? 41.533 13.898  0.452   1.00 45.81  ? 488  ILE A N   1 
ATOM   934  C CA  . ILE A 1 128 ? 42.138 15.110  1.025   1.00 45.36  ? 488  ILE A CA  1 
ATOM   935  C C   . ILE A 1 128 ? 41.447 15.488  2.338   1.00 44.93  ? 488  ILE A C   1 
ATOM   936  O O   . ILE A 1 128 ? 42.114 15.738  3.347   1.00 45.89  ? 488  ILE A O   1 
ATOM   937  C CB  . ILE A 1 128 ? 42.153 16.283  0.000   1.00 45.68  ? 488  ILE A CB  1 
ATOM   938  C CG1 . ILE A 1 128 ? 43.153 15.976  -1.135  1.00 45.23  ? 488  ILE A CG1 1 
ATOM   939  C CG2 . ILE A 1 128 ? 42.517 17.605  0.701   1.00 46.48  ? 488  ILE A CG2 1 
ATOM   940  C CD1 . ILE A 1 128 ? 43.015 16.872  -2.409  1.00 44.73  ? 488  ILE A CD1 1 
ATOM   941  N N   . ILE A 1 129 ? 40.119 15.472  2.344   1.00 44.84  ? 489  ILE A N   1 
ATOM   942  C CA  . ILE A 1 129 ? 39.338 15.598  3.590   1.00 45.02  ? 489  ILE A CA  1 
ATOM   943  C C   . ILE A 1 129 ? 39.827 14.679  4.717   1.00 45.61  ? 489  ILE A C   1 
ATOM   944  O O   . ILE A 1 129 ? 40.036 15.139  5.832   1.00 46.01  ? 489  ILE A O   1 
ATOM   945  C CB  . ILE A 1 129 ? 37.818 15.416  3.350   1.00 44.57  ? 489  ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 129 ? 37.237 16.686  2.730   1.00 43.29  ? 489  ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 129 ? 37.083 15.108  4.656   1.00 44.61  ? 489  ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 129 ? 35.954 16.466  1.977   1.00 41.58  ? 489  ILE A CD1 1 
ATOM   949  N N   . LEU A 1 130 ? 40.037 13.395  4.415   1.00 46.39  ? 490  LEU A N   1 
ATOM   950  C CA  . LEU A 1 130 ? 40.561 12.434  5.397   1.00 46.84  ? 490  LEU A CA  1 
ATOM   951  C C   . LEU A 1 130 ? 41.971 12.777  5.872   1.00 47.02  ? 490  LEU A C   1 
ATOM   952  O O   . LEU A 1 130 ? 42.281 12.626  7.049   1.00 47.10  ? 490  LEU A O   1 
ATOM   953  C CB  . LEU A 1 130 ? 40.557 11.010  4.830   1.00 46.70  ? 490  LEU A CB  1 
ATOM   954  C CG  . LEU A 1 130 ? 39.202 10.355  4.566   1.00 47.59  ? 490  LEU A CG  1 
ATOM   955  C CD1 . LEU A 1 130 ? 39.418 9.067   3.793   1.00 48.25  ? 490  LEU A CD1 1 
ATOM   956  C CD2 . LEU A 1 130 ? 38.421 10.094  5.862   1.00 47.15  ? 490  LEU A CD2 1 
ATOM   957  N N   . GLY A 1 131 ? 42.824 13.214  4.945   1.00 47.18  ? 491  GLY A N   1 
ATOM   958  C CA  . GLY A 1 131 ? 44.190 13.616  5.286   1.00 46.96  ? 491  GLY A CA  1 
ATOM   959  C C   . GLY A 1 131 ? 44.209 14.863  6.148   1.00 46.45  ? 491  GLY A C   1 
ATOM   960  O O   . GLY A 1 131 ? 44.937 14.897  7.127   1.00 46.35  ? 491  GLY A O   1 
ATOM   961  N N   . LEU A 1 132 ? 43.401 15.874  5.787   1.00 46.19  ? 492  LEU A N   1 
ATOM   962  C CA  . LEU A 1 132 ? 43.313 17.137  6.550   1.00 45.84  ? 492  LEU A CA  1 
ATOM   963  C C   . LEU A 1 132 ? 42.705 16.954  7.920   1.00 45.76  ? 492  LEU A C   1 
ATOM   964  O O   . LEU A 1 132 ? 43.209 17.495  8.909   1.00 46.07  ? 492  LEU A O   1 
ATOM   965  C CB  . LEU A 1 132 ? 42.488 18.200  5.807   1.00 45.80  ? 492  LEU A CB  1 
ATOM   966  C CG  . LEU A 1 132 ? 43.019 18.953  4.594   1.00 46.52  ? 492  LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 132 ? 41.877 19.797  4.021   1.00 46.14  ? 492  LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 132 ? 44.259 19.828  4.915   1.00 45.95  ? 492  LEU A CD2 1 
ATOM   969  N N   . GLN A 1 133 ? 41.607 16.205  7.987   1.00 45.83  ? 493  GLN A N   1 
ATOM   970  C CA  . GLN A 1 133 ? 40.963 15.921  9.280   1.00 46.10  ? 493  GLN A CA  1 
ATOM   971  C C   . GLN A 1 133 ? 41.869 15.134  10.220  1.00 45.98  ? 493  GLN A C   1 
ATOM   972  O O   . GLN A 1 133 ? 41.782 15.293  11.435  1.00 46.26  ? 493  GLN A O   1 
ATOM   973  C CB  . GLN A 1 133 ? 39.619 15.228  9.091   1.00 45.85  ? 493  GLN A CB  1 
ATOM   974  C CG  . GLN A 1 133 ? 38.593 16.128  8.407   1.00 47.58  ? 493  GLN A CG  1 
ATOM   975  C CD  . GLN A 1 133 ? 37.181 15.564  8.434   1.00 48.51  ? 493  GLN A CD  1 
ATOM   976  O OE1 . GLN A 1 133 ? 36.969 14.352  8.305   1.00 48.58  ? 493  GLN A OE1 1 
ATOM   977  N NE2 . GLN A 1 133 ? 36.207 16.446  8.608   1.00 48.73  ? 493  GLN A NE2 1 
ATOM   978  N N   . PHE A 1 134 ? 42.745 14.296  9.665   1.00 46.15  ? 494  PHE A N   1 
ATOM   979  C CA  . PHE A 1 134 ? 43.733 13.593  10.485  1.00 46.66  ? 494  PHE A CA  1 
ATOM   980  C C   . PHE A 1 134 ? 44.764 14.551  11.090  1.00 46.84  ? 494  PHE A C   1 
ATOM   981  O O   . PHE A 1 134 ? 45.115 14.430  12.254  1.00 47.52  ? 494  PHE A O   1 
ATOM   982  C CB  . PHE A 1 134 ? 44.464 12.512  9.696   1.00 46.24  ? 494  PHE A CB  1 
ATOM   983  C CG  . PHE A 1 134 ? 45.663 11.979  10.415  1.00 47.31  ? 494  PHE A CG  1 
ATOM   984  C CD1 . PHE A 1 134 ? 45.535 10.949  11.336  1.00 47.01  ? 494  PHE A CD1 1 
ATOM   985  C CD2 . PHE A 1 134 ? 46.926 12.531  10.197  1.00 47.68  ? 494  PHE A CD2 1 
ATOM   986  C CE1 . PHE A 1 134 ? 46.647 10.459  12.021  1.00 46.77  ? 494  PHE A CE1 1 
ATOM   987  C CE2 . PHE A 1 134 ? 48.038 12.048  10.880  1.00 48.74  ? 494  PHE A CE2 1 
ATOM   988  C CZ  . PHE A 1 134 ? 47.893 11.009  11.790  1.00 46.81  ? 494  PHE A CZ  1 
ATOM   989  N N   . LEU A 1 135 ? 45.258 15.479  10.273  1.00 46.97  ? 495  LEU A N   1 
ATOM   990  C CA  . LEU A 1 135 ? 46.208 16.495  10.710  1.00 46.66  ? 495  LEU A CA  1 
ATOM   991  C C   . LEU A 1 135 ? 45.608 17.424  11.749  1.00 46.13  ? 495  LEU A C   1 
ATOM   992  O O   . LEU A 1 135 ? 46.280 17.764  12.722  1.00 46.04  ? 495  LEU A O   1 
ATOM   993  C CB  . LEU A 1 135 ? 46.693 17.321  9.514   1.00 46.86  ? 495  LEU A CB  1 
ATOM   994  C CG  . LEU A 1 135 ? 47.591 16.609  8.509   1.00 47.60  ? 495  LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 135 ? 47.747 17.497  7.271   1.00 47.26  ? 495  LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 135 ? 48.949 16.281  9.148   1.00 46.98  ? 495  LEU A CD2 1 
ATOM   997  N N   . HIS A 1 136 ? 44.353 17.833  11.545  1.00 45.56  ? 496  HIS A N   1 
ATOM   998  C CA  . HIS A 1 136 ? 43.678 18.714  12.516  1.00 45.42  ? 496  HIS A CA  1 
ATOM   999  C C   . HIS A 1 136 ? 43.430 18.029  13.855  1.00 45.53  ? 496  HIS A C   1 
ATOM   1000 O O   . HIS A 1 136 ? 43.503 18.678  14.903  1.00 46.53  ? 496  HIS A O   1 
ATOM   1001 C CB  . HIS A 1 136 ? 42.366 19.316  11.974  1.00 45.18  ? 496  HIS A CB  1 
ATOM   1002 C CG  . HIS A 1 136 ? 42.527 20.124  10.721  1.00 43.73  ? 496  HIS A CG  1 
ATOM   1003 N ND1 . HIS A 1 136 ? 41.516 20.263  9.793   1.00 43.47  ? 496  HIS A ND1 1 
ATOM   1004 C CD2 . HIS A 1 136 ? 43.582 20.814  10.230  1.00 43.27  ? 496  HIS A CD2 1 
ATOM   1005 C CE1 . HIS A 1 136 ? 41.936 21.018  8.795   1.00 42.63  ? 496  HIS A CE1 1 
ATOM   1006 N NE2 . HIS A 1 136 ? 43.190 21.361  9.031   1.00 43.26  ? 496  HIS A NE2 1 
ATOM   1007 N N   . SER A 1 137 ? 43.149 16.726  13.833  1.00 45.25  ? 497  SER A N   1 
ATOM   1008 C CA  . SER A 1 137 ? 43.001 15.951  15.089  1.00 45.45  ? 497  SER A CA  1 
ATOM   1009 C C   . SER A 1 137 ? 44.296 15.863  15.925  1.00 45.46  ? 497  SER A C   1 
ATOM   1010 O O   . SER A 1 137 ? 44.238 15.642  17.120  1.00 45.28  ? 497  SER A O   1 
ATOM   1011 C CB  . SER A 1 137 ? 42.492 14.540  14.800  1.00 45.04  ? 497  SER A CB  1 
ATOM   1012 O OG  . SER A 1 137 ? 43.512 13.775  14.192  1.00 44.84  ? 497  SER A OG  1 
ATOM   1013 N N   . LYS A 1 138 ? 45.448 16.034  15.272  1.00 46.07  ? 498  LYS A N   1 
ATOM   1014 C CA  . LYS A 1 138 ? 46.765 16.037  15.920  1.00 46.45  ? 498  LYS A CA  1 
ATOM   1015 C C   . LYS A 1 138 ? 47.183 17.459  16.295  1.00 46.73  ? 498  LYS A C   1 
ATOM   1016 O O   . LYS A 1 138 ? 48.271 17.674  16.840  1.00 46.87  ? 498  LYS A O   1 
ATOM   1017 C CB  . LYS A 1 138 ? 47.828 15.440  14.981  1.00 46.71  ? 498  LYS A CB  1 
ATOM   1018 C CG  . LYS A 1 138 ? 47.595 13.989  14.549  1.00 46.83  ? 498  LYS A CG  1 
ATOM   1019 C CD  . LYS A 1 138 ? 47.907 13.044  15.682  1.00 47.16  ? 498  LYS A CD  1 
ATOM   1020 C CE  . LYS A 1 138 ? 47.478 11.630  15.362  1.00 47.75  ? 498  LYS A CE  1 
ATOM   1021 N NZ  . LYS A 1 138 ? 47.893 10.694  16.460  1.00 48.52  ? 498  LYS A NZ  1 
ATOM   1022 N N   . GLY A 1 139 ? 46.326 18.427  15.975  1.00 46.96  ? 499  GLY A N   1 
ATOM   1023 C CA  . GLY A 1 139 ? 46.557 19.821  16.330  1.00 47.21  ? 499  GLY A CA  1 
ATOM   1024 C C   . GLY A 1 139 ? 47.439 20.528  15.330  1.00 47.44  ? 499  GLY A C   1 
ATOM   1025 O O   . GLY A 1 139 ? 48.135 21.489  15.677  1.00 47.72  ? 499  GLY A O   1 
ATOM   1026 N N   . ILE A 1 140 ? 47.401 20.054  14.088  1.00 47.43  ? 500  ILE A N   1 
ATOM   1027 C CA  . ILE A 1 140 ? 48.231 20.587  13.008  1.00 47.60  ? 500  ILE A CA  1 
ATOM   1028 C C   . ILE A 1 140 ? 47.373 21.329  11.985  1.00 47.29  ? 500  ILE A C   1 
ATOM   1029 O O   . ILE A 1 140 ? 46.420 20.772  11.438  1.00 47.51  ? 500  ILE A O   1 
ATOM   1030 C CB  . ILE A 1 140 ? 49.094 19.460  12.315  1.00 47.39  ? 500  ILE A CB  1 
ATOM   1031 C CG1 . ILE A 1 140 ? 50.074 18.833  13.311  1.00 48.08  ? 500  ILE A CG1 1 
ATOM   1032 C CG2 . ILE A 1 140 ? 49.870 20.008  11.118  1.00 47.77  ? 500  ILE A CG2 1 
ATOM   1033 C CD1 . ILE A 1 140 ? 50.507 17.409  12.960  1.00 48.14  ? 500  ILE A CD1 1 
ATOM   1034 N N   . VAL A 1 141 ? 47.699 22.597  11.757  1.00 47.04  ? 501  VAL A N   1 
ATOM   1035 C CA  . VAL A 1 141 ? 47.158 23.340  10.626  1.00 47.04  ? 501  VAL A CA  1 
ATOM   1036 C C   . VAL A 1 141 ? 48.232 23.285  9.538   1.00 47.32  ? 501  VAL A C   1 
ATOM   1037 O O   . VAL A 1 141 ? 49.396 23.587  9.790   1.00 47.43  ? 501  VAL A O   1 
ATOM   1038 C CB  . VAL A 1 141 ? 46.807 24.803  10.994  1.00 46.81  ? 501  VAL A CB  1 
ATOM   1039 C CG1 . VAL A 1 141 ? 46.099 25.484  9.861   1.00 46.37  ? 501  VAL A CG1 1 
ATOM   1040 C CG2 . VAL A 1 141 ? 45.926 24.841  12.223  1.00 47.14  ? 501  VAL A CG2 1 
ATOM   1041 N N   . TYR A 1 142 ? 47.820 22.891  8.339   1.00 47.83  ? 502  TYR A N   1 
ATOM   1042 C CA  . TYR A 1 142 ? 48.720 22.563  7.240   1.00 48.23  ? 502  TYR A CA  1 
ATOM   1043 C C   . TYR A 1 142 ? 49.197 23.822  6.466   1.00 48.43  ? 502  TYR A C   1 
ATOM   1044 O O   . TYR A 1 142 ? 50.399 23.981  6.192   1.00 48.29  ? 502  TYR A O   1 
ATOM   1045 C CB  . TYR A 1 142 ? 48.038 21.516  6.333   1.00 48.12  ? 502  TYR A CB  1 
ATOM   1046 C CG  . TYR A 1 142 ? 48.817 21.147  5.092   1.00 48.42  ? 502  TYR A CG  1 
ATOM   1047 C CD1 . TYR A 1 142 ? 50.073 20.545  5.179   1.00 48.32  ? 502  TYR A CD1 1 
ATOM   1048 C CD2 . TYR A 1 142 ? 48.299 21.388  3.834   1.00 48.87  ? 502  TYR A CD2 1 
ATOM   1049 C CE1 . TYR A 1 142 ? 50.795 20.213  4.047   1.00 46.84  ? 502  TYR A CE1 1 
ATOM   1050 C CE2 . TYR A 1 142 ? 49.018 21.060  2.691   1.00 50.05  ? 502  TYR A CE2 1 
ATOM   1051 C CZ  . TYR A 1 142 ? 50.268 20.476  2.808   1.00 49.35  ? 502  TYR A CZ  1 
ATOM   1052 O OH  . TYR A 1 142 ? 50.971 20.151  1.667   1.00 50.27  ? 502  TYR A OH  1 
ATOM   1053 N N   . ARG A 1 143 ? 48.246 24.699  6.136   1.00 48.41  ? 503  ARG A N   1 
ATOM   1054 C CA  . ARG A 1 143 ? 48.489 26.053  5.585   1.00 48.88  ? 503  ARG A CA  1 
ATOM   1055 C C   . ARG A 1 143 ? 49.054 26.160  4.163   1.00 49.50  ? 503  ARG A C   1 
ATOM   1056 O O   . ARG A 1 143 ? 49.124 27.248  3.620   1.00 50.26  ? 503  ARG A O   1 
ATOM   1057 C CB  . ARG A 1 143 ? 49.330 26.906  6.550   1.00 48.38  ? 503  ARG A CB  1 
ATOM   1058 C CG  . ARG A 1 143 ? 48.655 27.196  7.886   1.00 47.59  ? 503  ARG A CG  1 
ATOM   1059 C CD  . ARG A 1 143 ? 49.353 28.321  8.620   1.00 46.82  ? 503  ARG A CD  1 
ATOM   1060 N NE  . ARG A 1 143 ? 50.666 27.920  9.100   1.00 44.38  ? 503  ARG A NE  1 
ATOM   1061 C CZ  . ARG A 1 143 ? 51.428 28.633  9.928   1.00 46.23  ? 503  ARG A CZ  1 
ATOM   1062 N NH1 . ARG A 1 143 ? 51.013 29.809  10.388  1.00 45.44  ? 503  ARG A NH1 1 
ATOM   1063 N NH2 . ARG A 1 143 ? 52.616 28.160  10.303  1.00 44.90  ? 503  ARG A NH2 1 
ATOM   1064 N N   . ASP A 1 144 ? 49.462 25.055  3.555   1.00 50.79  ? 504  ASP A N   1 
ATOM   1065 C CA  . ASP A 1 144 ? 50.030 25.104  2.202   1.00 51.35  ? 504  ASP A CA  1 
ATOM   1066 C C   . ASP A 1 144 ? 49.291 24.187  1.228   1.00 51.16  ? 504  ASP A C   1 
ATOM   1067 O O   . ASP A 1 144 ? 49.878 23.675  0.264   1.00 51.39  ? 504  ASP A O   1 
ATOM   1068 C CB  . ASP A 1 144 ? 51.531 24.774  2.223   1.00 52.04  ? 504  ASP A CB  1 
ATOM   1069 C CG  . ASP A 1 144 ? 52.269 25.264  0.959   1.00 55.09  ? 504  ASP A CG  1 
ATOM   1070 O OD1 . ASP A 1 144 ? 51.722 26.141  0.225   1.00 57.01  ? 504  ASP A OD1 1 
ATOM   1071 O OD2 . ASP A 1 144 ? 53.393 24.753  0.708   1.00 55.93  ? 504  ASP A OD2 1 
ATOM   1072 N N   . LEU A 1 145 ? 47.996 23.991  1.464   1.00 50.90  ? 505  LEU A N   1 
ATOM   1073 C CA  . LEU A 1 145 ? 47.199 23.143  0.576   1.00 50.60  ? 505  LEU A CA  1 
ATOM   1074 C C   . LEU A 1 145 ? 47.118 23.735  -0.818  1.00 50.39  ? 505  LEU A C   1 
ATOM   1075 O O   . LEU A 1 145 ? 46.778 24.901  -0.992  1.00 50.56  ? 505  LEU A O   1 
ATOM   1076 C CB  . LEU A 1 145 ? 45.821 22.849  1.163   1.00 50.52  ? 505  LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 145 ? 44.994 21.782  0.452   1.00 52.05  ? 505  LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 145 ? 45.615 20.379  0.593   1.00 52.67  ? 505  LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 145 ? 43.574 21.796  1.017   1.00 53.36  ? 505  LEU A CD2 1 
ATOM   1080 N N   . LYS A 1 146 ? 47.504 22.921  -1.797  1.00 49.94  ? 506  LYS A N   1 
ATOM   1081 C CA  . LYS A 1 146 ? 47.545 23.299  -3.189  1.00 49.77  ? 506  LYS A CA  1 
ATOM   1082 C C   . LYS A 1 146 ? 47.753 22.062  -4.073  1.00 49.72  ? 506  LYS A C   1 
ATOM   1083 O O   . LYS A 1 146 ? 48.340 21.076  -3.609  1.00 50.10  ? 506  LYS A O   1 
ATOM   1084 C CB  . LYS A 1 146 ? 48.627 24.364  -3.438  1.00 49.93  ? 506  LYS A CB  1 
ATOM   1085 C CG  . LYS A 1 146 ? 50.040 23.952  -3.159  1.00 49.33  ? 506  LYS A CG  1 
ATOM   1086 C CD  . LYS A 1 146 ? 50.962 25.052  -3.581  1.00 51.29  ? 506  LYS A CD  1 
ATOM   1087 C CE  . LYS A 1 146 ? 52.380 24.761  -3.178  1.00 54.93  ? 506  LYS A CE  1 
ATOM   1088 N NZ  . LYS A 1 146 ? 53.298 25.746  -3.805  1.00 57.89  ? 506  LYS A NZ  1 
ATOM   1089 N N   . LEU A 1 147 ? 47.292 22.124  -5.329  1.00 48.90  ? 507  LEU A N   1 
ATOM   1090 C CA  . LEU A 1 147 ? 47.371 20.983  -6.257  1.00 49.58  ? 507  LEU A CA  1 
ATOM   1091 C C   . LEU A 1 147 ? 48.784 20.418  -6.494  1.00 49.86  ? 507  LEU A C   1 
ATOM   1092 O O   . LEU A 1 147 ? 48.911 19.233  -6.759  1.00 50.27  ? 507  LEU A O   1 
ATOM   1093 C CB  . LEU A 1 147 ? 46.696 21.279  -7.612  1.00 49.54  ? 507  LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 147 ? 45.169 21.242  -7.754  1.00 50.60  ? 507  LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 147 ? 44.757 21.718  -9.144  1.00 52.92  ? 507  LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 147 ? 44.601 19.870  -7.460  1.00 50.65  ? 507  LEU A CD2 1 
ATOM   1097 N N   . ASP A 1 148 ? 49.814 21.265  -6.404  1.00 49.77  ? 508  ASP A N   1 
ATOM   1098 C CA  . ASP A 1 148 ? 51.211 20.847  -6.522  1.00 50.42  ? 508  ASP A CA  1 
ATOM   1099 C C   . ASP A 1 148 ? 51.655 19.967  -5.348  1.00 48.85  ? 508  ASP A C   1 
ATOM   1100 O O   . ASP A 1 148 ? 52.570 19.178  -5.494  1.00 48.86  ? 508  ASP A O   1 
ATOM   1101 C CB  . ASP A 1 148 ? 52.193 22.040  -6.566  1.00 51.58  ? 508  ASP A CB  1 
ATOM   1102 C CG  . ASP A 1 148 ? 51.701 23.199  -7.364  1.00 57.04  ? 508  ASP A CG  1 
ATOM   1103 O OD1 . ASP A 1 148 ? 52.493 23.642  -8.232  1.00 63.56  ? 508  ASP A OD1 1 
ATOM   1104 O OD2 . ASP A 1 148 ? 50.559 23.710  -7.127  1.00 63.85  ? 508  ASP A OD2 1 
ATOM   1105 N N   . ASN A 1 149 ? 51.031 20.130  -4.183  1.00 47.58  ? 509  ASN A N   1 
ATOM   1106 C CA  . ASN A 1 149 ? 51.406 19.360  -3.003  1.00 45.72  ? 509  ASN A CA  1 
ATOM   1107 C C   . ASN A 1 149 ? 50.665 18.036  -2.833  1.00 45.26  ? 509  ASN A C   1 
ATOM   1108 O O   . ASN A 1 149 ? 50.865 17.316  -1.841  1.00 44.04  ? 509  ASN A O   1 
ATOM   1109 C CB  . ASN A 1 149 ? 51.265 20.205  -1.745  1.00 46.10  ? 509  ASN A CB  1 
ATOM   1110 C CG  . ASN A 1 149 ? 52.399 21.206  -1.576  1.00 44.35  ? 509  ASN A CG  1 
ATOM   1111 O OD1 . ASN A 1 149 ? 53.330 21.242  -2.361  1.00 45.29  ? 509  ASN A OD1 1 
ATOM   1112 N ND2 . ASN A 1 149 ? 52.317 22.013  -0.537  1.00 43.90  ? 509  ASN A ND2 1 
ATOM   1113 N N   . ILE A 1 150 ? 49.846 17.695  -3.819  1.00 44.91  ? 510  ILE A N   1 
ATOM   1114 C CA  . ILE A 1 150 ? 49.123 16.427  -3.788  1.00 44.80  ? 510  ILE A CA  1 
ATOM   1115 C C   . ILE A 1 150 ? 49.726 15.489  -4.807  1.00 44.77  ? 510  ILE A C   1 
ATOM   1116 O O   . ILE A 1 150 ? 49.604 15.698  -6.009  1.00 44.69  ? 510  ILE A O   1 
ATOM   1117 C CB  . ILE A 1 150 ? 47.587 16.557  -4.031  1.00 45.00  ? 510  ILE A CB  1 
ATOM   1118 C CG1 . ILE A 1 150 ? 46.969 17.747  -3.259  1.00 45.04  ? 510  ILE A CG1 1 
ATOM   1119 C CG2 . ILE A 1 150 ? 46.887 15.237  -3.635  1.00 44.06  ? 510  ILE A CG2 1 
ATOM   1120 C CD1 . ILE A 1 150 ? 46.988 17.561  -1.715  1.00 44.09  ? 510  ILE A CD1 1 
ATOM   1121 N N   . LEU A 1 151 ? 50.397 14.456  -4.306  1.00 45.25  ? 511  LEU A N   1 
ATOM   1122 C CA  . LEU A 1 151 ? 50.999 13.423  -5.157  1.00 45.36  ? 511  LEU A CA  1 
ATOM   1123 C C   . LEU A 1 151 ? 50.074 12.205  -5.292  1.00 45.34  ? 511  LEU A C   1 
ATOM   1124 O O   . LEU A 1 151 ? 49.208 11.968  -4.443  1.00 45.12  ? 511  LEU A O   1 
ATOM   1125 C CB  . LEU A 1 151 ? 52.358 13.000  -4.580  1.00 44.81  ? 511  LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 151 ? 53.656 13.813  -4.831  1.00 46.33  ? 511  LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 151 ? 53.401 15.267  -4.993  1.00 47.22  ? 511  LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 151 ? 54.637 13.580  -3.674  1.00 45.03  ? 511  LEU A CD2 1 
ATOM   1129 N N   . LEU A 1 152 ? 50.266 11.440  -6.364  1.00 45.47  ? 512  LEU A N   1 
ATOM   1130 C CA  . LEU A 1 152 ? 49.614 10.150  -6.528  1.00 45.11  ? 512  LEU A CA  1 
ATOM   1131 C C   . LEU A 1 152 ? 50.572 9.022   -6.222  1.00 45.37  ? 512  LEU A C   1 
ATOM   1132 O O   . LEU A 1 152 ? 51.711 9.040   -6.690  1.00 44.31  ? 512  LEU A O   1 
ATOM   1133 C CB  . LEU A 1 152 ? 49.098 9.994   -7.953  1.00 45.48  ? 512  LEU A CB  1 
ATOM   1134 C CG  . LEU A 1 152 ? 48.013 10.996  -8.354  1.00 45.23  ? 512  LEU A CG  1 
ATOM   1135 C CD1 . LEU A 1 152 ? 47.588 10.721  -9.769  1.00 44.25  ? 512  LEU A CD1 1 
ATOM   1136 C CD2 . LEU A 1 152 ? 46.844 10.923  -7.371  1.00 43.78  ? 512  LEU A CD2 1 
ATOM   1137 N N   . ASP A 1 153 ? 50.114 8.044   -5.431  1.00 45.48  ? 513  ASP A N   1 
ATOM   1138 C CA  . ASP A 1 153 ? 50.868 6.807   -5.270  1.00 45.59  ? 513  ASP A CA  1 
ATOM   1139 C C   . ASP A 1 153 ? 50.638 5.919   -6.500  1.00 45.23  ? 513  ASP A C   1 
ATOM   1140 O O   . ASP A 1 153 ? 49.907 6.298   -7.417  1.00 43.95  ? 513  ASP A O   1 
ATOM   1141 C CB  . ASP A 1 153 ? 50.617 6.112   -3.910  1.00 45.35  ? 513  ASP A CB  1 
ATOM   1142 C CG  . ASP A 1 153 ? 49.285 5.348   -3.838  1.00 48.96  ? 513  ASP A CG  1 
ATOM   1143 O OD1 . ASP A 1 153 ? 48.612 5.141   -4.881  1.00 51.56  ? 513  ASP A OD1 1 
ATOM   1144 O OD2 . ASP A 1 153 ? 48.904 4.930   -2.706  1.00 51.54  ? 513  ASP A OD2 1 
ATOM   1145 N N   . LYS A 1 154 ? 51.285 4.756   -6.535  1.00 45.34  ? 514  LYS A N   1 
ATOM   1146 C CA  . LYS A 1 154 ? 51.279 3.923   -7.746  1.00 45.78  ? 514  LYS A CA  1 
ATOM   1147 C C   . LYS A 1 154 ? 49.875 3.391   -8.138  1.00 45.32  ? 514  LYS A C   1 
ATOM   1148 O O   . LYS A 1 154 ? 49.645 3.056   -9.303  1.00 45.28  ? 514  LYS A O   1 
ATOM   1149 C CB  . LYS A 1 154 ? 52.289 2.778   -7.596  1.00 46.46  ? 514  LYS A CB  1 
ATOM   1150 C CG  . LYS A 1 154 ? 51.889 1.779   -6.560  1.00 47.38  ? 514  LYS A CG  1 
ATOM   1151 C CD  . LYS A 1 154 ? 52.872 0.643   -6.505  1.00 53.78  ? 514  LYS A CD  1 
ATOM   1152 C CE  . LYS A 1 154 ? 52.313 -0.456  -5.642  1.00 55.46  ? 514  LYS A CE  1 
ATOM   1153 N NZ  . LYS A 1 154 ? 52.869 -1.756  -6.103  1.00 62.56  ? 514  LYS A NZ  1 
ATOM   1154 N N   . ASP A 1 155 ? 48.960 3.334   -7.168  1.00 44.95  ? 515  ASP A N   1 
ATOM   1155 C CA  . ASP A 1 155 ? 47.574 2.903   -7.373  1.00 45.68  ? 515  ASP A CA  1 
ATOM   1156 C C   . ASP A 1 155 ? 46.583 4.033   -7.668  1.00 46.01  ? 515  ASP A C   1 
ATOM   1157 O O   . ASP A 1 155 ? 45.465 3.759   -8.100  1.00 46.12  ? 515  ASP A O   1 
ATOM   1158 C CB  . ASP A 1 155 ? 47.065 2.148   -6.145  1.00 46.06  ? 515  ASP A CB  1 
ATOM   1159 C CG  . ASP A 1 155 ? 47.829 0.878   -5.889  1.00 48.43  ? 515  ASP A CG  1 
ATOM   1160 O OD1 . ASP A 1 155 ? 48.172 0.167   -6.864  1.00 51.53  ? 515  ASP A OD1 1 
ATOM   1161 O OD2 . ASP A 1 155 ? 48.099 0.590   -4.703  1.00 52.04  ? 515  ASP A OD2 1 
ATOM   1162 N N   . GLY A 1 156 ? 46.987 5.279   -7.398  1.00 45.74  ? 516  GLY A N   1 
ATOM   1163 C CA  . GLY A 1 156 ? 46.202 6.463   -7.696  1.00 45.89  ? 516  GLY A CA  1 
ATOM   1164 C C   . GLY A 1 156 ? 45.533 7.085   -6.476  1.00 46.39  ? 516  GLY A C   1 
ATOM   1165 O O   . GLY A 1 156 ? 44.657 7.928   -6.618  1.00 46.63  ? 516  GLY A O   1 
ATOM   1166 N N   . HIS A 1 157 ? 45.903 6.632   -5.283  1.00 46.70  ? 517  HIS A N   1 
ATOM   1167 C CA  . HIS A 1 157 ? 45.488 7.286   -4.041  1.00 47.12  ? 517  HIS A CA  1 
ATOM   1168 C C   . HIS A 1 157 ? 46.375 8.496   -3.788  1.00 47.25  ? 517  HIS A C   1 
ATOM   1169 O O   . HIS A 1 157 ? 47.525 8.525   -4.238  1.00 47.33  ? 517  HIS A O   1 
ATOM   1170 C CB  . HIS A 1 157 ? 45.575 6.330   -2.852  1.00 46.67  ? 517  HIS A CB  1 
ATOM   1171 C CG  . HIS A 1 157 ? 44.685 5.135   -2.965  1.00 46.43  ? 517  HIS A CG  1 
ATOM   1172 N ND1 . HIS A 1 157 ? 43.327 5.193   -2.732  1.00 46.88  ? 517  HIS A ND1 1 
ATOM   1173 C CD2 . HIS A 1 157 ? 44.963 3.841   -3.263  1.00 45.16  ? 517  HIS A CD2 1 
ATOM   1174 C CE1 . HIS A 1 157 ? 42.806 3.989   -2.893  1.00 45.94  ? 517  HIS A CE1 1 
ATOM   1175 N NE2 . HIS A 1 157 ? 43.777 3.154   -3.222  1.00 44.39  ? 517  HIS A NE2 1 
ATOM   1176 N N   . ILE A 1 158 ? 45.846 9.499   -3.087  1.00 47.83  ? 518  ILE A N   1 
ATOM   1177 C CA  . ILE A 1 158 ? 46.572 10.767  -2.921  1.00 47.49  ? 518  ILE A CA  1 
ATOM   1178 C C   . ILE A 1 158 ? 47.604 10.695  -1.823  1.00 47.62  ? 518  ILE A C   1 
ATOM   1179 O O   . ILE A 1 158 ? 47.469 9.910   -0.889  1.00 46.99  ? 518  ILE A O   1 
ATOM   1180 C CB  . ILE A 1 158 ? 45.641 12.005  -2.609  1.00 48.05  ? 518  ILE A CB  1 
ATOM   1181 C CG1 . ILE A 1 158 ? 45.020 11.899  -1.214  1.00 48.36  ? 518  ILE A CG1 1 
ATOM   1182 C CG2 . ILE A 1 158 ? 44.625 12.232  -3.695  1.00 46.02  ? 518  ILE A CG2 1 
ATOM   1183 C CD1 . ILE A 1 158 ? 45.271 13.094  -0.355  1.00 46.93  ? 518  ILE A CD1 1 
ATOM   1184 N N   . LYS A 1 159 ? 48.626 11.552  -1.929  1.00 48.13  ? 519  LYS A N   1 
ATOM   1185 C CA  . LYS A 1 159 ? 49.571 11.762  -0.845  1.00 47.78  ? 519  LYS A CA  1 
ATOM   1186 C C   . LYS A 1 159 ? 49.816 13.256  -0.669  1.00 47.90  ? 519  LYS A C   1 
ATOM   1187 O O   . LYS A 1 159 ? 50.387 13.889  -1.546  1.00 48.18  ? 519  LYS A O   1 
ATOM   1188 C CB  . LYS A 1 159 ? 50.896 11.062  -1.162  1.00 47.88  ? 519  LYS A CB  1 
ATOM   1189 C CG  . LYS A 1 159 ? 50.819 9.560   -1.126  1.00 47.86  ? 519  LYS A CG  1 
ATOM   1190 C CD  . LYS A 1 159 ? 51.219 9.041   0.212   1.00 45.99  ? 519  LYS A CD  1 
ATOM   1191 C CE  . LYS A 1 159 ? 51.069 7.527   0.294   1.00 43.56  ? 519  LYS A CE  1 
ATOM   1192 N NZ  . LYS A 1 159 ? 51.416 7.135   1.671   1.00 42.99  ? 519  LYS A NZ  1 
ATOM   1193 N N   . ILE A 1 160 ? 49.393 13.815  0.461   1.00 47.78  ? 520  ILE A N   1 
ATOM   1194 C CA  . ILE A 1 160 ? 49.734 15.199  0.811   1.00 47.29  ? 520  ILE A CA  1 
ATOM   1195 C C   . ILE A 1 160 ? 51.236 15.283  1.170   1.00 47.15  ? 520  ILE A C   1 
ATOM   1196 O O   . ILE A 1 160 ? 51.711 14.577  2.067   1.00 46.69  ? 520  ILE A O   1 
ATOM   1197 C CB  . ILE A 1 160 ? 48.857 15.722  1.970   1.00 47.15  ? 520  ILE A CB  1 
ATOM   1198 C CG1 . ILE A 1 160 ? 47.371 15.631  1.602   1.00 48.12  ? 520  ILE A CG1 1 
ATOM   1199 C CG2 . ILE A 1 160 ? 49.205 17.175  2.311   1.00 46.97  ? 520  ILE A CG2 1 
ATOM   1200 C CD1 . ILE A 1 160 ? 46.414 15.601  2.828   1.00 47.43  ? 520  ILE A CD1 1 
ATOM   1201 N N   . ALA A 1 161 ? 51.965 16.132  0.443   1.00 46.73  ? 521  ALA A N   1 
ATOM   1202 C CA  . ALA A 1 161 ? 53.409 16.358  0.631   1.00 46.61  ? 521  ALA A CA  1 
ATOM   1203 C C   . ALA A 1 161 ? 53.716 17.775  1.136   1.00 46.59  ? 521  ALA A C   1 
ATOM   1204 O O   . ALA A 1 161 ? 52.862 18.658  1.089   1.00 45.96  ? 521  ALA A O   1 
ATOM   1205 C CB  . ALA A 1 161 ? 54.161 16.105  -0.683  1.00 46.21  ? 521  ALA A CB  1 
ATOM   1206 N N   . ASP A 1 162 ? 54.949 17.967  1.617   1.00 46.87  ? 522  ASP A N   1 
ATOM   1207 C CA  . ASP A 1 162 ? 55.490 19.277  2.058   1.00 46.81  ? 522  ASP A CA  1 
ATOM   1208 C C   . ASP A 1 162 ? 54.832 19.846  3.312   1.00 47.11  ? 522  ASP A C   1 
ATOM   1209 O O   . ASP A 1 162 ? 53.846 20.589  3.227   1.00 48.06  ? 522  ASP A O   1 
ATOM   1210 C CB  . ASP A 1 162 ? 55.458 20.325  0.927   1.00 45.96  ? 522  ASP A CB  1 
ATOM   1211 C CG  . ASP A 1 162 ? 56.522 21.415  1.097   1.00 46.35  ? 522  ASP A CG  1 
ATOM   1212 O OD1 . ASP A 1 162 ? 56.958 21.696  2.239   1.00 45.53  ? 522  ASP A OD1 1 
ATOM   1213 O OD2 . ASP A 1 162 ? 56.927 22.006  0.074   1.00 46.93  ? 522  ASP A OD2 1 
ATOM   1214 N N   . PHE A 1 163 ? 55.420 19.542  4.462   1.00 47.12  ? 523  PHE A N   1 
ATOM   1215 C CA  . PHE A 1 163 ? 54.893 19.983  5.744   1.00 47.37  ? 523  PHE A CA  1 
ATOM   1216 C C   . PHE A 1 163 ? 55.662 21.164  6.339   1.00 47.71  ? 523  PHE A C   1 
ATOM   1217 O O   . PHE A 1 163 ? 55.605 21.420  7.535   1.00 47.09  ? 523  PHE A O   1 
ATOM   1218 C CB  . PHE A 1 163 ? 54.746 18.773  6.690   1.00 47.01  ? 523  PHE A CB  1 
ATOM   1219 C CG  . PHE A 1 163 ? 53.793 17.739  6.146   1.00 46.65  ? 523  PHE A CG  1 
ATOM   1220 C CD1 . PHE A 1 163 ? 54.266 16.637  5.438   1.00 45.15  ? 523  PHE A CD1 1 
ATOM   1221 C CD2 . PHE A 1 163 ? 52.419 17.935  6.238   1.00 46.32  ? 523  PHE A CD2 1 
ATOM   1222 C CE1 . PHE A 1 163 ? 53.377 15.714  4.869   1.00 46.59  ? 523  PHE A CE1 1 
ATOM   1223 C CE2 . PHE A 1 163 ? 51.521 17.011  5.670   1.00 47.18  ? 523  PHE A CE2 1 
ATOM   1224 C CZ  . PHE A 1 163 ? 52.004 15.899  4.986   1.00 45.43  ? 523  PHE A CZ  1 
ATOM   1225 N N   . GLY A 1 164 ? 56.302 21.931  5.458   1.00 48.90  ? 524  GLY A N   1 
ATOM   1226 C CA  . GLY A 1 164 ? 57.165 23.044  5.857   1.00 50.71  ? 524  GLY A CA  1 
ATOM   1227 C C   . GLY A 1 164 ? 56.490 24.339  6.283   1.00 52.18  ? 524  GLY A C   1 
ATOM   1228 O O   . GLY A 1 164 ? 57.169 25.275  6.718   1.00 52.55  ? 524  GLY A O   1 
ATOM   1229 N N   . MET A 1 165 ? 55.164 24.400  6.170   1.00 52.95  ? 525  MET A N   1 
ATOM   1230 C CA  . MET A 1 165 ? 54.402 25.567  6.613   1.00 54.70  ? 525  MET A CA  1 
ATOM   1231 C C   . MET A 1 165 ? 53.409 25.303  7.752   1.00 53.40  ? 525  MET A C   1 
ATOM   1232 O O   . MET A 1 165 ? 52.595 26.173  8.062   1.00 52.88  ? 525  MET A O   1 
ATOM   1233 C CB  . MET A 1 165 ? 53.665 26.197  5.426   1.00 54.66  ? 525  MET A CB  1 
ATOM   1234 C CG  . MET A 1 165 ? 54.404 27.348  4.777   1.00 56.84  ? 525  MET A CG  1 
ATOM   1235 S SD  . MET A 1 165 ? 53.538 27.975  3.326   1.00 60.72  ? 525  MET A SD  1 
ATOM   1236 C CE  . MET A 1 165 ? 51.894 28.133  4.030   1.00 60.15  ? 525  MET A CE  1 
ATOM   1237 N N   . CYS A 1 166 ? 53.484 24.124  8.374   1.00 53.11  ? 526  CYS A N   1 
ATOM   1238 C CA  . CYS A 1 166 ? 52.514 23.709  9.395   1.00 53.09  ? 526  CYS A CA  1 
ATOM   1239 C C   . CYS A 1 166 ? 52.639 24.486  10.708  1.00 53.51  ? 526  CYS A C   1 
ATOM   1240 O O   . CYS A 1 166 ? 53.735 24.919  11.101  1.00 52.81  ? 526  CYS A O   1 
ATOM   1241 C CB  . CYS A 1 166 ? 52.662 22.218  9.728   1.00 52.88  ? 526  CYS A CB  1 
ATOM   1242 S SG  . CYS A 1 166 ? 52.250 21.036  8.450   1.00 53.61  ? 526  CYS A SG  1 
ATOM   1243 N N   . LYS A 1 167 ? 51.503 24.628  11.388  1.00 53.97  ? 527  LYS A N   1 
ATOM   1244 C CA  . LYS A 1 167 ? 51.460 25.104  12.763  1.00 54.19  ? 527  LYS A CA  1 
ATOM   1245 C C   . LYS A 1 167 ? 51.042 23.942  13.662  1.00 54.64  ? 527  LYS A C   1 
ATOM   1246 O O   . LYS A 1 167 ? 50.123 23.193  13.331  1.00 54.03  ? 527  LYS A O   1 
ATOM   1247 C CB  . LYS A 1 167 ? 50.497 26.287  12.904  1.00 54.27  ? 527  LYS A CB  1 
ATOM   1248 C CG  . LYS A 1 167 ? 50.609 27.025  14.246  1.00 54.43  ? 527  LYS A CG  1 
ATOM   1249 C CD  . LYS A 1 167 ? 51.859 27.883  14.319  1.00 54.47  ? 527  LYS A CD  1 
ATOM   1250 C CE  . LYS A 1 167 ? 52.098 28.401  15.722  1.00 55.61  ? 527  LYS A CE  1 
ATOM   1251 N NZ  . LYS A 1 167 ? 53.097 29.510  15.703  1.00 55.29  ? 527  LYS A NZ  1 
ATOM   1252 N N   . GLU A 1 168 ? 51.693 23.843  14.819  1.00 55.79  ? 528  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 168 ? 51.743 22.615  15.599  1.00 56.97  ? 528  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 168 ? 50.885 22.450  16.861  1.00 57.44  ? 528  GLU A C   1 
ATOM   1255 O O   . GLU A 1 168 ? 50.655 21.312  17.302  1.00 58.07  ? 528  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 168 ? 53.186 22.358  16.001  1.00 57.55  ? 528  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 168 ? 53.871 21.272  15.229  1.00 58.73  ? 528  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 168 ? 55.107 20.803  15.952  1.00 60.37  ? 528  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 168 ? 55.782 21.653  16.582  1.00 60.08  ? 528  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 168 ? 55.390 19.584  15.908  1.00 62.15  ? 528  GLU A OE2 1 
ATOM   1261 N N   . ASN A 1 169 ? 50.448 23.529  17.489  1.00 57.67  ? 529  ASN A N   1 
ATOM   1262 C CA  . ASN A 1 169 ? 49.766 23.330  18.783  1.00 58.26  ? 529  ASN A CA  1 
ATOM   1263 C C   . ASN A 1 169 ? 48.354 23.899  18.796  1.00 58.51  ? 529  ASN A C   1 
ATOM   1264 O O   . ASN A 1 169 ? 47.989 24.693  19.669  1.00 58.53  ? 529  ASN A O   1 
ATOM   1265 C CB  . ASN A 1 169 ? 50.612 23.855  19.953  1.00 58.06  ? 529  ASN A CB  1 
ATOM   1266 C CG  . ASN A 1 169 ? 51.875 23.027  20.191  1.00 58.43  ? 529  ASN A CG  1 
ATOM   1267 O OD1 . ASN A 1 169 ? 52.986 23.479  19.904  1.00 58.15  ? 529  ASN A OD1 1 
ATOM   1268 N ND2 . ASN A 1 169 ? 51.710 21.814  20.726  1.00 57.44  ? 529  ASN A ND2 1 
ATOM   1269 N N   . MET A 1 170 ? 47.563 23.460  17.822  1.00 59.00  ? 530  MET A N   1 
ATOM   1270 C CA  . MET A 1 170 ? 46.276 24.080  17.521  1.00 59.47  ? 530  MET A CA  1 
ATOM   1271 C C   . MET A 1 170 ? 45.082 23.237  17.956  1.00 59.87  ? 530  MET A C   1 
ATOM   1272 O O   . MET A 1 170 ? 44.203 22.949  17.156  1.00 59.93  ? 530  MET A O   1 
ATOM   1273 C CB  . MET A 1 170 ? 46.182 24.394  16.026  1.00 59.15  ? 530  MET A CB  1 
ATOM   1274 C CG  . MET A 1 170 ? 47.344 25.207  15.462  1.00 59.12  ? 530  MET A CG  1 
ATOM   1275 S SD  . MET A 1 170 ? 47.287 26.955  15.883  1.00 57.68  ? 530  MET A SD  1 
ATOM   1276 C CE  . MET A 1 170 ? 48.490 27.033  17.189  1.00 59.77  ? 530  MET A CE  1 
ATOM   1277 N N   . LEU A 1 171 ? 45.049 22.848  19.226  1.00 60.53  ? 531  LEU A N   1 
ATOM   1278 C CA  . LEU A 1 171 ? 43.905 22.116  19.747  1.00 61.30  ? 531  LEU A CA  1 
ATOM   1279 C C   . LEU A 1 171 ? 42.875 23.057  20.356  1.00 61.83  ? 531  LEU A C   1 
ATOM   1280 O O   . LEU A 1 171 ? 43.217 23.951  21.136  1.00 62.25  ? 531  LEU A O   1 
ATOM   1281 C CB  . LEU A 1 171 ? 44.327 21.053  20.772  1.00 61.30  ? 531  LEU A CB  1 
ATOM   1282 C CG  . LEU A 1 171 ? 44.851 19.690  20.291  1.00 61.54  ? 531  LEU A CG  1 
ATOM   1283 C CD1 . LEU A 1 171 ? 44.146 19.215  19.012  1.00 59.85  ? 531  LEU A CD1 1 
ATOM   1284 C CD2 . LEU A 1 171 ? 46.370 19.714  20.110  1.00 62.04  ? 531  LEU A CD2 1 
ATOM   1285 N N   . GLY A 1 172 ? 41.614 22.846  19.988  1.00 62.16  ? 532  GLY A N   1 
ATOM   1286 C CA  . GLY A 1 172 ? 40.496 23.572  20.581  1.00 62.49  ? 532  GLY A CA  1 
ATOM   1287 C C   . GLY A 1 172 ? 40.448 25.045  20.228  1.00 62.55  ? 532  GLY A C   1 
ATOM   1288 O O   . GLY A 1 172 ? 40.201 25.415  19.075  1.00 62.76  ? 532  GLY A O   1 
ATOM   1289 N N   . ASP A 1 173 ? 40.689 25.882  21.231  1.00 62.54  ? 533  ASP A N   1 
ATOM   1290 C CA  . ASP A 1 173 ? 40.546 27.334  21.095  1.00 62.60  ? 533  ASP A CA  1 
ATOM   1291 C C   . ASP A 1 173 ? 41.800 28.065  20.586  1.00 62.28  ? 533  ASP A C   1 
ATOM   1292 O O   . ASP A 1 173 ? 41.782 29.292  20.441  1.00 62.38  ? 533  ASP A O   1 
ATOM   1293 C CB  . ASP A 1 173 ? 40.038 27.965  22.414  1.00 62.73  ? 533  ASP A CB  1 
ATOM   1294 C CG  . ASP A 1 173 ? 40.624 27.304  23.670  1.00 63.41  ? 533  ASP A CG  1 
ATOM   1295 O OD1 . ASP A 1 173 ? 40.888 28.027  24.661  1.00 63.60  ? 533  ASP A OD1 1 
ATOM   1296 O OD2 . ASP A 1 173 ? 40.799 26.065  23.685  1.00 64.27  ? 533  ASP A OD2 1 
ATOM   1297 N N   . ALA A 1 174 ? 42.866 27.312  20.306  1.00 61.72  ? 534  ALA A N   1 
ATOM   1298 C CA  . ALA A 1 174 ? 44.158 27.882  19.901  1.00 61.23  ? 534  ALA A CA  1 
ATOM   1299 C C   . ALA A 1 174 ? 44.137 28.559  18.523  1.00 60.88  ? 534  ALA A C   1 
ATOM   1300 O O   . ALA A 1 174 ? 43.566 28.032  17.565  1.00 60.75  ? 534  ALA A O   1 
ATOM   1301 C CB  . ALA A 1 174 ? 45.250 26.823  19.961  1.00 61.22  ? 534  ALA A CB  1 
ATOM   1302 N N   . LYS A 1 175 ? 44.779 29.723  18.451  1.00 60.57  ? 535  LYS A N   1 
ATOM   1303 C CA  . LYS A 1 175 ? 44.832 30.560  17.248  1.00 60.36  ? 535  LYS A CA  1 
ATOM   1304 C C   . LYS A 1 175 ? 46.261 31.014  16.923  1.00 60.22  ? 535  LYS A C   1 
ATOM   1305 O O   . LYS A 1 175 ? 47.125 31.037  17.799  1.00 60.18  ? 535  LYS A O   1 
ATOM   1306 C CB  . LYS A 1 175 ? 43.925 31.789  17.421  1.00 60.24  ? 535  LYS A CB  1 
ATOM   1307 C CG  . LYS A 1 175 ? 42.678 31.792  16.551  1.00 60.67  ? 535  LYS A CG  1 
ATOM   1308 C CD  . LYS A 1 175 ? 41.645 30.761  16.982  1.00 61.64  ? 535  LYS A CD  1 
ATOM   1309 C CE  . LYS A 1 175 ? 40.406 31.427  17.559  1.00 62.51  ? 535  LYS A CE  1 
ATOM   1310 N NZ  . LYS A 1 175 ? 39.512 31.926  16.475  1.00 61.79  ? 535  LYS A NZ  1 
ATOM   1311 N N   . THR A 1 176 ? 46.507 31.368  15.662  1.00 60.13  ? 536  THR A N   1 
ATOM   1312 C CA  . THR A 1 176 ? 47.799 31.932  15.263  1.00 60.17  ? 536  THR A CA  1 
ATOM   1313 C C   . THR A 1 176 ? 47.642 33.101  14.301  1.00 59.64  ? 536  THR A C   1 
ATOM   1314 O O   . THR A 1 176 ? 46.533 33.436  13.890  1.00 59.50  ? 536  THR A O   1 
ATOM   1315 C CB  . THR A 1 176 ? 48.763 30.890  14.652  1.00 60.52  ? 536  THR A CB  1 
ATOM   1316 O OG1 . THR A 1 176 ? 48.547 29.612  15.255  1.00 62.45  ? 536  THR A OG1 1 
ATOM   1317 C CG2 . THR A 1 176 ? 50.185 31.295  14.933  1.00 60.44  ? 536  THR A CG2 1 
ATOM   1318 N N   . ASN A 1 177 ? 48.775 33.682  13.919  1.00 59.39  ? 537  ASN A N   1 
ATOM   1319 C CA  . ASN A 1 177 ? 48.815 35.015  13.347  1.00 59.42  ? 537  ASN A CA  1 
ATOM   1320 C C   . ASN A 1 177 ? 49.622 35.157  12.058  1.00 59.08  ? 537  ASN A C   1 
ATOM   1321 O O   . ASN A 1 177 ? 49.492 36.163  11.372  1.00 59.70  ? 537  ASN A O   1 
ATOM   1322 C CB  . ASN A 1 177 ? 49.357 35.997  14.401  1.00 59.28  ? 537  ASN A CB  1 
ATOM   1323 C CG  . ASN A 1 177 ? 48.672 37.360  14.347  1.00 60.31  ? 537  ASN A CG  1 
ATOM   1324 O OD1 . ASN A 1 177 ? 47.834 37.620  13.476  1.00 61.17  ? 537  ASN A OD1 1 
ATOM   1325 N ND2 . ASN A 1 177 ? 49.017 38.233  15.293  1.00 60.44  ? 537  ASN A ND2 1 
ATOM   1326 N N   . GLU A 1 178 ? 50.440 34.164  11.720  1.00 58.73  ? 538  GLU A N   1 
ATOM   1327 C CA  . GLU A 1 178 ? 51.410 34.305  10.620  1.00 58.38  ? 538  GLU A CA  1 
ATOM   1328 C C   . GLU A 1 178 ? 50.792 34.467  9.229   1.00 58.18  ? 538  GLU A C   1 
ATOM   1329 O O   . GLU A 1 178 ? 49.798 33.809  8.899   1.00 58.07  ? 538  GLU A O   1 
ATOM   1330 C CB  . GLU A 1 178 ? 52.413 33.149  10.606  1.00 58.43  ? 538  GLU A CB  1 
ATOM   1331 C CG  . GLU A 1 178 ? 53.320 33.087  11.826  1.00 58.35  ? 538  GLU A CG  1 
ATOM   1332 C CD  . GLU A 1 178 ? 52.775 32.182  12.921  1.00 58.85  ? 538  GLU A CD  1 
ATOM   1333 O OE1 . GLU A 1 178 ? 51.865 31.379  12.627  1.00 57.82  ? 538  GLU A OE1 1 
ATOM   1334 O OE2 . GLU A 1 178 ? 53.262 32.270  14.076  1.00 59.35  ? 538  GLU A OE2 1 
ATOM   1335 N N   . PHE A 1 179 ? 51.392 35.343  8.422   1.00 57.78  ? 539  PHE A N   1 
ATOM   1336 C CA  . PHE A 1 179 ? 51.008 35.499  7.028   1.00 57.65  ? 539  PHE A CA  1 
ATOM   1337 C C   . PHE A 1 179 ? 51.685 34.408  6.190   1.00 57.45  ? 539  PHE A C   1 
ATOM   1338 O O   . PHE A 1 179 ? 52.831 34.546  5.765   1.00 57.85  ? 539  PHE A O   1 
ATOM   1339 C CB  . PHE A 1 179 ? 51.339 36.910  6.518   1.00 57.83  ? 539  PHE A CB  1 
ATOM   1340 C CG  . PHE A 1 179 ? 50.724 37.227  5.182   1.00 58.45  ? 539  PHE A CG  1 
ATOM   1341 C CD1 . PHE A 1 179 ? 49.477 37.835  5.104   1.00 58.88  ? 539  PHE A CD1 1 
ATOM   1342 C CD2 . PHE A 1 179 ? 51.384 36.909  4.003   1.00 58.68  ? 539  PHE A CD2 1 
ATOM   1343 C CE1 . PHE A 1 179 ? 48.898 38.122  3.874   1.00 58.06  ? 539  PHE A CE1 1 
ATOM   1344 C CE2 . PHE A 1 179 ? 50.804 37.186  2.765   1.00 58.86  ? 539  PHE A CE2 1 
ATOM   1345 C CZ  . PHE A 1 179 ? 49.563 37.797  2.705   1.00 58.34  ? 539  PHE A CZ  1 
ATOM   1346 N N   . CYS A 1 180 ? 51.225 33.266  5.865   1.00 20.00  ? 540  CYS A N   1 
ATOM   1347 C CA  . CYS A 1 180 ? 51.696 32.031  5.250   1.00 20.00  ? 540  CYS A CA  1 
ATOM   1348 C C   . CYS A 1 180 ? 50.791 31.608  4.099   1.00 20.00  ? 540  CYS A C   1 
ATOM   1349 O O   . CYS A 1 180 ? 49.566 31.803  4.187   1.00 55.92  ? 540  CYS A O   1 
ATOM   1350 C CB  . CYS A 1 180 ? 51.783 30.913  6.290   1.00 20.00  ? 540  CYS A CB  1 
ATOM   1351 S SG  . CYS A 1 180 ? 52.995 31.203  7.599   1.00 20.00  ? 540  CYS A SG  1 
ATOM   1352 N N   . GLY A 1 181 ? 51.162 31.159  3.141   1.00 56.44  ? 541  GLY A N   1 
ATOM   1353 C CA  . GLY A 1 181 ? 50.381 30.572  2.056   1.00 56.60  ? 541  GLY A CA  1 
ATOM   1354 C C   . GLY A 1 181 ? 50.899 30.790  0.659   1.00 56.68  ? 541  GLY A C   1 
ATOM   1355 O O   . GLY A 1 181 ? 51.955 31.365  0.451   1.00 57.57  ? 541  GLY A O   1 
ATOM   1356 N N   . THR A 1 182 ? 50.127 30.308  -0.300  1.00 57.04  ? 542  THR A N   1 
ATOM   1357 C CA  . THR A 1 182 ? 50.359 30.500  -1.729  1.00 56.82  ? 542  THR A CA  1 
ATOM   1358 C C   . THR A 1 182 ? 49.205 31.381  -2.218  1.00 55.63  ? 542  THR A C   1 
ATOM   1359 O O   . THR A 1 182 ? 48.055 31.107  -1.879  1.00 55.56  ? 542  THR A O   1 
ATOM   1360 C CB  . THR A 1 182 ? 50.382 29.112  -2.439  1.00 57.40  ? 542  THR A CB  1 
ATOM   1361 O OG1 . THR A 1 182 ? 51.606 28.442  -2.106  1.00 59.80  ? 542  THR A OG1 1 
ATOM   1362 C CG2 . THR A 1 182 ? 50.245 29.215  -3.967  1.00 58.22  ? 542  THR A CG2 1 
ATOM   1363 N N   . PRO A 1 183 ? 49.513 32.448  -2.987  1.00 54.56  ? 543  PRO A N   1 
ATOM   1364 C CA  . PRO A 1 183 ? 48.571 33.508  -3.374  1.00 53.87  ? 543  PRO A CA  1 
ATOM   1365 C C   . PRO A 1 183 ? 47.138 33.082  -3.753  1.00 52.67  ? 543  PRO A C   1 
ATOM   1366 O O   . PRO A 1 183 ? 46.187 33.609  -3.188  1.00 52.71  ? 543  PRO A O   1 
ATOM   1367 C CB  . PRO A 1 183 ? 49.282 34.189  -4.563  1.00 53.95  ? 543  PRO A CB  1 
ATOM   1368 C CG  . PRO A 1 183 ? 50.718 34.037  -4.245  1.00 54.06  ? 543  PRO A CG  1 
ATOM   1369 C CD  . PRO A 1 183 ? 50.858 32.699  -3.551  1.00 54.77  ? 543  PRO A CD  1 
ATOM   1370 N N   . ASP A 1 184 ? 46.976 32.155  -4.686  1.00 51.34  ? 544  ASP A N   1 
ATOM   1371 C CA  . ASP A 1 184 ? 45.634 31.768  -5.130  1.00 51.01  ? 544  ASP A CA  1 
ATOM   1372 C C   . ASP A 1 184 ? 44.807 31.092  -4.025  1.00 49.66  ? 544  ASP A C   1 
ATOM   1373 O O   . ASP A 1 184 ? 43.573 31.188  -4.025  1.00 49.32  ? 544  ASP A O   1 
ATOM   1374 C CB  . ASP A 1 184 ? 45.704 30.862  -6.366  1.00 51.90  ? 544  ASP A CB  1 
ATOM   1375 C CG  . ASP A 1 184 ? 45.883 31.650  -7.664  1.00 55.60  ? 544  ASP A CG  1 
ATOM   1376 O OD1 . ASP A 1 184 ? 44.974 32.438  -8.076  1.00 58.24  ? 544  ASP A OD1 1 
ATOM   1377 O OD2 . ASP A 1 184 ? 46.949 31.472  -8.285  1.00 61.39  ? 544  ASP A OD2 1 
ATOM   1378 N N   . TYR A 1 185 ? 45.497 30.464  -3.070  1.00 47.59  ? 545  TYR A N   1 
ATOM   1379 C CA  . TYR A 1 185 ? 44.868 29.595  -2.072  1.00 46.58  ? 545  TYR A CA  1 
ATOM   1380 C C   . TYR A 1 185 ? 44.718 30.197  -0.683  1.00 46.38  ? 545  TYR A C   1 
ATOM   1381 O O   . TYR A 1 185 ? 44.111 29.570  0.190   1.00 46.58  ? 545  TYR A O   1 
ATOM   1382 C CB  . TYR A 1 185 ? 45.671 28.299  -1.924  1.00 45.71  ? 545  TYR A CB  1 
ATOM   1383 C CG  . TYR A 1 185 ? 45.774 27.440  -3.147  1.00 44.55  ? 545  TYR A CG  1 
ATOM   1384 C CD1 . TYR A 1 185 ? 46.763 27.668  -4.100  1.00 43.38  ? 545  TYR A CD1 1 
ATOM   1385 C CD2 . TYR A 1 185 ? 44.896 26.367  -3.342  1.00 43.85  ? 545  TYR A CD2 1 
ATOM   1386 C CE1 . TYR A 1 185 ? 46.860 26.865  -5.227  1.00 45.01  ? 545  TYR A CE1 1 
ATOM   1387 C CE2 . TYR A 1 185 ? 44.999 25.546  -4.450  1.00 43.88  ? 545  TYR A CE2 1 
ATOM   1388 C CZ  . TYR A 1 185 ? 45.980 25.790  -5.376  1.00 45.33  ? 545  TYR A CZ  1 
ATOM   1389 O OH  . TYR A 1 185 ? 46.083 24.972  -6.466  1.00 47.65  ? 545  TYR A OH  1 
ATOM   1390 N N   . ILE A 1 186 ? 45.279 31.387  -0.474  1.00 46.66  ? 546  ILE A N   1 
ATOM   1391 C CA  . ILE A 1 186 ? 45.306 32.022  0.851   1.00 47.34  ? 546  ILE A CA  1 
ATOM   1392 C C   . ILE A 1 186 ? 43.928 32.532  1.324   1.00 47.33  ? 546  ILE A C   1 
ATOM   1393 O O   . ILE A 1 186 ? 43.201 33.201  0.581   1.00 47.17  ? 546  ILE A O   1 
ATOM   1394 C CB  . ILE A 1 186 ? 46.391 33.139  0.941   1.00 47.24  ? 546  ILE A CB  1 
ATOM   1395 C CG1 . ILE A 1 186 ? 46.539 33.634  2.375   1.00 47.79  ? 546  ILE A CG1 1 
ATOM   1396 C CG2 . ILE A 1 186 ? 46.059 34.314  0.006   1.00 48.03  ? 546  ILE A CG2 1 
ATOM   1397 C CD1 . ILE A 1 186 ? 47.914 34.265  2.665   1.00 51.19  ? 546  ILE A CD1 1 
ATOM   1398 N N   . ALA A 1 187 ? 43.597 32.199  2.568   1.00 47.32  ? 547  ALA A N   1 
ATOM   1399 C CA  . ALA A 1 187 ? 42.309 32.516  3.155   1.00 47.77  ? 547  ALA A CA  1 
ATOM   1400 C C   . ALA A 1 187 ? 42.128 34.014  3.435   1.00 48.45  ? 547  ALA A C   1 
ATOM   1401 O O   . ALA A 1 187 ? 43.081 34.684  3.831   1.00 48.31  ? 547  ALA A O   1 
ATOM   1402 C CB  . ALA A 1 187 ? 42.137 31.722  4.418   1.00 47.29  ? 547  ALA A CB  1 
ATOM   1403 N N   . PRO A 1 188 ? 40.891 34.541  3.261   1.00 49.20  ? 548  PRO A N   1 
ATOM   1404 C CA  . PRO A 1 188 ? 40.623 35.968  3.516   1.00 49.44  ? 548  PRO A CA  1 
ATOM   1405 C C   . PRO A 1 188 ? 40.959 36.406  4.940   1.00 49.76  ? 548  PRO A C   1 
ATOM   1406 O O   . PRO A 1 188 ? 41.434 37.525  5.125   1.00 50.53  ? 548  PRO A O   1 
ATOM   1407 C CB  . PRO A 1 188 ? 39.121 36.118  3.220   1.00 49.41  ? 548  PRO A CB  1 
ATOM   1408 C CG  . PRO A 1 188 ? 38.574 34.735  3.248   1.00 49.45  ? 548  PRO A CG  1 
ATOM   1409 C CD  . PRO A 1 188 ? 39.680 33.836  2.808   1.00 49.19  ? 548  PRO A CD  1 
ATOM   1410 N N   . GLU A 1 189 ? 40.767 35.533  5.930   1.00 49.90  ? 549  GLU A N   1 
ATOM   1411 C CA  . GLU A 1 189 ? 41.102 35.872  7.319   1.00 49.92  ? 549  GLU A CA  1 
ATOM   1412 C C   . GLU A 1 189 ? 42.611 36.063  7.552   1.00 50.01  ? 549  GLU A C   1 
ATOM   1413 O O   . GLU A 1 189 ? 43.011 36.809  8.443   1.00 50.46  ? 549  GLU A O   1 
ATOM   1414 C CB  . GLU A 1 189 ? 40.503 34.869  8.326   1.00 49.73  ? 549  GLU A CB  1 
ATOM   1415 C CG  . GLU A 1 189 ? 40.955 33.414  8.163   1.00 49.75  ? 549  GLU A CG  1 
ATOM   1416 C CD  . GLU A 1 189 ? 40.032 32.582  7.284   1.00 48.35  ? 549  GLU A CD  1 
ATOM   1417 O OE1 . GLU A 1 189 ? 39.434 33.122  6.339   1.00 47.71  ? 549  GLU A OE1 1 
ATOM   1418 O OE2 . GLU A 1 189 ? 39.900 31.370  7.543   1.00 50.11  ? 549  GLU A OE2 1 
ATOM   1419 N N   . ILE A 1 190 ? 43.440 35.385  6.765   1.00 49.99  ? 550  ILE A N   1 
ATOM   1420 C CA  . ILE A 1 190 ? 44.890 35.639  6.779   1.00 49.43  ? 550  ILE A CA  1 
ATOM   1421 C C   . ILE A 1 190 ? 45.165 37.017  6.159   1.00 49.53  ? 550  ILE A C   1 
ATOM   1422 O O   . ILE A 1 190 ? 45.887 37.823  6.739   1.00 49.77  ? 550  ILE A O   1 
ATOM   1423 C CB  . ILE A 1 190 ? 45.714 34.487  6.084   1.00 49.53  ? 550  ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 190 ? 45.454 33.139  6.779   1.00 48.52  ? 550  ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 190 ? 47.201 34.808  6.065   1.00 48.48  ? 550  ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 190 ? 46.173 31.947  6.178   1.00 49.10  ? 550  ILE A CD1 1 
ATOM   1427 N N   . LEU A 1 191 ? 44.555 37.290  5.005   1.00 49.76  ? 551  LEU A N   1 
ATOM   1428 C CA  . LEU A 1 191 ? 44.626 38.613  4.341   1.00 50.27  ? 551  LEU A CA  1 
ATOM   1429 C C   . LEU A 1 191 ? 44.146 39.830  5.162   1.00 50.56  ? 551  LEU A C   1 
ATOM   1430 O O   . LEU A 1 191 ? 44.571 40.958  4.909   1.00 50.59  ? 551  LEU A O   1 
ATOM   1431 C CB  . LEU A 1 191 ? 43.890 38.590  2.998   1.00 49.59  ? 551  LEU A CB  1 
ATOM   1432 C CG  . LEU A 1 191 ? 44.384 37.560  1.980   1.00 49.95  ? 551  LEU A CG  1 
ATOM   1433 C CD1 . LEU A 1 191 ? 43.553 37.666  0.707   1.00 47.44  ? 551  LEU A CD1 1 
ATOM   1434 C CD2 . LEU A 1 191 ? 45.897 37.718  1.715   1.00 48.68  ? 551  LEU A CD2 1 
ATOM   1435 N N   . LEU A 1 192 ? 43.259 39.599  6.126   1.00 51.29  ? 552  LEU A N   1 
ATOM   1436 C CA  . LEU A 1 192 ? 42.751 40.659  7.006   1.00 51.54  ? 552  LEU A CA  1 
ATOM   1437 C C   . LEU A 1 192 ? 43.528 40.749  8.329   1.00 51.89  ? 552  LEU A C   1 
ATOM   1438 O O   . LEU A 1 192 ? 43.168 41.517  9.234   1.00 51.94  ? 552  LEU A O   1 
ATOM   1439 C CB  . LEU A 1 192 ? 41.246 40.463  7.253   1.00 51.54  ? 552  LEU A CB  1 
ATOM   1440 C CG  . LEU A 1 192 ? 40.332 40.702  6.038   1.00 52.15  ? 552  LEU A CG  1 
ATOM   1441 C CD1 . LEU A 1 192 ? 38.991 40.015  6.205   1.00 51.80  ? 552  LEU A CD1 1 
ATOM   1442 C CD2 . LEU A 1 192 ? 40.141 42.198  5.785   1.00 51.32  ? 552  LEU A CD2 1 
ATOM   1443 N N   . GLY A 1 193 ? 44.596 39.963  8.433   1.00 52.34  ? 553  GLY A N   1 
ATOM   1444 C CA  . GLY A 1 193 ? 45.489 40.002  9.591   1.00 52.45  ? 553  GLY A CA  1 
ATOM   1445 C C   . GLY A 1 193 ? 44.859 39.480  10.871  1.00 52.80  ? 553  GLY A C   1 
ATOM   1446 O O   . GLY A 1 193 ? 45.258 39.873  11.965  1.00 52.97  ? 553  GLY A O   1 
ATOM   1447 N N   . GLN A 1 194 ? 43.875 38.595  10.735  1.00 52.85  ? 554  GLN A N   1 
ATOM   1448 C CA  . GLN A 1 194 ? 43.149 38.050  11.881  1.00 52.90  ? 554  GLN A CA  1 
ATOM   1449 C C   . GLN A 1 194 ? 43.851 36.835  12.469  1.00 52.77  ? 554  GLN A C   1 
ATOM   1450 O O   . GLN A 1 194 ? 44.597 36.139  11.778  1.00 53.15  ? 554  GLN A O   1 
ATOM   1451 C CB  . GLN A 1 194 ? 41.722 37.646  11.478  1.00 53.13  ? 554  GLN A CB  1 
ATOM   1452 C CG  . GLN A 1 194 ? 40.859 38.763  10.926  1.00 53.97  ? 554  GLN A CG  1 
ATOM   1453 C CD  . GLN A 1 194 ? 40.721 39.930  11.888  1.00 56.15  ? 554  GLN A CD  1 
ATOM   1454 O OE1 . GLN A 1 194 ? 40.552 39.745  13.099  1.00 57.34  ? 554  GLN A OE1 1 
ATOM   1455 N NE2 . GLN A 1 194 ? 40.795 41.145  11.352  1.00 56.35  ? 554  GLN A NE2 1 
ATOM   1456 N N   . LYS A 1 195 ? 43.601 36.587  13.749  1.00 52.51  ? 555  LYS A N   1 
ATOM   1457 C CA  . LYS A 1 195 ? 43.980 35.337  14.381  1.00 52.63  ? 555  LYS A CA  1 
ATOM   1458 C C   . LYS A 1 195 ? 43.125 34.234  13.754  1.00 52.09  ? 555  LYS A C   1 
ATOM   1459 O O   . LYS A 1 195 ? 41.932 34.439  13.513  1.00 52.40  ? 555  LYS A O   1 
ATOM   1460 C CB  . LYS A 1 195 ? 43.748 35.413  15.892  1.00 52.49  ? 555  LYS A CB  1 
ATOM   1461 C CG  . LYS A 1 195 ? 44.703 36.356  16.617  1.00 53.65  ? 555  LYS A CG  1 
ATOM   1462 C CD  . LYS A 1 195 ? 44.490 36.325  18.121  1.00 53.79  ? 555  LYS A CD  1 
ATOM   1463 C CE  . LYS A 1 195 ? 45.810 36.464  18.867  1.00 57.13  ? 555  LYS A CE  1 
ATOM   1464 N NZ  . LYS A 1 195 ? 46.507 37.753  18.569  1.00 58.99  ? 555  LYS A NZ  1 
ATOM   1465 N N   . TYR A 1 196 ? 43.730 33.081  13.475  1.00 51.18  ? 556  TYR A N   1 
ATOM   1466 C CA  . TYR A 1 196 ? 43.042 32.024  12.719  1.00 50.49  ? 556  TYR A CA  1 
ATOM   1467 C C   . TYR A 1 196 ? 43.372 30.612  13.201  1.00 50.09  ? 556  TYR A C   1 
ATOM   1468 O O   . TYR A 1 196 ? 44.389 30.399  13.867  1.00 49.68  ? 556  TYR A O   1 
ATOM   1469 C CB  . TYR A 1 196 ? 43.316 32.157  11.209  1.00 49.92  ? 556  TYR A CB  1 
ATOM   1470 C CG  . TYR A 1 196 ? 44.774 31.996  10.817  1.00 49.11  ? 556  TYR A CG  1 
ATOM   1471 C CD1 . TYR A 1 196 ? 45.343 30.726  10.678  1.00 48.41  ? 556  TYR A CD1 1 
ATOM   1472 C CD2 . TYR A 1 196 ? 45.579 33.110  10.580  1.00 48.51  ? 556  TYR A CD2 1 
ATOM   1473 C CE1 . TYR A 1 196 ? 46.672 30.565  10.319  1.00 48.81  ? 556  TYR A CE1 1 
ATOM   1474 C CE2 . TYR A 1 196 ? 46.924 32.967  10.229  1.00 48.57  ? 556  TYR A CE2 1 
ATOM   1475 C CZ  . TYR A 1 196 ? 47.460 31.690  10.099  1.00 49.51  ? 556  TYR A CZ  1 
ATOM   1476 O OH  . TYR A 1 196 ? 48.774 31.525  9.745   1.00 49.11  ? 556  TYR A OH  1 
ATOM   1477 N N   . ASN A 1 197 ? 42.499 29.662  12.860  1.00 49.79  ? 557  ASN A N   1 
ATOM   1478 C CA  . ASN A 1 197 ? 42.746 28.235  13.112  1.00 49.52  ? 557  ASN A CA  1 
ATOM   1479 C C   . ASN A 1 197 ? 42.680 27.423  11.816  1.00 49.18  ? 557  ASN A C   1 
ATOM   1480 O O   . ASN A 1 197 ? 43.020 27.947  10.759  1.00 49.38  ? 557  ASN A O   1 
ATOM   1481 C CB  . ASN A 1 197 ? 41.810 27.674  14.196  1.00 49.47  ? 557  ASN A CB  1 
ATOM   1482 C CG  . ASN A 1 197 ? 40.324 27.840  13.864  1.00 50.04  ? 557  ASN A CG  1 
ATOM   1483 O OD1 . ASN A 1 197 ? 39.939 28.219  12.756  1.00 51.91  ? 557  ASN A OD1 1 
ATOM   1484 N ND2 . ASN A 1 197 ? 39.482 27.551  14.843  1.00 51.83  ? 557  ASN A ND2 1 
ATOM   1485 N N   . HIS A 1 198 ? 42.241 26.164  11.898  1.00 48.88  ? 558  HIS A N   1 
ATOM   1486 C CA  . HIS A 1 198 ? 42.200 25.242  10.745  1.00 48.79  ? 558  HIS A CA  1 
ATOM   1487 C C   . HIS A 1 198 ? 41.217 25.662  9.641   1.00 48.34  ? 558  HIS A C   1 
ATOM   1488 O O   . HIS A 1 198 ? 41.198 25.081  8.556   1.00 48.57  ? 558  HIS A O   1 
ATOM   1489 C CB  . HIS A 1 198 ? 41.917 23.812  11.214  1.00 48.94  ? 558  HIS A CB  1 
ATOM   1490 C CG  . HIS A 1 198 ? 40.522 23.610  11.717  1.00 49.63  ? 558  HIS A CG  1 
ATOM   1491 N ND1 . HIS A 1 198 ? 40.113 24.022  12.966  1.00 50.41  ? 558  HIS A ND1 1 
ATOM   1492 C CD2 . HIS A 1 198 ? 39.438 23.048  11.131  1.00 50.20  ? 558  HIS A CD2 1 
ATOM   1493 C CE1 . HIS A 1 198 ? 38.836 23.724  13.129  1.00 50.63  ? 558  HIS A CE1 1 
ATOM   1494 N NE2 . HIS A 1 198 ? 38.404 23.133  12.030  1.00 51.00  ? 558  HIS A NE2 1 
ATOM   1495 N N   . SER A 1 199 ? 40.420 26.690  9.919   1.00 47.92  ? 559  SER A N   1 
ATOM   1496 C CA  . SER A 1 199 ? 39.517 27.270  8.937   1.00 47.11  ? 559  SER A CA  1 
ATOM   1497 C C   . SER A 1 199 ? 40.227 27.606  7.636   1.00 46.74  ? 559  SER A C   1 
ATOM   1498 O O   . SER A 1 199 ? 39.625 27.509  6.557   1.00 47.09  ? 559  SER A O   1 
ATOM   1499 C CB  . SER A 1 199 ? 38.848 28.531  9.505   1.00 47.26  ? 559  SER A CB  1 
ATOM   1500 O OG  . SER A 1 199 ? 39.731 29.637  9.499   1.00 45.78  ? 559  SER A OG  1 
ATOM   1501 N N   . VAL A 1 200 ? 41.499 28.007  7.733   1.00 45.94  ? 560  VAL A N   1 
ATOM   1502 C CA  . VAL A 1 200 ? 42.250 28.447  6.550   1.00 45.06  ? 560  VAL A CA  1 
ATOM   1503 C C   . VAL A 1 200 ? 42.484 27.278  5.601   1.00 44.37  ? 560  VAL A C   1 
ATOM   1504 O O   . VAL A 1 200 ? 42.476 27.452  4.391   1.00 44.51  ? 560  VAL A O   1 
ATOM   1505 C CB  . VAL A 1 200 ? 43.572 29.220  6.914   1.00 45.36  ? 560  VAL A CB  1 
ATOM   1506 C CG1 . VAL A 1 200 ? 43.253 30.469  7.751   1.00 44.36  ? 560  VAL A CG1 1 
ATOM   1507 C CG2 . VAL A 1 200 ? 44.603 28.317  7.649   1.00 45.30  ? 560  VAL A CG2 1 
ATOM   1508 N N   . ASP A 1 201 ? 42.647 26.080  6.162   1.00 44.39  ? 561  ASP A N   1 
ATOM   1509 C CA  . ASP A 1 201 ? 42.791 24.840  5.376   1.00 44.16  ? 561  ASP A CA  1 
ATOM   1510 C C   . ASP A 1 201 ? 41.539 24.510  4.577   1.00 43.37  ? 561  ASP A C   1 
ATOM   1511 O O   . ASP A 1 201 ? 41.634 24.008  3.464   1.00 44.96  ? 561  ASP A O   1 
ATOM   1512 C CB  . ASP A 1 201 ? 43.194 23.655  6.279   1.00 43.94  ? 561  ASP A CB  1 
ATOM   1513 C CG  . ASP A 1 201 ? 44.699 23.623  6.608   1.00 45.42  ? 561  ASP A CG  1 
ATOM   1514 O OD1 . ASP A 1 201 ? 45.512 24.345  5.948   1.00 45.11  ? 561  ASP A OD1 1 
ATOM   1515 O OD2 . ASP A 1 201 ? 45.068 22.842  7.521   1.00 43.55  ? 561  ASP A OD2 1 
ATOM   1516 N N   . TRP A 1 202 ? 40.364 24.808  5.128   1.00 43.19  ? 562  TRP A N   1 
ATOM   1517 C CA  . TRP A 1 202 ? 39.081 24.557  4.441   1.00 42.29  ? 562  TRP A CA  1 
ATOM   1518 C C   . TRP A 1 202 ? 38.779 25.573  3.328   1.00 42.15  ? 562  TRP A C   1 
ATOM   1519 O O   . TRP A 1 202 ? 38.177 25.220  2.290   1.00 42.25  ? 562  TRP A O   1 
ATOM   1520 C CB  . TRP A 1 202 ? 37.951 24.433  5.468   1.00 42.71  ? 562  TRP A CB  1 
ATOM   1521 C CG  . TRP A 1 202 ? 38.180 23.247  6.350   1.00 41.76  ? 562  TRP A CG  1 
ATOM   1522 C CD1 . TRP A 1 202 ? 38.477 23.250  7.677   1.00 41.78  ? 562  TRP A CD1 1 
ATOM   1523 C CD2 . TRP A 1 202 ? 38.194 21.874  5.935   1.00 42.37  ? 562  TRP A CD2 1 
ATOM   1524 N NE1 . TRP A 1 202 ? 38.648 21.960  8.127   1.00 41.73  ? 562  TRP A NE1 1 
ATOM   1525 C CE2 . TRP A 1 202 ? 38.493 21.098  7.071   1.00 42.29  ? 562  TRP A CE2 1 
ATOM   1526 C CE3 . TRP A 1 202 ? 37.973 21.223  4.703   1.00 42.71  ? 562  TRP A CE3 1 
ATOM   1527 C CZ2 . TRP A 1 202 ? 38.570 19.703  7.023   1.00 42.25  ? 562  TRP A CZ2 1 
ATOM   1528 C CZ3 . TRP A 1 202 ? 38.065 19.848  4.654   1.00 42.32  ? 562  TRP A CZ3 1 
ATOM   1529 C CH2 . TRP A 1 202 ? 38.348 19.099  5.815   1.00 42.34  ? 562  TRP A CH2 1 
ATOM   1530 N N   . TRP A 1 203 ? 39.239 26.815  3.505   1.00 41.50  ? 563  TRP A N   1 
ATOM   1531 C CA  . TRP A 1 203 ? 39.249 27.767  2.385   1.00 41.28  ? 563  TRP A CA  1 
ATOM   1532 C C   . TRP A 1 203 ? 40.166 27.289  1.236   1.00 41.53  ? 563  TRP A C   1 
ATOM   1533 O O   . TRP A 1 203 ? 39.757 27.271  0.072   1.00 41.44  ? 563  TRP A O   1 
ATOM   1534 C CB  . TRP A 1 203 ? 39.656 29.175  2.841   1.00 40.88  ? 563  TRP A CB  1 
ATOM   1535 C CG  . TRP A 1 203 ? 39.604 30.176  1.702   1.00 40.74  ? 563  TRP A CG  1 
ATOM   1536 C CD1 . TRP A 1 203 ? 40.572 30.407  0.741   1.00 40.55  ? 563  TRP A CD1 1 
ATOM   1537 C CD2 . TRP A 1 203 ? 38.515 31.036  1.382   1.00 39.30  ? 563  TRP A CD2 1 
ATOM   1538 N NE1 . TRP A 1 203 ? 40.146 31.382  -0.137  1.00 40.09  ? 563  TRP A NE1 1 
ATOM   1539 C CE2 . TRP A 1 203 ? 38.882 31.774  0.228   1.00 40.07  ? 563  TRP A CE2 1 
ATOM   1540 C CE3 . TRP A 1 203 ? 37.265 31.272  1.969   1.00 40.78  ? 563  TRP A CE3 1 
ATOM   1541 C CZ2 . TRP A 1 203 ? 38.041 32.742  -0.345  1.00 40.98  ? 563  TRP A CZ2 1 
ATOM   1542 C CZ3 . TRP A 1 203 ? 36.421 32.231  1.388   1.00 40.23  ? 563  TRP A CZ3 1 
ATOM   1543 C CH2 . TRP A 1 203 ? 36.823 32.956  0.248   1.00 40.16  ? 563  TRP A CH2 1 
ATOM   1544 N N   . SER A 1 204 ? 41.401 26.901  1.554   1.00 41.45  ? 564  SER A N   1 
ATOM   1545 C CA  . SER A 1 204 ? 42.321 26.403  0.513   1.00 41.99  ? 564  SER A CA  1 
ATOM   1546 C C   . SER A 1 204 ? 41.761 25.156  -0.180  1.00 41.75  ? 564  SER A C   1 
ATOM   1547 O O   . SER A 1 204 ? 41.979 24.964  -1.375  1.00 42.06  ? 564  SER A O   1 
ATOM   1548 C CB  . SER A 1 204 ? 43.688 26.070  1.120   1.00 41.95  ? 564  SER A CB  1 
ATOM   1549 O OG  . SER A 1 204 ? 44.295 27.238  1.647   1.00 43.21  ? 564  SER A OG  1 
ATOM   1550 N N   . PHE A 1 205 ? 41.055 24.320  0.586   1.00 41.93  ? 565  PHE A N   1 
ATOM   1551 C CA  . PHE A 1 205 ? 40.378 23.115  0.070   1.00 42.72  ? 565  PHE A CA  1 
ATOM   1552 C C   . PHE A 1 205 ? 39.355 23.457  -0.985  1.00 42.98  ? 565  PHE A C   1 
ATOM   1553 O O   . PHE A 1 205 ? 39.289 22.803  -2.029  1.00 44.15  ? 565  PHE A O   1 
ATOM   1554 C CB  . PHE A 1 205 ? 39.744 22.314  1.230   1.00 43.10  ? 565  PHE A CB  1 
ATOM   1555 C CG  . PHE A 1 205 ? 39.031 21.072  0.794   1.00 44.29  ? 565  PHE A CG  1 
ATOM   1556 C CD1 . PHE A 1 205 ? 39.753 19.944  0.395   1.00 45.51  ? 565  PHE A CD1 1 
ATOM   1557 C CD2 . PHE A 1 205 ? 37.633 21.016  0.797   1.00 43.53  ? 565  PHE A CD2 1 
ATOM   1558 C CE1 . PHE A 1 205 ? 39.090 18.802  -0.009  1.00 47.84  ? 565  PHE A CE1 1 
ATOM   1559 C CE2 . PHE A 1 205 ? 36.960 19.871  0.408   1.00 42.94  ? 565  PHE A CE2 1 
ATOM   1560 C CZ  . PHE A 1 205 ? 37.674 18.769  -0.005  1.00 45.46  ? 565  PHE A CZ  1 
ATOM   1561 N N   . GLY A 1 206 ? 38.588 24.519  -0.739  1.00 43.47  ? 566  GLY A N   1 
ATOM   1562 C CA  . GLY A 1 206 ? 37.625 25.035  -1.706  1.00 43.25  ? 566  GLY A CA  1 
ATOM   1563 C C   . GLY A 1 206 ? 38.283 25.504  -2.972  1.00 43.39  ? 566  GLY A C   1 
ATOM   1564 O O   . GLY A 1 206 ? 37.800 25.220  -4.069  1.00 44.55  ? 566  GLY A O   1 
ATOM   1565 N N   . VAL A 1 207 ? 39.408 26.195  -2.836  1.00 43.58  ? 567  VAL A N   1 
ATOM   1566 C CA  . VAL A 1 207 ? 40.145 26.697  -4.011  1.00 42.40  ? 567  VAL A CA  1 
ATOM   1567 C C   . VAL A 1 207 ? 40.640 25.523  -4.836  1.00 43.00  ? 567  VAL A C   1 
ATOM   1568 O O   . VAL A 1 207 ? 40.463 25.489  -6.047  1.00 43.77  ? 567  VAL A O   1 
ATOM   1569 C CB  . VAL A 1 207 ? 41.312 27.644  -3.622  1.00 42.28  ? 567  VAL A CB  1 
ATOM   1570 C CG1 . VAL A 1 207 ? 42.181 28.008  -4.863  1.00 39.79  ? 567  VAL A CG1 1 
ATOM   1571 C CG2 . VAL A 1 207 ? 40.787 28.904  -2.910  1.00 40.41  ? 567  VAL A CG2 1 
ATOM   1572 N N   . LEU A 1 208 ? 41.218 24.537  -4.157  1.00 43.67  ? 568  LEU A N   1 
ATOM   1573 C CA  . LEU A 1 208 ? 41.714 23.316  -4.793  1.00 44.25  ? 568  LEU A CA  1 
ATOM   1574 C C   . LEU A 1 208 ? 40.610 22.504  -5.492  1.00 43.79  ? 568  LEU A C   1 
ATOM   1575 O O   . LEU A 1 208 ? 40.779 22.104  -6.645  1.00 44.19  ? 568  LEU A O   1 
ATOM   1576 C CB  . LEU A 1 208 ? 42.506 22.494  -3.750  1.00 44.98  ? 568  LEU A CB  1 
ATOM   1577 C CG  . LEU A 1 208 ? 43.233 21.244  -4.221  1.00 48.20  ? 568  LEU A CG  1 
ATOM   1578 C CD1 . LEU A 1 208 ? 44.446 20.961  -3.365  1.00 48.87  ? 568  LEU A CD1 1 
ATOM   1579 C CD2 . LEU A 1 208 ? 42.266 20.050  -4.191  1.00 48.59  ? 568  LEU A CD2 1 
ATOM   1580 N N   . LEU A 1 209 ? 39.483 22.270  -4.808  1.00 43.86  ? 569  LEU A N   1 
ATOM   1581 C CA  . LEU A 1 209 ? 38.294 21.664  -5.423  1.00 43.67  ? 569  LEU A CA  1 
ATOM   1582 C C   . LEU A 1 209 ? 37.779 22.410  -6.625  1.00 42.62  ? 569  LEU A C   1 
ATOM   1583 O O   . LEU A 1 209 ? 37.476 21.825  -7.657  1.00 42.30  ? 569  LEU A O   1 
ATOM   1584 C CB  . LEU A 1 209 ? 37.123 21.620  -4.420  1.00 45.03  ? 569  LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 209 ? 36.226 20.364  -4.340  1.00 47.44  ? 569  LEU A CG  1 
ATOM   1586 C CD1 . LEU A 1 209 ? 34.863 20.692  -3.809  1.00 45.90  ? 569  LEU A CD1 1 
ATOM   1587 C CD2 . LEU A 1 209 ? 36.148 19.480  -5.641  1.00 46.25  ? 569  LEU A CD2 1 
ATOM   1588 N N   . TYR A 1 210 ? 37.612 23.721  -6.474  1.00 42.93  ? 570  TYR A N   1 
ATOM   1589 C CA  . TYR A 1 210 ? 37.233 24.578  -7.600  1.00 41.68  ? 570  TYR A CA  1 
ATOM   1590 C C   . TYR A 1 210 ? 38.127 24.356  -8.837  1.00 42.13  ? 570  TYR A C   1 
ATOM   1591 O O   . TYR A 1 210 ? 37.626 24.145  -9.950  1.00 42.15  ? 570  TYR A O   1 
ATOM   1592 C CB  . TYR A 1 210 ? 37.257 26.054  -7.163  1.00 40.48  ? 570  TYR A CB  1 
ATOM   1593 C CG  . TYR A 1 210 ? 36.737 26.993  -8.234  1.00 40.28  ? 570  TYR A CG  1 
ATOM   1594 C CD1 . TYR A 1 210 ? 37.522 27.317  -9.349  1.00 36.66  ? 570  TYR A CD1 1 
ATOM   1595 C CD2 . TYR A 1 210 ? 35.472 27.574  -8.127  1.00 38.45  ? 570  TYR A CD2 1 
ATOM   1596 C CE1 . TYR A 1 210 ? 37.063 28.175  -10.325 1.00 37.24  ? 570  TYR A CE1 1 
ATOM   1597 C CE2 . TYR A 1 210 ? 35.011 28.430  -9.101  1.00 38.91  ? 570  TYR A CE2 1 
ATOM   1598 C CZ  . TYR A 1 210 ? 35.810 28.729  -10.200 1.00 39.22  ? 570  TYR A CZ  1 
ATOM   1599 O OH  . TYR A 1 210 ? 35.355 29.585  -11.192 1.00 40.23  ? 570  TYR A OH  1 
ATOM   1600 N N   . GLU A 1 211 ? 39.444 24.414  -8.649  1.00 42.39  ? 571  GLU A N   1 
ATOM   1601 C CA  . GLU A 1 211 ? 40.400 24.191  -9.753  1.00 44.40  ? 571  GLU A CA  1 
ATOM   1602 C C   . GLU A 1 211 ? 40.297 22.799  -10.399 1.00 44.09  ? 571  GLU A C   1 
ATOM   1603 O O   . GLU A 1 211 ? 40.388 22.695  -11.621 1.00 44.86  ? 571  GLU A O   1 
ATOM   1604 C CB  . GLU A 1 211 ? 41.840 24.403  -9.272  1.00 44.16  ? 571  GLU A CB  1 
ATOM   1605 C CG  . GLU A 1 211 ? 42.144 25.822  -8.796  1.00 46.70  ? 571  GLU A CG  1 
ATOM   1606 C CD  . GLU A 1 211 ? 43.594 25.986  -8.342  1.00 48.39  ? 571  GLU A CD  1 
ATOM   1607 O OE1 . GLU A 1 211 ? 44.154 24.991  -7.817  1.00 51.24  ? 571  GLU A OE1 1 
ATOM   1608 O OE2 . GLU A 1 211 ? 44.159 27.114  -8.481  1.00 54.73  ? 571  GLU A OE2 1 
ATOM   1609 N N   . MET A 1 212 ? 40.112 21.752  -9.589  1.00 43.38  ? 572  MET A N   1 
ATOM   1610 C CA  . MET A 1 212 ? 39.932 20.388  -10.104 1.00 45.02  ? 572  MET A CA  1 
ATOM   1611 C C   . MET A 1 212 ? 38.732 20.284  -11.000 1.00 44.85  ? 572  MET A C   1 
ATOM   1612 O O   . MET A 1 212 ? 38.796 19.652  -12.038 1.00 45.28  ? 572  MET A O   1 
ATOM   1613 C CB  . MET A 1 212 ? 39.769 19.348  -8.967  1.00 44.63  ? 572  MET A CB  1 
ATOM   1614 C CG  . MET A 1 212 ? 41.019 19.154  -8.163  1.00 45.80  ? 572  MET A CG  1 
ATOM   1615 S SD  . MET A 1 212 ? 41.068 17.627  -7.200  1.00 46.50  ? 572  MET A SD  1 
ATOM   1616 C CE  . MET A 1 212 ? 39.857 17.954  -5.930  1.00 40.77  ? 572  MET A CE  1 
ATOM   1617 N N   . LEU A 1 213 ? 37.622 20.889  -10.566 1.00 45.59  ? 573  LEU A N   1 
ATOM   1618 C CA  . LEU A 1 213 ? 36.346 20.813  -11.285 1.00 45.08  ? 573  LEU A CA  1 
ATOM   1619 C C   . LEU A 1 213 ? 36.311 21.706  -12.506 1.00 44.91  ? 573  LEU A C   1 
ATOM   1620 O O   . LEU A 1 213 ? 35.751 21.343  -13.527 1.00 44.50  ? 573  LEU A O   1 
ATOM   1621 C CB  . LEU A 1 213 ? 35.186 21.162  -10.356 1.00 44.74  ? 573  LEU A CB  1 
ATOM   1622 C CG  . LEU A 1 213 ? 34.889 20.172  -9.230  1.00 46.58  ? 573  LEU A CG  1 
ATOM   1623 C CD1 . LEU A 1 213 ? 33.904 20.779  -8.165  1.00 45.07  ? 573  LEU A CD1 1 
ATOM   1624 C CD2 . LEU A 1 213 ? 34.343 18.858  -9.825  1.00 42.45  ? 573  LEU A CD2 1 
ATOM   1625 N N   . ILE A 1 214 ? 36.944 22.869  -12.407 1.00 45.54  ? 574  ILE A N   1 
ATOM   1626 C CA  . ILE A 1 214 ? 36.747 23.940  -13.397 1.00 45.71  ? 574  ILE A CA  1 
ATOM   1627 C C   . ILE A 1 214 ? 37.999 24.192  -14.234 1.00 46.43  ? 574  ILE A C   1 
ATOM   1628 O O   . ILE A 1 214 ? 37.923 24.610  -15.402 1.00 46.50  ? 574  ILE A O   1 
ATOM   1629 C CB  . ILE A 1 214 ? 36.127 25.222  -12.697 1.00 45.89  ? 574  ILE A CB  1 
ATOM   1630 C CG1 . ILE A 1 214 ? 34.682 24.883  -12.255 1.00 44.98  ? 574  ILE A CG1 1 
ATOM   1631 C CG2 . ILE A 1 214 ? 36.125 26.465  -13.635 1.00 45.16  ? 574  ILE A CG2 1 
ATOM   1632 C CD1 . ILE A 1 214 ? 34.210 25.583  -11.027 1.00 46.13  ? 574  ILE A CD1 1 
ATOM   1633 N N   . GLY A 1 215 ? 39.156 23.925  -13.643 1.00 47.24  ? 575  GLY A N   1 
ATOM   1634 C CA  . GLY A 1 215 ? 40.414 24.085  -14.361 1.00 48.47  ? 575  GLY A CA  1 
ATOM   1635 C C   . GLY A 1 215 ? 40.916 25.508  -14.416 1.00 49.08  ? 575  GLY A C   1 
ATOM   1636 O O   . GLY A 1 215 ? 41.777 25.812  -15.232 1.00 50.04  ? 575  GLY A O   1 
ATOM   1637 N N   . GLN A 1 216 ? 40.387 26.367  -13.536 1.00 49.53  ? 576  GLN A N   1 
ATOM   1638 C CA  . GLN A 1 216 ? 40.865 27.753  -13.346 1.00 50.05  ? 576  GLN A CA  1 
ATOM   1639 C C   . GLN A 1 216 ? 40.835 28.022  -11.880 1.00 48.47  ? 576  GLN A C   1 
ATOM   1640 O O   . GLN A 1 216 ? 40.091 27.378  -11.151 1.00 47.89  ? 576  GLN A O   1 
ATOM   1641 C CB  . GLN A 1 216 ? 39.898 28.763  -13.974 1.00 50.93  ? 576  GLN A CB  1 
ATOM   1642 C CG  . GLN A 1 216 ? 40.247 29.197  -15.338 1.00 57.04  ? 576  GLN A CG  1 
ATOM   1643 C CD  . GLN A 1 216 ? 39.140 29.993  -15.949 1.00 62.96  ? 576  GLN A CD  1 
ATOM   1644 O OE1 . GLN A 1 216 ? 38.893 31.132  -15.560 1.00 65.06  ? 576  GLN A OE1 1 
ATOM   1645 N NE2 . GLN A 1 216 ? 38.438 29.385  -16.918 1.00 66.90  ? 576  GLN A NE2 1 
ATOM   1646 N N   . SER A 1 217 ? 41.594 29.021  -11.455 1.00 47.29  ? 577  SER A N   1 
ATOM   1647 C CA  . SER A 1 217 ? 41.487 29.531  -10.090 1.00 46.89  ? 577  SER A CA  1 
ATOM   1648 C C   . SER A 1 217 ? 40.205 30.352  -9.900  1.00 45.08  ? 577  SER A C   1 
ATOM   1649 O O   . SER A 1 217 ? 39.790 31.036  -10.809 1.00 44.25  ? 577  SER A O   1 
ATOM   1650 C CB  . SER A 1 217 ? 42.736 30.353  -9.756  1.00 47.75  ? 577  SER A CB  1 
ATOM   1651 O OG  . SER A 1 217 ? 43.835 29.451  -9.645  1.00 52.08  ? 577  SER A OG  1 
ATOM   1652 N N   . PRO A 1 218 ? 39.566 30.259  -8.723  1.00 43.92  ? 578  PRO A N   1 
ATOM   1653 C CA  . PRO A 1 218 ? 38.325 31.006  -8.539  1.00 43.86  ? 578  PRO A CA  1 
ATOM   1654 C C   . PRO A 1 218 ? 38.520 32.550  -8.495  1.00 44.15  ? 578  PRO A C   1 
ATOM   1655 O O   . PRO A 1 218 ? 37.654 33.286  -8.941  1.00 43.97  ? 578  PRO A O   1 
ATOM   1656 C CB  . PRO A 1 218 ? 37.786 30.471  -7.193  1.00 43.61  ? 578  PRO A CB  1 
ATOM   1657 C CG  . PRO A 1 218 ? 38.969 29.987  -6.467  1.00 43.02  ? 578  PRO A CG  1 
ATOM   1658 C CD  . PRO A 1 218 ? 39.941 29.484  -7.521  1.00 43.35  ? 578  PRO A CD  1 
ATOM   1659 N N   . PHE A 1 219 ? 39.661 33.013  -7.985  1.00 44.47  ? 579  PHE A N   1 
ATOM   1660 C CA  . PHE A 1 219 ? 39.945 34.449  -7.872  1.00 44.66  ? 579  PHE A CA  1 
ATOM   1661 C C   . PHE A 1 219 ? 40.983 34.925  -8.884  1.00 45.76  ? 579  PHE A C   1 
ATOM   1662 O O   . PHE A 1 219 ? 41.768 34.139  -9.388  1.00 46.44  ? 579  PHE A O   1 
ATOM   1663 C CB  . PHE A 1 219 ? 40.295 34.781  -6.427  1.00 43.51  ? 579  PHE A CB  1 
ATOM   1664 C CG  . PHE A 1 219 ? 39.298 34.241  -5.463  1.00 41.47  ? 579  PHE A CG  1 
ATOM   1665 C CD1 . PHE A 1 219 ? 38.029 34.830  -5.365  1.00 41.02  ? 579  PHE A CD1 1 
ATOM   1666 C CD2 . PHE A 1 219 ? 39.578 33.102  -4.715  1.00 38.89  ? 579  PHE A CD2 1 
ATOM   1667 C CE1 . PHE A 1 219 ? 37.075 34.334  -4.500  1.00 39.15  ? 579  PHE A CE1 1 
ATOM   1668 C CE2 . PHE A 1 219 ? 38.633 32.582  -3.856  1.00 39.05  ? 579  PHE A CE2 1 
ATOM   1669 C CZ  . PHE A 1 219 ? 37.368 33.201  -3.743  1.00 41.04  ? 579  PHE A CZ  1 
ATOM   1670 N N   . HIS A 1 220 ? 40.949 36.205  -9.234  1.00 47.31  ? 580  HIS A N   1 
ATOM   1671 C CA  . HIS A 1 220 ? 41.759 36.693  -10.352 1.00 48.49  ? 580  HIS A CA  1 
ATOM   1672 C C   . HIS A 1 220 ? 42.297 38.095  -10.072 1.00 48.91  ? 580  HIS A C   1 
ATOM   1673 O O   . HIS A 1 220 ? 41.694 38.865  -9.328  1.00 48.64  ? 580  HIS A O   1 
ATOM   1674 C CB  . HIS A 1 220 ? 40.971 36.648  -11.682 1.00 48.54  ? 580  HIS A CB  1 
ATOM   1675 C CG  . HIS A 1 220 ? 39.912 37.705  -11.806 1.00 50.24  ? 580  HIS A CG  1 
ATOM   1676 N ND1 . HIS A 1 220 ? 38.719 37.654  -11.112 1.00 52.08  ? 580  HIS A ND1 1 
ATOM   1677 C CD2 . HIS A 1 220 ? 39.856 38.833  -12.561 1.00 51.29  ? 580  HIS A CD2 1 
ATOM   1678 C CE1 . HIS A 1 220 ? 37.990 38.722  -11.409 1.00 52.03  ? 580  HIS A CE1 1 
ATOM   1679 N NE2 . HIS A 1 220 ? 38.656 39.453  -12.286 1.00 50.79  ? 580  HIS A NE2 1 
ATOM   1680 N N   . GLY A 1 221 ? 43.441 38.405  -10.672 1.00 49.24  ? 581  GLY A N   1 
ATOM   1681 C CA  . GLY A 1 221 ? 44.077 39.696  -10.510 1.00 49.97  ? 581  GLY A CA  1 
ATOM   1682 C C   . GLY A 1 221 ? 45.298 39.745  -11.395 1.00 50.75  ? 581  GLY A C   1 
ATOM   1683 O O   . GLY A 1 221 ? 45.898 38.706  -11.657 1.00 50.49  ? 581  GLY A O   1 
ATOM   1684 N N   . GLN A 1 222 ? 45.664 40.934  -11.866 1.00 51.36  ? 582  GLN A N   1 
ATOM   1685 C CA  . GLN A 1 222 ? 46.852 41.077  -12.706 1.00 53.12  ? 582  GLN A CA  1 
ATOM   1686 C C   . GLN A 1 222 ? 48.139 41.031  -11.867 1.00 53.50  ? 582  GLN A C   1 
ATOM   1687 O O   . GLN A 1 222 ? 49.201 40.632  -12.362 1.00 53.87  ? 582  GLN A O   1 
ATOM   1688 C CB  . GLN A 1 222 ? 46.779 42.337  -13.566 1.00 52.73  ? 582  GLN A CB  1 
ATOM   1689 C CG  . GLN A 1 222 ? 46.084 42.118  -14.923 1.00 54.79  ? 582  GLN A CG  1 
ATOM   1690 C CD  . GLN A 1 222 ? 45.913 43.404  -15.712 1.00 55.19  ? 582  GLN A CD  1 
ATOM   1691 O OE1 . GLN A 1 222 ? 45.070 44.244  -15.385 1.00 58.94  ? 582  GLN A OE1 1 
ATOM   1692 N NE2 . GLN A 1 222 ? 46.715 43.567  -16.760 1.00 58.20  ? 582  GLN A NE2 1 
ATOM   1693 N N   . ASP A 1 223 ? 48.019 41.403  -10.593 1.00 53.61  ? 583  ASP A N   1 
ATOM   1694 C CA  . ASP A 1 223 ? 49.126 41.365  -9.647  1.00 54.58  ? 583  ASP A CA  1 
ATOM   1695 C C   . ASP A 1 223 ? 48.607 40.848  -8.315  1.00 54.59  ? 583  ASP A C   1 
ATOM   1696 O O   . ASP A 1 223 ? 47.395 40.715  -8.144  1.00 55.01  ? 583  ASP A O   1 
ATOM   1697 C CB  . ASP A 1 223 ? 49.773 42.760  -9.488  1.00 54.49  ? 583  ASP A CB  1 
ATOM   1698 C CG  . ASP A 1 223 ? 48.765 43.844  -9.121  1.00 56.24  ? 583  ASP A CG  1 
ATOM   1699 O OD1 . ASP A 1 223 ? 47.706 43.530  -8.533  1.00 58.49  ? 583  ASP A OD1 1 
ATOM   1700 O OD2 . ASP A 1 223 ? 49.028 45.028  -9.417  1.00 59.51  ? 583  ASP A OD2 1 
ATOM   1701 N N   . GLU A 1 224 ? 49.521 40.575  -7.380  1.00 54.82  ? 584  GLU A N   1 
ATOM   1702 C CA  . GLU A 1 224 ? 49.199 39.981  -6.080  1.00 54.83  ? 584  GLU A CA  1 
ATOM   1703 C C   . GLU A 1 224 ? 48.157 40.794  -5.339  1.00 53.95  ? 584  GLU A C   1 
ATOM   1704 O O   . GLU A 1 224 ? 47.246 40.231  -4.738  1.00 54.00  ? 584  GLU A O   1 
ATOM   1705 C CB  . GLU A 1 224 ? 50.462 39.848  -5.216  1.00 55.19  ? 584  GLU A CB  1 
ATOM   1706 C CG  . GLU A 1 224 ? 50.370 38.733  -4.157  1.00 56.56  ? 584  GLU A CG  1 
ATOM   1707 C CD  . GLU A 1 224 ? 51.695 38.463  -3.414  1.00 56.71  ? 584  GLU A CD  1 
ATOM   1708 O OE1 . GLU A 1 224 ? 52.221 37.326  -3.535  1.00 59.18  ? 584  GLU A OE1 1 
ATOM   1709 O OE2 . GLU A 1 224 ? 52.210 39.378  -2.720  1.00 58.03  ? 584  GLU A OE2 1 
ATOM   1710 N N   . GLU A 1 225 ? 48.293 42.115  -5.411  1.00 52.75  ? 585  GLU A N   1 
ATOM   1711 C CA  . GLU A 1 225 ? 47.407 43.057  -4.741  1.00 52.42  ? 585  GLU A CA  1 
ATOM   1712 C C   . GLU A 1 225 ? 45.948 42.984  -5.224  1.00 51.10  ? 585  GLU A C   1 
ATOM   1713 O O   . GLU A 1 225 ? 45.015 42.941  -4.418  1.00 51.08  ? 585  GLU A O   1 
ATOM   1714 C CB  . GLU A 1 225 ? 47.949 44.487  -4.905  1.00 52.50  ? 585  GLU A CB  1 
ATOM   1715 C CG  . GLU A 1 225 ? 49.430 44.639  -4.510  1.00 56.35  ? 585  GLU A CG  1 
ATOM   1716 C CD  . GLU A 1 225 ? 50.405 44.715  -5.706  1.00 59.21  ? 585  GLU A CD  1 
ATOM   1717 O OE1 . GLU A 1 225 ? 50.591 45.834  -6.277  1.00 60.27  ? 585  GLU A OE1 1 
ATOM   1718 O OE2 . GLU A 1 225 ? 51.016 43.672  -6.035  1.00 57.53  ? 585  GLU A OE2 1 
ATOM   1719 N N   . GLU A 1 226 ? 45.755 42.992  -6.535  1.00 49.42  ? 586  GLU A N   1 
ATOM   1720 C CA  . GLU A 1 226 ? 44.419 42.836  -7.092  1.00 48.31  ? 586  GLU A CA  1 
ATOM   1721 C C   . GLU A 1 226 ? 43.835 41.430  -6.803  1.00 46.77  ? 586  GLU A C   1 
ATOM   1722 O O   . GLU A 1 226 ? 42.638 41.299  -6.568  1.00 45.79  ? 586  GLU A O   1 
ATOM   1723 C CB  . GLU A 1 226 ? 44.423 43.155  -8.586  1.00 48.29  ? 586  GLU A CB  1 
ATOM   1724 C CG  . GLU A 1 226 ? 43.058 43.008  -9.228  1.00 49.28  ? 586  GLU A CG  1 
ATOM   1725 C CD  . GLU A 1 226 ? 43.093 43.167  -10.718 1.00 50.29  ? 586  GLU A CD  1 
ATOM   1726 O OE1 . GLU A 1 226 ? 44.203 43.169  -11.296 1.00 51.17  ? 586  GLU A OE1 1 
ATOM   1727 O OE2 . GLU A 1 226 ? 42.001 43.282  -11.312 1.00 50.98  ? 586  GLU A OE2 1 
ATOM   1728 N N   . LEU A 1 227 ? 44.696 40.408  -6.781  1.00 45.73  ? 587  LEU A N   1 
ATOM   1729 C CA  . LEU A 1 227 ? 44.297 39.036  -6.430  1.00 45.02  ? 587  LEU A CA  1 
ATOM   1730 C C   . LEU A 1 227 ? 43.834 38.932  -4.987  1.00 44.85  ? 587  LEU A C   1 
ATOM   1731 O O   . LEU A 1 227 ? 42.834 38.277  -4.710  1.00 45.62  ? 587  LEU A O   1 
ATOM   1732 C CB  . LEU A 1 227 ? 45.428 38.025  -6.693  1.00 44.54  ? 587  LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 227 ? 45.156 36.548  -6.325  1.00 45.72  ? 587  LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 227 ? 43.965 35.931  -7.123  1.00 40.65  ? 587  LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 227 ? 46.437 35.674  -6.465  1.00 44.84  ? 587  LEU A CD2 1 
ATOM   1736 N N   . PHE A 1 228 ? 44.551 39.581  -4.072  1.00 44.64  ? 588  PHE A N   1 
ATOM   1737 C CA  . PHE A 1 228 ? 44.140 39.643  -2.672  1.00 44.37  ? 588  PHE A CA  1 
ATOM   1738 C C   . PHE A 1 228 ? 42.784 40.320  -2.483  1.00 44.35  ? 588  PHE A C   1 
ATOM   1739 O O   . PHE A 1 228 ? 41.973 39.854  -1.682  1.00 44.07  ? 588  PHE A O   1 
ATOM   1740 C CB  . PHE A 1 228 ? 45.208 40.309  -1.805  1.00 44.42  ? 588  PHE A CB  1 
ATOM   1741 C CG  . PHE A 1 228 ? 46.462 39.479  -1.634  1.00 45.53  ? 588  PHE A CG  1 
ATOM   1742 C CD1 . PHE A 1 228 ? 46.503 38.139  -2.053  1.00 45.23  ? 588  PHE A CD1 1 
ATOM   1743 C CD2 . PHE A 1 228 ? 47.600 40.036  -1.039  1.00 45.47  ? 588  PHE A CD2 1 
ATOM   1744 C CE1 . PHE A 1 228 ? 47.666 37.369  -1.899  1.00 46.48  ? 588  PHE A CE1 1 
ATOM   1745 C CE2 . PHE A 1 228 ? 48.760 39.278  -0.863  1.00 45.88  ? 588  PHE A CE2 1 
ATOM   1746 C CZ  . PHE A 1 228 ? 48.793 37.936  -1.295  1.00 45.80  ? 588  PHE A CZ  1 
ATOM   1747 N N   . HIS A 1 229 ? 42.549 41.413  -3.218  1.00 44.35  ? 589  HIS A N   1 
ATOM   1748 C CA  . HIS A 1 229 ? 41.232 42.061  -3.272  1.00 44.71  ? 589  HIS A CA  1 
ATOM   1749 C C   . HIS A 1 229 ? 40.129 41.136  -3.815  1.00 44.04  ? 589  HIS A C   1 
ATOM   1750 O O   . HIS A 1 229 ? 39.016 41.102  -3.297  1.00 43.31  ? 589  HIS A O   1 
ATOM   1751 C CB  . HIS A 1 229 ? 41.298 43.348  -4.098  1.00 45.73  ? 589  HIS A CB  1 
ATOM   1752 C CG  . HIS A 1 229 ? 39.977 44.040  -4.234  1.00 48.80  ? 589  HIS A CG  1 
ATOM   1753 N ND1 . HIS A 1 229 ? 39.077 43.737  -5.237  1.00 52.84  ? 589  HIS A ND1 1 
ATOM   1754 C CD2 . HIS A 1 229 ? 39.393 45.000  -3.479  1.00 50.71  ? 589  HIS A CD2 1 
ATOM   1755 C CE1 . HIS A 1 229 ? 37.999 44.491  -5.099  1.00 53.93  ? 589  HIS A CE1 1 
ATOM   1756 N NE2 . HIS A 1 229 ? 38.167 45.268  -4.041  1.00 53.39  ? 589  HIS A NE2 1 
ATOM   1757 N N   . SER A 1 230 ? 40.452 40.371  -4.852  1.00 43.84  ? 590  SER A N   1 
ATOM   1758 C CA  . SER A 1 230 ? 39.521 39.387  -5.394  1.00 43.45  ? 590  SER A CA  1 
ATOM   1759 C C   . SER A 1 230 ? 39.152 38.324  -4.340  1.00 43.28  ? 590  SER A C   1 
ATOM   1760 O O   . SER A 1 230 ? 37.973 38.066  -4.103  1.00 42.69  ? 590  SER A O   1 
ATOM   1761 C CB  . SER A 1 230 ? 40.089 38.767  -6.671  1.00 43.38  ? 590  SER A CB  1 
ATOM   1762 O OG  . SER A 1 230 ? 39.151 37.896  -7.296  1.00 44.59  ? 590  SER A OG  1 
ATOM   1763 N N   . ILE A 1 231 ? 40.156 37.751  -3.680  1.00 43.26  ? 591  ILE A N   1 
ATOM   1764 C CA  . ILE A 1 231 ? 39.923 36.777  -2.618  1.00 43.57  ? 591  ILE A CA  1 
ATOM   1765 C C   . ILE A 1 231 ? 38.998 37.302  -1.519  1.00 44.90  ? 591  ILE A C   1 
ATOM   1766 O O   . ILE A 1 231 ? 38.115 36.573  -1.037  1.00 44.23  ? 591  ILE A O   1 
ATOM   1767 C CB  . ILE A 1 231 ? 41.255 36.258  -2.026  1.00 43.68  ? 591  ILE A CB  1 
ATOM   1768 C CG1 . ILE A 1 231 ? 42.002 35.416  -3.081  1.00 43.45  ? 591  ILE A CG1 1 
ATOM   1769 C CG2 . ILE A 1 231 ? 40.995 35.447  -0.750  1.00 42.31  ? 591  ILE A CG2 1 
ATOM   1770 C CD1 . ILE A 1 231 ? 43.497 35.189  -2.802  1.00 43.52  ? 591  ILE A CD1 1 
ATOM   1771 N N   . ARG A 1 232 ? 39.187 38.578  -1.151  1.00 46.06  ? 592  ARG A N   1 
ATOM   1772 C CA  . ARG A 1 232 ? 38.397 39.233  -0.110  1.00 47.70  ? 592  ARG A CA  1 
ATOM   1773 C C   . ARG A 1 232 ? 36.981 39.636  -0.531  1.00 47.93  ? 592  ARG A C   1 
ATOM   1774 O O   . ARG A 1 232 ? 36.103 39.713  0.320   1.00 48.27  ? 592  ARG A O   1 
ATOM   1775 C CB  . ARG A 1 232 ? 39.135 40.472  0.443   1.00 47.67  ? 592  ARG A CB  1 
ATOM   1776 C CG  . ARG A 1 232 ? 40.389 40.169  1.280   1.00 48.79  ? 592  ARG A CG  1 
ATOM   1777 C CD  . ARG A 1 232 ? 40.977 41.437  1.936   1.00 49.90  ? 592  ARG A CD  1 
ATOM   1778 N NE  . ARG A 1 232 ? 41.633 42.323  0.969   1.00 54.66  ? 592  ARG A NE  1 
ATOM   1779 C CZ  . ARG A 1 232 ? 41.120 43.464  0.504   1.00 55.06  ? 592  ARG A CZ  1 
ATOM   1780 N NH1 . ARG A 1 232 ? 39.936 43.898  0.918   1.00 54.04  ? 592  ARG A NH1 1 
ATOM   1781 N NH2 . ARG A 1 232 ? 41.805 44.184  -0.379  1.00 56.36  ? 592  ARG A NH2 1 
ATOM   1782 N N   . MET A 1 233 ? 36.756 39.879  -1.826  1.00 48.84  ? 593  MET A N   1 
ATOM   1783 C CA  . MET A 1 233 ? 35.538 40.584  -2.313  1.00 49.18  ? 593  MET A CA  1 
ATOM   1784 C C   . MET A 1 233 ? 34.644 39.856  -3.331  1.00 49.07  ? 593  MET A C   1 
ATOM   1785 O O   . MET A 1 233 ? 33.419 40.047  -3.324  1.00 49.03  ? 593  MET A O   1 
ATOM   1786 C CB  . MET A 1 233 ? 35.928 41.912  -2.961  1.00 49.65  ? 593  MET A CB  1 
ATOM   1787 C CG  . MET A 1 233 ? 36.614 42.906  -2.047  1.00 53.28  ? 593  MET A CG  1 
ATOM   1788 S SD  . MET A 1 233 ? 35.650 43.298  -0.579  1.00 60.37  ? 593  MET A SD  1 
ATOM   1789 C CE  . MET A 1 233 ? 34.208 44.110  -1.286  1.00 59.18  ? 593  MET A CE  1 
ATOM   1790 N N   . ASP A 1 234 ? 35.256 39.065  -4.219  1.00 48.16  ? 594  ASP A N   1 
ATOM   1791 C CA  . ASP A 1 234 ? 34.589 38.583  -5.422  1.00 47.84  ? 594  ASP A CA  1 
ATOM   1792 C C   . ASP A 1 234 ? 33.799 37.309  -5.173  1.00 47.42  ? 594  ASP A C   1 
ATOM   1793 O O   . ASP A 1 234 ? 34.075 36.554  -4.231  1.00 47.59  ? 594  ASP A O   1 
ATOM   1794 C CB  . ASP A 1 234 ? 35.605 38.323  -6.548  1.00 47.81  ? 594  ASP A CB  1 
ATOM   1795 C CG  . ASP A 1 234 ? 36.208 39.606  -7.141  1.00 49.71  ? 594  ASP A CG  1 
ATOM   1796 O OD1 . ASP A 1 234 ? 35.691 40.741  -6.917  1.00 50.29  ? 594  ASP A OD1 1 
ATOM   1797 O OD2 . ASP A 1 234 ? 37.211 39.457  -7.874  1.00 50.52  ? 594  ASP A OD2 1 
ATOM   1798 N N   . ASN A 1 235 ? 32.815 37.076  -6.032  1.00 47.11  ? 595  ASN A N   1 
ATOM   1799 C CA  . ASN A 1 235 ? 32.049 35.839  -6.026  1.00 47.02  ? 595  ASN A CA  1 
ATOM   1800 C C   . ASN A 1 235 ? 32.639 34.952  -7.100  1.00 45.95  ? 595  ASN A C   1 
ATOM   1801 O O   . ASN A 1 235 ? 32.772 35.388  -8.245  1.00 45.37  ? 595  ASN A O   1 
ATOM   1802 C CB  . ASN A 1 235 ? 30.577 36.098  -6.349  1.00 47.62  ? 595  ASN A CB  1 
ATOM   1803 C CG  . ASN A 1 235 ? 29.959 37.133  -5.448  1.00 50.91  ? 595  ASN A CG  1 
ATOM   1804 O OD1 . ASN A 1 235 ? 29.223 37.999  -5.909  1.00 54.44  ? 595  ASN A OD1 1 
ATOM   1805 N ND2 . ASN A 1 235 ? 30.259 37.059  -4.153  1.00 54.47  ? 595  ASN A ND2 1 
ATOM   1806 N N   . PRO A 1 236 ? 33.033 33.720  -6.736  1.00 45.48  ? 596  PRO A N   1 
ATOM   1807 C CA  . PRO A 1 236 ? 33.536 32.821  -7.776  1.00 44.96  ? 596  PRO A CA  1 
ATOM   1808 C C   . PRO A 1 236 ? 32.473 32.505  -8.807  1.00 44.87  ? 596  PRO A C   1 
ATOM   1809 O O   . PRO A 1 236 ? 31.278 32.447  -8.493  1.00 44.63  ? 596  PRO A O   1 
ATOM   1810 C CB  . PRO A 1 236 ? 33.911 31.557  -7.004  1.00 44.78  ? 596  PRO A CB  1 
ATOM   1811 C CG  . PRO A 1 236 ? 34.136 32.029  -5.600  1.00 45.16  ? 596  PRO A CG  1 
ATOM   1812 C CD  . PRO A 1 236 ? 33.104 33.103  -5.397  1.00 45.22  ? 596  PRO A CD  1 
ATOM   1813 N N   . PHE A 1 237 ? 32.932 32.322  -10.034 1.00 44.65  ? 597  PHE A N   1 
ATOM   1814 C CA  . PHE A 1 237 ? 32.097 31.921  -11.138 1.00 44.10  ? 597  PHE A CA  1 
ATOM   1815 C C   . PHE A 1 237 ? 31.830 30.404  -11.113 1.00 43.85  ? 597  PHE A C   1 
ATOM   1816 O O   . PHE A 1 237 ? 32.754 29.589  -10.953 1.00 44.41  ? 597  PHE A O   1 
ATOM   1817 C CB  . PHE A 1 237 ? 32.761 32.333  -12.457 1.00 43.19  ? 597  PHE A CB  1 
ATOM   1818 C CG  . PHE A 1 237 ? 32.091 31.763  -13.670 1.00 43.64  ? 597  PHE A CG  1 
ATOM   1819 C CD1 . PHE A 1 237 ? 30.849 32.242  -14.080 1.00 42.04  ? 597  PHE A CD1 1 
ATOM   1820 C CD2 . PHE A 1 237 ? 32.699 30.754  -14.406 1.00 40.33  ? 597  PHE A CD2 1 
ATOM   1821 C CE1 . PHE A 1 237 ? 30.230 31.706  -15.182 1.00 42.43  ? 597  PHE A CE1 1 
ATOM   1822 C CE2 . PHE A 1 237 ? 32.088 30.234  -15.525 1.00 40.83  ? 597  PHE A CE2 1 
ATOM   1823 C CZ  . PHE A 1 237 ? 30.851 30.697  -15.912 1.00 39.85  ? 597  PHE A CZ  1 
ATOM   1824 N N   . TYR A 1 238 ? 30.560 30.043  -11.283 1.00 43.38  ? 598  TYR A N   1 
ATOM   1825 C CA  . TYR A 1 238 ? 30.122 28.648  -11.325 1.00 43.51  ? 598  TYR A CA  1 
ATOM   1826 C C   . TYR A 1 238 ? 29.478 28.432  -12.669 1.00 43.22  ? 598  TYR A C   1 
ATOM   1827 O O   . TYR A 1 238 ? 28.473 29.061  -12.963 1.00 43.58  ? 598  TYR A O   1 
ATOM   1828 C CB  . TYR A 1 238 ? 29.140 28.351  -10.185 1.00 43.30  ? 598  TYR A CB  1 
ATOM   1829 C CG  . TYR A 1 238 ? 29.726 28.615  -8.798  1.00 43.10  ? 598  TYR A CG  1 
ATOM   1830 C CD1 . TYR A 1 238 ? 29.260 29.669  -8.004  1.00 43.11  ? 598  TYR A CD1 1 
ATOM   1831 C CD2 . TYR A 1 238 ? 30.765 27.822  -8.300  1.00 41.00  ? 598  TYR A CD2 1 
ATOM   1832 C CE1 . TYR A 1 238 ? 29.807 29.906  -6.728  1.00 43.46  ? 598  TYR A CE1 1 
ATOM   1833 C CE2 . TYR A 1 238 ? 31.306 28.039  -7.062  1.00 41.19  ? 598  TYR A CE2 1 
ATOM   1834 C CZ  . TYR A 1 238 ? 30.836 29.083  -6.273  1.00 43.83  ? 598  TYR A CZ  1 
ATOM   1835 O OH  . TYR A 1 238 ? 31.395 29.285  -5.030  1.00 43.98  ? 598  TYR A OH  1 
ATOM   1836 N N   . PRO A 1 239 ? 30.097 27.596  -13.520 1.00 43.37  ? 599  PRO A N   1 
ATOM   1837 C CA  . PRO A 1 239 ? 29.580 27.404  -14.872 1.00 43.44  ? 599  PRO A CA  1 
ATOM   1838 C C   . PRO A 1 239 ? 28.236 26.717  -14.848 1.00 43.93  ? 599  PRO A C   1 
ATOM   1839 O O   . PRO A 1 239 ? 27.979 25.918  -13.949 1.00 43.96  ? 599  PRO A O   1 
ATOM   1840 C CB  . PRO A 1 239 ? 30.605 26.480  -15.538 1.00 43.41  ? 599  PRO A CB  1 
ATOM   1841 C CG  . PRO A 1 239 ? 31.762 26.390  -14.612 1.00 42.94  ? 599  PRO A CG  1 
ATOM   1842 C CD  . PRO A 1 239 ? 31.297 26.782  -13.253 1.00 43.15  ? 599  PRO A CD  1 
ATOM   1843 N N   . ARG A 1 240 ? 27.418 27.030  -15.855 1.00 44.63  ? 600  ARG A N   1 
ATOM   1844 C CA  . ARG A 1 240 ? 26.079 26.494  -16.076 1.00 45.87  ? 600  ARG A CA  1 
ATOM   1845 C C   . ARG A 1 240 ? 26.012 24.965  -15.926 1.00 45.95  ? 600  ARG A C   1 
ATOM   1846 O O   . ARG A 1 240 ? 25.046 24.422  -15.347 1.00 45.73  ? 600  ARG A O   1 
ATOM   1847 C CB  . ARG A 1 240 ? 25.611 26.895  -17.490 1.00 45.14  ? 600  ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 240 ? 24.184 27.321  -17.564 1.00 47.75  ? 600  ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 240 ? 23.743 27.741  -18.975 1.00 48.38  ? 600  ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 240 ? 23.625 26.585  -19.860 1.00 56.76  ? 600  ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 240 ? 22.481 26.038  -20.279 1.00 56.91  ? 600  ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 240 ? 21.297 26.563  -19.943 1.00 58.02  ? 600  ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 240 ? 22.532 24.977  -21.074 1.00 56.00  ? 600  ARG A NH2 1 
ATOM   1854 N N   . TRP A 1 241 ? 27.033 24.279  -16.451 1.00 45.79  ? 601  TRP A N   1 
ATOM   1855 C CA  . TRP A 1 241 ? 27.045 22.811  -16.486 1.00 45.89  ? 601  TRP A CA  1 
ATOM   1856 C C   . TRP A 1 241 ? 27.462 22.169  -15.155 1.00 45.85  ? 601  TRP A C   1 
ATOM   1857 O O   . TRP A 1 241 ? 27.344 20.959  -15.000 1.00 45.47  ? 601  TRP A O   1 
ATOM   1858 C CB  . TRP A 1 241 ? 27.969 22.301  -17.604 1.00 45.94  ? 601  TRP A CB  1 
ATOM   1859 C CG  . TRP A 1 241 ? 29.390 22.892  -17.556 1.00 45.23  ? 601  TRP A CG  1 
ATOM   1860 C CD1 . TRP A 1 241 ? 29.860 23.931  -18.310 1.00 44.24  ? 601  TRP A CD1 1 
ATOM   1861 C CD2 . TRP A 1 241 ? 30.488 22.476  -16.713 1.00 42.76  ? 601  TRP A CD2 1 
ATOM   1862 N NE1 . TRP A 1 241 ? 31.175 24.179  -17.994 1.00 45.76  ? 601  TRP A NE1 1 
ATOM   1863 C CE2 . TRP A 1 241 ? 31.581 23.308  -17.014 1.00 43.86  ? 601  TRP A CE2 1 
ATOM   1864 C CE3 . TRP A 1 241 ? 30.648 21.478  -15.743 1.00 44.62  ? 601  TRP A CE3 1 
ATOM   1865 C CZ2 . TRP A 1 241 ? 32.838 23.181  -16.375 1.00 45.70  ? 601  TRP A CZ2 1 
ATOM   1866 C CZ3 . TRP A 1 241 ? 31.905 21.344  -15.100 1.00 46.57  ? 601  TRP A CZ3 1 
ATOM   1867 C CH2 . TRP A 1 241 ? 32.983 22.202  -15.427 1.00 44.87  ? 601  TRP A CH2 1 
ATOM   1868 N N   . LEU A 1 242 ? 27.989 22.959  -14.220 1.00 45.97  ? 602  LEU A N   1 
ATOM   1869 C CA  . LEU A 1 242 ? 28.500 22.396  -12.972 1.00 46.35  ? 602  LEU A CA  1 
ATOM   1870 C C   . LEU A 1 242 ? 27.406 21.704  -12.165 1.00 47.31  ? 602  LEU A C   1 
ATOM   1871 O O   . LEU A 1 242 ? 26.278 22.203  -12.060 1.00 46.71  ? 602  LEU A O   1 
ATOM   1872 C CB  . LEU A 1 242 ? 29.193 23.451  -12.118 1.00 46.32  ? 602  LEU A CB  1 
ATOM   1873 C CG  . LEU A 1 242 ? 29.910 22.960  -10.855 1.00 46.65  ? 602  LEU A CG  1 
ATOM   1874 C CD1 . LEU A 1 242 ? 31.114 22.046  -11.202 1.00 44.28  ? 602  LEU A CD1 1 
ATOM   1875 C CD2 . LEU A 1 242 ? 30.329 24.126  -9.947  1.00 45.86  ? 602  LEU A CD2 1 
ATOM   1876 N N   . GLU A 1 243 ? 27.756 20.525  -11.640 1.00 48.33  ? 603  GLU A N   1 
ATOM   1877 C CA  . GLU A 1 243 ? 26.872 19.713  -10.812 1.00 49.05  ? 603  GLU A CA  1 
ATOM   1878 C C   . GLU A 1 243 ? 26.442 20.533  -9.602  1.00 48.33  ? 603  GLU A C   1 
ATOM   1879 O O   . GLU A 1 243 ? 27.278 21.113  -8.916  1.00 48.80  ? 603  GLU A O   1 
ATOM   1880 C CB  . GLU A 1 243 ? 27.608 18.414  -10.401 1.00 49.91  ? 603  GLU A CB  1 
ATOM   1881 C CG  . GLU A 1 243 ? 27.123 17.712  -9.127  1.00 53.18  ? 603  GLU A CG  1 
ATOM   1882 C CD  . GLU A 1 243 ? 25.708 17.128  -9.248  1.00 59.23  ? 603  GLU A CD  1 
ATOM   1883 O OE1 . GLU A 1 243 ? 25.412 16.476  -10.287 1.00 61.74  ? 603  GLU A OE1 1 
ATOM   1884 O OE2 . GLU A 1 243 ? 24.894 17.322  -8.297  1.00 60.71  ? 603  GLU A OE2 1 
ATOM   1885 N N   . LYS A 1 244 ? 25.137 20.568  -9.365  1.00 47.85  ? 604  LYS A N   1 
ATOM   1886 C CA  . LYS A 1 244 ? 24.495 21.289  -8.271  1.00 48.04  ? 604  LYS A CA  1 
ATOM   1887 C C   . LYS A 1 244 ? 25.140 21.122  -6.906  1.00 46.87  ? 604  LYS A C   1 
ATOM   1888 O O   . LYS A 1 244 ? 25.313 22.093  -6.165  1.00 46.82  ? 604  LYS A O   1 
ATOM   1889 C CB  . LYS A 1 244 ? 23.036 20.824  -8.158  1.00 48.61  ? 604  LYS A CB  1 
ATOM   1890 C CG  . LYS A 1 244 ? 22.014 21.773  -8.749  1.00 53.33  ? 604  LYS A CG  1 
ATOM   1891 C CD  . LYS A 1 244 ? 20.652 21.074  -8.879  1.00 58.66  ? 604  LYS A CD  1 
ATOM   1892 C CE  . LYS A 1 244 ? 20.357 20.173  -7.664  1.00 61.24  ? 604  LYS A CE  1 
ATOM   1893 N NZ  . LYS A 1 244 ? 19.261 19.186  -7.943  1.00 63.84  ? 604  LYS A NZ  1 
ATOM   1894 N N   . GLU A 1 245 ? 25.432 19.876  -6.550  1.00 46.47  ? 605  GLU A N   1 
ATOM   1895 C CA  . GLU A 1 245 ? 25.999 19.562  -5.242  1.00 45.86  ? 605  GLU A CA  1 
ATOM   1896 C C   . GLU A 1 245 ? 27.453 19.998  -5.159  1.00 45.15  ? 605  GLU A C   1 
ATOM   1897 O O   . GLU A 1 245 ? 27.942 20.294  -4.073  1.00 45.09  ? 605  GLU A O   1 
ATOM   1898 C CB  . GLU A 1 245 ? 25.851 18.067  -4.909  1.00 46.57  ? 605  GLU A CB  1 
ATOM   1899 C CG  . GLU A 1 245 ? 24.384 17.532  -4.886  1.00 47.34  ? 605  GLU A CG  1 
ATOM   1900 C CD  . GLU A 1 245 ? 23.485 18.224  -3.853  1.00 52.32  ? 605  GLU A CD  1 
ATOM   1901 O OE1 . GLU A 1 245 ? 23.995 18.981  -2.993  1.00 55.32  ? 605  GLU A OE1 1 
ATOM   1902 O OE2 . GLU A 1 245 ? 22.246 18.017  -3.898  1.00 55.09  ? 605  GLU A OE2 1 
ATOM   1903 N N   . ALA A 1 246 ? 28.137 20.035  -6.301  1.00 44.51  ? 606  ALA A N   1 
ATOM   1904 C CA  . ALA A 1 246 ? 29.519 20.503  -6.342  1.00 44.84  ? 606  ALA A CA  1 
ATOM   1905 C C   . ALA A 1 246 ? 29.527 22.006  -6.128  1.00 44.54  ? 606  ALA A C   1 
ATOM   1906 O O   . ALA A 1 246 ? 30.288 22.472  -5.312  1.00 45.03  ? 606  ALA A O   1 
ATOM   1907 C CB  . ALA A 1 246 ? 30.227 20.107  -7.651  1.00 44.40  ? 606  ALA A CB  1 
ATOM   1908 N N   . LYS A 1 247 ? 28.639 22.748  -6.805  1.00 44.49  ? 607  LYS A N   1 
ATOM   1909 C CA  . LYS A 1 247 ? 28.466 24.195  -6.537  1.00 44.50  ? 607  LYS A CA  1 
ATOM   1910 C C   . LYS A 1 247 ? 28.130 24.463  -5.078  1.00 44.31  ? 607  LYS A C   1 
ATOM   1911 O O   . LYS A 1 247 ? 28.723 25.344  -4.441  1.00 43.93  ? 607  LYS A O   1 
ATOM   1912 C CB  . LYS A 1 247 ? 27.365 24.832  -7.413  1.00 44.56  ? 607  LYS A CB  1 
ATOM   1913 C CG  . LYS A 1 247 ? 27.176 26.345  -7.121  1.00 44.54  ? 607  LYS A CG  1 
ATOM   1914 C CD  . LYS A 1 247 ? 26.109 26.989  -7.978  1.00 44.98  ? 607  LYS A CD  1 
ATOM   1915 C CE  . LYS A 1 247 ? 25.781 28.372  -7.459  1.00 46.86  ? 607  LYS A CE  1 
ATOM   1916 N NZ  . LYS A 1 247 ? 24.997 29.130  -8.465  1.00 49.13  ? 607  LYS A NZ  1 
ATOM   1917 N N   . ASP A 1 248 ? 27.154 23.714  -4.566  1.00 44.42  ? 608  ASP A N   1 
ATOM   1918 C CA  . ASP A 1 248 ? 26.693 23.867  -3.186  1.00 44.74  ? 608  ASP A CA  1 
ATOM   1919 C C   . ASP A 1 248 ? 27.806 23.709  -2.160  1.00 44.18  ? 608  ASP A C   1 
ATOM   1920 O O   . ASP A 1 248 ? 27.875 24.486  -1.211  1.00 44.82  ? 608  ASP A O   1 
ATOM   1921 C CB  . ASP A 1 248 ? 25.553 22.890  -2.846  1.00 45.02  ? 608  ASP A CB  1 
ATOM   1922 C CG  . ASP A 1 248 ? 24.970 23.162  -1.467  1.00 48.01  ? 608  ASP A CG  1 
ATOM   1923 O OD1 . ASP A 1 248 ? 24.224 24.159  -1.328  1.00 54.29  ? 608  ASP A OD1 1 
ATOM   1924 O OD2 . ASP A 1 248 ? 25.274 22.418  -0.507  1.00 50.51  ? 608  ASP A OD2 1 
ATOM   1925 N N   . LEU A 1 249 ? 28.654 22.694  -2.330  1.00 43.59  ? 609  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 249 ? 29.815 22.511  -1.464  1.00 43.06  ? 609  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 249 ? 30.783 23.703  -1.548  1.00 42.61  ? 609  LEU A C   1 
ATOM   1928 O O   . LEU A 1 249 ? 31.184 24.234  -0.519  1.00 42.47  ? 609  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 249 ? 30.543 21.184  -1.762  1.00 42.99  ? 609  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 249 ? 31.800 20.909  -0.907  1.00 42.70  ? 609  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 249 ? 31.413 20.806  0.557   1.00 42.36  ? 609  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 249 ? 32.505 19.638  -1.305  1.00 43.71  ? 609  LEU A CD2 1 
ATOM   1933 N N   . LEU A 1 250 ? 31.125 24.124  -2.768  1.00 42.06  ? 610  LEU A N   1 
ATOM   1934 C CA  . LEU A 1 250 ? 31.969 25.314  -2.993  1.00 42.24  ? 610  LEU A CA  1 
ATOM   1935 C C   . LEU A 1 250 ? 31.423 26.588  -2.348  1.00 42.38  ? 610  LEU A C   1 
ATOM   1936 O O   . LEU A 1 250 ? 32.165 27.315  -1.677  1.00 42.55  ? 610  LEU A O   1 
ATOM   1937 C CB  . LEU A 1 250 ? 32.231 25.524  -4.497  1.00 41.96  ? 610  LEU A CB  1 
ATOM   1938 C CG  . LEU A 1 250 ? 33.125 24.477  -5.184  1.00 42.62  ? 610  LEU A CG  1 
ATOM   1939 C CD1 . LEU A 1 250 ? 33.186 24.649  -6.700  1.00 40.00  ? 610  LEU A CD1 1 
ATOM   1940 C CD2 . LEU A 1 250 ? 34.534 24.517  -4.579  1.00 40.72  ? 610  LEU A CD2 1 
ATOM   1941 N N   . VAL A 1 251 ? 30.125 26.843  -2.536  1.00 43.54  ? 611  VAL A N   1 
ATOM   1942 C CA  . VAL A 1 251 ? 29.412 27.964  -1.879  1.00 43.41  ? 611  VAL A CA  1 
ATOM   1943 C C   . VAL A 1 251 ? 29.569 27.922  -0.346  1.00 44.45  ? 611  VAL A C   1 
ATOM   1944 O O   . VAL A 1 251 ? 29.794 28.955  0.292   1.00 45.01  ? 611  VAL A O   1 
ATOM   1945 C CB  . VAL A 1 251 ? 27.898 28.014  -2.300  1.00 43.73  ? 611  VAL A CB  1 
ATOM   1946 C CG1 . VAL A 1 251 ? 27.075 28.853  -1.335  1.00 42.76  ? 611  VAL A CG1 1 
ATOM   1947 C CG2 . VAL A 1 251 ? 27.722 28.531  -3.756  1.00 40.81  ? 611  VAL A CG2 1 
ATOM   1948 N N   . LYS A 1 252 ? 29.473 26.724  0.235   1.00 44.99  ? 612  LYS A N   1 
ATOM   1949 C CA  . LYS A 1 252 ? 29.673 26.514  1.682   1.00 45.08  ? 612  LYS A CA  1 
ATOM   1950 C C   . LYS A 1 252 ? 31.114 26.633  2.212   1.00 44.72  ? 612  LYS A C   1 
ATOM   1951 O O   . LYS A 1 252 ? 31.307 27.019  3.352   1.00 44.68  ? 612  LYS A O   1 
ATOM   1952 C CB  . LYS A 1 252 ? 29.056 25.180  2.106   1.00 45.45  ? 612  LYS A CB  1 
ATOM   1953 C CG  . LYS A 1 252 ? 27.542 25.265  2.195   1.00 46.78  ? 612  LYS A CG  1 
ATOM   1954 C CD  . LYS A 1 252 ? 26.885 23.910  2.370   1.00 49.42  ? 612  LYS A CD  1 
ATOM   1955 C CE  . LYS A 1 252 ? 25.352 24.088  2.411   1.00 51.20  ? 612  LYS A CE  1 
ATOM   1956 N NZ  . LYS A 1 252 ? 24.705 22.796  2.030   1.00 53.26  ? 612  LYS A NZ  1 
ATOM   1957 N N   . LEU A 1 253 ? 32.113 26.289  1.402   1.00 44.57  ? 613  LEU A N   1 
ATOM   1958 C CA  . LEU A 1 253 ? 33.514 26.522  1.766   1.00 44.79  ? 613  LEU A CA  1 
ATOM   1959 C C   . LEU A 1 253 ? 33.945 27.978  1.535   1.00 44.94  ? 613  LEU A C   1 
ATOM   1960 O O   . LEU A 1 253 ? 34.745 28.513  2.290   1.00 45.63  ? 613  LEU A O   1 
ATOM   1961 C CB  . LEU A 1 253 ? 34.460 25.561  1.018   1.00 44.92  ? 613  LEU A CB  1 
ATOM   1962 C CG  . LEU A 1 253 ? 34.257 24.052  1.236   1.00 44.43  ? 613  LEU A CG  1 
ATOM   1963 C CD1 . LEU A 1 253 ? 34.855 23.243  0.064   1.00 42.82  ? 613  LEU A CD1 1 
ATOM   1964 C CD2 . LEU A 1 253 ? 34.852 23.651  2.555   1.00 42.73  ? 613  LEU A CD2 1 
ATOM   1965 N N   . PHE A 1 254 ? 33.418 28.623  0.501   1.00 44.84  ? 614  PHE A N   1 
ATOM   1966 C CA  . PHE A 1 254 ? 33.751 30.029  0.251   1.00 45.10  ? 614  PHE A CA  1 
ATOM   1967 C C   . PHE A 1 254 ? 32.948 31.036  1.100   1.00 45.55  ? 614  PHE A C   1 
ATOM   1968 O O   . PHE A 1 254 ? 32.635 32.118  0.635   1.00 46.47  ? 614  PHE A O   1 
ATOM   1969 C CB  . PHE A 1 254 ? 33.652 30.371  -1.242  1.00 44.41  ? 614  PHE A CB  1 
ATOM   1970 C CG  . PHE A 1 254 ? 34.705 29.697  -2.103  1.00 44.41  ? 614  PHE A CG  1 
ATOM   1971 C CD1 . PHE A 1 254 ? 36.028 29.618  -1.683  1.00 43.26  ? 614  PHE A CD1 1 
ATOM   1972 C CD2 . PHE A 1 254 ? 34.365 29.156  -3.345  1.00 43.24  ? 614  PHE A CD2 1 
ATOM   1973 C CE1 . PHE A 1 254 ? 37.002 29.005  -2.487  1.00 44.62  ? 614  PHE A CE1 1 
ATOM   1974 C CE2 . PHE A 1 254 ? 35.320 28.545  -4.151  1.00 42.17  ? 614  PHE A CE2 1 
ATOM   1975 C CZ  . PHE A 1 254 ? 36.643 28.467  -3.729  1.00 43.00  ? 614  PHE A CZ  1 
ATOM   1976 N N   . VAL A 1 255 ? 32.621 30.665  2.336   1.00 45.60  ? 615  VAL A N   1 
ATOM   1977 C CA  . VAL A 1 255 ? 32.075 31.579  3.320   1.00 45.64  ? 615  VAL A CA  1 
ATOM   1978 C C   . VAL A 1 255 ? 33.259 32.291  4.001   1.00 46.43  ? 615  VAL A C   1 
ATOM   1979 O O   . VAL A 1 255 ? 34.154 31.635  4.525   1.00 46.43  ? 615  VAL A O   1 
ATOM   1980 C CB  . VAL A 1 255 ? 31.180 30.817  4.352   1.00 45.88  ? 615  VAL A CB  1 
ATOM   1981 C CG1 . VAL A 1 255 ? 30.791 31.708  5.547   1.00 44.52  ? 615  VAL A CG1 1 
ATOM   1982 C CG2 . VAL A 1 255 ? 29.920 30.242  3.663   1.00 44.51  ? 615  VAL A CG2 1 
ATOM   1983 N N   . ARG A 1 256 ? 33.258 33.625  3.986   1.00 47.21  ? 616  ARG A N   1 
ATOM   1984 C CA  . ARG A 1 256 ? 34.411 34.418  4.441   1.00 48.35  ? 616  ARG A CA  1 
ATOM   1985 C C   . ARG A 1 256 ? 34.522 34.554  5.956   1.00 49.36  ? 616  ARG A C   1 
ATOM   1986 O O   . ARG A 1 256 ? 35.576 34.922  6.482   1.00 49.82  ? 616  ARG A O   1 
ATOM   1987 C CB  . ARG A 1 256 ? 34.406 35.799  3.778   1.00 47.77  ? 616  ARG A CB  1 
ATOM   1988 C CG  . ARG A 1 256 ? 34.656 35.704  2.313   1.00 47.44  ? 616  ARG A CG  1 
ATOM   1989 C CD  . ARG A 1 256 ? 35.092 37.008  1.703   1.00 47.74  ? 616  ARG A CD  1 
ATOM   1990 N NE  . ARG A 1 256 ? 35.611 36.755  0.365   1.00 49.30  ? 616  ARG A NE  1 
ATOM   1991 C CZ  . ARG A 1 256 ? 34.858 36.656  -0.724  1.00 49.51  ? 616  ARG A CZ  1 
ATOM   1992 N NH1 . ARG A 1 256 ? 33.540 36.820  -0.644  1.00 51.68  ? 616  ARG A NH1 1 
ATOM   1993 N NH2 . ARG A 1 256 ? 35.419 36.415  -1.896  1.00 47.28  ? 616  ARG A NH2 1 
ATOM   1994 N N   . GLU A 1 257 ? 33.425 34.272  6.651   1.00 50.52  ? 617  GLU A N   1 
ATOM   1995 C CA  . GLU A 1 257 ? 33.424 34.212  8.108   1.00 51.47  ? 617  GLU A CA  1 
ATOM   1996 C C   . GLU A 1 257 ? 33.827 32.790  8.511   1.00 51.15  ? 617  GLU A C   1 
ATOM   1997 O O   . GLU A 1 257 ? 33.050 31.856  8.333   1.00 51.06  ? 617  GLU A O   1 
ATOM   1998 C CB  . GLU A 1 257 ? 32.045 34.592  8.659   1.00 52.00  ? 617  GLU A CB  1 
ATOM   1999 C CG  . GLU A 1 257 ? 31.482 35.924  8.115   1.00 55.21  ? 617  GLU A CG  1 
ATOM   2000 C CD  . GLU A 1 257 ? 30.636 35.768  6.835   1.00 59.31  ? 617  GLU A CD  1 
ATOM   2001 O OE1 . GLU A 1 257 ? 31.099 35.189  5.824   1.00 59.40  ? 617  GLU A OE1 1 
ATOM   2002 O OE2 . GLU A 1 257 ? 29.485 36.252  6.846   1.00 62.66  ? 617  GLU A OE2 1 
ATOM   2003 N N   . PRO A 1 258 ? 35.061 32.621  9.023   1.00 51.30  ? 618  PRO A N   1 
ATOM   2004 C CA  . PRO A 1 258 ? 35.669 31.313  9.263   1.00 51.50  ? 618  PRO A CA  1 
ATOM   2005 C C   . PRO A 1 258 ? 34.814 30.366  10.097  1.00 51.71  ? 618  PRO A C   1 
ATOM   2006 O O   . PRO A 1 258 ? 34.717 29.180  9.773   1.00 52.08  ? 618  PRO A O   1 
ATOM   2007 C CB  . PRO A 1 258 ? 36.965 31.653  10.009  1.00 51.53  ? 618  PRO A CB  1 
ATOM   2008 C CG  . PRO A 1 258 ? 36.811 33.044  10.458  1.00 51.46  ? 618  PRO A CG  1 
ATOM   2009 C CD  . PRO A 1 258 ? 35.973 33.703  9.421   1.00 51.36  ? 618  PRO A CD  1 
ATOM   2010 N N   . GLU A 1 259 ? 34.193 30.884  11.149  1.00 51.71  ? 619  GLU A N   1 
ATOM   2011 C CA  . GLU A 1 259 ? 33.357 30.069  12.027  1.00 52.08  ? 619  GLU A CA  1 
ATOM   2012 C C   . GLU A 1 259 ? 32.036 29.596  11.385  1.00 51.45  ? 619  GLU A C   1 
ATOM   2013 O O   . GLU A 1 259 ? 31.322 28.777  11.965  1.00 51.84  ? 619  GLU A O   1 
ATOM   2014 C CB  . GLU A 1 259 ? 33.114 30.789  13.369  1.00 52.44  ? 619  GLU A CB  1 
ATOM   2015 C CG  . GLU A 1 259 ? 34.323 30.759  14.322  1.00 54.88  ? 619  GLU A CG  1 
ATOM   2016 C CD  . GLU A 1 259 ? 34.708 29.336  14.771  1.00 59.16  ? 619  GLU A CD  1 
ATOM   2017 O OE1 . GLU A 1 259 ? 33.858 28.655  15.387  1.00 61.54  ? 619  GLU A OE1 1 
ATOM   2018 O OE2 . GLU A 1 259 ? 35.859 28.898  14.523  1.00 60.36  ? 619  GLU A OE2 1 
ATOM   2019 N N   . LYS A 1 260 ? 31.732 30.086  10.187  1.00 50.77  ? 620  LYS A N   1 
ATOM   2020 C CA  . LYS A 1 260 ? 30.541 29.652  9.447   1.00 50.22  ? 620  LYS A CA  1 
ATOM   2021 C C   . LYS A 1 260 ? 30.850 28.820  8.201   1.00 49.53  ? 620  LYS A C   1 
ATOM   2022 O O   . LYS A 1 260 ? 29.948 28.496  7.435   1.00 49.48  ? 620  LYS A O   1 
ATOM   2023 C CB  . LYS A 1 260 ? 29.668 30.857  9.096   1.00 50.65  ? 620  LYS A CB  1 
ATOM   2024 C CG  . LYS A 1 260 ? 28.827 31.331  10.271  1.00 51.59  ? 620  LYS A CG  1 
ATOM   2025 C CD  . LYS A 1 260 ? 28.948 32.819  10.494  1.00 54.74  ? 620  LYS A CD  1 
ATOM   2026 C CE  . LYS A 1 260 ? 27.949 33.611  9.659   1.00 56.60  ? 620  LYS A CE  1 
ATOM   2027 N NZ  . LYS A 1 260 ? 27.429 34.800  10.411  1.00 56.76  ? 620  LYS A NZ  1 
ATOM   2028 N N   . ARG A 1 261 ? 32.124 28.477  8.020   1.00 48.56  ? 621  ARG A N   1 
ATOM   2029 C CA  . ARG A 1 261 ? 32.616 27.707  6.870   1.00 48.29  ? 621  ARG A CA  1 
ATOM   2030 C C   . ARG A 1 261 ? 32.454 26.199  7.142   1.00 47.98  ? 621  ARG A C   1 
ATOM   2031 O O   . ARG A 1 261 ? 32.698 25.756  8.257   1.00 47.21  ? 621  ARG A O   1 
ATOM   2032 C CB  . ARG A 1 261 ? 34.095 28.063  6.639   1.00 47.85  ? 621  ARG A CB  1 
ATOM   2033 C CG  . ARG A 1 261 ? 34.738 27.538  5.382   1.00 48.17  ? 621  ARG A CG  1 
ATOM   2034 C CD  . ARG A 1 261 ? 36.139 28.131  5.236   1.00 48.12  ? 621  ARG A CD  1 
ATOM   2035 N NE  . ARG A 1 261 ? 36.066 29.588  5.195   1.00 47.19  ? 621  ARG A NE  1 
ATOM   2036 C CZ  . ARG A 1 261 ? 37.009 30.422  5.624   1.00 44.00  ? 621  ARG A CZ  1 
ATOM   2037 N NH1 . ARG A 1 261 ? 38.144 29.963  6.126   1.00 42.41  ? 621  ARG A NH1 1 
ATOM   2038 N NH2 . ARG A 1 261 ? 36.804 31.727  5.536   1.00 42.38  ? 621  ARG A NH2 1 
ATOM   2039 N N   . LEU A 1 262 ? 32.015 25.428  6.141   1.00 48.10  ? 622  LEU A N   1 
ATOM   2040 C CA  . LEU A 1 262 ? 31.975 23.962  6.255   1.00 48.81  ? 622  LEU A CA  1 
ATOM   2041 C C   . LEU A 1 262 ? 33.404 23.472  6.469   1.00 49.20  ? 622  LEU A C   1 
ATOM   2042 O O   . LEU A 1 262 ? 34.335 23.989  5.835   1.00 49.55  ? 622  LEU A O   1 
ATOM   2043 C CB  . LEU A 1 262 ? 31.436 23.320  4.973   1.00 48.88  ? 622  LEU A CB  1 
ATOM   2044 C CG  . LEU A 1 262 ? 30.264 22.320  4.952   1.00 50.13  ? 622  LEU A CG  1 
ATOM   2045 C CD1 . LEU A 1 262 ? 30.355 21.444  3.716   1.00 50.11  ? 622  LEU A CD1 1 
ATOM   2046 C CD2 . LEU A 1 262 ? 30.097 21.456  6.214   1.00 49.95  ? 622  LEU A CD2 1 
ATOM   2047 N N   . GLY A 1 263 ? 33.576 22.479  7.344   1.00 49.47  ? 623  GLY A N   1 
ATOM   2048 C CA  . GLY A 1 263 ? 34.902 21.999  7.742   1.00 49.40  ? 623  GLY A CA  1 
ATOM   2049 C C   . GLY A 1 263 ? 35.204 22.483  9.143   1.00 49.55  ? 623  GLY A C   1 
ATOM   2050 O O   . GLY A 1 263 ? 35.758 21.752  9.965   1.00 49.73  ? 623  GLY A O   1 
ATOM   2051 N N   . VAL A 1 264 ? 34.821 23.727  9.418   1.00 49.91  ? 624  VAL A N   1 
ATOM   2052 C CA  . VAL A 1 264 ? 34.875 24.285  10.777  1.00 49.97  ? 624  VAL A CA  1 
ATOM   2053 C C   . VAL A 1 264 ? 33.577 23.980  11.531  1.00 50.56  ? 624  VAL A C   1 
ATOM   2054 O O   . VAL A 1 264 ? 33.613 23.467  12.654  1.00 50.37  ? 624  VAL A O   1 
ATOM   2055 C CB  . VAL A 1 264 ? 35.109 25.810  10.758  1.00 49.85  ? 624  VAL A CB  1 
ATOM   2056 C CG1 . VAL A 1 264 ? 35.309 26.346  12.180  1.00 49.03  ? 624  VAL A CG1 1 
ATOM   2057 C CG2 . VAL A 1 264 ? 36.293 26.135  9.882   1.00 48.84  ? 624  VAL A CG2 1 
ATOM   2058 N N   . ARG A 1 265 ? 32.449 24.327  10.906  1.00 51.10  ? 625  ARG A N   1 
ATOM   2059 C CA  . ARG A 1 265 ? 31.106 24.006  11.395  1.00 51.95  ? 625  ARG A CA  1 
ATOM   2060 C C   . ARG A 1 265 ? 30.595 22.765  10.656  1.00 51.67  ? 625  ARG A C   1 
ATOM   2061 O O   . ARG A 1 265 ? 31.189 22.343  9.656   1.00 51.90  ? 625  ARG A O   1 
ATOM   2062 C CB  . ARG A 1 265 ? 30.141 25.181  11.143  1.00 52.47  ? 625  ARG A CB  1 
ATOM   2063 C CG  . ARG A 1 265 ? 29.748 25.351  9.651   1.00 55.41  ? 625  ARG A CG  1 
ATOM   2064 C CD  . ARG A 1 265 ? 28.251 25.669  9.446   1.00 60.83  ? 625  ARG A CD  1 
ATOM   2065 N NE  . ARG A 1 265 ? 27.579 24.653  8.613   1.00 63.33  ? 625  ARG A NE  1 
ATOM   2066 C CZ  . ARG A 1 265 ? 27.606 24.596  7.277   1.00 64.89  ? 625  ARG A CZ  1 
ATOM   2067 N NH1 . ARG A 1 265 ? 26.958 23.624  6.637   1.00 65.38  ? 625  ARG A NH1 1 
ATOM   2068 N NH2 . ARG A 1 265 ? 28.275 25.500  6.570   1.00 64.57  ? 625  ARG A NH2 1 
ATOM   2069 N N   . GLY A 1 266 ? 29.489 22.197  11.132  1.00 51.36  ? 626  GLY A N   1 
ATOM   2070 C CA  . GLY A 1 266 ? 28.812 21.110  10.428  1.00 51.22  ? 626  GLY A CA  1 
ATOM   2071 C C   . GLY A 1 266 ? 29.674 19.873  10.244  1.00 51.55  ? 626  GLY A C   1 
ATOM   2072 O O   . GLY A 1 266 ? 30.642 19.663  10.988  1.00 51.97  ? 626  GLY A O   1 
ATOM   2073 N N   . ASP A 1 267 ? 29.321 19.052  9.256   1.00 51.01  ? 627  ASP A N   1 
ATOM   2074 C CA  . ASP A 1 267 ? 30.018 17.798  9.003   1.00 50.43  ? 627  ASP A CA  1 
ATOM   2075 C C   . ASP A 1 267 ? 30.183 17.628  7.498   1.00 49.62  ? 627  ASP A C   1 
ATOM   2076 O O   . ASP A 1 267 ? 29.269 17.173  6.811   1.00 49.47  ? 627  ASP A O   1 
ATOM   2077 C CB  . ASP A 1 267 ? 29.264 16.607  9.628   1.00 50.78  ? 627  ASP A CB  1 
ATOM   2078 C CG  . ASP A 1 267 ? 30.102 15.311  9.649   1.00 52.03  ? 627  ASP A CG  1 
ATOM   2079 O OD1 . ASP A 1 267 ? 31.211 15.291  9.071   1.00 53.97  ? 627  ASP A OD1 1 
ATOM   2080 O OD2 . ASP A 1 267 ? 29.662 14.309  10.258  1.00 52.69  ? 627  ASP A OD2 1 
ATOM   2081 N N   . ILE A 1 268 ? 31.357 18.008  6.999   1.00 48.74  ? 628  ILE A N   1 
ATOM   2082 C CA  . ILE A 1 268 ? 31.664 17.971  5.571   1.00 48.08  ? 628  ILE A CA  1 
ATOM   2083 C C   . ILE A 1 268 ? 31.478 16.567  4.932   1.00 47.89  ? 628  ILE A C   1 
ATOM   2084 O O   . ILE A 1 268 ? 31.117 16.458  3.768   1.00 47.50  ? 628  ILE A O   1 
ATOM   2085 C CB  . ILE A 1 268 ? 33.081 18.592  5.288   1.00 48.02  ? 628  ILE A CB  1 
ATOM   2086 C CG1 . ILE A 1 268 ? 33.280 18.869  3.788   1.00 47.73  ? 628  ILE A CG1 1 
ATOM   2087 C CG2 . ILE A 1 268 ? 34.195 17.732  5.923   1.00 47.32  ? 628  ILE A CG2 1 
ATOM   2088 C CD1 . ILE A 1 268 ? 34.382 19.897  3.445   1.00 47.51  ? 628  ILE A CD1 1 
ATOM   2089 N N   . ARG A 1 269 ? 31.692 15.510  5.707   1.00 47.92  ? 629  ARG A N   1 
ATOM   2090 C CA  . ARG A 1 269 ? 31.527 14.131  5.218   1.00 48.56  ? 629  ARG A CA  1 
ATOM   2091 C C   . ARG A 1 269 ? 30.092 13.828  4.821   1.00 48.77  ? 629  ARG A C   1 
ATOM   2092 O O   . ARG A 1 269 ? 29.826 12.987  3.958   1.00 48.57  ? 629  ARG A O   1 
ATOM   2093 C CB  . ARG A 1 269 ? 31.983 13.131  6.285   1.00 48.63  ? 629  ARG A CB  1 
ATOM   2094 C CG  . ARG A 1 269 ? 33.507 13.095  6.453   1.00 48.33  ? 629  ARG A CG  1 
ATOM   2095 C CD  . ARG A 1 269 ? 33.885 12.066  7.465   1.00 47.17  ? 629  ARG A CD  1 
ATOM   2096 N NE  . ARG A 1 269 ? 35.278 12.206  7.858   1.00 48.13  ? 629  ARG A NE  1 
ATOM   2097 C CZ  . ARG A 1 269 ? 35.987 11.256  8.464   1.00 48.77  ? 629  ARG A CZ  1 
ATOM   2098 N NH1 . ARG A 1 269 ? 35.428 10.069  8.733   1.00 44.99  ? 629  ARG A NH1 1 
ATOM   2099 N NH2 . ARG A 1 269 ? 37.258 11.497  8.791   1.00 47.25  ? 629  ARG A NH2 1 
ATOM   2100 N N   . GLN A 1 270 ? 29.171 14.547  5.450   1.00 48.92  ? 630  GLN A N   1 
ATOM   2101 C CA  . GLN A 1 270 ? 27.756 14.354  5.226   1.00 49.20  ? 630  GLN A CA  1 
ATOM   2102 C C   . GLN A 1 270 ? 27.207 15.181  4.049   1.00 48.32  ? 630  GLN A C   1 
ATOM   2103 O O   . GLN A 1 270 ? 26.026 15.071  3.718   1.00 48.69  ? 630  GLN A O   1 
ATOM   2104 C CB  . GLN A 1 270 ? 27.004 14.651  6.521   1.00 49.43  ? 630  GLN A CB  1 
ATOM   2105 C CG  . GLN A 1 270 ? 25.746 13.820  6.734   1.00 53.42  ? 630  GLN A CG  1 
ATOM   2106 C CD  . GLN A 1 270 ? 25.961 12.315  6.568   1.00 57.39  ? 630  GLN A CD  1 
ATOM   2107 O OE1 . GLN A 1 270 ? 27.078 11.789  6.763   1.00 57.86  ? 630  GLN A OE1 1 
ATOM   2108 N NE2 . GLN A 1 270 ? 24.882 11.613  6.212   1.00 56.81  ? 630  GLN A NE2 1 
ATOM   2109 N N   . HIS A 1 271 ? 28.052 15.990  3.409   1.00 47.06  ? 631  HIS A N   1 
ATOM   2110 C CA  . HIS A 1 271 ? 27.590 16.786  2.268   1.00 46.08  ? 631  HIS A CA  1 
ATOM   2111 C C   . HIS A 1 271 ? 27.105 15.863  1.151   1.00 46.01  ? 631  HIS A C   1 
ATOM   2112 O O   . HIS A 1 271 ? 27.716 14.826  0.918   1.00 46.47  ? 631  HIS A O   1 
ATOM   2113 C CB  . HIS A 1 271 ? 28.652 17.758  1.751   1.00 45.08  ? 631  HIS A CB  1 
ATOM   2114 C CG  . HIS A 1 271 ? 28.093 18.783  0.815   1.00 43.47  ? 631  HIS A CG  1 
ATOM   2115 N ND1 . HIS A 1 271 ? 27.975 18.567  -0.542  1.00 40.23  ? 631  HIS A ND1 1 
ATOM   2116 C CD2 . HIS A 1 271 ? 27.540 19.996  1.052   1.00 41.25  ? 631  HIS A CD2 1 
ATOM   2117 C CE1 . HIS A 1 271 ? 27.405 19.617  -1.104  1.00 40.69  ? 631  HIS A CE1 1 
ATOM   2118 N NE2 . HIS A 1 271 ? 27.123 20.495  -0.157  1.00 40.28  ? 631  HIS A NE2 1 
ATOM   2119 N N   . PRO A 1 272 ? 25.967 16.194  0.506   1.00 45.75  ? 632  PRO A N   1 
ATOM   2120 C CA  . PRO A 1 272 ? 25.454 15.361  -0.591  1.00 45.45  ? 632  PRO A CA  1 
ATOM   2121 C C   . PRO A 1 272 ? 26.422 15.033  -1.738  1.00 45.43  ? 632  PRO A C   1 
ATOM   2122 O O   . PRO A 1 272 ? 26.225 14.015  -2.390  1.00 45.34  ? 632  PRO A O   1 
ATOM   2123 C CB  . PRO A 1 272 ? 24.234 16.146  -1.092  1.00 45.44  ? 632  PRO A CB  1 
ATOM   2124 C CG  . PRO A 1 272 ? 23.754 16.869  0.133   1.00 45.28  ? 632  PRO A CG  1 
ATOM   2125 C CD  . PRO A 1 272 ? 25.032 17.295  0.825   1.00 45.83  ? 632  PRO A CD  1 
ATOM   2126 N N   . LEU A 1 273 ? 27.432 15.876  -1.997  1.00 45.17  ? 633  LEU A N   1 
ATOM   2127 C CA  . LEU A 1 273 ? 28.499 15.548  -2.962  1.00 44.72  ? 633  LEU A CA  1 
ATOM   2128 C C   . LEU A 1 273 ? 29.160 14.188  -2.681  1.00 44.89  ? 633  LEU A C   1 
ATOM   2129 O O   . LEU A 1 273 ? 29.551 13.469  -3.611  1.00 44.20  ? 633  LEU A O   1 
ATOM   2130 C CB  . LEU A 1 273 ? 29.594 16.643  -3.014  1.00 45.07  ? 633  LEU A CB  1 
ATOM   2131 C CG  . LEU A 1 273 ? 30.628 16.487  -4.158  1.00 44.62  ? 633  LEU A CG  1 
ATOM   2132 C CD1 . LEU A 1 273 ? 29.960 16.675  -5.538  1.00 44.03  ? 633  LEU A CD1 1 
ATOM   2133 C CD2 . LEU A 1 273 ? 31.833 17.425  -4.041  1.00 43.77  ? 633  LEU A CD2 1 
ATOM   2134 N N   . PHE A 1 274 ? 29.286 13.854  -1.398  1.00 45.24  ? 634  PHE A N   1 
ATOM   2135 C CA  . PHE A 1 274 ? 29.982 12.637  -0.955  1.00 46.12  ? 634  PHE A CA  1 
ATOM   2136 C C   . PHE A 1 274 ? 29.023 11.518  -0.568  1.00 47.43  ? 634  PHE A C   1 
ATOM   2137 O O   . PHE A 1 274 ? 29.425 10.540  0.051   1.00 47.60  ? 634  PHE A O   1 
ATOM   2138 C CB  . PHE A 1 274 ? 30.926 12.948  0.210   1.00 45.26  ? 634  PHE A CB  1 
ATOM   2139 C CG  . PHE A 1 274 ? 31.875 14.056  -0.075  1.00 44.07  ? 634  PHE A CG  1 
ATOM   2140 C CD1 . PHE A 1 274 ? 32.831 13.924  -1.078  1.00 43.17  ? 634  PHE A CD1 1 
ATOM   2141 C CD2 . PHE A 1 274 ? 31.809 15.244  0.642   1.00 42.45  ? 634  PHE A CD2 1 
ATOM   2142 C CE1 . PHE A 1 274 ? 33.725 14.961  -1.359  1.00 41.20  ? 634  PHE A CE1 1 
ATOM   2143 C CE2 . PHE A 1 274 ? 32.694 16.291  0.364   1.00 42.99  ? 634  PHE A CE2 1 
ATOM   2144 C CZ  . PHE A 1 274 ? 33.649 16.149  -0.635  1.00 41.94  ? 634  PHE A CZ  1 
ATOM   2145 N N   . ARG A 1 275 ? 27.763 11.693  -0.952  1.00 49.15  ? 635  ARG A N   1 
ATOM   2146 C CA  . ARG A 1 275 ? 26.642 10.773  -0.740  1.00 51.86  ? 635  ARG A CA  1 
ATOM   2147 C C   . ARG A 1 275 ? 27.006 9.286   -0.891  1.00 51.99  ? 635  ARG A C   1 
ATOM   2148 O O   . ARG A 1 275 ? 26.508 8.430   -0.135  1.00 52.24  ? 635  ARG A O   1 
ATOM   2149 C CB  . ARG A 1 275 ? 25.568 11.142  -1.768  1.00 51.03  ? 635  ARG A CB  1 
ATOM   2150 C CG  . ARG A 1 275 ? 24.195 10.623  -1.548  1.00 54.94  ? 635  ARG A CG  1 
ATOM   2151 C CD  . ARG A 1 275 ? 23.222 11.290  -2.567  1.00 55.46  ? 635  ARG A CD  1 
ATOM   2152 N NE  . ARG A 1 275 ? 23.887 11.518  -3.848  1.00 61.06  ? 635  ARG A NE  1 
ATOM   2153 C CZ  . ARG A 1 275 ? 23.559 12.461  -4.734  1.00 64.52  ? 635  ARG A CZ  1 
ATOM   2154 N NH1 . ARG A 1 275 ? 22.555 13.313  -4.506  1.00 64.04  ? 635  ARG A NH1 1 
ATOM   2155 N NH2 . ARG A 1 275 ? 24.263 12.559  -5.859  1.00 66.85  ? 635  ARG A NH2 1 
ATOM   2156 N N   . GLU A 1 276 ? 27.865 9.001   -1.871  1.00 52.38  ? 636  GLU A N   1 
ATOM   2157 C CA  . GLU A 1 276 ? 28.181 7.648   -2.297  1.00 53.51  ? 636  GLU A CA  1 
ATOM   2158 C C   . GLU A 1 276 ? 29.546 7.196   -1.795  1.00 52.56  ? 636  GLU A C   1 
ATOM   2159 O O   . GLU A 1 276 ? 30.020 6.113   -2.143  1.00 53.06  ? 636  GLU A O   1 
ATOM   2160 C CB  . GLU A 1 276 ? 28.132 7.562   -3.823  1.00 53.35  ? 636  GLU A CB  1 
ATOM   2161 C CG  . GLU A 1 276 ? 26.760 7.904   -4.390  1.00 56.27  ? 636  GLU A CG  1 
ATOM   2162 C CD  . GLU A 1 276 ? 26.642 7.690   -5.895  1.00 57.39  ? 636  GLU A CD  1 
ATOM   2163 O OE1 . GLU A 1 276 ? 27.666 7.804   -6.615  1.00 61.65  ? 636  GLU A OE1 1 
ATOM   2164 O OE2 . GLU A 1 276 ? 25.497 7.410   -6.353  1.00 64.27  ? 636  GLU A OE2 1 
ATOM   2165 N N   . ILE A 1 277 ? 30.170 8.029   -0.977  1.00 51.45  ? 637  ILE A N   1 
ATOM   2166 C CA  . ILE A 1 277 ? 31.440 7.688   -0.358  1.00 50.49  ? 637  ILE A CA  1 
ATOM   2167 C C   . ILE A 1 277 ? 31.179 6.967   0.969   1.00 49.71  ? 637  ILE A C   1 
ATOM   2168 O O   . ILE A 1 277 ? 30.469 7.484   1.855   1.00 48.86  ? 637  ILE A O   1 
ATOM   2169 C CB  . ILE A 1 277 ? 32.318 8.950   -0.101  1.00 49.97  ? 637  ILE A CB  1 
ATOM   2170 C CG1 . ILE A 1 277 ? 32.509 9.772   -1.381  1.00 50.31  ? 637  ILE A CG1 1 
ATOM   2171 C CG2 . ILE A 1 277 ? 33.654 8.571   0.555   1.00 50.75  ? 637  ILE A CG2 1 
ATOM   2172 C CD1 . ILE A 1 277 ? 33.517 9.208   -2.396  1.00 50.93  ? 637  ILE A CD1 1 
ATOM   2173 N N   . ASN A 1 278 ? 31.747 5.768   1.071   1.00 48.77  ? 638  ASN A N   1 
ATOM   2174 C CA  . ASN A 1 278 ? 31.930 5.068   2.333   1.00 48.17  ? 638  ASN A CA  1 
ATOM   2175 C C   . ASN A 1 278 ? 33.305 5.496   2.892   1.00 47.68  ? 638  ASN A C   1 
ATOM   2176 O O   . ASN A 1 278 ? 34.360 5.117   2.365   1.00 47.69  ? 638  ASN A O   1 
ATOM   2177 C CB  . ASN A 1 278 ? 31.841 3.548   2.112   1.00 47.95  ? 638  ASN A CB  1 
ATOM   2178 C CG  . ASN A 1 278 ? 31.891 2.758   3.406   1.00 49.18  ? 638  ASN A CG  1 
ATOM   2179 O OD1 . ASN A 1 278 ? 32.720 3.014   4.277   1.00 50.83  ? 638  ASN A OD1 1 
ATOM   2180 N ND2 . ASN A 1 278 ? 30.998 1.783   3.538   1.00 50.75  ? 638  ASN A ND2 1 
ATOM   2181 N N   . TRP A 1 279 ? 33.269 6.310   3.943   1.00 47.03  ? 639  TRP A N   1 
ATOM   2182 C CA  . TRP A 1 279 ? 34.444 6.939   4.519   1.00 46.41  ? 639  TRP A CA  1 
ATOM   2183 C C   . TRP A 1 279 ? 35.377 5.943   5.203   1.00 47.23  ? 639  TRP A C   1 
ATOM   2184 O O   . TRP A 1 279 ? 36.590 6.145   5.232   1.00 47.18  ? 639  TRP A O   1 
ATOM   2185 C CB  . TRP A 1 279 ? 34.014 8.059   5.482   1.00 45.60  ? 639  TRP A CB  1 
ATOM   2186 C CG  . TRP A 1 279 ? 33.346 9.197   4.739   1.00 44.39  ? 639  TRP A CG  1 
ATOM   2187 C CD1 . TRP A 1 279 ? 32.015 9.366   4.533   1.00 43.36  ? 639  TRP A CD1 1 
ATOM   2188 C CD2 . TRP A 1 279 ? 33.998 10.283  4.065   1.00 44.25  ? 639  TRP A CD2 1 
ATOM   2189 N NE1 . TRP A 1 279 ? 31.788 10.493  3.775   1.00 43.57  ? 639  TRP A NE1 1 
ATOM   2190 C CE2 . TRP A 1 279 ? 32.987 11.075  3.473   1.00 44.27  ? 639  TRP A CE2 1 
ATOM   2191 C CE3 . TRP A 1 279 ? 35.340 10.667  3.904   1.00 43.23  ? 639  TRP A CE3 1 
ATOM   2192 C CZ2 . TRP A 1 279 ? 33.272 12.240  2.751   1.00 44.34  ? 639  TRP A CZ2 1 
ATOM   2193 C CZ3 . TRP A 1 279 ? 35.624 11.817  3.179   1.00 43.00  ? 639  TRP A CZ3 1 
ATOM   2194 C CH2 . TRP A 1 279 ? 34.594 12.590  2.607   1.00 44.00  ? 639  TRP A CH2 1 
ATOM   2195 N N   . GLU A 1 280 ? 34.800 4.874   5.748   1.00 47.73  ? 640  GLU A N   1 
ATOM   2196 C CA  . GLU A 1 280 ? 35.561 3.819   6.400   1.00 48.50  ? 640  GLU A CA  1 
ATOM   2197 C C   . GLU A 1 280 ? 36.393 3.048   5.370   1.00 48.12  ? 640  GLU A C   1 
ATOM   2198 O O   . GLU A 1 280 ? 37.604 2.865   5.564   1.00 48.02  ? 640  GLU A O   1 
ATOM   2199 C CB  . GLU A 1 280 ? 34.637 2.876   7.187   1.00 48.96  ? 640  GLU A CB  1 
ATOM   2200 C CG  . GLU A 1 280 ? 33.885 3.523   8.385   1.00 51.63  ? 640  GLU A CG  1 
ATOM   2201 C CD  . GLU A 1 280 ? 33.039 4.741   7.990   1.00 55.16  ? 640  GLU A CD  1 
ATOM   2202 O OE1 . GLU A 1 280 ? 32.142 4.606   7.114   1.00 55.87  ? 640  GLU A OE1 1 
ATOM   2203 O OE2 . GLU A 1 280 ? 33.286 5.837   8.554   1.00 56.53  ? 640  GLU A OE2 1 
ATOM   2204 N N   . GLU A 1 281 ? 35.744 2.625   4.282   1.00 47.69  ? 641  GLU A N   1 
ATOM   2205 C CA  . GLU A 1 281 ? 36.409 1.925   3.167   1.00 47.70  ? 641  GLU A CA  1 
ATOM   2206 C C   . GLU A 1 281 ? 37.459 2.761   2.473   1.00 47.51  ? 641  GLU A C   1 
ATOM   2207 O O   . GLU A 1 281 ? 38.514 2.240   2.100   1.00 47.54  ? 641  GLU A O   1 
ATOM   2208 C CB  . GLU A 1 281 ? 35.396 1.431   2.126   1.00 47.23  ? 641  GLU A CB  1 
ATOM   2209 C CG  . GLU A 1 281 ? 34.674 0.151   2.558   1.00 47.82  ? 641  GLU A CG  1 
ATOM   2210 C CD  . GLU A 1 281 ? 33.580 -0.281  1.584   1.00 48.73  ? 641  GLU A CD  1 
ATOM   2211 O OE1 . GLU A 1 281 ? 33.474 0.283   0.464   1.00 48.33  ? 641  GLU A OE1 1 
ATOM   2212 O OE2 . GLU A 1 281 ? 32.822 -1.207  1.947   1.00 52.31  ? 641  GLU A OE2 1 
ATOM   2213 N N   . LEU A 1 282 ? 37.160 4.054   2.292   1.00 46.94  ? 642  LEU A N   1 
ATOM   2214 C CA  . LEU A 1 282 ? 38.079 4.980   1.675   1.00 46.33  ? 642  LEU A CA  1 
ATOM   2215 C C   . LEU A 1 282 ? 39.355 5.106   2.496   1.00 46.76  ? 642  LEU A C   1 
ATOM   2216 O O   . LEU A 1 282 ? 40.442 5.080   1.934   1.00 46.56  ? 642  LEU A O   1 
ATOM   2217 C CB  . LEU A 1 282 ? 37.425 6.357   1.478   1.00 46.29  ? 642  LEU A CB  1 
ATOM   2218 C CG  . LEU A 1 282 ? 38.177 7.368   0.612   1.00 46.03  ? 642  LEU A CG  1 
ATOM   2219 C CD1 . LEU A 1 282 ? 38.185 6.894   -0.826  1.00 46.54  ? 642  LEU A CD1 1 
ATOM   2220 C CD2 . LEU A 1 282 ? 37.560 8.767   0.683   1.00 45.43  ? 642  LEU A CD2 1 
ATOM   2221 N N   . GLU A 1 283 ? 39.227 5.267   3.808   1.00 47.21  ? 643  GLU A N   1 
ATOM   2222 C CA  . GLU A 1 283 ? 40.402 5.388   4.672   1.00 49.23  ? 643  GLU A CA  1 
ATOM   2223 C C   . GLU A 1 283 ? 41.259 4.088   4.735   1.00 49.75  ? 643  GLU A C   1 
ATOM   2224 O O   . GLU A 1 283 ? 42.467 4.142   4.987   1.00 50.38  ? 643  GLU A O   1 
ATOM   2225 C CB  . GLU A 1 283 ? 39.993 5.862   6.075   1.00 49.38  ? 643  GLU A CB  1 
ATOM   2226 C CG  . GLU A 1 283 ? 41.118 6.573   6.837   1.00 53.35  ? 643  GLU A CG  1 
ATOM   2227 C CD  . GLU A 1 283 ? 40.606 7.564   7.884   1.00 57.84  ? 643  GLU A CD  1 
ATOM   2228 O OE1 . GLU A 1 283 ? 39.632 7.233   8.603   1.00 59.11  ? 643  GLU A OE1 1 
ATOM   2229 O OE2 . GLU A 1 283 ? 41.183 8.676   7.990   1.00 58.58  ? 643  GLU A OE2 1 
ATOM   2230 N N   . ARG A 1 284 ? 40.633 2.935   4.499   1.00 49.91  ? 644  ARG A N   1 
ATOM   2231 C CA  . ARG A 1 284 ? 41.353 1.660   4.383   1.00 50.50  ? 644  ARG A CA  1 
ATOM   2232 C C   . ARG A 1 284 ? 41.852 1.386   2.948   1.00 50.48  ? 644  ARG A C   1 
ATOM   2233 O O   . ARG A 1 284 ? 42.412 0.321   2.680   1.00 49.70  ? 644  ARG A O   1 
ATOM   2234 C CB  . ARG A 1 284 ? 40.466 0.501   4.854   1.00 50.02  ? 644  ARG A CB  1 
ATOM   2235 C CG  . ARG A 1 284 ? 40.136 0.533   6.348   1.00 51.19  ? 644  ARG A CG  1 
ATOM   2236 C CD  . ARG A 1 284 ? 39.489 -0.774  6.804   1.00 51.72  ? 644  ARG A CD  1 
ATOM   2237 N NE  . ARG A 1 284 ? 38.263 -1.050  6.054   1.00 55.03  ? 644  ARG A NE  1 
ATOM   2238 C CZ  . ARG A 1 284 ? 37.035 -0.985  6.559   1.00 56.55  ? 644  ARG A CZ  1 
ATOM   2239 N NH1 . ARG A 1 284 ? 36.851 -0.671  7.836   1.00 58.26  ? 644  ARG A NH1 1 
ATOM   2240 N NH2 . ARG A 1 284 ? 35.988 -1.252  5.789   1.00 56.85  ? 644  ARG A NH2 1 
ATOM   2241 N N   . LYS A 1 285 ? 41.650 2.350   2.042   1.00 50.68  ? 645  LYS A N   1 
ATOM   2242 C CA  . LYS A 1 285 ? 42.035 2.217   0.622   1.00 51.59  ? 645  LYS A CA  1 
ATOM   2243 C C   . LYS A 1 285 ? 41.316 1.055   -0.087  1.00 51.90  ? 645  LYS A C   1 
ATOM   2244 O O   . LYS A 1 285 ? 41.865 0.387   -0.966  1.00 52.51  ? 645  LYS A O   1 
ATOM   2245 C CB  . LYS A 1 285 ? 43.557 2.117   0.459   1.00 51.92  ? 645  LYS A CB  1 
ATOM   2246 C CG  . LYS A 1 285 ? 44.317 3.387   0.829   1.00 53.83  ? 645  LYS A CG  1 
ATOM   2247 C CD  . LYS A 1 285 ? 45.664 3.044   1.440   1.00 59.72  ? 645  LYS A CD  1 
ATOM   2248 C CE  . LYS A 1 285 ? 46.750 2.828   0.408   1.00 61.38  ? 645  LYS A CE  1 
ATOM   2249 N NZ  . LYS A 1 285 ? 47.212 4.162   -0.054  1.00 66.37  ? 645  LYS A NZ  1 
ATOM   2250 N N   . GLU A 1 286 ? 40.067 0.830   0.291   1.00 52.17  ? 646  GLU A N   1 
ATOM   2251 C CA  . GLU A 1 286 ? 39.271 -0.231  -0.316  1.00 52.49  ? 646  GLU A CA  1 
ATOM   2252 C C   . GLU A 1 286 ? 38.404 0.271   -1.485  1.00 51.80  ? 646  GLU A C   1 
ATOM   2253 O O   . GLU A 1 286 ? 37.642 -0.488  -2.064  1.00 52.72  ? 646  GLU A O   1 
ATOM   2254 C CB  . GLU A 1 286 ? 38.447 -0.961  0.759   1.00 52.28  ? 646  GLU A CB  1 
ATOM   2255 C CG  . GLU A 1 286 ? 39.318 -1.679  1.789   1.00 52.34  ? 646  GLU A CG  1 
ATOM   2256 C CD  . GLU A 1 286 ? 38.546 -2.155  3.019   1.00 54.32  ? 646  GLU A CD  1 
ATOM   2257 O OE1 . GLU A 1 286 ? 37.329 -1.864  3.149   1.00 56.65  ? 646  GLU A OE1 1 
ATOM   2258 O OE2 . GLU A 1 286 ? 39.168 -2.833  3.871   1.00 56.26  ? 646  GLU A OE2 1 
ATOM   2259 N N   . ILE A 1 287 ? 38.545 1.543   -1.838  1.00 51.19  ? 647  ILE A N   1 
ATOM   2260 C CA  . ILE A 1 287 ? 37.841 2.113   -2.991  1.00 50.36  ? 647  ILE A CA  1 
ATOM   2261 C C   . ILE A 1 287 ? 38.800 2.219   -4.193  1.00 49.94  ? 647  ILE A C   1 
ATOM   2262 O O   . ILE A 1 287 ? 39.953 2.647   -4.029  1.00 50.24  ? 647  ILE A O   1 
ATOM   2263 C CB  . ILE A 1 287 ? 37.116 3.432   -2.590  1.00 50.58  ? 647  ILE A CB  1 
ATOM   2264 C CG1 . ILE A 1 287 ? 35.888 3.065   -1.728  1.00 52.25  ? 647  ILE A CG1 1 
ATOM   2265 C CG2 . ILE A 1 287 ? 36.682 4.278   -3.821  1.00 48.46  ? 647  ILE A CG2 1 
ATOM   2266 C CD1 . ILE A 1 287 ? 35.343 4.210   -0.880  1.00 56.80  ? 647  ILE A CD1 1 
ATOM   2267 N N   . ASP A 1 288 ? 38.350 1.762   -5.368  1.00 48.65  ? 648  ASP A N   1 
ATOM   2268 C CA  . ASP A 1 288 ? 39.152 1.828   -6.582  1.00 48.04  ? 648  ASP A CA  1 
ATOM   2269 C C   . ASP A 1 288 ? 39.394 3.294   -6.984  1.00 47.11  ? 648  ASP A C   1 
ATOM   2270 O O   . ASP A 1 288 ? 38.447 4.024   -7.250  1.00 47.11  ? 648  ASP A O   1 
ATOM   2271 C CB  . ASP A 1 288 ? 38.478 1.100   -7.747  1.00 48.06  ? 648  ASP A CB  1 
ATOM   2272 C CG  . ASP A 1 288 ? 38.496 -0.439  -7.602  1.00 51.77  ? 648  ASP A CG  1 
ATOM   2273 O OD1 . ASP A 1 288 ? 39.560 -1.050  -7.280  1.00 54.58  ? 648  ASP A OD1 1 
ATOM   2274 O OD2 . ASP A 1 288 ? 37.425 -1.052  -7.845  1.00 54.31  ? 648  ASP A OD2 1 
ATOM   2275 N N   . PRO A 1 289 ? 40.671 3.736   -7.009  1.00 45.99  ? 649  PRO A N   1 
ATOM   2276 C CA  . PRO A 1 289 ? 40.974 5.066   -7.565  1.00 45.31  ? 649  PRO A CA  1 
ATOM   2277 C C   . PRO A 1 289 ? 40.426 5.228   -8.987  1.00 44.72  ? 649  PRO A C   1 
ATOM   2278 O O   . PRO A 1 289 ? 40.258 4.219   -9.694  1.00 44.52  ? 649  PRO A O   1 
ATOM   2279 C CB  . PRO A 1 289 ? 42.509 5.114   -7.544  1.00 45.08  ? 649  PRO A CB  1 
ATOM   2280 C CG  . PRO A 1 289 ? 42.877 4.221   -6.397  1.00 45.92  ? 649  PRO A CG  1 
ATOM   2281 C CD  . PRO A 1 289 ? 41.884 3.069   -6.495  1.00 45.50  ? 649  PRO A CD  1 
ATOM   2282 N N   . PRO A 1 290 ? 40.084 6.474   -9.385  1.00 44.18  ? 650  PRO A N   1 
ATOM   2283 C CA  . PRO A 1 290 ? 39.556 6.721   -10.715 1.00 43.73  ? 650  PRO A CA  1 
ATOM   2284 C C   . PRO A 1 290 ? 40.623 6.617   -11.804 1.00 43.72  ? 650  PRO A C   1 
ATOM   2285 O O   . PRO A 1 290 ? 40.291 6.525   -12.982 1.00 44.59  ? 650  PRO A O   1 
ATOM   2286 C CB  . PRO A 1 290 ? 39.042 8.173   -10.619 1.00 44.07  ? 650  PRO A CB  1 
ATOM   2287 C CG  . PRO A 1 290 ? 39.937 8.813   -9.590  1.00 44.16  ? 650  PRO A CG  1 
ATOM   2288 C CD  . PRO A 1 290 ? 40.140 7.716   -8.579  1.00 44.45  ? 650  PRO A CD  1 
ATOM   2289 N N   . PHE A 1 291 ? 41.892 6.635   -11.416 1.00 43.03  ? 651  PHE A N   1 
ATOM   2290 C CA  . PHE A 1 291 ? 42.987 6.756   -12.365 1.00 42.65  ? 651  PHE A CA  1 
ATOM   2291 C C   . PHE A 1 291 ? 44.243 6.293   -11.665 1.00 42.96  ? 651  PHE A C   1 
ATOM   2292 O O   . PHE A 1 291 ? 44.391 6.489   -10.467 1.00 42.90  ? 651  PHE A O   1 
ATOM   2293 C CB  . PHE A 1 291 ? 43.141 8.229   -12.818 1.00 42.48  ? 651  PHE A CB  1 
ATOM   2294 C CG  . PHE A 1 291 ? 44.438 8.537   -13.520 1.00 42.04  ? 651  PHE A CG  1 
ATOM   2295 C CD1 . PHE A 1 291 ? 44.574 8.328   -14.902 1.00 42.39  ? 651  PHE A CD1 1 
ATOM   2296 C CD2 . PHE A 1 291 ? 45.524 9.053   -12.806 1.00 40.21  ? 651  PHE A CD2 1 
ATOM   2297 C CE1 . PHE A 1 291 ? 45.782 8.624   -15.559 1.00 41.84  ? 651  PHE A CE1 1 
ATOM   2298 C CE2 . PHE A 1 291 ? 46.729 9.343   -13.442 1.00 41.80  ? 651  PHE A CE2 1 
ATOM   2299 C CZ  . PHE A 1 291 ? 46.864 9.140   -14.820 1.00 41.87  ? 651  PHE A CZ  1 
ATOM   2300 N N   . ARG A 1 292 ? 45.147 5.713   -12.445 1.00 42.41  ? 652  ARG A N   1 
ATOM   2301 C CA  . ARG A 1 292 ? 46.395 5.171   -11.965 1.00 43.17  ? 652  ARG A CA  1 
ATOM   2302 C C   . ARG A 1 292 ? 47.505 5.741   -12.866 1.00 43.16  ? 652  ARG A C   1 
ATOM   2303 O O   . ARG A 1 292 ? 47.383 5.661   -14.098 1.00 42.70  ? 652  ARG A O   1 
ATOM   2304 C CB  . ARG A 1 292 ? 46.278 3.625   -12.101 1.00 42.55  ? 652  ARG A CB  1 
ATOM   2305 C CG  . ARG A 1 292 ? 47.460 2.872   -11.827 1.00 44.35  ? 652  ARG A CG  1 
ATOM   2306 C CD  . ARG A 1 292 ? 47.170 1.391   -11.720 1.00 45.73  ? 652  ARG A CD  1 
ATOM   2307 N NE  . ARG A 1 292 ? 47.275 0.675   -12.987 1.00 43.31  ? 652  ARG A NE  1 
ATOM   2308 C CZ  . ARG A 1 292 ? 47.457 -0.632  -13.067 1.00 40.07  ? 652  ARG A CZ  1 
ATOM   2309 N NH1 . ARG A 1 292 ? 47.577 -1.346  -11.961 1.00 38.59  ? 652  ARG A NH1 1 
ATOM   2310 N NH2 . ARG A 1 292 ? 47.526 -1.225  -14.245 1.00 40.86  ? 652  ARG A NH2 1 
ATOM   2311 N N   . PRO A 1 293 ? 48.578 6.341   -12.284 1.00 44.05  ? 653  PRO A N   1 
ATOM   2312 C CA  . PRO A 1 293 ? 49.675 6.774   -13.181 1.00 44.69  ? 653  PRO A CA  1 
ATOM   2313 C C   . PRO A 1 293 ? 50.357 5.615   -13.899 1.00 45.06  ? 653  PRO A C   1 
ATOM   2314 O O   . PRO A 1 293 ? 50.391 4.479   -13.361 1.00 45.67  ? 653  PRO A O   1 
ATOM   2315 C CB  . PRO A 1 293 ? 50.678 7.464   -12.234 1.00 45.32  ? 653  PRO A CB  1 
ATOM   2316 C CG  . PRO A 1 293 ? 50.333 7.012   -10.864 1.00 44.67  ? 653  PRO A CG  1 
ATOM   2317 C CD  . PRO A 1 293 ? 48.844 6.710   -10.879 1.00 44.46  ? 653  PRO A CD  1 
ATOM   2318 N N   . LYS A 1 294 ? 50.856 5.886   -15.107 1.00 44.80  ? 654  LYS A N   1 
ATOM   2319 C CA  . LYS A 1 294 ? 51.701 4.937   -15.837 1.00 45.53  ? 654  LYS A CA  1 
ATOM   2320 C C   . LYS A 1 294 ? 53.189 5.192   -15.512 1.00 44.78  ? 654  LYS A C   1 
ATOM   2321 O O   . LYS A 1 294 ? 53.718 6.297   -15.722 1.00 44.32  ? 654  LYS A O   1 
ATOM   2322 C CB  . LYS A 1 294 ? 51.448 4.996   -17.349 1.00 45.21  ? 654  LYS A CB  1 
ATOM   2323 C CG  . LYS A 1 294 ? 50.049 4.543   -17.787 1.00 48.57  ? 654  LYS A CG  1 
ATOM   2324 C CD  . LYS A 1 294 ? 49.928 4.421   -19.324 1.00 49.05  ? 654  LYS A CD  1 
ATOM   2325 C CE  . LYS A 1 294 ? 50.768 3.265   -19.858 1.00 53.65  ? 654  LYS A CE  1 
ATOM   2326 N NZ  . LYS A 1 294 ? 50.563 3.021   -21.334 1.00 57.43  ? 654  LYS A NZ  1 
ATOM   2327 N N   . VAL A 1 295 ? 53.847 4.166   -14.989 1.00 44.29  ? 655  VAL A N   1 
ATOM   2328 C CA  . VAL A 1 295 ? 55.183 4.283   -14.435 1.00 44.89  ? 655  VAL A CA  1 
ATOM   2329 C C   . VAL A 1 295 ? 55.882 2.977   -14.722 1.00 45.37  ? 655  VAL A C   1 
ATOM   2330 O O   . VAL A 1 295 ? 55.464 1.952   -14.208 1.00 45.90  ? 655  VAL A O   1 
ATOM   2331 C CB  . VAL A 1 295 ? 55.125 4.509   -12.892 1.00 45.10  ? 655  VAL A CB  1 
ATOM   2332 C CG1 . VAL A 1 295 ? 56.508 4.406   -12.249 1.00 45.40  ? 655  VAL A CG1 1 
ATOM   2333 C CG2 . VAL A 1 295 ? 54.470 5.822   -12.558 1.00 42.81  ? 655  VAL A CG2 1 
ATOM   2334 N N   . LYS A 1 296 ? 56.935 3.013   -15.539 1.00 45.52  ? 656  LYS A N   1 
ATOM   2335 C CA  . LYS A 1 296 ? 57.648 1.820   -15.956 1.00 46.18  ? 656  LYS A CA  1 
ATOM   2336 C C   . LYS A 1 296 ? 58.686 1.354   -14.947 1.00 46.20  ? 656  LYS A C   1 
ATOM   2337 O O   . LYS A 1 296 ? 58.993 0.164   -14.889 1.00 46.17  ? 656  LYS A O   1 
ATOM   2338 C CB  . LYS A 1 296 ? 58.347 2.043   -17.296 1.00 46.50  ? 656  LYS A CB  1 
ATOM   2339 C CG  . LYS A 1 296 ? 57.428 2.333   -18.452 1.00 49.16  ? 656  LYS A CG  1 
ATOM   2340 C CD  . LYS A 1 296 ? 58.183 2.260   -19.773 1.00 54.76  ? 656  LYS A CD  1 
ATOM   2341 C CE  . LYS A 1 296 ? 57.496 3.130   -20.830 1.00 58.83  ? 656  LYS A CE  1 
ATOM   2342 N NZ  . LYS A 1 296 ? 58.383 3.412   -22.013 1.00 61.46  ? 656  LYS A NZ  1 
ATOM   2343 N N   . SER A 1 297 ? 59.255 2.299   -14.195 1.00 45.92  ? 657  SER A N   1 
ATOM   2344 C CA  . SER A 1 297 ? 60.335 2.028   -13.228 1.00 45.53  ? 657  SER A CA  1 
ATOM   2345 C C   . SER A 1 297 ? 60.500 3.243   -12.297 1.00 44.86  ? 657  SER A C   1 
ATOM   2346 O O   . SER A 1 297 ? 59.852 4.266   -12.507 1.00 44.08  ? 657  SER A O   1 
ATOM   2347 C CB  . SER A 1 297 ? 61.669 1.722   -13.948 1.00 45.81  ? 657  SER A CB  1 
ATOM   2348 O OG  . SER A 1 297 ? 62.310 2.921   -14.380 1.00 47.63  ? 657  SER A OG  1 
ATOM   2349 N N   . PRO A 1 298 ? 61.361 3.126   -11.261 1.00 44.71  ? 658  PRO A N   1 
ATOM   2350 C CA  . PRO A 1 298 ? 61.729 4.283   -10.428 1.00 44.32  ? 658  PRO A CA  1 
ATOM   2351 C C   . PRO A 1 298 ? 62.363 5.446   -11.234 1.00 44.09  ? 658  PRO A C   1 
ATOM   2352 O O   . PRO A 1 298 ? 62.245 6.619   -10.841 1.00 43.73  ? 658  PRO A O   1 
ATOM   2353 C CB  . PRO A 1 298 ? 62.762 3.692   -9.463  1.00 44.28  ? 658  PRO A CB  1 
ATOM   2354 C CG  . PRO A 1 298 ? 62.396 2.216   -9.398  1.00 44.65  ? 658  PRO A CG  1 
ATOM   2355 C CD  . PRO A 1 298 ? 62.047 1.893   -10.808 1.00 44.38  ? 658  PRO A CD  1 
ATOM   2356 N N   . PHE A 1 299 ? 62.998 5.114   -12.355 1.00 43.32  ? 659  PHE A N   1 
ATOM   2357 C CA  . PHE A 1 299 ? 63.637 6.097   -13.211 1.00 43.77  ? 659  PHE A CA  1 
ATOM   2358 C C   . PHE A 1 299 ? 62.693 6.770   -14.225 1.00 43.92  ? 659  PHE A C   1 
ATOM   2359 O O   . PHE A 1 299 ? 63.095 7.697   -14.901 1.00 44.13  ? 659  PHE A O   1 
ATOM   2360 C CB  . PHE A 1 299 ? 64.837 5.478   -13.916 1.00 43.40  ? 659  PHE A CB  1 
ATOM   2361 C CG  . PHE A 1 299 ? 65.949 5.068   -12.974 1.00 44.76  ? 659  PHE A CG  1 
ATOM   2362 C CD1 . PHE A 1 299 ? 66.125 3.721   -12.623 1.00 45.15  ? 659  PHE A CD1 1 
ATOM   2363 C CD2 . PHE A 1 299 ? 66.810 6.025   -12.428 1.00 44.01  ? 659  PHE A CD2 1 
ATOM   2364 C CE1 . PHE A 1 299 ? 67.167 3.329   -11.761 1.00 46.88  ? 659  PHE A CE1 1 
ATOM   2365 C CE2 . PHE A 1 299 ? 67.827 5.658   -11.563 1.00 46.16  ? 659  PHE A CE2 1 
ATOM   2366 C CZ  . PHE A 1 299 ? 68.022 4.298   -11.230 1.00 46.04  ? 659  PHE A CZ  1 
ATOM   2367 N N   . ASP A 1 300 ? 61.453 6.294   -14.330 1.00 44.00  ? 660  ASP A N   1 
ATOM   2368 C CA  . ASP A 1 300 ? 60.458 6.871   -15.233 1.00 44.71  ? 660  ASP A CA  1 
ATOM   2369 C C   . ASP A 1 300 ? 60.014 8.219   -14.650 1.00 44.67  ? 660  ASP A C   1 
ATOM   2370 O O   . ASP A 1 300 ? 59.446 8.267   -13.556 1.00 43.73  ? 660  ASP A O   1 
ATOM   2371 C CB  . ASP A 1 300 ? 59.272 5.898   -15.404 1.00 45.13  ? 660  ASP A CB  1 
ATOM   2372 C CG  . ASP A 1 300 ? 58.210 6.398   -16.386 1.00 47.60  ? 660  ASP A CG  1 
ATOM   2373 O OD1 . ASP A 1 300 ? 58.155 7.614   -16.673 1.00 49.84  ? 660  ASP A OD1 1 
ATOM   2374 O OD2 . ASP A 1 300 ? 57.393 5.573   -16.863 1.00 48.47  ? 660  ASP A OD2 1 
ATOM   2375 N N   . CYS A 1 301 ? 60.334 9.299   -15.366 1.00 44.94  ? 661  CYS A N   1 
ATOM   2376 C CA  . CYS A 1 301 ? 60.010 10.675  -14.950 1.00 46.65  ? 661  CYS A CA  1 
ATOM   2377 C C   . CYS A 1 301 ? 58.913 11.339  -15.808 1.00 45.95  ? 661  CYS A C   1 
ATOM   2378 O O   . CYS A 1 301 ? 58.747 12.567  -15.783 1.00 45.67  ? 661  CYS A O   1 
ATOM   2379 C CB  . CYS A 1 301 ? 61.285 11.546  -14.920 1.00 46.75  ? 661  CYS A CB  1 
ATOM   2380 S SG  . CYS A 1 301 ? 62.567 10.862  -13.779 1.00 53.16  ? 661  CYS A SG  1 
ATOM   2381 N N   . SER A 1 302 ? 58.178 10.510  -16.546 1.00 45.11  ? 662  SER A N   1 
ATOM   2382 C CA  . SER A 1 302 ? 57.034 10.906  -17.375 1.00 45.31  ? 662  SER A CA  1 
ATOM   2383 C C   . SER A 1 302 ? 55.922 11.717  -16.689 1.00 44.67  ? 662  SER A C   1 
ATOM   2384 O O   . SER A 1 302 ? 55.119 12.356  -17.375 1.00 44.14  ? 662  SER A O   1 
ATOM   2385 C CB  . SER A 1 302 ? 56.369 9.648   -17.931 1.00 45.33  ? 662  SER A CB  1 
ATOM   2386 O OG  . SER A 1 302 ? 56.644 9.527   -19.300 1.00 49.04  ? 662  SER A OG  1 
ATOM   2387 N N   . ASN A 1 303 ? 55.842 11.644  -15.361 1.00 44.06  ? 663  ASN A N   1 
ATOM   2388 C CA  . ASN A 1 303 ? 54.696 12.195  -14.645 1.00 44.34  ? 663  ASN A CA  1 
ATOM   2389 C C   . ASN A 1 303 ? 54.961 13.470  -13.839 1.00 45.13  ? 663  ASN A C   1 
ATOM   2390 O O   . ASN A 1 303 ? 54.091 13.907  -13.083 1.00 44.48  ? 663  ASN A O   1 
ATOM   2391 C CB  . ASN A 1 303 ? 54.075 11.102  -13.749 1.00 44.07  ? 663  ASN A CB  1 
ATOM   2392 C CG  . ASN A 1 303 ? 53.468 9.981   -14.556 1.00 42.53  ? 663  ASN A CG  1 
ATOM   2393 O OD1 . ASN A 1 303 ? 52.512 10.193  -15.292 1.00 42.90  ? 663  ASN A OD1 1 
ATOM   2394 N ND2 . ASN A 1 303 ? 54.032 8.792   -14.444 1.00 41.05  ? 663  ASN A ND2 1 
ATOM   2395 N N   . PHE A 1 304 ? 56.169 14.033  -13.964 1.00 44.97  ? 664  PHE A N   1 
ATOM   2396 C CA  . PHE A 1 304 ? 56.509 15.231  -13.224 1.00 46.00  ? 664  PHE A CA  1 
ATOM   2397 C C   . PHE A 1 304 ? 57.422 16.174  -14.012 1.00 46.47  ? 664  PHE A C   1 
ATOM   2398 O O   . PHE A 1 304 ? 57.973 15.803  -15.056 1.00 46.34  ? 664  PHE A O   1 
ATOM   2399 C CB  . PHE A 1 304 ? 57.039 14.930  -11.795 1.00 46.48  ? 664  PHE A CB  1 
ATOM   2400 C CG  . PHE A 1 304 ? 58.267 14.042  -11.741 1.00 47.51  ? 664  PHE A CG  1 
ATOM   2401 C CD1 . PHE A 1 304 ? 58.139 12.668  -11.592 1.00 46.91  ? 664  PHE A CD1 1 
ATOM   2402 C CD2 . PHE A 1 304 ? 59.553 14.592  -11.799 1.00 48.37  ? 664  PHE A CD2 1 
ATOM   2403 C CE1 . PHE A 1 304 ? 59.254 11.863  -11.514 1.00 47.16  ? 664  PHE A CE1 1 
ATOM   2404 C CE2 . PHE A 1 304 ? 60.673 13.790  -11.718 1.00 47.73  ? 664  PHE A CE2 1 
ATOM   2405 C CZ  . PHE A 1 304 ? 60.525 12.423  -11.578 1.00 47.66  ? 664  PHE A CZ  1 
ATOM   2406 N N   . ASP A 1 305 ? 57.519 17.409  -13.522 1.00 46.75  ? 665  ASP A N   1 
ATOM   2407 C CA  . ASP A 1 305 ? 58.354 18.450  -14.139 1.00 47.10  ? 665  ASP A CA  1 
ATOM   2408 C C   . ASP A 1 305 ? 59.838 18.033  -14.189 1.00 46.31  ? 665  ASP A C   1 
ATOM   2409 O O   . ASP A 1 305 ? 60.435 17.648  -13.180 1.00 45.23  ? 665  ASP A O   1 
ATOM   2410 C CB  . ASP A 1 305 ? 58.165 19.784  -13.397 1.00 47.23  ? 665  ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 305 ? 58.629 20.985  -14.207 1.00 51.31  ? 665  ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 305 ? 59.784 21.008  -14.678 1.00 54.87  ? 665  ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 305 ? 57.842 21.945  -14.370 1.00 58.90  ? 665  ASP A OD2 1 
ATOM   2414 N N   . LYS A 1 306 ? 60.411 18.116  -15.385 1.00 46.24  ? 666  LYS A N   1 
ATOM   2415 C CA  . LYS A 1 306 ? 61.763 17.624  -15.657 1.00 46.42  ? 666  LYS A CA  1 
ATOM   2416 C C   . LYS A 1 306 ? 62.897 18.648  -15.415 1.00 46.04  ? 666  LYS A C   1 
ATOM   2417 O O   . LYS A 1 306 ? 64.071 18.344  -15.647 1.00 46.12  ? 666  LYS A O   1 
ATOM   2418 C CB  . LYS A 1 306 ? 61.792 17.014  -17.073 1.00 46.72  ? 666  LYS A CB  1 
ATOM   2419 C CG  . LYS A 1 306 ? 61.037 15.621  -17.120 1.00 47.75  ? 666  LYS A CG  1 
ATOM   2420 C CD  . LYS A 1 306 ? 60.645 15.147  -18.514 1.00 47.98  ? 666  LYS A CD  1 
ATOM   2421 C CE  . LYS A 1 306 ? 59.370 14.257  -18.492 1.00 48.66  ? 666  LYS A CE  1 
ATOM   2422 N NZ  . LYS A 1 306 ? 58.092 14.916  -17.894 1.00 49.34  ? 666  LYS A NZ  1 
ATOM   2423 N N   . GLU A 1 307 ? 62.544 19.833  -14.898 1.00 45.38  ? 667  GLU A N   1 
ATOM   2424 C CA  . GLU A 1 307 ? 63.453 20.990  -14.809 1.00 44.81  ? 667  GLU A CA  1 
ATOM   2425 C C   . GLU A 1 307 ? 64.865 20.712  -14.233 1.00 44.09  ? 667  GLU A C   1 
ATOM   2426 O O   . GLU A 1 307 ? 65.857 21.182  -14.761 1.00 43.68  ? 667  GLU A O   1 
ATOM   2427 C CB  . GLU A 1 307 ? 62.798 22.149  -14.048 1.00 44.14  ? 667  GLU A CB  1 
ATOM   2428 C CG  . GLU A 1 307 ? 63.685 23.413  -13.994 1.00 45.67  ? 667  GLU A CG  1 
ATOM   2429 C CD  . GLU A 1 307 ? 63.005 24.641  -13.402 1.00 46.03  ? 667  GLU A CD  1 
ATOM   2430 O OE1 . GLU A 1 307 ? 61.847 24.531  -12.941 1.00 50.28  ? 667  GLU A OE1 1 
ATOM   2431 O OE2 . GLU A 1 307 ? 63.644 25.725  -13.385 1.00 49.20  ? 667  GLU A OE2 1 
ATOM   2432 N N   . PHE A 1 308 ? 64.936 19.945  -13.155 1.00 44.03  ? 668  PHE A N   1 
ATOM   2433 C CA  . PHE A 1 308 ? 66.187 19.729  -12.430 1.00 43.40  ? 668  PHE A CA  1 
ATOM   2434 C C   . PHE A 1 308 ? 66.889 18.379  -12.713 1.00 43.51  ? 668  PHE A C   1 
ATOM   2435 O O   . PHE A 1 308 ? 67.964 18.095  -12.156 1.00 43.03  ? 668  PHE A O   1 
ATOM   2436 C CB  . PHE A 1 308 ? 65.937 19.917  -10.932 1.00 42.54  ? 668  PHE A CB  1 
ATOM   2437 C CG  . PHE A 1 308 ? 65.282 21.236  -10.585 1.00 42.90  ? 668  PHE A CG  1 
ATOM   2438 C CD1 . PHE A 1 308 ? 63.889 21.328  -10.440 1.00 42.81  ? 668  PHE A CD1 1 
ATOM   2439 C CD2 . PHE A 1 308 ? 66.048 22.393  -10.415 1.00 42.22  ? 668  PHE A CD2 1 
ATOM   2440 C CE1 . PHE A 1 308 ? 63.284 22.533  -10.110 1.00 40.92  ? 668  PHE A CE1 1 
ATOM   2441 C CE2 . PHE A 1 308 ? 65.440 23.609  -10.086 1.00 41.73  ? 668  PHE A CE2 1 
ATOM   2442 C CZ  . PHE A 1 308 ? 64.063 23.675  -9.937  1.00 41.23  ? 668  PHE A CZ  1 
ATOM   2443 N N   . LEU A 1 309 ? 66.318 17.578  -13.609 1.00 43.79  ? 669  LEU A N   1 
ATOM   2444 C CA  . LEU A 1 309 ? 66.729 16.165  -13.741 1.00 44.75  ? 669  LEU A CA  1 
ATOM   2445 C C   . LEU A 1 309 ? 68.083 15.954  -14.397 1.00 44.80  ? 669  LEU A C   1 
ATOM   2446 O O   . LEU A 1 309 ? 68.695 14.898  -14.212 1.00 45.32  ? 669  LEU A O   1 
ATOM   2447 C CB  . LEU A 1 309 ? 65.669 15.337  -14.464 1.00 44.59  ? 669  LEU A CB  1 
ATOM   2448 C CG  . LEU A 1 309 ? 64.300 15.122  -13.806 1.00 45.06  ? 669  LEU A CG  1 
ATOM   2449 C CD1 . LEU A 1 309 ? 63.426 14.397  -14.802 1.00 44.91  ? 669  LEU A CD1 1 
ATOM   2450 C CD2 . LEU A 1 309 ? 64.396 14.321  -12.519 1.00 45.89  ? 669  LEU A CD2 1 
ATOM   2451 N N   . ASN A 1 310 ? 68.543 16.952  -15.157 1.00 44.81  ? 670  ASN A N   1 
ATOM   2452 C CA  . ASN A 1 310 ? 69.887 16.936  -15.743 1.00 44.93  ? 670  ASN A CA  1 
ATOM   2453 C C   . ASN A 1 310 ? 70.935 17.691  -14.904 1.00 45.21  ? 670  ASN A C   1 
ATOM   2454 O O   . ASN A 1 310 ? 72.050 17.917  -15.371 1.00 45.32  ? 670  ASN A O   1 
ATOM   2455 C CB  . ASN A 1 310 ? 69.852 17.451  -17.196 1.00 44.73  ? 670  ASN A CB  1 
ATOM   2456 C CG  . ASN A 1 310 ? 71.097 17.051  -18.013 1.00 44.65  ? 670  ASN A CG  1 
ATOM   2457 O OD1 . ASN A 1 310 ? 71.618 15.940  -17.892 1.00 41.00  ? 670  ASN A OD1 1 
ATOM   2458 N ND2 . ASN A 1 310 ? 71.557 17.963  -18.863 1.00 42.40  ? 670  ASN A ND2 1 
ATOM   2459 N N   . GLU A 1 311 ? 70.590 18.086  -13.675 1.00 45.71  ? 671  GLU A N   1 
ATOM   2460 C CA  . GLU A 1 311 ? 71.571 18.700  -12.766 1.00 46.96  ? 671  GLU A CA  1 
ATOM   2461 C C   . GLU A 1 311 ? 72.272 17.585  -11.994 1.00 47.15  ? 671  GLU A C   1 
ATOM   2462 O O   . GLU A 1 311 ? 71.641 16.586  -11.617 1.00 46.52  ? 671  GLU A O   1 
ATOM   2463 C CB  . GLU A 1 311 ? 70.948 19.692  -11.772 1.00 46.24  ? 671  GLU A CB  1 
ATOM   2464 C CG  . GLU A 1 311 ? 70.023 20.730  -12.402 1.00 49.00  ? 671  GLU A CG  1 
ATOM   2465 C CD  . GLU A 1 311 ? 69.979 22.092  -11.677 1.00 49.86  ? 671  GLU A CD  1 
ATOM   2466 O OE1 . GLU A 1 311 ? 70.822 22.375  -10.782 1.00 51.60  ? 671  GLU A OE1 1 
ATOM   2467 O OE2 . GLU A 1 311 ? 69.078 22.897  -12.033 1.00 54.79  ? 671  GLU A OE2 1 
ATOM   2468 N N   . LYS A 1 312 ? 73.571 17.762  -11.761 1.00 47.41  ? 672  LYS A N   1 
ATOM   2469 C CA  . LYS A 1 312 ? 74.342 16.817  -10.987 1.00 48.35  ? 672  LYS A CA  1 
ATOM   2470 C C   . LYS A 1 312 ? 73.723 16.703  -9.602  1.00 49.06  ? 672  LYS A C   1 
ATOM   2471 O O   . LYS A 1 312 ? 73.448 17.720  -8.963  1.00 49.19  ? 672  LYS A O   1 
ATOM   2472 C CB  . LYS A 1 312 ? 75.814 17.227  -10.923 1.00 48.45  ? 672  LYS A CB  1 
ATOM   2473 C CG  . LYS A 1 312 ? 76.506 17.197  -12.276 1.00 48.87  ? 672  LYS A CG  1 
ATOM   2474 C CD  . LYS A 1 312 ? 78.015 17.098  -12.129 1.00 50.31  ? 672  LYS A CD  1 
ATOM   2475 C CE  . LYS A 1 312 ? 78.699 17.386  -13.449 1.00 50.70  ? 672  LYS A CE  1 
ATOM   2476 N NZ  . LYS A 1 312 ? 80.153 17.037  -13.367 1.00 54.13  ? 672  LYS A NZ  1 
ATOM   2477 N N   . PRO A 1 313 ? 73.452 15.461  -9.162  1.00 49.64  ? 673  PRO A N   1 
ATOM   2478 C CA  . PRO A 1 313 ? 72.772 15.149  -7.909  1.00 50.60  ? 673  PRO A CA  1 
ATOM   2479 C C   . PRO A 1 313 ? 73.669 15.367  -6.706  1.00 51.57  ? 673  PRO A C   1 
ATOM   2480 O O   . PRO A 1 313 ? 73.925 14.437  -5.918  1.00 51.74  ? 673  PRO A O   1 
ATOM   2481 C CB  . PRO A 1 313 ? 72.401 13.673  -8.057  1.00 50.65  ? 673  PRO A CB  1 
ATOM   2482 C CG  . PRO A 1 313 ? 72.848 13.259  -9.412  1.00 50.50  ? 673  PRO A CG  1 
ATOM   2483 C CD  . PRO A 1 313 ? 73.798 14.251  -9.919  1.00 49.77  ? 673  PRO A CD  1 
ATOM   2484 N N   . ARG A 1 314 ? 74.097 16.617  -6.557  1.00 52.49  ? 674  ARG A N   1 
ATOM   2485 C CA  . ARG A 1 314 ? 75.100 17.004  -5.590  1.00 53.63  ? 674  ARG A CA  1 
ATOM   2486 C C   . ARG A 1 314 ? 74.561 17.859  -4.446  1.00 53.92  ? 674  ARG A C   1 
ATOM   2487 O O   . ARG A 1 314 ? 73.699 18.730  -4.644  1.00 53.54  ? 674  ARG A O   1 
ATOM   2488 C CB  . ARG A 1 314 ? 76.199 17.783  -6.302  1.00 53.88  ? 674  ARG A CB  1 
ATOM   2489 C CG  . ARG A 1 314 ? 77.287 16.928  -6.912  1.00 55.85  ? 674  ARG A CG  1 
ATOM   2490 C CD  . ARG A 1 314 ? 77.990 17.715  -7.997  1.00 56.93  ? 674  ARG A CD  1 
ATOM   2491 N NE  . ARG A 1 314 ? 79.409 17.394  -8.123  1.00 57.95  ? 674  ARG A NE  1 
ATOM   2492 C CZ  . ARG A 1 314 ? 80.245 18.068  -8.909  1.00 58.97  ? 674  ARG A CZ  1 
ATOM   2493 N NH1 . ARG A 1 314 ? 79.796 19.090  -9.636  1.00 58.83  ? 674  ARG A NH1 1 
ATOM   2494 N NH2 . ARG A 1 314 ? 81.527 17.731  -8.972  1.00 59.61  ? 674  ARG A NH2 1 
ATOM   2495 N N   . LEU A 1 315 ? 75.099 17.597  -3.254  1.00 54.61  ? 675  LEU A N   1 
ATOM   2496 C CA  . LEU A 1 315 ? 75.021 18.516  -2.120  1.00 55.26  ? 675  LEU A CA  1 
ATOM   2497 C C   . LEU A 1 315 ? 76.024 19.644  -2.362  1.00 55.62  ? 675  LEU A C   1 
ATOM   2498 O O   . LEU A 1 315 ? 77.224 19.386  -2.532  1.00 56.38  ? 675  LEU A O   1 
ATOM   2499 C CB  . LEU A 1 315 ? 75.387 17.801  -0.808  1.00 54.92  ? 675  LEU A CB  1 
ATOM   2500 C CG  . LEU A 1 315 ? 74.561 16.616  -0.291  1.00 55.07  ? 675  LEU A CG  1 
ATOM   2501 C CD1 . LEU A 1 315 ? 75.287 15.949  0.871   1.00 55.43  ? 675  LEU A CD1 1 
ATOM   2502 C CD2 . LEU A 1 315 ? 73.153 17.040  0.119   1.00 54.21  ? 675  LEU A CD2 1 
HETATM 2503 N N   . SEP A 1 316 ? 75.559 20.887  -2.370  1.00 55.82  ? 676  SEP A N   1 
HETATM 2504 C CA  . SEP A 1 316 ? 76.496 21.983  -2.577  1.00 56.31  ? 676  SEP A CA  1 
HETATM 2505 C CB  . SEP A 1 316 ? 75.872 23.166  -3.334  1.00 57.00  ? 676  SEP A CB  1 
HETATM 2506 O OG  . SEP A 1 316 ? 74.766 23.762  -2.689  1.00 59.74  ? 676  SEP A OG  1 
HETATM 2507 C C   . SEP A 1 316 ? 77.271 22.408  -1.321  1.00 55.70  ? 676  SEP A C   1 
HETATM 2508 O O   . SEP A 1 316 ? 76.999 21.938  -0.212  1.00 55.23  ? 676  SEP A O   1 
HETATM 2509 P P   . SEP A 1 316 ? 74.203 24.857  -3.741  1.00 64.06  ? 676  SEP A P   1 
HETATM 2510 O O1P . SEP A 1 316 ? 73.643 26.165  -2.977  1.00 64.68  ? 676  SEP A O1P 1 
HETATM 2511 O O2P . SEP A 1 316 ? 73.052 24.205  -4.656  1.00 63.49  ? 676  SEP A O2P 1 
HETATM 2512 O O3P . SEP A 1 316 ? 75.410 25.390  -4.671  1.00 63.42  ? 676  SEP A O3P 1 
ATOM   2513 N N   . PHE A 1 317 ? 78.257 23.277  -1.533  1.00 55.12  ? 677  PHE A N   1 
ATOM   2514 C CA  . PHE A 1 317 ? 79.159 23.729  -0.483  1.00 54.59  ? 677  PHE A CA  1 
ATOM   2515 C C   . PHE A 1 317 ? 78.509 24.689  0.511   1.00 53.35  ? 677  PHE A C   1 
ATOM   2516 O O   . PHE A 1 317 ? 77.740 25.591  0.140   1.00 52.98  ? 677  PHE A O   1 
ATOM   2517 C CB  . PHE A 1 317 ? 80.419 24.368  -1.089  1.00 55.43  ? 677  PHE A CB  1 
ATOM   2518 C CG  . PHE A 1 317 ? 81.302 23.392  -1.824  1.00 57.20  ? 677  PHE A CG  1 
ATOM   2519 C CD1 . PHE A 1 317 ? 81.464 23.485  -3.205  1.00 59.14  ? 677  PHE A CD1 1 
ATOM   2520 C CD2 . PHE A 1 317 ? 81.965 22.372  -1.137  1.00 58.73  ? 677  PHE A CD2 1 
ATOM   2521 C CE1 . PHE A 1 317 ? 82.285 22.578  -3.895  1.00 59.97  ? 677  PHE A CE1 1 
ATOM   2522 C CE2 . PHE A 1 317 ? 82.782 21.461  -1.814  1.00 59.87  ? 677  PHE A CE2 1 
ATOM   2523 C CZ  . PHE A 1 317 ? 82.944 21.566  -3.198  1.00 59.06  ? 677  PHE A CZ  1 
ATOM   2524 N N   . ALA A 1 318 ? 78.847 24.475  1.778   1.00 51.72  ? 678  ALA A N   1 
ATOM   2525 C CA  . ALA A 1 318 ? 78.380 25.304  2.874   1.00 50.10  ? 678  ALA A CA  1 
ATOM   2526 C C   . ALA A 1 318 ? 79.418 26.360  3.271   1.00 48.74  ? 678  ALA A C   1 
ATOM   2527 O O   . ALA A 1 318 ? 80.605 26.204  2.972   1.00 48.46  ? 678  ALA A O   1 
ATOM   2528 C CB  . ALA A 1 318 ? 78.048 24.429  4.049   1.00 50.28  ? 678  ALA A CB  1 
ATOM   2529 N N   . ASP A 1 319 ? 78.947 27.432  3.924   1.00 47.07  ? 679  ASP A N   1 
ATOM   2530 C CA  . ASP A 1 319 ? 79.801 28.444  4.556   1.00 45.42  ? 679  ASP A CA  1 
ATOM   2531 C C   . ASP A 1 319 ? 80.498 27.842  5.785   1.00 44.61  ? 679  ASP A C   1 
ATOM   2532 O O   . ASP A 1 319 ? 79.983 27.920  6.914   1.00 44.24  ? 679  ASP A O   1 
ATOM   2533 C CB  . ASP A 1 319 ? 78.966 29.686  4.928   1.00 45.30  ? 679  ASP A CB  1 
ATOM   2534 C CG  . ASP A 1 319 ? 79.813 30.857  5.477   1.00 43.96  ? 679  ASP A CG  1 
ATOM   2535 O OD1 . ASP A 1 319 ? 81.054 30.753  5.590   1.00 44.06  ? 679  ASP A OD1 1 
ATOM   2536 O OD2 . ASP A 1 319 ? 79.215 31.899  5.816   1.00 41.53  ? 679  ASP A OD2 1 
ATOM   2537 N N   . ARG A 1 320 ? 81.669 27.244  5.543   1.00 43.68  ? 680  ARG A N   1 
ATOM   2538 C CA  . ARG A 1 320 ? 82.473 26.566  6.572   1.00 43.26  ? 680  ARG A CA  1 
ATOM   2539 C C   . ARG A 1 320 ? 82.675 27.389  7.855   1.00 41.75  ? 680  ARG A C   1 
ATOM   2540 O O   . ARG A 1 320 ? 82.662 26.831  8.984   1.00 41.33  ? 680  ARG A O   1 
ATOM   2541 C CB  . ARG A 1 320 ? 83.852 26.223  5.998   1.00 44.01  ? 680  ARG A CB  1 
ATOM   2542 C CG  . ARG A 1 320 ? 83.870 25.140  4.938   1.00 47.33  ? 680  ARG A CG  1 
ATOM   2543 C CD  . ARG A 1 320 ? 84.185 23.760  5.534   1.00 52.69  ? 680  ARG A CD  1 
ATOM   2544 N NE  . ARG A 1 320 ? 84.585 22.804  4.497   1.00 56.32  ? 680  ARG A NE  1 
ATOM   2545 C CZ  . ARG A 1 320 ? 83.757 22.281  3.588   1.00 58.43  ? 680  ARG A CZ  1 
ATOM   2546 N NH1 . ARG A 1 320 ? 82.468 22.618  3.567   1.00 58.59  ? 680  ARG A NH1 1 
ATOM   2547 N NH2 . ARG A 1 320 ? 84.223 21.422  2.687   1.00 59.62  ? 680  ARG A NH2 1 
ATOM   2548 N N   . ALA A 1 321 ? 82.876 28.706  7.669   1.00 39.98  ? 681  ALA A N   1 
ATOM   2549 C CA  . ALA A 1 321 ? 83.043 29.637  8.781   1.00 38.72  ? 681  ALA A CA  1 
ATOM   2550 C C   . ALA A 1 321 ? 81.805 29.668  9.681   1.00 37.79  ? 681  ALA A C   1 
ATOM   2551 O O   . ALA A 1 321 ? 81.915 29.497  10.898  1.00 37.46  ? 681  ALA A O   1 
ATOM   2552 C CB  . ALA A 1 321 ? 83.405 31.052  8.270   1.00 38.30  ? 681  ALA A CB  1 
ATOM   2553 N N   . LEU A 1 322 ? 80.628 29.856  9.082   1.00 37.33  ? 682  LEU A N   1 
ATOM   2554 C CA  . LEU A 1 322 ? 79.380 29.796  9.850   1.00 37.14  ? 682  LEU A CA  1 
ATOM   2555 C C   . LEU A 1 322 ? 79.108 28.423  10.490  1.00 36.79  ? 682  LEU A C   1 
ATOM   2556 O O   . LEU A 1 322 ? 78.647 28.358  11.628  1.00 36.71  ? 682  LEU A O   1 
ATOM   2557 C CB  . LEU A 1 322 ? 78.181 30.258  9.012   1.00 37.10  ? 682  LEU A CB  1 
ATOM   2558 C CG  . LEU A 1 322 ? 76.806 30.286  9.692   1.00 37.18  ? 682  LEU A CG  1 
ATOM   2559 C CD1 . LEU A 1 322 ? 76.854 31.021  11.040  1.00 37.32  ? 682  LEU A CD1 1 
ATOM   2560 C CD2 . LEU A 1 322 ? 75.779 30.910  8.766   1.00 37.08  ? 682  LEU A CD2 1 
ATOM   2561 N N   . ILE A 1 323 ? 79.401 27.334  9.766   1.00 36.89  ? 683  ILE A N   1 
ATOM   2562 C CA  . ILE A 1 323 ? 79.222 25.985  10.317  1.00 37.42  ? 683  ILE A CA  1 
ATOM   2563 C C   . ILE A 1 323 ? 80.118 25.681  11.523  1.00 38.52  ? 683  ILE A C   1 
ATOM   2564 O O   . ILE A 1 323 ? 79.649 25.087  12.501  1.00 38.59  ? 683  ILE A O   1 
ATOM   2565 C CB  . ILE A 1 323 ? 79.383 24.919  9.215   1.00 37.38  ? 683  ILE A CB  1 
ATOM   2566 C CG1 . ILE A 1 323 ? 78.079 24.821  8.420   1.00 36.66  ? 683  ILE A CG1 1 
ATOM   2567 C CG2 . ILE A 1 323 ? 79.773 23.546  9.787   1.00 36.57  ? 683  ILE A CG2 1 
ATOM   2568 C CD1 . ILE A 1 323 ? 78.315 24.502  6.990   1.00 36.73  ? 683  ILE A CD1 1 
ATOM   2569 N N   . ASN A 1 324 ? 81.388 26.105  11.470  1.00 39.28  ? 684  ASN A N   1 
ATOM   2570 C CA  . ASN A 1 324 ? 82.314 25.833  12.575  1.00 40.64  ? 684  ASN A CA  1 
ATOM   2571 C C   . ASN A 1 324 ? 82.136 26.759  13.779  1.00 41.41  ? 684  ASN A C   1 
ATOM   2572 O O   . ASN A 1 324 ? 82.690 26.501  14.847  1.00 41.16  ? 684  ASN A O   1 
ATOM   2573 C CB  . ASN A 1 324 ? 83.787 25.786  12.107  1.00 40.40  ? 684  ASN A CB  1 
ATOM   2574 C CG  . ASN A 1 324 ? 83.998 24.835  10.921  1.00 41.12  ? 684  ASN A CG  1 
ATOM   2575 O OD1 . ASN A 1 324 ? 83.074 24.086  10.513  1.00 42.19  ? 684  ASN A OD1 1 
ATOM   2576 N ND2 . ASN A 1 324 ? 85.204 24.888  10.344  1.00 40.00  ? 684  ASN A ND2 1 
ATOM   2577 N N   . SER A 1 325 ? 81.343 27.818  13.613  1.00 42.68  ? 685  SER A N   1 
ATOM   2578 C CA  . SER A 1 325 ? 81.144 28.808  14.682  1.00 43.98  ? 685  SER A CA  1 
ATOM   2579 C C   . SER A 1 325 ? 79.740 28.772  15.303  1.00 45.13  ? 685  SER A C   1 
ATOM   2580 O O   . SER A 1 325 ? 79.579 29.119  16.477  1.00 45.36  ? 685  SER A O   1 
ATOM   2581 C CB  . SER A 1 325 ? 81.455 30.221  14.181  1.00 43.73  ? 685  SER A CB  1 
ATOM   2582 O OG  . SER A 1 325 ? 80.523 30.623  13.185  1.00 43.66  ? 685  SER A OG  1 
ATOM   2583 N N   . MET A 1 326 ? 78.738 28.362  14.520  1.00 46.24  ? 686  MET A N   1 
ATOM   2584 C CA  . MET A 1 326 ? 77.360 28.238  15.018  1.00 47.80  ? 686  MET A CA  1 
ATOM   2585 C C   . MET A 1 326 ? 77.236 27.257  16.188  1.00 48.82  ? 686  MET A C   1 
ATOM   2586 O O   . MET A 1 326 ? 78.072 26.357  16.366  1.00 48.34  ? 686  MET A O   1 
ATOM   2587 C CB  . MET A 1 326 ? 76.369 27.868  13.890  1.00 47.62  ? 686  MET A CB  1 
ATOM   2588 C CG  . MET A 1 326 ? 76.505 26.455  13.318  1.00 47.12  ? 686  MET A CG  1 
ATOM   2589 S SD  . MET A 1 326 ? 75.385 26.118  11.929  1.00 48.62  ? 686  MET A SD  1 
ATOM   2590 C CE  . MET A 1 326 ? 75.811 24.429  11.541  1.00 49.43  ? 686  MET A CE  1 
ATOM   2591 N N   . ASP A 1 327 ? 76.192 27.456  16.988  1.00 50.53  ? 687  ASP A N   1 
ATOM   2592 C CA  . ASP A 1 327 ? 75.822 26.510  18.036  1.00 52.25  ? 687  ASP A CA  1 
ATOM   2593 C C   . ASP A 1 327 ? 75.395 25.195  17.375  1.00 53.06  ? 687  ASP A C   1 
ATOM   2594 O O   . ASP A 1 327 ? 74.623 25.198  16.417  1.00 53.00  ? 687  ASP A O   1 
ATOM   2595 C CB  . ASP A 1 327 ? 74.691 27.091  18.896  1.00 52.51  ? 687  ASP A CB  1 
ATOM   2596 C CG  . ASP A 1 327 ? 74.161 26.105  19.923  1.00 53.43  ? 687  ASP A CG  1 
ATOM   2597 O OD1 . ASP A 1 327 ? 74.966 25.364  20.528  1.00 54.36  ? 687  ASP A OD1 1 
ATOM   2598 O OD2 . ASP A 1 327 ? 72.927 26.077  20.122  1.00 55.71  ? 687  ASP A OD2 1 
ATOM   2599 N N   . GLN A 1 328 ? 75.914 24.084  17.888  1.00 54.32  ? 688  GLN A N   1 
ATOM   2600 C CA  . GLN A 1 328 ? 75.718 22.766  17.283  1.00 55.45  ? 688  GLN A CA  1 
ATOM   2601 C C   . GLN A 1 328 ? 74.421 22.097  17.747  1.00 56.39  ? 688  GLN A C   1 
ATOM   2602 O O   . GLN A 1 328 ? 73.915 21.187  17.086  1.00 56.96  ? 688  GLN A O   1 
ATOM   2603 C CB  . GLN A 1 328 ? 76.910 21.856  17.598  1.00 55.79  ? 688  GLN A CB  1 
ATOM   2604 C CG  . GLN A 1 328 ? 78.245 22.583  17.811  1.00 55.62  ? 688  GLN A CG  1 
ATOM   2605 C CD  . GLN A 1 328 ? 79.111 22.659  16.556  1.00 56.30  ? 688  GLN A CD  1 
ATOM   2606 O OE1 . GLN A 1 328 ? 78.647 23.038  15.476  1.00 55.84  ? 688  GLN A OE1 1 
ATOM   2607 N NE2 . GLN A 1 328 ? 80.390 22.305  16.705  1.00 56.50  ? 688  GLN A NE2 1 
ATOM   2608 N N   . ASN A 1 329 ? 73.868 22.563  18.864  1.00 57.30  ? 689  ASN A N   1 
ATOM   2609 C CA  . ASN A 1 329 ? 72.699 21.915  19.470  1.00 58.27  ? 689  ASN A CA  1 
ATOM   2610 C C   . ASN A 1 329 ? 71.319 22.449  19.052  1.00 58.90  ? 689  ASN A C   1 
ATOM   2611 O O   . ASN A 1 329 ? 70.303 22.119  19.680  1.00 58.83  ? 689  ASN A O   1 
ATOM   2612 C CB  . ASN A 1 329 ? 72.848 21.897  20.994  1.00 58.26  ? 689  ASN A CB  1 
ATOM   2613 C CG  . ASN A 1 329 ? 73.952 20.966  21.454  1.00 58.71  ? 689  ASN A CG  1 
ATOM   2614 O OD1 . ASN A 1 329 ? 74.073 19.837  20.967  1.00 59.23  ? 689  ASN A OD1 1 
ATOM   2615 N ND2 . ASN A 1 329 ? 74.768 21.433  22.395  1.00 58.84  ? 689  ASN A ND2 1 
ATOM   2616 N N   . MET A 1 330 ? 71.289 23.253  17.988  1.00 59.65  ? 690  MET A N   1 
ATOM   2617 C CA  . MET A 1 330 ? 70.043 23.816  17.463  1.00 60.48  ? 690  MET A CA  1 
ATOM   2618 C C   . MET A 1 330 ? 69.180 22.756  16.803  1.00 60.44  ? 690  MET A C   1 
ATOM   2619 O O   . MET A 1 330 ? 67.955 22.895  16.738  1.00 60.85  ? 690  MET A O   1 
ATOM   2620 C CB  . MET A 1 330 ? 70.329 24.885  16.414  1.00 60.51  ? 690  MET A CB  1 
ATOM   2621 C CG  . MET A 1 330 ? 71.009 26.135  16.908  1.00 61.17  ? 690  MET A CG  1 
ATOM   2622 S SD  . MET A 1 330 ? 70.999 27.366  15.596  1.00 61.79  ? 690  MET A SD  1 
ATOM   2623 C CE  . MET A 1 330 ? 71.705 26.440  14.229  1.00 62.33  ? 690  MET A CE  1 
ATOM   2624 N N   . PHE A 1 331 ? 69.827 21.718  16.279  1.00 60.48  ? 691  PHE A N   1 
ATOM   2625 C CA  . PHE A 1 331 ? 69.116 20.644  15.591  1.00 60.58  ? 691  PHE A CA  1 
ATOM   2626 C C   . PHE A 1 331 ? 69.202 19.353  16.385  1.00 60.50  ? 691  PHE A C   1 
ATOM   2627 O O   . PHE A 1 331 ? 69.292 18.257  15.821  1.00 60.14  ? 691  PHE A O   1 
ATOM   2628 C CB  . PHE A 1 331 ? 69.641 20.456  14.163  1.00 60.54  ? 691  PHE A CB  1 
ATOM   2629 C CG  . PHE A 1 331 ? 69.587 21.701  13.332  1.00 60.51  ? 691  PHE A CG  1 
ATOM   2630 C CD1 . PHE A 1 331 ? 70.735 22.457  13.120  1.00 60.20  ? 691  PHE A CD1 1 
ATOM   2631 C CD2 . PHE A 1 331 ? 68.386 22.124  12.768  1.00 60.81  ? 691  PHE A CD2 1 
ATOM   2632 C CE1 . PHE A 1 331 ? 70.689 23.609  12.355  1.00 60.30  ? 691  PHE A CE1 1 
ATOM   2633 C CE2 . PHE A 1 331 ? 68.335 23.280  12.001  1.00 60.46  ? 691  PHE A CE2 1 
ATOM   2634 C CZ  . PHE A 1 331 ? 69.488 24.021  11.795  1.00 59.92  ? 691  PHE A CZ  1 
ATOM   2635 N N   . ARG A 1 332 ? 69.189 19.488  17.707  1.00 60.64  ? 692  ARG A N   1 
ATOM   2636 C CA  . ARG A 1 332 ? 69.065 18.316  18.554  1.00 60.67  ? 692  ARG A CA  1 
ATOM   2637 C C   . ARG A 1 332 ? 67.603 17.897  18.683  1.00 60.22  ? 692  ARG A C   1 
ATOM   2638 O O   . ARG A 1 332 ? 66.689 18.718  18.517  1.00 60.18  ? 692  ARG A O   1 
ATOM   2639 C CB  . ARG A 1 332 ? 69.792 18.485  19.890  1.00 61.02  ? 692  ARG A CB  1 
ATOM   2640 C CG  . ARG A 1 332 ? 71.298 18.180  19.761  1.00 62.68  ? 692  ARG A CG  1 
ATOM   2641 C CD  . ARG A 1 332 ? 71.532 16.976  18.811  1.00 64.74  ? 692  ARG A CD  1 
ATOM   2642 N NE  . ARG A 1 332 ? 72.829 16.986  18.124  1.00 66.21  ? 692  ARG A NE  1 
ATOM   2643 C CZ  . ARG A 1 332 ? 73.135 17.738  17.062  1.00 67.01  ? 692  ARG A CZ  1 
ATOM   2644 N NH1 . ARG A 1 332 ? 72.253 18.589  16.546  1.00 67.16  ? 692  ARG A NH1 1 
ATOM   2645 N NH2 . ARG A 1 332 ? 74.342 17.653  16.516  1.00 67.43  ? 692  ARG A NH2 1 
ATOM   2646 N N   . ASN A 1 333 ? 67.405 16.604  18.939  1.00 59.71  ? 693  ASN A N   1 
ATOM   2647 C CA  . ASN A 1 333 ? 66.109 15.937  18.793  1.00 58.94  ? 693  ASN A CA  1 
ATOM   2648 C C   . ASN A 1 333 ? 65.631 15.913  17.341  1.00 58.19  ? 693  ASN A C   1 
ATOM   2649 O O   . ASN A 1 333 ? 64.440 15.741  17.080  1.00 58.25  ? 693  ASN A O   1 
ATOM   2650 C CB  . ASN A 1 333 ? 65.042 16.546  19.718  1.00 59.08  ? 693  ASN A CB  1 
ATOM   2651 C CG  . ASN A 1 333 ? 65.402 16.420  21.186  1.00 58.99  ? 693  ASN A CG  1 
ATOM   2652 O OD1 . ASN A 1 333 ? 65.838 15.362  21.646  1.00 58.71  ? 693  ASN A OD1 1 
ATOM   2653 N ND2 . ASN A 1 333 ? 65.214 17.501  21.932  1.00 59.10  ? 693  ASN A ND2 1 
ATOM   2654 N N   . PHE A 1 334 ? 66.565 16.072  16.404  1.00 57.27  ? 694  PHE A N   1 
ATOM   2655 C CA  . PHE A 1 334 ? 66.230 16.013  14.984  1.00 56.56  ? 694  PHE A CA  1 
ATOM   2656 C C   . PHE A 1 334 ? 66.097 14.574  14.526  1.00 56.57  ? 694  PHE A C   1 
ATOM   2657 O O   . PHE A 1 334 ? 65.222 14.270  13.729  1.00 56.57  ? 694  PHE A O   1 
ATOM   2658 C CB  . PHE A 1 334 ? 67.240 16.770  14.104  1.00 55.77  ? 694  PHE A CB  1 
ATOM   2659 C CG  . PHE A 1 334 ? 66.907 16.745  12.628  1.00 54.96  ? 694  PHE A CG  1 
ATOM   2660 C CD1 . PHE A 1 334 ? 65.839 17.487  12.123  1.00 53.36  ? 694  PHE A CD1 1 
ATOM   2661 C CD2 . PHE A 1 334 ? 67.657 15.980  11.744  1.00 53.65  ? 694  PHE A CD2 1 
ATOM   2662 C CE1 . PHE A 1 334 ? 65.530 17.466  10.760  1.00 53.28  ? 694  PHE A CE1 1 
ATOM   2663 C CE2 . PHE A 1 334 ? 67.347 15.951  10.378  1.00 53.85  ? 694  PHE A CE2 1 
ATOM   2664 C CZ  . PHE A 1 334 ? 66.281 16.692  9.887   1.00 52.97  ? 694  PHE A CZ  1 
HETATM 2665 N N   . SEP A 1 335 ? 66.951 13.691  15.037  1.00 56.78  ? 695  SEP A N   1 
HETATM 2666 C CA  . SEP A 1 335 ? 66.939 12.279  14.636  1.00 56.94  ? 695  SEP A CA  1 
HETATM 2667 C CB  . SEP A 1 335 ? 68.148 11.550  15.194  1.00 56.71  ? 695  SEP A CB  1 
HETATM 2668 O OG  . SEP A 1 335 ? 69.296 11.943  14.452  1.00 55.26  ? 695  SEP A OG  1 
HETATM 2669 C C   . SEP A 1 335 ? 65.654 11.539  14.984  1.00 57.50  ? 695  SEP A C   1 
HETATM 2670 O O   . SEP A 1 335 ? 65.007 11.824  15.994  1.00 57.53  ? 695  SEP A O   1 
HETATM 2671 P P   . SEP A 1 335 ? 70.519 12.289  15.477  1.00 52.99  ? 695  SEP A P   1 
HETATM 2672 O O1P . SEP A 1 335 ? 70.129 13.496  16.486  1.00 52.77  ? 695  SEP A O1P 1 
HETATM 2673 O O2P . SEP A 1 335 ? 71.766 12.729  14.541  1.00 50.82  ? 695  SEP A O2P 1 
HETATM 2674 O O3P . SEP A 1 335 ? 70.866 10.957  16.366  1.00 54.34  ? 695  SEP A O3P 1 
ATOM   2675 N N   . PHE A 1 336 ? 65.299 10.591  14.120  1.00 58.26  ? 696  PHE A N   1 
ATOM   2676 C CA  . PHE A 1 336 ? 64.051 9.844   14.216  1.00 59.15  ? 696  PHE A CA  1 
ATOM   2677 C C   . PHE A 1 336 ? 64.117 8.613   13.326  1.00 60.25  ? 696  PHE A C   1 
ATOM   2678 O O   . PHE A 1 336 ? 64.684 8.655   12.229  1.00 59.83  ? 696  PHE A O   1 
ATOM   2679 C CB  . PHE A 1 336 ? 62.864 10.725  13.804  1.00 58.83  ? 696  PHE A CB  1 
ATOM   2680 C CG  . PHE A 1 336 ? 61.517 10.066  13.958  1.00 58.20  ? 696  PHE A CG  1 
ATOM   2681 C CD1 . PHE A 1 336 ? 60.884 10.023  15.197  1.00 57.60  ? 696  PHE A CD1 1 
ATOM   2682 C CD2 . PHE A 1 336 ? 60.866 9.518   12.851  1.00 58.11  ? 696  PHE A CD2 1 
ATOM   2683 C CE1 . PHE A 1 336 ? 59.634 9.424   15.337  1.00 58.27  ? 696  PHE A CE1 1 
ATOM   2684 C CE2 . PHE A 1 336 ? 59.613 8.922   12.974  1.00 58.17  ? 696  PHE A CE2 1 
ATOM   2685 C CZ  . PHE A 1 336 ? 58.995 8.871   14.222  1.00 58.84  ? 696  PHE A CZ  1 
ATOM   2686 N N   . MET A 1 337 ? 63.535 7.520   13.818  1.00 61.96  ? 697  MET A N   1 
ATOM   2687 C CA  . MET A 1 337 ? 63.396 6.287   13.056  1.00 63.67  ? 697  MET A CA  1 
ATOM   2688 C C   . MET A 1 337 ? 61.951 5.775   13.095  1.00 64.56  ? 697  MET A C   1 
ATOM   2689 O O   . MET A 1 337 ? 61.440 5.429   14.167  1.00 64.71  ? 697  MET A O   1 
ATOM   2690 C CB  . MET A 1 337 ? 64.351 5.219   13.595  1.00 64.07  ? 697  MET A CB  1 
ATOM   2691 C CG  . MET A 1 337 ? 64.420 3.969   12.733  1.00 65.19  ? 697  MET A CG  1 
ATOM   2692 S SD  . MET A 1 337 ? 65.351 4.270   11.223  1.00 69.05  ? 697  MET A SD  1 
ATOM   2693 C CE  . MET A 1 337 ? 64.247 3.596   9.975   1.00 66.80  ? 697  MET A CE  1 
ATOM   2694 N N   . ASN A 1 338 ? 61.304 5.749   11.926  1.00 65.67  ? 698  ASN A N   1 
ATOM   2695 C CA  . ASN A 1 338 ? 59.999 5.098   11.724  1.00 66.97  ? 698  ASN A CA  1 
ATOM   2696 C C   . ASN A 1 338 ? 60.098 3.611   12.095  1.00 67.98  ? 698  ASN A C   1 
ATOM   2697 O O   . ASN A 1 338 ? 60.983 2.916   11.586  1.00 68.09  ? 698  ASN A O   1 
ATOM   2698 C CB  . ASN A 1 338 ? 59.573 5.256   10.256  1.00 66.80  ? 698  ASN A CB  1 
ATOM   2699 C CG  . ASN A 1 338 ? 58.170 4.727   9.961   1.00 66.99  ? 698  ASN A CG  1 
ATOM   2700 O OD1 . ASN A 1 338 ? 57.607 3.928   10.711  1.00 66.83  ? 698  ASN A OD1 1 
ATOM   2701 N ND2 . ASN A 1 338 ? 57.606 5.171   8.836   1.00 67.12  ? 698  ASN A ND2 1 
ATOM   2702 N N   . PRO A 1 339 ? 59.208 3.126   12.993  1.00 69.01  ? 699  PRO A N   1 
ATOM   2703 C CA  . PRO A 1 339 ? 59.257 1.720   13.451  1.00 69.71  ? 699  PRO A CA  1 
ATOM   2704 C C   . PRO A 1 339 ? 59.495 0.712   12.312  1.00 70.28  ? 699  PRO A C   1 
ATOM   2705 O O   . PRO A 1 339 ? 58.678 0.605   11.378  1.00 70.16  ? 699  PRO A O   1 
ATOM   2706 C CB  . PRO A 1 339 ? 57.886 1.517   14.106  1.00 69.62  ? 699  PRO A CB  1 
ATOM   2707 C CG  . PRO A 1 339 ? 57.543 2.869   14.647  1.00 69.51  ? 699  PRO A CG  1 
ATOM   2708 C CD  . PRO A 1 339 ? 58.106 3.871   13.641  1.00 69.25  ? 699  PRO A CD  1 
ATOM   2709 N N   . GLY A 1 340 ? 60.629 0.006   12.401  1.00 70.82  ? 700  GLY A N   1 
ATOM   2710 C CA  . GLY A 1 340 ? 61.091 -0.913  11.353  1.00 71.33  ? 700  GLY A CA  1 
ATOM   2711 C C   . GLY A 1 340 ? 61.309 -0.221  10.014  1.00 71.62  ? 700  GLY A C   1 
ATOM   2712 O O   . GLY A 1 340 ? 62.408 0.253   9.712   1.00 71.87  ? 700  GLY A O   1 
ATOM   2713 N N   . LEU B 1 15  ? 70.404 -47.348 -16.506 1.00 66.76  ? 375  LEU B N   1 
ATOM   2714 C CA  . LEU B 1 15  ? 71.355 -46.427 -15.807 1.00 66.72  ? 375  LEU B CA  1 
ATOM   2715 C C   . LEU B 1 15  ? 70.704 -45.211 -15.108 1.00 66.74  ? 375  LEU B C   1 
ATOM   2716 O O   . LEU B 1 15  ? 69.810 -44.541 -15.663 1.00 66.28  ? 375  LEU B O   1 
ATOM   2717 C CB  . LEU B 1 15  ? 72.498 -45.980 -16.745 1.00 66.75  ? 375  LEU B CB  1 
ATOM   2718 C CG  . LEU B 1 15  ? 72.269 -45.438 -18.166 1.00 66.72  ? 375  LEU B CG  1 
ATOM   2719 C CD1 . LEU B 1 15  ? 72.113 -43.919 -18.203 1.00 66.30  ? 375  LEU B CD1 1 
ATOM   2720 C CD2 . LEU B 1 15  ? 73.408 -45.889 -19.090 1.00 65.47  ? 375  LEU B CD2 1 
ATOM   2721 N N   . LYS B 1 16  ? 71.170 -44.968 -13.875 1.00 66.42  ? 376  LYS B N   1 
ATOM   2722 C CA  . LYS B 1 16  ? 70.975 -43.714 -13.127 1.00 65.54  ? 376  LYS B CA  1 
ATOM   2723 C C   . LYS B 1 16  ? 70.320 -43.843 -11.735 1.00 64.87  ? 376  LYS B C   1 
ATOM   2724 O O   . LYS B 1 16  ? 70.424 -44.898 -11.088 1.00 65.30  ? 376  LYS B O   1 
ATOM   2725 C CB  . LYS B 1 16  ? 70.296 -42.654 -13.983 1.00 65.76  ? 376  LYS B CB  1 
ATOM   2726 C CG  . LYS B 1 16  ? 71.153 -42.143 -15.135 1.00 66.38  ? 376  LYS B CG  1 
ATOM   2727 C CD  . LYS B 1 16  ? 70.550 -40.887 -15.742 1.00 67.66  ? 376  LYS B CD  1 
ATOM   2728 C CE  . LYS B 1 16  ? 70.972 -39.651 -14.964 1.00 68.42  ? 376  LYS B CE  1 
ATOM   2729 N NZ  . LYS B 1 16  ? 72.442 -39.399 -15.111 1.00 68.32  ? 376  LYS B NZ  1 
ATOM   2730 N N   . ILE B 1 17  ? 69.684 -42.755 -11.301 1.00 63.48  ? 377  ILE B N   1 
ATOM   2731 C CA  . ILE B 1 17  ? 69.080 -42.513 -9.957  1.00 62.51  ? 377  ILE B CA  1 
ATOM   2732 C C   . ILE B 1 17  ? 70.007 -42.457 -8.725  1.00 61.64  ? 377  ILE B C   1 
ATOM   2733 O O   . ILE B 1 17  ? 69.879 -41.553 -7.885  1.00 61.60  ? 377  ILE B O   1 
ATOM   2734 C CB  . ILE B 1 17  ? 67.680 -43.214 -9.698  1.00 62.54  ? 377  ILE B CB  1 
ATOM   2735 C CG1 . ILE B 1 17  ? 66.979 -42.603 -8.473  1.00 62.12  ? 377  ILE B CG1 1 
ATOM   2736 C CG2 . ILE B 1 17  ? 67.788 -44.731 -9.563  1.00 62.83  ? 377  ILE B CG2 1 
ATOM   2737 C CD1 . ILE B 1 17  ? 66.668 -41.128 -8.593  1.00 61.41  ? 377  ILE B CD1 1 
ATOM   2738 N N   . GLU B 1 18  ? 70.936 -43.403 -8.636  1.00 60.46  ? 378  GLU B N   1 
ATOM   2739 C CA  . GLU B 1 18  ? 72.004 -43.376 -7.628  1.00 59.36  ? 378  GLU B CA  1 
ATOM   2740 C C   . GLU B 1 18  ? 72.999 -42.237 -7.911  1.00 57.92  ? 378  GLU B C   1 
ATOM   2741 O O   . GLU B 1 18  ? 73.801 -41.859 -7.048  1.00 57.60  ? 378  GLU B O   1 
ATOM   2742 C CB  . GLU B 1 18  ? 72.728 -44.730 -7.588  1.00 59.61  ? 378  GLU B CB  1 
ATOM   2743 C CG  . GLU B 1 18  ? 71.957 -45.833 -6.858  1.00 61.68  ? 378  GLU B CG  1 
ATOM   2744 C CD  . GLU B 1 18  ? 72.034 -47.189 -7.570  1.00 65.38  ? 378  GLU B CD  1 
ATOM   2745 O OE1 . GLU B 1 18  ? 71.374 -47.333 -8.626  1.00 67.28  ? 378  GLU B OE1 1 
ATOM   2746 O OE2 . GLU B 1 18  ? 72.735 -48.113 -7.078  1.00 65.90  ? 378  GLU B OE2 1 
ATOM   2747 N N   . ASP B 1 19  ? 72.924 -41.696 -9.126  1.00 56.12  ? 379  ASP B N   1 
ATOM   2748 C CA  . ASP B 1 19  ? 73.797 -40.613 -9.576  1.00 54.70  ? 379  ASP B CA  1 
ATOM   2749 C C   . ASP B 1 19  ? 73.483 -39.265 -8.924  1.00 53.07  ? 379  ASP B C   1 
ATOM   2750 O O   . ASP B 1 19  ? 74.263 -38.325 -9.037  1.00 52.62  ? 379  ASP B O   1 
ATOM   2751 C CB  . ASP B 1 19  ? 73.726 -40.487 -11.101 1.00 54.89  ? 379  ASP B CB  1 
ATOM   2752 C CG  . ASP B 1 19  ? 74.207 -41.748 -11.822 1.00 56.39  ? 379  ASP B CG  1 
ATOM   2753 O OD1 . ASP B 1 19  ? 75.068 -42.487 -11.278 1.00 57.12  ? 379  ASP B OD1 1 
ATOM   2754 O OD2 . ASP B 1 19  ? 73.726 -41.996 -12.949 1.00 58.32  ? 379  ASP B OD2 1 
ATOM   2755 N N   . PHE B 1 20  ? 72.346 -39.196 -8.235  1.00 51.55  ? 380  PHE B N   1 
ATOM   2756 C CA  . PHE B 1 20  ? 71.858 -37.972 -7.611  1.00 50.06  ? 380  PHE B CA  1 
ATOM   2757 C C   . PHE B 1 20  ? 71.811 -38.071 -6.088  1.00 50.34  ? 380  PHE B C   1 
ATOM   2758 O O   . PHE B 1 20  ? 71.429 -39.101 -5.532  1.00 50.32  ? 380  PHE B O   1 
ATOM   2759 C CB  . PHE B 1 20  ? 70.454 -37.634 -8.118  1.00 48.75  ? 380  PHE B CB  1 
ATOM   2760 C CG  . PHE B 1 20  ? 70.374 -37.373 -9.595  1.00 45.95  ? 380  PHE B CG  1 
ATOM   2761 C CD1 . PHE B 1 20  ? 70.556 -36.077 -10.101 1.00 43.78  ? 380  PHE B CD1 1 
ATOM   2762 C CD2 . PHE B 1 20  ? 70.079 -38.407 -10.481 1.00 41.99  ? 380  PHE B CD2 1 
ATOM   2763 C CE1 . PHE B 1 20  ? 70.466 -35.818 -11.463 1.00 41.42  ? 380  PHE B CE1 1 
ATOM   2764 C CE2 . PHE B 1 20  ? 69.983 -38.163 -11.843 1.00 41.31  ? 380  PHE B CE2 1 
ATOM   2765 C CZ  . PHE B 1 20  ? 70.185 -36.857 -12.337 1.00 43.95  ? 380  PHE B CZ  1 
ATOM   2766 N N   . GLU B 1 21  ? 72.206 -36.982 -5.434  1.00 50.46  ? 381  GLU B N   1 
ATOM   2767 C CA  . GLU B 1 21  ? 71.926 -36.742 -4.023  1.00 50.65  ? 381  GLU B CA  1 
ATOM   2768 C C   . GLU B 1 21  ? 70.583 -36.006 -3.983  1.00 50.35  ? 381  GLU B C   1 
ATOM   2769 O O   . GLU B 1 21  ? 70.442 -34.934 -4.583  1.00 49.80  ? 381  GLU B O   1 
ATOM   2770 C CB  . GLU B 1 21  ? 73.019 -35.845 -3.422  1.00 50.94  ? 381  GLU B CB  1 
ATOM   2771 C CG  . GLU B 1 21  ? 73.572 -36.277 -2.051  1.00 53.11  ? 381  GLU B CG  1 
ATOM   2772 C CD  . GLU B 1 21  ? 72.813 -35.705 -0.858  1.00 55.72  ? 381  GLU B CD  1 
ATOM   2773 O OE1 . GLU B 1 21  ? 72.288 -34.569 -0.960  1.00 57.17  ? 381  GLU B OE1 1 
ATOM   2774 O OE2 . GLU B 1 21  ? 72.756 -36.395 0.190   1.00 55.98  ? 381  GLU B OE2 1 
ATOM   2775 N N   . LEU B 1 22  ? 69.595 -36.585 -3.305  1.00 49.99  ? 382  LEU B N   1 
ATOM   2776 C CA  . LEU B 1 22  ? 68.324 -35.903 -3.095  1.00 49.81  ? 382  LEU B CA  1 
ATOM   2777 C C   . LEU B 1 22  ? 68.359 -35.069 -1.818  1.00 49.78  ? 382  LEU B C   1 
ATOM   2778 O O   . LEU B 1 22  ? 68.284 -35.594 -0.709  1.00 49.48  ? 382  LEU B O   1 
ATOM   2779 C CB  . LEU B 1 22  ? 67.149 -36.883 -3.077  1.00 49.69  ? 382  LEU B CB  1 
ATOM   2780 C CG  . LEU B 1 22  ? 66.864 -37.713 -4.333  1.00 50.00  ? 382  LEU B CG  1 
ATOM   2781 C CD1 . LEU B 1 22  ? 65.618 -38.555 -4.114  1.00 51.09  ? 382  LEU B CD1 1 
ATOM   2782 C CD2 . LEU B 1 22  ? 66.683 -36.859 -5.563  1.00 49.40  ? 382  LEU B CD2 1 
ATOM   2783 N N   . HIS B 1 23  ? 68.447 -33.755 -2.005  1.00 49.91  ? 383  HIS B N   1 
ATOM   2784 C CA  . HIS B 1 23  ? 68.630 -32.794 -0.924  1.00 50.10  ? 383  HIS B CA  1 
ATOM   2785 C C   . HIS B 1 23  ? 67.361 -32.423 -0.173  1.00 49.89  ? 383  HIS B C   1 
ATOM   2786 O O   . HIS B 1 23  ? 67.397 -32.197 1.041   1.00 49.75  ? 383  HIS B O   1 
ATOM   2787 C CB  . HIS B 1 23  ? 69.260 -31.524 -1.487  1.00 50.26  ? 383  HIS B CB  1 
ATOM   2788 C CG  . HIS B 1 23  ? 70.688 -31.699 -1.891  1.00 52.16  ? 383  HIS B CG  1 
ATOM   2789 N ND1 . HIS B 1 23  ? 71.738 -31.298 -1.094  1.00 53.58  ? 383  HIS B ND1 1 
ATOM   2790 C CD2 . HIS B 1 23  ? 71.242 -32.251 -2.997  1.00 53.44  ? 383  HIS B CD2 1 
ATOM   2791 C CE1 . HIS B 1 23  ? 72.880 -31.583 -1.697  1.00 54.24  ? 383  HIS B CE1 1 
ATOM   2792 N NE2 . HIS B 1 23  ? 72.607 -32.164 -2.852  1.00 54.19  ? 383  HIS B NE2 1 
ATOM   2793 N N   . LYS B 1 24  ? 66.243 -32.368 -0.893  1.00 49.46  ? 384  LYS B N   1 
ATOM   2794 C CA  . LYS B 1 24  ? 65.032 -31.746 -0.382  1.00 49.27  ? 384  LYS B CA  1 
ATOM   2795 C C   . LYS B 1 24  ? 63.842 -32.133 -1.262  1.00 48.47  ? 384  LYS B C   1 
ATOM   2796 O O   . LYS B 1 24  ? 63.978 -32.241 -2.481  1.00 48.06  ? 384  LYS B O   1 
ATOM   2797 C CB  . LYS B 1 24  ? 65.232 -30.219 -0.399  1.00 49.90  ? 384  LYS B CB  1 
ATOM   2798 C CG  . LYS B 1 24  ? 64.145 -29.394 0.250   1.00 51.81  ? 384  LYS B CG  1 
ATOM   2799 C CD  . LYS B 1 24  ? 64.259 -27.937 -0.187  1.00 55.11  ? 384  LYS B CD  1 
ATOM   2800 C CE  . LYS B 1 24  ? 62.984 -27.148 0.143   1.00 57.82  ? 384  LYS B CE  1 
ATOM   2801 N NZ  . LYS B 1 24  ? 62.748 -27.023 1.623   1.00 59.41  ? 384  LYS B NZ  1 
ATOM   2802 N N   . MET B 1 25  ? 62.686 -32.361 -0.646  1.00 47.67  ? 385  MET B N   1 
ATOM   2803 C CA  . MET B 1 25  ? 61.449 -32.463 -1.406  1.00 47.89  ? 385  MET B CA  1 
ATOM   2804 C C   . MET B 1 25  ? 60.889 -31.056 -1.672  1.00 45.79  ? 385  MET B C   1 
ATOM   2805 O O   . MET B 1 25  ? 60.607 -30.305 -0.742  1.00 45.64  ? 385  MET B O   1 
ATOM   2806 C CB  . MET B 1 25  ? 60.412 -33.344 -0.702  1.00 47.55  ? 385  MET B CB  1 
ATOM   2807 C CG  . MET B 1 25  ? 59.230 -33.660 -1.605  1.00 48.48  ? 385  MET B CG  1 
ATOM   2808 S SD  . MET B 1 25  ? 57.790 -34.305 -0.748  1.00 53.91  ? 385  MET B SD  1 
ATOM   2809 C CE  . MET B 1 25  ? 57.074 -32.805 -0.049  1.00 53.89  ? 385  MET B CE  1 
ATOM   2810 N N   . LEU B 1 26  ? 60.761 -30.701 -2.944  1.00 44.09  ? 386  LEU B N   1 
ATOM   2811 C CA  . LEU B 1 26  ? 60.267 -29.376 -3.331  1.00 43.03  ? 386  LEU B CA  1 
ATOM   2812 C C   . LEU B 1 26  ? 58.767 -29.278 -3.027  1.00 43.18  ? 386  LEU B C   1 
ATOM   2813 O O   . LEU B 1 26  ? 58.310 -28.327 -2.414  1.00 43.63  ? 386  LEU B O   1 
ATOM   2814 C CB  . LEU B 1 26  ? 60.615 -29.052 -4.799  1.00 41.35  ? 386  LEU B CB  1 
ATOM   2815 C CG  . LEU B 1 26  ? 62.117 -28.868 -5.102  1.00 39.40  ? 386  LEU B CG  1 
ATOM   2816 C CD1 . LEU B 1 26  ? 62.451 -28.806 -6.595  1.00 32.24  ? 386  LEU B CD1 1 
ATOM   2817 C CD2 . LEU B 1 26  ? 62.703 -27.646 -4.352  1.00 36.37  ? 386  LEU B CD2 1 
ATOM   2818 N N   . GLY B 1 27  ? 58.017 -30.294 -3.409  1.00 43.22  ? 387  GLY B N   1 
ATOM   2819 C CA  . GLY B 1 27  ? 56.627 -30.357 -3.058  1.00 44.02  ? 387  GLY B CA  1 
ATOM   2820 C C   . GLY B 1 27  ? 55.991 -31.629 -3.552  1.00 44.68  ? 387  GLY B C   1 
ATOM   2821 O O   . GLY B 1 27  ? 56.607 -32.408 -4.291  1.00 44.92  ? 387  GLY B O   1 
ATOM   2822 N N   . LYS B 1 28  ? 54.742 -31.806 -3.152  1.00 45.38  ? 388  LYS B N   1 
ATOM   2823 C CA  . LYS B 1 28  ? 53.956 -32.985 -3.450  1.00 46.78  ? 388  LYS B CA  1 
ATOM   2824 C C   . LYS B 1 28  ? 52.540 -32.514 -3.757  1.00 46.86  ? 388  LYS B C   1 
ATOM   2825 O O   . LYS B 1 28  ? 52.020 -31.642 -3.065  1.00 47.47  ? 388  LYS B O   1 
ATOM   2826 C CB  . LYS B 1 28  ? 53.945 -33.898 -2.228  1.00 47.10  ? 388  LYS B CB  1 
ATOM   2827 C CG  . LYS B 1 28  ? 53.279 -35.226 -2.426  1.00 49.98  ? 388  LYS B CG  1 
ATOM   2828 C CD  . LYS B 1 28  ? 52.973 -35.845 -1.074  1.00 55.21  ? 388  LYS B CD  1 
ATOM   2829 C CE  . LYS B 1 28  ? 51.970 -36.995 -1.206  1.00 58.17  ? 388  LYS B CE  1 
ATOM   2830 N NZ  . LYS B 1 28  ? 51.109 -37.088 0.016   1.00 60.33  ? 388  LYS B NZ  1 
ATOM   2831 N N   . GLY B 1 29  ? 51.922 -33.084 -4.787  1.00 46.60  ? 389  GLY B N   1 
ATOM   2832 C CA  . GLY B 1 29  ? 50.588 -32.667 -5.192  1.00 46.32  ? 389  GLY B CA  1 
ATOM   2833 C C   . GLY B 1 29  ? 50.096 -33.482 -6.359  1.00 46.41  ? 389  GLY B C   1 
ATOM   2834 O O   . GLY B 1 29  ? 50.557 -34.618 -6.556  1.00 46.58  ? 389  GLY B O   1 
ATOM   2835 N N   . SER B 1 30  ? 49.188 -32.900 -7.150  1.00 45.93  ? 390  SER B N   1 
ATOM   2836 C CA  . SER B 1 30  ? 48.635 -33.569 -8.345  1.00 45.88  ? 390  SER B CA  1 
ATOM   2837 C C   . SER B 1 30  ? 49.711 -33.938 -9.370  1.00 45.74  ? 390  SER B C   1 
ATOM   2838 O O   . SER B 1 30  ? 49.525 -34.873 -10.147 1.00 46.30  ? 390  SER B O   1 
ATOM   2839 C CB  . SER B 1 30  ? 47.565 -32.690 -9.010  1.00 45.78  ? 390  SER B CB  1 
ATOM   2840 O OG  . SER B 1 30  ? 48.072 -31.370 -9.293  1.00 48.49  ? 390  SER B OG  1 
ATOM   2841 N N   . PHE B 1 31  ? 50.819 -33.180 -9.362  1.00 44.99  ? 391  PHE B N   1 
ATOM   2842 C CA  . PHE B 1 31  ? 51.993 -33.372 -10.223 1.00 43.77  ? 391  PHE B CA  1 
ATOM   2843 C C   . PHE B 1 31  ? 52.916 -34.495 -9.757  1.00 44.16  ? 391  PHE B C   1 
ATOM   2844 O O   . PHE B 1 31  ? 53.926 -34.784 -10.416 1.00 44.98  ? 391  PHE B O   1 
ATOM   2845 C CB  . PHE B 1 31  ? 52.817 -32.070 -10.284 1.00 42.95  ? 391  PHE B CB  1 
ATOM   2846 C CG  . PHE B 1 31  ? 53.053 -31.428 -8.935  1.00 41.46  ? 391  PHE B CG  1 
ATOM   2847 C CD1 . PHE B 1 31  ? 52.203 -30.423 -8.466  1.00 41.08  ? 391  PHE B CD1 1 
ATOM   2848 C CD2 . PHE B 1 31  ? 54.116 -31.826 -8.132  1.00 39.71  ? 391  PHE B CD2 1 
ATOM   2849 C CE1 . PHE B 1 31  ? 52.409 -29.825 -7.224  1.00 39.33  ? 391  PHE B CE1 1 
ATOM   2850 C CE2 . PHE B 1 31  ? 54.324 -31.250 -6.893  1.00 38.76  ? 391  PHE B CE2 1 
ATOM   2851 C CZ  . PHE B 1 31  ? 53.472 -30.244 -6.431  1.00 40.16  ? 391  PHE B CZ  1 
ATOM   2852 N N   . GLY B 1 32  ? 52.595 -35.118 -8.626  1.00 43.42  ? 392  GLY B N   1 
ATOM   2853 C CA  . GLY B 1 32  ? 53.465 -36.146 -8.056  1.00 42.81  ? 392  GLY B CA  1 
ATOM   2854 C C   . GLY B 1 32  ? 54.335 -35.639 -6.922  1.00 42.49  ? 392  GLY B C   1 
ATOM   2855 O O   . GLY B 1 32  ? 53.879 -34.889 -6.071  1.00 42.94  ? 392  GLY B O   1 
ATOM   2856 N N   . LYS B 1 33  ? 55.586 -36.079 -6.901  1.00 42.68  ? 393  LYS B N   1 
ATOM   2857 C CA  . LYS B 1 33  ? 56.586 -35.603 -5.951  1.00 42.84  ? 393  LYS B CA  1 
ATOM   2858 C C   . LYS B 1 33  ? 57.745 -35.044 -6.751  1.00 42.46  ? 393  LYS B C   1 
ATOM   2859 O O   . LYS B 1 33  ? 58.218 -35.699 -7.686  1.00 42.45  ? 393  LYS B O   1 
ATOM   2860 C CB  . LYS B 1 33  ? 57.107 -36.738 -5.074  1.00 42.90  ? 393  LYS B CB  1 
ATOM   2861 C CG  . LYS B 1 33  ? 56.368 -36.936 -3.782  1.00 45.75  ? 393  LYS B CG  1 
ATOM   2862 C CD  . LYS B 1 33  ? 56.734 -38.278 -3.175  1.00 48.12  ? 393  LYS B CD  1 
ATOM   2863 C CE  . LYS B 1 33  ? 55.977 -38.519 -1.884  1.00 50.83  ? 393  LYS B CE  1 
ATOM   2864 N NZ  . LYS B 1 33  ? 55.903 -39.988 -1.568  1.00 51.07  ? 393  LYS B NZ  1 
ATOM   2865 N N   . VAL B 1 34  ? 58.205 -33.849 -6.379  1.00 41.71  ? 394  VAL B N   1 
ATOM   2866 C CA  . VAL B 1 34  ? 59.357 -33.227 -7.025  1.00 40.78  ? 394  VAL B CA  1 
ATOM   2867 C C   . VAL B 1 34  ? 60.470 -33.004 -5.984  1.00 40.61  ? 394  VAL B C   1 
ATOM   2868 O O   . VAL B 1 34  ? 60.214 -32.510 -4.878  1.00 40.58  ? 394  VAL B O   1 
ATOM   2869 C CB  . VAL B 1 34  ? 58.953 -31.938 -7.791  1.00 41.09  ? 394  VAL B CB  1 
ATOM   2870 C CG1 . VAL B 1 34  ? 60.163 -31.285 -8.509  1.00 40.71  ? 394  VAL B CG1 1 
ATOM   2871 C CG2 . VAL B 1 34  ? 57.858 -32.265 -8.802  1.00 39.65  ? 394  VAL B CG2 1 
ATOM   2872 N N   . PHE B 1 35  ? 61.689 -33.432 -6.322  1.00 39.49  ? 395  PHE B N   1 
ATOM   2873 C CA  . PHE B 1 35  ? 62.834 -33.316 -5.417  1.00 39.19  ? 395  PHE B CA  1 
ATOM   2874 C C   . PHE B 1 35  ? 63.895 -32.350 -5.949  1.00 38.61  ? 395  PHE B C   1 
ATOM   2875 O O   . PHE B 1 35  ? 64.103 -32.259 -7.141  1.00 37.45  ? 395  PHE B O   1 
ATOM   2876 C CB  . PHE B 1 35  ? 63.483 -34.696 -5.157  1.00 38.83  ? 395  PHE B CB  1 
ATOM   2877 C CG  . PHE B 1 35  ? 62.577 -35.674 -4.465  1.00 39.30  ? 395  PHE B CG  1 
ATOM   2878 C CD1 . PHE B 1 35  ? 61.687 -36.459 -5.198  1.00 40.11  ? 395  PHE B CD1 1 
ATOM   2879 C CD2 . PHE B 1 35  ? 62.602 -35.807 -3.075  1.00 38.57  ? 395  PHE B CD2 1 
ATOM   2880 C CE1 . PHE B 1 35  ? 60.823 -37.345 -4.556  1.00 39.44  ? 395  PHE B CE1 1 
ATOM   2881 C CE2 . PHE B 1 35  ? 61.762 -36.692 -2.431  1.00 38.82  ? 395  PHE B CE2 1 
ATOM   2882 C CZ  . PHE B 1 35  ? 60.868 -37.471 -3.172  1.00 39.81  ? 395  PHE B CZ  1 
ATOM   2883 N N   . LEU B 1 36  ? 64.564 -31.645 -5.043  1.00 39.45  ? 396  LEU B N   1 
ATOM   2884 C CA  . LEU B 1 36  ? 65.829 -30.987 -5.372  1.00 40.30  ? 396  LEU B CA  1 
ATOM   2885 C C   . LEU B 1 36  ? 66.944 -32.041 -5.396  1.00 41.15  ? 396  LEU B C   1 
ATOM   2886 O O   . LEU B 1 36  ? 67.216 -32.690 -4.388  1.00 41.15  ? 396  LEU B O   1 
ATOM   2887 C CB  . LEU B 1 36  ? 66.159 -29.869 -4.376  1.00 40.44  ? 396  LEU B CB  1 
ATOM   2888 C CG  . LEU B 1 36  ? 67.419 -29.023 -4.617  1.00 39.92  ? 396  LEU B CG  1 
ATOM   2889 C CD1 . LEU B 1 36  ? 67.443 -28.497 -6.033  1.00 40.19  ? 396  LEU B CD1 1 
ATOM   2890 C CD2 . LEU B 1 36  ? 67.507 -27.893 -3.627  1.00 39.46  ? 396  LEU B CD2 1 
ATOM   2891 N N   . ALA B 1 37  ? 67.568 -32.206 -6.559  1.00 41.82  ? 397  ALA B N   1 
ATOM   2892 C CA  . ALA B 1 37  ? 68.580 -33.232 -6.764  1.00 42.65  ? 397  ALA B CA  1 
ATOM   2893 C C   . ALA B 1 37  ? 69.923 -32.670 -7.270  1.00 43.23  ? 397  ALA B C   1 
ATOM   2894 O O   . ALA B 1 37  ? 69.962 -31.789 -8.120  1.00 42.82  ? 397  ALA B O   1 
ATOM   2895 C CB  . ALA B 1 37  ? 68.052 -34.303 -7.713  1.00 42.11  ? 397  ALA B CB  1 
ATOM   2896 N N   . GLU B 1 38  ? 71.022 -33.194 -6.734  1.00 44.49  ? 398  GLU B N   1 
ATOM   2897 C CA  . GLU B 1 38  ? 72.352 -32.815 -7.208  1.00 45.88  ? 398  GLU B CA  1 
ATOM   2898 C C   . GLU B 1 38  ? 73.003 -33.975 -7.948  1.00 45.92  ? 398  GLU B C   1 
ATOM   2899 O O   . GLU B 1 38  ? 73.178 -35.047 -7.382  1.00 45.76  ? 398  GLU B O   1 
ATOM   2900 C CB  . GLU B 1 38  ? 73.231 -32.341 -6.054  1.00 45.68  ? 398  GLU B CB  1 
ATOM   2901 C CG  . GLU B 1 38  ? 74.616 -31.881 -6.475  1.00 46.46  ? 398  GLU B CG  1 
ATOM   2902 C CD  . GLU B 1 38  ? 75.518 -31.552 -5.296  1.00 47.39  ? 398  GLU B CD  1 
ATOM   2903 O OE1 . GLU B 1 38  ? 75.072 -31.695 -4.131  1.00 49.48  ? 398  GLU B OE1 1 
ATOM   2904 O OE2 . GLU B 1 38  ? 76.685 -31.145 -5.534  1.00 50.59  ? 398  GLU B OE2 1 
ATOM   2905 N N   . PHE B 1 39  ? 73.340 -33.749 -9.216  1.00 46.72  ? 399  PHE B N   1 
ATOM   2906 C CA  . PHE B 1 39  ? 74.013 -34.746 -10.035 1.00 47.87  ? 399  PHE B CA  1 
ATOM   2907 C C   . PHE B 1 39  ? 75.464 -34.846 -9.567  1.00 48.49  ? 399  PHE B C   1 
ATOM   2908 O O   . PHE B 1 39  ? 76.297 -33.998 -9.903  1.00 48.36  ? 399  PHE B O   1 
ATOM   2909 C CB  . PHE B 1 39  ? 73.905 -34.383 -11.525 1.00 47.98  ? 399  PHE B CB  1 
ATOM   2910 C CG  . PHE B 1 39  ? 74.491 -35.420 -12.457 1.00 48.49  ? 399  PHE B CG  1 
ATOM   2911 C CD1 . PHE B 1 39  ? 75.537 -35.088 -13.313 1.00 49.50  ? 399  PHE B CD1 1 
ATOM   2912 C CD2 . PHE B 1 39  ? 73.991 -36.723 -12.486 1.00 48.25  ? 399  PHE B CD2 1 
ATOM   2913 C CE1 . PHE B 1 39  ? 76.092 -36.044 -14.184 1.00 50.10  ? 399  PHE B CE1 1 
ATOM   2914 C CE2 . PHE B 1 39  ? 74.531 -37.684 -13.348 1.00 49.44  ? 399  PHE B CE2 1 
ATOM   2915 C CZ  . PHE B 1 39  ? 75.592 -37.348 -14.198 1.00 49.46  ? 399  PHE B CZ  1 
ATOM   2916 N N   . LYS B 1 40  ? 75.735 -35.878 -8.763  1.00 49.58  ? 400  LYS B N   1 
ATOM   2917 C CA  . LYS B 1 40  ? 77.017 -36.065 -8.042  1.00 50.46  ? 400  LYS B CA  1 
ATOM   2918 C C   . LYS B 1 40  ? 78.286 -35.828 -8.856  1.00 50.66  ? 400  LYS B C   1 
ATOM   2919 O O   . LYS B 1 40  ? 79.272 -35.292 -8.340  1.00 50.63  ? 400  LYS B O   1 
ATOM   2920 C CB  . LYS B 1 40  ? 77.081 -37.462 -7.421  1.00 50.65  ? 400  LYS B CB  1 
ATOM   2921 C CG  . LYS B 1 40  ? 75.976 -37.773 -6.415  1.00 52.31  ? 400  LYS B CG  1 
ATOM   2922 C CD  . LYS B 1 40  ? 76.249 -37.154 -5.057  1.00 54.06  ? 400  LYS B CD  1 
ATOM   2923 C CE  . LYS B 1 40  ? 75.813 -38.098 -3.954  1.00 55.21  ? 400  LYS B CE  1 
ATOM   2924 N NZ  . LYS B 1 40  ? 76.401 -37.691 -2.649  1.00 56.25  ? 400  LYS B NZ  1 
ATOM   2925 N N   . LYS B 1 41  ? 78.249 -36.232 -10.124 1.00 51.21  ? 401  LYS B N   1 
ATOM   2926 C CA  . LYS B 1 41  ? 79.406 -36.165 -11.017 1.00 51.56  ? 401  LYS B CA  1 
ATOM   2927 C C   . LYS B 1 41  ? 79.817 -34.727 -11.342 1.00 51.58  ? 401  LYS B C   1 
ATOM   2928 O O   . LYS B 1 41  ? 80.999 -34.369 -11.224 1.00 51.55  ? 401  LYS B O   1 
ATOM   2929 C CB  . LYS B 1 41  ? 79.106 -36.930 -12.311 1.00 51.80  ? 401  LYS B CB  1 
ATOM   2930 C CG  . LYS B 1 41  ? 80.294 -37.653 -12.899 1.00 53.00  ? 401  LYS B CG  1 
ATOM   2931 C CD  . LYS B 1 41  ? 80.000 -38.142 -14.311 1.00 54.83  ? 401  LYS B CD  1 
ATOM   2932 C CE  . LYS B 1 41  ? 81.226 -38.823 -14.920 1.00 55.21  ? 401  LYS B CE  1 
ATOM   2933 N NZ  . LYS B 1 41  ? 82.411 -37.918 -15.007 1.00 55.89  ? 401  LYS B NZ  1 
ATOM   2934 N N   . THR B 1 42  ? 78.841 -33.906 -11.736 1.00 51.43  ? 402  THR B N   1 
ATOM   2935 C CA  . THR B 1 42  ? 79.113 -32.537 -12.196 1.00 51.50  ? 402  THR B CA  1 
ATOM   2936 C C   . THR B 1 42  ? 78.705 -31.454 -11.190 1.00 50.92  ? 402  THR B C   1 
ATOM   2937 O O   . THR B 1 42  ? 78.988 -30.277 -11.397 1.00 50.86  ? 402  THR B O   1 
ATOM   2938 C CB  . THR B 1 42  ? 78.447 -32.252 -13.568 1.00 51.51  ? 402  THR B CB  1 
ATOM   2939 O OG1 . THR B 1 42  ? 77.021 -32.295 -13.427 1.00 53.00  ? 402  THR B OG1 1 
ATOM   2940 C CG2 . THR B 1 42  ? 78.886 -33.284 -14.610 1.00 52.09  ? 402  THR B CG2 1 
ATOM   2941 N N   . ASN B 1 43  ? 78.037 -31.865 -10.113 1.00 50.67  ? 403  ASN B N   1 
ATOM   2942 C CA  . ASN B 1 43  ? 77.544 -30.955 -9.059  1.00 50.11  ? 403  ASN B CA  1 
ATOM   2943 C C   . ASN B 1 43  ? 76.433 -29.968 -9.508  1.00 49.40  ? 403  ASN B C   1 
ATOM   2944 O O   . ASN B 1 43  ? 76.177 -28.950 -8.858  1.00 49.16  ? 403  ASN B O   1 
ATOM   2945 C CB  . ASN B 1 43  ? 78.719 -30.250 -8.351  1.00 49.96  ? 403  ASN B CB  1 
ATOM   2946 C CG  . ASN B 1 43  ? 79.717 -31.239 -7.743  1.00 50.84  ? 403  ASN B CG  1 
ATOM   2947 O OD1 . ASN B 1 43  ? 80.932 -30.998 -7.732  1.00 50.32  ? 403  ASN B OD1 1 
ATOM   2948 N ND2 . ASN B 1 43  ? 79.205 -32.362 -7.236  1.00 51.57  ? 403  ASN B ND2 1 
ATOM   2949 N N   . GLN B 1 44  ? 75.772 -30.303 -10.615 1.00 48.78  ? 404  GLN B N   1 
ATOM   2950 C CA  . GLN B 1 44  ? 74.654 -29.524 -11.150 1.00 48.26  ? 404  GLN B CA  1 
ATOM   2951 C C   . GLN B 1 44  ? 73.339 -29.885 -10.446 1.00 46.95  ? 404  GLN B C   1 
ATOM   2952 O O   . GLN B 1 44  ? 73.106 -31.049 -10.115 1.00 46.72  ? 404  GLN B O   1 
ATOM   2953 C CB  . GLN B 1 44  ? 74.505 -29.779 -12.656 1.00 48.78  ? 404  GLN B CB  1 
ATOM   2954 C CG  . GLN B 1 44  ? 75.603 -29.188 -13.547 1.00 51.88  ? 404  GLN B CG  1 
ATOM   2955 C CD  . GLN B 1 44  ? 75.814 -29.981 -14.846 1.00 55.49  ? 404  GLN B CD  1 
ATOM   2956 O OE1 . GLN B 1 44  ? 75.368 -31.136 -14.979 1.00 56.60  ? 404  GLN B OE1 1 
ATOM   2957 N NE2 . GLN B 1 44  ? 76.525 -29.374 -15.797 1.00 56.26  ? 404  GLN B NE2 1 
ATOM   2958 N N   . PHE B 1 45  ? 72.479 -28.885 -10.248 1.00 45.41  ? 405  PHE B N   1 
ATOM   2959 C CA  . PHE B 1 45  ? 71.175 -29.078 -9.601  1.00 43.55  ? 405  PHE B CA  1 
ATOM   2960 C C   . PHE B 1 45  ? 70.038 -29.259 -10.599 1.00 42.83  ? 405  PHE B C   1 
ATOM   2961 O O   . PHE B 1 45  ? 69.995 -28.606 -11.649 1.00 42.60  ? 405  PHE B O   1 
ATOM   2962 C CB  . PHE B 1 45  ? 70.867 -27.951 -8.615  1.00 43.01  ? 405  PHE B CB  1 
ATOM   2963 C CG  . PHE B 1 45  ? 71.722 -27.983 -7.368  1.00 42.83  ? 405  PHE B CG  1 
ATOM   2964 C CD1 . PHE B 1 45  ? 73.016 -27.473 -7.377  1.00 43.40  ? 405  PHE B CD1 1 
ATOM   2965 C CD2 . PHE B 1 45  ? 71.231 -28.519 -6.184  1.00 43.02  ? 405  PHE B CD2 1 
ATOM   2966 C CE1 . PHE B 1 45  ? 73.811 -27.499 -6.215  1.00 44.03  ? 405  PHE B CE1 1 
ATOM   2967 C CE2 . PHE B 1 45  ? 72.004 -28.557 -5.024  1.00 41.88  ? 405  PHE B CE2 1 
ATOM   2968 C CZ  . PHE B 1 45  ? 73.296 -28.049 -5.036  1.00 43.78  ? 405  PHE B CZ  1 
ATOM   2969 N N   . PHE B 1 46  ? 69.128 -30.167 -10.251 1.00 41.59  ? 406  PHE B N   1 
ATOM   2970 C CA  . PHE B 1 46  ? 67.972 -30.488 -11.070 1.00 41.14  ? 406  PHE B CA  1 
ATOM   2971 C C   . PHE B 1 46  ? 66.740 -30.599 -10.179 1.00 40.25  ? 406  PHE B C   1 
ATOM   2972 O O   . PHE B 1 46  ? 66.869 -30.737 -8.963  1.00 39.97  ? 406  PHE B O   1 
ATOM   2973 C CB  . PHE B 1 46  ? 68.213 -31.790 -11.862 1.00 41.34  ? 406  PHE B CB  1 
ATOM   2974 C CG  . PHE B 1 46  ? 69.335 -31.684 -12.863 1.00 42.63  ? 406  PHE B CG  1 
ATOM   2975 C CD1 . PHE B 1 46  ? 70.658 -32.004 -12.495 1.00 42.25  ? 406  PHE B CD1 1 
ATOM   2976 C CD2 . PHE B 1 46  ? 69.087 -31.223 -14.160 1.00 42.56  ? 406  PHE B CD2 1 
ATOM   2977 C CE1 . PHE B 1 46  ? 71.716 -31.886 -13.402 1.00 41.88  ? 406  PHE B CE1 1 
ATOM   2978 C CE2 . PHE B 1 46  ? 70.131 -31.099 -15.079 1.00 43.53  ? 406  PHE B CE2 1 
ATOM   2979 C CZ  . PHE B 1 46  ? 71.461 -31.431 -14.695 1.00 43.08  ? 406  PHE B CZ  1 
ATOM   2980 N N   . ALA B 1 47  ? 65.565 -30.468 -10.785 1.00 39.07  ? 407  ALA B N   1 
ATOM   2981 C CA  . ALA B 1 47  ? 64.303 -30.816 -10.134 1.00 39.46  ? 407  ALA B CA  1 
ATOM   2982 C C   . ALA B 1 47  ? 63.964 -32.205 -10.656 1.00 39.14  ? 407  ALA B C   1 
ATOM   2983 O O   . ALA B 1 47  ? 63.948 -32.421 -11.874 1.00 40.09  ? 407  ALA B O   1 
ATOM   2984 C CB  . ALA B 1 47  ? 63.200 -29.820 -10.497 1.00 38.24  ? 407  ALA B CB  1 
ATOM   2985 N N   . ILE B 1 48  ? 63.744 -33.166 -9.772  1.00 38.85  ? 408  ILE B N   1 
ATOM   2986 C CA  . ILE B 1 48  ? 63.387 -34.509 -10.247 1.00 38.06  ? 408  ILE B CA  1 
ATOM   2987 C C   . ILE B 1 48  ? 61.974 -34.860 -9.810  1.00 38.10  ? 408  ILE B C   1 
ATOM   2988 O O   . ILE B 1 48  ? 61.665 -34.885 -8.629  1.00 38.00  ? 408  ILE B O   1 
ATOM   2989 C CB  . ILE B 1 48  ? 64.411 -35.605 -9.802  1.00 38.59  ? 408  ILE B CB  1 
ATOM   2990 C CG1 . ILE B 1 48  ? 65.799 -35.360 -10.427 1.00 38.38  ? 408  ILE B CG1 1 
ATOM   2991 C CG2 . ILE B 1 48  ? 63.888 -37.032 -10.131 1.00 37.51  ? 408  ILE B CG2 1 
ATOM   2992 C CD1 . ILE B 1 48  ? 66.784 -36.576 -10.344 1.00 37.03  ? 408  ILE B CD1 1 
ATOM   2993 N N   . LYS B 1 49  ? 61.112 -35.111 -10.786 1.00 38.28  ? 409  LYS B N   1 
ATOM   2994 C CA  . LYS B 1 49  ? 59.780 -35.595 -10.526 1.00 38.09  ? 409  LYS B CA  1 
ATOM   2995 C C   . LYS B 1 49  ? 59.831 -37.120 -10.484 1.00 38.48  ? 409  LYS B C   1 
ATOM   2996 O O   . LYS B 1 49  ? 60.312 -37.755 -11.423 1.00 38.21  ? 409  LYS B O   1 
ATOM   2997 C CB  . LYS B 1 49  ? 58.813 -35.121 -11.610 1.00 38.10  ? 409  LYS B CB  1 
ATOM   2998 C CG  . LYS B 1 49  ? 57.473 -35.927 -11.639 1.00 40.16  ? 409  LYS B CG  1 
ATOM   2999 C CD  . LYS B 1 49  ? 56.451 -35.190 -12.469 1.00 43.93  ? 409  LYS B CD  1 
ATOM   3000 C CE  . LYS B 1 49  ? 55.434 -36.106 -13.066 1.00 44.40  ? 409  LYS B CE  1 
ATOM   3001 N NZ  . LYS B 1 49  ? 54.095 -35.462 -12.976 1.00 44.95  ? 409  LYS B NZ  1 
ATOM   3002 N N   . ALA B 1 50  ? 59.335 -37.682 -9.389  1.00 38.52  ? 410  ALA B N   1 
ATOM   3003 C CA  . ALA B 1 50  ? 59.253 -39.122 -9.187  1.00 39.31  ? 410  ALA B CA  1 
ATOM   3004 C C   . ALA B 1 50  ? 57.789 -39.561 -9.104  1.00 39.66  ? 410  ALA B C   1 
ATOM   3005 O O   . ALA B 1 50  ? 56.972 -38.887 -8.486  1.00 40.53  ? 410  ALA B O   1 
ATOM   3006 C CB  . ALA B 1 50  ? 59.992 -39.510 -7.920  1.00 38.64  ? 410  ALA B CB  1 
ATOM   3007 N N   . LEU B 1 51  ? 57.472 -40.675 -9.763  1.00 40.09  ? 411  LEU B N   1 
ATOM   3008 C CA  . LEU B 1 51  ? 56.166 -41.318 -9.689  1.00 39.95  ? 411  LEU B CA  1 
ATOM   3009 C C   . LEU B 1 51  ? 56.333 -42.816 -9.385  1.00 40.00  ? 411  LEU B C   1 
ATOM   3010 O O   . LEU B 1 51  ? 57.240 -43.454 -9.898  1.00 40.15  ? 411  LEU B O   1 
ATOM   3011 C CB  . LEU B 1 51  ? 55.399 -41.130 -11.008 1.00 39.76  ? 411  LEU B CB  1 
ATOM   3012 C CG  . LEU B 1 51  ? 54.902 -39.735 -11.407 1.00 40.07  ? 411  LEU B CG  1 
ATOM   3013 C CD1 . LEU B 1 51  ? 54.366 -39.783 -12.818 1.00 39.66  ? 411  LEU B CD1 1 
ATOM   3014 C CD2 . LEU B 1 51  ? 53.815 -39.208 -10.451 1.00 39.23  ? 411  LEU B CD2 1 
ATOM   3015 N N   . LYS B 1 52  ? 55.464 -43.367 -8.538  1.00 40.27  ? 412  LYS B N   1 
ATOM   3016 C CA  . LYS B 1 52  ? 55.345 -44.820 -8.384  1.00 40.72  ? 412  LYS B CA  1 
ATOM   3017 C C   . LYS B 1 52  ? 54.441 -45.353 -9.492  1.00 40.02  ? 412  LYS B C   1 
ATOM   3018 O O   . LYS B 1 52  ? 53.308 -44.912 -9.610  1.00 40.30  ? 412  LYS B O   1 
ATOM   3019 C CB  . LYS B 1 52  ? 54.777 -45.170 -7.009  1.00 40.35  ? 412  LYS B CB  1 
ATOM   3020 C CG  . LYS B 1 52  ? 55.729 -44.913 -5.853  1.00 41.73  ? 412  LYS B CG  1 
ATOM   3021 C CD  . LYS B 1 52  ? 55.044 -45.144 -4.509  1.00 42.86  ? 412  LYS B CD  1 
ATOM   3022 C CE  . LYS B 1 52  ? 56.041 -45.002 -3.329  1.00 47.07  ? 412  LYS B CE  1 
ATOM   3023 N NZ  . LYS B 1 52  ? 55.439 -44.900 -1.940  1.00 44.94  ? 412  LYS B NZ  1 
ATOM   3024 N N   . LYS B 1 53  ? 54.953 -46.268 -10.317 1.00 39.71  ? 413  LYS B N   1 
ATOM   3025 C CA  . LYS B 1 53  ? 54.180 -46.923 -11.396 1.00 39.63  ? 413  LYS B CA  1 
ATOM   3026 C C   . LYS B 1 53  ? 52.884 -47.588 -10.883 1.00 39.81  ? 413  LYS B C   1 
ATOM   3027 O O   . LYS B 1 53  ? 51.840 -47.539 -11.518 1.00 39.01  ? 413  LYS B O   1 
ATOM   3028 C CB  . LYS B 1 53  ? 55.041 -47.993 -12.079 1.00 39.34  ? 413  LYS B CB  1 
ATOM   3029 C CG  . LYS B 1 53  ? 56.316 -47.493 -12.767 1.00 39.30  ? 413  LYS B CG  1 
ATOM   3030 C CD  . LYS B 1 53  ? 57.054 -48.672 -13.416 1.00 39.42  ? 413  LYS B CD  1 
ATOM   3031 C CE  . LYS B 1 53  ? 58.126 -48.220 -14.396 1.00 39.84  ? 413  LYS B CE  1 
ATOM   3032 N NZ  . LYS B 1 53  ? 58.861 -49.388 -14.982 1.00 37.41  ? 413  LYS B NZ  1 
ATOM   3033 N N   . ASP B 1 54  ? 53.034 -48.280 -9.763  1.00 40.80  ? 414  ASP B N   1 
ATOM   3034 C CA  . ASP B 1 54  ? 51.988 -48.778 -8.854  1.00 42.03  ? 414  ASP B CA  1 
ATOM   3035 C C   . ASP B 1 54  ? 50.769 -47.802 -8.694  1.00 41.59  ? 414  ASP B C   1 
ATOM   3036 O O   . ASP B 1 54  ? 49.626 -48.101 -9.051  1.00 40.99  ? 414  ASP B O   1 
ATOM   3037 C CB  . ASP B 1 54  ? 52.712 -48.834 -7.514  1.00 42.48  ? 414  ASP B CB  1 
ATOM   3038 C CG  . ASP B 1 54  ? 52.263 -49.911 -6.659  1.00 46.27  ? 414  ASP B CG  1 
ATOM   3039 O OD1 . ASP B 1 54  ? 51.980 -51.005 -7.183  1.00 52.31  ? 414  ASP B OD1 1 
ATOM   3040 O OD2 . ASP B 1 54  ? 52.246 -49.682 -5.429  1.00 51.12  ? 414  ASP B OD2 1 
ATOM   3041 N N   . VAL B 1 55  ? 51.064 -46.641 -8.124  1.00 41.00  ? 415  VAL B N   1 
ATOM   3042 C CA  . VAL B 1 55  ? 50.102 -45.576 -7.875  1.00 40.96  ? 415  VAL B CA  1 
ATOM   3043 C C   . VAL B 1 55  ? 49.545 -44.962 -9.175  1.00 40.43  ? 415  VAL B C   1 
ATOM   3044 O O   . VAL B 1 55  ? 48.343 -44.759 -9.283  1.00 40.56  ? 415  VAL B O   1 
ATOM   3045 C CB  . VAL B 1 55  ? 50.731 -44.529 -6.932  1.00 41.07  ? 415  VAL B CB  1 
ATOM   3046 C CG1 . VAL B 1 55  ? 49.784 -43.363 -6.666  1.00 40.62  ? 415  VAL B CG1 1 
ATOM   3047 C CG2 . VAL B 1 55  ? 51.121 -45.237 -5.631  1.00 41.34  ? 415  VAL B CG2 1 
ATOM   3048 N N   . VAL B 1 56  ? 50.397 -44.722 -10.166 1.00 40.11  ? 416  VAL B N   1 
ATOM   3049 C CA  . VAL B 1 56  ? 49.950 -44.263 -11.489 1.00 40.22  ? 416  VAL B CA  1 
ATOM   3050 C C   . VAL B 1 56  ? 48.829 -45.154 -12.053 1.00 41.12  ? 416  VAL B C   1 
ATOM   3051 O O   . VAL B 1 56  ? 47.806 -44.640 -12.550 1.00 41.47  ? 416  VAL B O   1 
ATOM   3052 C CB  . VAL B 1 56  ? 51.116 -44.192 -12.492 1.00 40.35  ? 416  VAL B CB  1 
ATOM   3053 C CG1 . VAL B 1 56  ? 50.608 -44.043 -13.943 1.00 39.21  ? 416  VAL B CG1 1 
ATOM   3054 C CG2 . VAL B 1 56  ? 52.095 -43.061 -12.113 1.00 39.16  ? 416  VAL B CG2 1 
ATOM   3055 N N   . LEU B 1 57  ? 49.016 -46.472 -11.963 1.00 40.87  ? 417  LEU B N   1 
ATOM   3056 C CA  . LEU B 1 57  ? 48.025 -47.434 -12.447 1.00 41.51  ? 417  LEU B CA  1 
ATOM   3057 C C   . LEU B 1 57  ? 46.728 -47.468 -11.620 1.00 41.42  ? 417  LEU B C   1 
ATOM   3058 O O   . LEU B 1 57  ? 45.649 -47.635 -12.192 1.00 41.55  ? 417  LEU B O   1 
ATOM   3059 C CB  . LEU B 1 57  ? 48.627 -48.848 -12.591 1.00 41.19  ? 417  LEU B CB  1 
ATOM   3060 C CG  . LEU B 1 57  ? 47.677 -49.927 -13.150 1.00 43.41  ? 417  LEU B CG  1 
ATOM   3061 C CD1 . LEU B 1 57  ? 47.294 -49.626 -14.607 1.00 45.74  ? 417  LEU B CD1 1 
ATOM   3062 C CD2 . LEU B 1 57  ? 48.235 -51.357 -13.031 1.00 42.02  ? 417  LEU B CD2 1 
ATOM   3063 N N   . MET B 1 58  ? 46.827 -47.330 -10.294 1.00 41.41  ? 418  MET B N   1 
ATOM   3064 C CA  . MET B 1 58  ? 45.631 -47.299 -9.443  1.00 41.83  ? 418  MET B CA  1 
ATOM   3065 C C   . MET B 1 58  ? 44.841 -45.984 -9.590  1.00 42.67  ? 418  MET B C   1 
ATOM   3066 O O   . MET B 1 58  ? 43.638 -45.959 -9.368  1.00 43.05  ? 418  MET B O   1 
ATOM   3067 C CB  . MET B 1 58  ? 45.964 -47.571 -7.967  1.00 41.49  ? 418  MET B CB  1 
ATOM   3068 C CG  . MET B 1 58  ? 46.338 -49.009 -7.647  1.00 41.32  ? 418  MET B CG  1 
ATOM   3069 S SD  . MET B 1 58  ? 46.794 -49.302 -5.920  1.00 40.89  ? 418  MET B SD  1 
ATOM   3070 C CE  . MET B 1 58  ? 48.379 -48.447 -5.835  1.00 38.40  ? 418  MET B CE  1 
ATOM   3071 N N   . ASP B 1 59  ? 45.525 -44.903 -9.949  1.00 44.01  ? 419  ASP B N   1 
ATOM   3072 C CA  . ASP B 1 59  ? 44.887 -43.615 -10.249 1.00 45.16  ? 419  ASP B CA  1 
ATOM   3073 C C   . ASP B 1 59  ? 44.399 -43.576 -11.703 1.00 45.41  ? 419  ASP B C   1 
ATOM   3074 O O   . ASP B 1 59  ? 43.791 -42.601 -12.123 1.00 45.78  ? 419  ASP B O   1 
ATOM   3075 C CB  . ASP B 1 59  ? 45.867 -42.448 -10.048 1.00 45.53  ? 419  ASP B CB  1 
ATOM   3076 C CG  . ASP B 1 59  ? 46.226 -42.178 -8.580  1.00 47.51  ? 419  ASP B CG  1 
ATOM   3077 O OD1 . ASP B 1 59  ? 45.437 -42.420 -7.653  1.00 50.10  ? 419  ASP B OD1 1 
ATOM   3078 O OD2 . ASP B 1 59  ? 47.325 -41.633 -8.361  1.00 55.04  ? 419  ASP B OD2 1 
ATOM   3079 N N   . ASP B 1 60  ? 44.689 -44.628 -12.469 1.00 45.88  ? 420  ASP B N   1 
ATOM   3080 C CA  . ASP B 1 60  ? 44.336 -44.707 -13.893 1.00 46.82  ? 420  ASP B CA  1 
ATOM   3081 C C   . ASP B 1 60  ? 44.939 -43.556 -14.732 1.00 47.07  ? 420  ASP B C   1 
ATOM   3082 O O   . ASP B 1 60  ? 44.280 -42.982 -15.600 1.00 46.95  ? 420  ASP B O   1 
ATOM   3083 C CB  . ASP B 1 60  ? 42.811 -44.799 -14.060 1.00 47.20  ? 420  ASP B CB  1 
ATOM   3084 C CG  . ASP B 1 60  ? 42.396 -45.174 -15.468 1.00 49.52  ? 420  ASP B CG  1 
ATOM   3085 O OD1 . ASP B 1 60  ? 43.276 -45.508 -16.292 1.00 52.66  ? 420  ASP B OD1 1 
ATOM   3086 O OD2 . ASP B 1 60  ? 41.186 -45.134 -15.762 1.00 52.48  ? 420  ASP B OD2 1 
ATOM   3087 N N   . ASP B 1 61  ? 46.210 -43.250 -14.474 1.00 47.27  ? 421  ASP B N   1 
ATOM   3088 C CA  . ASP B 1 61  ? 46.870 -42.085 -15.042 1.00 47.60  ? 421  ASP B CA  1 
ATOM   3089 C C   . ASP B 1 61  ? 48.048 -42.442 -15.944 1.00 47.33  ? 421  ASP B C   1 
ATOM   3090 O O   . ASP B 1 61  ? 48.987 -41.657 -16.082 1.00 47.36  ? 421  ASP B O   1 
ATOM   3091 C CB  . ASP B 1 61  ? 47.346 -41.176 -13.916 1.00 47.60  ? 421  ASP B CB  1 
ATOM   3092 C CG  . ASP B 1 61  ? 46.257 -40.245 -13.410 1.00 51.56  ? 421  ASP B CG  1 
ATOM   3093 O OD1 . ASP B 1 61  ? 45.170 -40.145 -14.044 1.00 54.28  ? 421  ASP B OD1 1 
ATOM   3094 O OD2 . ASP B 1 61  ? 46.496 -39.598 -12.363 1.00 55.75  ? 421  ASP B OD2 1 
ATOM   3095 N N   . VAL B 1 62  ? 47.999 -43.623 -16.547 1.00 46.78  ? 422  VAL B N   1 
ATOM   3096 C CA  . VAL B 1 62  ? 49.068 -44.090 -17.428 1.00 46.77  ? 422  VAL B CA  1 
ATOM   3097 C C   . VAL B 1 62  ? 49.203 -43.239 -18.702 1.00 47.36  ? 422  VAL B C   1 
ATOM   3098 O O   . VAL B 1 62  ? 50.312 -42.888 -19.108 1.00 46.94  ? 422  VAL B O   1 
ATOM   3099 C CB  . VAL B 1 62  ? 48.904 -45.606 -17.783 1.00 46.12  ? 422  VAL B CB  1 
ATOM   3100 C CG1 . VAL B 1 62  ? 49.886 -46.031 -18.850 1.00 46.07  ? 422  VAL B CG1 1 
ATOM   3101 C CG2 . VAL B 1 62  ? 49.073 -46.471 -16.544 1.00 44.38  ? 422  VAL B CG2 1 
ATOM   3102 N N   . GLU B 1 63  ? 48.082 -42.922 -19.336 1.00 48.20  ? 423  GLU B N   1 
ATOM   3103 C CA  . GLU B 1 63  ? 48.122 -42.239 -20.624 1.00 49.64  ? 423  GLU B CA  1 
ATOM   3104 C C   . GLU B 1 63  ? 48.546 -40.784 -20.475 1.00 49.51  ? 423  GLU B C   1 
ATOM   3105 O O   . GLU B 1 63  ? 49.338 -40.288 -21.277 1.00 49.71  ? 423  GLU B O   1 
ATOM   3106 C CB  . GLU B 1 63  ? 46.790 -42.398 -21.389 1.00 50.32  ? 423  GLU B CB  1 
ATOM   3107 C CG  . GLU B 1 63  ? 46.629 -41.522 -22.654 1.00 53.69  ? 423  GLU B CG  1 
ATOM   3108 C CD  . GLU B 1 63  ? 47.682 -41.771 -23.753 1.00 57.85  ? 423  GLU B CD  1 
ATOM   3109 O OE1 . GLU B 1 63  ? 48.232 -42.897 -23.855 1.00 60.62  ? 423  GLU B OE1 1 
ATOM   3110 O OE2 . GLU B 1 63  ? 47.942 -40.832 -24.541 1.00 58.63  ? 423  GLU B OE2 1 
ATOM   3111 N N   . CYS B 1 64  ? 48.063 -40.109 -19.435 1.00 49.24  ? 424  CYS B N   1 
ATOM   3112 C CA  . CYS B 1 64  ? 48.468 -38.726 -19.214 1.00 49.51  ? 424  CYS B CA  1 
ATOM   3113 C C   . CYS B 1 64  ? 49.905 -38.553 -18.664 1.00 48.51  ? 424  CYS B C   1 
ATOM   3114 O O   . CYS B 1 64  ? 50.481 -37.476 -18.799 1.00 48.44  ? 424  CYS B O   1 
ATOM   3115 C CB  . CYS B 1 64  ? 47.435 -37.946 -18.388 1.00 49.85  ? 424  CYS B CB  1 
ATOM   3116 S SG  . CYS B 1 64  ? 47.356 -38.379 -16.650 1.00 53.83  ? 424  CYS B SG  1 
ATOM   3117 N N   . THR B 1 65  ? 50.469 -39.595 -18.058 1.00 47.46  ? 425  THR B N   1 
ATOM   3118 C CA  . THR B 1 65  ? 51.903 -39.633 -17.699 1.00 46.44  ? 425  THR B CA  1 
ATOM   3119 C C   . THR B 1 65  ? 52.769 -39.721 -18.958 1.00 45.98  ? 425  THR B C   1 
ATOM   3120 O O   . THR B 1 65  ? 53.816 -39.090 -19.063 1.00 45.57  ? 425  THR B O   1 
ATOM   3121 C CB  . THR B 1 65  ? 52.232 -40.845 -16.777 1.00 46.64  ? 425  THR B CB  1 
ATOM   3122 O OG1 . THR B 1 65  ? 51.479 -40.750 -15.564 1.00 46.21  ? 425  THR B OG1 1 
ATOM   3123 C CG2 . THR B 1 65  ? 53.730 -40.919 -16.449 1.00 46.07  ? 425  THR B CG2 1 
ATOM   3124 N N   . MET B 1 66  ? 52.315 -40.506 -19.921 1.00 45.84  ? 426  MET B N   1 
ATOM   3125 C CA  . MET B 1 66  ? 53.015 -40.626 -21.183 1.00 45.95  ? 426  MET B CA  1 
ATOM   3126 C C   . MET B 1 66  ? 52.855 -39.364 -22.044 1.00 45.14  ? 426  MET B C   1 
ATOM   3127 O O   . MET B 1 66  ? 53.784 -38.968 -22.746 1.00 45.42  ? 426  MET B O   1 
ATOM   3128 C CB  . MET B 1 66  ? 52.542 -41.873 -21.919 1.00 45.77  ? 426  MET B CB  1 
ATOM   3129 C CG  . MET B 1 66  ? 53.691 -42.810 -22.326 1.00 49.98  ? 426  MET B CG  1 
ATOM   3130 S SD  . MET B 1 66  ? 54.655 -43.537 -20.971 1.00 49.87  ? 426  MET B SD  1 
ATOM   3131 C CE  . MET B 1 66  ? 53.389 -43.810 -19.768 1.00 49.97  ? 426  MET B CE  1 
ATOM   3132 N N   . VAL B 1 67  ? 51.680 -38.748 -21.998 1.00 44.67  ? 427  VAL B N   1 
ATOM   3133 C CA  . VAL B 1 67  ? 51.448 -37.471 -22.657 1.00 44.61  ? 427  VAL B CA  1 
ATOM   3134 C C   . VAL B 1 67  ? 52.430 -36.426 -22.100 1.00 44.87  ? 427  VAL B C   1 
ATOM   3135 O O   . VAL B 1 67  ? 53.169 -35.804 -22.859 1.00 44.48  ? 427  VAL B O   1 
ATOM   3136 C CB  . VAL B 1 67  ? 49.969 -37.003 -22.518 1.00 44.36  ? 427  VAL B CB  1 
ATOM   3137 C CG1 . VAL B 1 67  ? 49.833 -35.544 -22.896 1.00 44.97  ? 427  VAL B CG1 1 
ATOM   3138 C CG2 . VAL B 1 67  ? 49.063 -37.840 -23.393 1.00 43.68  ? 427  VAL B CG2 1 
ATOM   3139 N N   . GLU B 1 68  ? 52.468 -36.291 -20.773 1.00 45.33  ? 428  GLU B N   1 
ATOM   3140 C CA  . GLU B 1 68  ? 53.397 -35.392 -20.109 1.00 46.61  ? 428  GLU B CA  1 
ATOM   3141 C C   . GLU B 1 68  ? 54.842 -35.617 -20.566 1.00 46.45  ? 428  GLU B C   1 
ATOM   3142 O O   . GLU B 1 68  ? 55.543 -34.656 -20.888 1.00 46.40  ? 428  GLU B O   1 
ATOM   3143 C CB  . GLU B 1 68  ? 53.294 -35.508 -18.594 1.00 45.92  ? 428  GLU B CB  1 
ATOM   3144 C CG  . GLU B 1 68  ? 54.172 -34.476 -17.841 1.00 48.04  ? 428  GLU B CG  1 
ATOM   3145 C CD  . GLU B 1 68  ? 53.926 -34.492 -16.348 1.00 49.54  ? 428  GLU B CD  1 
ATOM   3146 O OE1 . GLU B 1 68  ? 53.259 -35.437 -15.878 1.00 56.29  ? 428  GLU B OE1 1 
ATOM   3147 O OE2 . GLU B 1 68  ? 54.382 -33.583 -15.625 1.00 53.53  ? 428  GLU B OE2 1 
ATOM   3148 N N   . LYS B 1 69  ? 55.264 -36.884 -20.610 1.00 46.54  ? 429  LYS B N   1 
ATOM   3149 C CA  . LYS B 1 69  ? 56.599 -37.263 -21.069 1.00 46.30  ? 429  LYS B CA  1 
ATOM   3150 C C   . LYS B 1 69  ? 56.850 -36.829 -22.521 1.00 46.02  ? 429  LYS B C   1 
ATOM   3151 O O   . LYS B 1 69  ? 57.911 -36.274 -22.818 1.00 45.94  ? 429  LYS B O   1 
ATOM   3152 C CB  . LYS B 1 69  ? 56.847 -38.778 -20.886 1.00 45.94  ? 429  LYS B CB  1 
ATOM   3153 C CG  . LYS B 1 69  ? 58.163 -39.281 -21.498 1.00 47.04  ? 429  LYS B CG  1 
ATOM   3154 C CD  . LYS B 1 69  ? 57.932 -39.772 -22.941 1.00 49.79  ? 429  LYS B CD  1 
ATOM   3155 C CE  . LYS B 1 69  ? 59.225 -39.961 -23.707 1.00 51.42  ? 429  LYS B CE  1 
ATOM   3156 N NZ  . LYS B 1 69  ? 59.011 -40.357 -25.144 1.00 51.81  ? 429  LYS B NZ  1 
ATOM   3157 N N   . ARG B 1 70  ? 55.891 -37.103 -23.417 1.00 45.35  ? 430  ARG B N   1 
ATOM   3158 C CA  . ARG B 1 70  ? 56.005 -36.701 -24.822 1.00 44.63  ? 430  ARG B CA  1 
ATOM   3159 C C   . ARG B 1 70  ? 56.025 -35.170 -25.014 1.00 45.39  ? 430  ARG B C   1 
ATOM   3160 O O   . ARG B 1 70  ? 56.819 -34.667 -25.804 1.00 45.19  ? 430  ARG B O   1 
ATOM   3161 C CB  . ARG B 1 70  ? 54.904 -37.324 -25.684 1.00 44.57  ? 430  ARG B CB  1 
ATOM   3162 C CG  . ARG B 1 70  ? 55.045 -38.821 -25.937 1.00 43.62  ? 430  ARG B CG  1 
ATOM   3163 C CD  . ARG B 1 70  ? 54.107 -39.296 -27.046 1.00 43.75  ? 430  ARG B CD  1 
ATOM   3164 N NE  . ARG B 1 70  ? 52.683 -39.222 -26.698 1.00 42.00  ? 430  ARG B NE  1 
ATOM   3165 C CZ  . ARG B 1 70  ? 52.002 -40.183 -26.074 1.00 42.20  ? 430  ARG B CZ  1 
ATOM   3166 N NH1 . ARG B 1 70  ? 52.608 -41.304 -25.693 1.00 41.48  ? 430  ARG B NH1 1 
ATOM   3167 N NH2 . ARG B 1 70  ? 50.708 -40.024 -25.824 1.00 40.71  ? 430  ARG B NH2 1 
ATOM   3168 N N   . VAL B 1 71  ? 55.152 -34.438 -24.312 1.00 45.42  ? 431  VAL B N   1 
ATOM   3169 C CA  . VAL B 1 71  ? 55.194 -32.971 -24.362 1.00 45.50  ? 431  VAL B CA  1 
ATOM   3170 C C   . VAL B 1 71  ? 56.538 -32.449 -23.842 1.00 45.84  ? 431  VAL B C   1 
ATOM   3171 O O   . VAL B 1 71  ? 57.228 -31.693 -24.535 1.00 46.21  ? 431  VAL B O   1 
ATOM   3172 C CB  . VAL B 1 71  ? 54.014 -32.300 -23.590 1.00 45.54  ? 431  VAL B CB  1 
ATOM   3173 C CG1 . VAL B 1 71  ? 54.187 -30.769 -23.582 1.00 45.14  ? 431  VAL B CG1 1 
ATOM   3174 C CG2 . VAL B 1 71  ? 52.665 -32.695 -24.197 1.00 43.21  ? 431  VAL B CG2 1 
ATOM   3175 N N   . LEU B 1 72  ? 56.910 -32.854 -22.626 1.00 45.96  ? 432  LEU B N   1 
ATOM   3176 C CA  . LEU B 1 72  ? 58.206 -32.480 -22.041 1.00 45.80  ? 432  LEU B CA  1 
ATOM   3177 C C   . LEU B 1 72  ? 59.415 -32.767 -22.948 1.00 46.55  ? 432  LEU B C   1 
ATOM   3178 O O   . LEU B 1 72  ? 60.359 -31.965 -23.002 1.00 46.57  ? 432  LEU B O   1 
ATOM   3179 C CB  . LEU B 1 72  ? 58.396 -33.138 -20.669 1.00 45.40  ? 432  LEU B CB  1 
ATOM   3180 C CG  . LEU B 1 72  ? 57.648 -32.498 -19.496 1.00 44.61  ? 432  LEU B CG  1 
ATOM   3181 C CD1 . LEU B 1 72  ? 57.838 -33.290 -18.200 1.00 41.48  ? 432  LEU B CD1 1 
ATOM   3182 C CD2 . LEU B 1 72  ? 58.071 -31.007 -19.310 1.00 45.72  ? 432  LEU B CD2 1 
ATOM   3183 N N   . SER B 1 73  ? 59.370 -33.884 -23.677 1.00 46.97  ? 433  SER B N   1 
ATOM   3184 C CA  . SER B 1 73  ? 60.481 -34.307 -24.545 1.00 47.35  ? 433  SER B CA  1 
ATOM   3185 C C   . SER B 1 73  ? 60.745 -33.318 -25.679 1.00 47.44  ? 433  SER B C   1 
ATOM   3186 O O   . SER B 1 73  ? 61.753 -33.386 -26.360 1.00 47.31  ? 433  SER B O   1 
ATOM   3187 C CB  . SER B 1 73  ? 60.222 -35.726 -25.090 1.00 47.21  ? 433  SER B CB  1 
ATOM   3188 O OG  . SER B 1 73  ? 59.325 -35.715 -26.193 1.00 47.12  ? 433  SER B OG  1 
ATOM   3189 N N   . LEU B 1 74  ? 59.840 -32.361 -25.834 1.00 48.34  ? 434  LEU B N   1 
ATOM   3190 C CA  . LEU B 1 74  ? 59.872 -31.406 -26.937 1.00 48.30  ? 434  LEU B CA  1 
ATOM   3191 C C   . LEU B 1 74  ? 60.086 -29.970 -26.420 1.00 47.73  ? 434  LEU B C   1 
ATOM   3192 O O   . LEU B 1 74  ? 60.271 -29.036 -27.197 1.00 48.21  ? 434  LEU B O   1 
ATOM   3193 C CB  . LEU B 1 74  ? 58.564 -31.603 -27.734 1.00 49.18  ? 434  LEU B CB  1 
ATOM   3194 C CG  . LEU B 1 74  ? 57.541 -30.609 -28.285 1.00 50.09  ? 434  LEU B CG  1 
ATOM   3195 C CD1 . LEU B 1 74  ? 56.485 -31.431 -29.027 1.00 49.59  ? 434  LEU B CD1 1 
ATOM   3196 C CD2 . LEU B 1 74  ? 56.893 -29.742 -27.191 1.00 50.28  ? 434  LEU B CD2 1 
ATOM   3197 N N   . ALA B 1 75  ? 60.109 -29.829 -25.095 1.00 46.75  ? 435  ALA B N   1 
ATOM   3198 C CA  . ALA B 1 75  ? 60.105 -28.529 -24.404 1.00 45.66  ? 435  ALA B CA  1 
ATOM   3199 C C   . ALA B 1 75  ? 61.414 -27.737 -24.521 1.00 45.50  ? 435  ALA B C   1 
ATOM   3200 O O   . ALA B 1 75  ? 61.388 -26.502 -24.427 1.00 45.22  ? 435  ALA B O   1 
ATOM   3201 C CB  . ALA B 1 75  ? 59.725 -28.712 -22.927 1.00 44.93  ? 435  ALA B CB  1 
ATOM   3202 N N   . TRP B 1 76  ? 62.541 -28.440 -24.721 1.00 44.47  ? 436  TRP B N   1 
ATOM   3203 C CA  . TRP B 1 76  ? 63.864 -27.810 -24.853 1.00 44.05  ? 436  TRP B CA  1 
ATOM   3204 C C   . TRP B 1 76  ? 63.915 -26.822 -26.008 1.00 44.04  ? 436  TRP B C   1 
ATOM   3205 O O   . TRP B 1 76  ? 64.799 -25.966 -26.049 1.00 44.65  ? 436  TRP B O   1 
ATOM   3206 C CB  . TRP B 1 76  ? 64.980 -28.862 -25.053 1.00 43.37  ? 436  TRP B CB  1 
ATOM   3207 C CG  . TRP B 1 76  ? 64.811 -29.716 -26.305 1.00 42.06  ? 436  TRP B CG  1 
ATOM   3208 C CD1 . TRP B 1 76  ? 64.254 -30.958 -26.367 1.00 41.80  ? 436  TRP B CD1 1 
ATOM   3209 C CD2 . TRP B 1 76  ? 65.173 -29.374 -27.652 1.00 40.97  ? 436  TRP B CD2 1 
ATOM   3210 N NE1 . TRP B 1 76  ? 64.260 -31.423 -27.660 1.00 41.51  ? 436  TRP B NE1 1 
ATOM   3211 C CE2 . TRP B 1 76  ? 64.817 -30.472 -28.471 1.00 41.87  ? 436  TRP B CE2 1 
ATOM   3212 C CE3 . TRP B 1 76  ? 65.770 -28.254 -28.246 1.00 41.02  ? 436  TRP B CE3 1 
ATOM   3213 C CZ2 . TRP B 1 76  ? 65.039 -30.485 -29.853 1.00 41.36  ? 436  TRP B CZ2 1 
ATOM   3214 C CZ3 . TRP B 1 76  ? 65.978 -28.256 -29.613 1.00 41.50  ? 436  TRP B CZ3 1 
ATOM   3215 C CH2 . TRP B 1 76  ? 65.618 -29.371 -30.405 1.00 42.83  ? 436  TRP B CH2 1 
ATOM   3216 N N   . GLU B 1 77  ? 62.980 -26.967 -26.949 1.00 44.11  ? 437  GLU B N   1 
ATOM   3217 C CA  . GLU B 1 77  ? 62.907 -26.149 -28.163 1.00 44.30  ? 437  GLU B CA  1 
ATOM   3218 C C   . GLU B 1 77  ? 62.438 -24.716 -27.921 1.00 43.66  ? 437  GLU B C   1 
ATOM   3219 O O   . GLU B 1 77  ? 62.638 -23.851 -28.774 1.00 44.38  ? 437  GLU B O   1 
ATOM   3220 C CB  . GLU B 1 77  ? 61.938 -26.764 -29.169 1.00 45.00  ? 437  GLU B CB  1 
ATOM   3221 C CG  . GLU B 1 77  ? 62.317 -28.085 -29.770 1.00 47.03  ? 437  GLU B CG  1 
ATOM   3222 C CD  . GLU B 1 77  ? 61.381 -28.458 -30.903 1.00 50.17  ? 437  GLU B CD  1 
ATOM   3223 O OE1 . GLU B 1 77  ? 61.366 -27.735 -31.925 1.00 51.51  ? 437  GLU B OE1 1 
ATOM   3224 O OE2 . GLU B 1 77  ? 60.656 -29.465 -30.771 1.00 51.51  ? 437  GLU B OE2 1 
ATOM   3225 N N   . HIS B 1 78  ? 61.779 -24.469 -26.795 1.00 42.35  ? 438  HIS B N   1 
ATOM   3226 C CA  . HIS B 1 78  ? 61.258 -23.132 -26.515 1.00 41.47  ? 438  HIS B CA  1 
ATOM   3227 C C   . HIS B 1 78  ? 61.786 -22.601 -25.184 1.00 41.05  ? 438  HIS B C   1 
ATOM   3228 O O   . HIS B 1 78  ? 61.778 -23.325 -24.202 1.00 41.46  ? 438  HIS B O   1 
ATOM   3229 C CB  . HIS B 1 78  ? 59.720 -23.134 -26.518 1.00 41.34  ? 438  HIS B CB  1 
ATOM   3230 C CG  . HIS B 1 78  ? 59.132 -21.764 -26.600 1.00 40.26  ? 438  HIS B CG  1 
ATOM   3231 N ND1 . HIS B 1 78  ? 59.056 -21.061 -27.785 1.00 40.41  ? 438  HIS B ND1 1 
ATOM   3232 C CD2 . HIS B 1 78  ? 58.671 -20.937 -25.638 1.00 38.86  ? 438  HIS B CD2 1 
ATOM   3233 C CE1 . HIS B 1 78  ? 58.548 -19.865 -27.551 1.00 40.58  ? 438  HIS B CE1 1 
ATOM   3234 N NE2 . HIS B 1 78  ? 58.313 -19.760 -26.257 1.00 41.64  ? 438  HIS B NE2 1 
ATOM   3235 N N   . PRO B 1 79  ? 62.249 -21.337 -25.145 1.00 40.53  ? 439  PRO B N   1 
ATOM   3236 C CA  . PRO B 1 79  ? 62.779 -20.798 -23.881 1.00 40.39  ? 439  PRO B CA  1 
ATOM   3237 C C   . PRO B 1 79  ? 61.803 -20.650 -22.700 1.00 40.48  ? 439  PRO B C   1 
ATOM   3238 O O   . PRO B 1 79  ? 62.246 -20.604 -21.542 1.00 40.40  ? 439  PRO B O   1 
ATOM   3239 C CB  . PRO B 1 79  ? 63.328 -19.409 -24.295 1.00 40.54  ? 439  PRO B CB  1 
ATOM   3240 C CG  . PRO B 1 79  ? 62.586 -19.066 -25.550 1.00 40.40  ? 439  PRO B CG  1 
ATOM   3241 C CD  . PRO B 1 79  ? 62.380 -20.364 -26.256 1.00 40.36  ? 439  PRO B CD  1 
ATOM   3242 N N   . PHE B 1 80  ? 60.499 -20.582 -22.975 1.00 40.33  ? 440  PHE B N   1 
ATOM   3243 C CA  . PHE B 1 80  ? 59.530 -20.220 -21.947 1.00 39.99  ? 440  PHE B CA  1 
ATOM   3244 C C   . PHE B 1 80  ? 58.744 -21.424 -21.422 1.00 40.81  ? 440  PHE B C   1 
ATOM   3245 O O   . PHE B 1 80  ? 57.735 -21.290 -20.708 1.00 40.98  ? 440  PHE B O   1 
ATOM   3246 C CB  . PHE B 1 80  ? 58.649 -19.049 -22.426 1.00 39.86  ? 440  PHE B CB  1 
ATOM   3247 C CG  . PHE B 1 80  ? 59.443 -17.809 -22.802 1.00 38.35  ? 440  PHE B CG  1 
ATOM   3248 C CD1 . PHE B 1 80  ? 60.419 -17.298 -21.941 1.00 38.66  ? 440  PHE B CD1 1 
ATOM   3249 C CD2 . PHE B 1 80  ? 59.221 -17.157 -23.997 1.00 38.53  ? 440  PHE B CD2 1 
ATOM   3250 C CE1 . PHE B 1 80  ? 61.168 -16.169 -22.277 1.00 35.86  ? 440  PHE B CE1 1 
ATOM   3251 C CE2 . PHE B 1 80  ? 59.968 -16.011 -24.343 1.00 39.22  ? 440  PHE B CE2 1 
ATOM   3252 C CZ  . PHE B 1 80  ? 60.947 -15.527 -23.480 1.00 36.73  ? 440  PHE B CZ  1 
ATOM   3253 N N   . LEU B 1 81  ? 59.265 -22.608 -21.736 1.00 41.11  ? 441  LEU B N   1 
ATOM   3254 C CA  . LEU B 1 81  ? 58.758 -23.858 -21.196 1.00 41.50  ? 441  LEU B CA  1 
ATOM   3255 C C   . LEU B 1 81  ? 59.815 -24.453 -20.294 1.00 42.02  ? 441  LEU B C   1 
ATOM   3256 O O   . LEU B 1 81  ? 60.996 -24.289 -20.513 1.00 42.16  ? 441  LEU B O   1 
ATOM   3257 C CB  . LEU B 1 81  ? 58.412 -24.863 -22.313 1.00 41.41  ? 441  LEU B CB  1 
ATOM   3258 C CG  . LEU B 1 81  ? 57.378 -24.436 -23.357 1.00 41.31  ? 441  LEU B CG  1 
ATOM   3259 C CD1 . LEU B 1 81  ? 57.152 -25.563 -24.347 1.00 42.90  ? 441  LEU B CD1 1 
ATOM   3260 C CD2 . LEU B 1 81  ? 56.103 -24.065 -22.675 1.00 39.78  ? 441  LEU B CD2 1 
ATOM   3261 N N   . THR B 1 82  ? 59.355 -25.146 -19.277 1.00 42.63  ? 442  THR B N   1 
ATOM   3262 C CA  . THR B 1 82  ? 60.162 -25.889 -18.323 1.00 43.85  ? 442  THR B CA  1 
ATOM   3263 C C   . THR B 1 82  ? 60.885 -27.044 -19.063 1.00 44.22  ? 442  THR B C   1 
ATOM   3264 O O   . THR B 1 82  ? 60.227 -27.898 -19.666 1.00 44.51  ? 442  THR B O   1 
ATOM   3265 C CB  . THR B 1 82  ? 59.133 -26.357 -17.256 1.00 45.08  ? 442  THR B CB  1 
ATOM   3266 O OG1 . THR B 1 82  ? 59.513 -25.975 -15.923 1.00 50.00  ? 442  THR B OG1 1 
ATOM   3267 C CG2 . THR B 1 82  ? 58.738 -27.754 -17.399 1.00 40.44  ? 442  THR B CG2 1 
ATOM   3268 N N   . HIS B 1 83  ? 62.228 -27.036 -19.094 1.00 43.47  ? 443  HIS B N   1 
ATOM   3269 C CA  . HIS B 1 83  ? 62.980 -28.039 -19.860 1.00 43.28  ? 443  HIS B CA  1 
ATOM   3270 C C   . HIS B 1 83  ? 63.223 -29.357 -19.121 1.00 43.24  ? 443  HIS B C   1 
ATOM   3271 O O   . HIS B 1 83  ? 63.584 -29.395 -17.945 1.00 42.89  ? 443  HIS B O   1 
ATOM   3272 C CB  . HIS B 1 83  ? 64.333 -27.486 -20.409 1.00 43.22  ? 443  HIS B CB  1 
ATOM   3273 C CG  . HIS B 1 83  ? 64.181 -26.328 -21.348 1.00 43.81  ? 443  HIS B CG  1 
ATOM   3274 N ND1 . HIS B 1 83  ? 65.243 -25.543 -21.743 1.00 45.72  ? 443  HIS B ND1 1 
ATOM   3275 C CD2 . HIS B 1 83  ? 63.080 -25.795 -21.938 1.00 43.87  ? 443  HIS B CD2 1 
ATOM   3276 C CE1 . HIS B 1 83  ? 64.806 -24.590 -22.551 1.00 45.68  ? 443  HIS B CE1 1 
ATOM   3277 N NE2 . HIS B 1 83  ? 63.497 -24.719 -22.680 1.00 43.91  ? 443  HIS B NE2 1 
ATOM   3278 N N   . MET B 1 84  ? 63.053 -30.438 -19.859 1.00 43.57  ? 444  MET B N   1 
ATOM   3279 C CA  . MET B 1 84  ? 63.380 -31.772 -19.396 1.00 43.83  ? 444  MET B CA  1 
ATOM   3280 C C   . MET B 1 84  ? 64.655 -32.271 -20.108 1.00 43.54  ? 444  MET B C   1 
ATOM   3281 O O   . MET B 1 84  ? 64.779 -32.192 -21.335 1.00 42.28  ? 444  MET B O   1 
ATOM   3282 C CB  . MET B 1 84  ? 62.186 -32.702 -19.658 1.00 44.53  ? 444  MET B CB  1 
ATOM   3283 C CG  . MET B 1 84  ? 62.316 -34.121 -19.117 1.00 46.39  ? 444  MET B CG  1 
ATOM   3284 S SD  . MET B 1 84  ? 62.733 -35.220 -20.466 1.00 54.29  ? 444  MET B SD  1 
ATOM   3285 C CE  . MET B 1 84  ? 61.077 -35.560 -21.087 1.00 52.84  ? 444  MET B CE  1 
ATOM   3286 N N   . PHE B 1 85  ? 65.579 -32.793 -19.310 1.00 43.57  ? 445  PHE B N   1 
ATOM   3287 C CA  . PHE B 1 85  ? 66.836 -33.346 -19.782 1.00 43.90  ? 445  PHE B CA  1 
ATOM   3288 C C   . PHE B 1 85  ? 66.730 -34.824 -20.140 1.00 43.45  ? 445  PHE B C   1 
ATOM   3289 O O   . PHE B 1 85  ? 67.122 -35.242 -21.228 1.00 43.01  ? 445  PHE B O   1 
ATOM   3290 C CB  . PHE B 1 85  ? 67.930 -33.114 -18.734 1.00 44.45  ? 445  PHE B CB  1 
ATOM   3291 C CG  . PHE B 1 85  ? 68.261 -31.654 -18.522 1.00 46.07  ? 445  PHE B CG  1 
ATOM   3292 C CD1 . PHE B 1 85  ? 67.642 -30.925 -17.520 1.00 45.97  ? 445  PHE B CD1 1 
ATOM   3293 C CD2 . PHE B 1 85  ? 69.195 -31.011 -19.337 1.00 47.70  ? 445  PHE B CD2 1 
ATOM   3294 C CE1 . PHE B 1 85  ? 67.945 -29.570 -17.327 1.00 46.40  ? 445  PHE B CE1 1 
ATOM   3295 C CE2 . PHE B 1 85  ? 69.512 -29.650 -19.141 1.00 48.68  ? 445  PHE B CE2 1 
ATOM   3296 C CZ  . PHE B 1 85  ? 68.865 -28.931 -18.138 1.00 46.79  ? 445  PHE B CZ  1 
ATOM   3297 N N   . CYS B 1 86  ? 66.216 -35.621 -19.215 1.00 43.76  ? 446  CYS B N   1 
ATOM   3298 C CA  . CYS B 1 86  ? 65.919 -37.025 -19.513 1.00 44.17  ? 446  CYS B CA  1 
ATOM   3299 C C   . CYS B 1 86  ? 64.811 -37.581 -18.637 1.00 43.10  ? 446  CYS B C   1 
ATOM   3300 O O   . CYS B 1 86  ? 64.473 -37.009 -17.611 1.00 42.45  ? 446  CYS B O   1 
ATOM   3301 C CB  . CYS B 1 86  ? 67.178 -37.902 -19.404 1.00 44.55  ? 446  CYS B CB  1 
ATOM   3302 S SG  . CYS B 1 86  ? 67.966 -37.851 -17.781 1.00 48.93  ? 446  CYS B SG  1 
ATOM   3303 N N   . THR B 1 87  ? 64.237 -38.694 -19.092 1.00 42.76  ? 447  THR B N   1 
ATOM   3304 C CA  . THR B 1 87  ? 63.367 -39.533 -18.288 1.00 42.31  ? 447  THR B CA  1 
ATOM   3305 C C   . THR B 1 87  ? 63.968 -40.923 -18.250 1.00 41.86  ? 447  THR B C   1 
ATOM   3306 O O   . THR B 1 87  ? 64.566 -41.385 -19.228 1.00 41.59  ? 447  THR B O   1 
ATOM   3307 C CB  . THR B 1 87  ? 61.938 -39.620 -18.861 1.00 42.43  ? 447  THR B CB  1 
ATOM   3308 O OG1 . THR B 1 87  ? 62.003 -39.986 -20.246 1.00 43.57  ? 447  THR B OG1 1 
ATOM   3309 C CG2 . THR B 1 87  ? 61.234 -38.300 -18.736 1.00 41.49  ? 447  THR B CG2 1 
ATOM   3310 N N   . PHE B 1 88  ? 63.833 -41.576 -17.104 1.00 41.32  ? 448  PHE B N   1 
ATOM   3311 C CA  . PHE B 1 88  ? 64.219 -42.974 -16.965 1.00 40.59  ? 448  PHE B CA  1 
ATOM   3312 C C   . PHE B 1 88  ? 63.310 -43.695 -15.974 1.00 40.20  ? 448  PHE B C   1 
ATOM   3313 O O   . PHE B 1 88  ? 62.638 -43.068 -15.151 1.00 40.35  ? 448  PHE B O   1 
ATOM   3314 C CB  . PHE B 1 88  ? 65.712 -43.115 -16.587 1.00 40.42  ? 448  PHE B CB  1 
ATOM   3315 C CG  . PHE B 1 88  ? 66.090 -42.448 -15.290 1.00 40.25  ? 448  PHE B CG  1 
ATOM   3316 C CD1 . PHE B 1 88  ? 66.176 -43.183 -14.114 1.00 41.62  ? 448  PHE B CD1 1 
ATOM   3317 C CD2 . PHE B 1 88  ? 66.405 -41.099 -15.248 1.00 40.54  ? 448  PHE B CD2 1 
ATOM   3318 C CE1 . PHE B 1 88  ? 66.538 -42.566 -12.909 1.00 41.33  ? 448  PHE B CE1 1 
ATOM   3319 C CE2 . PHE B 1 88  ? 66.755 -40.477 -14.048 1.00 39.26  ? 448  PHE B CE2 1 
ATOM   3320 C CZ  . PHE B 1 88  ? 66.833 -41.208 -12.884 1.00 39.61  ? 448  PHE B CZ  1 
ATOM   3321 N N   . GLN B 1 89  ? 63.291 -45.015 -16.047 1.00 40.20  ? 449  GLN B N   1 
ATOM   3322 C CA  . GLN B 1 89  ? 62.452 -45.785 -15.157 1.00 40.56  ? 449  GLN B CA  1 
ATOM   3323 C C   . GLN B 1 89  ? 63.251 -46.870 -14.435 1.00 40.72  ? 449  GLN B C   1 
ATOM   3324 O O   . GLN B 1 89  ? 64.294 -47.298 -14.913 1.00 40.89  ? 449  GLN B O   1 
ATOM   3325 C CB  . GLN B 1 89  ? 61.258 -46.364 -15.933 1.00 40.56  ? 449  GLN B CB  1 
ATOM   3326 C CG  . GLN B 1 89  ? 61.615 -47.487 -16.947 1.00 40.03  ? 449  GLN B CG  1 
ATOM   3327 C CD  . GLN B 1 89  ? 60.440 -47.843 -17.842 1.00 40.04  ? 449  GLN B CD  1 
ATOM   3328 O OE1 . GLN B 1 89  ? 59.389 -48.253 -17.363 1.00 41.41  ? 449  GLN B OE1 1 
ATOM   3329 N NE2 . GLN B 1 89  ? 60.612 -47.673 -19.146 1.00 38.94  ? 449  GLN B NE2 1 
ATOM   3330 N N   . THR B 1 90  ? 62.764 -47.278 -13.268 1.00 41.00  ? 450  THR B N   1 
ATOM   3331 C CA  . THR B 1 90  ? 63.248 -48.482 -12.583 1.00 41.37  ? 450  THR B CA  1 
ATOM   3332 C C   . THR B 1 90  ? 62.097 -49.485 -12.557 1.00 41.44  ? 450  THR B C   1 
ATOM   3333 O O   . THR B 1 90  ? 61.084 -49.294 -13.244 1.00 41.82  ? 450  THR B O   1 
ATOM   3334 C CB  . THR B 1 90  ? 63.691 -48.166 -11.135 1.00 41.76  ? 450  THR B CB  1 
ATOM   3335 O OG1 . THR B 1 90  ? 62.564 -47.686 -10.379 1.00 41.54  ? 450  THR B OG1 1 
ATOM   3336 C CG2 . THR B 1 90  ? 64.793 -47.095 -11.124 1.00 40.96  ? 450  THR B CG2 1 
ATOM   3337 N N   . LYS B 1 91  ? 62.232 -50.539 -11.755 1.00 41.45  ? 451  LYS B N   1 
ATOM   3338 C CA  . LYS B 1 91  ? 61.165 -51.531 -11.604 1.00 41.09  ? 451  LYS B CA  1 
ATOM   3339 C C   . LYS B 1 91  ? 59.881 -50.878 -11.065 1.00 40.84  ? 451  LYS B C   1 
ATOM   3340 O O   . LYS B 1 91  ? 58.799 -51.157 -11.561 1.00 40.87  ? 451  LYS B O   1 
ATOM   3341 C CB  . LYS B 1 91  ? 61.603 -52.693 -10.710 1.00 40.62  ? 451  LYS B CB  1 
ATOM   3342 C CG  . LYS B 1 91  ? 60.566 -53.809 -10.615 1.00 41.31  ? 451  LYS B CG  1 
ATOM   3343 C CD  . LYS B 1 91  ? 61.028 -54.990 -9.785  1.00 41.39  ? 451  LYS B CD  1 
ATOM   3344 C CE  . LYS B 1 91  ? 59.989 -56.093 -9.864  1.00 43.20  ? 451  LYS B CE  1 
ATOM   3345 N NZ  . LYS B 1 91  ? 60.416 -57.364 -9.216  1.00 43.75  ? 451  LYS B NZ  1 
ATOM   3346 N N   . GLU B 1 92  ? 60.031 -49.987 -10.082 1.00 40.76  ? 452  GLU B N   1 
ATOM   3347 C CA  . GLU B 1 92  ? 58.913 -49.362 -9.359  1.00 40.50  ? 452  GLU B CA  1 
ATOM   3348 C C   . GLU B 1 92  ? 58.614 -47.904 -9.730  1.00 39.85  ? 452  GLU B C   1 
ATOM   3349 O O   . GLU B 1 92  ? 57.497 -47.441 -9.539  1.00 39.40  ? 452  GLU B O   1 
ATOM   3350 C CB  . GLU B 1 92  ? 59.186 -49.386 -7.854  1.00 40.67  ? 452  GLU B CB  1 
ATOM   3351 C CG  . GLU B 1 92  ? 59.153 -50.742 -7.198  1.00 40.32  ? 452  GLU B CG  1 
ATOM   3352 C CD  . GLU B 1 92  ? 59.152 -50.660 -5.663  1.00 41.37  ? 452  GLU B CD  1 
ATOM   3353 O OE1 . GLU B 1 92  ? 59.031 -49.542 -5.103  1.00 42.86  ? 452  GLU B OE1 1 
ATOM   3354 O OE2 . GLU B 1 92  ? 59.273 -51.724 -5.009  1.00 43.97  ? 452  GLU B OE2 1 
ATOM   3355 N N   . ASN B 1 93  ? 59.608 -47.190 -10.253 1.00 39.64  ? 453  ASN B N   1 
ATOM   3356 C CA  . ASN B 1 93  ? 59.547 -45.726 -10.362 1.00 39.26  ? 453  ASN B CA  1 
ATOM   3357 C C   . ASN B 1 93  ? 59.638 -45.155 -11.776 1.00 38.62  ? 453  ASN B C   1 
ATOM   3358 O O   . ASN B 1 93  ? 60.233 -45.746 -12.665 1.00 38.80  ? 453  ASN B O   1 
ATOM   3359 C CB  . ASN B 1 93  ? 60.659 -45.070 -9.530  1.00 39.74  ? 453  ASN B CB  1 
ATOM   3360 C CG  . ASN B 1 93  ? 60.797 -45.653 -8.140  1.00 40.94  ? 453  ASN B CG  1 
ATOM   3361 O OD1 . ASN B 1 93  ? 59.929 -45.477 -7.290  1.00 41.30  ? 453  ASN B OD1 1 
ATOM   3362 N ND2 . ASN B 1 93  ? 61.926 -46.336 -7.895  1.00 45.10  ? 453  ASN B ND2 1 
ATOM   3363 N N   . LEU B 1 94  ? 59.056 -43.977 -11.954 1.00 38.10  ? 454  LEU B N   1 
ATOM   3364 C CA  . LEU B 1 94  ? 59.242 -43.168 -13.155 1.00 37.72  ? 454  LEU B CA  1 
ATOM   3365 C C   . LEU B 1 94  ? 59.927 -41.873 -12.738 1.00 37.18  ? 454  LEU B C   1 
ATOM   3366 O O   . LEU B 1 94  ? 59.489 -41.237 -11.800 1.00 37.69  ? 454  LEU B O   1 
ATOM   3367 C CB  . LEU B 1 94  ? 57.884 -42.859 -13.802 1.00 37.03  ? 454  LEU B CB  1 
ATOM   3368 C CG  . LEU B 1 94  ? 57.099 -44.063 -14.316 1.00 37.68  ? 454  LEU B CG  1 
ATOM   3369 C CD1 . LEU B 1 94  ? 55.698 -43.645 -14.656 1.00 36.20  ? 454  LEU B CD1 1 
ATOM   3370 C CD2 . LEU B 1 94  ? 57.786 -44.748 -15.540 1.00 35.53  ? 454  LEU B CD2 1 
ATOM   3371 N N   . PHE B 1 95  ? 60.998 -41.490 -13.425 1.00 37.67  ? 455  PHE B N   1 
ATOM   3372 C CA  . PHE B 1 95  ? 61.717 -40.238 -13.125 1.00 37.56  ? 455  PHE B CA  1 
ATOM   3373 C C   . PHE B 1 95  ? 61.822 -39.289 -14.325 1.00 37.82  ? 455  PHE B C   1 
ATOM   3374 O O   . PHE B 1 95  ? 62.076 -39.712 -15.456 1.00 37.39  ? 455  PHE B O   1 
ATOM   3375 C CB  . PHE B 1 95  ? 63.126 -40.519 -12.611 1.00 37.08  ? 455  PHE B CB  1 
ATOM   3376 C CG  . PHE B 1 95  ? 63.184 -41.369 -11.365 1.00 37.20  ? 455  PHE B CG  1 
ATOM   3377 C CD1 . PHE B 1 95  ? 62.933 -40.826 -10.114 1.00 37.21  ? 455  PHE B CD1 1 
ATOM   3378 C CD2 . PHE B 1 95  ? 63.543 -42.712 -11.445 1.00 36.70  ? 455  PHE B CD2 1 
ATOM   3379 C CE1 . PHE B 1 95  ? 63.019 -41.631 -8.958  1.00 36.15  ? 455  PHE B CE1 1 
ATOM   3380 C CE2 . PHE B 1 95  ? 63.640 -43.498 -10.306 1.00 35.76  ? 455  PHE B CE2 1 
ATOM   3381 C CZ  . PHE B 1 95  ? 63.381 -42.954 -9.063  1.00 35.83  ? 455  PHE B CZ  1 
ATOM   3382 N N   . PHE B 1 96  ? 61.621 -38.001 -14.053 1.00 38.41  ? 456  PHE B N   1 
ATOM   3383 C CA  . PHE B 1 96  ? 61.758 -36.932 -15.042 1.00 38.98  ? 456  PHE B CA  1 
ATOM   3384 C C   . PHE B 1 96  ? 62.809 -35.987 -14.490 1.00 39.36  ? 456  PHE B C   1 
ATOM   3385 O O   . PHE B 1 96  ? 62.615 -35.417 -13.399 1.00 39.57  ? 456  PHE B O   1 
ATOM   3386 C CB  . PHE B 1 96  ? 60.469 -36.103 -15.202 1.00 38.94  ? 456  PHE B CB  1 
ATOM   3387 C CG  . PHE B 1 96  ? 59.218 -36.901 -15.508 1.00 38.48  ? 456  PHE B CG  1 
ATOM   3388 C CD1 . PHE B 1 96  ? 58.707 -37.819 -14.589 1.00 37.59  ? 456  PHE B CD1 1 
ATOM   3389 C CD2 . PHE B 1 96  ? 58.490 -36.643 -16.677 1.00 39.17  ? 456  PHE B CD2 1 
ATOM   3390 C CE1 . PHE B 1 96  ? 57.497 -38.503 -14.833 1.00 39.49  ? 456  PHE B CE1 1 
ATOM   3391 C CE2 . PHE B 1 96  ? 57.280 -37.317 -16.940 1.00 39.08  ? 456  PHE B CE2 1 
ATOM   3392 C CZ  . PHE B 1 96  ? 56.787 -38.247 -16.017 1.00 39.46  ? 456  PHE B CZ  1 
ATOM   3393 N N   . VAL B 1 97  ? 63.921 -35.837 -15.208 1.00 39.27  ? 457  VAL B N   1 
ATOM   3394 C CA  . VAL B 1 97  ? 64.990 -34.943 -14.748 1.00 39.71  ? 457  VAL B CA  1 
ATOM   3395 C C   . VAL B 1 97  ? 64.815 -33.582 -15.412 1.00 40.19  ? 457  VAL B C   1 
ATOM   3396 O O   . VAL B 1 97  ? 64.990 -33.443 -16.635 1.00 39.27  ? 457  VAL B O   1 
ATOM   3397 C CB  . VAL B 1 97  ? 66.389 -35.560 -14.960 1.00 40.31  ? 457  VAL B CB  1 
ATOM   3398 C CG1 . VAL B 1 97  ? 67.502 -34.599 -14.491 1.00 39.78  ? 457  VAL B CG1 1 
ATOM   3399 C CG2 . VAL B 1 97  ? 66.477 -36.893 -14.211 1.00 38.65  ? 457  VAL B CG2 1 
ATOM   3400 N N   . MET B 1 98  ? 64.403 -32.606 -14.593 1.00 40.71  ? 458  MET B N   1 
ATOM   3401 C CA  . MET B 1 98  ? 63.983 -31.268 -15.060 1.00 41.77  ? 458  MET B CA  1 
ATOM   3402 C C   . MET B 1 98  ? 65.003 -30.195 -14.657 1.00 41.53  ? 458  MET B C   1 
ATOM   3403 O O   . MET B 1 98  ? 65.718 -30.371 -13.672 1.00 41.27  ? 458  MET B O   1 
ATOM   3404 C CB  . MET B 1 98  ? 62.624 -30.880 -14.440 1.00 41.81  ? 458  MET B CB  1 
ATOM   3405 C CG  . MET B 1 98  ? 61.501 -31.947 -14.521 1.00 44.64  ? 458  MET B CG  1 
ATOM   3406 S SD  . MET B 1 98  ? 60.873 -32.160 -16.200 1.00 49.26  ? 458  MET B SD  1 
ATOM   3407 C CE  . MET B 1 98  ? 60.254 -30.488 -16.523 1.00 43.63  ? 458  MET B CE  1 
ATOM   3408 N N   . GLU B 1 99  ? 65.046 -29.078 -15.393 1.00 41.72  ? 459  GLU B N   1 
ATOM   3409 C CA  . GLU B 1 99  ? 65.774 -27.886 -14.920 1.00 42.17  ? 459  GLU B CA  1 
ATOM   3410 C C   . GLU B 1 99  ? 65.158 -27.366 -13.624 1.00 41.42  ? 459  GLU B C   1 
ATOM   3411 O O   . GLU B 1 99  ? 63.926 -27.347 -13.456 1.00 40.61  ? 459  GLU B O   1 
ATOM   3412 C CB  . GLU B 1 99  ? 65.831 -26.774 -15.982 1.00 42.21  ? 459  GLU B CB  1 
ATOM   3413 C CG  . GLU B 1 99  ? 64.486 -26.090 -16.293 1.00 43.63  ? 459  GLU B CG  1 
ATOM   3414 C CD  . GLU B 1 99  ? 64.627 -24.930 -17.276 1.00 43.84  ? 459  GLU B CD  1 
ATOM   3415 O OE1 . GLU B 1 99  ? 63.711 -24.759 -18.109 1.00 46.62  ? 459  GLU B OE1 1 
ATOM   3416 O OE2 . GLU B 1 99  ? 65.648 -24.197 -17.231 1.00 45.27  ? 459  GLU B OE2 1 
ATOM   3417 N N   . TYR B 1 100 ? 66.030 -26.990 -12.699 1.00 41.06  ? 460  TYR B N   1 
ATOM   3418 C CA  . TYR B 1 100 ? 65.609 -26.458 -11.430 1.00 41.58  ? 460  TYR B CA  1 
ATOM   3419 C C   . TYR B 1 100 ? 65.431 -24.934 -11.508 1.00 42.20  ? 460  TYR B C   1 
ATOM   3420 O O   . TYR B 1 100 ? 66.343 -24.190 -11.879 1.00 41.91  ? 460  TYR B O   1 
ATOM   3421 C CB  . TYR B 1 100 ? 66.566 -26.875 -10.328 1.00 41.95  ? 460  TYR B CB  1 
ATOM   3422 C CG  . TYR B 1 100 ? 66.315 -26.161 -9.027  1.00 43.84  ? 460  TYR B CG  1 
ATOM   3423 C CD1 . TYR B 1 100 ? 65.046 -26.181 -8.426  1.00 43.76  ? 460  TYR B CD1 1 
ATOM   3424 C CD2 . TYR B 1 100 ? 67.342 -25.445 -8.394  1.00 43.43  ? 460  TYR B CD2 1 
ATOM   3425 C CE1 . TYR B 1 100 ? 64.806 -25.509 -7.247  1.00 43.83  ? 460  TYR B CE1 1 
ATOM   3426 C CE2 . TYR B 1 100 ? 67.114 -24.780 -7.200  1.00 42.15  ? 460  TYR B CE2 1 
ATOM   3427 C CZ  . TYR B 1 100 ? 65.851 -24.821 -6.636  1.00 44.00  ? 460  TYR B CZ  1 
ATOM   3428 O OH  . TYR B 1 100 ? 65.620 -24.167 -5.455  1.00 46.22  ? 460  TYR B OH  1 
ATOM   3429 N N   . LEU B 1 101 ? 64.220 -24.494 -11.169 1.00 43.15  ? 461  LEU B N   1 
ATOM   3430 C CA  . LEU B 1 101 ? 63.801 -23.108 -11.271 1.00 43.90  ? 461  LEU B CA  1 
ATOM   3431 C C   . LEU B 1 101 ? 63.440 -22.584 -9.896  1.00 44.84  ? 461  LEU B C   1 
ATOM   3432 O O   . LEU B 1 101 ? 62.503 -23.055 -9.239  1.00 45.69  ? 461  LEU B O   1 
ATOM   3433 C CB  . LEU B 1 101 ? 62.648 -22.964 -12.263 1.00 43.88  ? 461  LEU B CB  1 
ATOM   3434 C CG  . LEU B 1 101 ? 63.108 -23.372 -13.675 1.00 44.04  ? 461  LEU B CG  1 
ATOM   3435 C CD1 . LEU B 1 101 ? 61.935 -23.841 -14.547 1.00 42.85  ? 461  LEU B CD1 1 
ATOM   3436 C CD2 . LEU B 1 101 ? 63.953 -22.255 -14.359 1.00 42.03  ? 461  LEU B CD2 1 
ATOM   3437 N N   . ASN B 1 102 ? 64.192 -21.561 -9.527  1.00 45.46  ? 462  ASN B N   1 
ATOM   3438 C CA  . ASN B 1 102 ? 64.383 -21.028 -8.192  1.00 46.40  ? 462  ASN B CA  1 
ATOM   3439 C C   . ASN B 1 102 ? 63.725 -19.643 -7.997  1.00 45.91  ? 462  ASN B C   1 
ATOM   3440 O O   . ASN B 1 102 ? 63.710 -19.103 -6.888  1.00 46.06  ? 462  ASN B O   1 
ATOM   3441 C CB  . ASN B 1 102 ? 65.910 -20.810 -8.063  1.00 47.80  ? 462  ASN B CB  1 
ATOM   3442 C CG  . ASN B 1 102 ? 66.370 -20.786 -6.659  1.00 51.13  ? 462  ASN B CG  1 
ATOM   3443 O OD1 . ASN B 1 102 ? 65.555 -20.791 -5.719  1.00 57.10  ? 462  ASN B OD1 1 
ATOM   3444 N ND2 . ASN B 1 102 ? 67.688 -20.782 -6.475  1.00 54.14  ? 462  ASN B ND2 1 
ATOM   3445 N N   . GLY B 1 103 ? 63.226 -19.058 -9.078  1.00 44.96  ? 463  GLY B N   1 
ATOM   3446 C CA  . GLY B 1 103 ? 62.671 -17.708 -9.039  1.00 44.96  ? 463  GLY B CA  1 
ATOM   3447 C C   . GLY B 1 103 ? 61.301 -17.513 -8.397  1.00 45.21  ? 463  GLY B C   1 
ATOM   3448 O O   . GLY B 1 103 ? 60.866 -16.366 -8.220  1.00 45.16  ? 463  GLY B O   1 
ATOM   3449 N N   . GLY B 1 104 ? 60.620 -18.608 -8.042  1.00 44.53  ? 464  GLY B N   1 
ATOM   3450 C CA  . GLY B 1 104 ? 59.271 -18.530 -7.461  1.00 44.57  ? 464  GLY B CA  1 
ATOM   3451 C C   . GLY B 1 104 ? 58.152 -18.526 -8.496  1.00 44.88  ? 464  GLY B C   1 
ATOM   3452 O O   . GLY B 1 104 ? 58.319 -18.049 -9.620  1.00 45.74  ? 464  GLY B O   1 
ATOM   3453 N N   . ASP B 1 105 ? 56.988 -19.042 -8.130  1.00 44.64  ? 465  ASP B N   1 
ATOM   3454 C CA  . ASP B 1 105 ? 55.847 -18.999 -9.047  1.00 44.36  ? 465  ASP B CA  1 
ATOM   3455 C C   . ASP B 1 105 ? 55.074 -17.658 -8.981  1.00 43.75  ? 465  ASP B C   1 
ATOM   3456 O O   . ASP B 1 105 ? 55.156 -16.936 -7.990  1.00 43.39  ? 465  ASP B O   1 
ATOM   3457 C CB  . ASP B 1 105 ? 54.923 -20.204 -8.792  1.00 44.60  ? 465  ASP B CB  1 
ATOM   3458 C CG  . ASP B 1 105 ? 54.365 -20.204 -7.407  1.00 46.51  ? 465  ASP B CG  1 
ATOM   3459 O OD1 . ASP B 1 105 ? 53.260 -19.665 -7.213  1.00 49.80  ? 465  ASP B OD1 1 
ATOM   3460 O OD2 . ASP B 1 105 ? 55.035 -20.711 -6.489  1.00 52.61  ? 465  ASP B OD2 1 
ATOM   3461 N N   . LEU B 1 106 ? 54.315 -17.346 -10.029 1.00 43.07  ? 466  LEU B N   1 
ATOM   3462 C CA  . LEU B 1 106 ? 53.509 -16.117 -10.068 1.00 43.70  ? 466  LEU B CA  1 
ATOM   3463 C C   . LEU B 1 106 ? 52.439 -15.964 -8.961  1.00 44.05  ? 466  LEU B C   1 
ATOM   3464 O O   . LEU B 1 106 ? 52.108 -14.832 -8.585  1.00 44.75  ? 466  LEU B O   1 
ATOM   3465 C CB  . LEU B 1 106 ? 52.903 -15.868 -11.466 1.00 42.34  ? 466  LEU B CB  1 
ATOM   3466 C CG  . LEU B 1 106 ? 53.918 -15.538 -12.569 1.00 43.72  ? 466  LEU B CG  1 
ATOM   3467 C CD1 . LEU B 1 106 ? 53.202 -15.065 -13.805 1.00 43.97  ? 466  LEU B CD1 1 
ATOM   3468 C CD2 . LEU B 1 106 ? 54.947 -14.501 -12.100 1.00 41.29  ? 466  LEU B CD2 1 
ATOM   3469 N N   . MET B 1 107 ? 51.933 -17.076 -8.435  1.00 43.64  ? 467  MET B N   1 
ATOM   3470 C CA  . MET B 1 107 ? 50.972 -17.030 -7.347  1.00 44.30  ? 467  MET B CA  1 
ATOM   3471 C C   . MET B 1 107 ? 51.643 -16.539 -6.087  1.00 43.61  ? 467  MET B C   1 
ATOM   3472 O O   . MET B 1 107 ? 51.089 -15.716 -5.366  1.00 43.68  ? 467  MET B O   1 
ATOM   3473 C CB  . MET B 1 107 ? 50.351 -18.416 -7.067  1.00 44.31  ? 467  MET B CB  1 
ATOM   3474 C CG  . MET B 1 107 ? 49.310 -18.430 -5.907  1.00 46.96  ? 467  MET B CG  1 
ATOM   3475 S SD  . MET B 1 107 ? 47.816 -17.444 -6.353  1.00 53.87  ? 467  MET B SD  1 
ATOM   3476 C CE  . MET B 1 107 ? 47.913 -16.257 -5.080  1.00 54.78  ? 467  MET B CE  1 
ATOM   3477 N N   . TYR B 1 108 ? 52.823 -17.083 -5.790  1.00 42.97  ? 468  TYR B N   1 
ATOM   3478 C CA  . TYR B 1 108 ? 53.612 -16.564 -4.687  1.00 42.09  ? 468  TYR B CA  1 
ATOM   3479 C C   . TYR B 1 108 ? 53.914 -15.059 -4.852  1.00 41.58  ? 468  TYR B C   1 
ATOM   3480 O O   . TYR B 1 108 ? 53.759 -14.306 -3.917  1.00 41.34  ? 468  TYR B O   1 
ATOM   3481 C CB  . TYR B 1 108 ? 54.902 -17.369 -4.504  1.00 42.20  ? 468  TYR B CB  1 
ATOM   3482 C CG  . TYR B 1 108 ? 55.912 -16.668 -3.629  1.00 41.21  ? 468  TYR B CG  1 
ATOM   3483 C CD1 . TYR B 1 108 ? 55.807 -16.704 -2.234  1.00 41.73  ? 468  TYR B CD1 1 
ATOM   3484 C CD2 . TYR B 1 108 ? 56.944 -15.928 -4.201  1.00 40.44  ? 468  TYR B CD2 1 
ATOM   3485 C CE1 . TYR B 1 108 ? 56.741 -16.050 -1.433  1.00 42.47  ? 468  TYR B CE1 1 
ATOM   3486 C CE2 . TYR B 1 108 ? 57.879 -15.261 -3.421  1.00 41.03  ? 468  TYR B CE2 1 
ATOM   3487 C CZ  . TYR B 1 108 ? 57.779 -15.319 -2.051  1.00 43.11  ? 468  TYR B CZ  1 
ATOM   3488 O OH  . TYR B 1 108 ? 58.721 -14.649 -1.303  1.00 43.66  ? 468  TYR B OH  1 
ATOM   3489 N N   . HIS B 1 109 ? 54.336 -14.639 -6.036  1.00 42.36  ? 469  HIS B N   1 
ATOM   3490 C CA  . HIS B 1 109 ? 54.764 -13.242 -6.270  1.00 44.01  ? 469  HIS B CA  1 
ATOM   3491 C C   . HIS B 1 109 ? 53.639 -12.212 -6.162  1.00 45.78  ? 469  HIS B C   1 
ATOM   3492 O O   . HIS B 1 109 ? 53.861 -11.090 -5.733  1.00 45.70  ? 469  HIS B O   1 
ATOM   3493 C CB  . HIS B 1 109 ? 55.507 -13.111 -7.612  1.00 42.75  ? 469  HIS B CB  1 
ATOM   3494 C CG  . HIS B 1 109 ? 56.897 -13.659 -7.559  1.00 41.03  ? 469  HIS B CG  1 
ATOM   3495 N ND1 . HIS B 1 109 ? 57.844 -13.178 -6.678  1.00 41.72  ? 469  HIS B ND1 1 
ATOM   3496 C CD2 . HIS B 1 109 ? 57.479 -14.692 -8.209  1.00 37.98  ? 469  HIS B CD2 1 
ATOM   3497 C CE1 . HIS B 1 109 ? 58.956 -13.885 -6.795  1.00 38.82  ? 469  HIS B CE1 1 
ATOM   3498 N NE2 . HIS B 1 109 ? 58.767 -14.799 -7.726  1.00 39.27  ? 469  HIS B NE2 1 
ATOM   3499 N N   . ILE B 1 110 ? 52.433 -12.624 -6.549  1.00 47.78  ? 470  ILE B N   1 
ATOM   3500 C CA  . ILE B 1 110 ? 51.297 -11.740 -6.558  1.00 49.56  ? 470  ILE B CA  1 
ATOM   3501 C C   . ILE B 1 110 ? 50.704 -11.581 -5.156  1.00 51.27  ? 470  ILE B C   1 
ATOM   3502 O O   . ILE B 1 110 ? 50.027 -10.582 -4.887  1.00 51.24  ? 470  ILE B O   1 
ATOM   3503 C CB  . ILE B 1 110 ? 50.251 -12.200 -7.591  1.00 49.42  ? 470  ILE B CB  1 
ATOM   3504 C CG1 . ILE B 1 110 ? 49.508 -10.977 -8.146  1.00 50.02  ? 470  ILE B CG1 1 
ATOM   3505 C CG2 . ILE B 1 110 ? 49.338 -13.286 -7.008  1.00 49.14  ? 470  ILE B CG2 1 
ATOM   3506 C CD1 . ILE B 1 110 ? 48.529 -11.309 -9.251  1.00 49.33  ? 470  ILE B CD1 1 
ATOM   3507 N N   . GLN B 1 111 ? 50.992 -12.539 -4.265  1.00 52.20  ? 471  GLN B N   1 
ATOM   3508 C CA  . GLN B 1 111 ? 50.502 -12.490 -2.891  1.00 54.35  ? 471  GLN B CA  1 
ATOM   3509 C C   . GLN B 1 111 ? 51.185 -11.368 -2.113  1.00 54.65  ? 471  GLN B C   1 
ATOM   3510 O O   . GLN B 1 111 ? 50.584 -10.772 -1.217  1.00 55.52  ? 471  GLN B O   1 
ATOM   3511 C CB  . GLN B 1 111 ? 50.608 -13.866 -2.193  1.00 54.34  ? 471  GLN B CB  1 
ATOM   3512 C CG  . GLN B 1 111 ? 49.493 -14.893 -2.628  1.00 54.68  ? 471  GLN B CG  1 
ATOM   3513 C CD  . GLN B 1 111 ? 49.771 -16.354 -2.172  1.00 58.16  ? 471  GLN B CD  1 
ATOM   3514 O OE1 . GLN B 1 111 ? 50.759 -16.980 -2.584  1.00 64.39  ? 471  GLN B OE1 1 
ATOM   3515 N NE2 . GLN B 1 111 ? 48.878 -16.908 -1.341  1.00 61.86  ? 471  GLN B NE2 1 
ATOM   3516 N N   . SER B 1 112 ? 52.414 -11.040 -2.500  1.00 54.37  ? 472  SER B N   1 
ATOM   3517 C CA  . SER B 1 112 ? 53.168 -9.944  -1.889  1.00 54.97  ? 472  SER B CA  1 
ATOM   3518 C C   . SER B 1 112 ? 52.671 -8.553  -2.334  1.00 54.47  ? 472  SER B C   1 
ATOM   3519 O O   . SER B 1 112 ? 52.444 -7.666  -1.500  1.00 54.73  ? 472  SER B O   1 
ATOM   3520 C CB  . SER B 1 112 ? 54.679 -10.119 -2.171  1.00 55.35  ? 472  SER B CB  1 
ATOM   3521 O OG  . SER B 1 112 ? 55.098 -11.488 -1.958  1.00 56.60  ? 472  SER B OG  1 
ATOM   3522 N N   . CYS B 1 113 ? 52.468 -8.372  -3.636  1.00 53.62  ? 473  CYS B N   1 
ATOM   3523 C CA  . CYS B 1 113 ? 52.177 -7.046  -4.173  1.00 53.10  ? 473  CYS B CA  1 
ATOM   3524 C C   . CYS B 1 113 ? 50.714 -6.818  -4.525  1.00 52.47  ? 473  CYS B C   1 
ATOM   3525 O O   . CYS B 1 113 ? 50.357 -5.708  -4.921  1.00 53.26  ? 473  CYS B O   1 
ATOM   3526 C CB  . CYS B 1 113 ? 53.055 -6.772  -5.391  1.00 53.49  ? 473  CYS B CB  1 
ATOM   3527 S SG  . CYS B 1 113 ? 52.813 -7.959  -6.706  1.00 53.41  ? 473  CYS B SG  1 
ATOM   3528 N N   . HIS B 1 114 ? 49.881 -7.859  -4.362  1.00 51.28  ? 474  HIS B N   1 
ATOM   3529 C CA  . HIS B 1 114 ? 48.422 -7.861  -4.639  1.00 50.05  ? 474  HIS B CA  1 
ATOM   3530 C C   . HIS B 1 114 ? 48.041 -7.897  -6.115  1.00 48.65  ? 474  HIS B C   1 
ATOM   3531 O O   . HIS B 1 114 ? 47.022 -8.460  -6.460  1.00 48.41  ? 474  HIS B O   1 
ATOM   3532 C CB  . HIS B 1 114 ? 47.670 -6.714  -3.920  1.00 50.72  ? 474  HIS B CB  1 
ATOM   3533 C CG  . HIS B 1 114 ? 48.078 -6.529  -2.490  1.00 53.76  ? 474  HIS B CG  1 
ATOM   3534 N ND1 . HIS B 1 114 ? 48.245 -7.585  -1.619  1.00 56.12  ? 474  HIS B ND1 1 
ATOM   3535 C CD2 . HIS B 1 114 ? 48.388 -5.411  -1.787  1.00 58.21  ? 474  HIS B CD2 1 
ATOM   3536 C CE1 . HIS B 1 114 ? 48.622 -7.130  -0.437  1.00 57.53  ? 474  HIS B CE1 1 
ATOM   3537 N NE2 . HIS B 1 114 ? 48.719 -5.813  -0.512  1.00 59.92  ? 474  HIS B NE2 1 
ATOM   3538 N N   . LYS B 1 115 ? 48.879 -7.334  -6.972  1.00 47.62  ? 475  LYS B N   1 
ATOM   3539 C CA  . LYS B 1 115 ? 48.577 -7.052  -8.365  1.00 48.37  ? 475  LYS B CA  1 
ATOM   3540 C C   . LYS B 1 115 ? 49.913 -6.809  -9.035  1.00 46.98  ? 475  LYS B C   1 
ATOM   3541 O O   . LYS B 1 115 ? 50.760 -6.183  -8.439  1.00 47.19  ? 475  LYS B O   1 
ATOM   3542 C CB  . LYS B 1 115 ? 47.920 -5.656  -8.417  1.00 49.60  ? 475  LYS B CB  1 
ATOM   3543 C CG  . LYS B 1 115 ? 46.566 -5.590  -8.906  1.00 53.48  ? 475  LYS B CG  1 
ATOM   3544 C CD  . LYS B 1 115 ? 45.881 -4.376  -8.316  1.00 56.97  ? 475  LYS B CD  1 
ATOM   3545 C CE  . LYS B 1 115 ? 46.329 -3.089  -8.909  1.00 57.05  ? 475  LYS B CE  1 
ATOM   3546 N NZ  . LYS B 1 115 ? 46.040 -2.049  -7.898  1.00 59.20  ? 475  LYS B NZ  1 
ATOM   3547 N N   . PHE B 1 116 ? 50.099 -7.227  -10.278 1.00 46.05  ? 476  PHE B N   1 
ATOM   3548 C CA  . PHE B 1 116 ? 51.322 -6.847  -10.980 1.00 45.50  ? 476  PHE B CA  1 
ATOM   3549 C C   . PHE B 1 116 ? 51.134 -5.491  -11.673 1.00 46.00  ? 476  PHE B C   1 
ATOM   3550 O O   . PHE B 1 116 ? 50.107 -5.246  -12.339 1.00 43.82  ? 476  PHE B O   1 
ATOM   3551 C CB  . PHE B 1 116 ? 51.796 -7.918  -11.974 1.00 44.53  ? 476  PHE B CB  1 
ATOM   3552 C CG  . PHE B 1 116 ? 52.170 -9.230  -11.333 1.00 44.28  ? 476  PHE B CG  1 
ATOM   3553 C CD1 . PHE B 1 116 ? 52.896 -9.268  -10.141 1.00 44.08  ? 476  PHE B CD1 1 
ATOM   3554 C CD2 . PHE B 1 116 ? 51.833 -10.424 -11.939 1.00 42.40  ? 476  PHE B CD2 1 
ATOM   3555 C CE1 . PHE B 1 116 ? 53.253 -10.485 -9.550  1.00 43.61  ? 476  PHE B CE1 1 
ATOM   3556 C CE2 . PHE B 1 116 ? 52.180 -11.655 -11.342 1.00 43.27  ? 476  PHE B CE2 1 
ATOM   3557 C CZ  . PHE B 1 116 ? 52.892 -11.681 -10.162 1.00 42.49  ? 476  PHE B CZ  1 
ATOM   3558 N N   . ASP B 1 117 ? 52.133 -4.617  -11.498 1.00 46.21  ? 477  ASP B N   1 
ATOM   3559 C CA  . ASP B 1 117 ? 52.132 -3.326  -12.182 1.00 47.63  ? 477  ASP B CA  1 
ATOM   3560 C C   . ASP B 1 117 ? 52.029 -3.618  -13.681 1.00 47.58  ? 477  ASP B C   1 
ATOM   3561 O O   . ASP B 1 117 ? 52.344 -4.723  -14.137 1.00 48.28  ? 477  ASP B O   1 
ATOM   3562 C CB  . ASP B 1 117 ? 53.352 -2.461  -11.793 1.00 47.74  ? 477  ASP B CB  1 
ATOM   3563 C CG  . ASP B 1 117 ? 54.688 -3.066  -12.243 1.00 51.15  ? 477  ASP B CG  1 
ATOM   3564 O OD1 . ASP B 1 117 ? 54.999 -2.956  -13.452 1.00 53.73  ? 477  ASP B OD1 1 
ATOM   3565 O OD2 . ASP B 1 117 ? 55.442 -3.634  -11.394 1.00 54.15  ? 477  ASP B OD2 1 
ATOM   3566 N N   . LEU B 1 118 ? 51.521 -2.654  -14.424 1.00 47.47  ? 478  LEU B N   1 
ATOM   3567 C CA  . LEU B 1 118 ? 51.147 -2.851  -15.812 1.00 47.20  ? 478  LEU B CA  1 
ATOM   3568 C C   . LEU B 1 118 ? 52.278 -3.341  -16.725 1.00 47.05  ? 478  LEU B C   1 
ATOM   3569 O O   . LEU B 1 118 ? 52.048 -4.178  -17.585 1.00 47.39  ? 478  LEU B O   1 
ATOM   3570 C CB  . LEU B 1 118 ? 50.580 -1.541  -16.361 1.00 47.15  ? 478  LEU B CB  1 
ATOM   3571 C CG  . LEU B 1 118 ? 50.133 -1.546  -17.824 1.00 47.48  ? 478  LEU B CG  1 
ATOM   3572 C CD1 . LEU B 1 118 ? 48.798 -2.279  -17.952 1.00 46.06  ? 478  LEU B CD1 1 
ATOM   3573 C CD2 . LEU B 1 118 ? 50.026 -0.111  -18.319 1.00 47.16  ? 478  LEU B CD2 1 
ATOM   3574 N N   . SER B 1 119 ? 53.465 -2.762  -16.582 1.00 46.48  ? 479  SER B N   1 
ATOM   3575 C CA  . SER B 1 119 ? 54.613 -3.131  -17.399 1.00 46.81  ? 479  SER B CA  1 
ATOM   3576 C C   . SER B 1 119 ? 55.021 -4.587  -17.114 1.00 45.66  ? 479  SER B C   1 
ATOM   3577 O O   . SER B 1 119 ? 55.323 -5.339  -18.030 1.00 45.88  ? 479  SER B O   1 
ATOM   3578 C CB  . SER B 1 119 ? 55.813 -2.197  -17.109 1.00 46.86  ? 479  SER B CB  1 
ATOM   3579 O OG  . SER B 1 119 ? 55.504 -0.849  -17.413 1.00 50.15  ? 479  SER B OG  1 
ATOM   3580 N N   . ARG B 1 120 ? 55.035 -4.941  -15.837 1.00 44.79  ? 480  ARG B N   1 
ATOM   3581 C CA  . ARG B 1 120 ? 55.355 -6.281  -15.362 1.00 44.73  ? 480  ARG B CA  1 
ATOM   3582 C C   . ARG B 1 120 ? 54.342 -7.349  -15.830 1.00 44.89  ? 480  ARG B C   1 
ATOM   3583 O O   . ARG B 1 120 ? 54.748 -8.399  -16.324 1.00 44.89  ? 480  ARG B O   1 
ATOM   3584 C CB  . ARG B 1 120 ? 55.510 -6.269  -13.837 1.00 43.80  ? 480  ARG B CB  1 
ATOM   3585 C CG  . ARG B 1 120 ? 55.910 -7.608  -13.246 1.00 43.39  ? 480  ARG B CG  1 
ATOM   3586 C CD  . ARG B 1 120 ? 55.870 -7.551  -11.732 1.00 43.30  ? 480  ARG B CD  1 
ATOM   3587 N NE  . ARG B 1 120 ? 56.342 -8.782  -11.096 1.00 41.08  ? 480  ARG B NE  1 
ATOM   3588 C CZ  . ARG B 1 120 ? 56.327 -8.965  -9.784  1.00 41.95  ? 480  ARG B CZ  1 
ATOM   3589 N NH1 . ARG B 1 120 ? 55.881 -8.002  -8.991  1.00 43.08  ? 480  ARG B NH1 1 
ATOM   3590 N NH2 . ARG B 1 120 ? 56.742 -10.100 -9.258  1.00 41.14  ? 480  ARG B NH2 1 
ATOM   3591 N N   . ALA B 1 121 ? 53.043 -7.067  -15.684 1.00 44.76  ? 481  ALA B N   1 
ATOM   3592 C CA  . ALA B 1 121 ? 51.954 -7.937  -16.194 1.00 44.81  ? 481  ALA B CA  1 
ATOM   3593 C C   . ALA B 1 121 ? 51.990 -8.129  -17.713 1.00 45.23  ? 481  ALA B C   1 
ATOM   3594 O O   . ALA B 1 121 ? 51.729 -9.236  -18.216 1.00 45.76  ? 481  ALA B O   1 
ATOM   3595 C CB  . ALA B 1 121 ? 50.553 -7.386  -15.755 1.00 43.79  ? 481  ALA B CB  1 
ATOM   3596 N N   . THR B 1 122 ? 52.291 -7.047  -18.435 1.00 44.82  ? 482  THR B N   1 
ATOM   3597 C CA  . THR B 1 122 ? 52.359 -7.044  -19.908 1.00 45.02  ? 482  THR B CA  1 
ATOM   3598 C C   . THR B 1 122 ? 53.552 -7.867  -20.403 1.00 44.75  ? 482  THR B C   1 
ATOM   3599 O O   . THR B 1 122 ? 53.459 -8.569  -21.413 1.00 44.47  ? 482  THR B O   1 
ATOM   3600 C CB  . THR B 1 122 ? 52.465 -5.571  -20.464 1.00 45.09  ? 482  THR B CB  1 
ATOM   3601 O OG1 . THR B 1 122 ? 51.333 -4.807  -20.022 1.00 46.04  ? 482  THR B OG1 1 
ATOM   3602 C CG2 . THR B 1 122 ? 52.547 -5.521  -21.980 1.00 44.27  ? 482  THR B CG2 1 
ATOM   3603 N N   . PHE B 1 123 ? 54.678 -7.747  -19.701 1.00 44.25  ? 483  PHE B N   1 
ATOM   3604 C CA  . PHE B 1 123 ? 55.855 -8.560  -19.976 1.00 43.90  ? 483  PHE B CA  1 
ATOM   3605 C C   . PHE B 1 123 ? 55.550 -10.055 -19.769 1.00 43.45  ? 483  PHE B C   1 
ATOM   3606 O O   . PHE B 1 123 ? 55.853 -10.865 -20.636 1.00 43.52  ? 483  PHE B O   1 
ATOM   3607 C CB  . PHE B 1 123 ? 57.022 -8.114  -19.084 1.00 44.07  ? 483  PHE B CB  1 
ATOM   3608 C CG  . PHE B 1 123 ? 58.246 -8.965  -19.217 1.00 43.75  ? 483  PHE B CG  1 
ATOM   3609 C CD1 . PHE B 1 123 ? 59.175 -8.707  -20.209 1.00 44.58  ? 483  PHE B CD1 1 
ATOM   3610 C CD2 . PHE B 1 123 ? 58.477 -10.017 -18.328 1.00 44.70  ? 483  PHE B CD2 1 
ATOM   3611 C CE1 . PHE B 1 123 ? 60.321 -9.492  -20.336 1.00 44.74  ? 483  PHE B CE1 1 
ATOM   3612 C CE2 . PHE B 1 123 ? 59.614 -10.813 -18.441 1.00 43.84  ? 483  PHE B CE2 1 
ATOM   3613 C CZ  . PHE B 1 123 ? 60.538 -10.543 -19.450 1.00 44.60  ? 483  PHE B CZ  1 
ATOM   3614 N N   . TYR B 1 124 ? 54.939 -10.412 -18.636 1.00 43.22  ? 484  TYR B N   1 
ATOM   3615 C CA  . TYR B 1 124 ? 54.551 -11.813 -18.387 1.00 42.53  ? 484  TYR B CA  1 
ATOM   3616 C C   . TYR B 1 124 ? 53.582 -12.331 -19.418 1.00 43.17  ? 484  TYR B C   1 
ATOM   3617 O O   . TYR B 1 124 ? 53.742 -13.454 -19.907 1.00 42.99  ? 484  TYR B O   1 
ATOM   3618 C CB  . TYR B 1 124 ? 53.936 -12.002 -17.009 1.00 41.90  ? 484  TYR B CB  1 
ATOM   3619 C CG  . TYR B 1 124 ? 54.881 -11.758 -15.861 1.00 40.61  ? 484  TYR B CG  1 
ATOM   3620 C CD1 . TYR B 1 124 ? 56.281 -11.884 -16.018 1.00 37.49  ? 484  TYR B CD1 1 
ATOM   3621 C CD2 . TYR B 1 124 ? 54.382 -11.436 -14.609 1.00 39.33  ? 484  TYR B CD2 1 
ATOM   3622 C CE1 . TYR B 1 124 ? 57.141 -11.646 -14.953 1.00 37.52  ? 484  TYR B CE1 1 
ATOM   3623 C CE2 . TYR B 1 124 ? 55.241 -11.224 -13.535 1.00 40.16  ? 484  TYR B CE2 1 
ATOM   3624 C CZ  . TYR B 1 124 ? 56.612 -11.309 -13.726 1.00 38.46  ? 484  TYR B CZ  1 
ATOM   3625 O OH  . TYR B 1 124 ? 57.421 -11.051 -12.667 1.00 41.03  ? 484  TYR B OH  1 
ATOM   3626 N N   . ALA B 1 125 ? 52.585 -11.501 -19.755 1.00 43.18  ? 485  ALA B N   1 
ATOM   3627 C CA  . ALA B 1 125 ? 51.575 -11.863 -20.724 1.00 42.88  ? 485  ALA B CA  1 
ATOM   3628 C C   . ALA B 1 125 ? 52.187 -12.130 -22.093 1.00 43.28  ? 485  ALA B C   1 
ATOM   3629 O O   . ALA B 1 125 ? 51.790 -13.075 -22.779 1.00 43.72  ? 485  ALA B O   1 
ATOM   3630 C CB  . ALA B 1 125 ? 50.491 -10.798 -20.811 1.00 43.07  ? 485  ALA B CB  1 
ATOM   3631 N N   . ALA B 1 126 ? 53.158 -11.312 -22.490 1.00 43.33  ? 486  ALA B N   1 
ATOM   3632 C CA  . ALA B 1 126 ? 53.841 -11.492 -23.771 1.00 42.83  ? 486  ALA B CA  1 
ATOM   3633 C C   . ALA B 1 126 ? 54.683 -12.782 -23.828 1.00 43.31  ? 486  ALA B C   1 
ATOM   3634 O O   . ALA B 1 126 ? 54.646 -13.502 -24.827 1.00 43.51  ? 486  ALA B O   1 
ATOM   3635 C CB  . ALA B 1 126 ? 54.683 -10.263 -24.105 1.00 42.48  ? 486  ALA B CB  1 
ATOM   3636 N N   . GLU B 1 127 ? 55.439 -13.071 -22.766 1.00 43.63  ? 487  GLU B N   1 
ATOM   3637 C CA  . GLU B 1 127 ? 56.220 -14.311 -22.699 1.00 44.58  ? 487  GLU B CA  1 
ATOM   3638 C C   . GLU B 1 127 ? 55.322 -15.560 -22.681 1.00 44.38  ? 487  GLU B C   1 
ATOM   3639 O O   . GLU B 1 127 ? 55.635 -16.548 -23.336 1.00 44.57  ? 487  GLU B O   1 
ATOM   3640 C CB  . GLU B 1 127 ? 57.214 -14.305 -21.518 1.00 44.32  ? 487  GLU B CB  1 
ATOM   3641 C CG  . GLU B 1 127 ? 58.271 -13.206 -21.610 1.00 44.95  ? 487  GLU B CG  1 
ATOM   3642 C CD  . GLU B 1 127 ? 59.572 -13.524 -20.861 1.00 46.34  ? 487  GLU B CD  1 
ATOM   3643 O OE1 . GLU B 1 127 ? 59.511 -14.134 -19.776 1.00 49.35  ? 487  GLU B OE1 1 
ATOM   3644 O OE2 . GLU B 1 127 ? 60.673 -13.151 -21.359 1.00 49.22  ? 487  GLU B OE2 1 
ATOM   3645 N N   . ILE B 1 128 ? 54.206 -15.498 -21.943 1.00 44.84  ? 488  ILE B N   1 
ATOM   3646 C CA  . ILE B 1 128 ? 53.183 -16.562 -21.926 1.00 44.16  ? 488  ILE B CA  1 
ATOM   3647 C C   . ILE B 1 128 ? 52.542 -16.797 -23.292 1.00 44.60  ? 488  ILE B C   1 
ATOM   3648 O O   . ILE B 1 128 ? 52.408 -17.941 -23.703 1.00 45.65  ? 488  ILE B O   1 
ATOM   3649 C CB  . ILE B 1 128 ? 52.131 -16.352 -20.806 1.00 44.97  ? 488  ILE B CB  1 
ATOM   3650 C CG1 . ILE B 1 128 ? 52.815 -16.438 -19.433 1.00 42.51  ? 488  ILE B CG1 1 
ATOM   3651 C CG2 . ILE B 1 128 ? 50.956 -17.388 -20.927 1.00 44.54  ? 488  ILE B CG2 1 
ATOM   3652 C CD1 . ILE B 1 128 ? 52.005 -15.862 -18.262 1.00 43.51  ? 488  ILE B CD1 1 
ATOM   3653 N N   . ILE B 1 129 ? 52.203 -15.735 -24.023 1.00 44.62  ? 489  ILE B N   1 
ATOM   3654 C CA  . ILE B 1 129 ? 51.743 -15.852 -25.420 1.00 44.06  ? 489  ILE B CA  1 
ATOM   3655 C C   . ILE B 1 129 ? 52.725 -16.637 -26.302 1.00 44.66  ? 489  ILE B C   1 
ATOM   3656 O O   . ILE B 1 129 ? 52.323 -17.482 -27.101 1.00 45.40  ? 489  ILE B O   1 
ATOM   3657 C CB  . ILE B 1 129 ? 51.438 -14.435 -26.061 1.00 44.08  ? 489  ILE B CB  1 
ATOM   3658 C CG1 . ILE B 1 129 ? 50.099 -13.898 -25.540 1.00 43.76  ? 489  ILE B CG1 1 
ATOM   3659 C CG2 . ILE B 1 129 ? 51.453 -14.470 -27.609 1.00 41.63  ? 489  ILE B CG2 1 
ATOM   3660 C CD1 . ILE B 1 129 ? 49.878 -12.393 -25.737 1.00 43.57  ? 489  ILE B CD1 1 
ATOM   3661 N N   . LEU B 1 130 ? 54.016 -16.354 -26.171 1.00 44.67  ? 490  LEU B N   1 
ATOM   3662 C CA  . LEU B 1 130 ? 55.030 -17.033 -26.979 1.00 44.10  ? 490  LEU B CA  1 
ATOM   3663 C C   . LEU B 1 130 ? 55.072 -18.545 -26.683 1.00 43.96  ? 490  LEU B C   1 
ATOM   3664 O O   . LEU B 1 130 ? 55.153 -19.354 -27.593 1.00 44.67  ? 490  LEU B O   1 
ATOM   3665 C CB  . LEU B 1 130 ? 56.419 -16.392 -26.752 1.00 43.24  ? 490  LEU B CB  1 
ATOM   3666 C CG  . LEU B 1 130 ? 56.704 -15.022 -27.387 1.00 43.79  ? 490  LEU B CG  1 
ATOM   3667 C CD1 . LEU B 1 130 ? 58.089 -14.478 -26.975 1.00 42.03  ? 490  LEU B CD1 1 
ATOM   3668 C CD2 . LEU B 1 130 ? 56.591 -15.065 -28.912 1.00 41.65  ? 490  LEU B CD2 1 
ATOM   3669 N N   . GLY B 1 131 ? 55.042 -18.903 -25.404 1.00 44.12  ? 491  GLY B N   1 
ATOM   3670 C CA  . GLY B 1 131 ? 55.012 -20.294 -24.958 1.00 44.41  ? 491  GLY B CA  1 
ATOM   3671 C C   . GLY B 1 131 ? 53.765 -21.049 -25.397 1.00 44.60  ? 491  GLY B C   1 
ATOM   3672 O O   . GLY B 1 131 ? 53.876 -22.193 -25.815 1.00 44.63  ? 491  GLY B O   1 
ATOM   3673 N N   . LEU B 1 132 ? 52.592 -20.408 -25.306 1.00 44.67  ? 492  LEU B N   1 
ATOM   3674 C CA  . LEU B 1 132 ? 51.305 -21.009 -25.736 1.00 45.16  ? 492  LEU B CA  1 
ATOM   3675 C C   . LEU B 1 132 ? 51.237 -21.226 -27.238 1.00 44.91  ? 492  LEU B C   1 
ATOM   3676 O O   . LEU B 1 132 ? 50.830 -22.300 -27.692 1.00 45.03  ? 492  LEU B O   1 
ATOM   3677 C CB  . LEU B 1 132 ? 50.103 -20.156 -25.298 1.00 45.05  ? 492  LEU B CB  1 
ATOM   3678 C CG  . LEU B 1 132 ? 49.692 -20.198 -23.827 1.00 46.94  ? 492  LEU B CG  1 
ATOM   3679 C CD1 . LEU B 1 132 ? 48.503 -19.252 -23.596 1.00 45.66  ? 492  LEU B CD1 1 
ATOM   3680 C CD2 . LEU B 1 132 ? 49.376 -21.674 -23.329 1.00 45.02  ? 492  LEU B CD2 1 
ATOM   3681 N N   . GLN B 1 133 ? 51.643 -20.204 -27.997 1.00 44.51  ? 493  GLN B N   1 
ATOM   3682 C CA  . GLN B 1 133 ? 51.722 -20.281 -29.458 1.00 44.41  ? 493  GLN B CA  1 
ATOM   3683 C C   . GLN B 1 133 ? 52.680 -21.348 -29.977 1.00 44.42  ? 493  GLN B C   1 
ATOM   3684 O O   . GLN B 1 133 ? 52.417 -21.960 -31.025 1.00 44.53  ? 493  GLN B O   1 
ATOM   3685 C CB  . GLN B 1 133 ? 52.082 -18.919 -30.067 1.00 43.87  ? 493  GLN B CB  1 
ATOM   3686 C CG  . GLN B 1 133 ? 50.970 -17.888 -29.947 1.00 44.43  ? 493  GLN B CG  1 
ATOM   3687 C CD  . GLN B 1 133 ? 51.275 -16.590 -30.694 1.00 44.50  ? 493  GLN B CD  1 
ATOM   3688 O OE1 . GLN B 1 133 ? 52.421 -16.125 -30.733 1.00 45.57  ? 493  GLN B OE1 1 
ATOM   3689 N NE2 . GLN B 1 133 ? 50.251 -16.001 -31.284 1.00 40.90  ? 493  GLN B NE2 1 
ATOM   3690 N N   . PHE B 1 134 ? 53.804 -21.543 -29.282 1.00 44.59  ? 494  PHE B N   1 
ATOM   3691 C CA  . PHE B 1 134 ? 54.721 -22.647 -29.612 1.00 44.88  ? 494  PHE B CA  1 
ATOM   3692 C C   . PHE B 1 134 ? 54.037 -24.005 -29.417 1.00 44.43  ? 494  PHE B C   1 
ATOM   3693 O O   . PHE B 1 134 ? 54.091 -24.869 -30.280 1.00 45.02  ? 494  PHE B O   1 
ATOM   3694 C CB  . PHE B 1 134 ? 55.993 -22.592 -28.757 1.00 44.90  ? 494  PHE B CB  1 
ATOM   3695 C CG  . PHE B 1 134 ? 56.842 -23.839 -28.848 1.00 44.77  ? 494  PHE B CG  1 
ATOM   3696 C CD1 . PHE B 1 134 ? 57.750 -24.002 -29.877 1.00 43.53  ? 494  PHE B CD1 1 
ATOM   3697 C CD2 . PHE B 1 134 ? 56.728 -24.848 -27.893 1.00 45.80  ? 494  PHE B CD2 1 
ATOM   3698 C CE1 . PHE B 1 134 ? 58.537 -25.146 -29.962 1.00 44.82  ? 494  PHE B CE1 1 
ATOM   3699 C CE2 . PHE B 1 134 ? 57.515 -26.012 -27.976 1.00 46.05  ? 494  PHE B CE2 1 
ATOM   3700 C CZ  . PHE B 1 134 ? 58.422 -26.150 -29.009 1.00 43.71  ? 494  PHE B CZ  1 
ATOM   3701 N N   . LEU B 1 135 ? 53.410 -24.168 -28.264 1.00 44.35  ? 495  LEU B N   1 
ATOM   3702 C CA  . LEU B 1 135 ? 52.655 -25.368 -27.923 1.00 44.17  ? 495  LEU B CA  1 
ATOM   3703 C C   . LEU B 1 135 ? 51.603 -25.657 -28.968 1.00 43.91  ? 495  LEU B C   1 
ATOM   3704 O O   . LEU B 1 135 ? 51.536 -26.773 -29.475 1.00 44.52  ? 495  LEU B O   1 
ATOM   3705 C CB  . LEU B 1 135 ? 52.006 -25.216 -26.547 1.00 43.74  ? 495  LEU B CB  1 
ATOM   3706 C CG  . LEU B 1 135 ? 52.902 -25.352 -25.316 1.00 43.66  ? 495  LEU B CG  1 
ATOM   3707 C CD1 . LEU B 1 135 ? 52.132 -24.949 -24.039 1.00 41.22  ? 495  LEU B CD1 1 
ATOM   3708 C CD2 . LEU B 1 135 ? 53.459 -26.773 -25.186 1.00 42.68  ? 495  LEU B CD2 1 
ATOM   3709 N N   . HIS B 1 136 ? 50.810 -24.645 -29.322 1.00 43.75  ? 496  HIS B N   1 
ATOM   3710 C CA  . HIS B 1 136 ? 49.769 -24.814 -30.337 1.00 43.51  ? 496  HIS B CA  1 
ATOM   3711 C C   . HIS B 1 136 ? 50.314 -25.226 -31.698 1.00 44.25  ? 496  HIS B C   1 
ATOM   3712 O O   . HIS B 1 136 ? 49.738 -26.108 -32.344 1.00 44.40  ? 496  HIS B O   1 
ATOM   3713 C CB  . HIS B 1 136 ? 48.838 -23.598 -30.423 1.00 42.88  ? 496  HIS B CB  1 
ATOM   3714 C CG  . HIS B 1 136 ? 48.168 -23.273 -29.124 1.00 42.09  ? 496  HIS B CG  1 
ATOM   3715 N ND1 . HIS B 1 136 ? 47.723 -22.007 -28.809 1.00 41.34  ? 496  HIS B ND1 1 
ATOM   3716 C CD2 . HIS B 1 136 ? 47.907 -24.043 -28.039 1.00 40.02  ? 496  HIS B CD2 1 
ATOM   3717 C CE1 . HIS B 1 136 ? 47.203 -22.018 -27.593 1.00 39.94  ? 496  HIS B CE1 1 
ATOM   3718 N NE2 . HIS B 1 136 ? 47.306 -23.240 -27.104 1.00 39.95  ? 496  HIS B NE2 1 
ATOM   3719 N N   . SER B 1 137 ? 51.424 -24.611 -32.128 1.00 44.92  ? 497  SER B N   1 
ATOM   3720 C CA  . SER B 1 137 ? 52.055 -24.974 -33.412 1.00 45.32  ? 497  SER B CA  1 
ATOM   3721 C C   . SER B 1 137 ? 52.450 -26.460 -33.472 1.00 45.42  ? 497  SER B C   1 
ATOM   3722 O O   . SER B 1 137 ? 52.561 -27.029 -34.552 1.00 46.03  ? 497  SER B O   1 
ATOM   3723 C CB  . SER B 1 137 ? 53.283 -24.100 -33.695 1.00 45.30  ? 497  SER B CB  1 
ATOM   3724 O OG  . SER B 1 137 ? 54.350 -24.444 -32.825 1.00 45.73  ? 497  SER B OG  1 
ATOM   3725 N N   . LYS B 1 138 ? 52.668 -27.062 -32.303 1.00 45.70  ? 498  LYS B N   1 
ATOM   3726 C CA  . LYS B 1 138 ? 53.010 -28.477 -32.167 1.00 46.04  ? 498  LYS B CA  1 
ATOM   3727 C C   . LYS B 1 138 ? 51.754 -29.350 -31.951 1.00 46.01  ? 498  LYS B C   1 
ATOM   3728 O O   . LYS B 1 138 ? 51.868 -30.553 -31.709 1.00 45.89  ? 498  LYS B O   1 
ATOM   3729 C CB  . LYS B 1 138 ? 53.972 -28.672 -30.990 1.00 46.13  ? 498  LYS B CB  1 
ATOM   3730 C CG  . LYS B 1 138 ? 55.301 -27.954 -31.118 1.00 47.08  ? 498  LYS B CG  1 
ATOM   3731 C CD  . LYS B 1 138 ? 56.282 -28.750 -31.976 1.00 47.76  ? 498  LYS B CD  1 
ATOM   3732 C CE  . LYS B 1 138 ? 57.633 -28.067 -31.994 1.00 49.87  ? 498  LYS B CE  1 
ATOM   3733 N NZ  . LYS B 1 138 ? 58.541 -28.686 -33.002 1.00 51.21  ? 498  LYS B NZ  1 
ATOM   3734 N N   . GLY B 1 139 ? 50.571 -28.730 -32.033 1.00 45.50  ? 499  GLY B N   1 
ATOM   3735 C CA  . GLY B 1 139 ? 49.295 -29.418 -31.844 1.00 44.57  ? 499  GLY B CA  1 
ATOM   3736 C C   . GLY B 1 139 ? 49.000 -29.763 -30.401 1.00 44.17  ? 499  GLY B C   1 
ATOM   3737 O O   . GLY B 1 139 ? 48.284 -30.714 -30.118 1.00 44.36  ? 499  GLY B O   1 
ATOM   3738 N N   . ILE B 1 140 ? 49.560 -28.995 -29.479 1.00 43.70  ? 500  ILE B N   1 
ATOM   3739 C CA  . ILE B 1 140 ? 49.315 -29.221 -28.066 1.00 43.44  ? 500  ILE B CA  1 
ATOM   3740 C C   . ILE B 1 140 ? 48.396 -28.133 -27.509 1.00 43.51  ? 500  ILE B C   1 
ATOM   3741 O O   . ILE B 1 140 ? 48.606 -26.940 -27.748 1.00 43.23  ? 500  ILE B O   1 
ATOM   3742 C CB  . ILE B 1 140 ? 50.637 -29.290 -27.255 1.00 43.25  ? 500  ILE B CB  1 
ATOM   3743 C CG1 . ILE B 1 140 ? 51.514 -30.439 -27.762 1.00 43.58  ? 500  ILE B CG1 1 
ATOM   3744 C CG2 . ILE B 1 140 ? 50.355 -29.429 -25.754 1.00 42.19  ? 500  ILE B CG2 1 
ATOM   3745 C CD1 . ILE B 1 140 ? 52.974 -30.206 -27.541 1.00 44.55  ? 500  ILE B CD1 1 
ATOM   3746 N N   . VAL B 1 141 ? 47.380 -28.575 -26.779 1.00 43.60  ? 501  VAL B N   1 
ATOM   3747 C CA  . VAL B 1 141 ? 46.525 -27.717 -25.976 1.00 43.65  ? 501  VAL B CA  1 
ATOM   3748 C C   . VAL B 1 141 ? 46.898 -27.962 -24.523 1.00 43.82  ? 501  VAL B C   1 
ATOM   3749 O O   . VAL B 1 141 ? 46.839 -29.092 -24.032 1.00 43.68  ? 501  VAL B O   1 
ATOM   3750 C CB  . VAL B 1 141 ? 45.025 -28.012 -26.220 1.00 43.84  ? 501  VAL B CB  1 
ATOM   3751 C CG1 . VAL B 1 141 ? 44.168 -26.953 -25.527 1.00 43.97  ? 501  VAL B CG1 1 
ATOM   3752 C CG2 . VAL B 1 141 ? 44.735 -27.995 -27.724 1.00 43.84  ? 501  VAL B CG2 1 
ATOM   3753 N N   . TYR B 1 142 ? 47.275 -26.889 -23.835 1.00 44.19  ? 502  TYR B N   1 
ATOM   3754 C CA  . TYR B 1 142 ? 47.864 -26.992 -22.518 1.00 44.51  ? 502  TYR B CA  1 
ATOM   3755 C C   . TYR B 1 142 ? 46.816 -27.266 -21.407 1.00 45.00  ? 502  TYR B C   1 
ATOM   3756 O O   . TYR B 1 142 ? 46.993 -28.166 -20.574 1.00 44.97  ? 502  TYR B O   1 
ATOM   3757 C CB  . TYR B 1 142 ? 48.735 -25.739 -22.278 1.00 45.00  ? 502  TYR B CB  1 
ATOM   3758 C CG  . TYR B 1 142 ? 49.311 -25.639 -20.888 1.00 45.11  ? 502  TYR B CG  1 
ATOM   3759 C CD1 . TYR B 1 142 ? 50.341 -26.491 -20.465 1.00 45.09  ? 502  TYR B CD1 1 
ATOM   3760 C CD2 . TYR B 1 142 ? 48.834 -24.692 -19.999 1.00 46.38  ? 502  TYR B CD2 1 
ATOM   3761 C CE1 . TYR B 1 142 ? 50.857 -26.405 -19.183 1.00 45.99  ? 502  TYR B CE1 1 
ATOM   3762 C CE2 . TYR B 1 142 ? 49.364 -24.582 -18.715 1.00 47.41  ? 502  TYR B CE2 1 
ATOM   3763 C CZ  . TYR B 1 142 ? 50.356 -25.441 -18.314 1.00 46.34  ? 502  TYR B CZ  1 
ATOM   3764 O OH  . TYR B 1 142 ? 50.832 -25.329 -17.041 1.00 46.34  ? 502  TYR B OH  1 
ATOM   3765 N N   . ARG B 1 143 ? 45.734 -26.486 -21.391 1.00 45.46  ? 503  ARG B N   1 
ATOM   3766 C CA  . ARG B 1 143 ? 44.557 -26.754 -20.557 1.00 47.56  ? 503  ARG B CA  1 
ATOM   3767 C C   . ARG B 1 143 ? 44.689 -26.507 -19.054 1.00 48.93  ? 503  ARG B C   1 
ATOM   3768 O O   . ARG B 1 143 ? 43.667 -26.497 -18.369 1.00 50.41  ? 503  ARG B O   1 
ATOM   3769 C CB  . ARG B 1 143 ? 43.944 -28.171 -20.792 1.00 47.52  ? 503  ARG B CB  1 
ATOM   3770 C CG  . ARG B 1 143 ? 43.549 -28.479 -22.239 1.00 47.51  ? 503  ARG B CG  1 
ATOM   3771 C CD  . ARG B 1 143 ? 42.624 -29.689 -22.340 1.00 47.83  ? 503  ARG B CD  1 
ATOM   3772 N NE  . ARG B 1 143 ? 43.305 -30.959 -22.095 1.00 47.36  ? 503  ARG B NE  1 
ATOM   3773 C CZ  . ARG B 1 143 ? 42.822 -32.157 -22.411 1.00 47.36  ? 503  ARG B CZ  1 
ATOM   3774 N NH1 . ARG B 1 143 ? 41.630 -32.269 -22.999 1.00 49.19  ? 503  ARG B NH1 1 
ATOM   3775 N NH2 . ARG B 1 143 ? 43.530 -33.251 -22.139 1.00 44.47  ? 503  ARG B NH2 1 
ATOM   3776 N N   . ASP B 1 144 ? 45.898 -26.316 -18.531 1.00 49.77  ? 504  ASP B N   1 
ATOM   3777 C CA  . ASP B 1 144 ? 46.072 -26.062 -17.081 1.00 50.55  ? 504  ASP B CA  1 
ATOM   3778 C C   . ASP B 1 144 ? 46.643 -24.644 -16.733 1.00 50.54  ? 504  ASP B C   1 
ATOM   3779 O O   . ASP B 1 144 ? 47.309 -24.485 -15.719 1.00 50.57  ? 504  ASP B O   1 
ATOM   3780 C CB  . ASP B 1 144 ? 46.944 -27.168 -16.442 1.00 50.61  ? 504  ASP B CB  1 
ATOM   3781 C CG  . ASP B 1 144 ? 46.692 -27.336 -14.920 1.00 54.20  ? 504  ASP B CG  1 
ATOM   3782 O OD1 . ASP B 1 144 ? 45.621 -26.882 -14.442 1.00 54.97  ? 504  ASP B OD1 1 
ATOM   3783 O OD2 . ASP B 1 144 ? 47.558 -27.939 -14.207 1.00 55.49  ? 504  ASP B OD2 1 
ATOM   3784 N N   . LEU B 1 145 ? 46.412 -23.632 -17.565 1.00 50.49  ? 505  LEU B N   1 
ATOM   3785 C CA  . LEU B 1 145 ? 46.934 -22.293 -17.254 1.00 51.70  ? 505  LEU B CA  1 
ATOM   3786 C C   . LEU B 1 145 ? 46.391 -21.755 -15.959 1.00 51.99  ? 505  LEU B C   1 
ATOM   3787 O O   . LEU B 1 145 ? 45.178 -21.737 -15.743 1.00 53.36  ? 505  LEU B O   1 
ATOM   3788 C CB  . LEU B 1 145 ? 46.626 -21.281 -18.343 1.00 52.29  ? 505  LEU B CB  1 
ATOM   3789 C CG  . LEU B 1 145 ? 47.672 -20.821 -19.333 1.00 52.09  ? 505  LEU B CG  1 
ATOM   3790 C CD1 . LEU B 1 145 ? 47.133 -19.541 -19.880 1.00 53.36  ? 505  LEU B CD1 1 
ATOM   3791 C CD2 . LEU B 1 145 ? 49.063 -20.580 -18.720 1.00 52.16  ? 505  LEU B CD2 1 
ATOM   3792 N N   . LYS B 1 146 ? 47.305 -21.352 -15.085 1.00 51.59  ? 506  LYS B N   1 
ATOM   3793 C CA  . LYS B 1 146 ? 46.982 -20.769 -13.784 1.00 51.15  ? 506  LYS B CA  1 
ATOM   3794 C C   . LYS B 1 146 ? 48.275 -20.192 -13.259 1.00 50.67  ? 506  LYS B C   1 
ATOM   3795 O O   . LYS B 1 146 ? 49.345 -20.594 -13.698 1.00 50.07  ? 506  LYS B O   1 
ATOM   3796 C CB  . LYS B 1 146 ? 46.360 -21.784 -12.796 1.00 50.85  ? 506  LYS B CB  1 
ATOM   3797 C CG  . LYS B 1 146 ? 47.219 -22.969 -12.393 1.00 51.00  ? 506  LYS B CG  1 
ATOM   3798 C CD  . LYS B 1 146 ? 46.371 -24.019 -11.673 1.00 51.46  ? 506  LYS B CD  1 
ATOM   3799 C CE  . LYS B 1 146 ? 47.232 -25.168 -11.205 1.00 53.13  ? 506  LYS B CE  1 
ATOM   3800 N NZ  . LYS B 1 146 ? 46.468 -26.152 -10.379 1.00 52.63  ? 506  LYS B NZ  1 
ATOM   3801 N N   . LEU B 1 147 ? 48.160 -19.237 -12.346 1.00 50.60  ? 507  LEU B N   1 
ATOM   3802 C CA  . LEU B 1 147 ? 49.302 -18.527 -11.799 1.00 50.42  ? 507  LEU B CA  1 
ATOM   3803 C C   . LEU B 1 147 ? 50.327 -19.450 -11.169 1.00 49.84  ? 507  LEU B C   1 
ATOM   3804 O O   . LEU B 1 147 ? 51.521 -19.202 -11.290 1.00 48.85  ? 507  LEU B O   1 
ATOM   3805 C CB  . LEU B 1 147 ? 48.858 -17.480 -10.774 1.00 50.03  ? 507  LEU B CB  1 
ATOM   3806 C CG  . LEU B 1 147 ? 48.281 -16.162 -11.307 1.00 52.20  ? 507  LEU B CG  1 
ATOM   3807 C CD1 . LEU B 1 147 ? 47.766 -15.320 -10.139 1.00 50.32  ? 507  LEU B CD1 1 
ATOM   3808 C CD2 . LEU B 1 147 ? 49.282 -15.407 -12.169 1.00 49.75  ? 507  LEU B CD2 1 
ATOM   3809 N N   . ASP B 1 148 ? 49.836 -20.479 -10.482 1.00 49.31  ? 508  ASP B N   1 
ATOM   3810 C CA  . ASP B 1 148 ? 50.667 -21.465 -9.786  1.00 49.92  ? 508  ASP B CA  1 
ATOM   3811 C C   . ASP B 1 148 ? 51.590 -22.274 -10.726 1.00 48.66  ? 508  ASP B C   1 
ATOM   3812 O O   . ASP B 1 148 ? 52.598 -22.808 -10.286 1.00 48.10  ? 508  ASP B O   1 
ATOM   3813 C CB  . ASP B 1 148 ? 49.807 -22.482 -9.007  1.00 50.63  ? 508  ASP B CB  1 
ATOM   3814 C CG  . ASP B 1 148 ? 48.569 -21.883 -8.367  1.00 55.13  ? 508  ASP B CG  1 
ATOM   3815 O OD1 . ASP B 1 148 ? 48.401 -22.203 -7.161  1.00 59.23  ? 508  ASP B OD1 1 
ATOM   3816 O OD2 . ASP B 1 148 ? 47.746 -21.151 -9.034  1.00 57.72  ? 508  ASP B OD2 1 
ATOM   3817 N N   . ASN B 1 149 ? 51.210 -22.384 -11.994 1.00 47.78  ? 509  ASN B N   1 
ATOM   3818 C CA  . ASN B 1 149 ? 51.991 -23.099 -13.007 1.00 47.39  ? 509  ASN B CA  1 
ATOM   3819 C C   . ASN B 1 149 ? 52.975 -22.229 -13.785 1.00 47.26  ? 509  ASN B C   1 
ATOM   3820 O O   . ASN B 1 149 ? 53.637 -22.701 -14.705 1.00 47.03  ? 509  ASN B O   1 
ATOM   3821 C CB  . ASN B 1 149 ? 51.049 -23.820 -13.984 1.00 47.35  ? 509  ASN B CB  1 
ATOM   3822 C CG  . ASN B 1 149 ? 50.421 -25.064 -13.364 1.00 46.00  ? 509  ASN B CG  1 
ATOM   3823 O OD1 . ASN B 1 149 ? 50.807 -25.484 -12.276 1.00 43.26  ? 509  ASN B OD1 1 
ATOM   3824 N ND2 . ASN B 1 149 ? 49.460 -25.658 -14.062 1.00 45.03  ? 509  ASN B ND2 1 
ATOM   3825 N N   . ILE B 1 150 ? 53.070 -20.954 -13.425 1.00 47.07  ? 510  ILE B N   1 
ATOM   3826 C CA  . ILE B 1 150 ? 54.066 -20.085 -14.051 1.00 46.06  ? 510  ILE B CA  1 
ATOM   3827 C C   . ILE B 1 150 ? 55.199 -19.801 -13.076 1.00 45.69  ? 510  ILE B C   1 
ATOM   3828 O O   . ILE B 1 150 ? 54.991 -19.191 -12.031 1.00 45.53  ? 510  ILE B O   1 
ATOM   3829 C CB  . ILE B 1 150 ? 53.467 -18.787 -14.621 1.00 46.10  ? 510  ILE B CB  1 
ATOM   3830 C CG1 . ILE B 1 150 ? 52.103 -19.050 -15.316 1.00 45.75  ? 510  ILE B CG1 1 
ATOM   3831 C CG2 . ILE B 1 150 ? 54.490 -18.103 -15.544 1.00 44.19  ? 510  ILE B CG2 1 
ATOM   3832 C CD1 . ILE B 1 150 ? 52.193 -19.574 -16.747 1.00 45.87  ? 510  ILE B CD1 1 
ATOM   3833 N N   . LEU B 1 151 ? 56.384 -20.309 -13.406 1.00 44.96  ? 511  LEU B N   1 
ATOM   3834 C CA  . LEU B 1 151 ? 57.571 -20.117 -12.576 1.00 44.48  ? 511  LEU B CA  1 
ATOM   3835 C C   . LEU B 1 151 ? 58.397 -18.995 -13.160 1.00 43.88  ? 511  LEU B C   1 
ATOM   3836 O O   . LEU B 1 151 ? 58.312 -18.703 -14.362 1.00 44.03  ? 511  LEU B O   1 
ATOM   3837 C CB  . LEU B 1 151 ? 58.433 -21.399 -12.522 1.00 44.91  ? 511  LEU B CB  1 
ATOM   3838 C CG  . LEU B 1 151 ? 57.952 -22.653 -11.780 1.00 45.61  ? 511  LEU B CG  1 
ATOM   3839 C CD1 . LEU B 1 151 ? 58.924 -23.829 -11.983 1.00 42.94  ? 511  LEU B CD1 1 
ATOM   3840 C CD2 . LEU B 1 151 ? 57.776 -22.396 -10.275 1.00 46.28  ? 511  LEU B CD2 1 
ATOM   3841 N N   . LEU B 1 152 ? 59.202 -18.368 -12.316 1.00 43.41  ? 512  LEU B N   1 
ATOM   3842 C CA  . LEU B 1 152 ? 60.277 -17.500 -12.813 1.00 42.79  ? 512  LEU B CA  1 
ATOM   3843 C C   . LEU B 1 152 ? 61.647 -18.176 -12.726 1.00 43.08  ? 512  LEU B C   1 
ATOM   3844 O O   . LEU B 1 152 ? 61.926 -18.903 -11.779 1.00 41.01  ? 512  LEU B O   1 
ATOM   3845 C CB  . LEU B 1 152 ? 60.294 -16.145 -12.077 1.00 41.57  ? 512  LEU B CB  1 
ATOM   3846 C CG  . LEU B 1 152 ? 59.014 -15.291 -12.077 1.00 43.03  ? 512  LEU B CG  1 
ATOM   3847 C CD1 . LEU B 1 152 ? 59.197 -13.964 -11.338 1.00 40.80  ? 512  LEU B CD1 1 
ATOM   3848 C CD2 . LEU B 1 152 ? 58.446 -15.050 -13.474 1.00 42.37  ? 512  LEU B CD2 1 
ATOM   3849 N N   . ASP B 1 153 ? 62.454 -17.951 -13.770 1.00 44.43  ? 513  ASP B N   1 
ATOM   3850 C CA  . ASP B 1 153 ? 63.919 -17.954 -13.739 1.00 46.57  ? 513  ASP B CA  1 
ATOM   3851 C C   . ASP B 1 153 ? 64.506 -17.151 -12.615 1.00 46.73  ? 513  ASP B C   1 
ATOM   3852 O O   . ASP B 1 153 ? 63.847 -16.257 -12.084 1.00 46.88  ? 513  ASP B O   1 
ATOM   3853 C CB  . ASP B 1 153 ? 64.452 -17.167 -14.960 1.00 47.81  ? 513  ASP B CB  1 
ATOM   3854 C CG  . ASP B 1 153 ? 64.749 -18.036 -16.083 1.00 51.02  ? 513  ASP B CG  1 
ATOM   3855 O OD1 . ASP B 1 153 ? 64.650 -19.272 -15.845 1.00 57.40  ? 513  ASP B OD1 1 
ATOM   3856 O OD2 . ASP B 1 153 ? 65.075 -17.514 -17.174 1.00 51.52  ? 513  ASP B OD2 1 
ATOM   3857 N N   . LYS B 1 154 ? 65.795 -17.390 -12.370 1.00 46.76  ? 514  LYS B N   1 
ATOM   3858 C CA  . LYS B 1 154 ? 66.615 -16.535 -11.530 1.00 47.78  ? 514  LYS B CA  1 
ATOM   3859 C C   . LYS B 1 154 ? 66.721 -15.108 -12.095 1.00 46.93  ? 514  LYS B C   1 
ATOM   3860 O O   . LYS B 1 154 ? 66.913 -14.173 -11.329 1.00 47.74  ? 514  LYS B O   1 
ATOM   3861 C CB  . LYS B 1 154 ? 68.007 -17.152 -11.314 1.00 47.33  ? 514  LYS B CB  1 
ATOM   3862 C CG  . LYS B 1 154 ? 68.920 -17.115 -12.543 1.00 48.94  ? 514  LYS B CG  1 
ATOM   3863 C CD  . LYS B 1 154 ? 70.031 -18.159 -12.487 1.00 50.55  ? 514  LYS B CD  1 
ATOM   3864 C CE  . LYS B 1 154 ? 71.051 -17.869 -11.390 1.00 55.26  ? 514  LYS B CE  1 
ATOM   3865 N NZ  . LYS B 1 154 ? 71.715 -19.136 -10.919 1.00 56.87  ? 514  LYS B NZ  1 
ATOM   3866 N N   . ASP B 1 155 ? 66.598 -14.948 -13.417 1.00 46.47  ? 515  ASP B N   1 
ATOM   3867 C CA  . ASP B 1 155 ? 66.586 -13.615 -14.061 1.00 46.23  ? 515  ASP B CA  1 
ATOM   3868 C C   . ASP B 1 155 ? 65.215 -12.923 -14.174 1.00 45.54  ? 515  ASP B C   1 
ATOM   3869 O O   . ASP B 1 155 ? 65.145 -11.726 -14.459 1.00 45.43  ? 515  ASP B O   1 
ATOM   3870 C CB  . ASP B 1 155 ? 67.201 -13.689 -15.452 1.00 46.67  ? 515  ASP B CB  1 
ATOM   3871 C CG  . ASP B 1 155 ? 68.607 -14.278 -15.444 1.00 50.24  ? 515  ASP B CG  1 
ATOM   3872 O OD1 . ASP B 1 155 ? 69.489 -13.793 -14.663 1.00 50.44  ? 515  ASP B OD1 1 
ATOM   3873 O OD2 . ASP B 1 155 ? 68.816 -15.236 -16.229 1.00 52.97  ? 515  ASP B OD2 1 
ATOM   3874 N N   . GLY B 1 156 ? 64.132 -13.670 -13.976 1.00 44.63  ? 516  GLY B N   1 
ATOM   3875 C CA  . GLY B 1 156 ? 62.797 -13.093 -14.016 1.00 43.57  ? 516  GLY B CA  1 
ATOM   3876 C C   . GLY B 1 156 ? 61.998 -13.408 -15.263 1.00 43.44  ? 516  GLY B C   1 
ATOM   3877 O O   . GLY B 1 156 ? 60.914 -12.872 -15.430 1.00 43.82  ? 516  GLY B O   1 
ATOM   3878 N N   . HIS B 1 157 ? 62.540 -14.246 -16.147 1.00 42.96  ? 517  HIS B N   1 
ATOM   3879 C CA  . HIS B 1 157 ? 61.783 -14.807 -17.283 1.00 43.35  ? 517  HIS B CA  1 
ATOM   3880 C C   . HIS B 1 157 ? 60.837 -15.940 -16.888 1.00 43.47  ? 517  HIS B C   1 
ATOM   3881 O O   . HIS B 1 157 ? 61.126 -16.691 -15.963 1.00 42.75  ? 517  HIS B O   1 
ATOM   3882 C CB  . HIS B 1 157 ? 62.731 -15.290 -18.381 1.00 42.40  ? 517  HIS B CB  1 
ATOM   3883 C CG  . HIS B 1 157 ? 63.450 -14.172 -19.047 1.00 44.57  ? 517  HIS B CG  1 
ATOM   3884 N ND1 . HIS B 1 157 ? 64.760 -13.845 -18.749 1.00 46.32  ? 517  HIS B ND1 1 
ATOM   3885 C CD2 . HIS B 1 157 ? 63.026 -13.260 -19.950 1.00 41.79  ? 517  HIS B CD2 1 
ATOM   3886 C CE1 . HIS B 1 157 ? 65.117 -12.795 -19.464 1.00 44.59  ? 517  HIS B CE1 1 
ATOM   3887 N NE2 . HIS B 1 157 ? 64.080 -12.417 -20.192 1.00 44.63  ? 517  HIS B NE2 1 
ATOM   3888 N N   . ILE B 1 158 ? 59.713 -16.045 -17.595 1.00 44.31  ? 518  ILE B N   1 
ATOM   3889 C CA  . ILE B 1 158 ? 58.691 -17.016 -17.243 1.00 45.07  ? 518  ILE B CA  1 
ATOM   3890 C C   . ILE B 1 158 ? 59.016 -18.432 -17.733 1.00 45.35  ? 518  ILE B C   1 
ATOM   3891 O O   . ILE B 1 158 ? 59.693 -18.613 -18.764 1.00 45.05  ? 518  ILE B O   1 
ATOM   3892 C CB  . ILE B 1 158 ? 57.229 -16.608 -17.693 1.00 45.49  ? 518  ILE B CB  1 
ATOM   3893 C CG1 . ILE B 1 158 ? 57.008 -16.765 -19.191 1.00 45.79  ? 518  ILE B CG1 1 
ATOM   3894 C CG2 . ILE B 1 158 ? 56.783 -15.246 -17.138 1.00 45.87  ? 518  ILE B CG2 1 
ATOM   3895 C CD1 . ILE B 1 158 ? 56.144 -18.011 -19.576 1.00 43.40  ? 518  ILE B CD1 1 
ATOM   3896 N N   . LYS B 1 159 ? 58.543 -19.410 -16.954 1.00 44.89  ? 519  LYS B N   1 
ATOM   3897 C CA  . LYS B 1 159 ? 58.536 -20.827 -17.323 1.00 44.94  ? 519  LYS B CA  1 
ATOM   3898 C C   . LYS B 1 159 ? 57.162 -21.415 -17.080 1.00 44.77  ? 519  LYS B C   1 
ATOM   3899 O O   . LYS B 1 159 ? 56.697 -21.490 -15.939 1.00 44.47  ? 519  LYS B O   1 
ATOM   3900 C CB  . LYS B 1 159 ? 59.554 -21.600 -16.497 1.00 44.90  ? 519  LYS B CB  1 
ATOM   3901 C CG  . LYS B 1 159 ? 61.011 -21.228 -16.788 1.00 44.31  ? 519  LYS B CG  1 
ATOM   3902 C CD  . LYS B 1 159 ? 61.409 -21.809 -18.097 1.00 44.85  ? 519  LYS B CD  1 
ATOM   3903 C CE  . LYS B 1 159 ? 62.916 -21.699 -18.338 1.00 45.37  ? 519  LYS B CE  1 
ATOM   3904 N NZ  . LYS B 1 159 ? 63.213 -22.389 -19.621 1.00 44.12  ? 519  LYS B NZ  1 
ATOM   3905 N N   . ILE B 1 160 ? 56.497 -21.805 -18.161 1.00 44.96  ? 520  ILE B N   1 
ATOM   3906 C CA  . ILE B 1 160 ? 55.278 -22.623 -18.051 1.00 44.07  ? 520  ILE B CA  1 
ATOM   3907 C C   . ILE B 1 160 ? 55.655 -24.033 -17.607 1.00 43.31  ? 520  ILE B C   1 
ATOM   3908 O O   . ILE B 1 160 ? 56.469 -24.685 -18.259 1.00 43.30  ? 520  ILE B O   1 
ATOM   3909 C CB  . ILE B 1 160 ? 54.512 -22.665 -19.387 1.00 44.31  ? 520  ILE B CB  1 
ATOM   3910 C CG1 . ILE B 1 160 ? 54.276 -21.230 -19.904 1.00 44.28  ? 520  ILE B CG1 1 
ATOM   3911 C CG2 . ILE B 1 160 ? 53.209 -23.482 -19.248 1.00 43.01  ? 520  ILE B CG2 1 
ATOM   3912 C CD1 . ILE B 1 160 ? 53.471 -21.150 -21.181 1.00 45.37  ? 520  ILE B CD1 1 
ATOM   3913 N N   . ALA B 1 161 ? 55.074 -24.478 -16.490 1.00 42.79  ? 521  ALA B N   1 
ATOM   3914 C CA  . ALA B 1 161 ? 55.353 -25.772 -15.877 1.00 42.52  ? 521  ALA B CA  1 
ATOM   3915 C C   . ALA B 1 161 ? 54.106 -26.646 -15.875 1.00 43.27  ? 521  ALA B C   1 
ATOM   3916 O O   . ALA B 1 161 ? 53.011 -26.136 -16.092 1.00 43.42  ? 521  ALA B O   1 
ATOM   3917 C CB  . ALA B 1 161 ? 55.859 -25.583 -14.445 1.00 41.90  ? 521  ALA B CB  1 
ATOM   3918 N N   . ASP B 1 162 ? 54.292 -27.956 -15.639 1.00 43.63  ? 522  ASP B N   1 
ATOM   3919 C CA  . ASP B 1 162 ? 53.213 -28.955 -15.439 1.00 43.71  ? 522  ASP B CA  1 
ATOM   3920 C C   . ASP B 1 162 ? 52.398 -29.274 -16.687 1.00 43.22  ? 522  ASP B C   1 
ATOM   3921 O O   . ASP B 1 162 ? 51.346 -28.681 -16.934 1.00 43.50  ? 522  ASP B O   1 
ATOM   3922 C CB  . ASP B 1 162 ? 52.257 -28.561 -14.298 1.00 44.68  ? 522  ASP B CB  1 
ATOM   3923 C CG  . ASP B 1 162 ? 51.560 -29.771 -13.652 1.00 46.23  ? 522  ASP B CG  1 
ATOM   3924 O OD1 . ASP B 1 162 ? 51.394 -30.830 -14.294 1.00 48.18  ? 522  ASP B OD1 1 
ATOM   3925 O OD2 . ASP B 1 162 ? 51.188 -29.668 -12.467 1.00 49.37  ? 522  ASP B OD2 1 
ATOM   3926 N N   . PHE B 1 163 ? 52.846 -30.262 -17.438 1.00 42.31  ? 523  PHE B N   1 
ATOM   3927 C CA  . PHE B 1 163 ? 52.157 -30.607 -18.677 1.00 42.71  ? 523  PHE B CA  1 
ATOM   3928 C C   . PHE B 1 163 ? 51.271 -31.840 -18.539 1.00 42.43  ? 523  PHE B C   1 
ATOM   3929 O O   . PHE B 1 163 ? 50.960 -32.470 -19.524 1.00 42.48  ? 523  PHE B O   1 
ATOM   3930 C CB  . PHE B 1 163 ? 53.152 -30.679 -19.847 1.00 42.06  ? 523  PHE B CB  1 
ATOM   3931 C CG  . PHE B 1 163 ? 53.918 -29.392 -20.028 1.00 42.02  ? 523  PHE B CG  1 
ATOM   3932 C CD1 . PHE B 1 163 ? 55.104 -29.173 -19.336 1.00 40.45  ? 523  PHE B CD1 1 
ATOM   3933 C CD2 . PHE B 1 163 ? 53.407 -28.368 -20.821 1.00 41.14  ? 523  PHE B CD2 1 
ATOM   3934 C CE1 . PHE B 1 163 ? 55.803 -27.965 -19.471 1.00 42.80  ? 523  PHE B CE1 1 
ATOM   3935 C CE2 . PHE B 1 163 ? 54.094 -27.169 -20.960 1.00 42.57  ? 523  PHE B CE2 1 
ATOM   3936 C CZ  . PHE B 1 163 ? 55.299 -26.965 -20.283 1.00 41.24  ? 523  PHE B CZ  1 
ATOM   3937 N N   . GLY B 1 164 ? 50.841 -32.112 -17.310 1.00 43.13  ? 524  GLY B N   1 
ATOM   3938 C CA  . GLY B 1 164 ? 49.958 -33.228 -16.964 1.00 45.93  ? 524  GLY B CA  1 
ATOM   3939 C C   . GLY B 1 164 ? 48.531 -33.266 -17.482 1.00 47.74  ? 524  GLY B C   1 
ATOM   3940 O O   . GLY B 1 164 ? 47.908 -34.319 -17.452 1.00 48.41  ? 524  GLY B O   1 
ATOM   3941 N N   . MET B 1 165 ? 48.008 -32.128 -17.934 1.00 49.47  ? 525  MET B N   1 
ATOM   3942 C CA  . MET B 1 165 ? 46.665 -32.023 -18.502 1.00 52.90  ? 525  MET B CA  1 
ATOM   3943 C C   . MET B 1 165 ? 46.633 -31.771 -20.010 1.00 51.20  ? 525  MET B C   1 
ATOM   3944 O O   . MET B 1 165 ? 45.573 -31.497 -20.556 1.00 51.38  ? 525  MET B O   1 
ATOM   3945 C CB  . MET B 1 165 ? 45.856 -30.927 -17.786 1.00 52.25  ? 525  MET B CB  1 
ATOM   3946 C CG  . MET B 1 165 ? 44.877 -31.466 -16.721 1.00 57.25  ? 525  MET B CG  1 
ATOM   3947 S SD  . MET B 1 165 ? 44.263 -30.128 -15.661 1.00 62.39  ? 525  MET B SD  1 
ATOM   3948 C CE  . MET B 1 165 ? 43.539 -29.069 -16.917 1.00 63.67  ? 525  MET B CE  1 
ATOM   3949 N N   . CYS B 1 166 ? 47.784 -31.861 -20.675 1.00 50.80  ? 526  CYS B N   1 
ATOM   3950 C CA  . CYS B 1 166 ? 47.897 -31.599 -22.117 1.00 50.73  ? 526  CYS B CA  1 
ATOM   3951 C C   . CYS B 1 166 ? 47.124 -32.568 -23.029 1.00 50.88  ? 526  CYS B C   1 
ATOM   3952 O O   . CYS B 1 166 ? 47.026 -33.778 -22.739 1.00 50.19  ? 526  CYS B O   1 
ATOM   3953 C CB  . CYS B 1 166 ? 49.366 -31.599 -22.537 1.00 50.71  ? 526  CYS B CB  1 
ATOM   3954 S SG  . CYS B 1 166 ? 50.266 -30.087 -22.116 1.00 52.20  ? 526  CYS B SG  1 
ATOM   3955 N N   . LYS B 1 167 ? 46.586 -32.019 -24.124 1.00 51.01  ? 527  LYS B N   1 
ATOM   3956 C CA  . LYS B 1 167 ? 46.026 -32.803 -25.229 1.00 51.70  ? 527  LYS B CA  1 
ATOM   3957 C C   . LYS B 1 167 ? 46.899 -32.670 -26.473 1.00 52.37  ? 527  LYS B C   1 
ATOM   3958 O O   . LYS B 1 167 ? 47.194 -31.561 -26.917 1.00 52.24  ? 527  LYS B O   1 
ATOM   3959 C CB  . LYS B 1 167 ? 44.593 -32.361 -25.547 1.00 51.46  ? 527  LYS B CB  1 
ATOM   3960 C CG  . LYS B 1 167 ? 43.797 -33.340 -26.417 1.00 52.78  ? 527  LYS B CG  1 
ATOM   3961 C CD  . LYS B 1 167 ? 43.727 -34.739 -25.796 1.00 53.69  ? 527  LYS B CD  1 
ATOM   3962 C CE  . LYS B 1 167 ? 42.710 -35.639 -26.483 1.00 56.09  ? 527  LYS B CE  1 
ATOM   3963 N NZ  . LYS B 1 167 ? 43.137 -36.088 -27.838 1.00 58.53  ? 527  LYS B NZ  1 
ATOM   3964 N N   . GLU B 1 168 ? 47.306 -33.805 -27.031 1.00 53.67  ? 528  GLU B N   1 
ATOM   3965 C CA  . GLU B 1 168 ? 48.135 -33.844 -28.237 1.00 54.77  ? 528  GLU B CA  1 
ATOM   3966 C C   . GLU B 1 168 ? 47.297 -33.970 -29.511 1.00 55.17  ? 528  GLU B C   1 
ATOM   3967 O O   . GLU B 1 168 ? 46.066 -34.078 -29.447 1.00 54.62  ? 528  GLU B O   1 
ATOM   3968 C CB  . GLU B 1 168 ? 49.102 -35.017 -28.171 1.00 54.54  ? 528  GLU B CB  1 
ATOM   3969 C CG  . GLU B 1 168 ? 50.149 -34.946 -27.076 1.00 55.72  ? 528  GLU B CG  1 
ATOM   3970 C CD  . GLU B 1 168 ? 50.927 -36.257 -26.967 1.00 56.42  ? 528  GLU B CD  1 
ATOM   3971 O OE1 . GLU B 1 168 ? 50.291 -37.340 -26.961 1.00 58.75  ? 528  GLU B OE1 1 
ATOM   3972 O OE2 . GLU B 1 168 ? 52.173 -36.206 -26.888 1.00 58.75  ? 528  GLU B OE2 1 
ATOM   3973 N N   . ASN B 1 169 ? 47.986 -33.955 -30.659 1.00 56.14  ? 529  ASN B N   1 
ATOM   3974 C CA  . ASN B 1 169 ? 47.384 -34.123 -31.990 1.00 57.19  ? 529  ASN B CA  1 
ATOM   3975 C C   . ASN B 1 169 ? 46.219 -33.171 -32.281 1.00 58.12  ? 529  ASN B C   1 
ATOM   3976 O O   . ASN B 1 169 ? 45.185 -33.571 -32.818 1.00 58.18  ? 529  ASN B O   1 
ATOM   3977 C CB  . ASN B 1 169 ? 46.981 -35.585 -32.217 1.00 57.22  ? 529  ASN B CB  1 
ATOM   3978 C CG  . ASN B 1 169 ? 48.096 -36.551 -31.874 1.00 57.07  ? 529  ASN B CG  1 
ATOM   3979 O OD1 . ASN B 1 169 ? 49.165 -36.517 -32.475 1.00 57.72  ? 529  ASN B OD1 1 
ATOM   3980 N ND2 . ASN B 1 169 ? 47.855 -37.407 -30.892 1.00 56.34  ? 529  ASN B ND2 1 
ATOM   3981 N N   . MET B 1 170 ? 46.411 -31.904 -31.935 1.00 59.28  ? 530  MET B N   1 
ATOM   3982 C CA  . MET B 1 170 ? 45.359 -30.898 -32.033 1.00 60.49  ? 530  MET B CA  1 
ATOM   3983 C C   . MET B 1 170 ? 45.573 -29.913 -33.185 1.00 61.18  ? 530  MET B C   1 
ATOM   3984 O O   . MET B 1 170 ? 45.318 -28.717 -33.047 1.00 61.77  ? 530  MET B O   1 
ATOM   3985 C CB  . MET B 1 170 ? 45.215 -30.157 -30.697 1.00 60.34  ? 530  MET B CB  1 
ATOM   3986 C CG  . MET B 1 170 ? 44.683 -31.036 -29.571 1.00 60.75  ? 530  MET B CG  1 
ATOM   3987 S SD  . MET B 1 170 ? 43.023 -31.670 -29.902 1.00 60.40  ? 530  MET B SD  1 
ATOM   3988 C CE  . MET B 1 170 ? 42.096 -30.138 -29.799 1.00 60.52  ? 530  MET B CE  1 
ATOM   3989 N N   . LEU B 1 171 ? 46.022 -30.423 -34.325 1.00 62.05  ? 531  LEU B N   1 
ATOM   3990 C CA  . LEU B 1 171 ? 46.277 -29.581 -35.492 1.00 62.86  ? 531  LEU B CA  1 
ATOM   3991 C C   . LEU B 1 171 ? 45.086 -29.593 -36.445 1.00 63.40  ? 531  LEU B C   1 
ATOM   3992 O O   . LEU B 1 171 ? 44.320 -30.561 -36.465 1.00 63.74  ? 531  LEU B O   1 
ATOM   3993 C CB  . LEU B 1 171 ? 47.554 -30.041 -36.206 1.00 62.90  ? 531  LEU B CB  1 
ATOM   3994 C CG  . LEU B 1 171 ? 48.846 -29.967 -35.383 1.00 63.05  ? 531  LEU B CG  1 
ATOM   3995 C CD1 . LEU B 1 171 ? 49.831 -31.055 -35.794 1.00 63.24  ? 531  LEU B CD1 1 
ATOM   3996 C CD2 . LEU B 1 171 ? 49.485 -28.571 -35.455 1.00 63.09  ? 531  LEU B CD2 1 
ATOM   3997 N N   . GLY B 1 172 ? 44.934 -28.513 -37.218 1.00 63.97  ? 532  GLY B N   1 
ATOM   3998 C CA  . GLY B 1 172 ? 43.917 -28.413 -38.286 1.00 64.44  ? 532  GLY B CA  1 
ATOM   3999 C C   . GLY B 1 172 ? 42.481 -28.593 -37.814 1.00 64.75  ? 532  GLY B C   1 
ATOM   4000 O O   . GLY B 1 172 ? 42.003 -27.858 -36.952 1.00 64.70  ? 532  GLY B O   1 
ATOM   4001 N N   . ASP B 1 173 ? 41.804 -29.585 -38.385 1.00 65.01  ? 533  ASP B N   1 
ATOM   4002 C CA  . ASP B 1 173 ? 40.457 -29.985 -37.967 1.00 65.27  ? 533  ASP B CA  1 
ATOM   4003 C C   . ASP B 1 173 ? 40.330 -30.227 -36.451 1.00 65.29  ? 533  ASP B C   1 
ATOM   4004 O O   . ASP B 1 173 ? 39.367 -29.773 -35.827 1.00 65.32  ? 533  ASP B O   1 
ATOM   4005 C CB  . ASP B 1 173 ? 40.066 -31.270 -38.715 1.00 65.38  ? 533  ASP B CB  1 
ATOM   4006 C CG  . ASP B 1 173 ? 38.550 -31.454 -38.859 1.00 65.74  ? 533  ASP B CG  1 
ATOM   4007 O OD1 . ASP B 1 173 ? 37.772 -30.627 -38.333 1.00 65.46  ? 533  ASP B OD1 1 
ATOM   4008 O OD2 . ASP B 1 173 ? 38.140 -32.441 -39.518 1.00 65.62  ? 533  ASP B OD2 1 
ATOM   4009 N N   . ALA B 1 174 ? 41.334 -30.901 -35.880 1.00 65.20  ? 534  ALA B N   1 
ATOM   4010 C CA  . ALA B 1 174 ? 41.227 -31.663 -34.620 1.00 64.98  ? 534  ALA B CA  1 
ATOM   4011 C C   . ALA B 1 174 ? 40.644 -30.966 -33.392 1.00 65.00  ? 534  ALA B C   1 
ATOM   4012 O O   . ALA B 1 174 ? 41.078 -29.883 -32.999 1.00 64.66  ? 534  ALA B O   1 
ATOM   4013 C CB  . ALA B 1 174 ? 42.566 -32.312 -34.275 1.00 64.99  ? 534  ALA B CB  1 
ATOM   4014 N N   . LYS B 1 175 ? 39.654 -31.624 -32.795 1.00 65.07  ? 535  LYS B N   1 
ATOM   4015 C CA  . LYS B 1 175 ? 38.965 -31.131 -31.612 1.00 65.00  ? 535  LYS B CA  1 
ATOM   4016 C C   . LYS B 1 175 ? 38.859 -32.241 -30.574 1.00 64.97  ? 535  LYS B C   1 
ATOM   4017 O O   . LYS B 1 175 ? 39.007 -33.417 -30.901 1.00 64.67  ? 535  LYS B O   1 
ATOM   4018 C CB  . LYS B 1 175 ? 37.584 -30.586 -31.982 1.00 65.06  ? 535  LYS B CB  1 
ATOM   4019 C CG  . LYS B 1 175 ? 37.628 -29.164 -32.523 1.00 65.79  ? 535  LYS B CG  1 
ATOM   4020 C CD  . LYS B 1 175 ? 36.240 -28.622 -32.766 1.00 66.75  ? 535  LYS B CD  1 
ATOM   4021 C CE  . LYS B 1 175 ? 36.247 -27.105 -32.835 1.00 66.69  ? 535  LYS B CE  1 
ATOM   4022 N NZ  . LYS B 1 175 ? 34.857 -26.581 -32.987 1.00 66.84  ? 535  LYS B NZ  1 
ATOM   4023 N N   . THR B 1 176 ? 38.624 -31.852 -29.321 1.00 65.06  ? 536  THR B N   1 
ATOM   4024 C CA  . THR B 1 176 ? 38.570 -32.791 -28.199 1.00 64.99  ? 536  THR B CA  1 
ATOM   4025 C C   . THR B 1 176 ? 37.477 -32.445 -27.181 1.00 65.16  ? 536  THR B C   1 
ATOM   4026 O O   . THR B 1 176 ? 36.888 -31.366 -27.241 1.00 64.81  ? 536  THR B O   1 
ATOM   4027 C CB  . THR B 1 176 ? 39.954 -32.974 -27.514 1.00 65.04  ? 536  THR B CB  1 
ATOM   4028 O OG1 . THR B 1 176 ? 39.881 -34.082 -26.608 1.00 65.92  ? 536  THR B OG1 1 
ATOM   4029 C CG2 . THR B 1 176 ? 40.385 -31.725 -26.765 1.00 63.56  ? 536  THR B CG2 1 
ATOM   4030 N N   . ASN B 1 177 ? 37.247 -33.353 -26.232 1.00 65.64  ? 537  ASN B N   1 
ATOM   4031 C CA  . ASN B 1 177 ? 35.977 -33.419 -25.506 1.00 66.14  ? 537  ASN B CA  1 
ATOM   4032 C C   . ASN B 1 177 ? 36.049 -33.312 -23.979 1.00 66.23  ? 537  ASN B C   1 
ATOM   4033 O O   . ASN B 1 177 ? 35.080 -32.888 -23.346 1.00 66.09  ? 537  ASN B O   1 
ATOM   4034 C CB  . ASN B 1 177 ? 35.254 -34.721 -25.893 1.00 66.31  ? 537  ASN B CB  1 
ATOM   4035 C CG  . ASN B 1 177 ? 33.755 -34.540 -26.047 1.00 67.29  ? 537  ASN B CG  1 
ATOM   4036 O OD1 . ASN B 1 177 ? 33.211 -33.462 -25.794 1.00 67.93  ? 537  ASN B OD1 1 
ATOM   4037 N ND2 . ASN B 1 177 ? 33.073 -35.603 -26.478 1.00 68.68  ? 537  ASN B ND2 1 
ATOM   4038 N N   . GLU B 1 178 ? 37.191 -33.686 -23.401 1.00 66.77  ? 538  GLU B N   1 
ATOM   4039 C CA  . GLU B 1 178 ? 37.357 -33.840 -21.940 1.00 67.50  ? 538  GLU B CA  1 
ATOM   4040 C C   . GLU B 1 178 ? 36.998 -32.627 -21.069 1.00 68.32  ? 538  GLU B C   1 
ATOM   4041 O O   . GLU B 1 178 ? 37.307 -31.483 -21.422 1.00 68.17  ? 538  GLU B O   1 
ATOM   4042 C CB  . GLU B 1 178 ? 38.782 -34.303 -21.604 1.00 67.38  ? 538  GLU B CB  1 
ATOM   4043 C CG  . GLU B 1 178 ? 39.170 -35.665 -22.209 1.00 67.04  ? 538  GLU B CG  1 
ATOM   4044 C CD  . GLU B 1 178 ? 39.724 -35.553 -23.627 1.00 66.02  ? 538  GLU B CD  1 
ATOM   4045 O OE1 . GLU B 1 178 ? 40.092 -34.428 -24.034 1.00 65.08  ? 538  GLU B OE1 1 
ATOM   4046 O OE2 . GLU B 1 178 ? 39.797 -36.589 -24.327 1.00 65.07  ? 538  GLU B OE2 1 
ATOM   4047 N N   . PHE B 1 179 ? 36.366 -32.877 -19.937 1.00 69.23  ? 539  PHE B N   1 
ATOM   4048 C CA  . PHE B 1 179 ? 36.204 -31.870 -18.909 1.00 70.33  ? 539  PHE B CA  1 
ATOM   4049 C C   . PHE B 1 179 ? 37.440 -31.647 -18.028 1.00 70.42  ? 539  PHE B C   1 
ATOM   4050 O O   . PHE B 1 179 ? 37.814 -32.480 -17.243 1.00 70.60  ? 539  PHE B O   1 
ATOM   4051 C CB  . PHE B 1 179 ? 34.995 -32.214 -18.049 1.00 70.82  ? 539  PHE B CB  1 
ATOM   4052 C CG  . PHE B 1 179 ? 34.422 -31.053 -17.309 1.00 72.03  ? 539  PHE B CG  1 
ATOM   4053 C CD1 . PHE B 1 179 ? 34.927 -30.678 -16.092 1.00 73.12  ? 539  PHE B CD1 1 
ATOM   4054 C CD2 . PHE B 1 179 ? 33.377 -30.352 -17.821 1.00 73.20  ? 539  PHE B CD2 1 
ATOM   4055 C CE1 . PHE B 1 179 ? 34.410 -29.630 -15.420 1.00 73.28  ? 539  PHE B CE1 1 
ATOM   4056 C CE2 . PHE B 1 179 ? 32.859 -29.302 -17.143 1.00 74.23  ? 539  PHE B CE2 1 
ATOM   4057 C CZ  . PHE B 1 179 ? 33.373 -28.943 -15.945 1.00 72.70  ? 539  PHE B CZ  1 
ATOM   4058 N N   . CYS B 1 180 ? 38.050 -30.488 -18.143 1.00 70.63  ? 540  CYS B N   1 
ATOM   4059 C CA  . CYS B 1 180 ? 39.433 -30.322 -17.780 1.00 70.76  ? 540  CYS B CA  1 
ATOM   4060 C C   . CYS B 1 180 ? 39.572 -28.971 -17.164 1.00 69.91  ? 540  CYS B C   1 
ATOM   4061 O O   . CYS B 1 180 ? 39.113 -28.030 -17.724 1.00 70.78  ? 540  CYS B O   1 
ATOM   4062 C CB  . CYS B 1 180 ? 40.264 -30.313 -19.037 1.00 70.92  ? 540  CYS B CB  1 
ATOM   4063 S SG  . CYS B 1 180 ? 41.252 -31.671 -19.173 1.00 74.07  ? 540  CYS B SG  1 
ATOM   4064 N N   . GLY B 1 181 ? 40.233 -28.865 -16.032 1.00 68.59  ? 541  GLY B N   1 
ATOM   4065 C CA  . GLY B 1 181 ? 40.815 -27.608 -15.641 1.00 67.20  ? 541  GLY B CA  1 
ATOM   4066 C C   . GLY B 1 181 ? 40.339 -27.134 -14.303 1.00 66.15  ? 541  GLY B C   1 
ATOM   4067 O O   . GLY B 1 181 ? 39.414 -27.663 -13.763 1.00 66.63  ? 541  GLY B O   1 
ATOM   4068 N N   . THR B 1 182 ? 40.997 -26.127 -13.781 1.00 65.01  ? 542  THR B N   1 
ATOM   4069 C CA  . THR B 1 182 ? 40.640 -25.470 -12.542 1.00 64.20  ? 542  THR B CA  1 
ATOM   4070 C C   . THR B 1 182 ? 39.403 -24.584 -12.794 1.00 62.06  ? 542  THR B C   1 
ATOM   4071 O O   . THR B 1 182 ? 39.399 -23.825 -13.754 1.00 61.67  ? 542  THR B O   1 
ATOM   4072 C CB  . THR B 1 182 ? 41.872 -24.690 -12.038 1.00 64.95  ? 542  THR B CB  1 
ATOM   4073 O OG1 . THR B 1 182 ? 42.856 -25.650 -11.612 1.00 68.04  ? 542  THR B OG1 1 
ATOM   4074 C CG2 . THR B 1 182 ? 41.545 -23.735 -10.875 1.00 64.91  ? 542  THR B CG2 1 
ATOM   4075 N N   . PRO B 1 183 ? 38.357 -24.708 -11.948 1.00 60.23  ? 543  PRO B N   1 
ATOM   4076 C CA  . PRO B 1 183 ? 37.041 -24.044 -12.093 1.00 59.39  ? 543  PRO B CA  1 
ATOM   4077 C C   . PRO B 1 183 ? 37.026 -22.552 -12.496 1.00 58.22  ? 543  PRO B C   1 
ATOM   4078 O O   . PRO B 1 183 ? 36.302 -22.196 -13.428 1.00 58.22  ? 543  PRO B O   1 
ATOM   4079 C CB  . PRO B 1 183 ? 36.394 -24.264 -10.720 1.00 59.47  ? 543  PRO B CB  1 
ATOM   4080 C CG  . PRO B 1 183 ? 36.909 -25.616 -10.323 1.00 60.28  ? 543  PRO B CG  1 
ATOM   4081 C CD  . PRO B 1 183 ? 38.380 -25.558 -10.739 1.00 60.36  ? 543  PRO B CD  1 
ATOM   4082 N N   . ASP B 1 184 ? 37.822 -21.713 -11.821 1.00 56.59  ? 544  ASP B N   1 
ATOM   4083 C CA  . ASP B 1 184 ? 37.971 -20.292 -12.147 1.00 55.58  ? 544  ASP B CA  1 
ATOM   4084 C C   . ASP B 1 184 ? 38.347 -20.029 -13.601 1.00 53.86  ? 544  ASP B C   1 
ATOM   4085 O O   . ASP B 1 184 ? 37.951 -18.990 -14.153 1.00 52.76  ? 544  ASP B O   1 
ATOM   4086 C CB  . ASP B 1 184 ? 39.051 -19.629 -11.261 1.00 56.52  ? 544  ASP B CB  1 
ATOM   4087 C CG  . ASP B 1 184 ? 38.612 -19.447 -9.815  1.00 59.74  ? 544  ASP B CG  1 
ATOM   4088 O OD1 . ASP B 1 184 ? 37.409 -19.590 -9.504  1.00 63.21  ? 544  ASP B OD1 1 
ATOM   4089 O OD2 . ASP B 1 184 ? 39.489 -19.150 -8.970  1.00 65.60  ? 544  ASP B OD2 1 
ATOM   4090 N N   . TYR B 1 185 ? 39.114 -20.955 -14.193 1.00 51.78  ? 545  TYR B N   1 
ATOM   4091 C CA  . TYR B 1 185 ? 39.731 -20.791 -15.531 1.00 50.53  ? 545  TYR B CA  1 
ATOM   4092 C C   . TYR B 1 185 ? 39.014 -21.475 -16.698 1.00 49.94  ? 545  TYR B C   1 
ATOM   4093 O O   . TYR B 1 185 ? 39.433 -21.330 -17.866 1.00 49.24  ? 545  TYR B O   1 
ATOM   4094 C CB  . TYR B 1 185 ? 41.178 -21.304 -15.518 1.00 50.87  ? 545  TYR B CB  1 
ATOM   4095 C CG  . TYR B 1 185 ? 42.155 -20.518 -14.675 1.00 50.29  ? 545  TYR B CG  1 
ATOM   4096 C CD1 . TYR B 1 185 ? 42.254 -20.743 -13.306 1.00 50.77  ? 545  TYR B CD1 1 
ATOM   4097 C CD2 . TYR B 1 185 ? 43.003 -19.571 -15.252 1.00 48.75  ? 545  TYR B CD2 1 
ATOM   4098 C CE1 . TYR B 1 185 ? 43.148 -20.013 -12.522 1.00 52.51  ? 545  TYR B CE1 1 
ATOM   4099 C CE2 . TYR B 1 185 ? 43.900 -18.836 -14.478 1.00 48.18  ? 545  TYR B CE2 1 
ATOM   4100 C CZ  . TYR B 1 185 ? 43.962 -19.061 -13.122 1.00 52.18  ? 545  TYR B CZ  1 
ATOM   4101 O OH  . TYR B 1 185 ? 44.884 -18.374 -12.346 1.00 55.19  ? 545  TYR B OH  1 
ATOM   4102 N N   . ILE B 1 186 ? 37.958 -22.225 -16.398 1.00 49.01  ? 546  ILE B N   1 
ATOM   4103 C CA  . ILE B 1 186 ? 37.324 -23.077 -17.412 1.00 50.07  ? 546  ILE B CA  1 
ATOM   4104 C C   . ILE B 1 186 ? 36.527 -22.262 -18.449 1.00 49.08  ? 546  ILE B C   1 
ATOM   4105 O O   . ILE B 1 186 ? 35.712 -21.430 -18.078 1.00 48.99  ? 546  ILE B O   1 
ATOM   4106 C CB  . ILE B 1 186 ? 36.429 -24.221 -16.794 1.00 49.60  ? 546  ILE B CB  1 
ATOM   4107 C CG1 . ILE B 1 186 ? 37.235 -25.055 -15.791 1.00 51.87  ? 546  ILE B CG1 1 
ATOM   4108 C CG2 . ILE B 1 186 ? 35.940 -25.141 -17.888 1.00 50.10  ? 546  ILE B CG2 1 
ATOM   4109 C CD1 . ILE B 1 186 ? 36.468 -26.263 -15.128 1.00 51.73  ? 546  ILE B CD1 1 
ATOM   4110 N N   . ALA B 1 187 ? 36.795 -22.523 -19.732 1.00 48.43  ? 547  ALA B N   1 
ATOM   4111 C CA  . ALA B 1 187 ? 36.160 -21.848 -20.862 1.00 47.76  ? 547  ALA B CA  1 
ATOM   4112 C C   . ALA B 1 187 ? 34.666 -22.152 -20.932 1.00 47.65  ? 547  ALA B C   1 
ATOM   4113 O O   . ALA B 1 187 ? 34.242 -23.251 -20.550 1.00 47.70  ? 547  ALA B O   1 
ATOM   4114 C CB  . ALA B 1 187 ? 36.834 -22.280 -22.152 1.00 47.33  ? 547  ALA B CB  1 
ATOM   4115 N N   . PRO B 1 188 ? 33.862 -21.203 -21.458 1.00 47.29  ? 548  PRO B N   1 
ATOM   4116 C CA  . PRO B 1 188 ? 32.430 -21.497 -21.622 1.00 46.99  ? 548  PRO B CA  1 
ATOM   4117 C C   . PRO B 1 188 ? 32.157 -22.661 -22.576 1.00 46.96  ? 548  PRO B C   1 
ATOM   4118 O O   . PRO B 1 188 ? 31.236 -23.412 -22.331 1.00 46.89  ? 548  PRO B O   1 
ATOM   4119 C CB  . PRO B 1 188 ? 31.831 -20.194 -22.165 1.00 47.08  ? 548  PRO B CB  1 
ATOM   4120 C CG  . PRO B 1 188 ? 32.947 -19.235 -22.325 1.00 46.04  ? 548  PRO B CG  1 
ATOM   4121 C CD  . PRO B 1 188 ? 34.236 -19.866 -21.949 1.00 47.08  ? 548  PRO B CD  1 
ATOM   4122 N N   . GLU B 1 189 ? 32.952 -22.827 -23.636 1.00 47.32  ? 549  GLU B N   1 
ATOM   4123 C CA  . GLU B 1 189 ? 32.749 -23.954 -24.582 1.00 47.67  ? 549  GLU B CA  1 
ATOM   4124 C C   . GLU B 1 189 ? 32.896 -25.340 -23.921 1.00 47.80  ? 549  GLU B C   1 
ATOM   4125 O O   . GLU B 1 189 ? 32.217 -26.284 -24.300 1.00 47.79  ? 549  GLU B O   1 
ATOM   4126 C CB  . GLU B 1 189 ? 33.658 -23.842 -25.822 1.00 47.41  ? 549  GLU B CB  1 
ATOM   4127 C CG  . GLU B 1 189 ? 35.149 -23.810 -25.527 1.00 46.36  ? 549  GLU B CG  1 
ATOM   4128 C CD  . GLU B 1 189 ? 35.738 -22.394 -25.512 1.00 47.71  ? 549  GLU B CD  1 
ATOM   4129 O OE1 . GLU B 1 189 ? 35.086 -21.457 -24.986 1.00 46.81  ? 549  GLU B OE1 1 
ATOM   4130 O OE2 . GLU B 1 189 ? 36.870 -22.223 -26.023 1.00 45.48  ? 549  GLU B OE2 1 
ATOM   4131 N N   . ILE B 1 190 ? 33.785 -25.445 -22.935 1.00 48.24  ? 550  ILE B N   1 
ATOM   4132 C CA  . ILE B 1 190 ? 33.920 -26.666 -22.129 1.00 48.25  ? 550  ILE B CA  1 
ATOM   4133 C C   . ILE B 1 190 ? 32.678 -26.924 -21.263 1.00 48.29  ? 550  ILE B C   1 
ATOM   4134 O O   . ILE B 1 190 ? 32.149 -28.031 -21.272 1.00 48.71  ? 550  ILE B O   1 
ATOM   4135 C CB  . ILE B 1 190 ? 35.182 -26.636 -21.239 1.00 48.07  ? 550  ILE B CB  1 
ATOM   4136 C CG1 . ILE B 1 190 ? 36.444 -26.615 -22.102 1.00 47.71  ? 550  ILE B CG1 1 
ATOM   4137 C CG2 . ILE B 1 190 ? 35.193 -27.852 -20.280 1.00 48.33  ? 550  ILE B CG2 1 
ATOM   4138 C CD1 . ILE B 1 190 ? 37.740 -26.561 -21.307 1.00 47.85  ? 550  ILE B CD1 1 
ATOM   4139 N N   . LEU B 1 191 ? 32.215 -25.896 -20.544 1.00 48.27  ? 551  LEU B N   1 
ATOM   4140 C CA  . LEU B 1 191 ? 31.021 -25.981 -19.693 1.00 48.74  ? 551  LEU B CA  1 
ATOM   4141 C C   . LEU B 1 191 ? 29.775 -26.339 -20.479 1.00 49.09  ? 551  LEU B C   1 
ATOM   4142 O O   . LEU B 1 191 ? 28.884 -27.019 -19.947 1.00 49.28  ? 551  LEU B O   1 
ATOM   4143 C CB  . LEU B 1 191 ? 30.777 -24.677 -18.925 1.00 48.70  ? 551  LEU B CB  1 
ATOM   4144 C CG  . LEU B 1 191 ? 31.913 -24.144 -18.047 1.00 49.92  ? 551  LEU B CG  1 
ATOM   4145 C CD1 . LEU B 1 191 ? 31.479 -22.863 -17.354 1.00 48.14  ? 551  LEU B CD1 1 
ATOM   4146 C CD2 . LEU B 1 191 ? 32.352 -25.203 -17.026 1.00 49.82  ? 551  LEU B CD2 1 
ATOM   4147 N N   . LEU B 1 192 ? 29.719 -25.898 -21.736 1.00 49.32  ? 552  LEU B N   1 
ATOM   4148 C CA  . LEU B 1 192 ? 28.626 -26.265 -22.645 1.00 50.25  ? 552  LEU B CA  1 
ATOM   4149 C C   . LEU B 1 192 ? 28.805 -27.669 -23.262 1.00 50.42  ? 552  LEU B C   1 
ATOM   4150 O O   . LEU B 1 192 ? 27.994 -28.105 -24.074 1.00 50.15  ? 552  LEU B O   1 
ATOM   4151 C CB  . LEU B 1 192 ? 28.427 -25.185 -23.731 1.00 50.28  ? 552  LEU B CB  1 
ATOM   4152 C CG  . LEU B 1 192 ? 28.045 -23.788 -23.207 1.00 51.67  ? 552  LEU B CG  1 
ATOM   4153 C CD1 . LEU B 1 192 ? 28.272 -22.684 -24.240 1.00 51.20  ? 552  LEU B CD1 1 
ATOM   4154 C CD2 . LEU B 1 192 ? 26.606 -23.763 -22.689 1.00 51.96  ? 552  LEU B CD2 1 
ATOM   4155 N N   . GLY B 1 193 ? 29.875 -28.366 -22.881 1.00 50.79  ? 553  GLY B N   1 
ATOM   4156 C CA  . GLY B 1 193 ? 30.097 -29.747 -23.334 1.00 50.88  ? 553  GLY B CA  1 
ATOM   4157 C C   . GLY B 1 193 ? 30.426 -29.868 -24.810 1.00 50.73  ? 553  GLY B C   1 
ATOM   4158 O O   . GLY B 1 193 ? 30.194 -30.908 -25.404 1.00 50.96  ? 553  GLY B O   1 
ATOM   4159 N N   . GLN B 1 194 ? 30.960 -28.797 -25.397 1.00 50.89  ? 554  GLN B N   1 
ATOM   4160 C CA  . GLN B 1 194 ? 31.331 -28.771 -26.815 1.00 50.88  ? 554  GLN B CA  1 
ATOM   4161 C C   . GLN B 1 194 ? 32.699 -29.397 -27.021 1.00 50.61  ? 554  GLN B C   1 
ATOM   4162 O O   . GLN B 1 194 ? 33.531 -29.401 -26.105 1.00 50.84  ? 554  GLN B O   1 
ATOM   4163 C CB  . GLN B 1 194 ? 31.369 -27.324 -27.353 1.00 50.88  ? 554  GLN B CB  1 
ATOM   4164 C CG  . GLN B 1 194 ? 30.069 -26.540 -27.258 1.00 51.95  ? 554  GLN B CG  1 
ATOM   4165 C CD  . GLN B 1 194 ? 28.904 -27.280 -27.902 1.00 54.22  ? 554  GLN B CD  1 
ATOM   4166 O OE1 . GLN B 1 194 ? 28.107 -27.905 -27.214 1.00 55.54  ? 554  GLN B OE1 1 
ATOM   4167 N NE2 . GLN B 1 194 ? 28.821 -27.233 -29.228 1.00 55.01  ? 554  GLN B NE2 1 
ATOM   4168 N N   . LYS B 1 195 ? 32.917 -29.927 -28.225 1.00 50.14  ? 555  LYS B N   1 
ATOM   4169 C CA  . LYS B 1 195 ? 34.250 -30.266 -28.706 1.00 49.56  ? 555  LYS B CA  1 
ATOM   4170 C C   . LYS B 1 195 ? 35.055 -28.985 -28.819 1.00 48.90  ? 555  LYS B C   1 
ATOM   4171 O O   . LYS B 1 195 ? 34.553 -27.981 -29.318 1.00 49.14  ? 555  LYS B O   1 
ATOM   4172 C CB  . LYS B 1 195 ? 34.173 -30.966 -30.068 1.00 49.68  ? 555  LYS B CB  1 
ATOM   4173 C CG  . LYS B 1 195 ? 34.250 -32.488 -29.981 1.00 50.43  ? 555  LYS B CG  1 
ATOM   4174 C CD  . LYS B 1 195 ? 33.482 -33.152 -31.106 1.00 52.07  ? 555  LYS B CD  1 
ATOM   4175 C CE  . LYS B 1 195 ? 33.075 -34.578 -30.737 1.00 52.81  ? 555  LYS B CE  1 
ATOM   4176 N NZ  . LYS B 1 195 ? 32.322 -35.262 -31.846 1.00 53.27  ? 555  LYS B NZ  1 
ATOM   4177 N N   . TYR B 1 196 ? 36.294 -29.004 -28.347 1.00 48.08  ? 556  TYR B N   1 
ATOM   4178 C CA  . TYR B 1 196 ? 37.083 -27.773 -28.310 1.00 47.69  ? 556  TYR B CA  1 
ATOM   4179 C C   . TYR B 1 196 ? 38.505 -27.936 -28.829 1.00 47.13  ? 556  TYR B C   1 
ATOM   4180 O O   . TYR B 1 196 ? 38.996 -29.040 -28.980 1.00 46.49  ? 556  TYR B O   1 
ATOM   4181 C CB  . TYR B 1 196 ? 37.094 -27.167 -26.899 1.00 47.43  ? 556  TYR B CB  1 
ATOM   4182 C CG  . TYR B 1 196 ? 37.704 -28.065 -25.849 1.00 47.82  ? 556  TYR B CG  1 
ATOM   4183 C CD1 . TYR B 1 196 ? 36.905 -28.935 -25.102 1.00 48.17  ? 556  TYR B CD1 1 
ATOM   4184 C CD2 . TYR B 1 196 ? 39.084 -28.061 -25.608 1.00 46.81  ? 556  TYR B CD2 1 
ATOM   4185 C CE1 . TYR B 1 196 ? 37.463 -29.772 -24.146 1.00 47.80  ? 556  TYR B CE1 1 
ATOM   4186 C CE2 . TYR B 1 196 ? 39.649 -28.893 -24.651 1.00 46.50  ? 556  TYR B CE2 1 
ATOM   4187 C CZ  . TYR B 1 196 ? 38.834 -29.734 -23.916 1.00 47.43  ? 556  TYR B CZ  1 
ATOM   4188 O OH  . TYR B 1 196 ? 39.384 -30.550 -22.957 1.00 48.29  ? 556  TYR B OH  1 
ATOM   4189 N N   . ASN B 1 197 ? 39.143 -26.805 -29.109 1.00 47.04  ? 557  ASN B N   1 
ATOM   4190 C CA  . ASN B 1 197 ? 40.533 -26.777 -29.511 1.00 46.71  ? 557  ASN B CA  1 
ATOM   4191 C C   . ASN B 1 197 ? 41.346 -25.826 -28.604 1.00 46.65  ? 557  ASN B C   1 
ATOM   4192 O O   . ASN B 1 197 ? 41.037 -25.668 -27.424 1.00 46.71  ? 557  ASN B O   1 
ATOM   4193 C CB  . ASN B 1 197 ? 40.647 -26.434 -31.005 1.00 46.47  ? 557  ASN B CB  1 
ATOM   4194 C CG  . ASN B 1 197 ? 40.041 -25.078 -31.356 1.00 46.59  ? 557  ASN B CG  1 
ATOM   4195 O OD1 . ASN B 1 197 ? 39.739 -24.271 -30.485 1.00 47.43  ? 557  ASN B OD1 1 
ATOM   4196 N ND2 . ASN B 1 197 ? 39.872 -24.824 -32.645 1.00 46.20  ? 557  ASN B ND2 1 
ATOM   4197 N N   . HIS B 1 198 ? 42.372 -25.194 -29.165 1.00 46.84  ? 558  HIS B N   1 
ATOM   4198 C CA  . HIS B 1 198 ? 43.288 -24.307 -28.427 1.00 46.40  ? 558  HIS B CA  1 
ATOM   4199 C C   . HIS B 1 198 ? 42.607 -23.054 -27.876 1.00 45.88  ? 558  HIS B C   1 
ATOM   4200 O O   . HIS B 1 198 ? 43.171 -22.357 -27.034 1.00 46.39  ? 558  HIS B O   1 
ATOM   4201 C CB  . HIS B 1 198 ? 44.480 -23.933 -29.315 1.00 46.37  ? 558  HIS B CB  1 
ATOM   4202 C CG  . HIS B 1 198 ? 44.093 -23.272 -30.603 1.00 47.71  ? 558  HIS B CG  1 
ATOM   4203 N ND1 . HIS B 1 198 ? 44.345 -21.940 -30.862 1.00 48.81  ? 558  HIS B ND1 1 
ATOM   4204 C CD2 . HIS B 1 198 ? 43.460 -23.754 -31.699 1.00 49.83  ? 558  HIS B CD2 1 
ATOM   4205 C CE1 . HIS B 1 198 ? 43.889 -21.632 -32.062 1.00 49.12  ? 558  HIS B CE1 1 
ATOM   4206 N NE2 . HIS B 1 198 ? 43.349 -22.714 -32.592 1.00 50.46  ? 558  HIS B NE2 1 
ATOM   4207 N N   . SER B 1 199 ? 41.384 -22.798 -28.327 1.00 45.09  ? 559  SER B N   1 
ATOM   4208 C CA  . SER B 1 199 ? 40.575 -21.683 -27.855 1.00 44.50  ? 559  SER B CA  1 
ATOM   4209 C C   . SER B 1 199 ? 40.463 -21.607 -26.333 1.00 44.51  ? 559  SER B C   1 
ATOM   4210 O O   . SER B 1 199 ? 40.413 -20.510 -25.754 1.00 45.29  ? 559  SER B O   1 
ATOM   4211 C CB  . SER B 1 199 ? 39.172 -21.754 -28.483 1.00 45.16  ? 559  SER B CB  1 
ATOM   4212 O OG  . SER B 1 199 ? 38.389 -22.829 -27.952 1.00 43.47  ? 559  SER B OG  1 
ATOM   4213 N N   . VAL B 1 200 ? 40.423 -22.763 -25.681 1.00 44.00  ? 560  VAL B N   1 
ATOM   4214 C CA  . VAL B 1 200 ? 40.290 -22.819 -24.228 1.00 43.70  ? 560  VAL B CA  1 
ATOM   4215 C C   . VAL B 1 200 ? 41.518 -22.260 -23.509 1.00 43.59  ? 560  VAL B C   1 
ATOM   4216 O O   . VAL B 1 200 ? 41.403 -21.740 -22.403 1.00 43.75  ? 560  VAL B O   1 
ATOM   4217 C CB  . VAL B 1 200 ? 39.984 -24.264 -23.725 1.00 43.78  ? 560  VAL B CB  1 
ATOM   4218 C CG1 . VAL B 1 200 ? 38.690 -24.789 -24.362 1.00 42.51  ? 560  VAL B CG1 1 
ATOM   4219 C CG2 . VAL B 1 200 ? 41.179 -25.223 -23.963 1.00 43.14  ? 560  VAL B CG2 1 
ATOM   4220 N N   . ASP B 1 201 ? 42.689 -22.413 -24.126 1.00 43.10  ? 561  ASP B N   1 
ATOM   4221 C CA  . ASP B 1 201 ? 43.914 -21.800 -23.626 1.00 43.51  ? 561  ASP B CA  1 
ATOM   4222 C C   . ASP B 1 201 ? 43.858 -20.272 -23.696 1.00 42.97  ? 561  ASP B C   1 
ATOM   4223 O O   . ASP B 1 201 ? 44.404 -19.603 -22.827 1.00 43.90  ? 561  ASP B O   1 
ATOM   4224 C CB  . ASP B 1 201 ? 45.130 -22.295 -24.411 1.00 43.75  ? 561  ASP B CB  1 
ATOM   4225 C CG  . ASP B 1 201 ? 45.617 -23.655 -23.954 1.00 43.45  ? 561  ASP B CG  1 
ATOM   4226 O OD1 . ASP B 1 201 ? 45.206 -24.128 -22.870 1.00 43.73  ? 561  ASP B OD1 1 
ATOM   4227 O OD2 . ASP B 1 201 ? 46.449 -24.230 -24.681 1.00 43.17  ? 561  ASP B OD2 1 
ATOM   4228 N N   . TRP B 1 202 ? 43.189 -19.737 -24.711 1.00 42.30  ? 562  TRP B N   1 
ATOM   4229 C CA  . TRP B 1 202 ? 43.029 -18.286 -24.849 1.00 42.14  ? 562  TRP B CA  1 
ATOM   4230 C C   . TRP B 1 202 ? 42.010 -17.710 -23.874 1.00 42.21  ? 562  TRP B C   1 
ATOM   4231 O O   . TRP B 1 202 ? 42.220 -16.626 -23.341 1.00 42.70  ? 562  TRP B O   1 
ATOM   4232 C CB  . TRP B 1 202 ? 42.811 -17.887 -26.315 1.00 41.88  ? 562  TRP B CB  1 
ATOM   4233 C CG  . TRP B 1 202 ? 44.048 -18.188 -27.142 1.00 41.72  ? 562  TRP B CG  1 
ATOM   4234 C CD1 . TRP B 1 202 ? 44.139 -19.039 -28.202 1.00 42.62  ? 562  TRP B CD1 1 
ATOM   4235 C CD2 . TRP B 1 202 ? 45.380 -17.672 -26.927 1.00 42.42  ? 562  TRP B CD2 1 
ATOM   4236 N NE1 . TRP B 1 202 ? 45.422 -19.058 -28.692 1.00 43.46  ? 562  TRP B NE1 1 
ATOM   4237 C CE2 . TRP B 1 202 ? 46.209 -18.235 -27.923 1.00 43.45  ? 562  TRP B CE2 1 
ATOM   4238 C CE3 . TRP B 1 202 ? 45.940 -16.759 -26.012 1.00 42.71  ? 562  TRP B CE3 1 
ATOM   4239 C CZ2 . TRP B 1 202 ? 47.575 -17.927 -28.029 1.00 41.73  ? 562  TRP B CZ2 1 
ATOM   4240 C CZ3 . TRP B 1 202 ? 47.303 -16.460 -26.110 1.00 42.06  ? 562  TRP B CZ3 1 
ATOM   4241 C CH2 . TRP B 1 202 ? 48.105 -17.056 -27.109 1.00 42.25  ? 562  TRP B CH2 1 
ATOM   4242 N N   . TRP B 1 203 ? 40.958 -18.466 -23.550 1.00 42.41  ? 563  TRP B N   1 
ATOM   4243 C CA  . TRP B 1 203 ? 40.089 -18.080 -22.434 1.00 41.75  ? 563  TRP B CA  1 
ATOM   4244 C C   . TRP B 1 203 ? 40.852 -18.024 -21.109 1.00 42.56  ? 563  TRP B C   1 
ATOM   4245 O O   . TRP B 1 203 ? 40.760 -17.042 -20.373 1.00 43.28  ? 563  TRP B O   1 
ATOM   4246 C CB  . TRP B 1 203 ? 38.876 -19.014 -22.297 1.00 40.98  ? 563  TRP B CB  1 
ATOM   4247 C CG  . TRP B 1 203 ? 37.946 -18.591 -21.194 1.00 38.27  ? 563  TRP B CG  1 
ATOM   4248 C CD1 . TRP B 1 203 ? 38.008 -18.945 -19.863 1.00 37.96  ? 563  TRP B CD1 1 
ATOM   4249 C CD2 . TRP B 1 203 ? 36.830 -17.711 -21.325 1.00 37.77  ? 563  TRP B CD2 1 
ATOM   4250 N NE1 . TRP B 1 203 ? 36.987 -18.333 -19.156 1.00 39.10  ? 563  TRP B NE1 1 
ATOM   4251 C CE2 . TRP B 1 203 ? 36.243 -17.580 -20.040 1.00 38.63  ? 563  TRP B CE2 1 
ATOM   4252 C CE3 . TRP B 1 203 ? 36.247 -17.037 -22.414 1.00 38.24  ? 563  TRP B CE3 1 
ATOM   4253 C CZ2 . TRP B 1 203 ? 35.110 -16.796 -19.819 1.00 39.39  ? 563  TRP B CZ2 1 
ATOM   4254 C CZ3 . TRP B 1 203 ? 35.109 -16.267 -22.193 1.00 38.58  ? 563  TRP B CZ3 1 
ATOM   4255 C CH2 . TRP B 1 203 ? 34.555 -16.146 -20.900 1.00 38.65  ? 563  TRP B CH2 1 
ATOM   4256 N N   . SER B 1 204 ? 41.579 -19.088 -20.800 1.00 42.35  ? 564  SER B N   1 
ATOM   4257 C CA  . SER B 1 204 ? 42.357 -19.192 -19.567 1.00 43.17  ? 564  SER B CA  1 
ATOM   4258 C C   . SER B 1 204 ? 43.424 -18.131 -19.458 1.00 42.88  ? 564  SER B C   1 
ATOM   4259 O O   . SER B 1 204 ? 43.740 -17.701 -18.361 1.00 43.86  ? 564  SER B O   1 
ATOM   4260 C CB  . SER B 1 204 ? 43.047 -20.554 -19.513 1.00 42.84  ? 564  SER B CB  1 
ATOM   4261 O OG  . SER B 1 204 ? 42.058 -21.540 -19.351 1.00 47.60  ? 564  SER B OG  1 
ATOM   4262 N N   . PHE B 1 205 ? 44.002 -17.775 -20.600 1.00 42.85  ? 565  PHE B N   1 
ATOM   4263 C CA  . PHE B 1 205 ? 44.964 -16.712 -20.701 1.00 43.77  ? 565  PHE B CA  1 
ATOM   4264 C C   . PHE B 1 205 ? 44.350 -15.368 -20.271 1.00 43.60  ? 565  PHE B C   1 
ATOM   4265 O O   . PHE B 1 205 ? 44.960 -14.632 -19.506 1.00 43.95  ? 565  PHE B O   1 
ATOM   4266 C CB  . PHE B 1 205 ? 45.534 -16.620 -22.126 1.00 43.53  ? 565  PHE B CB  1 
ATOM   4267 C CG  . PHE B 1 205 ? 46.529 -15.505 -22.292 1.00 45.16  ? 565  PHE B CG  1 
ATOM   4268 C CD1 . PHE B 1 205 ? 47.796 -15.596 -21.708 1.00 44.66  ? 565  PHE B CD1 1 
ATOM   4269 C CD2 . PHE B 1 205 ? 46.190 -14.340 -22.991 1.00 43.85  ? 565  PHE B CD2 1 
ATOM   4270 C CE1 . PHE B 1 205 ? 48.703 -14.549 -21.837 1.00 44.54  ? 565  PHE B CE1 1 
ATOM   4271 C CE2 . PHE B 1 205 ? 47.094 -13.301 -23.110 1.00 43.32  ? 565  PHE B CE2 1 
ATOM   4272 C CZ  . PHE B 1 205 ? 48.350 -13.410 -22.527 1.00 44.01  ? 565  PHE B CZ  1 
ATOM   4273 N N   . GLY B 1 206 ? 43.155 -15.060 -20.780 1.00 43.41  ? 566  GLY B N   1 
ATOM   4274 C CA  . GLY B 1 206 ? 42.373 -13.939 -20.307 1.00 43.38  ? 566  GLY B CA  1 
ATOM   4275 C C   . GLY B 1 206 ? 42.148 -13.941 -18.807 1.00 43.89  ? 566  GLY B C   1 
ATOM   4276 O O   . GLY B 1 206 ? 42.308 -12.910 -18.170 1.00 44.94  ? 566  GLY B O   1 
ATOM   4277 N N   . VAL B 1 207 ? 41.784 -15.085 -18.228 1.00 43.18  ? 567  VAL B N   1 
ATOM   4278 C CA  . VAL B 1 207 ? 41.560 -15.154 -16.778 1.00 43.01  ? 567  VAL B CA  1 
ATOM   4279 C C   . VAL B 1 207 ? 42.861 -14.814 -16.006 1.00 44.07  ? 567  VAL B C   1 
ATOM   4280 O O   . VAL B 1 207 ? 42.862 -14.005 -15.075 1.00 44.23  ? 567  VAL B O   1 
ATOM   4281 C CB  . VAL B 1 207 ? 41.016 -16.575 -16.303 1.00 42.24  ? 567  VAL B CB  1 
ATOM   4282 C CG1 . VAL B 1 207 ? 40.977 -16.662 -14.779 1.00 37.80  ? 567  VAL B CG1 1 
ATOM   4283 C CG2 . VAL B 1 207 ? 39.642 -16.881 -16.893 1.00 39.94  ? 567  VAL B CG2 1 
ATOM   4284 N N   . LEU B 1 208 ? 43.937 -15.496 -16.378 1.00 44.09  ? 568  LEU B N   1 
ATOM   4285 C CA  . LEU B 1 208 ? 45.260 -15.239 -15.838 1.00 45.27  ? 568  LEU B CA  1 
ATOM   4286 C C   . LEU B 1 208 ? 45.718 -13.774 -15.975 1.00 44.96  ? 568  LEU B C   1 
ATOM   4287 O O   . LEU B 1 208 ? 46.186 -13.190 -15.005 1.00 45.79  ? 568  LEU B O   1 
ATOM   4288 C CB  . LEU B 1 208 ? 46.271 -16.196 -16.505 1.00 46.18  ? 568  LEU B CB  1 
ATOM   4289 C CG  . LEU B 1 208 ? 47.715 -16.217 -15.974 1.00 47.44  ? 568  LEU B CG  1 
ATOM   4290 C CD1 . LEU B 1 208 ? 47.891 -17.423 -15.170 1.00 51.81  ? 568  LEU B CD1 1 
ATOM   4291 C CD2 . LEU B 1 208 ? 48.630 -16.329 -17.134 1.00 49.36  ? 568  LEU B CD2 1 
ATOM   4292 N N   . LEU B 1 209 ? 45.602 -13.208 -17.168 1.00 44.74  ? 569  LEU B N   1 
ATOM   4293 C CA  . LEU B 1 209 ? 45.884 -11.776 -17.400 1.00 45.89  ? 569  LEU B CA  1 
ATOM   4294 C C   . LEU B 1 209 ? 45.023 -10.867 -16.508 1.00 44.65  ? 569  LEU B C   1 
ATOM   4295 O O   . LEU B 1 209 ? 45.543 -9.981  -15.857 1.00 45.53  ? 569  LEU B O   1 
ATOM   4296 C CB  . LEU B 1 209 ? 45.670 -11.398 -18.877 1.00 45.61  ? 569  LEU B CB  1 
ATOM   4297 C CG  . LEU B 1 209 ? 46.555 -10.350 -19.600 1.00 48.66  ? 569  LEU B CG  1 
ATOM   4298 C CD1 . LEU B 1 209 ? 45.745 -9.598  -20.618 1.00 47.57  ? 569  LEU B CD1 1 
ATOM   4299 C CD2 . LEU B 1 209 ? 47.390 -9.400  -18.704 1.00 48.02  ? 569  LEU B CD2 1 
ATOM   4300 N N   . TYR B 1 210 ? 43.717 -11.104 -16.463 1.00 43.58  ? 570  TYR B N   1 
ATOM   4301 C CA  . TYR B 1 210 ? 42.836 -10.395 -15.532 1.00 42.89  ? 570  TYR B CA  1 
ATOM   4302 C C   . TYR B 1 210 ? 43.347 -10.459 -14.101 1.00 43.36  ? 570  TYR B C   1 
ATOM   4303 O O   . TYR B 1 210 ? 43.411 -9.435  -13.433 1.00 43.45  ? 570  TYR B O   1 
ATOM   4304 C CB  . TYR B 1 210 ? 41.418 -10.960 -15.599 1.00 41.25  ? 570  TYR B CB  1 
ATOM   4305 C CG  . TYR B 1 210 ? 40.405 -10.224 -14.751 1.00 41.29  ? 570  TYR B CG  1 
ATOM   4306 C CD1 . TYR B 1 210 ? 40.336 -10.422 -13.348 1.00 38.66  ? 570  TYR B CD1 1 
ATOM   4307 C CD2 . TYR B 1 210 ? 39.478 -9.343  -15.350 1.00 39.22  ? 570  TYR B CD2 1 
ATOM   4308 C CE1 . TYR B 1 210 ? 39.397 -9.717  -12.563 1.00 39.36  ? 570  TYR B CE1 1 
ATOM   4309 C CE2 . TYR B 1 210 ? 38.525 -8.662  -14.581 1.00 39.26  ? 570  TYR B CE2 1 
ATOM   4310 C CZ  . TYR B 1 210 ? 38.476 -8.850  -13.203 1.00 40.75  ? 570  TYR B CZ  1 
ATOM   4311 O OH  . TYR B 1 210 ? 37.525 -8.160  -12.462 1.00 40.46  ? 570  TYR B OH  1 
ATOM   4312 N N   . GLU B 1 211 ? 43.662 -11.664 -13.620 1.00 43.25  ? 571  GLU B N   1 
ATOM   4313 C CA  . GLU B 1 211 ? 44.224 -11.854 -12.282 1.00 44.29  ? 571  GLU B CA  1 
ATOM   4314 C C   . GLU B 1 211 ? 45.581 -11.161 -12.071 1.00 43.09  ? 571  GLU B C   1 
ATOM   4315 O O   . GLU B 1 211 ? 45.834 -10.645 -11.003 1.00 43.39  ? 571  GLU B O   1 
ATOM   4316 C CB  . GLU B 1 211 ? 44.344 -13.362 -11.944 1.00 43.98  ? 571  GLU B CB  1 
ATOM   4317 C CG  . GLU B 1 211 ? 42.996 -14.085 -11.815 1.00 46.72  ? 571  GLU B CG  1 
ATOM   4318 C CD  . GLU B 1 211 ? 43.143 -15.532 -11.335 1.00 48.07  ? 571  GLU B CD  1 
ATOM   4319 O OE1 . GLU B 1 211 ? 44.225 -16.127 -11.554 1.00 55.28  ? 571  GLU B OE1 1 
ATOM   4320 O OE2 . GLU B 1 211 ? 42.182 -16.082 -10.750 1.00 54.73  ? 571  GLU B OE2 1 
ATOM   4321 N N   . MET B 1 212 ? 46.449 -11.140 -13.074 1.00 42.93  ? 572  MET B N   1 
ATOM   4322 C CA  . MET B 1 212 ? 47.712 -10.364 -12.953 1.00 44.12  ? 572  MET B CA  1 
ATOM   4323 C C   . MET B 1 212 ? 47.490 -8.846  -12.791 1.00 43.71  ? 572  MET B C   1 
ATOM   4324 O O   . MET B 1 212 ? 48.120 -8.207  -11.972 1.00 43.39  ? 572  MET B O   1 
ATOM   4325 C CB  . MET B 1 212 ? 48.651 -10.643 -14.133 1.00 43.54  ? 572  MET B CB  1 
ATOM   4326 C CG  . MET B 1 212 ? 49.214 -12.082 -14.105 1.00 43.30  ? 572  MET B CG  1 
ATOM   4327 S SD  . MET B 1 212 ? 50.563 -12.288 -15.246 1.00 45.80  ? 572  MET B SD  1 
ATOM   4328 C CE  . MET B 1 212 ? 49.895 -11.925 -16.833 1.00 42.21  ? 572  MET B CE  1 
ATOM   4329 N N   . LEU B 1 213 ? 46.566 -8.305  -13.579 1.00 43.71  ? 573  LEU B N   1 
ATOM   4330 C CA  . LEU B 1 213 ? 46.305 -6.875  -13.651 1.00 43.34  ? 573  LEU B CA  1 
ATOM   4331 C C   . LEU B 1 213 ? 45.480 -6.379  -12.483 1.00 42.68  ? 573  LEU B C   1 
ATOM   4332 O O   . LEU B 1 213 ? 45.670 -5.252  -12.013 1.00 41.90  ? 573  LEU B O   1 
ATOM   4333 C CB  . LEU B 1 213 ? 45.574 -6.536  -14.949 1.00 42.71  ? 573  LEU B CB  1 
ATOM   4334 C CG  . LEU B 1 213 ? 46.358 -6.641  -16.251 1.00 44.21  ? 573  LEU B CG  1 
ATOM   4335 C CD1 . LEU B 1 213 ? 45.385 -6.743  -17.476 1.00 44.02  ? 573  LEU B CD1 1 
ATOM   4336 C CD2 . LEU B 1 213 ? 47.329 -5.443  -16.398 1.00 43.53  ? 573  LEU B CD2 1 
ATOM   4337 N N   . ILE B 1 214 ? 44.577 -7.229  -12.008 1.00 42.29  ? 574  ILE B N   1 
ATOM   4338 C CA  . ILE B 1 214 ? 43.552 -6.787  -11.068 1.00 42.29  ? 574  ILE B CA  1 
ATOM   4339 C C   . ILE B 1 214 ? 43.692 -7.398  -9.680  1.00 42.60  ? 574  ILE B C   1 
ATOM   4340 O O   . ILE B 1 214 ? 43.311 -6.783  -8.685  1.00 42.70  ? 574  ILE B O   1 
ATOM   4341 C CB  . ILE B 1 214 ? 42.136 -6.934  -11.716 1.00 42.59  ? 574  ILE B CB  1 
ATOM   4342 C CG1 . ILE B 1 214 ? 41.998 -5.879  -12.855 1.00 42.34  ? 574  ILE B CG1 1 
ATOM   4343 C CG2 . ILE B 1 214 ? 41.016 -6.735  -10.681 1.00 43.16  ? 574  ILE B CG2 1 
ATOM   4344 C CD1 . ILE B 1 214 ? 41.099 -6.312  -14.000 1.00 44.24  ? 574  ILE B CD1 1 
ATOM   4345 N N   . GLY B 1 215 ? 44.289 -8.593  -9.605  1.00 42.57  ? 575  GLY B N   1 
ATOM   4346 C CA  . GLY B 1 215 ? 44.441 -9.282  -8.334  1.00 42.35  ? 575  GLY B CA  1 
ATOM   4347 C C   . GLY B 1 215 ? 43.135 -9.854  -7.814  1.00 42.17  ? 575  GLY B C   1 
ATOM   4348 O O   . GLY B 1 215 ? 42.994 -10.084 -6.617  1.00 41.91  ? 575  GLY B O   1 
ATOM   4349 N N   . GLN B 1 216 ? 42.181 -10.091 -8.714  1.00 41.93  ? 576  GLN B N   1 
ATOM   4350 C CA  . GLN B 1 216 ? 40.905 -10.693 -8.325  1.00 42.24  ? 576  GLN B CA  1 
ATOM   4351 C C   . GLN B 1 216 ? 40.564 -11.668 -9.433  1.00 42.51  ? 576  GLN B C   1 
ATOM   4352 O O   . GLN B 1 216 ? 41.122 -11.557 -10.529 1.00 42.56  ? 576  GLN B O   1 
ATOM   4353 C CB  . GLN B 1 216 ? 39.771 -9.643  -8.207  1.00 41.83  ? 576  GLN B CB  1 
ATOM   4354 C CG  . GLN B 1 216 ? 40.000 -8.516  -7.203  1.00 41.85  ? 576  GLN B CG  1 
ATOM   4355 C CD  . GLN B 1 216 ? 39.750 -8.923  -5.782  1.00 42.93  ? 576  GLN B CD  1 
ATOM   4356 O OE1 . GLN B 1 216 ? 39.168 -9.996  -5.507  1.00 42.13  ? 576  GLN B OE1 1 
ATOM   4357 N NE2 . GLN B 1 216 ? 40.198 -8.081  -4.842  1.00 39.68  ? 576  GLN B NE2 1 
ATOM   4358 N N   . SER B 1 217 ? 39.650 -12.599 -9.161  1.00 42.59  ? 577  SER B N   1 
ATOM   4359 C CA  . SER B 1 217 ? 39.121 -13.477 -10.224 1.00 44.44  ? 577  SER B CA  1 
ATOM   4360 C C   . SER B 1 217 ? 37.977 -12.843 -11.024 1.00 43.32  ? 577  SER B C   1 
ATOM   4361 O O   . SER B 1 217 ? 37.052 -12.262 -10.436 1.00 43.71  ? 577  SER B O   1 
ATOM   4362 C CB  . SER B 1 217 ? 38.685 -14.830 -9.647  1.00 44.25  ? 577  SER B CB  1 
ATOM   4363 O OG  . SER B 1 217 ? 39.863 -15.487 -9.180  1.00 50.34  ? 577  SER B OG  1 
ATOM   4364 N N   . PRO B 1 218 ? 38.010 -13.009 -12.356 1.00 42.86  ? 578  PRO B N   1 
ATOM   4365 C CA  . PRO B 1 218 ? 36.992 -12.411 -13.197 1.00 42.59  ? 578  PRO B CA  1 
ATOM   4366 C C   . PRO B 1 218 ? 35.596 -13.040 -13.007 1.00 43.56  ? 578  PRO B C   1 
ATOM   4367 O O   . PRO B 1 218 ? 34.602 -12.305 -12.951 1.00 42.90  ? 578  PRO B O   1 
ATOM   4368 C CB  . PRO B 1 218 ? 37.518 -12.634 -14.618 1.00 42.54  ? 578  PRO B CB  1 
ATOM   4369 C CG  . PRO B 1 218 ? 38.456 -13.742 -14.539 1.00 42.92  ? 578  PRO B CG  1 
ATOM   4370 C CD  . PRO B 1 218 ? 38.996 -13.793 -13.129 1.00 42.21  ? 578  PRO B CD  1 
ATOM   4371 N N   . PHE B 1 219 ? 35.533 -14.370 -12.888 1.00 43.43  ? 579  PHE B N   1 
ATOM   4372 C CA  . PHE B 1 219 ? 34.259 -15.091 -12.752 1.00 44.26  ? 579  PHE B CA  1 
ATOM   4373 C C   . PHE B 1 219 ? 34.224 -15.761 -11.391 1.00 44.53  ? 579  PHE B C   1 
ATOM   4374 O O   . PHE B 1 219 ? 35.254 -16.227 -10.879 1.00 45.15  ? 579  PHE B O   1 
ATOM   4375 C CB  . PHE B 1 219 ? 34.061 -16.084 -13.919 1.00 43.80  ? 579  PHE B CB  1 
ATOM   4376 C CG  . PHE B 1 219 ? 34.292 -15.461 -15.260 1.00 42.87  ? 579  PHE B CG  1 
ATOM   4377 C CD1 . PHE B 1 219 ? 33.323 -14.671 -15.849 1.00 44.58  ? 579  PHE B CD1 1 
ATOM   4378 C CD2 . PHE B 1 219 ? 35.504 -15.605 -15.902 1.00 44.26  ? 579  PHE B CD2 1 
ATOM   4379 C CE1 . PHE B 1 219 ? 33.553 -14.036 -17.087 1.00 45.29  ? 579  PHE B CE1 1 
ATOM   4380 C CE2 . PHE B 1 219 ? 35.753 -14.973 -17.122 1.00 42.92  ? 579  PHE B CE2 1 
ATOM   4381 C CZ  . PHE B 1 219 ? 34.764 -14.181 -17.719 1.00 43.49  ? 579  PHE B CZ  1 
ATOM   4382 N N   . HIS B 1 220 ? 33.050 -15.761 -10.785 1.00 44.60  ? 580  HIS B N   1 
ATOM   4383 C CA  . HIS B 1 220 ? 32.907 -16.138 -9.394  1.00 45.07  ? 580  HIS B CA  1 
ATOM   4384 C C   . HIS B 1 220 ? 31.459 -16.536 -9.079  1.00 45.47  ? 580  HIS B C   1 
ATOM   4385 O O   . HIS B 1 220 ? 30.531 -16.281 -9.855  1.00 44.65  ? 580  HIS B O   1 
ATOM   4386 C CB  . HIS B 1 220 ? 33.373 -14.991 -8.472  1.00 45.21  ? 580  HIS B CB  1 
ATOM   4387 C CG  . HIS B 1 220 ? 32.528 -13.750 -8.578  1.00 46.92  ? 580  HIS B CG  1 
ATOM   4388 N ND1 . HIS B 1 220 ? 32.939 -12.615 -9.255  1.00 47.47  ? 580  HIS B ND1 1 
ATOM   4389 C CD2 . HIS B 1 220 ? 31.282 -13.481 -8.115  1.00 46.77  ? 580  HIS B CD2 1 
ATOM   4390 C CE1 . HIS B 1 220 ? 31.978 -11.707 -9.203  1.00 47.85  ? 580  HIS B CE1 1 
ATOM   4391 N NE2 . HIS B 1 220 ? 30.960 -12.210 -8.526  1.00 47.38  ? 580  HIS B NE2 1 
ATOM   4392 N N   . GLY B 1 221 ? 31.293 -17.150 -7.912  1.00 46.27  ? 581  GLY B N   1 
ATOM   4393 C CA  . GLY B 1 221 ? 30.006 -17.558 -7.391  1.00 47.19  ? 581  GLY B CA  1 
ATOM   4394 C C   . GLY B 1 221 ? 30.196 -17.975 -5.951  1.00 48.01  ? 581  GLY B C   1 
ATOM   4395 O O   . GLY B 1 221 ? 31.330 -18.243 -5.511  1.00 48.33  ? 581  GLY B O   1 
ATOM   4396 N N   . GLN B 1 222 ? 29.090 -17.983 -5.219  1.00 48.56  ? 582  GLN B N   1 
ATOM   4397 C CA  . GLN B 1 222 ? 29.019 -18.483 -3.847  1.00 49.89  ? 582  GLN B CA  1 
ATOM   4398 C C   . GLN B 1 222 ? 28.909 -20.013 -3.801  1.00 50.09  ? 582  GLN B C   1 
ATOM   4399 O O   . GLN B 1 222 ? 29.016 -20.600 -2.721  1.00 50.39  ? 582  GLN B O   1 
ATOM   4400 C CB  . GLN B 1 222 ? 27.808 -17.873 -3.109  1.00 49.79  ? 582  GLN B CB  1 
ATOM   4401 C CG  . GLN B 1 222 ? 27.736 -16.344 -3.143  1.00 51.73  ? 582  GLN B CG  1 
ATOM   4402 C CD  . GLN B 1 222 ? 28.952 -15.683 -2.498  1.00 53.48  ? 582  GLN B CD  1 
ATOM   4403 O OE1 . GLN B 1 222 ? 29.128 -15.749 -1.280  1.00 53.76  ? 582  GLN B OE1 1 
ATOM   4404 N NE2 . GLN B 1 222 ? 29.789 -15.042 -3.316  1.00 51.88  ? 582  GLN B NE2 1 
ATOM   4405 N N   . ASP B 1 223 ? 28.623 -20.624 -4.958  1.00 50.33  ? 583  ASP B N   1 
ATOM   4406 C CA  . ASP B 1 223 ? 28.719 -22.079 -5.189  1.00 50.63  ? 583  ASP B CA  1 
ATOM   4407 C C   . ASP B 1 223 ? 29.121 -22.298 -6.637  1.00 50.86  ? 583  ASP B C   1 
ATOM   4408 O O   . ASP B 1 223 ? 29.223 -21.325 -7.388  1.00 50.82  ? 583  ASP B O   1 
ATOM   4409 C CB  . ASP B 1 223 ? 27.413 -22.830 -4.845  1.00 51.00  ? 583  ASP B CB  1 
ATOM   4410 C CG  . ASP B 1 223 ? 26.223 -22.370 -5.661  1.00 51.44  ? 583  ASP B CG  1 
ATOM   4411 O OD1 . ASP B 1 223 ? 26.404 -21.848 -6.777  1.00 52.18  ? 583  ASP B OD1 1 
ATOM   4412 O OD2 . ASP B 1 223 ? 25.088 -22.536 -5.182  1.00 55.02  ? 583  ASP B OD2 1 
ATOM   4413 N N   . GLU B 1 224 ? 29.354 -23.550 -7.034  1.00 51.21  ? 584  GLU B N   1 
ATOM   4414 C CA  . GLU B 1 224 ? 29.926 -23.836 -8.366  1.00 52.01  ? 584  GLU B CA  1 
ATOM   4415 C C   . GLU B 1 224 ? 28.959 -23.508 -9.516  1.00 51.52  ? 584  GLU B C   1 
ATOM   4416 O O   . GLU B 1 224 ? 29.379 -23.033 -10.572 1.00 51.44  ? 584  GLU B O   1 
ATOM   4417 C CB  . GLU B 1 224 ? 30.464 -25.274 -8.476  1.00 51.69  ? 584  GLU B CB  1 
ATOM   4418 C CG  . GLU B 1 224 ? 31.435 -25.451 -9.656  1.00 52.64  ? 584  GLU B CG  1 
ATOM   4419 C CD  . GLU B 1 224 ? 32.062 -26.857 -9.748  1.00 53.71  ? 584  GLU B CD  1 
ATOM   4420 O OE1 . GLU B 1 224 ? 33.315 -26.939 -9.842  1.00 57.00  ? 584  GLU B OE1 1 
ATOM   4421 O OE2 . GLU B 1 224 ? 31.320 -27.869 -9.737  1.00 52.19  ? 584  GLU B OE2 1 
ATOM   4422 N N   . GLU B 1 225 ? 27.679 -23.769 -9.291  1.00 51.16  ? 585  GLU B N   1 
ATOM   4423 C CA  . GLU B 1 225 ? 26.598 -23.395 -10.206 1.00 51.69  ? 585  GLU B CA  1 
ATOM   4424 C C   . GLU B 1 225 ? 26.595 -21.901 -10.604 1.00 51.04  ? 585  GLU B C   1 
ATOM   4425 O O   . GLU B 1 225 ? 26.502 -21.582 -11.790 1.00 51.24  ? 585  GLU B O   1 
ATOM   4426 C CB  . GLU B 1 225 ? 25.261 -23.773 -9.560  1.00 52.19  ? 585  GLU B CB  1 
ATOM   4427 C CG  . GLU B 1 225 ? 24.019 -23.428 -10.363 1.00 56.04  ? 585  GLU B CG  1 
ATOM   4428 C CD  . GLU B 1 225 ? 22.826 -24.244 -9.928  1.00 61.05  ? 585  GLU B CD  1 
ATOM   4429 O OE1 . GLU B 1 225 ? 23.036 -25.403 -9.478  1.00 64.09  ? 585  GLU B OE1 1 
ATOM   4430 O OE2 . GLU B 1 225 ? 21.682 -23.735 -10.029 1.00 63.47  ? 585  GLU B OE2 1 
ATOM   4431 N N   . GLU B 1 226 ? 26.688 -21.002 -9.617  1.00 49.84  ? 586  GLU B N   1 
ATOM   4432 C CA  . GLU B 1 226 ? 26.758 -19.558 -9.852  1.00 49.35  ? 586  GLU B CA  1 
ATOM   4433 C C   . GLU B 1 226 ? 28.018 -19.171 -10.650 1.00 48.71  ? 586  GLU B C   1 
ATOM   4434 O O   . GLU B 1 226 ? 27.955 -18.347 -11.558 1.00 47.58  ? 586  GLU B O   1 
ATOM   4435 C CB  . GLU B 1 226 ? 26.754 -18.793 -8.524  1.00 49.24  ? 586  GLU B CB  1 
ATOM   4436 C CG  . GLU B 1 226 ? 25.425 -18.797 -7.765  1.00 50.90  ? 586  GLU B CG  1 
ATOM   4437 C CD  . GLU B 1 226 ? 25.402 -17.775 -6.621  1.00 51.29  ? 586  GLU B CD  1 
ATOM   4438 O OE1 . GLU B 1 226 ? 26.384 -17.008 -6.494  1.00 53.11  ? 586  GLU B OE1 1 
ATOM   4439 O OE2 . GLU B 1 226 ? 24.403 -17.739 -5.853  1.00 53.58  ? 586  GLU B OE2 1 
ATOM   4440 N N   . LEU B 1 227 ? 29.151 -19.783 -10.296 1.00 47.98  ? 587  LEU B N   1 
ATOM   4441 C CA  . LEU B 1 227 ? 30.386 -19.623 -11.024 1.00 48.18  ? 587  LEU B CA  1 
ATOM   4442 C C   . LEU B 1 227 ? 30.272 -19.981 -12.514 1.00 47.60  ? 587  LEU B C   1 
ATOM   4443 O O   . LEU B 1 227 ? 30.669 -19.198 -13.371 1.00 47.96  ? 587  LEU B O   1 
ATOM   4444 C CB  . LEU B 1 227 ? 31.505 -20.405 -10.345 1.00 47.84  ? 587  LEU B CB  1 
ATOM   4445 C CG  . LEU B 1 227 ? 32.801 -20.560 -11.126 1.00 49.33  ? 587  LEU B CG  1 
ATOM   4446 C CD1 . LEU B 1 227 ? 33.552 -19.230 -11.230 1.00 46.95  ? 587  LEU B CD1 1 
ATOM   4447 C CD2 . LEU B 1 227 ? 33.676 -21.676 -10.498 1.00 49.54  ? 587  LEU B CD2 1 
ATOM   4448 N N   . PHE B 1 228 ? 29.732 -21.153 -12.809 1.00 47.41  ? 588  PHE B N   1 
ATOM   4449 C CA  . PHE B 1 228 ? 29.519 -21.601 -14.192 1.00 47.30  ? 588  PHE B CA  1 
ATOM   4450 C C   . PHE B 1 228 ? 28.538 -20.719 -14.991 1.00 47.16  ? 588  PHE B C   1 
ATOM   4451 O O   . PHE B 1 228 ? 28.766 -20.459 -16.169 1.00 46.65  ? 588  PHE B O   1 
ATOM   4452 C CB  . PHE B 1 228 ? 29.051 -23.068 -14.213 1.00 47.59  ? 588  PHE B CB  1 
ATOM   4453 C CG  . PHE B 1 228 ? 30.132 -24.065 -13.841 1.00 47.78  ? 588  PHE B CG  1 
ATOM   4454 C CD1 . PHE B 1 228 ? 31.441 -23.655 -13.633 1.00 47.67  ? 588  PHE B CD1 1 
ATOM   4455 C CD2 . PHE B 1 228 ? 29.840 -25.428 -13.770 1.00 48.98  ? 588  PHE B CD2 1 
ATOM   4456 C CE1 . PHE B 1 228 ? 32.447 -24.580 -13.303 1.00 50.19  ? 588  PHE B CE1 1 
ATOM   4457 C CE2 . PHE B 1 228 ? 30.832 -26.368 -13.459 1.00 48.50  ? 588  PHE B CE2 1 
ATOM   4458 C CZ  . PHE B 1 228 ? 32.132 -25.946 -13.216 1.00 48.55  ? 588  PHE B CZ  1 
ATOM   4459 N N   . HIS B 1 229 ? 27.450 -20.285 -14.348 1.00 46.79  ? 589  HIS B N   1 
ATOM   4460 C CA  . HIS B 1 229 ? 26.550 -19.278 -14.915 1.00 47.20  ? 589  HIS B CA  1 
ATOM   4461 C C   . HIS B 1 229 ? 27.286 -17.960 -15.208 1.00 47.40  ? 589  HIS B C   1 
ATOM   4462 O O   . HIS B 1 229 ? 27.129 -17.377 -16.271 1.00 47.60  ? 589  HIS B O   1 
ATOM   4463 C CB  . HIS B 1 229 ? 25.382 -19.020 -13.964 1.00 47.31  ? 589  HIS B CB  1 
ATOM   4464 C CG  . HIS B 1 229 ? 24.363 -18.064 -14.506 1.00 48.45  ? 589  HIS B CG  1 
ATOM   4465 N ND1 . HIS B 1 229 ? 24.489 -16.693 -14.389 1.00 48.05  ? 589  HIS B ND1 1 
ATOM   4466 C CD2 . HIS B 1 229 ? 23.202 -18.281 -15.168 1.00 48.39  ? 589  HIS B CD2 1 
ATOM   4467 C CE1 . HIS B 1 229 ? 23.453 -16.107 -14.961 1.00 47.89  ? 589  HIS B CE1 1 
ATOM   4468 N NE2 . HIS B 1 229 ? 22.656 -17.048 -15.439 1.00 50.02  ? 589  HIS B NE2 1 
ATOM   4469 N N   . SER B 1 230 ? 28.095 -17.504 -14.258 1.00 47.31  ? 590  SER B N   1 
ATOM   4470 C CA  . SER B 1 230 ? 28.925 -16.318 -14.436 1.00 47.68  ? 590  SER B CA  1 
ATOM   4471 C C   . SER B 1 230 ? 29.868 -16.454 -15.656 1.00 47.62  ? 590  SER B C   1 
ATOM   4472 O O   . SER B 1 230 ? 29.973 -15.533 -16.474 1.00 47.08  ? 590  SER B O   1 
ATOM   4473 C CB  . SER B 1 230 ? 29.671 -16.024 -13.130 1.00 47.59  ? 590  SER B CB  1 
ATOM   4474 O OG  . SER B 1 230 ? 30.796 -15.199 -13.318 1.00 50.13  ? 590  SER B OG  1 
ATOM   4475 N N   . ILE B 1 231 ? 30.506 -17.619 -15.796 1.00 47.76  ? 591  ILE B N   1 
ATOM   4476 C CA  . ILE B 1 231 ? 31.409 -17.898 -16.923 1.00 47.58  ? 591  ILE B CA  1 
ATOM   4477 C C   . ILE B 1 231 ? 30.671 -17.870 -18.262 1.00 48.54  ? 591  ILE B C   1 
ATOM   4478 O O   . ILE B 1 231 ? 31.175 -17.319 -19.248 1.00 48.35  ? 591  ILE B O   1 
ATOM   4479 C CB  . ILE B 1 231 ? 32.168 -19.225 -16.720 1.00 47.67  ? 591  ILE B CB  1 
ATOM   4480 C CG1 . ILE B 1 231 ? 33.133 -19.101 -15.521 1.00 46.69  ? 591  ILE B CG1 1 
ATOM   4481 C CG2 . ILE B 1 231 ? 32.885 -19.677 -18.024 1.00 47.65  ? 591  ILE B CG2 1 
ATOM   4482 C CD1 . ILE B 1 231 ? 33.615 -20.425 -14.935 1.00 47.15  ? 591  ILE B CD1 1 
ATOM   4483 N N   . ARG B 1 232 ? 29.467 -18.449 -18.280 1.00 49.13  ? 592  ARG B N   1 
ATOM   4484 C CA  . ARG B 1 232 ? 28.664 -18.537 -19.485 1.00 49.81  ? 592  ARG B CA  1 
ATOM   4485 C C   . ARG B 1 232 ? 27.956 -17.215 -19.852 1.00 50.54  ? 592  ARG B C   1 
ATOM   4486 O O   . ARG B 1 232 ? 27.821 -16.905 -21.032 1.00 50.87  ? 592  ARG B O   1 
ATOM   4487 C CB  . ARG B 1 232 ? 27.621 -19.653 -19.354 1.00 50.00  ? 592  ARG B CB  1 
ATOM   4488 C CG  . ARG B 1 232 ? 28.146 -21.090 -19.422 1.00 49.30  ? 592  ARG B CG  1 
ATOM   4489 C CD  . ARG B 1 232 ? 26.957 -22.082 -19.380 1.00 50.65  ? 592  ARG B CD  1 
ATOM   4490 N NE  . ARG B 1 232 ? 26.329 -22.198 -18.059 1.00 50.36  ? 592  ARG B NE  1 
ATOM   4491 C CZ  . ARG B 1 232 ? 25.176 -21.631 -17.711 1.00 50.89  ? 592  ARG B CZ  1 
ATOM   4492 N NH1 . ARG B 1 232 ? 24.499 -20.892 -18.583 1.00 52.06  ? 592  ARG B NH1 1 
ATOM   4493 N NH2 . ARG B 1 232 ? 24.696 -21.794 -16.483 1.00 49.87  ? 592  ARG B NH2 1 
ATOM   4494 N N   . MET B 1 233 ? 27.524 -16.441 -18.854 1.00 50.94  ? 593  MET B N   1 
ATOM   4495 C CA  . MET B 1 233 ? 26.569 -15.349 -19.084 1.00 52.00  ? 593  MET B CA  1 
ATOM   4496 C C   . MET B 1 233 ? 27.028 -13.911 -18.783 1.00 51.81  ? 593  MET B C   1 
ATOM   4497 O O   . MET B 1 233 ? 26.491 -12.969 -19.360 1.00 51.55  ? 593  MET B O   1 
ATOM   4498 C CB  . MET B 1 233 ? 25.252 -15.613 -18.322 1.00 52.20  ? 593  MET B CB  1 
ATOM   4499 C CG  . MET B 1 233 ? 24.662 -17.001 -18.488 1.00 54.21  ? 593  MET B CG  1 
ATOM   4500 S SD  . MET B 1 233 ? 24.060 -17.337 -20.151 1.00 59.16  ? 593  MET B SD  1 
ATOM   4501 C CE  . MET B 1 233 ? 22.779 -16.079 -20.312 1.00 60.15  ? 593  MET B CE  1 
ATOM   4502 N N   . ASP B 1 234 ? 28.000 -13.746 -17.882 1.00 51.88  ? 594  ASP B N   1 
ATOM   4503 C CA  . ASP B 1 234 ? 28.275 -12.442 -17.283 1.00 51.64  ? 594  ASP B CA  1 
ATOM   4504 C C   . ASP B 1 234 ? 29.534 -11.773 -17.809 1.00 51.52  ? 594  ASP B C   1 
ATOM   4505 O O   . ASP B 1 234 ? 30.415 -12.428 -18.361 1.00 52.06  ? 594  ASP B O   1 
ATOM   4506 C CB  . ASP B 1 234 ? 28.333 -12.564 -15.750 1.00 51.80  ? 594  ASP B CB  1 
ATOM   4507 C CG  . ASP B 1 234 ? 26.979 -12.959 -15.138 1.00 53.23  ? 594  ASP B CG  1 
ATOM   4508 O OD1 . ASP B 1 234 ? 25.937 -12.847 -15.832 1.00 53.74  ? 594  ASP B OD1 1 
ATOM   4509 O OD2 . ASP B 1 234 ? 26.950 -13.385 -13.961 1.00 54.25  ? 594  ASP B OD2 1 
ATOM   4510 N N   . ASN B 1 235 ? 29.608 -10.458 -17.633 1.00 51.02  ? 595  ASN B N   1 
ATOM   4511 C CA  . ASN B 1 235 ? 30.822 -9.702  -17.900 1.00 50.53  ? 595  ASN B CA  1 
ATOM   4512 C C   . ASN B 1 235 ? 31.608 -9.511  -16.608 1.00 49.63  ? 595  ASN B C   1 
ATOM   4513 O O   . ASN B 1 235 ? 31.009 -9.220  -15.558 1.00 49.47  ? 595  ASN B O   1 
ATOM   4514 C CB  . ASN B 1 235 ? 30.488 -8.338  -18.498 1.00 51.04  ? 595  ASN B CB  1 
ATOM   4515 C CG  . ASN B 1 235 ? 29.858 -8.430  -19.888 1.00 53.25  ? 595  ASN B CG  1 
ATOM   4516 O OD1 . ASN B 1 235 ? 30.376 -9.106  -20.784 1.00 55.97  ? 595  ASN B OD1 1 
ATOM   4517 N ND2 . ASN B 1 235 ? 28.753 -7.717  -20.080 1.00 53.21  ? 595  ASN B ND2 1 
ATOM   4518 N N   . PRO B 1 236 ? 32.945 -9.684  -16.667 1.00 48.59  ? 596  PRO B N   1 
ATOM   4519 C CA  . PRO B 1 236 ? 33.765 -9.361  -15.495 1.00 48.25  ? 596  PRO B CA  1 
ATOM   4520 C C   . PRO B 1 236 ? 33.756 -7.864  -15.190 1.00 47.84  ? 596  PRO B C   1 
ATOM   4521 O O   . PRO B 1 236 ? 33.610 -7.035  -16.091 1.00 47.39  ? 596  PRO B O   1 
ATOM   4522 C CB  . PRO B 1 236 ? 35.191 -9.785  -15.896 1.00 47.60  ? 596  PRO B CB  1 
ATOM   4523 C CG  . PRO B 1 236 ? 35.111 -10.373 -17.222 1.00 48.06  ? 596  PRO B CG  1 
ATOM   4524 C CD  . PRO B 1 236 ? 33.747 -10.180 -17.801 1.00 48.65  ? 596  PRO B CD  1 
ATOM   4525 N N   . PHE B 1 237 ? 33.931 -7.549  -13.917 1.00 47.29  ? 597  PHE B N   1 
ATOM   4526 C CA  . PHE B 1 237 ? 34.120 -6.202  -13.478 1.00 46.34  ? 597  PHE B CA  1 
ATOM   4527 C C   . PHE B 1 237 ? 35.482 -5.659  -13.910 1.00 46.38  ? 597  PHE B C   1 
ATOM   4528 O O   . PHE B 1 237 ? 36.520 -6.268  -13.636 1.00 47.36  ? 597  PHE B O   1 
ATOM   4529 C CB  . PHE B 1 237 ? 33.992 -6.142  -11.959 1.00 46.05  ? 597  PHE B CB  1 
ATOM   4530 C CG  . PHE B 1 237 ? 34.171 -4.741  -11.395 1.00 46.76  ? 597  PHE B CG  1 
ATOM   4531 C CD1 . PHE B 1 237 ? 33.220 -3.741  -11.662 1.00 44.34  ? 597  PHE B CD1 1 
ATOM   4532 C CD2 . PHE B 1 237 ? 35.268 -4.433  -10.602 1.00 42.58  ? 597  PHE B CD2 1 
ATOM   4533 C CE1 . PHE B 1 237 ? 33.381 -2.439  -11.149 1.00 44.61  ? 597  PHE B CE1 1 
ATOM   4534 C CE2 . PHE B 1 237 ? 35.436 -3.132  -10.087 1.00 44.86  ? 597  PHE B CE2 1 
ATOM   4535 C CZ  . PHE B 1 237 ? 34.487 -2.134  -10.367 1.00 43.91  ? 597  PHE B CZ  1 
ATOM   4536 N N   . TYR B 1 238 ? 35.472 -4.507  -14.580 1.00 45.75  ? 598  TYR B N   1 
ATOM   4537 C CA  . TYR B 1 238 ? 36.691 -3.804  -14.967 1.00 44.77  ? 598  TYR B CA  1 
ATOM   4538 C C   . TYR B 1 238 ? 36.818 -2.523  -14.140 1.00 44.15  ? 598  TYR B C   1 
ATOM   4539 O O   . TYR B 1 238 ? 36.038 -1.581  -14.326 1.00 43.12  ? 598  TYR B O   1 
ATOM   4540 C CB  . TYR B 1 238 ? 36.647 -3.454  -16.458 1.00 45.07  ? 598  TYR B CB  1 
ATOM   4541 C CG  . TYR B 1 238 ? 36.613 -4.674  -17.350 1.00 45.13  ? 598  TYR B CG  1 
ATOM   4542 C CD1 . TYR B 1 238 ? 35.510 -4.942  -18.147 1.00 45.26  ? 598  TYR B CD1 1 
ATOM   4543 C CD2 . TYR B 1 238 ? 37.687 -5.562  -17.388 1.00 45.52  ? 598  TYR B CD2 1 
ATOM   4544 C CE1 . TYR B 1 238 ? 35.475 -6.064  -18.965 1.00 46.20  ? 598  TYR B CE1 1 
ATOM   4545 C CE2 . TYR B 1 238 ? 37.664 -6.686  -18.204 1.00 46.22  ? 598  TYR B CE2 1 
ATOM   4546 C CZ  . TYR B 1 238 ? 36.549 -6.936  -18.985 1.00 45.38  ? 598  TYR B CZ  1 
ATOM   4547 O OH  . TYR B 1 238 ? 36.510 -8.043  -19.800 1.00 45.11  ? 598  TYR B OH  1 
ATOM   4548 N N   . PRO B 1 239 ? 37.776 -2.498  -13.201 1.00 43.88  ? 599  PRO B N   1 
ATOM   4549 C CA  . PRO B 1 239 ? 37.945 -1.317  -12.340 1.00 43.67  ? 599  PRO B CA  1 
ATOM   4550 C C   . PRO B 1 239 ? 38.152 -0.062  -13.174 1.00 43.45  ? 599  PRO B C   1 
ATOM   4551 O O   . PRO B 1 239 ? 38.783 -0.130  -14.237 1.00 43.95  ? 599  PRO B O   1 
ATOM   4552 C CB  . PRO B 1 239 ? 39.201 -1.638  -11.514 1.00 43.64  ? 599  PRO B CB  1 
ATOM   4553 C CG  . PRO B 1 239 ? 39.342 -3.156  -11.589 1.00 43.56  ? 599  PRO B CG  1 
ATOM   4554 C CD  . PRO B 1 239 ? 38.739 -3.578  -12.894 1.00 43.49  ? 599  PRO B CD  1 
ATOM   4555 N N   . ARG B 1 240 ? 37.610 1.067   -12.713 1.00 42.75  ? 600  ARG B N   1 
ATOM   4556 C CA  . ARG B 1 240 ? 37.685 2.336   -13.482 1.00 42.48  ? 600  ARG B CA  1 
ATOM   4557 C C   . ARG B 1 240 ? 39.120 2.843   -13.770 1.00 42.13  ? 600  ARG B C   1 
ATOM   4558 O O   . ARG B 1 240 ? 39.328 3.583   -14.735 1.00 42.52  ? 600  ARG B O   1 
ATOM   4559 C CB  . ARG B 1 240 ? 36.840 3.434   -12.812 1.00 42.16  ? 600  ARG B CB  1 
ATOM   4560 C CG  . ARG B 1 240 ? 37.250 3.731   -11.350 1.00 42.33  ? 600  ARG B CG  1 
ATOM   4561 C CD  . ARG B 1 240 ? 36.311 4.732   -10.680 1.00 42.11  ? 600  ARG B CD  1 
ATOM   4562 N NE  . ARG B 1 240 ? 36.762 5.009   -9.318  1.00 40.05  ? 600  ARG B NE  1 
ATOM   4563 C CZ  . ARG B 1 240 ? 36.336 6.015   -8.563  1.00 37.61  ? 600  ARG B CZ  1 
ATOM   4564 N NH1 . ARG B 1 240 ? 35.420 6.850   -9.013  1.00 37.92  ? 600  ARG B NH1 1 
ATOM   4565 N NH2 . ARG B 1 240 ? 36.824 6.178   -7.342  1.00 36.54  ? 600  ARG B NH2 1 
ATOM   4566 N N   . TRP B 1 241 ? 40.091 2.455   -12.945 1.00 41.32  ? 601  TRP B N   1 
ATOM   4567 C CA  . TRP B 1 241 ? 41.501 2.815   -13.174 1.00 41.68  ? 601  TRP B CA  1 
ATOM   4568 C C   . TRP B 1 241 ? 42.209 1.977   -14.257 1.00 42.31  ? 601  TRP B C   1 
ATOM   4569 O O   . TRP B 1 241 ? 43.311 2.335   -14.669 1.00 42.75  ? 601  TRP B O   1 
ATOM   4570 C CB  . TRP B 1 241 ? 42.328 2.753   -11.862 1.00 40.82  ? 601  TRP B CB  1 
ATOM   4571 C CG  . TRP B 1 241 ? 42.190 1.418   -11.093 1.00 40.75  ? 601  TRP B CG  1 
ATOM   4572 C CD1 . TRP B 1 241 ? 41.414 1.190   -9.988  1.00 38.54  ? 601  TRP B CD1 1 
ATOM   4573 C CD2 . TRP B 1 241 ? 42.842 0.174   -11.384 1.00 39.02  ? 601  TRP B CD2 1 
ATOM   4574 N NE1 . TRP B 1 241 ? 41.535 -0.102  -9.580  1.00 39.99  ? 601  TRP B NE1 1 
ATOM   4575 C CE2 . TRP B 1 241 ? 42.408 -0.755  -10.414 1.00 41.04  ? 601  TRP B CE2 1 
ATOM   4576 C CE3 . TRP B 1 241 ? 43.754 -0.246  -12.364 1.00 38.95  ? 601  TRP B CE3 1 
ATOM   4577 C CZ2 . TRP B 1 241 ? 42.843 -2.086  -10.402 1.00 41.27  ? 601  TRP B CZ2 1 
ATOM   4578 C CZ3 . TRP B 1 241 ? 44.179 -1.580  -12.364 1.00 40.10  ? 601  TRP B CZ3 1 
ATOM   4579 C CH2 . TRP B 1 241 ? 43.734 -2.477  -11.383 1.00 40.37  ? 601  TRP B CH2 1 
ATOM   4580 N N   . LEU B 1 242 ? 41.611 0.858   -14.687 1.00 42.44  ? 602  LEU B N   1 
ATOM   4581 C CA  . LEU B 1 242 ? 42.257 -0.047  -15.645 1.00 42.91  ? 602  LEU B CA  1 
ATOM   4582 C C   . LEU B 1 242 ? 42.479 0.628   -16.985 1.00 43.46  ? 602  LEU B C   1 
ATOM   4583 O O   . LEU B 1 242 ? 41.550 1.172   -17.567 1.00 43.69  ? 602  LEU B O   1 
ATOM   4584 C CB  . LEU B 1 242 ? 41.457 -1.363  -15.828 1.00 42.81  ? 602  LEU B CB  1 
ATOM   4585 C CG  . LEU B 1 242 ? 42.038 -2.496  -16.711 1.00 42.97  ? 602  LEU B CG  1 
ATOM   4586 C CD1 . LEU B 1 242 ? 43.368 -3.060  -16.178 1.00 43.10  ? 602  LEU B CD1 1 
ATOM   4587 C CD2 . LEU B 1 242 ? 41.055 -3.648  -16.921 1.00 43.42  ? 602  LEU B CD2 1 
ATOM   4588 N N   . GLU B 1 243 ? 43.710 0.573   -17.482 1.00 44.25  ? 603  GLU B N   1 
ATOM   4589 C CA  . GLU B 1 243 ? 44.062 1.219   -18.748 1.00 44.94  ? 603  GLU B CA  1 
ATOM   4590 C C   . GLU B 1 243 ? 43.262 0.635   -19.901 1.00 45.18  ? 603  GLU B C   1 
ATOM   4591 O O   . GLU B 1 243 ? 43.000 -0.567  -19.938 1.00 44.55  ? 603  GLU B O   1 
ATOM   4592 C CB  . GLU B 1 243 ? 45.566 1.079   -19.037 1.00 45.32  ? 603  GLU B CB  1 
ATOM   4593 C CG  . GLU B 1 243 ? 46.475 1.891   -18.090 1.00 46.56  ? 603  GLU B CG  1 
ATOM   4594 C CD  . GLU B 1 243 ? 46.728 1.191   -16.732 1.00 47.69  ? 603  GLU B CD  1 
ATOM   4595 O OE1 . GLU B 1 243 ? 46.222 0.061   -16.508 1.00 46.63  ? 603  GLU B OE1 1 
ATOM   4596 O OE2 . GLU B 1 243 ? 47.440 1.788   -15.890 1.00 47.76  ? 603  GLU B OE2 1 
ATOM   4597 N N   . LYS B 1 244 ? 42.932 1.500   -20.855 1.00 45.89  ? 604  LYS B N   1 
ATOM   4598 C CA  . LYS B 1 244 ? 42.054 1.179   -21.981 1.00 47.14  ? 604  LYS B CA  1 
ATOM   4599 C C   . LYS B 1 244 ? 42.565 0.020   -22.832 1.00 46.78  ? 604  LYS B C   1 
ATOM   4600 O O   . LYS B 1 244 ? 41.781 -0.793  -23.310 1.00 47.13  ? 604  LYS B O   1 
ATOM   4601 C CB  . LYS B 1 244 ? 41.835 2.431   -22.856 1.00 47.12  ? 604  LYS B CB  1 
ATOM   4602 C CG  . LYS B 1 244 ? 41.056 2.145   -24.142 1.00 48.96  ? 604  LYS B CG  1 
ATOM   4603 C CD  . LYS B 1 244 ? 41.002 3.306   -25.124 1.00 49.19  ? 604  LYS B CD  1 
ATOM   4604 C CE  . LYS B 1 244 ? 39.936 3.011   -26.179 1.00 51.19  ? 604  LYS B CE  1 
ATOM   4605 N NZ  . LYS B 1 244 ? 39.765 4.107   -27.197 1.00 50.95  ? 604  LYS B NZ  1 
ATOM   4606 N N   . GLU B 1 245 ? 43.876 -0.053  -23.023 1.00 47.07  ? 605  GLU B N   1 
ATOM   4607 C CA  . GLU B 1 245 ? 44.477 -1.109  -23.842 1.00 47.45  ? 605  GLU B CA  1 
ATOM   4608 C C   . GLU B 1 245 ? 44.327 -2.469  -23.181 1.00 47.40  ? 605  GLU B C   1 
ATOM   4609 O O   . GLU B 1 245 ? 44.025 -3.449  -23.861 1.00 47.69  ? 605  GLU B O   1 
ATOM   4610 C CB  . GLU B 1 245 ? 45.954 -0.817  -24.151 1.00 47.55  ? 605  GLU B CB  1 
ATOM   4611 C CG  . GLU B 1 245 ? 46.177 0.481   -24.944 1.00 49.21  ? 605  GLU B CG  1 
ATOM   4612 C CD  . GLU B 1 245 ? 46.161 1.744   -24.067 1.00 51.94  ? 605  GLU B CD  1 
ATOM   4613 O OE1 . GLU B 1 245 ? 46.021 1.635   -22.822 1.00 51.60  ? 605  GLU B OE1 1 
ATOM   4614 O OE2 . GLU B 1 245 ? 46.289 2.857   -24.631 1.00 54.07  ? 605  GLU B OE2 1 
ATOM   4615 N N   . ALA B 1 246 ? 44.504 -2.512  -21.861 1.00 47.00  ? 606  ALA B N   1 
ATOM   4616 C CA  . ALA B 1 246 ? 44.433 -3.767  -21.101 1.00 47.50  ? 606  ALA B CA  1 
ATOM   4617 C C   . ALA B 1 246 ? 42.994 -4.288  -20.998 1.00 47.94  ? 606  ALA B C   1 
ATOM   4618 O O   . ALA B 1 246 ? 42.774 -5.496  -21.064 1.00 48.47  ? 606  ALA B O   1 
ATOM   4619 C CB  . ALA B 1 246 ? 45.032 -3.600  -19.717 1.00 46.28  ? 606  ALA B CB  1 
ATOM   4620 N N   . LYS B 1 247 ? 42.036 -3.375  -20.815 1.00 48.18  ? 607  LYS B N   1 
ATOM   4621 C CA  . LYS B 1 247 ? 40.616 -3.707  -20.810 1.00 48.70  ? 607  LYS B CA  1 
ATOM   4622 C C   . LYS B 1 247 ? 40.176 -4.257  -22.165 1.00 48.52  ? 607  LYS B C   1 
ATOM   4623 O O   . LYS B 1 247 ? 39.430 -5.241  -22.226 1.00 48.93  ? 607  LYS B O   1 
ATOM   4624 C CB  . LYS B 1 247 ? 39.757 -2.470  -20.473 1.00 48.90  ? 607  LYS B CB  1 
ATOM   4625 C CG  . LYS B 1 247 ? 38.279 -2.807  -20.419 1.00 48.45  ? 607  LYS B CG  1 
ATOM   4626 C CD  . LYS B 1 247 ? 37.355 -1.628  -20.203 1.00 49.42  ? 607  LYS B CD  1 
ATOM   4627 C CE  . LYS B 1 247 ? 35.960 -2.021  -20.697 1.00 51.50  ? 607  LYS B CE  1 
ATOM   4628 N NZ  . LYS B 1 247 ? 34.862 -1.386  -19.929 1.00 55.10  ? 607  LYS B NZ  1 
ATOM   4629 N N   . ASP B 1 248 ? 40.631 -3.610  -23.238 1.00 47.53  ? 608  ASP B N   1 
ATOM   4630 C CA  . ASP B 1 248 ? 40.306 -4.023  -24.600 1.00 47.64  ? 608  ASP B CA  1 
ATOM   4631 C C   . ASP B 1 248 ? 40.785 -5.435  -24.936 1.00 47.17  ? 608  ASP B C   1 
ATOM   4632 O O   . ASP B 1 248 ? 40.025 -6.224  -25.479 1.00 47.50  ? 608  ASP B O   1 
ATOM   4633 C CB  . ASP B 1 248 ? 40.852 -3.022  -25.618 1.00 47.87  ? 608  ASP B CB  1 
ATOM   4634 C CG  . ASP B 1 248 ? 40.389 -3.310  -27.034 1.00 50.11  ? 608  ASP B CG  1 
ATOM   4635 O OD1 . ASP B 1 248 ? 39.166 -3.174  -27.329 1.00 54.32  ? 608  ASP B OD1 1 
ATOM   4636 O OD2 . ASP B 1 248 ? 41.254 -3.653  -27.866 1.00 51.96  ? 608  ASP B OD2 1 
ATOM   4637 N N   . LEU B 1 249 ? 42.038 -5.753  -24.616 1.00 46.30  ? 609  LEU B N   1 
ATOM   4638 C CA  . LEU B 1 249 ? 42.542 -7.120  -24.770 1.00 45.71  ? 609  LEU B CA  1 
ATOM   4639 C C   . LEU B 1 249 ? 41.692 -8.132  -23.999 1.00 44.81  ? 609  LEU B C   1 
ATOM   4640 O O   . LEU B 1 249 ? 41.322 -9.159  -24.551 1.00 45.34  ? 609  LEU B O   1 
ATOM   4641 C CB  . LEU B 1 249 ? 44.022 -7.229  -24.339 1.00 45.83  ? 609  LEU B CB  1 
ATOM   4642 C CG  . LEU B 1 249 ? 44.675 -8.620  -24.437 1.00 45.25  ? 609  LEU B CG  1 
ATOM   4643 C CD1 . LEU B 1 249 ? 44.538 -9.212  -25.830 1.00 44.75  ? 609  LEU B CD1 1 
ATOM   4644 C CD2 . LEU B 1 249 ? 46.120 -8.515  -24.078 1.00 45.87  ? 609  LEU B CD2 1 
ATOM   4645 N N   . LEU B 1 250 ? 41.378 -7.837  -22.742 1.00 43.86  ? 610  LEU B N   1 
ATOM   4646 C CA  . LEU B 1 250 ? 40.535 -8.719  -21.921 1.00 44.18  ? 610  LEU B CA  1 
ATOM   4647 C C   . LEU B 1 250 ? 39.122 -8.928  -22.493 1.00 44.85  ? 610  LEU B C   1 
ATOM   4648 O O   . LEU B 1 250 ? 38.603 -10.044 -22.474 1.00 44.75  ? 610  LEU B O   1 
ATOM   4649 C CB  . LEU B 1 250 ? 40.452 -8.220  -20.476 1.00 43.49  ? 610  LEU B CB  1 
ATOM   4650 C CG  . LEU B 1 250 ? 41.743 -8.307  -19.648 1.00 45.18  ? 610  LEU B CG  1 
ATOM   4651 C CD1 . LEU B 1 250 ? 41.598 -7.568  -18.305 1.00 42.90  ? 610  LEU B CD1 1 
ATOM   4652 C CD2 . LEU B 1 250 ? 42.145 -9.776  -19.443 1.00 43.77  ? 610  LEU B CD2 1 
ATOM   4653 N N   . VAL B 1 251 ? 38.520 -7.851  -23.012 1.00 45.25  ? 611  VAL B N   1 
ATOM   4654 C CA  . VAL B 1 251 ? 37.208 -7.908  -23.648 1.00 45.06  ? 611  VAL B CA  1 
ATOM   4655 C C   . VAL B 1 251 ? 37.240 -8.834  -24.874 1.00 45.41  ? 611  VAL B C   1 
ATOM   4656 O O   . VAL B 1 251 ? 36.288 -9.619  -25.104 1.00 45.31  ? 611  VAL B O   1 
ATOM   4657 C CB  . VAL B 1 251 ? 36.693 -6.462  -23.999 1.00 45.13  ? 611  VAL B CB  1 
ATOM   4658 C CG1 . VAL B 1 251 ? 35.634 -6.483  -25.089 1.00 45.62  ? 611  VAL B CG1 1 
ATOM   4659 C CG2 . VAL B 1 251 ? 36.178 -5.733  -22.732 1.00 43.69  ? 611  VAL B CG2 1 
ATOM   4660 N N   . LYS B 1 252 ? 38.325 -8.747  -25.651 1.00 45.01  ? 612  LYS B N   1 
ATOM   4661 C CA  . LYS B 1 252 ? 38.504 -9.589  -26.850 1.00 45.33  ? 612  LYS B CA  1 
ATOM   4662 C C   . LYS B 1 252 ? 38.789 -11.062 -26.537 1.00 45.45  ? 612  LYS B C   1 
ATOM   4663 O O   . LYS B 1 252 ? 38.523 -11.926 -27.357 1.00 45.78  ? 612  LYS B O   1 
ATOM   4664 C CB  . LYS B 1 252 ? 39.609 -9.041  -27.753 1.00 45.37  ? 612  LYS B CB  1 
ATOM   4665 C CG  . LYS B 1 252 ? 39.234 -7.780  -28.514 1.00 45.98  ? 612  LYS B CG  1 
ATOM   4666 C CD  . LYS B 1 252 ? 40.446 -7.213  -29.246 1.00 47.38  ? 612  LYS B CD  1 
ATOM   4667 C CE  . LYS B 1 252 ? 40.153 -5.845  -29.906 1.00 47.12  ? 612  LYS B CE  1 
ATOM   4668 N NZ  . LYS B 1 252 ? 38.699 -5.571  -30.068 1.00 45.09  ? 612  LYS B NZ  1 
ATOM   4669 N N   . LEU B 1 253 ? 39.347 -11.331 -25.364 1.00 45.84  ? 613  LEU B N   1 
ATOM   4670 C CA  . LEU B 1 253 ? 39.661 -12.689 -24.941 1.00 46.35  ? 613  LEU B CA  1 
ATOM   4671 C C   . LEU B 1 253 ? 38.453 -13.331 -24.269 1.00 46.88  ? 613  LEU B C   1 
ATOM   4672 O O   . LEU B 1 253 ? 38.294 -14.546 -24.328 1.00 47.35  ? 613  LEU B O   1 
ATOM   4673 C CB  . LEU B 1 253 ? 40.865 -12.713 -23.985 1.00 45.98  ? 613  LEU B CB  1 
ATOM   4674 C CG  . LEU B 1 253 ? 42.235 -12.399 -24.608 1.00 46.13  ? 613  LEU B CG  1 
ATOM   4675 C CD1 . LEU B 1 253 ? 43.281 -12.047 -23.526 1.00 44.48  ? 613  LEU B CD1 1 
ATOM   4676 C CD2 . LEU B 1 253 ? 42.730 -13.541 -25.504 1.00 44.24  ? 613  LEU B CD2 1 
ATOM   4677 N N   . PHE B 1 254 ? 37.608 -12.526 -23.629 1.00 46.66  ? 614  PHE B N   1 
ATOM   4678 C CA  . PHE B 1 254 ? 36.418 -13.058 -22.975 1.00 46.84  ? 614  PHE B CA  1 
ATOM   4679 C C   . PHE B 1 254 ? 35.220 -13.191 -23.910 1.00 46.92  ? 614  PHE B C   1 
ATOM   4680 O O   . PHE B 1 254 ? 34.087 -13.326 -23.465 1.00 47.34  ? 614  PHE B O   1 
ATOM   4681 C CB  . PHE B 1 254 ? 36.077 -12.290 -21.698 1.00 46.12  ? 614  PHE B CB  1 
ATOM   4682 C CG  . PHE B 1 254 ? 37.094 -12.464 -20.603 1.00 47.58  ? 614  PHE B CG  1 
ATOM   4683 C CD1 . PHE B 1 254 ? 37.639 -13.724 -20.326 1.00 47.10  ? 614  PHE B CD1 1 
ATOM   4684 C CD2 . PHE B 1 254 ? 37.516 -11.370 -19.840 1.00 47.77  ? 614  PHE B CD2 1 
ATOM   4685 C CE1 . PHE B 1 254 ? 38.577 -13.891 -19.318 1.00 44.22  ? 614  PHE B CE1 1 
ATOM   4686 C CE2 . PHE B 1 254 ? 38.456 -11.528 -18.820 1.00 45.29  ? 614  PHE B CE2 1 
ATOM   4687 C CZ  . PHE B 1 254 ? 38.986 -12.776 -18.563 1.00 45.92  ? 614  PHE B CZ  1 
ATOM   4688 N N   . VAL B 1 255 ? 35.479 -13.181 -25.211 1.00 47.65  ? 615  VAL B N   1 
ATOM   4689 C CA  . VAL B 1 255 ? 34.431 -13.465 -26.206 1.00 47.40  ? 615  VAL B CA  1 
ATOM   4690 C C   . VAL B 1 255 ? 34.061 -14.938 -26.071 1.00 47.94  ? 615  VAL B C   1 
ATOM   4691 O O   . VAL B 1 255 ? 34.934 -15.798 -26.014 1.00 47.32  ? 615  VAL B O   1 
ATOM   4692 C CB  . VAL B 1 255 ? 34.897 -13.115 -27.631 1.00 47.25  ? 615  VAL B CB  1 
ATOM   4693 C CG1 . VAL B 1 255 ? 33.960 -13.708 -28.707 1.00 46.29  ? 615  VAL B CG1 1 
ATOM   4694 C CG2 . VAL B 1 255 ? 34.980 -11.613 -27.776 1.00 46.33  ? 615  VAL B CG2 1 
ATOM   4695 N N   . ARG B 1 256 ? 32.763 -15.217 -25.986 1.00 49.09  ? 616  ARG B N   1 
ATOM   4696 C CA  . ARG B 1 256 ? 32.290 -16.561 -25.651 1.00 50.15  ? 616  ARG B CA  1 
ATOM   4697 C C   . ARG B 1 256 ? 32.190 -17.506 -26.839 1.00 50.67  ? 616  ARG B C   1 
ATOM   4698 O O   . ARG B 1 256 ? 32.237 -18.729 -26.656 1.00 51.14  ? 616  ARG B O   1 
ATOM   4699 C CB  . ARG B 1 256 ? 30.993 -16.487 -24.855 1.00 50.31  ? 616  ARG B CB  1 
ATOM   4700 C CG  . ARG B 1 256 ? 31.281 -16.102 -23.423 1.00 51.83  ? 616  ARG B CG  1 
ATOM   4701 C CD  . ARG B 1 256 ? 30.199 -15.249 -22.813 1.00 55.58  ? 616  ARG B CD  1 
ATOM   4702 N NE  . ARG B 1 256 ? 30.308 -15.252 -21.350 1.00 59.29  ? 616  ARG B NE  1 
ATOM   4703 C CZ  . ARG B 1 256 ? 31.083 -14.454 -20.609 1.00 58.87  ? 616  ARG B CZ  1 
ATOM   4704 N NH1 . ARG B 1 256 ? 31.872 -13.516 -21.152 1.00 60.89  ? 616  ARG B NH1 1 
ATOM   4705 N NH2 . ARG B 1 256 ? 31.061 -14.595 -19.298 1.00 57.30  ? 616  ARG B NH2 1 
ATOM   4706 N N   . GLU B 1 257 ? 32.069 -16.948 -28.043 1.00 50.93  ? 617  GLU B N   1 
ATOM   4707 C CA  . GLU B 1 257 ? 32.173 -17.722 -29.281 1.00 51.80  ? 617  GLU B CA  1 
ATOM   4708 C C   . GLU B 1 257 ? 33.656 -18.009 -29.573 1.00 51.46  ? 617  GLU B C   1 
ATOM   4709 O O   . GLU B 1 257 ? 34.388 -17.110 -29.986 1.00 51.45  ? 617  GLU B O   1 
ATOM   4710 C CB  . GLU B 1 257 ? 31.537 -16.960 -30.451 1.00 51.73  ? 617  GLU B CB  1 
ATOM   4711 C CG  . GLU B 1 257 ? 30.017 -17.109 -30.559 1.00 53.19  ? 617  GLU B CG  1 
ATOM   4712 C CD  . GLU B 1 257 ? 29.438 -16.508 -31.849 1.00 53.69  ? 617  GLU B CD  1 
ATOM   4713 O OE1 . GLU B 1 257 ? 29.508 -15.268 -32.033 1.00 56.56  ? 617  GLU B OE1 1 
ATOM   4714 O OE2 . GLU B 1 257 ? 28.895 -17.275 -32.676 1.00 55.88  ? 617  GLU B OE2 1 
ATOM   4715 N N   . PRO B 1 258 ? 34.110 -19.262 -29.346 1.00 51.33  ? 618  PRO B N   1 
ATOM   4716 C CA  . PRO B 1 258 ? 35.544 -19.581 -29.468 1.00 51.13  ? 618  PRO B CA  1 
ATOM   4717 C C   . PRO B 1 258 ? 36.190 -19.178 -30.798 1.00 51.13  ? 618  PRO B C   1 
ATOM   4718 O O   . PRO B 1 258 ? 37.339 -18.764 -30.810 1.00 51.31  ? 618  PRO B O   1 
ATOM   4719 C CB  . PRO B 1 258 ? 35.588 -21.108 -29.294 1.00 51.33  ? 618  PRO B CB  1 
ATOM   4720 C CG  . PRO B 1 258 ? 34.168 -21.583 -29.465 1.00 50.94  ? 618  PRO B CG  1 
ATOM   4721 C CD  . PRO B 1 258 ? 33.322 -20.449 -28.963 1.00 51.03  ? 618  PRO B CD  1 
ATOM   4722 N N   . GLU B 1 259 ? 35.459 -19.287 -31.902 1.00 51.34  ? 619  GLU B N   1 
ATOM   4723 C CA  . GLU B 1 259 ? 36.001 -18.943 -33.217 1.00 51.48  ? 619  GLU B CA  1 
ATOM   4724 C C   . GLU B 1 259 ? 36.118 -17.427 -33.461 1.00 50.91  ? 619  GLU B C   1 
ATOM   4725 O O   . GLU B 1 259 ? 36.659 -17.004 -34.486 1.00 50.75  ? 619  GLU B O   1 
ATOM   4726 C CB  . GLU B 1 259 ? 35.201 -19.633 -34.336 1.00 52.08  ? 619  GLU B CB  1 
ATOM   4727 C CG  . GLU B 1 259 ? 35.464 -21.155 -34.460 1.00 54.65  ? 619  GLU B CG  1 
ATOM   4728 C CD  . GLU B 1 259 ? 36.958 -21.504 -34.632 1.00 57.94  ? 619  GLU B CD  1 
ATOM   4729 O OE1 . GLU B 1 259 ? 37.574 -21.025 -35.621 1.00 58.73  ? 619  GLU B OE1 1 
ATOM   4730 O OE2 . GLU B 1 259 ? 37.512 -22.255 -33.781 1.00 58.06  ? 619  GLU B OE2 1 
ATOM   4731 N N   . LYS B 1 260 ? 35.618 -16.626 -32.520 1.00 50.23  ? 620  LYS B N   1 
ATOM   4732 C CA  . LYS B 1 260 ? 35.699 -15.157 -32.594 1.00 50.08  ? 620  LYS B CA  1 
ATOM   4733 C C   . LYS B 1 260 ? 36.609 -14.553 -31.513 1.00 49.77  ? 620  LYS B C   1 
ATOM   4734 O O   . LYS B 1 260 ? 36.743 -13.336 -31.401 1.00 50.06  ? 620  LYS B O   1 
ATOM   4735 C CB  . LYS B 1 260 ? 34.298 -14.543 -32.519 1.00 50.16  ? 620  LYS B CB  1 
ATOM   4736 C CG  . LYS B 1 260 ? 33.508 -14.690 -33.804 1.00 50.84  ? 620  LYS B CG  1 
ATOM   4737 C CD  . LYS B 1 260 ? 32.072 -14.253 -33.637 1.00 51.72  ? 620  LYS B CD  1 
ATOM   4738 C CE  . LYS B 1 260 ? 31.255 -14.667 -34.858 1.00 52.75  ? 620  LYS B CE  1 
ATOM   4739 N NZ  . LYS B 1 260 ? 29.792 -14.639 -34.594 1.00 53.31  ? 620  LYS B NZ  1 
ATOM   4740 N N   . ARG B 1 261 ? 37.237 -15.423 -30.735 1.00 49.11  ? 621  ARG B N   1 
ATOM   4741 C CA  . ARG B 1 261 ? 38.127 -15.033 -29.649 1.00 49.29  ? 621  ARG B CA  1 
ATOM   4742 C C   . ARG B 1 261 ? 39.510 -14.686 -30.188 1.00 48.70  ? 621  ARG B C   1 
ATOM   4743 O O   . ARG B 1 261 ? 39.993 -15.348 -31.093 1.00 48.69  ? 621  ARG B O   1 
ATOM   4744 C CB  . ARG B 1 261 ? 38.229 -16.187 -28.661 1.00 48.91  ? 621  ARG B CB  1 
ATOM   4745 C CG  . ARG B 1 261 ? 38.787 -15.831 -27.306 1.00 50.15  ? 621  ARG B CG  1 
ATOM   4746 C CD  . ARG B 1 261 ? 37.907 -16.471 -26.239 1.00 49.06  ? 621  ARG B CD  1 
ATOM   4747 N NE  . ARG B 1 261 ? 38.179 -17.880 -26.131 1.00 48.81  ? 621  ARG B NE  1 
ATOM   4748 C CZ  . ARG B 1 261 ? 37.282 -18.836 -25.921 1.00 46.60  ? 621  ARG B CZ  1 
ATOM   4749 N NH1 . ARG B 1 261 ? 35.986 -18.586 -25.783 1.00 42.30  ? 621  ARG B NH1 1 
ATOM   4750 N NH2 . ARG B 1 261 ? 37.723 -20.074 -25.831 1.00 47.84  ? 621  ARG B NH2 1 
ATOM   4751 N N   . LEU B 1 262 ? 40.123 -13.635 -29.645 1.00 48.58  ? 622  LEU B N   1 
ATOM   4752 C CA  . LEU B 1 262 ? 41.503 -13.271 -29.978 1.00 48.45  ? 622  LEU B CA  1 
ATOM   4753 C C   . LEU B 1 262 ? 42.446 -14.406 -29.537 1.00 48.15  ? 622  LEU B C   1 
ATOM   4754 O O   . LEU B 1 262 ? 42.270 -14.981 -28.463 1.00 48.05  ? 622  LEU B O   1 
ATOM   4755 C CB  . LEU B 1 262 ? 41.896 -11.975 -29.258 1.00 48.62  ? 622  LEU B CB  1 
ATOM   4756 C CG  . LEU B 1 262 ? 42.594 -10.796 -29.967 1.00 48.74  ? 622  LEU B CG  1 
ATOM   4757 C CD1 . LEU B 1 262 ? 43.572 -10.193 -29.023 1.00 46.35  ? 622  LEU B CD1 1 
ATOM   4758 C CD2 . LEU B 1 262 ? 43.286 -11.126 -31.293 1.00 47.40  ? 622  LEU B CD2 1 
ATOM   4759 N N   . GLY B 1 263 ? 43.440 -14.711 -30.362 1.00 48.09  ? 623  GLY B N   1 
ATOM   4760 C CA  . GLY B 1 263 ? 44.295 -15.870 -30.165 1.00 48.35  ? 623  GLY B CA  1 
ATOM   4761 C C   . GLY B 1 263 ? 43.858 -16.969 -31.111 1.00 49.20  ? 623  GLY B C   1 
ATOM   4762 O O   . GLY B 1 263 ? 44.685 -17.612 -31.751 1.00 49.17  ? 623  GLY B O   1 
ATOM   4763 N N   . VAL B 1 264 ? 42.546 -17.182 -31.203 1.00 50.13  ? 624  VAL B N   1 
ATOM   4764 C CA  . VAL B 1 264 ? 41.962 -18.047 -32.244 1.00 50.90  ? 624  VAL B CA  1 
ATOM   4765 C C   . VAL B 1 264 ? 41.861 -17.265 -33.558 1.00 51.84  ? 624  VAL B C   1 
ATOM   4766 O O   . VAL B 1 264 ? 42.324 -17.721 -34.598 1.00 52.06  ? 624  VAL B O   1 
ATOM   4767 C CB  . VAL B 1 264 ? 40.569 -18.600 -31.828 1.00 50.86  ? 624  VAL B CB  1 
ATOM   4768 C CG1 . VAL B 1 264 ? 40.126 -19.763 -32.746 1.00 50.26  ? 624  VAL B CG1 1 
ATOM   4769 C CG2 . VAL B 1 264 ? 40.587 -19.044 -30.376 1.00 50.17  ? 624  VAL B CG2 1 
ATOM   4770 N N   . ARG B 1 265 ? 41.269 -16.075 -33.492 1.00 53.34  ? 625  ARG B N   1 
ATOM   4771 C CA  . ARG B 1 265 ? 41.142 -15.178 -34.651 1.00 54.85  ? 625  ARG B CA  1 
ATOM   4772 C C   . ARG B 1 265 ? 42.130 -14.002 -34.527 1.00 54.95  ? 625  ARG B C   1 
ATOM   4773 O O   . ARG B 1 265 ? 42.460 -13.580 -33.424 1.00 55.82  ? 625  ARG B O   1 
ATOM   4774 C CB  . ARG B 1 265 ? 39.695 -14.671 -34.759 1.00 55.04  ? 625  ARG B CB  1 
ATOM   4775 C CG  . ARG B 1 265 ? 39.477 -13.517 -35.756 1.00 58.23  ? 625  ARG B CG  1 
ATOM   4776 C CD  . ARG B 1 265 ? 38.446 -12.478 -35.272 1.00 61.20  ? 625  ARG B CD  1 
ATOM   4777 N NE  . ARG B 1 265 ? 38.622 -12.087 -33.867 1.00 63.24  ? 625  ARG B NE  1 
ATOM   4778 C CZ  . ARG B 1 265 ? 39.417 -11.107 -33.431 1.00 64.71  ? 625  ARG B CZ  1 
ATOM   4779 N NH1 . ARG B 1 265 ? 40.150 -10.394 -34.284 1.00 65.73  ? 625  ARG B NH1 1 
ATOM   4780 N NH2 . ARG B 1 265 ? 39.472 -10.831 -32.132 1.00 63.51  ? 625  ARG B NH2 1 
ATOM   4781 N N   . GLY B 1 266 ? 42.620 -13.506 -35.657 1.00 55.25  ? 626  GLY B N   1 
ATOM   4782 C CA  . GLY B 1 266 ? 43.453 -12.306 -35.694 1.00 55.50  ? 626  GLY B CA  1 
ATOM   4783 C C   . GLY B 1 266 ? 44.891 -12.543 -35.271 1.00 55.70  ? 626  GLY B C   1 
ATOM   4784 O O   . GLY B 1 266 ? 45.384 -13.672 -35.344 1.00 56.38  ? 626  GLY B O   1 
ATOM   4785 N N   . ASP B 1 267 ? 45.563 -11.470 -34.843 1.00 55.04  ? 627  ASP B N   1 
ATOM   4786 C CA  . ASP B 1 267 ? 46.937 -11.533 -34.344 1.00 53.91  ? 627  ASP B CA  1 
ATOM   4787 C C   . ASP B 1 267 ? 46.997 -10.827 -32.996 1.00 52.99  ? 627  ASP B C   1 
ATOM   4788 O O   . ASP B 1 267 ? 46.985 -9.592  -32.921 1.00 53.00  ? 627  ASP B O   1 
ATOM   4789 C CB  . ASP B 1 267 ? 47.933 -10.904 -35.344 1.00 53.94  ? 627  ASP B CB  1 
ATOM   4790 C CG  . ASP B 1 267 ? 49.410 -11.226 -35.013 1.00 54.35  ? 627  ASP B CG  1 
ATOM   4791 O OD1 . ASP B 1 267 ? 49.693 -11.843 -33.954 1.00 54.55  ? 627  ASP B OD1 1 
ATOM   4792 O OD2 . ASP B 1 267 ? 50.301 -10.861 -35.819 1.00 54.47  ? 627  ASP B OD2 1 
ATOM   4793 N N   . ILE B 1 268 ? 47.049 -11.633 -31.940 1.00 51.98  ? 628  ILE B N   1 
ATOM   4794 C CA  . ILE B 1 268 ? 47.140 -11.155 -30.562 1.00 51.20  ? 628  ILE B CA  1 
ATOM   4795 C C   . ILE B 1 268 ? 48.423 -10.356 -30.294 1.00 50.50  ? 628  ILE B C   1 
ATOM   4796 O O   . ILE B 1 268 ? 48.453 -9.519  -29.387 1.00 50.33  ? 628  ILE B O   1 
ATOM   4797 C CB  . ILE B 1 268 ? 47.004 -12.327 -29.554 1.00 51.18  ? 628  ILE B CB  1 
ATOM   4798 C CG1 . ILE B 1 268 ? 46.823 -11.800 -28.117 1.00 51.73  ? 628  ILE B CG1 1 
ATOM   4799 C CG2 . ILE B 1 268 ? 48.178 -13.324 -29.706 1.00 51.05  ? 628  ILE B CG2 1 
ATOM   4800 C CD1 . ILE B 1 268 ? 46.266 -12.832 -27.109 1.00 51.00  ? 628  ILE B CD1 1 
ATOM   4801 N N   . ARG B 1 269 ? 49.464 -10.619 -31.088 1.00 49.64  ? 629  ARG B N   1 
ATOM   4802 C CA  . ARG B 1 269 ? 50.749 -9.941  -30.958 1.00 49.47  ? 629  ARG B CA  1 
ATOM   4803 C C   . ARG B 1 269 ? 50.669 -8.486  -31.405 1.00 49.33  ? 629  ARG B C   1 
ATOM   4804 O O   . ARG B 1 269 ? 51.432 -7.645  -30.929 1.00 49.67  ? 629  ARG B O   1 
ATOM   4805 C CB  . ARG B 1 269 ? 51.835 -10.655 -31.771 1.00 49.48  ? 629  ARG B CB  1 
ATOM   4806 C CG  . ARG B 1 269 ? 52.346 -11.938 -31.161 1.00 49.75  ? 629  ARG B CG  1 
ATOM   4807 C CD  . ARG B 1 269 ? 53.470 -12.496 -32.013 1.00 49.87  ? 629  ARG B CD  1 
ATOM   4808 N NE  . ARG B 1 269 ? 53.753 -13.880 -31.653 1.00 51.35  ? 629  ARG B NE  1 
ATOM   4809 C CZ  . ARG B 1 269 ? 54.841 -14.558 -32.018 1.00 52.69  ? 629  ARG B CZ  1 
ATOM   4810 N NH1 . ARG B 1 269 ? 55.793 -13.984 -32.751 1.00 51.75  ? 629  ARG B NH1 1 
ATOM   4811 N NH2 . ARG B 1 269 ? 54.978 -15.821 -31.631 1.00 53.34  ? 629  ARG B NH2 1 
ATOM   4812 N N   . GLN B 1 270 ? 49.760 -8.203  -32.334 1.00 48.96  ? 630  GLN B N   1 
ATOM   4813 C CA  . GLN B 1 270 ? 49.557 -6.851  -32.811 1.00 49.05  ? 630  GLN B CA  1 
ATOM   4814 C C   . GLN B 1 270 ? 48.570 -6.054  -31.952 1.00 48.46  ? 630  GLN B C   1 
ATOM   4815 O O   . GLN B 1 270 ? 48.207 -4.947  -32.317 1.00 48.74  ? 630  GLN B O   1 
ATOM   4816 C CB  . GLN B 1 270 ? 49.155 -6.834  -34.299 1.00 49.27  ? 630  GLN B CB  1 
ATOM   4817 C CG  . GLN B 1 270 ? 50.128 -7.568  -35.244 1.00 50.70  ? 630  GLN B CG  1 
ATOM   4818 C CD  . GLN B 1 270 ? 51.558 -7.048  -35.157 1.00 53.32  ? 630  GLN B CD  1 
ATOM   4819 O OE1 . GLN B 1 270 ? 52.381 -7.571  -34.399 1.00 54.27  ? 630  GLN B OE1 1 
ATOM   4820 N NE2 . GLN B 1 270 ? 51.861 -6.007  -35.939 1.00 55.64  ? 630  GLN B NE2 1 
ATOM   4821 N N   . HIS B 1 271 ? 48.148 -6.593  -30.812 1.00 47.89  ? 631  HIS B N   1 
ATOM   4822 C CA  . HIS B 1 271 ? 47.257 -5.823  -29.944 1.00 47.82  ? 631  HIS B CA  1 
ATOM   4823 C C   . HIS B 1 271 ? 48.007 -4.623  -29.322 1.00 47.90  ? 631  HIS B C   1 
ATOM   4824 O O   . HIS B 1 271 ? 49.157 -4.775  -28.920 1.00 48.20  ? 631  HIS B O   1 
ATOM   4825 C CB  . HIS B 1 271 ? 46.588 -6.681  -28.864 1.00 47.12  ? 631  HIS B CB  1 
ATOM   4826 C CG  . HIS B 1 271 ? 45.499 -5.959  -28.132 1.00 46.88  ? 631  HIS B CG  1 
ATOM   4827 N ND1 . HIS B 1 271 ? 45.735 -5.188  -27.011 1.00 46.33  ? 631  HIS B ND1 1 
ATOM   4828 C CD2 . HIS B 1 271 ? 44.173 -5.847  -28.392 1.00 45.38  ? 631  HIS B CD2 1 
ATOM   4829 C CE1 . HIS B 1 271 ? 44.600 -4.644  -26.606 1.00 46.12  ? 631  HIS B CE1 1 
ATOM   4830 N NE2 . HIS B 1 271 ? 43.637 -5.028  -27.427 1.00 46.28  ? 631  HIS B NE2 1 
ATOM   4831 N N   . PRO B 1 272 ? 47.361 -3.432  -29.265 1.00 47.63  ? 632  PRO B N   1 
ATOM   4832 C CA  . PRO B 1 272 ? 47.948 -2.208  -28.673 1.00 47.26  ? 632  PRO B CA  1 
ATOM   4833 C C   . PRO B 1 272 ? 48.569 -2.329  -27.265 1.00 47.03  ? 632  PRO B C   1 
ATOM   4834 O O   . PRO B 1 272 ? 49.446 -1.540  -26.926 1.00 47.57  ? 632  PRO B O   1 
ATOM   4835 C CB  . PRO B 1 272 ? 46.772 -1.223  -28.656 1.00 47.60  ? 632  PRO B CB  1 
ATOM   4836 C CG  . PRO B 1 272 ? 45.886 -1.666  -29.801 1.00 47.70  ? 632  PRO B CG  1 
ATOM   4837 C CD  . PRO B 1 272 ? 46.014 -3.178  -29.828 1.00 47.56  ? 632  PRO B CD  1 
ATOM   4838 N N   . LEU B 1 273 ? 48.154 -3.297  -26.456 1.00 46.51  ? 633  LEU B N   1 
ATOM   4839 C CA  . LEU B 1 273 ? 48.806 -3.520  -25.165 1.00 45.78  ? 633  LEU B CA  1 
ATOM   4840 C C   . LEU B 1 273 ? 50.295 -3.876  -25.348 1.00 45.62  ? 633  LEU B C   1 
ATOM   4841 O O   . LEU B 1 273 ? 51.127 -3.529  -24.509 1.00 44.36  ? 633  LEU B O   1 
ATOM   4842 C CB  . LEU B 1 273 ? 48.076 -4.612  -24.346 1.00 45.71  ? 633  LEU B CB  1 
ATOM   4843 C CG  . LEU B 1 273 ? 48.588 -4.860  -22.913 1.00 45.68  ? 633  LEU B CG  1 
ATOM   4844 C CD1 . LEU B 1 273 ? 48.364 -3.613  -22.050 1.00 44.92  ? 633  LEU B CD1 1 
ATOM   4845 C CD2 . LEU B 1 273 ? 47.985 -6.103  -22.228 1.00 44.90  ? 633  LEU B CD2 1 
ATOM   4846 N N   . PHE B 1 274 ? 50.595 -4.553  -26.458 1.00 45.60  ? 634  PHE B N   1 
ATOM   4847 C CA  . PHE B 1 274 ? 51.927 -5.070  -26.770 1.00 46.90  ? 634  PHE B CA  1 
ATOM   4848 C C   . PHE B 1 274 ? 52.686 -4.206  -27.768 1.00 48.59  ? 634  PHE B C   1 
ATOM   4849 O O   . PHE B 1 274 ? 53.735 -4.607  -28.274 1.00 49.27  ? 634  PHE B O   1 
ATOM   4850 C CB  . PHE B 1 274 ? 51.821 -6.499  -27.304 1.00 46.01  ? 634  PHE B CB  1 
ATOM   4851 C CG  . PHE B 1 274 ? 51.147 -7.438  -26.351 1.00 44.91  ? 634  PHE B CG  1 
ATOM   4852 C CD1 . PHE B 1 274 ? 51.670 -7.641  -25.078 1.00 42.88  ? 634  PHE B CD1 1 
ATOM   4853 C CD2 . PHE B 1 274 ? 49.961 -8.090  -26.708 1.00 43.52  ? 634  PHE B CD2 1 
ATOM   4854 C CE1 . PHE B 1 274 ? 51.046 -8.496  -24.178 1.00 41.58  ? 634  PHE B CE1 1 
ATOM   4855 C CE2 . PHE B 1 274 ? 49.331 -8.952  -25.810 1.00 43.18  ? 634  PHE B CE2 1 
ATOM   4856 C CZ  . PHE B 1 274 ? 49.871 -9.156  -24.549 1.00 42.19  ? 634  PHE B CZ  1 
ATOM   4857 N N   . ARG B 1 275 ? 52.117 -3.036  -28.055 1.00 49.92  ? 635  ARG B N   1 
ATOM   4858 C CA  . ARG B 1 275 ? 52.729 -1.958  -28.823 1.00 51.66  ? 635  ARG B CA  1 
ATOM   4859 C C   . ARG B 1 275 ? 54.250 -1.819  -28.656 1.00 51.84  ? 635  ARG B C   1 
ATOM   4860 O O   . ARG B 1 275 ? 54.971 -1.674  -29.645 1.00 51.71  ? 635  ARG B O   1 
ATOM   4861 C CB  . ARG B 1 275 ? 52.016 -0.664  -28.423 1.00 52.02  ? 635  ARG B CB  1 
ATOM   4862 C CG  . ARG B 1 275 ? 52.453 0.592   -29.079 1.00 55.13  ? 635  ARG B CG  1 
ATOM   4863 C CD  . ARG B 1 275 ? 51.313 1.614   -29.022 1.00 60.46  ? 635  ARG B CD  1 
ATOM   4864 N NE  . ARG B 1 275 ? 50.675 1.697   -27.703 1.00 63.62  ? 635  ARG B NE  1 
ATOM   4865 C CZ  . ARG B 1 275 ? 49.402 2.056   -27.504 1.00 67.21  ? 635  ARG B CZ  1 
ATOM   4866 N NH1 . ARG B 1 275 ? 48.605 2.357   -28.534 1.00 67.99  ? 635  ARG B NH1 1 
ATOM   4867 N NH2 . ARG B 1 275 ? 48.911 2.116   -26.272 1.00 68.41  ? 635  ARG B NH2 1 
ATOM   4868 N N   . GLU B 1 276 ? 54.732 -1.890  -27.415 1.00 52.53  ? 636  GLU B N   1 
ATOM   4869 C CA  . GLU B 1 276 ? 56.156 -1.670  -27.123 1.00 53.48  ? 636  GLU B CA  1 
ATOM   4870 C C   . GLU B 1 276 ? 57.016 -2.938  -27.063 1.00 52.70  ? 636  GLU B C   1 
ATOM   4871 O O   . GLU B 1 276 ? 58.212 -2.849  -26.804 1.00 52.66  ? 636  GLU B O   1 
ATOM   4872 C CB  . GLU B 1 276 ? 56.320 -0.880  -25.826 1.00 53.29  ? 636  GLU B CB  1 
ATOM   4873 C CG  . GLU B 1 276 ? 55.997 0.604   -25.950 1.00 54.83  ? 636  GLU B CG  1 
ATOM   4874 C CD  . GLU B 1 276 ? 55.842 1.282   -24.587 1.00 56.08  ? 636  GLU B CD  1 
ATOM   4875 O OE1 . GLU B 1 276 ? 55.817 0.572   -23.546 1.00 60.36  ? 636  GLU B OE1 1 
ATOM   4876 O OE2 . GLU B 1 276 ? 55.738 2.527   -24.555 1.00 60.86  ? 636  GLU B OE2 1 
ATOM   4877 N N   . ILE B 1 277 ? 56.410 -4.102  -27.300 1.00 52.17  ? 637  ILE B N   1 
ATOM   4878 C CA  . ILE B 1 277 ? 57.133 -5.383  -27.314 1.00 51.69  ? 637  ILE B CA  1 
ATOM   4879 C C   . ILE B 1 277 ? 57.705 -5.658  -28.704 1.00 51.27  ? 637  ILE B C   1 
ATOM   4880 O O   . ILE B 1 277 ? 56.984 -5.640  -29.710 1.00 51.21  ? 637  ILE B O   1 
ATOM   4881 C CB  . ILE B 1 277 ? 56.239 -6.585  -26.818 1.00 51.95  ? 637  ILE B CB  1 
ATOM   4882 C CG1 . ILE B 1 277 ? 56.267 -6.707  -25.295 1.00 52.65  ? 637  ILE B CG1 1 
ATOM   4883 C CG2 . ILE B 1 277 ? 56.748 -7.910  -27.329 1.00 52.32  ? 637  ILE B CG2 1 
ATOM   4884 C CD1 . ILE B 1 277 ? 55.193 -5.971  -24.617 1.00 54.33  ? 637  ILE B CD1 1 
ATOM   4885 N N   . ASN B 1 278 ? 59.017 -5.860  -28.756 1.00 50.68  ? 638  ASN B N   1 
ATOM   4886 C CA  . ASN B 1 278 ? 59.654 -6.430  -29.925 1.00 50.18  ? 638  ASN B CA  1 
ATOM   4887 C C   . ASN B 1 278 ? 59.687 -7.936  -29.685 1.00 49.74  ? 638  ASN B C   1 
ATOM   4888 O O   . ASN B 1 278 ? 60.411 -8.418  -28.804 1.00 49.40  ? 638  ASN B O   1 
ATOM   4889 C CB  . ASN B 1 278 ? 61.072 -5.857  -30.130 1.00 50.03  ? 638  ASN B CB  1 
ATOM   4890 C CG  . ASN B 1 278 ? 61.760 -6.422  -31.371 1.00 50.34  ? 638  ASN B CG  1 
ATOM   4891 O OD1 . ASN B 1 278 ? 61.899 -7.633  -31.517 1.00 51.88  ? 638  ASN B OD1 1 
ATOM   4892 N ND2 . ASN B 1 278 ? 62.178 -5.547  -32.272 1.00 50.92  ? 638  ASN B ND2 1 
ATOM   4893 N N   . TRP B 1 279 ? 58.879 -8.665  -30.453 1.00 49.47  ? 639  TRP B N   1 
ATOM   4894 C CA  . TRP B 1 279 ? 58.655 -10.101 -30.224 1.00 49.04  ? 639  TRP B CA  1 
ATOM   4895 C C   . TRP B 1 279 ? 59.865 -10.975 -30.568 1.00 49.47  ? 639  TRP B C   1 
ATOM   4896 O O   . TRP B 1 279 ? 60.027 -12.048 -29.993 1.00 49.19  ? 639  TRP B O   1 
ATOM   4897 C CB  . TRP B 1 279 ? 57.403 -10.583 -30.977 1.00 48.30  ? 639  TRP B CB  1 
ATOM   4898 C CG  . TRP B 1 279 ? 56.137 -9.978  -30.460 1.00 46.91  ? 639  TRP B CG  1 
ATOM   4899 C CD1 . TRP B 1 279 ? 55.549 -8.829  -30.891 1.00 45.98  ? 639  TRP B CD1 1 
ATOM   4900 C CD2 . TRP B 1 279 ? 55.310 -10.479 -29.400 1.00 46.73  ? 639  TRP B CD2 1 
ATOM   4901 N NE1 . TRP B 1 279 ? 54.407 -8.582  -30.175 1.00 45.99  ? 639  TRP B NE1 1 
ATOM   4902 C CE2 . TRP B 1 279 ? 54.239 -9.577  -29.246 1.00 46.37  ? 639  TRP B CE2 1 
ATOM   4903 C CE3 . TRP B 1 279 ? 55.368 -11.607 -28.567 1.00 46.29  ? 639  TRP B CE3 1 
ATOM   4904 C CZ2 . TRP B 1 279 ? 53.241 -9.763  -28.293 1.00 45.89  ? 639  TRP B CZ2 1 
ATOM   4905 C CZ3 . TRP B 1 279 ? 54.373 -11.795 -27.635 1.00 45.55  ? 639  TRP B CZ3 1 
ATOM   4906 C CH2 . TRP B 1 279 ? 53.320 -10.881 -27.507 1.00 46.90  ? 639  TRP B CH2 1 
ATOM   4907 N N   . GLU B 1 280 ? 60.704 -10.511 -31.500 1.00 50.14  ? 640  GLU B N   1 
ATOM   4908 C CA  . GLU B 1 280 ? 61.945 -11.202 -31.861 1.00 51.16  ? 640  GLU B CA  1 
ATOM   4909 C C   . GLU B 1 280 ? 62.926 -11.187 -30.676 1.00 50.84  ? 640  GLU B C   1 
ATOM   4910 O O   . GLU B 1 280 ? 63.459 -12.235 -30.293 1.00 50.80  ? 640  GLU B O   1 
ATOM   4911 C CB  . GLU B 1 280 ? 62.601 -10.559 -33.090 1.00 51.53  ? 640  GLU B CB  1 
ATOM   4912 C CG  . GLU B 1 280 ? 61.642 -9.943  -34.126 1.00 53.41  ? 640  GLU B CG  1 
ATOM   4913 C CD  . GLU B 1 280 ? 62.357 -9.032  -35.134 1.00 53.78  ? 640  GLU B CD  1 
ATOM   4914 O OE1 . GLU B 1 280 ? 63.586 -9.194  -35.347 1.00 58.38  ? 640  GLU B OE1 1 
ATOM   4915 O OE2 . GLU B 1 280 ? 61.692 -8.141  -35.721 1.00 57.01  ? 640  GLU B OE2 1 
ATOM   4916 N N   . GLU B 1 281 ? 63.136 -9.999  -30.095 1.00 50.49  ? 641  GLU B N   1 
ATOM   4917 C CA  . GLU B 1 281 ? 64.017 -9.804  -28.929 1.00 50.64  ? 641  GLU B CA  1 
ATOM   4918 C C   . GLU B 1 281 ? 63.505 -10.546 -27.691 1.00 50.09  ? 641  GLU B C   1 
ATOM   4919 O O   . GLU B 1 281 ? 64.297 -11.055 -26.899 1.00 49.76  ? 641  GLU B O   1 
ATOM   4920 C CB  . GLU B 1 281 ? 64.182 -8.310  -28.589 1.00 50.31  ? 641  GLU B CB  1 
ATOM   4921 C CG  . GLU B 1 281 ? 64.936 -7.473  -29.630 1.00 51.47  ? 641  GLU B CG  1 
ATOM   4922 C CD  . GLU B 1 281 ? 64.886 -5.953  -29.353 1.00 52.36  ? 641  GLU B CD  1 
ATOM   4923 O OE1 . GLU B 1 281 ? 64.667 -5.522  -28.188 1.00 53.32  ? 641  GLU B OE1 1 
ATOM   4924 O OE2 . GLU B 1 281 ? 65.076 -5.181  -30.324 1.00 55.07  ? 641  GLU B OE2 1 
ATOM   4925 N N   . LEU B 1 282 ? 62.183 -10.588 -27.533 1.00 50.02  ? 642  LEU B N   1 
ATOM   4926 C CA  . LEU B 1 282 ? 61.547 -11.251 -26.408 1.00 50.04  ? 642  LEU B CA  1 
ATOM   4927 C C   . LEU B 1 282 ? 61.815 -12.753 -26.444 1.00 50.83  ? 642  LEU B C   1 
ATOM   4928 O O   . LEU B 1 282 ? 62.266 -13.311 -25.446 1.00 50.52  ? 642  LEU B O   1 
ATOM   4929 C CB  . LEU B 1 282 ? 60.045 -10.944 -26.361 1.00 49.94  ? 642  LEU B CB  1 
ATOM   4930 C CG  . LEU B 1 282 ? 59.256 -11.357 -25.111 1.00 48.22  ? 642  LEU B CG  1 
ATOM   4931 C CD1 . LEU B 1 282 ? 59.602 -10.523 -23.901 1.00 47.80  ? 642  LEU B CD1 1 
ATOM   4932 C CD2 . LEU B 1 282 ? 57.799 -11.242 -25.390 1.00 47.65  ? 642  LEU B CD2 1 
ATOM   4933 N N   . GLU B 1 283 ? 61.593 -13.389 -27.597 1.00 51.59  ? 643  GLU B N   1 
ATOM   4934 C CA  . GLU B 1 283 ? 61.871 -14.813 -27.749 1.00 53.18  ? 643  GLU B CA  1 
ATOM   4935 C C   . GLU B 1 283 ? 63.346 -15.209 -27.554 1.00 53.63  ? 643  GLU B C   1 
ATOM   4936 O O   . GLU B 1 283 ? 63.641 -16.365 -27.240 1.00 53.91  ? 643  GLU B O   1 
ATOM   4937 C CB  . GLU B 1 283 ? 61.325 -15.366 -29.076 1.00 52.99  ? 643  GLU B CB  1 
ATOM   4938 C CG  . GLU B 1 283 ? 60.870 -16.845 -28.944 1.00 54.44  ? 643  GLU B CG  1 
ATOM   4939 C CD  . GLU B 1 283 ? 59.851 -17.289 -30.003 1.00 55.02  ? 643  GLU B CD  1 
ATOM   4940 O OE1 . GLU B 1 283 ? 60.151 -17.156 -31.219 1.00 56.05  ? 643  GLU B OE1 1 
ATOM   4941 O OE2 . GLU B 1 283 ? 58.765 -17.795 -29.612 1.00 55.38  ? 643  GLU B OE2 1 
ATOM   4942 N N   . ARG B 1 284 ? 64.262 -14.259 -27.731 1.00 54.45  ? 644  ARG B N   1 
ATOM   4943 C CA  . ARG B 1 284 ? 65.687 -14.513 -27.519 1.00 55.08  ? 644  ARG B CA  1 
ATOM   4944 C C   . ARG B 1 284 ? 66.137 -14.100 -26.117 1.00 55.34  ? 644  ARG B C   1 
ATOM   4945 O O   . ARG B 1 284 ? 67.319 -14.155 -25.809 1.00 55.37  ? 644  ARG B O   1 
ATOM   4946 C CB  . ARG B 1 284 ? 66.534 -13.794 -28.577 1.00 55.42  ? 644  ARG B CB  1 
ATOM   4947 C CG  . ARG B 1 284 ? 66.191 -14.161 -30.012 1.00 56.83  ? 644  ARG B CG  1 
ATOM   4948 C CD  . ARG B 1 284 ? 67.293 -13.772 -30.937 1.00 59.90  ? 644  ARG B CD  1 
ATOM   4949 N NE  . ARG B 1 284 ? 66.781 -13.163 -32.161 1.00 63.42  ? 644  ARG B NE  1 
ATOM   4950 C CZ  . ARG B 1 284 ? 66.655 -11.849 -32.353 1.00 65.29  ? 644  ARG B CZ  1 
ATOM   4951 N NH1 . ARG B 1 284 ? 66.998 -10.990 -31.394 1.00 65.10  ? 644  ARG B NH1 1 
ATOM   4952 N NH2 . ARG B 1 284 ? 66.191 -11.387 -33.511 1.00 66.38  ? 644  ARG B NH2 1 
ATOM   4953 N N   . LYS B 1 285 ? 65.193 -13.693 -25.273 1.00 55.78  ? 645  LYS B N   1 
ATOM   4954 C CA  . LYS B 1 285 ? 65.492 -13.251 -23.899 1.00 56.51  ? 645  LYS B CA  1 
ATOM   4955 C C   . LYS B 1 285 ? 66.433 -12.039 -23.859 1.00 56.53  ? 645  LYS B C   1 
ATOM   4956 O O   . LYS B 1 285 ? 67.298 -11.932 -22.990 1.00 56.78  ? 645  LYS B O   1 
ATOM   4957 C CB  . LYS B 1 285 ? 66.048 -14.404 -23.049 1.00 56.38  ? 645  LYS B CB  1 
ATOM   4958 C CG  . LYS B 1 285 ? 65.051 -15.510 -22.716 1.00 56.63  ? 645  LYS B CG  1 
ATOM   4959 C CD  . LYS B 1 285 ? 65.697 -16.556 -21.812 1.00 57.59  ? 645  LYS B CD  1 
ATOM   4960 C CE  . LYS B 1 285 ? 64.655 -17.550 -21.320 1.00 61.14  ? 645  LYS B CE  1 
ATOM   4961 N NZ  . LYS B 1 285 ? 65.184 -18.587 -20.361 1.00 62.75  ? 645  LYS B NZ  1 
ATOM   4962 N N   . GLU B 1 286 ? 66.239 -11.120 -24.798 1.00 56.57  ? 646  GLU B N   1 
ATOM   4963 C CA  . GLU B 1 286 ? 67.037 -9.899  -24.879 1.00 56.73  ? 646  GLU B CA  1 
ATOM   4964 C C   . GLU B 1 286 ? 66.332 -8.689  -24.276 1.00 56.90  ? 646  GLU B C   1 
ATOM   4965 O O   . GLU B 1 286 ? 66.932 -7.622  -24.162 1.00 57.00  ? 646  GLU B O   1 
ATOM   4966 C CB  . GLU B 1 286 ? 67.423 -9.617  -26.327 1.00 56.43  ? 646  GLU B CB  1 
ATOM   4967 C CG  . GLU B 1 286 ? 68.408 -10.628 -26.882 1.00 57.00  ? 646  GLU B CG  1 
ATOM   4968 C CD  . GLU B 1 286 ? 68.578 -10.535 -28.383 1.00 58.83  ? 646  GLU B CD  1 
ATOM   4969 O OE1 . GLU B 1 286 ? 68.054 -9.572  -29.002 1.00 59.59  ? 646  GLU B OE1 1 
ATOM   4970 O OE2 . GLU B 1 286 ? 69.255 -11.426 -28.945 1.00 59.87  ? 646  GLU B OE2 1 
ATOM   4971 N N   . ILE B 1 287 ? 65.053 -8.855  -23.928 1.00 57.23  ? 647  ILE B N   1 
ATOM   4972 C CA  . ILE B 1 287 ? 64.300 -7.850  -23.177 1.00 57.60  ? 647  ILE B CA  1 
ATOM   4973 C C   . ILE B 1 287 ? 64.422 -8.165  -21.697 1.00 57.57  ? 647  ILE B C   1 
ATOM   4974 O O   . ILE B 1 287 ? 64.132 -9.288  -21.269 1.00 57.86  ? 647  ILE B O   1 
ATOM   4975 C CB  . ILE B 1 287 ? 62.807 -7.785  -23.582 1.00 57.48  ? 647  ILE B CB  1 
ATOM   4976 C CG1 . ILE B 1 287 ? 62.661 -7.217  -25.000 1.00 57.99  ? 647  ILE B CG1 1 
ATOM   4977 C CG2 . ILE B 1 287 ? 62.023 -6.906  -22.604 1.00 57.72  ? 647  ILE B CG2 1 
ATOM   4978 C CD1 . ILE B 1 287 ? 61.279 -7.436  -25.611 1.00 58.03  ? 647  ILE B CD1 1 
ATOM   4979 N N   . ASP B 1 288 ? 64.861 -7.165  -20.934 1.00 57.58  ? 648  ASP B N   1 
ATOM   4980 C CA  . ASP B 1 288 ? 65.125 -7.294  -19.506 1.00 57.57  ? 648  ASP B CA  1 
ATOM   4981 C C   . ASP B 1 288 ? 63.823 -7.314  -18.719 1.00 56.58  ? 648  ASP B C   1 
ATOM   4982 O O   . ASP B 1 288 ? 62.980 -6.424  -18.889 1.00 56.91  ? 648  ASP B O   1 
ATOM   4983 C CB  . ASP B 1 288 ? 65.995 -6.137  -19.025 1.00 58.45  ? 648  ASP B CB  1 
ATOM   4984 C CG  . ASP B 1 288 ? 67.035 -6.569  -18.008 1.00 61.83  ? 648  ASP B CG  1 
ATOM   4985 O OD1 . ASP B 1 288 ? 66.643 -6.977  -16.888 1.00 65.93  ? 648  ASP B OD1 1 
ATOM   4986 O OD2 . ASP B 1 288 ? 68.252 -6.483  -18.322 1.00 64.71  ? 648  ASP B OD2 1 
ATOM   4987 N N   . PRO B 1 289 ? 63.647 -8.334  -17.857 1.00 55.39  ? 649  PRO B N   1 
ATOM   4988 C CA  . PRO B 1 289 ? 62.465 -8.434  -17.000 1.00 54.55  ? 649  PRO B CA  1 
ATOM   4989 C C   . PRO B 1 289 ? 62.294 -7.194  -16.093 1.00 53.55  ? 649  PRO B C   1 
ATOM   4990 O O   . PRO B 1 289 ? 63.232 -6.799  -15.422 1.00 53.92  ? 649  PRO B O   1 
ATOM   4991 C CB  . PRO B 1 289 ? 62.772 -9.677  -16.148 1.00 53.94  ? 649  PRO B CB  1 
ATOM   4992 C CG  . PRO B 1 289 ? 63.658 -10.475 -16.987 1.00 54.79  ? 649  PRO B CG  1 
ATOM   4993 C CD  . PRO B 1 289 ? 64.557 -9.476  -17.647 1.00 54.99  ? 649  PRO B CD  1 
ATOM   4994 N N   . PRO B 1 290 ? 61.103 -6.584  -16.078 1.00 52.92  ? 650  PRO B N   1 
ATOM   4995 C CA  . PRO B 1 290 ? 60.827 -5.481  -15.153 1.00 52.39  ? 650  PRO B CA  1 
ATOM   4996 C C   . PRO B 1 290 ? 60.979 -5.852  -13.675 1.00 51.85  ? 650  PRO B C   1 
ATOM   4997 O O   . PRO B 1 290 ? 61.138 -4.968  -12.839 1.00 52.54  ? 650  PRO B O   1 
ATOM   4998 C CB  . PRO B 1 290 ? 59.364 -5.146  -15.451 1.00 52.31  ? 650  PRO B CB  1 
ATOM   4999 C CG  . PRO B 1 290 ? 59.177 -5.587  -16.844 1.00 52.99  ? 650  PRO B CG  1 
ATOM   5000 C CD  . PRO B 1 290 ? 59.946 -6.857  -16.942 1.00 52.62  ? 650  PRO B CD  1 
ATOM   5001 N N   . PHE B 1 291 ? 60.914 -7.143  -13.357 1.00 50.93  ? 651  PHE B N   1 
ATOM   5002 C CA  . PHE B 1 291 ? 61.097 -7.624  -11.994 1.00 49.56  ? 651  PHE B CA  1 
ATOM   5003 C C   . PHE B 1 291 ? 62.155 -8.726  -11.952 1.00 49.60  ? 651  PHE B C   1 
ATOM   5004 O O   . PHE B 1 291 ? 62.145 -9.639  -12.772 1.00 48.88  ? 651  PHE B O   1 
ATOM   5005 C CB  . PHE B 1 291 ? 59.762 -8.116  -11.435 1.00 48.84  ? 651  PHE B CB  1 
ATOM   5006 C CG  . PHE B 1 291 ? 59.870 -8.842  -10.115 1.00 47.55  ? 651  PHE B CG  1 
ATOM   5007 C CD1 . PHE B 1 291 ? 59.804 -8.135  -8.907  1.00 46.72  ? 651  PHE B CD1 1 
ATOM   5008 C CD2 . PHE B 1 291 ? 60.030 -10.244 -10.084 1.00 45.15  ? 651  PHE B CD2 1 
ATOM   5009 C CE1 . PHE B 1 291 ? 59.901 -8.822  -7.675  1.00 47.47  ? 651  PHE B CE1 1 
ATOM   5010 C CE2 . PHE B 1 291 ? 60.118 -10.942 -8.878  1.00 44.10  ? 651  PHE B CE2 1 
ATOM   5011 C CZ  . PHE B 1 291 ? 60.042 -10.238 -7.665  1.00 46.87  ? 651  PHE B CZ  1 
ATOM   5012 N N   . ARG B 1 292 ? 63.058 -8.630  -10.985 1.00 49.98  ? 652  ARG B N   1 
ATOM   5013 C CA  . ARG B 1 292 ? 64.065 -9.653  -10.771 1.00 51.73  ? 652  ARG B CA  1 
ATOM   5014 C C   . ARG B 1 292 ? 63.876 -10.255 -9.381  1.00 51.63  ? 652  ARG B C   1 
ATOM   5015 O O   . ARG B 1 292 ? 63.954 -9.543  -8.373  1.00 51.11  ? 652  ARG B O   1 
ATOM   5016 C CB  . ARG B 1 292 ? 65.494 -9.094  -10.954 1.00 52.01  ? 652  ARG B CB  1 
ATOM   5017 C CG  . ARG B 1 292 ? 66.593 -10.172 -10.953 1.00 53.75  ? 652  ARG B CG  1 
ATOM   5018 C CD  . ARG B 1 292 ? 67.998 -9.587  -11.213 1.00 54.27  ? 652  ARG B CD  1 
ATOM   5019 N NE  . ARG B 1 292 ? 69.033 -10.593 -10.978 1.00 59.09  ? 652  ARG B NE  1 
ATOM   5020 C CZ  . ARG B 1 292 ? 69.516 -11.420 -11.909 1.00 61.50  ? 652  ARG B CZ  1 
ATOM   5021 N NH1 . ARG B 1 292 ? 69.071 -11.349 -13.164 1.00 62.39  ? 652  ARG B NH1 1 
ATOM   5022 N NH2 . ARG B 1 292 ? 70.449 -12.322 -11.589 1.00 61.41  ? 652  ARG B NH2 1 
ATOM   5023 N N   . PRO B 1 293 ? 63.616 -11.574 -9.325  1.00 52.20  ? 653  PRO B N   1 
ATOM   5024 C CA  . PRO B 1 293 ? 63.427 -12.279 -8.055  1.00 53.47  ? 653  PRO B CA  1 
ATOM   5025 C C   . PRO B 1 293 ? 64.660 -12.200 -7.145  1.00 54.78  ? 653  PRO B C   1 
ATOM   5026 O O   . PRO B 1 293 ? 65.778 -12.162 -7.636  1.00 54.09  ? 653  PRO B O   1 
ATOM   5027 C CB  . PRO B 1 293 ? 63.133 -13.735 -8.489  1.00 53.04  ? 653  PRO B CB  1 
ATOM   5028 C CG  . PRO B 1 293 ? 63.648 -13.846 -9.868  1.00 52.82  ? 653  PRO B CG  1 
ATOM   5029 C CD  . PRO B 1 293 ? 63.494 -12.477 -10.481 1.00 52.13  ? 653  PRO B CD  1 
ATOM   5030 N N   . LYS B 1 294 ? 64.436 -12.124 -5.837  1.00 57.35  ? 654  LYS B N   1 
ATOM   5031 C CA  . LYS B 1 294 ? 65.505 -12.246 -4.851  1.00 60.65  ? 654  LYS B CA  1 
ATOM   5032 C C   . LYS B 1 294 ? 65.649 -13.736 -4.672  1.00 62.07  ? 654  LYS B C   1 
ATOM   5033 O O   . LYS B 1 294 ? 64.814 -14.356 -4.007  1.00 62.99  ? 654  LYS B O   1 
ATOM   5034 C CB  . LYS B 1 294 ? 65.118 -11.595 -3.522  1.00 60.62  ? 654  LYS B CB  1 
ATOM   5035 C CG  . LYS B 1 294 ? 65.349 -10.095 -3.477  1.00 64.18  ? 654  LYS B CG  1 
ATOM   5036 C CD  . LYS B 1 294 ? 64.359 -9.417  -2.532  1.00 68.73  ? 654  LYS B CD  1 
ATOM   5037 C CE  . LYS B 1 294 ? 64.711 -7.954  -2.287  1.00 70.14  ? 654  LYS B CE  1 
ATOM   5038 N NZ  . LYS B 1 294 ? 65.849 -7.822  -1.317  1.00 71.33  ? 654  LYS B NZ  1 
ATOM   5039 N N   . VAL B 1 295 ? 66.669 -14.313 -5.303  1.00 63.68  ? 655  VAL B N   1 
ATOM   5040 C CA  . VAL B 1 295 ? 66.795 -15.772 -5.401  1.00 65.49  ? 655  VAL B CA  1 
ATOM   5041 C C   . VAL B 1 295 ? 67.791 -16.351 -4.379  1.00 66.88  ? 655  VAL B C   1 
ATOM   5042 O O   . VAL B 1 295 ? 68.886 -15.792 -4.152  1.00 66.75  ? 655  VAL B O   1 
ATOM   5043 C CB  . VAL B 1 295 ? 67.119 -16.211 -6.877  1.00 65.70  ? 655  VAL B CB  1 
ATOM   5044 C CG1 . VAL B 1 295 ? 68.091 -17.399 -6.942  1.00 65.36  ? 655  VAL B CG1 1 
ATOM   5045 C CG2 . VAL B 1 295 ? 65.831 -16.474 -7.662  1.00 64.68  ? 655  VAL B CG2 1 
ATOM   5046 N N   . LYS B 1 296 ? 67.389 -17.456 -3.751  1.00 68.04  ? 656  LYS B N   1 
ATOM   5047 C CA  . LYS B 1 296 ? 68.274 -18.164 -2.834  1.00 69.41  ? 656  LYS B CA  1 
ATOM   5048 C C   . LYS B 1 296 ? 68.839 -19.419 -3.509  1.00 70.00  ? 656  LYS B C   1 
ATOM   5049 O O   . LYS B 1 296 ? 68.082 -20.272 -3.992  1.00 70.73  ? 656  LYS B O   1 
ATOM   5050 C CB  . LYS B 1 296 ? 67.555 -18.500 -1.513  1.00 69.61  ? 656  LYS B CB  1 
ATOM   5051 C CG  . LYS B 1 296 ? 68.368 -19.374 -0.527  1.00 70.37  ? 656  LYS B CG  1 
ATOM   5052 C CD  . LYS B 1 296 ? 69.635 -18.679 -0.027  1.00 71.47  ? 656  LYS B CD  1 
ATOM   5053 C CE  . LYS B 1 296 ? 70.644 -19.696 0.502   1.00 72.48  ? 656  LYS B CE  1 
ATOM   5054 N NZ  . LYS B 1 296 ? 71.902 -19.048 0.970   1.00 72.67  ? 656  LYS B NZ  1 
ATOM   5055 N N   . SER B 1 297 ? 70.168 -19.514 -3.534  1.00 70.27  ? 657  SER B N   1 
ATOM   5056 C CA  . SER B 1 297 ? 70.897 -20.636 -4.148  1.00 70.28  ? 657  SER B CA  1 
ATOM   5057 C C   . SER B 1 297 ? 70.531 -21.989 -3.545  1.00 70.22  ? 657  SER B C   1 
ATOM   5058 O O   . SER B 1 297 ? 70.084 -22.050 -2.394  1.00 70.28  ? 657  SER B O   1 
ATOM   5059 C CB  . SER B 1 297 ? 72.410 -20.428 -3.987  1.00 70.28  ? 657  SER B CB  1 
ATOM   5060 O OG  . SER B 1 297 ? 72.810 -19.176 -4.507  1.00 70.45  ? 657  SER B OG  1 
ATOM   5061 N N   . PRO B 1 298 ? 70.694 -23.076 -4.333  1.00 70.24  ? 658  PRO B N   1 
ATOM   5062 C CA  . PRO B 1 298 ? 70.771 -24.420 -3.761  1.00 70.28  ? 658  PRO B CA  1 
ATOM   5063 C C   . PRO B 1 298 ? 72.204 -24.751 -3.323  1.00 70.67  ? 658  PRO B C   1 
ATOM   5064 O O   . PRO B 1 298 ? 72.530 -24.709 -2.129  1.00 71.06  ? 658  PRO B O   1 
ATOM   5065 C CB  . PRO B 1 298 ? 70.363 -25.311 -4.930  1.00 70.15  ? 658  PRO B CB  1 
ATOM   5066 C CG  . PRO B 1 298 ? 70.807 -24.571 -6.145  1.00 69.81  ? 658  PRO B CG  1 
ATOM   5067 C CD  . PRO B 1 298 ? 70.757 -23.100 -5.809  1.00 70.13  ? 658  PRO B CD  1 
ATOM   5068 N N   . ARG B 1 314 ? 67.822 -37.794 4.624   1.00 89.96  ? 674  ARG B N   1 
ATOM   5069 C CA  . ARG B 1 314 ? 67.196 -39.088 4.349   1.00 90.00  ? 674  ARG B CA  1 
ATOM   5070 C C   . ARG B 1 314 ? 66.803 -39.210 2.865   1.00 89.58  ? 674  ARG B C   1 
ATOM   5071 O O   . ARG B 1 314 ? 67.677 -39.361 2.005   1.00 89.63  ? 674  ARG B O   1 
ATOM   5072 C CB  . ARG B 1 314 ? 65.980 -39.308 5.264   1.00 90.12  ? 674  ARG B CB  1 
ATOM   5073 C CG  . ARG B 1 314 ? 65.633 -40.781 5.513   1.00 91.18  ? 674  ARG B CG  1 
ATOM   5074 C CD  . ARG B 1 314 ? 64.127 -41.059 5.446   1.00 92.51  ? 674  ARG B CD  1 
ATOM   5075 N NE  . ARG B 1 314 ? 63.332 -40.085 6.194   1.00 93.73  ? 674  ARG B NE  1 
ATOM   5076 C CZ  . ARG B 1 314 ? 62.488 -39.211 5.646   1.00 94.62  ? 674  ARG B CZ  1 
ATOM   5077 N NH1 . ARG B 1 314 ? 62.299 -39.181 4.328   1.00 94.42  ? 674  ARG B NH1 1 
ATOM   5078 N NH2 . ARG B 1 314 ? 61.822 -38.365 6.425   1.00 94.70  ? 674  ARG B NH2 1 
ATOM   5079 N N   . LEU B 1 315 ? 65.496 -39.144 2.588   1.00 88.99  ? 675  LEU B N   1 
ATOM   5080 C CA  . LEU B 1 315 ? 64.917 -39.205 1.229   1.00 88.39  ? 675  LEU B CA  1 
ATOM   5081 C C   . LEU B 1 315 ? 65.404 -40.409 0.386   1.00 87.96  ? 675  LEU B C   1 
ATOM   5082 O O   . LEU B 1 315 ? 66.358 -40.303 -0.390  1.00 87.84  ? 675  LEU B O   1 
ATOM   5083 C CB  . LEU B 1 315 ? 65.093 -37.860 0.494   1.00 88.33  ? 675  LEU B CB  1 
ATOM   5084 C CG  . LEU B 1 315 ? 64.595 -36.582 1.194   1.00 88.16  ? 675  LEU B CG  1 
ATOM   5085 C CD1 . LEU B 1 315 ? 65.357 -35.362 0.712   1.00 87.60  ? 675  LEU B CD1 1 
ATOM   5086 C CD2 . LEU B 1 315 ? 63.093 -36.365 1.033   1.00 87.83  ? 675  LEU B CD2 1 
HETATM 5087 N N   . SEP B 1 316 ? 64.720 -41.543 0.547   1.00 87.44  ? 676  SEP B N   1 
HETATM 5088 C CA  . SEP B 1 316 ? 65.121 -42.826 -0.050  1.00 86.90  ? 676  SEP B CA  1 
HETATM 5089 C CB  . SEP B 1 316 ? 65.262 -43.877 1.062   1.00 87.09  ? 676  SEP B CB  1 
HETATM 5090 O OG  . SEP B 1 316 ? 65.503 -45.178 0.546   1.00 87.60  ? 676  SEP B OG  1 
HETATM 5091 C C   . SEP B 1 316 ? 64.138 -43.301 -1.133  1.00 86.31  ? 676  SEP B C   1 
HETATM 5092 O O   . SEP B 1 316 ? 63.109 -42.658 -1.361  1.00 86.37  ? 676  SEP B O   1 
HETATM 5093 P P   . SEP B 1 316 ? 67.033 -45.640 0.789   1.00 87.84  ? 676  SEP B P   1 
HETATM 5094 O O1P . SEP B 1 316 ? 67.196 -47.178 0.336   1.00 87.72  ? 676  SEP B O1P 1 
HETATM 5095 O O2P . SEP B 1 316 ? 67.407 -45.506 2.352   1.00 87.88  ? 676  SEP B O2P 1 
HETATM 5096 O O3P . SEP B 1 316 ? 68.019 -44.712 -0.091  1.00 87.60  ? 676  SEP B O3P 1 
ATOM   5097 N N   . PHE B 1 317 ? 64.454 -44.418 -1.798  1.00 85.40  ? 677  PHE B N   1 
ATOM   5098 C CA  . PHE B 1 317 ? 63.562 -44.981 -2.829  1.00 84.39  ? 677  PHE B CA  1 
ATOM   5099 C C   . PHE B 1 317 ? 63.323 -46.502 -2.805  1.00 83.62  ? 677  PHE B C   1 
ATOM   5100 O O   . PHE B 1 317 ? 63.392 -47.132 -1.746  1.00 83.72  ? 677  PHE B O   1 
ATOM   5101 C CB  . PHE B 1 317 ? 63.954 -44.493 -4.229  1.00 84.44  ? 677  PHE B CB  1 
ATOM   5102 C CG  . PHE B 1 317 ? 63.247 -43.239 -4.637  1.00 84.55  ? 677  PHE B CG  1 
ATOM   5103 C CD1 . PHE B 1 317 ? 63.903 -42.017 -4.616  1.00 84.88  ? 677  PHE B CD1 1 
ATOM   5104 C CD2 . PHE B 1 317 ? 61.909 -43.275 -5.015  1.00 84.39  ? 677  PHE B CD2 1 
ATOM   5105 C CE1 . PHE B 1 317 ? 63.237 -40.851 -4.983  1.00 84.58  ? 677  PHE B CE1 1 
ATOM   5106 C CE2 . PHE B 1 317 ? 61.241 -42.117 -5.379  1.00 84.21  ? 677  PHE B CE2 1 
ATOM   5107 C CZ  . PHE B 1 317 ? 61.908 -40.904 -5.360  1.00 84.33  ? 677  PHE B CZ  1 
ATOM   5108 N N   . ALA B 1 318 ? 63.049 -47.060 -3.989  1.00 82.50  ? 678  ALA B N   1 
ATOM   5109 C CA  . ALA B 1 318 ? 62.430 -48.392 -4.181  1.00 81.19  ? 678  ALA B CA  1 
ATOM   5110 C C   . ALA B 1 318 ? 62.951 -49.582 -3.355  1.00 80.23  ? 678  ALA B C   1 
ATOM   5111 O O   . ALA B 1 318 ? 63.937 -50.241 -3.715  1.00 80.26  ? 678  ALA B O   1 
ATOM   5112 C CB  . ALA B 1 318 ? 62.401 -48.749 -5.668  1.00 81.26  ? 678  ALA B CB  1 
ATOM   5113 N N   . ASP B 1 319 ? 62.260 -49.840 -2.249  1.00 78.66  ? 679  ASP B N   1 
ATOM   5114 C CA  . ASP B 1 319 ? 62.425 -51.047 -1.451  1.00 77.18  ? 679  ASP B CA  1 
ATOM   5115 C C   . ASP B 1 319 ? 61.119 -51.138 -0.675  1.00 75.84  ? 679  ASP B C   1 
ATOM   5116 O O   . ASP B 1 319 ? 60.985 -50.553 0.406   1.00 75.75  ? 679  ASP B O   1 
ATOM   5117 C CB  . ASP B 1 319 ? 63.639 -50.937 -0.513  1.00 77.42  ? 679  ASP B CB  1 
ATOM   5118 C CG  . ASP B 1 319 ? 64.254 -52.294 -0.178  1.00 77.63  ? 679  ASP B CG  1 
ATOM   5119 O OD1 . ASP B 1 319 ? 63.574 -53.137 0.451   1.00 78.05  ? 679  ASP B OD1 1 
ATOM   5120 O OD2 . ASP B 1 319 ? 65.432 -52.513 -0.535  1.00 77.94  ? 679  ASP B OD2 1 
ATOM   5121 N N   . ARG B 1 320 ? 60.150 -51.854 -1.244  1.00 74.09  ? 680  ARG B N   1 
ATOM   5122 C CA  . ARG B 1 320 ? 58.763 -51.739 -0.796  1.00 72.29  ? 680  ARG B CA  1 
ATOM   5123 C C   . ARG B 1 320 ? 58.052 -53.043 -0.425  1.00 71.20  ? 680  ARG B C   1 
ATOM   5124 O O   . ARG B 1 320 ? 57.403 -53.105 0.624   1.00 71.36  ? 680  ARG B O   1 
ATOM   5125 C CB  . ARG B 1 320 ? 57.957 -50.975 -1.845  1.00 72.19  ? 680  ARG B CB  1 
ATOM   5126 C CG  . ARG B 1 320 ? 56.932 -50.021 -1.270  1.00 71.71  ? 680  ARG B CG  1 
ATOM   5127 C CD  . ARG B 1 320 ? 56.939 -48.684 -1.995  1.00 69.54  ? 680  ARG B CD  1 
ATOM   5128 N NE  . ARG B 1 320 ? 56.980 -48.818 -3.453  1.00 69.44  ? 680  ARG B NE  1 
ATOM   5129 C CZ  . ARG B 1 320 ? 55.930 -48.698 -4.267  1.00 69.33  ? 680  ARG B CZ  1 
ATOM   5130 N NH1 . ARG B 1 320 ? 54.719 -48.442 -3.778  1.00 69.39  ? 680  ARG B NH1 1 
ATOM   5131 N NH2 . ARG B 1 320 ? 56.093 -48.832 -5.582  1.00 68.16  ? 680  ARG B NH2 1 
ATOM   5132 N N   . ALA B 1 321 ? 58.171 -54.067 -1.274  1.00 69.35  ? 681  ALA B N   1 
ATOM   5133 C CA  . ALA B 1 321 ? 57.378 -55.306 -1.158  1.00 67.77  ? 681  ALA B CA  1 
ATOM   5134 C C   . ALA B 1 321 ? 55.900 -55.067 -1.490  1.00 66.59  ? 681  ALA B C   1 
ATOM   5135 O O   . ALA B 1 321 ? 55.149 -54.507 -0.689  1.00 66.34  ? 681  ALA B O   1 
ATOM   5136 C CB  . ALA B 1 321 ? 57.539 -55.964 0.228   1.00 67.78  ? 681  ALA B CB  1 
ATOM   5137 N N   . LEU B 1 322 ? 55.498 -55.513 -2.677  1.00 65.18  ? 682  LEU B N   1 
ATOM   5138 C CA  . LEU B 1 322 ? 54.183 -55.205 -3.231  1.00 63.86  ? 682  LEU B CA  1 
ATOM   5139 C C   . LEU B 1 322 ? 53.271 -56.425 -3.399  1.00 63.09  ? 682  LEU B C   1 
ATOM   5140 O O   . LEU B 1 322 ? 53.743 -57.556 -3.522  1.00 63.05  ? 682  LEU B O   1 
ATOM   5141 C CB  . LEU B 1 322 ? 54.340 -54.467 -4.569  1.00 63.79  ? 682  LEU B CB  1 
ATOM   5142 C CG  . LEU B 1 322 ? 55.266 -53.242 -4.621  1.00 63.32  ? 682  LEU B CG  1 
ATOM   5143 C CD1 . LEU B 1 322 ? 55.339 -52.686 -6.036  1.00 63.96  ? 682  LEU B CD1 1 
ATOM   5144 C CD2 . LEU B 1 322 ? 54.839 -52.152 -3.640  1.00 61.95  ? 682  LEU B CD2 1 
ATOM   5145 N N   . ILE B 1 323 ? 51.962 -56.181 -3.397  1.00 62.14  ? 683  ILE B N   1 
ATOM   5146 C CA  . ILE B 1 323 ? 50.964 -57.230 -3.594  1.00 61.26  ? 683  ILE B CA  1 
ATOM   5147 C C   . ILE B 1 323 ? 51.002 -57.738 -5.039  1.00 60.96  ? 683  ILE B C   1 
ATOM   5148 O O   . ILE B 1 323 ? 51.297 -58.909 -5.274  1.00 60.87  ? 683  ILE B O   1 
ATOM   5149 C CB  . ILE B 1 323 ? 49.525 -56.765 -3.195  1.00 61.24  ? 683  ILE B CB  1 
ATOM   5150 C CG1 . ILE B 1 323 ? 49.444 -56.457 -1.694  1.00 60.84  ? 683  ILE B CG1 1 
ATOM   5151 C CG2 . ILE B 1 323 ? 48.488 -57.823 -3.563  1.00 61.00  ? 683  ILE B CG2 1 
ATOM   5152 C CD1 . ILE B 1 323 ? 48.140 -55.812 -1.251  1.00 60.91  ? 683  ILE B CD1 1 
ATOM   5153 N N   . ASN B 1 324 ? 50.715 -56.855 -5.994  1.00 60.56  ? 684  ASN B N   1 
ATOM   5154 C CA  . ASN B 1 324 ? 50.692 -57.211 -7.416  1.00 60.31  ? 684  ASN B CA  1 
ATOM   5155 C C   . ASN B 1 324 ? 51.931 -56.714 -8.152  1.00 60.36  ? 684  ASN B C   1 
ATOM   5156 O O   . ASN B 1 324 ? 52.461 -55.645 -7.840  1.00 60.10  ? 684  ASN B O   1 
ATOM   5157 C CB  . ASN B 1 324 ? 49.429 -56.673 -8.106  1.00 60.25  ? 684  ASN B CB  1 
ATOM   5158 C CG  . ASN B 1 324 ? 48.132 -57.208 -7.489  1.00 60.30  ? 684  ASN B CG  1 
ATOM   5159 O OD1 . ASN B 1 324 ? 47.120 -56.508 -7.460  1.00 60.09  ? 684  ASN B OD1 1 
ATOM   5160 N ND2 . ASN B 1 324 ? 48.158 -58.447 -7.005  1.00 59.55  ? 684  ASN B ND2 1 
ATOM   5161 N N   . SER B 1 325 ? 52.380 -57.503 -9.127  1.00 60.40  ? 685  SER B N   1 
ATOM   5162 C CA  . SER B 1 325 ? 53.541 -57.163 -9.953  1.00 60.61  ? 685  SER B CA  1 
ATOM   5163 C C   . SER B 1 325 ? 53.116 -56.240 -11.077 1.00 60.64  ? 685  SER B C   1 
ATOM   5164 O O   . SER B 1 325 ? 52.021 -56.379 -11.629 1.00 60.53  ? 685  SER B O   1 
ATOM   5165 C CB  . SER B 1 325 ? 54.161 -58.424 -10.561 1.00 60.65  ? 685  SER B CB  1 
ATOM   5166 O OG  . SER B 1 325 ? 54.222 -59.473 -9.613  1.00 61.15  ? 685  SER B OG  1 
ATOM   5167 N N   . MET B 1 326 ? 53.992 -55.302 -11.420 1.00 60.90  ? 686  MET B N   1 
ATOM   5168 C CA  . MET B 1 326 ? 53.709 -54.351 -12.478 1.00 60.92  ? 686  MET B CA  1 
ATOM   5169 C C   . MET B 1 326 ? 54.016 -55.011 -13.824 1.00 60.68  ? 686  MET B C   1 
ATOM   5170 O O   . MET B 1 326 ? 55.067 -55.639 -13.987 1.00 60.51  ? 686  MET B O   1 
ATOM   5171 C CB  . MET B 1 326 ? 54.555 -53.084 -12.288 1.00 61.21  ? 686  MET B CB  1 
ATOM   5172 C CG  . MET B 1 326 ? 53.784 -51.761 -12.360 1.00 62.39  ? 686  MET B CG  1 
ATOM   5173 S SD  . MET B 1 326 ? 52.997 -51.428 -13.954 1.00 64.18  ? 686  MET B SD  1 
ATOM   5174 C CE  . MET B 1 326 ? 54.447 -51.098 -14.954 1.00 64.86  ? 686  MET B CE  1 
ATOM   5175 N N   . ASP B 1 327 ? 53.078 -54.891 -14.764 1.00 60.43  ? 687  ASP B N   1 
ATOM   5176 C CA  . ASP B 1 327 ? 53.303 -55.223 -16.174 1.00 60.17  ? 687  ASP B CA  1 
ATOM   5177 C C   . ASP B 1 327 ? 54.107 -54.084 -16.825 1.00 59.79  ? 687  ASP B C   1 
ATOM   5178 O O   . ASP B 1 327 ? 53.593 -52.978 -17.024 1.00 60.00  ? 687  ASP B O   1 
ATOM   5179 C CB  . ASP B 1 327 ? 51.957 -55.426 -16.885 1.00 60.39  ? 687  ASP B CB  1 
ATOM   5180 C CG  . ASP B 1 327 ? 52.069 -55.362 -18.402 1.00 61.15  ? 687  ASP B CG  1 
ATOM   5181 O OD1 . ASP B 1 327 ? 52.512 -56.354 -19.017 1.00 61.61  ? 687  ASP B OD1 1 
ATOM   5182 O OD2 . ASP B 1 327 ? 51.701 -54.315 -18.979 1.00 62.82  ? 687  ASP B OD2 1 
ATOM   5183 N N   . GLN B 1 328 ? 55.366 -54.358 -17.155 1.00 59.05  ? 688  GLN B N   1 
ATOM   5184 C CA  . GLN B 1 328 ? 56.290 -53.312 -17.588 1.00 58.19  ? 688  GLN B CA  1 
ATOM   5185 C C   . GLN B 1 328 ? 56.034 -52.679 -18.970 1.00 58.14  ? 688  GLN B C   1 
ATOM   5186 O O   . GLN B 1 328 ? 56.389 -51.505 -19.192 1.00 58.57  ? 688  GLN B O   1 
ATOM   5187 C CB  . GLN B 1 328 ? 57.752 -53.751 -17.415 1.00 57.78  ? 688  GLN B CB  1 
ATOM   5188 C CG  . GLN B 1 328 ? 58.173 -54.022 -15.942 1.00 56.65  ? 688  GLN B CG  1 
ATOM   5189 C CD  . GLN B 1 328 ? 57.871 -52.872 -14.940 1.00 55.06  ? 688  GLN B CD  1 
ATOM   5190 O OE1 . GLN B 1 328 ? 57.634 -51.714 -15.316 1.00 53.27  ? 688  GLN B OE1 1 
ATOM   5191 N NE2 . GLN B 1 328 ? 57.884 -53.209 -13.654 1.00 53.71  ? 688  GLN B NE2 1 
ATOM   5192 N N   . ASN B 1 329 ? 55.413 -53.430 -19.878 1.00 57.56  ? 689  ASN B N   1 
ATOM   5193 C CA  . ASN B 1 329 ? 55.029 -52.911 -21.203 1.00 57.08  ? 689  ASN B CA  1 
ATOM   5194 C C   . ASN B 1 329 ? 54.134 -51.655 -21.133 1.00 56.77  ? 689  ASN B C   1 
ATOM   5195 O O   . ASN B 1 329 ? 53.968 -50.928 -22.121 1.00 56.64  ? 689  ASN B O   1 
ATOM   5196 C CB  . ASN B 1 329 ? 54.352 -54.010 -22.038 1.00 57.09  ? 689  ASN B CB  1 
ATOM   5197 C CG  . ASN B 1 329 ? 55.306 -55.144 -22.414 1.00 56.97  ? 689  ASN B CG  1 
ATOM   5198 O OD1 . ASN B 1 329 ? 56.522 -54.961 -22.474 1.00 56.84  ? 689  ASN B OD1 1 
ATOM   5199 N ND2 . ASN B 1 329 ? 54.749 -56.318 -22.681 1.00 56.21  ? 689  ASN B ND2 1 
ATOM   5200 N N   . MET B 1 330 ? 53.585 -51.412 -19.946 1.00 56.39  ? 690  MET B N   1 
ATOM   5201 C CA  . MET B 1 330 ? 52.726 -50.263 -19.654 1.00 56.22  ? 690  MET B CA  1 
ATOM   5202 C C   . MET B 1 330 ? 53.443 -48.917 -19.855 1.00 55.38  ? 690  MET B C   1 
ATOM   5203 O O   . MET B 1 330 ? 52.826 -47.922 -20.266 1.00 55.69  ? 690  MET B O   1 
ATOM   5204 C CB  . MET B 1 330 ? 52.208 -50.389 -18.216 1.00 56.58  ? 690  MET B CB  1 
ATOM   5205 C CG  . MET B 1 330 ? 51.022 -49.507 -17.861 1.00 58.64  ? 690  MET B CG  1 
ATOM   5206 S SD  . MET B 1 330 ? 49.431 -50.351 -17.829 1.00 63.73  ? 690  MET B SD  1 
ATOM   5207 C CE  . MET B 1 330 ? 49.151 -50.685 -19.576 1.00 63.69  ? 690  MET B CE  1 
ATOM   5208 N N   . PHE B 1 331 ? 54.743 -48.887 -19.569 1.00 54.27  ? 691  PHE B N   1 
ATOM   5209 C CA  . PHE B 1 331 ? 55.533 -47.663 -19.717 1.00 53.10  ? 691  PHE B CA  1 
ATOM   5210 C C   . PHE B 1 331 ? 56.636 -47.851 -20.759 1.00 52.78  ? 691  PHE B C   1 
ATOM   5211 O O   . PHE B 1 331 ? 57.765 -47.383 -20.599 1.00 52.39  ? 691  PHE B O   1 
ATOM   5212 C CB  . PHE B 1 331 ? 56.072 -47.209 -18.360 1.00 52.79  ? 691  PHE B CB  1 
ATOM   5213 C CG  . PHE B 1 331 ? 54.994 -46.985 -17.333 1.00 52.12  ? 691  PHE B CG  1 
ATOM   5214 C CD1 . PHE B 1 331 ? 54.631 -47.999 -16.448 1.00 51.55  ? 691  PHE B CD1 1 
ATOM   5215 C CD2 . PHE B 1 331 ? 54.320 -45.769 -17.268 1.00 51.21  ? 691  PHE B CD2 1 
ATOM   5216 C CE1 . PHE B 1 331 ? 53.623 -47.802 -15.506 1.00 50.66  ? 691  PHE B CE1 1 
ATOM   5217 C CE2 . PHE B 1 331 ? 53.310 -45.558 -16.333 1.00 49.85  ? 691  PHE B CE2 1 
ATOM   5218 C CZ  . PHE B 1 331 ? 52.967 -46.578 -15.447 1.00 51.48  ? 691  PHE B CZ  1 
ATOM   5219 N N   . ARG B 1 332 ? 56.278 -48.577 -21.817 1.00 52.33  ? 692  ARG B N   1 
ATOM   5220 C CA  . ARG B 1 332 ? 57.098 -48.730 -23.010 1.00 51.93  ? 692  ARG B CA  1 
ATOM   5221 C C   . ARG B 1 332 ? 57.352 -47.349 -23.613 1.00 50.98  ? 692  ARG B C   1 
ATOM   5222 O O   . ARG B 1 332 ? 56.418 -46.544 -23.752 1.00 51.02  ? 692  ARG B O   1 
ATOM   5223 C CB  . ARG B 1 332 ? 56.356 -49.606 -24.021 1.00 52.25  ? 692  ARG B CB  1 
ATOM   5224 C CG  . ARG B 1 332 ? 57.183 -50.165 -25.161 1.00 53.88  ? 692  ARG B CG  1 
ATOM   5225 C CD  . ARG B 1 332 ? 56.251 -50.758 -26.219 1.00 56.90  ? 692  ARG B CD  1 
ATOM   5226 N NE  . ARG B 1 332 ? 56.850 -51.870 -26.956 1.00 59.41  ? 692  ARG B NE  1 
ATOM   5227 C CZ  . ARG B 1 332 ? 56.520 -53.151 -26.788 1.00 61.09  ? 692  ARG B CZ  1 
ATOM   5228 N NH1 . ARG B 1 332 ? 55.590 -53.498 -25.899 1.00 61.36  ? 692  ARG B NH1 1 
ATOM   5229 N NH2 . ARG B 1 332 ? 57.119 -54.096 -27.511 1.00 61.54  ? 692  ARG B NH2 1 
ATOM   5230 N N   . ASN B 1 333 ? 58.611 -47.087 -23.955 1.00 49.49  ? 693  ASN B N   1 
ATOM   5231 C CA  . ASN B 1 333 ? 59.029 -45.827 -24.570 1.00 48.46  ? 693  ASN B CA  1 
ATOM   5232 C C   . ASN B 1 333 ? 59.012 -44.608 -23.632 1.00 47.22  ? 693  ASN B C   1 
ATOM   5233 O O   . ASN B 1 333 ? 59.076 -43.474 -24.102 1.00 46.96  ? 693  ASN B O   1 
ATOM   5234 C CB  . ASN B 1 333 ? 58.225 -45.541 -25.854 1.00 48.62  ? 693  ASN B CB  1 
ATOM   5235 C CG  . ASN B 1 333 ? 58.340 -46.652 -26.878 1.00 49.88  ? 693  ASN B CG  1 
ATOM   5236 O OD1 . ASN B 1 333 ? 57.332 -47.254 -27.266 1.00 51.86  ? 693  ASN B OD1 1 
ATOM   5237 N ND2 . ASN B 1 333 ? 59.566 -46.941 -27.315 1.00 48.31  ? 693  ASN B ND2 1 
ATOM   5238 N N   . PHE B 1 334 ? 58.939 -44.853 -22.321 1.00 45.61  ? 694  PHE B N   1 
ATOM   5239 C CA  . PHE B 1 334 ? 59.061 -43.797 -21.317 1.00 44.56  ? 694  PHE B CA  1 
ATOM   5240 C C   . PHE B 1 334 ? 60.411 -43.080 -21.347 1.00 44.21  ? 694  PHE B C   1 
ATOM   5241 O O   . PHE B 1 334 ? 60.450 -41.852 -21.295 1.00 44.26  ? 694  PHE B O   1 
ATOM   5242 C CB  . PHE B 1 334 ? 58.762 -44.291 -19.888 1.00 43.55  ? 694  PHE B CB  1 
ATOM   5243 C CG  . PHE B 1 334 ? 58.865 -43.196 -18.841 1.00 42.81  ? 694  PHE B CG  1 
ATOM   5244 C CD1 . PHE B 1 334 ? 57.831 -42.266 -18.675 1.00 40.19  ? 694  PHE B CD1 1 
ATOM   5245 C CD2 . PHE B 1 334 ? 60.013 -43.074 -18.048 1.00 39.85  ? 694  PHE B CD2 1 
ATOM   5246 C CE1 . PHE B 1 334 ? 57.934 -41.244 -17.720 1.00 41.34  ? 694  PHE B CE1 1 
ATOM   5247 C CE2 . PHE B 1 334 ? 60.117 -42.076 -17.083 1.00 39.11  ? 694  PHE B CE2 1 
ATOM   5248 C CZ  . PHE B 1 334 ? 59.088 -41.142 -16.924 1.00 40.14  ? 694  PHE B CZ  1 
HETATM 5249 N N   . SEP B 1 335 ? 61.497 -43.845 -21.403 1.00 43.86  ? 695  SEP B N   1 
HETATM 5250 C CA  . SEP B 1 335 ? 62.849 -43.304 -21.497 1.00 44.22  ? 695  SEP B CA  1 
HETATM 5251 C CB  . SEP B 1 335 ? 63.871 -44.408 -21.650 1.00 44.69  ? 695  SEP B CB  1 
HETATM 5252 O OG  . SEP B 1 335 ? 64.241 -44.882 -20.384 1.00 47.26  ? 695  SEP B OG  1 
HETATM 5253 C C   . SEP B 1 335 ? 63.038 -42.341 -22.643 1.00 44.11  ? 695  SEP B C   1 
HETATM 5254 O O   . SEP B 1 335 ? 62.502 -42.524 -23.743 1.00 44.50  ? 695  SEP B O   1 
HETATM 5255 P P   . SEP B 1 335 ? 64.175 -46.486 -20.360 1.00 49.90  ? 695  SEP B P   1 
HETATM 5256 O O1P . SEP B 1 335 ? 62.721 -46.998 -20.861 1.00 47.63  ? 695  SEP B O1P 1 
HETATM 5257 O O2P . SEP B 1 335 ? 64.506 -46.756 -18.800 1.00 48.10  ? 695  SEP B O2P 1 
HETATM 5258 O O3P . SEP B 1 335 ? 65.252 -47.155 -21.344 1.00 51.78  ? 695  SEP B O3P 1 
ATOM   5259 N N   . PHE B 1 336 ? 63.818 -41.310 -22.361 1.00 43.54  ? 696  PHE B N   1 
ATOM   5260 C CA  . PHE B 1 336 ? 64.099 -40.260 -23.306 1.00 43.36  ? 696  PHE B CA  1 
ATOM   5261 C C   . PHE B 1 336 ? 65.357 -39.578 -22.810 1.00 43.33  ? 696  PHE B C   1 
ATOM   5262 O O   . PHE B 1 336 ? 65.602 -39.481 -21.611 1.00 42.81  ? 696  PHE B O   1 
ATOM   5263 C CB  . PHE B 1 336 ? 62.931 -39.252 -23.396 1.00 43.19  ? 696  PHE B CB  1 
ATOM   5264 C CG  . PHE B 1 336 ? 63.308 -37.930 -24.036 1.00 43.76  ? 696  PHE B CG  1 
ATOM   5265 C CD1 . PHE B 1 336 ? 63.224 -37.757 -25.419 1.00 44.22  ? 696  PHE B CD1 1 
ATOM   5266 C CD2 . PHE B 1 336 ? 63.761 -36.867 -23.261 1.00 43.33  ? 696  PHE B CD2 1 
ATOM   5267 C CE1 . PHE B 1 336 ? 63.566 -36.544 -26.003 1.00 43.22  ? 696  PHE B CE1 1 
ATOM   5268 C CE2 . PHE B 1 336 ? 64.104 -35.644 -23.844 1.00 43.50  ? 696  PHE B CE2 1 
ATOM   5269 C CZ  . PHE B 1 336 ? 64.008 -35.489 -25.215 1.00 43.23  ? 696  PHE B CZ  1 
ATOM   5270 N N   . MET B 1 337 ? 66.148 -39.115 -23.759 1.00 43.70  ? 697  MET B N   1 
ATOM   5271 C CA  . MET B 1 337 ? 67.313 -38.309 -23.490 1.00 44.54  ? 697  MET B CA  1 
ATOM   5272 C C   . MET B 1 337 ? 67.240 -37.205 -24.542 1.00 43.80  ? 697  MET B C   1 
ATOM   5273 O O   . MET B 1 337 ? 66.886 -37.477 -25.693 1.00 43.76  ? 697  MET B O   1 
ATOM   5274 C CB  . MET B 1 337 ? 68.564 -39.197 -23.633 1.00 45.45  ? 697  MET B CB  1 
ATOM   5275 C CG  . MET B 1 337 ? 69.933 -38.514 -23.475 1.00 48.86  ? 697  MET B CG  1 
ATOM   5276 S SD  . MET B 1 337 ? 70.212 -37.731 -21.863 1.00 55.88  ? 697  MET B SD  1 
ATOM   5277 C CE  . MET B 1 337 ? 71.815 -38.442 -21.487 1.00 50.14  ? 697  MET B CE  1 
ATOM   5278 N N   . ASN B 1 338 ? 67.502 -35.961 -24.143 1.00 43.48  ? 698  ASN B N   1 
ATOM   5279 C CA  . ASN B 1 338 ? 67.695 -34.852 -25.092 1.00 42.65  ? 698  ASN B CA  1 
ATOM   5280 C C   . ASN B 1 338 ? 68.551 -35.358 -26.282 1.00 42.45  ? 698  ASN B C   1 
ATOM   5281 O O   . ASN B 1 338 ? 69.623 -35.910 -26.060 1.00 42.31  ? 698  ASN B O   1 
ATOM   5282 C CB  . ASN B 1 338 ? 68.354 -33.658 -24.374 1.00 42.31  ? 698  ASN B CB  1 
ATOM   5283 C CG  . ASN B 1 338 ? 68.730 -32.507 -25.324 1.00 41.83  ? 698  ASN B CG  1 
ATOM   5284 O OD1 . ASN B 1 338 ? 69.626 -32.634 -26.151 1.00 42.92  ? 698  ASN B OD1 1 
ATOM   5285 N ND2 . ASN B 1 338 ? 68.061 -31.380 -25.182 1.00 41.09  ? 698  ASN B ND2 1 
ATOM   5286 N N   . PRO B 1 339 ? 68.052 -35.206 -27.533 1.00 42.21  ? 699  PRO B N   1 
ATOM   5287 C CA  . PRO B 1 339 ? 68.700 -35.780 -28.727 1.00 42.24  ? 699  PRO B CA  1 
ATOM   5288 C C   . PRO B 1 339 ? 70.095 -35.220 -29.042 1.00 42.44  ? 699  PRO B C   1 
ATOM   5289 O O   . PRO B 1 339 ? 70.900 -35.897 -29.685 1.00 42.35  ? 699  PRO B O   1 
ATOM   5290 C CB  . PRO B 1 339 ? 67.720 -35.455 -29.861 1.00 42.21  ? 699  PRO B CB  1 
ATOM   5291 C CG  . PRO B 1 339 ? 66.878 -34.321 -29.350 1.00 42.08  ? 699  PRO B CG  1 
ATOM   5292 C CD  . PRO B 1 339 ? 66.811 -34.475 -27.868 1.00 41.97  ? 699  PRO B CD  1 
ATOM   5293 N N   . GLY B 1 340 ? 70.355 -33.993 -28.597 1.00 43.05  ? 700  GLY B N   1 
ATOM   5294 C CA  . GLY B 1 340 ? 71.657 -33.355 -28.698 1.00 43.36  ? 700  GLY B CA  1 
ATOM   5295 C C   . GLY B 1 340 ? 72.664 -33.948 -27.735 1.00 44.07  ? 700  GLY B C   1 
ATOM   5296 O O   . GLY B 1 340 ? 73.802 -34.201 -28.112 1.00 43.99  ? 700  GLY B O   1 
ATOM   5297 N N   . MET B 1 341 ? 72.248 -34.158 -26.490 1.00 45.03  ? 701  MET B N   1 
ATOM   5298 C CA  . MET B 1 341 ? 73.067 -34.873 -25.504 1.00 46.30  ? 701  MET B CA  1 
ATOM   5299 C C   . MET B 1 341 ? 73.311 -36.344 -25.896 1.00 46.50  ? 701  MET B C   1 
ATOM   5300 O O   . MET B 1 341 ? 74.384 -36.891 -25.622 1.00 46.72  ? 701  MET B O   1 
ATOM   5301 C CB  . MET B 1 341 ? 72.454 -34.768 -24.092 1.00 46.87  ? 701  MET B CB  1 
ATOM   5302 C CG  . MET B 1 341 ? 72.995 -33.622 -23.230 1.00 48.95  ? 701  MET B CG  1 
ATOM   5303 S SD  . MET B 1 341 ? 74.793 -33.691 -22.936 1.00 55.69  ? 701  MET B SD  1 
ATOM   5304 C CE  . MET B 1 341 ? 74.976 -35.161 -21.922 1.00 54.92  ? 701  MET B CE  1 
ATOM   5305 N N   . GLU B 1 342 ? 72.329 -36.967 -26.552 1.00 46.88  ? 702  GLU B N   1 
ATOM   5306 C CA  . GLU B 1 342 ? 72.500 -38.316 -27.138 1.00 47.20  ? 702  GLU B CA  1 
ATOM   5307 C C   . GLU B 1 342 ? 73.635 -38.364 -28.134 1.00 46.44  ? 702  GLU B C   1 
ATOM   5308 O O   . GLU B 1 342 ? 74.442 -39.290 -28.106 1.00 46.60  ? 702  GLU B O   1 
ATOM   5309 C CB  . GLU B 1 342 ? 71.227 -38.804 -27.843 1.00 47.73  ? 702  GLU B CB  1 
ATOM   5310 C CG  . GLU B 1 342 ? 70.076 -39.117 -26.923 1.00 49.98  ? 702  GLU B CG  1 
ATOM   5311 C CD  . GLU B 1 342 ? 69.063 -40.078 -27.541 1.00 53.39  ? 702  GLU B CD  1 
ATOM   5312 O OE1 . GLU B 1 342 ? 68.655 -39.860 -28.708 1.00 54.26  ? 702  GLU B OE1 1 
ATOM   5313 O OE2 . GLU B 1 342 ? 68.676 -41.053 -26.850 1.00 54.46  ? 702  GLU B OE2 1 
ATOM   5314 N N   . ARG B 1 343 ? 73.674 -37.379 -29.030 1.00 46.14  ? 703  ARG B N   1 
ATOM   5315 C CA  . ARG B 1 343 ? 74.755 -37.246 -30.013 1.00 45.47  ? 703  ARG B CA  1 
ATOM   5316 C C   . ARG B 1 343 ? 76.113 -36.981 -29.358 1.00 45.57  ? 703  ARG B C   1 
ATOM   5317 O O   . ARG B 1 343 ? 77.110 -37.545 -29.778 1.00 45.68  ? 703  ARG B O   1 
ATOM   5318 C CB  . ARG B 1 343 ? 74.458 -36.137 -31.014 1.00 45.39  ? 703  ARG B CB  1 
ATOM   5319 C CG  . ARG B 1 343 ? 73.428 -36.462 -32.067 1.00 44.39  ? 703  ARG B CG  1 
ATOM   5320 C CD  . ARG B 1 343 ? 73.035 -35.151 -32.746 1.00 46.44  ? 703  ARG B CD  1 
ATOM   5321 N NE  . ARG B 1 343 ? 71.688 -35.226 -33.293 1.00 48.45  ? 703  ARG B NE  1 
ATOM   5322 C CZ  . ARG B 1 343 ? 70.628 -34.556 -32.847 1.00 47.21  ? 703  ARG B CZ  1 
ATOM   5323 N NH1 . ARG B 1 343 ? 70.718 -33.700 -31.843 1.00 47.61  ? 703  ARG B NH1 1 
ATOM   5324 N NH2 . ARG B 1 343 ? 69.457 -34.742 -33.435 1.00 48.10  ? 703  ARG B NH2 1 
ATOM   5325 N N   . LEU B 1 344 ? 76.146 -36.127 -28.337 1.00 45.95  ? 704  LEU B N   1 
ATOM   5326 C CA  . LEU B 1 344 ? 77.390 -35.813 -27.624 1.00 46.31  ? 704  LEU B CA  1 
ATOM   5327 C C   . LEU B 1 344 ? 78.054 -37.032 -26.959 1.00 47.04  ? 704  LEU B C   1 
ATOM   5328 O O   . LEU B 1 344 ? 79.281 -37.156 -26.953 1.00 47.16  ? 704  LEU B O   1 
ATOM   5329 C CB  . LEU B 1 344 ? 77.164 -34.689 -26.595 1.00 45.84  ? 704  LEU B CB  1 
ATOM   5330 C CG  . LEU B 1 344 ? 78.400 -34.185 -25.824 1.00 45.74  ? 704  LEU B CG  1 
ATOM   5331 C CD1 . LEU B 1 344 ? 79.458 -33.585 -26.754 1.00 44.03  ? 704  LEU B CD1 1 
ATOM   5332 C CD2 . LEU B 1 344 ? 78.038 -33.201 -24.732 1.00 45.66  ? 704  LEU B CD2 1 
ATOM   5333 N N   . ILE B 1 345 ? 77.236 -37.921 -26.406 1.00 48.47  ? 705  ILE B N   1 
ATOM   5334 C CA  . ILE B 1 345 ? 77.713 -39.083 -25.649 1.00 49.59  ? 705  ILE B CA  1 
ATOM   5335 C C   . ILE B 1 345 ? 78.190 -40.201 -26.571 1.00 50.22  ? 705  ILE B C   1 
ATOM   5336 O O   . ILE B 1 345 ? 79.309 -40.707 -26.414 1.00 50.36  ? 705  ILE B O   1 
ATOM   5337 C CB  . ILE B 1 345 ? 76.632 -39.586 -24.651 1.00 49.65  ? 705  ILE B CB  1 
ATOM   5338 C CG1 . ILE B 1 345 ? 76.421 -38.552 -23.539 1.00 50.19  ? 705  ILE B CG1 1 
ATOM   5339 C CG2 . ILE B 1 345 ? 77.016 -40.942 -24.054 1.00 50.62  ? 705  ILE B CG2 1 
ATOM   5340 C CD1 . ILE B 1 345 ? 75.055 -38.639 -22.851 1.00 50.84  ? 705  ILE B CD1 1 
ATOM   5341 N N   . SER B 1 346 ? 77.350 -40.570 -27.537 1.00 51.30  ? 706  SER B N   1 
ATOM   5342 C CA  . SER B 1 346 ? 77.688 -41.616 -28.514 1.00 52.46  ? 706  SER B CA  1 
ATOM   5343 C C   . SER B 1 346 ? 78.783 -41.180 -29.483 1.00 52.87  ? 706  SER B C   1 
ATOM   5344 O O   . SER B 1 346 ? 79.426 -42.018 -30.127 1.00 52.90  ? 706  SER B O   1 
ATOM   5345 C CB  . SER B 1 346 ? 76.445 -42.095 -29.277 1.00 52.62  ? 706  SER B CB  1 
ATOM   5346 O OG  . SER B 1 346 ? 75.613 -41.007 -29.656 1.00 53.68  ? 706  SER B OG  1 
ATOM   5347 N N   . HIS B 1 347 ? 78.992 -39.868 -29.584 1.00 53.51  ? 707  HIS B N   1 
ATOM   5348 C CA  . HIS B 1 347 ? 80.112 -39.337 -30.356 1.00 54.11  ? 707  HIS B CA  1 
ATOM   5349 C C   . HIS B 1 347 ? 81.410 -39.408 -29.548 1.00 54.63  ? 707  HIS B C   1 
ATOM   5350 O O   . HIS B 1 347 ? 82.466 -39.642 -30.110 1.00 54.55  ? 707  HIS B O   1 
ATOM   5351 C CB  . HIS B 1 347 ? 79.835 -37.914 -30.831 1.00 53.87  ? 707  HIS B CB  1 
ATOM   5352 C CG  . HIS B 1 347 ? 80.825 -37.413 -31.834 1.00 53.65  ? 707  HIS B CG  1 
ATOM   5353 N ND1 . HIS B 1 347 ? 81.945 -36.693 -31.478 1.00 52.71  ? 707  HIS B ND1 1 
ATOM   5354 C CD2 . HIS B 1 347 ? 80.864 -37.529 -33.182 1.00 53.23  ? 707  HIS B CD2 1 
ATOM   5355 C CE1 . HIS B 1 347 ? 82.630 -36.386 -32.564 1.00 53.27  ? 707  HIS B CE1 1 
ATOM   5356 N NE2 . HIS B 1 347 ? 81.997 -36.882 -33.611 1.00 53.25  ? 707  HIS B NE2 1 
ATOM   5357 N N   . HIS B 1 348 ? 81.320 -39.219 -28.231 1.00 55.64  ? 708  HIS B N   1 
ATOM   5358 C CA  . HIS B 1 348 ? 82.475 -39.365 -27.337 1.00 56.61  ? 708  HIS B CA  1 
ATOM   5359 C C   . HIS B 1 348 ? 82.840 -40.844 -27.088 1.00 57.35  ? 708  HIS B C   1 
ATOM   5360 O O   . HIS B 1 348 ? 82.849 -41.319 -25.945 1.00 57.37  ? 708  HIS B O   1 
ATOM   5361 C CB  . HIS B 1 348 ? 82.247 -38.611 -26.016 1.00 56.71  ? 708  HIS B CB  1 
ATOM   5362 C CG  . HIS B 1 348 ? 82.731 -37.188 -26.025 1.00 57.27  ? 708  HIS B CG  1 
ATOM   5363 N ND1 . HIS B 1 348 ? 82.164 -36.205 -26.812 1.00 57.80  ? 708  HIS B ND1 1 
ATOM   5364 C CD2 . HIS B 1 348 ? 83.709 -36.576 -25.314 1.00 57.16  ? 708  HIS B CD2 1 
ATOM   5365 C CE1 . HIS B 1 348 ? 82.783 -35.057 -26.599 1.00 57.08  ? 708  HIS B CE1 1 
ATOM   5366 N NE2 . HIS B 1 348 ? 83.724 -35.255 -25.694 1.00 57.14  ? 708  HIS B NE2 1 
ATOM   5367 N N   . HIS B 1 349 ? 83.096 -41.561 -28.184 1.00 58.26  ? 709  HIS B N   1 
ATOM   5368 C CA  . HIS B 1 349 ? 83.797 -42.851 -28.193 1.00 58.91  ? 709  HIS B CA  1 
ATOM   5369 C C   . HIS B 1 349 ? 85.013 -42.650 -29.086 1.00 59.44  ? 709  HIS B C   1 
ATOM   5370 O O   . HIS B 1 349 ? 86.001 -43.393 -29.014 1.00 59.52  ? 709  HIS B O   1 
ATOM   5371 C CB  . HIS B 1 349 ? 82.907 -43.963 -28.750 1.00 58.83  ? 709  HIS B CB  1 
ATOM   5372 C CG  . HIS B 1 349 ? 81.992 -44.580 -27.733 1.00 59.68  ? 709  HIS B CG  1 
ATOM   5373 N ND1 . HIS B 1 349 ? 81.962 -45.938 -27.484 1.00 59.87  ? 709  HIS B ND1 1 
ATOM   5374 C CD2 . HIS B 1 349 ? 81.072 -44.028 -26.904 1.00 59.69  ? 709  HIS B CD2 1 
ATOM   5375 C CE1 . HIS B 1 349 ? 81.065 -46.194 -26.548 1.00 59.25  ? 709  HIS B CE1 1 
ATOM   5376 N NE2 . HIS B 1 349 ? 80.513 -45.053 -26.178 1.00 59.68  ? 709  HIS B NE2 1 
ATOM   5377 N N   . HIS B 1 350 ? 84.913 -41.631 -29.938 1.00 60.03  ? 710  HIS B N   1 
ATOM   5378 C CA  . HIS B 1 350 ? 86.040 -41.109 -30.711 1.00 60.68  ? 710  HIS B CA  1 
ATOM   5379 C C   . HIS B 1 350 ? 86.907 -40.231 -29.804 1.00 60.87  ? 710  HIS B C   1 
ATOM   5380 O O   . HIS B 1 350 ? 88.032 -39.858 -30.162 1.00 61.04  ? 710  HIS B O   1 
ATOM   5381 C CB  . HIS B 1 350 ? 85.533 -40.279 -31.899 1.00 60.79  ? 710  HIS B CB  1 
ATOM   5382 C CG  . HIS B 1 350 ? 84.501 -40.976 -32.734 1.00 61.30  ? 710  HIS B CG  1 
ATOM   5383 N ND1 . HIS B 1 350 ? 84.824 -41.729 -33.842 1.00 61.63  ? 710  HIS B ND1 1 
ATOM   5384 C CD2 . HIS B 1 350 ? 83.152 -41.029 -32.624 1.00 61.48  ? 710  HIS B CD2 1 
ATOM   5385 C CE1 . HIS B 1 350 ? 83.719 -42.219 -34.376 1.00 61.99  ? 710  HIS B CE1 1 
ATOM   5386 N NE2 . HIS B 1 350 ? 82.690 -41.810 -33.655 1.00 61.74  ? 710  HIS B NE2 1 
ATOM   5387 N N   . HIS B 1 351 ? 86.358 -39.910 -28.630 1.00 61.23  ? 711  HIS B N   1 
ATOM   5388 C CA  . HIS B 1 351 ? 87.022 -39.083 -27.624 1.00 61.39  ? 711  HIS B CA  1 
ATOM   5389 C C   . HIS B 1 351 ? 87.115 -39.808 -26.279 1.00 61.50  ? 711  HIS B C   1 
ATOM   5390 O O   . HIS B 1 351 ? 88.007 -40.644 -26.075 1.00 61.45  ? 711  HIS B O   1 
ATOM   5391 C CB  . HIS B 1 351 ? 86.301 -37.735 -27.472 1.00 61.18  ? 711  HIS B CB  1 
ATOM   5392 C CG  . HIS B 1 351 ? 86.337 -36.893 -28.712 1.00 61.08  ? 711  HIS B CG  1 
ATOM   5393 N ND1 . HIS B 1 351 ? 87.515 -36.442 -29.270 1.00 60.98  ? 711  HIS B ND1 1 
ATOM   5394 C CD2 . HIS B 1 351 ? 85.344 -36.433 -29.509 1.00 60.77  ? 711  HIS B CD2 1 
ATOM   5395 C CE1 . HIS B 1 351 ? 87.244 -35.738 -30.356 1.00 60.94  ? 711  HIS B CE1 1 
ATOM   5396 N NE2 . HIS B 1 351 ? 85.934 -35.717 -30.522 1.00 60.53  ? 711  HIS B NE2 1 
HETATM 5397 C CBD . LG8 C 2 .   ? 56.977 19.337  -3.664  1.00 42.55  ? 1701 LG8 A CBD 1 
HETATM 5398 C CBB . LG8 C 2 .   ? 57.057 19.229  -2.114  1.00 40.93  ? 1701 LG8 A CBB 1 
HETATM 5399 N NAW . LG8 C 2 .   ? 57.605 17.916  -1.734  1.00 41.45  ? 1701 LG8 A NAW 1 
HETATM 5400 C CAV . LG8 C 2 .   ? 57.416 16.813  -2.420  1.00 40.19  ? 1701 LG8 A CAV 1 
HETATM 5401 C CAX . LG8 C 2 .   ? 58.365 17.684  -0.641  1.00 40.24  ? 1701 LG8 A CAX 1 
HETATM 5402 C CAY . LG8 C 2 .   ? 58.798 18.586  0.347   1.00 39.06  ? 1701 LG8 A CAY 1 
HETATM 5403 C CAZ . LG8 C 2 .   ? 59.606 18.053  1.374   1.00 40.38  ? 1701 LG8 A CAZ 1 
HETATM 5404 C CAP . LG8 C 2 .   ? 59.948 16.685  1.407   1.00 39.49  ? 1701 LG8 A CAP 1 
HETATM 5405 C CAO . LG8 C 2 .   ? 59.521 15.800  0.414   1.00 38.71  ? 1701 LG8 A CAO 1 
HETATM 5406 C CAN . LG8 C 2 .   ? 58.709 16.335  -0.607  1.00 38.89  ? 1701 LG8 A CAN 1 
HETATM 5407 C CAM . LG8 C 2 .   ? 58.056 15.772  -1.843  1.00 38.37  ? 1701 LG8 A CAM 1 
HETATM 5408 C CAH . LG8 C 2 .   ? 58.159 14.336  -2.209  1.00 39.44  ? 1701 LG8 A CAH 1 
HETATM 5409 C CAE . LG8 C 2 .   ? 57.941 13.211  -1.261  1.00 39.97  ? 1701 LG8 A CAE 1 
HETATM 5410 O OAF . LG8 C 2 .   ? 57.619 13.315  -0.076  1.00 38.76  ? 1701 LG8 A OAF 1 
HETATM 5411 N NAD . LG8 C 2 .   ? 58.128 12.037  -1.889  1.00 40.55  ? 1701 LG8 A NAD 1 
HETATM 5412 C CAC . LG8 C 2 .   ? 58.478 12.303  -3.153  1.00 39.74  ? 1701 LG8 A CAC 1 
HETATM 5413 O OAB . LG8 C 2 .   ? 58.736 11.469  -4.011  1.00 40.85  ? 1701 LG8 A OAB 1 
HETATM 5414 C CAG . LG8 C 2 .   ? 58.534 13.755  -3.379  1.00 37.82  ? 1701 LG8 A CAG 1 
HETATM 5415 C CAL . LG8 C 2 .   ? 58.846 14.326  -4.707  1.00 37.36  ? 1701 LG8 A CAL 1 
HETATM 5416 C CAU . LG8 C 2 .   ? 58.515 13.742  -5.891  1.00 37.41  ? 1701 LG8 A CAU 1 
HETATM 5417 C CAK . LG8 C 2 .   ? 59.503 15.641  -5.042  1.00 37.03  ? 1701 LG8 A CAK 1 
HETATM 5418 C CAJ . LG8 C 2 .   ? 60.055 16.725  -4.333  1.00 37.74  ? 1701 LG8 A CAJ 1 
HETATM 5419 C CAI . LG8 C 2 .   ? 60.566 17.797  -5.068  1.00 36.31  ? 1701 LG8 A CAI 1 
HETATM 5420 C CAQ . LG8 C 2 .   ? 60.529 17.794  -6.470  1.00 35.98  ? 1701 LG8 A CAQ 1 
HETATM 5421 C CAR . LG8 C 2 .   ? 59.979 16.720  -7.175  1.00 35.60  ? 1701 LG8 A CAR 1 
HETATM 5422 C CAS . LG8 C 2 .   ? 59.468 15.648  -6.434  1.00 37.68  ? 1701 LG8 A CAS 1 
HETATM 5423 N NAT . LG8 C 2 .   ? 58.888 14.508  -6.889  1.00 39.18  ? 1701 LG8 A NAT 1 
HETATM 5424 C CBA . LG8 C 2 .   ? 58.721 14.209  -8.302  1.00 37.20  ? 1701 LG8 A CBA 1 
HETATM 5425 C CBF . LG8 C 2 .   ? 56.151 18.160  -4.259  1.00 42.46  ? 1701 LG8 A CBF 1 
HETATM 5426 C CBG . LG8 C 2 .   ? 56.105 18.064  -5.823  1.00 41.92  ? 1701 LG8 A CBG 1 
HETATM 5427 N NBH . LG8 C 2 .   ? 56.025 19.342  -6.589  1.00 45.65  ? 1701 LG8 A NBH 1 
HETATM 5428 C C6  . LG8 C 2 .   ? 56.604 16.776  -3.693  1.00 39.66  ? 1701 LG8 A C6  1 
HETATM 5429 C CBI . LG8 C 2 .   ? 57.385 19.878  -6.951  1.00 43.60  ? 1701 LG8 A CBI 1 
HETATM 5430 C CBJ . LG8 C 2 .   ? 55.048 19.362  -7.716  1.00 40.82  ? 1701 LG8 A CBJ 1 
HETATM 5431 C CBD . LG8 D 2 .   ? 54.184 -27.075 -9.878  1.00 46.10  ? 1712 LG8 B CBD 1 
HETATM 5432 C CBB . LG8 D 2 .   ? 54.223 -27.917 -11.181 1.00 43.15  ? 1712 LG8 B CBB 1 
HETATM 5433 N NAW . LG8 D 2 .   ? 55.611 -28.258 -11.503 1.00 43.07  ? 1712 LG8 B NAW 1 
HETATM 5434 C CAV . LG8 D 2 .   ? 56.633 -27.468 -11.243 1.00 42.65  ? 1712 LG8 B CAV 1 
HETATM 5435 C CAX . LG8 D 2 .   ? 55.994 -29.403 -12.094 1.00 42.00  ? 1712 LG8 B CAX 1 
HETATM 5436 C CAY . LG8 D 2 .   ? 55.207 -30.494 -12.520 1.00 42.24  ? 1712 LG8 B CAY 1 
HETATM 5437 C CAZ . LG8 D 2 .   ? 55.861 -31.586 -13.098 1.00 41.46  ? 1712 LG8 B CAZ 1 
HETATM 5438 C CAP . LG8 D 2 .   ? 57.261 -31.564 -13.241 1.00 41.50  ? 1712 LG8 B CAP 1 
HETATM 5439 C CAO . LG8 D 2 .   ? 58.037 -30.485 -12.798 1.00 41.35  ? 1712 LG8 B CAO 1 
HETATM 5440 C CAN . LG8 D 2 .   ? 57.371 -29.395 -12.230 1.00 41.29  ? 1712 LG8 B CAN 1 
HETATM 5441 C CAM . LG8 D 2 .   ? 57.786 -28.068 -11.640 1.00 41.25  ? 1712 LG8 B CAM 1 
HETATM 5442 C CAH . LG8 D 2 .   ? 59.207 -27.620 -11.585 1.00 41.39  ? 1712 LG8 B CAH 1 
HETATM 5443 C CAE . LG8 D 2 .   ? 60.122 -27.696 -12.734 1.00 39.95  ? 1712 LG8 B CAE 1 
HETATM 5444 O OAF . LG8 D 2 .   ? 59.801 -28.103 -13.834 1.00 39.73  ? 1712 LG8 B OAF 1 
HETATM 5445 N NAD . LG8 D 2 .   ? 61.332 -27.245 -12.396 1.00 40.39  ? 1712 LG8 B NAD 1 
HETATM 5446 C CAC . LG8 D 2 .   ? 61.285 -26.862 -11.110 1.00 41.08  ? 1712 LG8 B CAC 1 
HETATM 5447 O OAB . LG8 D 2 .   ? 62.209 -26.390 -10.447 1.00 40.58  ? 1712 LG8 B OAB 1 
HETATM 5448 C CAG . LG8 D 2 .   ? 59.946 -27.123 -10.563 1.00 39.39  ? 1712 LG8 B CAG 1 
HETATM 5449 C CAL . LG8 D 2 .   ? 59.589 -26.789 -9.169  1.00 39.73  ? 1712 LG8 B CAL 1 
HETATM 5450 C CAU . LG8 D 2 .   ? 60.098 -25.748 -8.463  1.00 40.80  ? 1712 LG8 B CAU 1 
HETATM 5451 C CAK . LG8 D 2 .   ? 58.593 -27.476 -8.270  1.00 39.54  ? 1712 LG8 B CAK 1 
HETATM 5452 C CAJ . LG8 D 2 .   ? 57.741 -28.578 -8.381  1.00 38.82  ? 1712 LG8 B CAJ 1 
HETATM 5453 C CAI . LG8 D 2 .   ? 56.952 -28.913 -7.287  1.00 38.63  ? 1712 LG8 B CAI 1 
HETATM 5454 C CAQ . LG8 D 2 .   ? 57.016 -28.154 -6.118  1.00 38.92  ? 1712 LG8 B CAQ 1 
HETATM 5455 C CAR . LG8 D 2 .   ? 57.866 -27.046 -5.997  1.00 38.95  ? 1712 LG8 B CAR 1 
HETATM 5456 C CAS . LG8 D 2 .   ? 58.663 -26.722 -7.104  1.00 41.28  ? 1712 LG8 B CAS 1 
HETATM 5457 N NAT . LG8 D 2 .   ? 59.565 -25.698 -7.257  1.00 42.14  ? 1712 LG8 B NAT 1 
HETATM 5458 C CBA . LG8 D 2 .   ? 59.902 -24.707 -6.227  1.00 38.31  ? 1712 LG8 B CBA 1 
HETATM 5459 C CBF . LG8 D 2 .   ? 55.066 -25.799 -9.967  1.00 46.43  ? 1712 LG8 B CBF 1 
HETATM 5460 C CBG . LG8 D 2 .   ? 55.155 -25.026 -8.600  1.00 46.68  ? 1712 LG8 B CBG 1 
HETATM 5461 N NBH . LG8 D 2 .   ? 53.911 -24.969 -7.765  1.00 49.01  ? 1712 LG8 B NBH 1 
HETATM 5462 C C6  . LG8 D 2 .   ? 56.482 -26.114 -10.570 1.00 41.93  ? 1712 LG8 B C6  1 
HETATM 5463 C CBI . LG8 D 2 .   ? 53.939 -25.930 -6.630  1.00 46.04  ? 1712 LG8 B CBI 1 
HETATM 5464 C CBJ . LG8 D 2 .   ? 53.458 -23.612 -7.341  1.00 46.84  ? 1712 LG8 B CBJ 1 
HETATM 5465 C C1  . MPD E 3 .   ? 46.614 -12.053 -4.635  1.00 61.91  ? 1713 MPD B C1  1 
HETATM 5466 C C2  . MPD E 3 .   ? 45.656 -13.144 -5.118  1.00 62.73  ? 1713 MPD B C2  1 
HETATM 5467 O O2  . MPD E 3 .   ? 44.365 -12.511 -5.272  1.00 65.40  ? 1713 MPD B O2  1 
HETATM 5468 C CM  . MPD E 3 .   ? 45.580 -14.226 -4.044  1.00 60.92  ? 1713 MPD B CM  1 
HETATM 5469 C C3  . MPD E 3 .   ? 46.017 -13.711 -6.500  1.00 62.46  ? 1713 MPD B C3  1 
HETATM 5470 C C4  . MPD E 3 .   ? 44.884 -14.358 -7.323  1.00 60.44  ? 1713 MPD B C4  1 
HETATM 5471 O O4  . MPD E 3 .   ? 43.858 -14.836 -6.499  1.00 59.26  ? 1713 MPD B O4  1 
HETATM 5472 C C5  . MPD E 3 .   ? 44.243 -13.374 -8.282  1.00 61.12  ? 1713 MPD B C5  1 
HETATM 5473 O O   . HOH F 4 .   ? 75.424 9.401   -4.166  1.00 53.97  ? 2001 HOH A O   1 
HETATM 5474 O O   . HOH F 4 .   ? 62.853 17.998  -12.004 1.00 31.33  ? 2002 HOH A O   1 
HETATM 5475 O O   . HOH F 4 .   ? 60.731 21.593  -7.635  1.00 54.55  ? 2003 HOH A O   1 
HETATM 5476 O O   . HOH F 4 .   ? 66.397 28.069  -3.763  1.00 71.16  ? 2004 HOH A O   1 
HETATM 5477 O O   . HOH F 4 .   ? 59.709 25.950  -4.981  1.00 48.10  ? 2005 HOH A O   1 
HETATM 5478 O O   . HOH F 4 .   ? 59.916 24.480  3.221   1.00 47.02  ? 2006 HOH A O   1 
HETATM 5479 O O   . HOH F 4 .   ? 56.914 25.689  -3.033  1.00 92.95  ? 2007 HOH A O   1 
HETATM 5480 O O   . HOH F 4 .   ? 69.863 0.961   -10.299 1.00 64.53  ? 2008 HOH A O   1 
HETATM 5481 O O   . HOH F 4 .   ? 61.895 0.670   -4.301  1.00 49.82  ? 2009 HOH A O   1 
HETATM 5482 O O   . HOH F 4 .   ? 69.540 24.030  2.225   1.00 48.91  ? 2010 HOH A O   1 
HETATM 5483 O O   . HOH F 4 .   ? 75.754 26.954  1.773   1.00 60.92  ? 2011 HOH A O   1 
HETATM 5484 O O   . HOH F 4 .   ? 57.550 17.643  4.116   1.00 49.12  ? 2012 HOH A O   1 
HETATM 5485 O O   . HOH F 4 .   ? 60.532 23.358  7.127   1.00 55.80  ? 2013 HOH A O   1 
HETATM 5486 O O   . HOH F 4 .   ? 59.491 14.202  16.379  1.00 67.46  ? 2014 HOH A O   1 
HETATM 5487 O O   . HOH F 4 .   ? 61.544 18.049  18.110  1.00 65.86  ? 2015 HOH A O   1 
HETATM 5488 O O   . HOH F 4 .   ? 56.237 9.203   8.915   1.00 52.55  ? 2016 HOH A O   1 
HETATM 5489 O O   . HOH F 4 .   ? 45.110 5.661   9.998   1.00 69.93  ? 2017 HOH A O   1 
HETATM 5490 O O   . HOH F 4 .   ? 43.460 7.702   10.939  1.00 61.57  ? 2018 HOH A O   1 
HETATM 5491 O O   . HOH F 4 .   ? 79.336 15.113  10.497  1.00 54.87  ? 2019 HOH A O   1 
HETATM 5492 O O   . HOH F 4 .   ? 85.995 21.712  13.617  1.00 50.20  ? 2020 HOH A O   1 
HETATM 5493 O O   . HOH F 4 .   ? 76.398 21.771  13.446  1.00 66.83  ? 2021 HOH A O   1 
HETATM 5494 O O   . HOH F 4 .   ? 56.818 9.496   -13.458 1.00 39.37  ? 2022 HOH A O   1 
HETATM 5495 O O   . HOH F 4 .   ? 55.572 12.776  -8.621  1.00 35.39  ? 2023 HOH A O   1 
HETATM 5496 O O   . HOH F 4 .   ? 55.649 15.510  -8.562  1.00 31.99  ? 2024 HOH A O   1 
HETATM 5497 O O   . HOH F 4 .   ? 55.769 18.379  -11.320 1.00 28.89  ? 2025 HOH A O   1 
HETATM 5498 O O   . HOH F 4 .   ? 51.771 18.517  -17.491 1.00 49.47  ? 2026 HOH A O   1 
HETATM 5499 O O   . HOH F 4 .   ? 54.717 18.022  -19.607 1.00 72.24  ? 2027 HOH A O   1 
HETATM 5500 O O   . HOH F 4 .   ? 48.711 12.977  -16.860 1.00 54.73  ? 2028 HOH A O   1 
HETATM 5501 O O   . HOH F 4 .   ? 48.333 19.698  -22.365 1.00 67.28  ? 2029 HOH A O   1 
HETATM 5502 O O   . HOH F 4 .   ? 45.517 23.776  -17.836 1.00 51.73  ? 2030 HOH A O   1 
HETATM 5503 O O   . HOH F 4 .   ? 43.771 23.592  -15.741 1.00 40.16  ? 2031 HOH A O   1 
HETATM 5504 O O   . HOH F 4 .   ? 38.509 15.776  -17.716 1.00 48.48  ? 2032 HOH A O   1 
HETATM 5505 O O   . HOH F 4 .   ? 37.022 12.039  -17.912 1.00 48.13  ? 2033 HOH A O   1 
HETATM 5506 O O   . HOH F 4 .   ? 39.471 13.209  -15.451 1.00 31.08  ? 2034 HOH A O   1 
HETATM 5507 O O   . HOH F 4 .   ? 36.551 9.191   -12.921 1.00 56.49  ? 2035 HOH A O   1 
HETATM 5508 O O   . HOH F 4 .   ? 32.531 11.803  -13.573 1.00 41.73  ? 2036 HOH A O   1 
HETATM 5509 O O   . HOH F 4 .   ? 34.236 9.257   -6.851  1.00 41.95  ? 2037 HOH A O   1 
HETATM 5510 O O   . HOH F 4 .   ? 30.184 11.333  -9.519  1.00 59.25  ? 2038 HOH A O   1 
HETATM 5511 O O   . HOH F 4 .   ? 45.525 12.350  -15.483 1.00 45.87  ? 2039 HOH A O   1 
HETATM 5512 O O   . HOH F 4 .   ? 43.805 8.720   -9.014  1.00 29.31  ? 2040 HOH A O   1 
HETATM 5513 O O   . HOH F 4 .   ? 40.743 11.448  8.905   1.00 48.30  ? 2041 HOH A O   1 
HETATM 5514 O O   . HOH F 4 .   ? 33.792 17.420  10.685  1.00 63.60  ? 2042 HOH A O   1 
HETATM 5515 O O   . HOH F 4 .   ? 40.740 11.823  11.607  1.00 61.90  ? 2043 HOH A O   1 
HETATM 5516 O O   . HOH F 4 .   ? 39.685 16.491  12.481  1.00 54.63  ? 2044 HOH A O   1 
HETATM 5517 O O   . HOH F 4 .   ? 39.080 19.509  10.930  1.00 46.93  ? 2045 HOH A O   1 
HETATM 5518 O O   . HOH F 4 .   ? 43.903 11.467  15.299  1.00 67.40  ? 2046 HOH A O   1 
HETATM 5519 O O   . HOH F 4 .   ? 52.767 22.805  5.282   1.00 39.82  ? 2047 HOH A O   1 
HETATM 5520 O O   . HOH F 4 .   ? 54.839 29.421  11.826  1.00 54.98  ? 2048 HOH A O   1 
HETATM 5521 O O   . HOH F 4 .   ? 47.398 29.411  3.820   1.00 51.03  ? 2049 HOH A O   1 
HETATM 5522 O O   . HOH F 4 .   ? 54.806 23.792  2.530   1.00 52.43  ? 2050 HOH A O   1 
HETATM 5523 O O   . HOH F 4 .   ? 55.368 25.449  -0.876  1.00 62.23  ? 2051 HOH A O   1 
HETATM 5524 O O   . HOH F 4 .   ? 48.570 27.033  -0.298  1.00 51.79  ? 2052 HOH A O   1 
HETATM 5525 O O   . HOH F 4 .   ? 53.824 7.405   -7.032  1.00 35.03  ? 2053 HOH A O   1 
HETATM 5526 O O   . HOH F 4 .   ? 48.177 2.457   -2.678  1.00 55.76  ? 2054 HOH A O   1 
HETATM 5527 O O   . HOH F 4 .   ? 53.255 4.161   -4.503  1.00 41.25  ? 2055 HOH A O   1 
HETATM 5528 O O   . HOH F 4 .   ? 51.514 3.358   -11.161 1.00 34.01  ? 2056 HOH A O   1 
HETATM 5529 O O   . HOH F 4 .   ? 51.803 -3.278  -4.124  1.00 58.03  ? 2057 HOH A O   1 
HETATM 5530 O O   . HOH F 4 .   ? 45.632 0.020   -2.902  1.00 65.82  ? 2058 HOH A O   1 
HETATM 5531 O O   . HOH F 4 .   ? 44.759 1.252   -8.835  1.00 34.37  ? 2059 HOH A O   1 
HETATM 5532 O O   . HOH F 4 .   ? 60.219 20.430  -9.705  1.00 53.72  ? 2060 HOH A O   1 
HETATM 5533 O O   . HOH F 4 .   ? 56.580 23.562  -4.285  1.00 61.25  ? 2061 HOH A O   1 
HETATM 5534 O O   . HOH F 4 .   ? 43.519 0.638   -4.214  1.00 55.91  ? 2062 HOH A O   1 
HETATM 5535 O O   . HOH F 4 .   ? 50.347 4.553   1.936   1.00 58.82  ? 2063 HOH A O   1 
HETATM 5536 O O   . HOH F 4 .   ? 60.181 2.567   -6.280  1.00 66.61  ? 2064 HOH A O   1 
HETATM 5537 O O   . HOH F 4 .   ? 59.376 21.733  3.327   1.00 56.61  ? 2065 HOH A O   1 
HETATM 5538 O O   . HOH F 4 .   ? 55.695 22.649  -2.056  1.00 34.07  ? 2066 HOH A O   1 
HETATM 5539 O O   . HOH F 4 .   ? 58.162 24.570  0.849   1.00 55.73  ? 2067 HOH A O   1 
HETATM 5540 O O   . HOH F 4 .   ? 56.551 15.768  2.254   1.00 33.78  ? 2068 HOH A O   1 
HETATM 5541 O O   . HOH F 4 .   ? 59.921 25.431  5.643   1.00 50.74  ? 2069 HOH A O   1 
HETATM 5542 O O   . HOH F 4 .   ? 54.611 25.267  15.167  1.00 70.63  ? 2070 HOH A O   1 
HETATM 5543 O O   . HOH F 4 .   ? 46.602 30.610  20.843  1.00 58.11  ? 2071 HOH A O   1 
HETATM 5544 O O   . HOH F 4 .   ? 78.903 15.182  13.094  1.00 67.15  ? 2072 HOH A O   1 
HETATM 5545 O O   . HOH F 4 .   ? 53.573 37.069  9.392   1.00 59.47  ? 2073 HOH A O   1 
HETATM 5546 O O   . HOH F 4 .   ? 47.501 29.076  0.844   1.00 47.06  ? 2074 HOH A O   1 
HETATM 5547 O O   . HOH F 4 .   ? 57.528 17.719  -9.688  1.00 47.71  ? 2075 HOH A O   1 
HETATM 5548 O O   . HOH F 4 .   ? 42.175 32.098  -1.900  1.00 26.83  ? 2076 HOH A O   1 
HETATM 5549 O O   . HOH F 4 .   ? 42.241 31.747  -6.516  1.00 29.94  ? 2077 HOH A O   1 
HETATM 5550 O O   . HOH F 4 .   ? 44.265 33.625  -10.163 1.00 35.92  ? 2078 HOH A O   1 
HETATM 5551 O O   . HOH F 4 .   ? 53.101 20.693  -16.499 1.00 51.35  ? 2079 HOH A O   1 
HETATM 5552 O O   . HOH F 4 .   ? 44.767 29.763  3.565   1.00 39.24  ? 2080 HOH A O   1 
HETATM 5553 O O   . HOH F 4 .   ? 39.914 13.664  -17.925 1.00 52.52  ? 2081 HOH A O   1 
HETATM 5554 O O   . HOH F 4 .   ? 30.788 9.953   -6.126  1.00 54.06  ? 2082 HOH A O   1 
HETATM 5555 O O   . HOH F 4 .   ? 48.286 37.421  8.451   1.00 56.33  ? 2083 HOH A O   1 
HETATM 5556 O O   . HOH F 4 .   ? 41.787 38.517  15.248  1.00 64.80  ? 2084 HOH A O   1 
HETATM 5557 O O   . HOH F 4 .   ? 46.877 36.839  10.572  1.00 59.27  ? 2085 HOH A O   1 
HETATM 5558 O O   . HOH F 4 .   ? 39.943 33.968  11.759  1.00 53.48  ? 2086 HOH A O   1 
HETATM 5559 O O   . HOH F 4 .   ? 56.057 26.857  13.242  1.00 92.39  ? 2087 HOH A O   1 
HETATM 5560 O O   . HOH F 4 .   ? 40.027 31.368  12.019  1.00 48.23  ? 2088 HOH A O   1 
HETATM 5561 O O   . HOH F 4 .   ? 46.052 25.258  3.463   1.00 40.34  ? 2089 HOH A O   1 
HETATM 5562 O O   . HOH F 4 .   ? 58.886 28.735  6.062   1.00 69.89  ? 2090 HOH A O   1 
HETATM 5563 O O   . HOH F 4 .   ? 36.655 30.634  -13.588 1.00 60.37  ? 2091 HOH A O   1 
HETATM 5564 O O   . HOH F 4 .   ? 46.946 27.866  -9.076  1.00 51.55  ? 2092 HOH A O   1 
HETATM 5565 O O   . HOH F 4 .   ? 44.702 32.577  -12.477 1.00 49.18  ? 2093 HOH A O   1 
HETATM 5566 O O   . HOH F 4 .   ? 52.784 21.428  -14.039 1.00 45.89  ? 2094 HOH A O   1 
HETATM 5567 O O   . HOH F 4 .   ? 34.796 18.848  -13.937 1.00 27.75  ? 2095 HOH A O   1 
HETATM 5568 O O   . HOH F 4 .   ? 35.847 25.219  -17.113 1.00 48.06  ? 2096 HOH A O   1 
HETATM 5569 O O   . HOH F 4 .   ? 40.260 28.057  -18.292 1.00 58.18  ? 2097 HOH A O   1 
HETATM 5570 O O   . HOH F 4 .   ? 46.137 30.340  -10.826 1.00 58.90  ? 2098 HOH A O   1 
HETATM 5571 O O   . HOH F 4 .   ? 44.135 30.127  -13.010 1.00 52.49  ? 2099 HOH A O   1 
HETATM 5572 O O   . HOH F 4 .   ? 35.773 32.813  -10.594 1.00 38.37  ? 2100 HOH A O   1 
HETATM 5573 O O   . HOH F 4 .   ? 39.580 41.331  -9.870  1.00 58.52  ? 2101 HOH A O   1 
HETATM 5574 O O   . HOH F 4 .   ? 37.194 35.959  -9.884  1.00 45.08  ? 2102 HOH A O   1 
HETATM 5575 O O   . HOH F 4 .   ? 43.923 36.819  -13.595 1.00 51.66  ? 2103 HOH A O   1 
HETATM 5576 O O   . HOH F 4 .   ? 49.990 40.080  -14.821 1.00 55.28  ? 2104 HOH A O   1 
HETATM 5577 O O   . HOH F 4 .   ? 44.564 45.633  -17.759 1.00 50.02  ? 2105 HOH A O   1 
HETATM 5578 O O   . HOH F 4 .   ? 47.285 27.668  -11.660 1.00 56.79  ? 2106 HOH A O   1 
HETATM 5579 O O   . HOH F 4 .   ? 49.096 37.384  -8.920  1.00 57.27  ? 2107 HOH A O   1 
HETATM 5580 O O   . HOH F 4 .   ? 44.728 44.003  -1.743  1.00 49.50  ? 2108 HOH A O   1 
HETATM 5581 O O   . HOH F 4 .   ? 45.697 38.114  -15.324 1.00 54.31  ? 2109 HOH A O   1 
HETATM 5582 O O   . HOH F 4 .   ? 46.067 45.288  -11.651 1.00 74.40  ? 2110 HOH A O   1 
HETATM 5583 O O   . HOH F 4 .   ? 38.598 42.459  -7.637  1.00 73.85  ? 2111 HOH A O   1 
HETATM 5584 O O   . HOH F 4 .   ? 29.508 35.298  -10.828 1.00 55.02  ? 2112 HOH A O   1 
HETATM 5585 O O   . HOH F 4 .   ? 24.445 29.416  -14.724 1.00 49.12  ? 2113 HOH A O   1 
HETATM 5586 O O   . HOH F 4 .   ? 27.140 32.706  -13.597 1.00 41.83  ? 2114 HOH A O   1 
HETATM 5587 O O   . HOH F 4 .   ? 42.903 46.444  -2.411  1.00 70.41  ? 2115 HOH A O   1 
HETATM 5588 O O   . HOH F 4 .   ? 44.474 42.246  0.969   1.00 53.57  ? 2116 HOH A O   1 
HETATM 5589 O O   . HOH F 4 .   ? 24.290 26.454  -4.243  1.00 63.67  ? 2117 HOH A O   1 
HETATM 5590 O O   . HOH F 4 .   ? 26.919 32.160  -5.023  1.00 58.70  ? 2118 HOH A O   1 
HETATM 5591 O O   . HOH F 4 .   ? 34.348 36.092  -10.460 1.00 56.99  ? 2119 HOH A O   1 
HETATM 5592 O O   . HOH F 4 .   ? 32.286 39.076  -8.033  1.00 49.66  ? 2120 HOH A O   1 
HETATM 5593 O O   . HOH F 4 .   ? 35.848 38.945  4.997   1.00 50.83  ? 2121 HOH A O   1 
HETATM 5594 O O   . HOH F 4 .   ? 38.384 37.607  9.052   1.00 67.82  ? 2122 HOH A O   1 
HETATM 5595 O O   . HOH F 4 .   ? 28.602 33.799  2.333   1.00 55.43  ? 2123 HOH A O   1 
HETATM 5596 O O   . HOH F 4 .   ? 28.802 33.157  -9.298  1.00 59.24  ? 2124 HOH A O   1 
HETATM 5597 O O   . HOH F 4 .   ? 30.189 31.188  -3.625  1.00 48.00  ? 2125 HOH A O   1 
HETATM 5598 O O   . HOH F 4 .   ? 28.355 31.873  -11.339 1.00 43.10  ? 2126 HOH A O   1 
HETATM 5599 O O   . HOH F 4 .   ? 26.950 30.215  -14.446 1.00 29.91  ? 2127 HOH A O   1 
HETATM 5600 O O   . HOH F 4 .   ? 26.223 26.625  -11.650 1.00 42.91  ? 2128 HOH A O   1 
HETATM 5601 O O   . HOH F 4 .   ? 23.349 27.012  -13.488 1.00 54.77  ? 2129 HOH A O   1 
HETATM 5602 O O   . HOH F 4 .   ? 25.493 24.295  -19.822 1.00 65.62  ? 2130 HOH A O   1 
HETATM 5603 O O   . HOH F 4 .   ? 23.880 22.970  -23.402 1.00 41.97  ? 2131 HOH A O   1 
HETATM 5604 O O   . HOH F 4 .   ? 28.643 25.065  15.367  1.00 59.51  ? 2132 HOH A O   1 
HETATM 5605 O O   . HOH F 4 .   ? 32.746 27.092  -18.282 1.00 50.71  ? 2133 HOH A O   1 
HETATM 5606 O O   . HOH F 4 .   ? 24.002 22.325  -13.546 1.00 59.44  ? 2134 HOH A O   1 
HETATM 5607 O O   . HOH F 4 .   ? 25.497 24.501  -10.683 1.00 44.41  ? 2135 HOH A O   1 
HETATM 5608 O O   . HOH F 4 .   ? 22.526 16.264  -7.957  1.00 65.93  ? 2136 HOH A O   1 
HETATM 5609 O O   . HOH F 4 .   ? 23.799 24.433  -6.092  1.00 47.13  ? 2137 HOH A O   1 
HETATM 5610 O O   . HOH F 4 .   ? 23.137 20.366  -0.790  1.00 52.96  ? 2138 HOH A O   1 
HETATM 5611 O O   . HOH F 4 .   ? 20.598 17.421  -1.714  1.00 63.77  ? 2139 HOH A O   1 
HETATM 5612 O O   . HOH F 4 .   ? 33.951 3.526   -7.067  1.00 63.72  ? 2140 HOH A O   1 
HETATM 5613 O O   . HOH F 4 .   ? 25.992 29.343  -10.956 1.00 47.10  ? 2141 HOH A O   1 
HETATM 5614 O O   . HOH F 4 .   ? 22.700 27.605  -8.563  1.00 50.51  ? 2142 HOH A O   1 
HETATM 5615 O O   . HOH F 4 .   ? 26.151 31.836  -7.569  1.00 58.80  ? 2143 HOH A O   1 
HETATM 5616 O O   . HOH F 4 .   ? 29.739 31.370  -0.697  1.00 44.21  ? 2144 HOH A O   1 
HETATM 5617 O O   . HOH F 4 .   ? 60.192 10.797  -19.636 1.00 57.94  ? 2145 HOH A O   1 
HETATM 5618 O O   . HOH F 4 .   ? 48.774 8.690   -18.263 1.00 50.55  ? 2146 HOH A O   1 
HETATM 5619 O O   . HOH F 4 .   ? 31.287 34.047  -1.164  1.00 62.80  ? 2147 HOH A O   1 
HETATM 5620 O O   . HOH F 4 .   ? 30.908 34.981  2.835   1.00 47.28  ? 2148 HOH A O   1 
HETATM 5621 O O   . HOH F 4 .   ? 37.306 37.100  6.329   1.00 66.39  ? 2149 HOH A O   1 
HETATM 5622 O O   . HOH F 4 .   ? 36.426 19.030  9.747   1.00 44.55  ? 2150 HOH A O   1 
HETATM 5623 O O   . HOH F 4 .   ? 29.153 27.229  5.077   1.00 50.44  ? 2151 HOH A O   1 
HETATM 5624 O O   . HOH F 4 .   ? 28.657 22.832  13.921  1.00 61.97  ? 2152 HOH A O   1 
HETATM 5625 O O   . HOH F 4 .   ? 33.467 15.416  9.146   1.00 46.52  ? 2153 HOH A O   1 
HETATM 5626 O O   . HOH F 4 .   ? 27.170 18.534  5.789   1.00 51.28  ? 2154 HOH A O   1 
HETATM 5627 O O   . HOH F 4 .   ? 32.932 19.421  9.017   1.00 47.99  ? 2155 HOH A O   1 
HETATM 5628 O O   . HOH F 4 .   ? 27.983 12.486  2.221   1.00 39.84  ? 2156 HOH A O   1 
HETATM 5629 O O   . HOH F 4 .   ? 32.712 9.047   8.577   1.00 52.02  ? 2157 HOH A O   1 
HETATM 5630 O O   . HOH F 4 .   ? 29.398 10.642  -3.872  1.00 45.24  ? 2158 HOH A O   1 
HETATM 5631 O O   . HOH F 4 .   ? 25.335 9.012   2.371   1.00 54.75  ? 2159 HOH A O   1 
HETATM 5632 O O   . HOH F 4 .   ? 32.277 4.644   -2.022  1.00 48.62  ? 2160 HOH A O   1 
HETATM 5633 O O   . HOH F 4 .   ? 28.705 3.766   -2.360  1.00 60.66  ? 2161 HOH A O   1 
HETATM 5634 O O   . HOH F 4 .   ? 29.096 9.630   2.630   1.00 48.26  ? 2162 HOH A O   1 
HETATM 5635 O O   . HOH F 4 .   ? 30.553 6.421   5.565   1.00 49.72  ? 2163 HOH A O   1 
HETATM 5636 O O   . HOH F 4 .   ? 40.442 4.507   -0.890  1.00 55.29  ? 2164 HOH A O   1 
HETATM 5637 O O   . HOH F 4 .   ? 44.748 2.441   5.495   1.00 58.13  ? 2165 HOH A O   1 
HETATM 5638 O O   . HOH F 4 .   ? 38.334 8.997   10.029  1.00 52.38  ? 2166 HOH A O   1 
HETATM 5639 O O   . HOH F 4 .   ? 37.000 6.888   7.976   1.00 68.58  ? 2167 HOH A O   1 
HETATM 5640 O O   . HOH F 4 .   ? 32.703 -0.619  6.003   1.00 66.17  ? 2168 HOH A O   1 
HETATM 5641 O O   . HOH F 4 .   ? 48.043 6.780   -0.548  1.00 45.39  ? 2169 HOH A O   1 
HETATM 5642 O O   . HOH F 4 .   ? 38.038 -4.686  5.421   1.00 59.96  ? 2170 HOH A O   1 
HETATM 5643 O O   . HOH F 4 .   ? 34.499 -1.910  -6.971  1.00 73.85  ? 2171 HOH A O   1 
HETATM 5644 O O   . HOH F 4 .   ? 35.485 0.958   -5.564  1.00 50.37  ? 2172 HOH A O   1 
HETATM 5645 O O   . HOH F 4 .   ? 37.383 -3.759  -6.706  1.00 53.16  ? 2173 HOH A O   1 
HETATM 5646 O O   . HOH F 4 .   ? 37.365 6.893   -13.850 1.00 56.05  ? 2174 HOH A O   1 
HETATM 5647 O O   . HOH F 4 .   ? 47.816 -3.847  -12.670 1.00 27.80  ? 2175 HOH A O   1 
HETATM 5648 O O   . HOH F 4 .   ? 46.866 4.629   -16.284 1.00 47.02  ? 2176 HOH A O   1 
HETATM 5649 O O   . HOH F 4 .   ? 50.466 0.769   -22.601 1.00 70.83  ? 2177 HOH A O   1 
HETATM 5650 O O   . HOH F 4 .   ? 54.310 -0.519  -14.701 1.00 38.01  ? 2178 HOH A O   1 
HETATM 5651 O O   . HOH F 4 .   ? 52.361 1.689   -15.441 1.00 35.07  ? 2179 HOH A O   1 
HETATM 5652 O O   . HOH F 4 .   ? 59.867 -1.628  -16.625 1.00 60.71  ? 2180 HOH A O   1 
HETATM 5653 O O   . HOH F 4 .   ? 55.563 5.610   -18.627 1.00 40.62  ? 2181 HOH A O   1 
HETATM 5654 O O   . HOH F 4 .   ? 61.486 9.316   -17.858 1.00 54.06  ? 2182 HOH A O   1 
HETATM 5655 O O   . HOH F 4 .   ? 58.211 12.170  -20.773 1.00 64.56  ? 2183 HOH A O   1 
HETATM 5656 O O   . HOH F 4 .   ? 50.637 8.611   -16.149 1.00 38.92  ? 2184 HOH A O   1 
HETATM 5657 O O   . HOH F 4 .   ? 60.151 22.365  -16.636 1.00 54.37  ? 2185 HOH A O   1 
HETATM 5658 O O   . HOH F 4 .   ? 60.067 18.116  -10.627 1.00 45.38  ? 2186 HOH A O   1 
HETATM 5659 O O   . HOH F 4 .   ? 56.606 20.423  -17.170 1.00 60.67  ? 2187 HOH A O   1 
HETATM 5660 O O   . HOH F 4 .   ? 68.918 12.449  -15.659 1.00 54.63  ? 2188 HOH A O   1 
HETATM 5661 O O   . HOH F 4 .   ? 67.579 23.161  -14.051 1.00 41.64  ? 2189 HOH A O   1 
HETATM 5662 O O   . HOH F 4 .   ? 69.561 15.213  -11.601 1.00 40.54  ? 2190 HOH A O   1 
HETATM 5663 O O   . HOH F 4 .   ? 72.616 21.073  -1.143  1.00 68.86  ? 2191 HOH A O   1 
HETATM 5664 O O   . HOH F 4 .   ? 84.905 29.142  16.058  1.00 70.83  ? 2192 HOH A O   1 
HETATM 5665 O O   . HOH F 4 .   ? 86.426 22.737  8.619   1.00 64.65  ? 2193 HOH A O   1 
HETATM 5666 O O   . HOH F 4 .   ? 74.273 11.258  15.729  1.00 70.34  ? 2194 HOH A O   1 
HETATM 5667 O O   . HOH F 4 .   ? 55.041 21.689  -5.168  1.00 42.46  ? 2195 HOH A O   1 
HETATM 5668 O O   . HOH G 4 .   ? 72.053 -50.722 -6.891  1.00 127.44 ? 2001 HOH B O   1 
HETATM 5669 O O   . HOH G 4 .   ? 59.591 -25.833 -2.187  1.00 55.19  ? 2002 HOH B O   1 
HETATM 5670 O O   . HOH G 4 .   ? 53.880 -30.003 -0.827  1.00 56.98  ? 2003 HOH B O   1 
HETATM 5671 O O   . HOH G 4 .   ? 51.332 -37.080 -5.011  1.00 56.28  ? 2004 HOH B O   1 
HETATM 5672 O O   . HOH G 4 .   ? 50.650 -37.875 -9.657  1.00 49.47  ? 2005 HOH B O   1 
HETATM 5673 O O   . HOH G 4 .   ? 48.719 -30.203 -6.165  1.00 46.30  ? 2006 HOH B O   1 
HETATM 5674 O O   . HOH G 4 .   ? 48.738 -28.663 -8.186  1.00 71.09  ? 2007 HOH B O   1 
HETATM 5675 O O   . HOH G 4 .   ? 49.903 -34.319 -13.257 1.00 46.76  ? 2008 HOH B O   1 
HETATM 5676 O O   . HOH G 4 .   ? 55.480 -41.526 -3.501  1.00 83.57  ? 2009 HOH B O   1 
HETATM 5677 O O   . HOH G 4 .   ? 79.508 -39.819 -10.264 1.00 69.83  ? 2010 HOH B O   1 
HETATM 5678 O O   . HOH G 4 .   ? 78.170 -34.389 -5.410  1.00 91.72  ? 2011 HOH B O   1 
HETATM 5679 O O   . HOH G 4 .   ? 72.428 -27.555 -14.044 1.00 68.76  ? 2012 HOH B O   1 
HETATM 5680 O O   . HOH G 4 .   ? 73.141 -26.329 -11.138 1.00 64.47  ? 2013 HOH B O   1 
HETATM 5681 O O   . HOH G 4 .   ? 68.830 -27.251 -13.682 1.00 46.84  ? 2014 HOH B O   1 
HETATM 5682 O O   . HOH G 4 .   ? 51.916 -36.716 -12.358 1.00 55.13  ? 2015 HOH B O   1 
HETATM 5683 O O   . HOH G 4 .   ? 55.203 -39.678 -6.495  1.00 46.56  ? 2016 HOH B O   1 
HETATM 5684 O O   . HOH G 4 .   ? 53.289 -41.672 -7.310  1.00 35.62  ? 2017 HOH B O   1 
HETATM 5685 O O   . HOH G 4 .   ? 51.027 -48.863 -3.434  1.00 38.16  ? 2018 HOH B O   1 
HETATM 5686 O O   . HOH G 4 .   ? 43.486 -48.891 -12.736 1.00 66.51  ? 2019 HOH B O   1 
HETATM 5687 O O   . HOH G 4 .   ? 42.016 -48.058 -8.510  1.00 59.41  ? 2020 HOH B O   1 
HETATM 5688 O O   . HOH G 4 .   ? 49.744 -40.909 -10.538 1.00 59.62  ? 2021 HOH B O   1 
HETATM 5689 O O   . HOH G 4 .   ? 40.649 -42.751 -12.483 1.00 74.92  ? 2022 HOH B O   1 
HETATM 5690 O O   . HOH G 4 .   ? 46.050 -41.545 -5.211  1.00 44.02  ? 2023 HOH B O   1 
HETATM 5691 O O   . HOH G 4 .   ? 41.705 -41.196 -14.635 1.00 63.62  ? 2024 HOH B O   1 
HETATM 5692 O O   . HOH G 4 .   ? 41.703 -46.717 -18.167 1.00 79.84  ? 2025 HOH B O   1 
HETATM 5693 O O   . HOH G 4 .   ? 45.683 -45.698 -17.031 1.00 51.04  ? 2026 HOH B O   1 
HETATM 5694 O O   . HOH G 4 .   ? 48.188 -36.965 -12.471 1.00 69.63  ? 2027 HOH B O   1 
HETATM 5695 O O   . HOH G 4 .   ? 44.405 -38.857 -10.598 1.00 61.84  ? 2028 HOH B O   1 
HETATM 5696 O O   . HOH G 4 .   ? 43.055 -40.202 -12.630 1.00 64.02  ? 2029 HOH B O   1 
HETATM 5697 O O   . HOH G 4 .   ? 45.227 -43.459 -18.537 1.00 55.58  ? 2030 HOH B O   1 
HETATM 5698 O O   . HOH G 4 .   ? 45.286 -40.628 -18.122 1.00 60.37  ? 2031 HOH B O   1 
HETATM 5699 O O   . HOH G 4 .   ? 50.598 -38.890 -13.995 1.00 43.84  ? 2032 HOH B O   1 
HETATM 5700 O O   . HOH G 4 .   ? 50.833 -36.573 -16.138 1.00 49.11  ? 2033 HOH B O   1 
HETATM 5701 O O   . HOH G 4 .   ? 55.437 -31.269 -16.545 1.00 32.75  ? 2034 HOH B O   1 
HETATM 5702 O O   . HOH G 4 .   ? 55.719 -42.448 -26.063 1.00 58.41  ? 2035 HOH B O   1 
HETATM 5703 O O   . HOH G 4 .   ? 62.669 -31.000 -23.112 1.00 46.79  ? 2036 HOH B O   1 
HETATM 5704 O O   . HOH G 4 .   ? 63.105 -33.819 -28.818 1.00 50.51  ? 2037 HOH B O   1 
HETATM 5705 O O   . HOH G 4 .   ? 64.831 -22.994 -25.744 1.00 54.01  ? 2038 HOH B O   1 
HETATM 5706 O O   . HOH G 4 .   ? 61.872 -32.534 -30.573 1.00 53.49  ? 2039 HOH B O   1 
HETATM 5707 O O   . HOH G 4 .   ? 68.371 -41.564 -19.052 1.00 75.29  ? 2040 HOH B O   1 
HETATM 5708 O O   . HOH G 4 .   ? 56.154 -51.787 -9.836  1.00 59.38  ? 2041 HOH B O   1 
HETATM 5709 O O   . HOH G 4 .   ? 62.440 -50.293 -8.394  1.00 71.50  ? 2042 HOH B O   1 
HETATM 5710 O O   . HOH G 4 .   ? 58.919 -54.437 -5.483  1.00 62.18  ? 2043 HOH B O   1 
HETATM 5711 O O   . HOH G 4 .   ? 55.465 -49.082 -8.395  1.00 39.37  ? 2044 HOH B O   1 
HETATM 5712 O O   . HOH G 4 .   ? 58.887 -46.242 -4.684  1.00 67.38  ? 2045 HOH B O   1 
HETATM 5713 O O   . HOH G 4 .   ? 66.374 -22.302 -18.939 1.00 62.21  ? 2046 HOH B O   1 
HETATM 5714 O O   . HOH G 4 .   ? 67.047 -21.715 -10.915 1.00 54.64  ? 2047 HOH B O   1 
HETATM 5715 O O   . HOH G 4 .   ? 60.553 -21.540 -7.914  1.00 46.96  ? 2048 HOH B O   1 
HETATM 5716 O O   . HOH G 4 .   ? 57.193 -22.694 -6.997  1.00 60.70  ? 2049 HOH B O   1 
HETATM 5717 O O   . HOH G 4 .   ? 57.400 -19.938 -4.865  1.00 62.72  ? 2050 HOH B O   1 
HETATM 5718 O O   . HOH G 4 .   ? 52.532 -20.690 -4.899  1.00 47.66  ? 2051 HOH B O   1 
HETATM 5719 O O   . HOH G 4 .   ? 61.002 -12.832 -1.592  1.00 67.06  ? 2052 HOH B O   1 
HETATM 5720 O O   . HOH G 4 .   ? 57.779 -11.254 -4.742  1.00 43.14  ? 2053 HOH B O   1 
HETATM 5721 O O   . HOH G 4 .   ? 56.221 -9.650  -6.456  1.00 32.73  ? 2054 HOH B O   1 
HETATM 5722 O O   . HOH G 4 .   ? 49.117 -19.007 0.226   1.00 48.16  ? 2055 HOH B O   1 
HETATM 5723 O O   . HOH G 4 .   ? 50.287 -9.528  2.117   1.00 57.60  ? 2056 HOH B O   1 
HETATM 5724 O O   . HOH G 4 .   ? 49.424 -16.386 0.744   1.00 59.33  ? 2057 HOH B O   1 
HETATM 5725 O O   . HOH G 4 .   ? 51.939 -19.511 -2.657  1.00 38.92  ? 2058 HOH B O   1 
HETATM 5726 O O   . HOH G 4 .   ? 47.866 -11.272 -0.570  1.00 39.19  ? 2059 HOH B O   1 
HETATM 5727 O O   . HOH G 4 .   ? 55.312 -6.292  -2.638  1.00 64.79  ? 2060 HOH B O   1 
HETATM 5728 O O   . HOH G 4 .   ? 57.746 -11.870 -2.301  1.00 55.98  ? 2061 HOH B O   1 
HETATM 5729 O O   . HOH G 4 .   ? 49.826 -2.958  -5.973  1.00 47.71  ? 2062 HOH B O   1 
HETATM 5730 O O   . HOH G 4 .   ? 46.538 -9.393  -2.303  1.00 50.71  ? 2063 HOH B O   1 
HETATM 5731 O O   . HOH G 4 .   ? 44.939 -8.996  -4.816  1.00 40.25  ? 2064 HOH B O   1 
HETATM 5732 O O   . HOH G 4 .   ? 44.144 -0.032  -6.710  1.00 38.96  ? 2065 HOH B O   1 
HETATM 5733 O O   . HOH G 4 .   ? 51.079 -3.253  -8.018  1.00 48.78  ? 2066 HOH B O   1 
HETATM 5734 O O   . HOH G 4 .   ? 58.241 -4.658  -11.145 1.00 49.30  ? 2067 HOH B O   1 
HETATM 5735 O O   . HOH G 4 .   ? 54.421 -5.390  -9.610  1.00 33.58  ? 2068 HOH B O   1 
HETATM 5736 O O   . HOH G 4 .   ? 55.584 -1.786  -8.820  1.00 56.84  ? 2069 HOH B O   1 
HETATM 5737 O O   . HOH G 4 .   ? 50.752 -0.344  -13.076 1.00 31.97  ? 2070 HOH B O   1 
HETATM 5738 O O   . HOH G 4 .   ? 57.050 -1.338  -20.188 1.00 58.30  ? 2071 HOH B O   1 
HETATM 5739 O O   . HOH G 4 .   ? 56.345 -4.542  -20.409 1.00 42.29  ? 2072 HOH B O   1 
HETATM 5740 O O   . HOH G 4 .   ? 53.608 1.158   -17.570 1.00 39.68  ? 2073 HOH B O   1 
HETATM 5741 O O   . HOH G 4 .   ? 56.070 -19.082 -30.099 1.00 44.77  ? 2074 HOH B O   1 
HETATM 5742 O O   . HOH G 4 .   ? 50.480 -21.195 -32.882 1.00 58.06  ? 2075 HOH B O   1 
HETATM 5743 O O   . HOH G 4 .   ? 47.661 -20.208 -30.902 1.00 49.77  ? 2076 HOH B O   1 
HETATM 5744 O O   . HOH G 4 .   ? 57.096 -31.078 -34.627 1.00 78.84  ? 2077 HOH B O   1 
HETATM 5745 O O   . HOH G 4 .   ? 58.863 -31.173 -32.563 1.00 63.51  ? 2078 HOH B O   1 
HETATM 5746 O O   . HOH G 4 .   ? 48.849 -29.316 -18.854 1.00 37.77  ? 2079 HOH B O   1 
HETATM 5747 O O   . HOH G 4 .   ? 40.856 -26.071 -19.584 1.00 68.15  ? 2080 HOH B O   1 
HETATM 5748 O O   . HOH G 4 .   ? 43.044 -23.746 -16.965 1.00 53.85  ? 2081 HOH B O   1 
HETATM 5749 O O   . HOH G 4 .   ? 48.630 -30.146 -15.307 1.00 42.18  ? 2082 HOH B O   1 
HETATM 5750 O O   . HOH G 4 .   ? 47.472 -28.511 -11.605 1.00 48.74  ? 2083 HOH B O   1 
HETATM 5751 O O   . HOH G 4 .   ? 43.693 -24.698 -14.558 1.00 46.91  ? 2084 HOH B O   1 
HETATM 5752 O O   . HOH G 4 .   ? 46.229 -28.938 -9.243  1.00 70.46  ? 2085 HOH B O   1 
HETATM 5753 O O   . HOH G 4 .   ? 50.435 -22.033 -5.509  1.00 74.17  ? 2086 HOH B O   1 
HETATM 5754 O O   . HOH G 4 .   ? 51.086 -25.939 -9.226  1.00 54.90  ? 2087 HOH B O   1 
HETATM 5755 O O   . HOH G 4 .   ? 66.268 -19.950 -17.665 1.00 55.92  ? 2088 HOH B O   1 
HETATM 5756 O O   . HOH G 4 .   ? 67.142 -16.467 -17.934 1.00 52.94  ? 2089 HOH B O   1 
HETATM 5757 O O   . HOH G 4 .   ? 67.427 -20.726 -15.226 1.00 56.39  ? 2090 HOH B O   1 
HETATM 5758 O O   . HOH G 4 .   ? 70.192 -19.395 -8.604  1.00 68.96  ? 2091 HOH B O   1 
HETATM 5759 O O   . HOH G 4 .   ? 66.741 -20.356 -12.825 1.00 45.24  ? 2092 HOH B O   1 
HETATM 5760 O O   . HOH G 4 .   ? 51.428 -40.179 -8.317  1.00 62.15  ? 2093 HOH B O   1 
HETATM 5761 O O   . HOH G 4 .   ? 47.712 -32.023 -13.867 1.00 54.25  ? 2094 HOH B O   1 
HETATM 5762 O O   . HOH G 4 .   ? 60.057 -11.120 -13.678 1.00 37.15  ? 2095 HOH B O   1 
HETATM 5763 O O   . HOH G 4 .   ? 52.897 -42.100 -4.684  1.00 57.02  ? 2096 HOH B O   1 
HETATM 5764 O O   . HOH G 4 .   ? 58.014 -41.695 -5.156  1.00 55.37  ? 2097 HOH B O   1 
HETATM 5765 O O   . HOH G 4 .   ? 56.926 -28.971 -15.688 1.00 32.21  ? 2098 HOH B O   1 
HETATM 5766 O O   . HOH G 4 .   ? 52.086 -33.255 -13.890 1.00 44.29  ? 2099 HOH B O   1 
HETATM 5767 O O   . HOH G 4 .   ? 50.493 -27.869 -10.882 1.00 35.69  ? 2100 HOH B O   1 
HETATM 5768 O O   . HOH G 4 .   ? 47.002 -35.319 -20.452 1.00 42.78  ? 2101 HOH B O   1 
HETATM 5769 O O   . HOH G 4 .   ? 42.895 -50.335 -8.427  1.00 63.58  ? 2102 HOH B O   1 
HETATM 5770 O O   . HOH G 4 .   ? 36.852 -30.553 -35.758 1.00 67.03  ? 2103 HOH B O   1 
HETATM 5771 O O   . HOH G 4 .   ? 33.575 -30.364 -23.302 1.00 59.13  ? 2104 HOH B O   1 
HETATM 5772 O O   . HOH G 4 .   ? 35.329 -35.504 -19.402 1.00 66.00  ? 2105 HOH B O   1 
HETATM 5773 O O   . HOH G 4 .   ? 37.091 -28.823 -12.902 1.00 73.97  ? 2106 HOH B O   1 
HETATM 5774 O O   . HOH G 4 .   ? 40.636 -24.429 -16.230 1.00 56.89  ? 2107 HOH B O   1 
HETATM 5775 O O   . HOH G 4 .   ? 40.970 -27.786 -9.557  1.00 52.98  ? 2108 HOH B O   1 
HETATM 5776 O O   . HOH G 4 .   ? 53.531 -23.280 -3.545  1.00 51.92  ? 2109 HOH B O   1 
HETATM 5777 O O   . HOH G 4 .   ? 39.441 -22.412 -9.589  1.00 58.18  ? 2110 HOH B O   1 
HETATM 5778 O O   . HOH G 4 .   ? 37.448 -16.728 -12.688 1.00 27.12  ? 2111 HOH B O   1 
HETATM 5779 O O   . HOH G 4 .   ? 36.639 -19.147 -16.505 1.00 27.58  ? 2112 HOH B O   1 
HETATM 5780 O O   . HOH G 4 .   ? 57.436 -8.049  -4.792  1.00 55.12  ? 2113 HOH B O   1 
HETATM 5781 O O   . HOH G 4 .   ? 45.286 -18.765 -10.239 1.00 40.83  ? 2114 HOH B O   1 
HETATM 5782 O O   . HOH G 4 .   ? 53.089 -4.098  -2.050  1.00 61.80  ? 2115 HOH B O   1 
HETATM 5783 O O   . HOH G 4 .   ? 50.838 -1.331  -9.724  1.00 72.56  ? 2116 HOH B O   1 
HETATM 5784 O O   . HOH G 4 .   ? 60.073 -4.403  -9.141  1.00 67.77  ? 2117 HOH B O   1 
HETATM 5785 O O   . HOH G 4 .   ? 52.348 0.839   -11.322 1.00 41.71  ? 2118 HOH B O   1 
HETATM 5786 O O   . HOH G 4 .   ? 54.441 3.197   -19.308 1.00 56.93  ? 2119 HOH B O   1 
HETATM 5787 O O   . HOH G 4 .   ? 58.743 -5.572  -21.167 1.00 63.73  ? 2120 HOH B O   1 
HETATM 5788 O O   . HOH G 4 .   ? 55.725 -3.317  -22.800 1.00 45.72  ? 2121 HOH B O   1 
HETATM 5789 O O   . HOH G 4 .   ? 54.730 -19.829 -32.987 1.00 60.65  ? 2122 HOH B O   1 
HETATM 5790 O O   . HOH G 4 .   ? 34.222 -25.592 -28.668 1.00 49.24  ? 2123 HOH B O   1 
HETATM 5791 O O   . HOH G 4 .   ? 36.924 -24.608 -29.421 1.00 58.10  ? 2124 HOH B O   1 
HETATM 5792 O O   . HOH G 4 .   ? 44.822 -23.539 -20.214 1.00 41.17  ? 2125 HOH B O   1 
HETATM 5793 O O   . HOH G 4 .   ? 39.721 -23.079 -20.298 1.00 40.83  ? 2126 HOH B O   1 
HETATM 5794 O O   . HOH G 4 .   ? 37.422 -7.619  -9.806  1.00 34.36  ? 2127 HOH B O   1 
HETATM 5795 O O   . HOH G 4 .   ? 41.912 -18.123 -9.228  1.00 63.95  ? 2128 HOH B O   1 
HETATM 5796 O O   . HOH G 4 .   ? 43.629 -21.506 -9.275  1.00 68.93  ? 2129 HOH B O   1 
HETATM 5797 O O   . HOH G 4 .   ? 41.676 -4.506  -7.820  1.00 48.19  ? 2130 HOH B O   1 
HETATM 5798 O O   . HOH G 4 .   ? 41.634 -5.537  -5.162  1.00 47.45  ? 2131 HOH B O   1 
HETATM 5799 O O   . HOH G 4 .   ? 53.379 -17.918 -34.221 1.00 70.62  ? 2132 HOH B O   1 
HETATM 5800 O O   . HOH G 4 .   ? 36.045 -9.885  -9.674  1.00 48.41  ? 2133 HOH B O   1 
HETATM 5801 O O   . HOH G 4 .   ? 38.574 -12.594 -6.547  1.00 32.04  ? 2134 HOH B O   1 
HETATM 5802 O O   . HOH G 4 .   ? 34.195 -9.714  -11.907 1.00 34.31  ? 2135 HOH B O   1 
HETATM 5803 O O   . HOH G 4 .   ? 35.955 -17.315 -8.320  1.00 34.69  ? 2136 HOH B O   1 
HETATM 5804 O O   . HOH G 4 .   ? 31.447 -9.739  -6.332  1.00 56.70  ? 2137 HOH B O   1 
HETATM 5805 O O   . HOH G 4 .   ? 28.380 -14.579 -10.133 1.00 57.14  ? 2138 HOH B O   1 
HETATM 5806 O O   . HOH G 4 .   ? 32.802 -20.573 -3.856  1.00 58.33  ? 2139 HOH B O   1 
HETATM 5807 O O   . HOH G 4 .   ? 34.009 -17.866 -6.715  1.00 40.65  ? 2140 HOH B O   1 
HETATM 5808 O O   . HOH G 4 .   ? 31.542 -19.137 -1.264  1.00 42.51  ? 2141 HOH B O   1 
HETATM 5809 O O   . HOH G 4 .   ? 31.455 -16.520 -0.192  1.00 37.97  ? 2142 HOH B O   1 
HETATM 5810 O O   . HOH G 4 .   ? 29.838 -14.373 -5.899  1.00 37.78  ? 2143 HOH B O   1 
HETATM 5811 O O   . HOH G 4 .   ? 38.271 -5.501  -8.368  1.00 44.87  ? 2144 HOH B O   1 
HETATM 5812 O O   . HOH G 4 .   ? 25.015 -23.807 -2.801  1.00 60.99  ? 2145 HOH B O   1 
HETATM 5813 O O   . HOH G 4 .   ? 34.146 -25.567 -7.713  1.00 57.98  ? 2146 HOH B O   1 
HETATM 5814 O O   . HOH G 4 .   ? 25.339 -23.097 -13.685 1.00 51.62  ? 2147 HOH B O   1 
HETATM 5815 O O   . HOH G 4 .   ? 27.298 -14.786 -6.329  1.00 60.76  ? 2148 HOH B O   1 
HETATM 5816 O O   . HOH G 4 .   ? 26.152 -15.850 -11.183 1.00 54.14  ? 2149 HOH B O   1 
HETATM 5817 O O   . HOH G 4 .   ? 23.766 -16.623 -10.047 1.00 62.82  ? 2150 HOH B O   1 
HETATM 5818 O O   . HOH G 4 .   ? 22.980 -19.270 -2.812  1.00 61.79  ? 2151 HOH B O   1 
HETATM 5819 O O   . HOH G 4 .   ? 32.120 -4.685  -19.428 1.00 53.19  ? 2152 HOH B O   1 
HETATM 5820 O O   . HOH G 4 .   ? 32.486 -6.160  -21.416 1.00 46.31  ? 2153 HOH B O   1 
HETATM 5821 O O   . HOH G 4 .   ? 33.188 5.647   -4.425  1.00 53.90  ? 2154 HOH B O   1 
HETATM 5822 O O   . HOH G 4 .   ? 49.469 -0.684  -31.569 1.00 57.64  ? 2155 HOH B O   1 
HETATM 5823 O O   . HOH G 4 .   ? 24.799 -20.745 -21.313 1.00 59.29  ? 2156 HOH B O   1 
HETATM 5824 O O   . HOH G 4 .   ? 27.432 -24.811 -16.911 1.00 53.76  ? 2157 HOH B O   1 
HETATM 5825 O O   . HOH G 4 .   ? 47.015 5.863   -18.638 1.00 61.02  ? 2158 HOH B O   1 
HETATM 5826 O O   . HOH G 4 .   ? 30.157 -10.598 -13.188 1.00 75.34  ? 2159 HOH B O   1 
HETATM 5827 O O   . HOH G 4 .   ? 32.357 -10.576 -21.126 1.00 72.19  ? 2160 HOH B O   1 
HETATM 5828 O O   . HOH G 4 .   ? 31.749 -5.278  -16.921 1.00 50.71  ? 2161 HOH B O   1 
HETATM 5829 O O   . HOH G 4 .   ? 35.763 -9.048  -29.856 1.00 51.93  ? 2162 HOH B O   1 
HETATM 5830 O O   . HOH G 4 .   ? 32.873 -3.245  -15.374 1.00 47.50  ? 2163 HOH B O   1 
HETATM 5831 O O   . HOH G 4 .   ? 34.163 0.345   -13.709 1.00 46.83  ? 2164 HOH B O   1 
HETATM 5832 O O   . HOH G 4 .   ? 34.198 -8.609  -21.363 1.00 46.54  ? 2165 HOH B O   1 
HETATM 5833 O O   . HOH G 4 .   ? 37.332 0.226   -16.786 1.00 49.53  ? 2166 HOH B O   1 
HETATM 5834 O O   . HOH G 4 .   ? 35.192 7.355   -5.433  1.00 45.36  ? 2167 HOH B O   1 
HETATM 5835 O O   . HOH G 4 .   ? 35.856 0.903   -10.333 1.00 38.26  ? 2168 HOH B O   1 
HETATM 5836 O O   . HOH G 4 .   ? 51.683 -3.075  -32.644 1.00 51.90  ? 2169 HOH B O   1 
HETATM 5837 O O   . HOH G 4 .   ? 44.289 4.777   -14.946 1.00 35.85  ? 2170 HOH B O   1 
HETATM 5838 O O   . HOH G 4 .   ? 39.320 1.119   -18.185 1.00 51.84  ? 2171 HOH B O   1 
HETATM 5839 O O   . HOH G 4 .   ? 49.648 1.923   -14.658 1.00 35.74  ? 2172 HOH B O   1 
HETATM 5840 O O   . HOH G 4 .   ? 43.737 4.475   -20.357 1.00 47.80  ? 2173 HOH B O   1 
HETATM 5841 O O   . HOH G 4 .   ? 47.324 3.302   -21.081 1.00 90.07  ? 2174 HOH B O   1 
HETATM 5842 O O   . HOH G 4 .   ? 62.427 -2.140  -15.550 1.00 59.67  ? 2175 HOH B O   1 
HETATM 5843 O O   . HOH G 4 .   ? 42.477 -2.645  -30.024 1.00 58.38  ? 2176 HOH B O   1 
HETATM 5844 O O   . HOH G 4 .   ? 68.551 -10.575 -17.147 1.00 59.30  ? 2177 HOH B O   1 
HETATM 5845 O O   . HOH G 4 .   ? 64.431 -4.323  -11.270 1.00 59.45  ? 2178 HOH B O   1 
HETATM 5846 O O   . HOH G 4 .   ? 33.909 -9.742  -23.762 1.00 44.89  ? 2179 HOH B O   1 
HETATM 5847 O O   . HOH G 4 .   ? 31.903 -11.670 -23.815 1.00 56.89  ? 2180 HOH B O   1 
HETATM 5848 O O   . HOH G 4 .   ? 28.370 -13.214 -22.919 1.00 59.54  ? 2181 HOH B O   1 
HETATM 5849 O O   . HOH G 4 .   ? 31.149 -21.054 -25.985 1.00 48.68  ? 2182 HOH B O   1 
HETATM 5850 O O   . HOH G 4 .   ? 30.756 -12.750 -26.085 1.00 49.95  ? 2183 HOH B O   1 
HETATM 5851 O O   . HOH G 4 .   ? 32.678 -20.495 -32.357 1.00 57.51  ? 2184 HOH B O   1 
HETATM 5852 O O   . HOH G 4 .   ? 38.871 -18.295 -36.244 1.00 57.61  ? 2185 HOH B O   1 
HETATM 5853 O O   . HOH G 4 .   ? 36.374 -24.546 -35.642 1.00 71.70  ? 2186 HOH B O   1 
HETATM 5854 O O   . HOH G 4 .   ? 39.968 -22.360 -35.158 1.00 75.41  ? 2187 HOH B O   1 
HETATM 5855 O O   . HOH G 4 .   ? 37.755 -11.232 -29.960 1.00 57.76  ? 2188 HOH B O   1 
HETATM 5856 O O   . HOH G 4 .   ? 50.224 -14.052 -33.365 1.00 50.89  ? 2189 HOH B O   1 
HETATM 5857 O O   . HOH G 4 .   ? 48.948 -9.275  -38.568 1.00 76.75  ? 2190 HOH B O   1 
HETATM 5858 O O   . HOH G 4 .   ? 46.251 -14.307 -32.404 1.00 48.86  ? 2191 HOH B O   1 
HETATM 5859 O O   . HOH G 4 .   ? 55.992 -11.557 -34.444 1.00 58.19  ? 2192 HOH B O   1 
HETATM 5860 O O   . HOH G 4 .   ? 54.476 -9.414  -34.471 1.00 59.48  ? 2193 HOH B O   1 
HETATM 5861 O O   . HOH G 4 .   ? 50.807 -3.680  -35.626 1.00 61.47  ? 2194 HOH B O   1 
HETATM 5862 O O   . HOH G 4 .   ? 51.180 -4.953  -30.563 1.00 43.39  ? 2195 HOH B O   1 
HETATM 5863 O O   . HOH G 4 .   ? 53.847 -2.817  -24.817 1.00 47.75  ? 2196 HOH B O   1 
HETATM 5864 O O   . HOH G 4 .   ? 54.443 -5.460  -30.704 1.00 41.41  ? 2197 HOH B O   1 
HETATM 5865 O O   . HOH G 4 .   ? 54.047 -2.317  -32.237 1.00 56.90  ? 2198 HOH B O   1 
HETATM 5866 O O   . HOH G 4 .   ? 57.995 -7.598  -33.209 1.00 63.93  ? 2199 HOH B O   1 
HETATM 5867 O O   . HOH G 4 .   ? 62.658 -11.570 -23.160 1.00 51.32  ? 2200 HOH B O   1 
HETATM 5868 O O   . HOH G 4 .   ? 62.839 -18.552 -19.082 1.00 58.61  ? 2201 HOH B O   1 
HETATM 5869 O O   . HOH G 4 .   ? 65.183 -4.519  -22.352 1.00 53.58  ? 2202 HOH B O   1 
HETATM 5870 O O   . HOH G 4 .   ? 61.277 -1.872  -13.143 1.00 60.42  ? 2203 HOH B O   1 
HETATM 5871 O O   . HOH G 4 .   ? 62.962 -6.101  -9.055  1.00 55.28  ? 2204 HOH B O   1 
HETATM 5872 O O   . HOH G 4 .   ? 67.293 -9.819  -14.695 1.00 54.26  ? 2205 HOH B O   1 
HETATM 5873 O O   . HOH G 4 .   ? 62.715 -8.230  -5.906  1.00 57.26  ? 2206 HOH B O   1 
HETATM 5874 O O   . HOH G 4 .   ? 61.600 -12.465 -4.892  1.00 44.37  ? 2207 HOH B O   1 
HETATM 5875 O O   . HOH G 4 .   ? 69.128 -13.272 -4.998  1.00 63.33  ? 2208 HOH B O   1 
HETATM 5876 O O   . HOH G 4 .   ? 72.221 -24.060 1.123   1.00 59.74  ? 2209 HOH B O   1 
HETATM 5877 O O   . HOH G 4 .   ? 60.354 -40.444 -1.233  1.00 59.69  ? 2210 HOH B O   1 
HETATM 5878 O O   . HOH G 4 .   ? 57.365 -56.660 -4.938  1.00 60.09  ? 2211 HOH B O   1 
HETATM 5879 O O   . HOH G 4 .   ? 53.795 -59.687 -6.644  1.00 71.54  ? 2212 HOH B O   1 
HETATM 5880 O O   . HOH G 4 .   ? 65.767 -38.261 -28.069 1.00 57.48  ? 2213 HOH B O   1 
HETATM 5881 O O   . HOH G 4 .   ? 66.590 -30.978 -22.949 1.00 54.52  ? 2214 HOH B O   1 
HETATM 5882 O O   . HOH G 4 .   ? 65.657 -40.489 -26.503 1.00 57.01  ? 2215 HOH B O   1 
HETATM 5883 O O   . HOH G 4 .   ? 72.687 -41.877 -29.660 1.00 56.66  ? 2216 HOH B O   1 
HETATM 5884 O O   . HOH G 4 .   ? 84.092 -39.244 -35.281 1.00 76.49  ? 2217 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   361 ?   ?   ?   A . n 
A 1 2   PRO 2   362 ?   ?   ?   A . n 
A 1 3   GLU 3   363 ?   ?   ?   A . n 
A 1 4   LEU 4   364 ?   ?   ?   A . n 
A 1 5   ASN 5   365 ?   ?   ?   A . n 
A 1 6   LYS 6   366 ?   ?   ?   A . n 
A 1 7   GLU 7   367 ?   ?   ?   A . n 
A 1 8   ARG 8   368 ?   ?   ?   A . n 
A 1 9   PRO 9   369 ?   ?   ?   A . n 
A 1 10  SER 10  370 ?   ?   ?   A . n 
A 1 11  LEU 11  371 ?   ?   ?   A . n 
A 1 12  GLN 12  372 ?   ?   ?   A . n 
A 1 13  ILE 13  373 ?   ?   ?   A . n 
A 1 14  LYS 14  374 ?   ?   ?   A . n 
A 1 15  LEU 15  375 375 LEU LEU A . n 
A 1 16  LYS 16  376 376 LYS LYS A . n 
A 1 17  ILE 17  377 377 ILE ILE A . n 
A 1 18  GLU 18  378 378 GLU GLU A . n 
A 1 19  ASP 19  379 379 ASP ASP A . n 
A 1 20  PHE 20  380 380 PHE PHE A . n 
A 1 21  GLU 21  381 381 GLU GLU A . n 
A 1 22  LEU 22  382 382 LEU LEU A . n 
A 1 23  HIS 23  383 383 HIS HIS A . n 
A 1 24  LYS 24  384 384 LYS LYS A . n 
A 1 25  MET 25  385 385 MET MET A . n 
A 1 26  LEU 26  386 386 LEU LEU A . n 
A 1 27  GLY 27  387 387 GLY GLY A . n 
A 1 28  LYS 28  388 388 LYS LYS A . n 
A 1 29  GLY 29  389 389 GLY GLY A . n 
A 1 30  SER 30  390 390 SER SER A . n 
A 1 31  PHE 31  391 391 PHE PHE A . n 
A 1 32  GLY 32  392 392 GLY GLY A . n 
A 1 33  LYS 33  393 393 LYS LYS A . n 
A 1 34  VAL 34  394 394 VAL VAL A . n 
A 1 35  PHE 35  395 395 PHE PHE A . n 
A 1 36  LEU 36  396 396 LEU LEU A . n 
A 1 37  ALA 37  397 397 ALA ALA A . n 
A 1 38  GLU 38  398 398 GLU GLU A . n 
A 1 39  PHE 39  399 399 PHE PHE A . n 
A 1 40  LYS 40  400 400 LYS LYS A . n 
A 1 41  LYS 41  401 401 LYS LYS A . n 
A 1 42  THR 42  402 402 THR THR A . n 
A 1 43  ASN 43  403 403 ASN ASN A . n 
A 1 44  GLN 44  404 404 GLN GLN A . n 
A 1 45  PHE 45  405 405 PHE PHE A . n 
A 1 46  PHE 46  406 406 PHE PHE A . n 
A 1 47  ALA 47  407 407 ALA ALA A . n 
A 1 48  ILE 48  408 408 ILE ILE A . n 
A 1 49  LYS 49  409 409 LYS LYS A . n 
A 1 50  ALA 50  410 410 ALA ALA A . n 
A 1 51  LEU 51  411 411 LEU LEU A . n 
A 1 52  LYS 52  412 412 LYS LYS A . n 
A 1 53  LYS 53  413 413 LYS LYS A . n 
A 1 54  ASP 54  414 414 ASP ASP A . n 
A 1 55  VAL 55  415 415 VAL VAL A . n 
A 1 56  VAL 56  416 416 VAL VAL A . n 
A 1 57  LEU 57  417 417 LEU LEU A . n 
A 1 58  MET 58  418 418 MET MET A . n 
A 1 59  ASP 59  419 419 ASP ASP A . n 
A 1 60  ASP 60  420 420 ASP ASP A . n 
A 1 61  ASP 61  421 421 ASP ASP A . n 
A 1 62  VAL 62  422 422 VAL VAL A . n 
A 1 63  GLU 63  423 423 GLU GLU A . n 
A 1 64  CYS 64  424 424 CYS CYS A . n 
A 1 65  THR 65  425 425 THR THR A . n 
A 1 66  MET 66  426 426 MET MET A . n 
A 1 67  VAL 67  427 427 VAL VAL A . n 
A 1 68  GLU 68  428 428 GLU GLU A . n 
A 1 69  LYS 69  429 429 LYS LYS A . n 
A 1 70  ARG 70  430 430 ARG ARG A . n 
A 1 71  VAL 71  431 431 VAL VAL A . n 
A 1 72  LEU 72  432 432 LEU LEU A . n 
A 1 73  SER 73  433 433 SER SER A . n 
A 1 74  LEU 74  434 434 LEU LEU A . n 
A 1 75  ALA 75  435 435 ALA ALA A . n 
A 1 76  TRP 76  436 436 TRP TRP A . n 
A 1 77  GLU 77  437 437 GLU GLU A . n 
A 1 78  HIS 78  438 438 HIS HIS A . n 
A 1 79  PRO 79  439 439 PRO PRO A . n 
A 1 80  PHE 80  440 440 PHE PHE A . n 
A 1 81  LEU 81  441 441 LEU LEU A . n 
A 1 82  THR 82  442 442 THR THR A . n 
A 1 83  HIS 83  443 443 HIS HIS A . n 
A 1 84  MET 84  444 444 MET MET A . n 
A 1 85  PHE 85  445 445 PHE PHE A . n 
A 1 86  CYS 86  446 446 CYS CYS A . n 
A 1 87  THR 87  447 447 THR THR A . n 
A 1 88  PHE 88  448 448 PHE PHE A . n 
A 1 89  GLN 89  449 449 GLN GLN A . n 
A 1 90  THR 90  450 450 THR THR A . n 
A 1 91  LYS 91  451 451 LYS LYS A . n 
A 1 92  GLU 92  452 452 GLU GLU A . n 
A 1 93  ASN 93  453 453 ASN ASN A . n 
A 1 94  LEU 94  454 454 LEU LEU A . n 
A 1 95  PHE 95  455 455 PHE PHE A . n 
A 1 96  PHE 96  456 456 PHE PHE A . n 
A 1 97  VAL 97  457 457 VAL VAL A . n 
A 1 98  MET 98  458 458 MET MET A . n 
A 1 99  GLU 99  459 459 GLU GLU A . n 
A 1 100 TYR 100 460 460 TYR TYR A . n 
A 1 101 LEU 101 461 461 LEU LEU A . n 
A 1 102 ASN 102 462 462 ASN ASN A . n 
A 1 103 GLY 103 463 463 GLY GLY A . n 
A 1 104 GLY 104 464 464 GLY GLY A . n 
A 1 105 ASP 105 465 465 ASP ASP A . n 
A 1 106 LEU 106 466 466 LEU LEU A . n 
A 1 107 MET 107 467 467 MET MET A . n 
A 1 108 TYR 108 468 468 TYR TYR A . n 
A 1 109 HIS 109 469 469 HIS HIS A . n 
A 1 110 ILE 110 470 470 ILE ILE A . n 
A 1 111 GLN 111 471 471 GLN GLN A . n 
A 1 112 SER 112 472 472 SER SER A . n 
A 1 113 CYS 113 473 473 CYS CYS A . n 
A 1 114 HIS 114 474 474 HIS HIS A . n 
A 1 115 LYS 115 475 475 LYS LYS A . n 
A 1 116 PHE 116 476 476 PHE PHE A . n 
A 1 117 ASP 117 477 477 ASP ASP A . n 
A 1 118 LEU 118 478 478 LEU LEU A . n 
A 1 119 SER 119 479 479 SER SER A . n 
A 1 120 ARG 120 480 480 ARG ARG A . n 
A 1 121 ALA 121 481 481 ALA ALA A . n 
A 1 122 THR 122 482 482 THR THR A . n 
A 1 123 PHE 123 483 483 PHE PHE A . n 
A 1 124 TYR 124 484 484 TYR TYR A . n 
A 1 125 ALA 125 485 485 ALA ALA A . n 
A 1 126 ALA 126 486 486 ALA ALA A . n 
A 1 127 GLU 127 487 487 GLU GLU A . n 
A 1 128 ILE 128 488 488 ILE ILE A . n 
A 1 129 ILE 129 489 489 ILE ILE A . n 
A 1 130 LEU 130 490 490 LEU LEU A . n 
A 1 131 GLY 131 491 491 GLY GLY A . n 
A 1 132 LEU 132 492 492 LEU LEU A . n 
A 1 133 GLN 133 493 493 GLN GLN A . n 
A 1 134 PHE 134 494 494 PHE PHE A . n 
A 1 135 LEU 135 495 495 LEU LEU A . n 
A 1 136 HIS 136 496 496 HIS HIS A . n 
A 1 137 SER 137 497 497 SER SER A . n 
A 1 138 LYS 138 498 498 LYS LYS A . n 
A 1 139 GLY 139 499 499 GLY GLY A . n 
A 1 140 ILE 140 500 500 ILE ILE A . n 
A 1 141 VAL 141 501 501 VAL VAL A . n 
A 1 142 TYR 142 502 502 TYR TYR A . n 
A 1 143 ARG 143 503 503 ARG ARG A . n 
A 1 144 ASP 144 504 504 ASP ASP A . n 
A 1 145 LEU 145 505 505 LEU LEU A . n 
A 1 146 LYS 146 506 506 LYS LYS A . n 
A 1 147 LEU 147 507 507 LEU LEU A . n 
A 1 148 ASP 148 508 508 ASP ASP A . n 
A 1 149 ASN 149 509 509 ASN ASN A . n 
A 1 150 ILE 150 510 510 ILE ILE A . n 
A 1 151 LEU 151 511 511 LEU LEU A . n 
A 1 152 LEU 152 512 512 LEU LEU A . n 
A 1 153 ASP 153 513 513 ASP ASP A . n 
A 1 154 LYS 154 514 514 LYS LYS A . n 
A 1 155 ASP 155 515 515 ASP ASP A . n 
A 1 156 GLY 156 516 516 GLY GLY A . n 
A 1 157 HIS 157 517 517 HIS HIS A . n 
A 1 158 ILE 158 518 518 ILE ILE A . n 
A 1 159 LYS 159 519 519 LYS LYS A . n 
A 1 160 ILE 160 520 520 ILE ILE A . n 
A 1 161 ALA 161 521 521 ALA ALA A . n 
A 1 162 ASP 162 522 522 ASP ASP A . n 
A 1 163 PHE 163 523 523 PHE PHE A . n 
A 1 164 GLY 164 524 524 GLY GLY A . n 
A 1 165 MET 165 525 525 MET MET A . n 
A 1 166 CYS 166 526 526 CYS CYS A . n 
A 1 167 LYS 167 527 527 LYS LYS A . n 
A 1 168 GLU 168 528 528 GLU GLU A . n 
A 1 169 ASN 169 529 529 ASN ASN A . n 
A 1 170 MET 170 530 530 MET MET A . n 
A 1 171 LEU 171 531 531 LEU LEU A . n 
A 1 172 GLY 172 532 532 GLY GLY A . n 
A 1 173 ASP 173 533 533 ASP ASP A . n 
A 1 174 ALA 174 534 534 ALA ALA A . n 
A 1 175 LYS 175 535 535 LYS LYS A . n 
A 1 176 THR 176 536 536 THR THR A . n 
A 1 177 ASN 177 537 537 ASN ASN A . n 
A 1 178 GLU 178 538 538 GLU GLU A . n 
A 1 179 PHE 179 539 539 PHE PHE A . n 
A 1 180 CYS 180 540 540 CYS CYS A . n 
A 1 181 GLY 181 541 541 GLY GLY A . n 
A 1 182 THR 182 542 542 THR THR A . n 
A 1 183 PRO 183 543 543 PRO PRO A . n 
A 1 184 ASP 184 544 544 ASP ASP A . n 
A 1 185 TYR 185 545 545 TYR TYR A . n 
A 1 186 ILE 186 546 546 ILE ILE A . n 
A 1 187 ALA 187 547 547 ALA ALA A . n 
A 1 188 PRO 188 548 548 PRO PRO A . n 
A 1 189 GLU 189 549 549 GLU GLU A . n 
A 1 190 ILE 190 550 550 ILE ILE A . n 
A 1 191 LEU 191 551 551 LEU LEU A . n 
A 1 192 LEU 192 552 552 LEU LEU A . n 
A 1 193 GLY 193 553 553 GLY GLY A . n 
A 1 194 GLN 194 554 554 GLN GLN A . n 
A 1 195 LYS 195 555 555 LYS LYS A . n 
A 1 196 TYR 196 556 556 TYR TYR A . n 
A 1 197 ASN 197 557 557 ASN ASN A . n 
A 1 198 HIS 198 558 558 HIS HIS A . n 
A 1 199 SER 199 559 559 SER SER A . n 
A 1 200 VAL 200 560 560 VAL VAL A . n 
A 1 201 ASP 201 561 561 ASP ASP A . n 
A 1 202 TRP 202 562 562 TRP TRP A . n 
A 1 203 TRP 203 563 563 TRP TRP A . n 
A 1 204 SER 204 564 564 SER SER A . n 
A 1 205 PHE 205 565 565 PHE PHE A . n 
A 1 206 GLY 206 566 566 GLY GLY A . n 
A 1 207 VAL 207 567 567 VAL VAL A . n 
A 1 208 LEU 208 568 568 LEU LEU A . n 
A 1 209 LEU 209 569 569 LEU LEU A . n 
A 1 210 TYR 210 570 570 TYR TYR A . n 
A 1 211 GLU 211 571 571 GLU GLU A . n 
A 1 212 MET 212 572 572 MET MET A . n 
A 1 213 LEU 213 573 573 LEU LEU A . n 
A 1 214 ILE 214 574 574 ILE ILE A . n 
A 1 215 GLY 215 575 575 GLY GLY A . n 
A 1 216 GLN 216 576 576 GLN GLN A . n 
A 1 217 SER 217 577 577 SER SER A . n 
A 1 218 PRO 218 578 578 PRO PRO A . n 
A 1 219 PHE 219 579 579 PHE PHE A . n 
A 1 220 HIS 220 580 580 HIS HIS A . n 
A 1 221 GLY 221 581 581 GLY GLY A . n 
A 1 222 GLN 222 582 582 GLN GLN A . n 
A 1 223 ASP 223 583 583 ASP ASP A . n 
A 1 224 GLU 224 584 584 GLU GLU A . n 
A 1 225 GLU 225 585 585 GLU GLU A . n 
A 1 226 GLU 226 586 586 GLU GLU A . n 
A 1 227 LEU 227 587 587 LEU LEU A . n 
A 1 228 PHE 228 588 588 PHE PHE A . n 
A 1 229 HIS 229 589 589 HIS HIS A . n 
A 1 230 SER 230 590 590 SER SER A . n 
A 1 231 ILE 231 591 591 ILE ILE A . n 
A 1 232 ARG 232 592 592 ARG ARG A . n 
A 1 233 MET 233 593 593 MET MET A . n 
A 1 234 ASP 234 594 594 ASP ASP A . n 
A 1 235 ASN 235 595 595 ASN ASN A . n 
A 1 236 PRO 236 596 596 PRO PRO A . n 
A 1 237 PHE 237 597 597 PHE PHE A . n 
A 1 238 TYR 238 598 598 TYR TYR A . n 
A 1 239 PRO 239 599 599 PRO PRO A . n 
A 1 240 ARG 240 600 600 ARG ARG A . n 
A 1 241 TRP 241 601 601 TRP TRP A . n 
A 1 242 LEU 242 602 602 LEU LEU A . n 
A 1 243 GLU 243 603 603 GLU GLU A . n 
A 1 244 LYS 244 604 604 LYS LYS A . n 
A 1 245 GLU 245 605 605 GLU GLU A . n 
A 1 246 ALA 246 606 606 ALA ALA A . n 
A 1 247 LYS 247 607 607 LYS LYS A . n 
A 1 248 ASP 248 608 608 ASP ASP A . n 
A 1 249 LEU 249 609 609 LEU LEU A . n 
A 1 250 LEU 250 610 610 LEU LEU A . n 
A 1 251 VAL 251 611 611 VAL VAL A . n 
A 1 252 LYS 252 612 612 LYS LYS A . n 
A 1 253 LEU 253 613 613 LEU LEU A . n 
A 1 254 PHE 254 614 614 PHE PHE A . n 
A 1 255 VAL 255 615 615 VAL VAL A . n 
A 1 256 ARG 256 616 616 ARG ARG A . n 
A 1 257 GLU 257 617 617 GLU GLU A . n 
A 1 258 PRO 258 618 618 PRO PRO A . n 
A 1 259 GLU 259 619 619 GLU GLU A . n 
A 1 260 LYS 260 620 620 LYS LYS A . n 
A 1 261 ARG 261 621 621 ARG ARG A . n 
A 1 262 LEU 262 622 622 LEU LEU A . n 
A 1 263 GLY 263 623 623 GLY GLY A . n 
A 1 264 VAL 264 624 624 VAL VAL A . n 
A 1 265 ARG 265 625 625 ARG ARG A . n 
A 1 266 GLY 266 626 626 GLY GLY A . n 
A 1 267 ASP 267 627 627 ASP ASP A . n 
A 1 268 ILE 268 628 628 ILE ILE A . n 
A 1 269 ARG 269 629 629 ARG ARG A . n 
A 1 270 GLN 270 630 630 GLN GLN A . n 
A 1 271 HIS 271 631 631 HIS HIS A . n 
A 1 272 PRO 272 632 632 PRO PRO A . n 
A 1 273 LEU 273 633 633 LEU LEU A . n 
A 1 274 PHE 274 634 634 PHE PHE A . n 
A 1 275 ARG 275 635 635 ARG ARG A . n 
A 1 276 GLU 276 636 636 GLU GLU A . n 
A 1 277 ILE 277 637 637 ILE ILE A . n 
A 1 278 ASN 278 638 638 ASN ASN A . n 
A 1 279 TRP 279 639 639 TRP TRP A . n 
A 1 280 GLU 280 640 640 GLU GLU A . n 
A 1 281 GLU 281 641 641 GLU GLU A . n 
A 1 282 LEU 282 642 642 LEU LEU A . n 
A 1 283 GLU 283 643 643 GLU GLU A . n 
A 1 284 ARG 284 644 644 ARG ARG A . n 
A 1 285 LYS 285 645 645 LYS LYS A . n 
A 1 286 GLU 286 646 646 GLU GLU A . n 
A 1 287 ILE 287 647 647 ILE ILE A . n 
A 1 288 ASP 288 648 648 ASP ASP A . n 
A 1 289 PRO 289 649 649 PRO PRO A . n 
A 1 290 PRO 290 650 650 PRO PRO A . n 
A 1 291 PHE 291 651 651 PHE PHE A . n 
A 1 292 ARG 292 652 652 ARG ARG A . n 
A 1 293 PRO 293 653 653 PRO PRO A . n 
A 1 294 LYS 294 654 654 LYS LYS A . n 
A 1 295 VAL 295 655 655 VAL VAL A . n 
A 1 296 LYS 296 656 656 LYS LYS A . n 
A 1 297 SER 297 657 657 SER SER A . n 
A 1 298 PRO 298 658 658 PRO PRO A . n 
A 1 299 PHE 299 659 659 PHE PHE A . n 
A 1 300 ASP 300 660 660 ASP ASP A . n 
A 1 301 CYS 301 661 661 CYS CYS A . n 
A 1 302 SER 302 662 662 SER SER A . n 
A 1 303 ASN 303 663 663 ASN ASN A . n 
A 1 304 PHE 304 664 664 PHE PHE A . n 
A 1 305 ASP 305 665 665 ASP ASP A . n 
A 1 306 LYS 306 666 666 LYS LYS A . n 
A 1 307 GLU 307 667 667 GLU GLU A . n 
A 1 308 PHE 308 668 668 PHE PHE A . n 
A 1 309 LEU 309 669 669 LEU LEU A . n 
A 1 310 ASN 310 670 670 ASN ASN A . n 
A 1 311 GLU 311 671 671 GLU GLU A . n 
A 1 312 LYS 312 672 672 LYS LYS A . n 
A 1 313 PRO 313 673 673 PRO PRO A . n 
A 1 314 ARG 314 674 674 ARG ARG A . n 
A 1 315 LEU 315 675 675 LEU LEU A . n 
A 1 316 SEP 316 676 676 SEP SEP A . n 
A 1 317 PHE 317 677 677 PHE PHE A . n 
A 1 318 ALA 318 678 678 ALA ALA A . n 
A 1 319 ASP 319 679 679 ASP ASP A . n 
A 1 320 ARG 320 680 680 ARG ARG A . n 
A 1 321 ALA 321 681 681 ALA ALA A . n 
A 1 322 LEU 322 682 682 LEU LEU A . n 
A 1 323 ILE 323 683 683 ILE ILE A . n 
A 1 324 ASN 324 684 684 ASN ASN A . n 
A 1 325 SER 325 685 685 SER SER A . n 
A 1 326 MET 326 686 686 MET MET A . n 
A 1 327 ASP 327 687 687 ASP ASP A . n 
A 1 328 GLN 328 688 688 GLN GLN A . n 
A 1 329 ASN 329 689 689 ASN ASN A . n 
A 1 330 MET 330 690 690 MET MET A . n 
A 1 331 PHE 331 691 691 PHE PHE A . n 
A 1 332 ARG 332 692 692 ARG ARG A . n 
A 1 333 ASN 333 693 693 ASN ASN A . n 
A 1 334 PHE 334 694 694 PHE PHE A . n 
A 1 335 SEP 335 695 695 SEP SEP A . n 
A 1 336 PHE 336 696 696 PHE PHE A . n 
A 1 337 MET 337 697 697 MET MET A . n 
A 1 338 ASN 338 698 698 ASN ASN A . n 
A 1 339 PRO 339 699 699 PRO PRO A . n 
A 1 340 GLY 340 700 700 GLY GLY A . n 
A 1 341 MET 341 701 ?   ?   ?   A . n 
A 1 342 GLU 342 702 ?   ?   ?   A . n 
A 1 343 ARG 343 703 ?   ?   ?   A . n 
A 1 344 LEU 344 704 ?   ?   ?   A . n 
A 1 345 ILE 345 705 ?   ?   ?   A . n 
A 1 346 SER 346 706 ?   ?   ?   A . n 
A 1 347 HIS 347 707 ?   ?   ?   A . n 
A 1 348 HIS 348 708 ?   ?   ?   A . n 
A 1 349 HIS 349 709 ?   ?   ?   A . n 
A 1 350 HIS 350 710 ?   ?   ?   A . n 
A 1 351 HIS 351 711 ?   ?   ?   A . n 
A 1 352 HIS 352 712 ?   ?   ?   A . n 
B 1 1   GLU 1   361 ?   ?   ?   B . n 
B 1 2   PRO 2   362 ?   ?   ?   B . n 
B 1 3   GLU 3   363 ?   ?   ?   B . n 
B 1 4   LEU 4   364 ?   ?   ?   B . n 
B 1 5   ASN 5   365 ?   ?   ?   B . n 
B 1 6   LYS 6   366 ?   ?   ?   B . n 
B 1 7   GLU 7   367 ?   ?   ?   B . n 
B 1 8   ARG 8   368 ?   ?   ?   B . n 
B 1 9   PRO 9   369 ?   ?   ?   B . n 
B 1 10  SER 10  370 ?   ?   ?   B . n 
B 1 11  LEU 11  371 ?   ?   ?   B . n 
B 1 12  GLN 12  372 ?   ?   ?   B . n 
B 1 13  ILE 13  373 ?   ?   ?   B . n 
B 1 14  LYS 14  374 ?   ?   ?   B . n 
B 1 15  LEU 15  375 375 LEU LEU B . n 
B 1 16  LYS 16  376 376 LYS LYS B . n 
B 1 17  ILE 17  377 377 ILE ILE B . n 
B 1 18  GLU 18  378 378 GLU GLU B . n 
B 1 19  ASP 19  379 379 ASP ASP B . n 
B 1 20  PHE 20  380 380 PHE PHE B . n 
B 1 21  GLU 21  381 381 GLU GLU B . n 
B 1 22  LEU 22  382 382 LEU LEU B . n 
B 1 23  HIS 23  383 383 HIS HIS B . n 
B 1 24  LYS 24  384 384 LYS LYS B . n 
B 1 25  MET 25  385 385 MET MET B . n 
B 1 26  LEU 26  386 386 LEU LEU B . n 
B 1 27  GLY 27  387 387 GLY GLY B . n 
B 1 28  LYS 28  388 388 LYS LYS B . n 
B 1 29  GLY 29  389 389 GLY GLY B . n 
B 1 30  SER 30  390 390 SER SER B . n 
B 1 31  PHE 31  391 391 PHE PHE B . n 
B 1 32  GLY 32  392 392 GLY GLY B . n 
B 1 33  LYS 33  393 393 LYS LYS B . n 
B 1 34  VAL 34  394 394 VAL VAL B . n 
B 1 35  PHE 35  395 395 PHE PHE B . n 
B 1 36  LEU 36  396 396 LEU LEU B . n 
B 1 37  ALA 37  397 397 ALA ALA B . n 
B 1 38  GLU 38  398 398 GLU GLU B . n 
B 1 39  PHE 39  399 399 PHE PHE B . n 
B 1 40  LYS 40  400 400 LYS LYS B . n 
B 1 41  LYS 41  401 401 LYS LYS B . n 
B 1 42  THR 42  402 402 THR THR B . n 
B 1 43  ASN 43  403 403 ASN ASN B . n 
B 1 44  GLN 44  404 404 GLN GLN B . n 
B 1 45  PHE 45  405 405 PHE PHE B . n 
B 1 46  PHE 46  406 406 PHE PHE B . n 
B 1 47  ALA 47  407 407 ALA ALA B . n 
B 1 48  ILE 48  408 408 ILE ILE B . n 
B 1 49  LYS 49  409 409 LYS LYS B . n 
B 1 50  ALA 50  410 410 ALA ALA B . n 
B 1 51  LEU 51  411 411 LEU LEU B . n 
B 1 52  LYS 52  412 412 LYS LYS B . n 
B 1 53  LYS 53  413 413 LYS LYS B . n 
B 1 54  ASP 54  414 414 ASP ASP B . n 
B 1 55  VAL 55  415 415 VAL VAL B . n 
B 1 56  VAL 56  416 416 VAL VAL B . n 
B 1 57  LEU 57  417 417 LEU LEU B . n 
B 1 58  MET 58  418 418 MET MET B . n 
B 1 59  ASP 59  419 419 ASP ASP B . n 
B 1 60  ASP 60  420 420 ASP ASP B . n 
B 1 61  ASP 61  421 421 ASP ASP B . n 
B 1 62  VAL 62  422 422 VAL VAL B . n 
B 1 63  GLU 63  423 423 GLU GLU B . n 
B 1 64  CYS 64  424 424 CYS CYS B . n 
B 1 65  THR 65  425 425 THR THR B . n 
B 1 66  MET 66  426 426 MET MET B . n 
B 1 67  VAL 67  427 427 VAL VAL B . n 
B 1 68  GLU 68  428 428 GLU GLU B . n 
B 1 69  LYS 69  429 429 LYS LYS B . n 
B 1 70  ARG 70  430 430 ARG ARG B . n 
B 1 71  VAL 71  431 431 VAL VAL B . n 
B 1 72  LEU 72  432 432 LEU LEU B . n 
B 1 73  SER 73  433 433 SER SER B . n 
B 1 74  LEU 74  434 434 LEU LEU B . n 
B 1 75  ALA 75  435 435 ALA ALA B . n 
B 1 76  TRP 76  436 436 TRP TRP B . n 
B 1 77  GLU 77  437 437 GLU GLU B . n 
B 1 78  HIS 78  438 438 HIS HIS B . n 
B 1 79  PRO 79  439 439 PRO PRO B . n 
B 1 80  PHE 80  440 440 PHE PHE B . n 
B 1 81  LEU 81  441 441 LEU LEU B . n 
B 1 82  THR 82  442 442 THR THR B . n 
B 1 83  HIS 83  443 443 HIS HIS B . n 
B 1 84  MET 84  444 444 MET MET B . n 
B 1 85  PHE 85  445 445 PHE PHE B . n 
B 1 86  CYS 86  446 446 CYS CYS B . n 
B 1 87  THR 87  447 447 THR THR B . n 
B 1 88  PHE 88  448 448 PHE PHE B . n 
B 1 89  GLN 89  449 449 GLN GLN B . n 
B 1 90  THR 90  450 450 THR THR B . n 
B 1 91  LYS 91  451 451 LYS LYS B . n 
B 1 92  GLU 92  452 452 GLU GLU B . n 
B 1 93  ASN 93  453 453 ASN ASN B . n 
B 1 94  LEU 94  454 454 LEU LEU B . n 
B 1 95  PHE 95  455 455 PHE PHE B . n 
B 1 96  PHE 96  456 456 PHE PHE B . n 
B 1 97  VAL 97  457 457 VAL VAL B . n 
B 1 98  MET 98  458 458 MET MET B . n 
B 1 99  GLU 99  459 459 GLU GLU B . n 
B 1 100 TYR 100 460 460 TYR TYR B . n 
B 1 101 LEU 101 461 461 LEU LEU B . n 
B 1 102 ASN 102 462 462 ASN ASN B . n 
B 1 103 GLY 103 463 463 GLY GLY B . n 
B 1 104 GLY 104 464 464 GLY GLY B . n 
B 1 105 ASP 105 465 465 ASP ASP B . n 
B 1 106 LEU 106 466 466 LEU LEU B . n 
B 1 107 MET 107 467 467 MET MET B . n 
B 1 108 TYR 108 468 468 TYR TYR B . n 
B 1 109 HIS 109 469 469 HIS HIS B . n 
B 1 110 ILE 110 470 470 ILE ILE B . n 
B 1 111 GLN 111 471 471 GLN GLN B . n 
B 1 112 SER 112 472 472 SER SER B . n 
B 1 113 CYS 113 473 473 CYS CYS B . n 
B 1 114 HIS 114 474 474 HIS HIS B . n 
B 1 115 LYS 115 475 475 LYS LYS B . n 
B 1 116 PHE 116 476 476 PHE PHE B . n 
B 1 117 ASP 117 477 477 ASP ASP B . n 
B 1 118 LEU 118 478 478 LEU LEU B . n 
B 1 119 SER 119 479 479 SER SER B . n 
B 1 120 ARG 120 480 480 ARG ARG B . n 
B 1 121 ALA 121 481 481 ALA ALA B . n 
B 1 122 THR 122 482 482 THR THR B . n 
B 1 123 PHE 123 483 483 PHE PHE B . n 
B 1 124 TYR 124 484 484 TYR TYR B . n 
B 1 125 ALA 125 485 485 ALA ALA B . n 
B 1 126 ALA 126 486 486 ALA ALA B . n 
B 1 127 GLU 127 487 487 GLU GLU B . n 
B 1 128 ILE 128 488 488 ILE ILE B . n 
B 1 129 ILE 129 489 489 ILE ILE B . n 
B 1 130 LEU 130 490 490 LEU LEU B . n 
B 1 131 GLY 131 491 491 GLY GLY B . n 
B 1 132 LEU 132 492 492 LEU LEU B . n 
B 1 133 GLN 133 493 493 GLN GLN B . n 
B 1 134 PHE 134 494 494 PHE PHE B . n 
B 1 135 LEU 135 495 495 LEU LEU B . n 
B 1 136 HIS 136 496 496 HIS HIS B . n 
B 1 137 SER 137 497 497 SER SER B . n 
B 1 138 LYS 138 498 498 LYS LYS B . n 
B 1 139 GLY 139 499 499 GLY GLY B . n 
B 1 140 ILE 140 500 500 ILE ILE B . n 
B 1 141 VAL 141 501 501 VAL VAL B . n 
B 1 142 TYR 142 502 502 TYR TYR B . n 
B 1 143 ARG 143 503 503 ARG ARG B . n 
B 1 144 ASP 144 504 504 ASP ASP B . n 
B 1 145 LEU 145 505 505 LEU LEU B . n 
B 1 146 LYS 146 506 506 LYS LYS B . n 
B 1 147 LEU 147 507 507 LEU LEU B . n 
B 1 148 ASP 148 508 508 ASP ASP B . n 
B 1 149 ASN 149 509 509 ASN ASN B . n 
B 1 150 ILE 150 510 510 ILE ILE B . n 
B 1 151 LEU 151 511 511 LEU LEU B . n 
B 1 152 LEU 152 512 512 LEU LEU B . n 
B 1 153 ASP 153 513 513 ASP ASP B . n 
B 1 154 LYS 154 514 514 LYS LYS B . n 
B 1 155 ASP 155 515 515 ASP ASP B . n 
B 1 156 GLY 156 516 516 GLY GLY B . n 
B 1 157 HIS 157 517 517 HIS HIS B . n 
B 1 158 ILE 158 518 518 ILE ILE B . n 
B 1 159 LYS 159 519 519 LYS LYS B . n 
B 1 160 ILE 160 520 520 ILE ILE B . n 
B 1 161 ALA 161 521 521 ALA ALA B . n 
B 1 162 ASP 162 522 522 ASP ASP B . n 
B 1 163 PHE 163 523 523 PHE PHE B . n 
B 1 164 GLY 164 524 524 GLY GLY B . n 
B 1 165 MET 165 525 525 MET MET B . n 
B 1 166 CYS 166 526 526 CYS CYS B . n 
B 1 167 LYS 167 527 527 LYS LYS B . n 
B 1 168 GLU 168 528 528 GLU GLU B . n 
B 1 169 ASN 169 529 529 ASN ASN B . n 
B 1 170 MET 170 530 530 MET MET B . n 
B 1 171 LEU 171 531 531 LEU LEU B . n 
B 1 172 GLY 172 532 532 GLY GLY B . n 
B 1 173 ASP 173 533 533 ASP ASP B . n 
B 1 174 ALA 174 534 534 ALA ALA B . n 
B 1 175 LYS 175 535 535 LYS LYS B . n 
B 1 176 THR 176 536 536 THR THR B . n 
B 1 177 ASN 177 537 537 ASN ASN B . n 
B 1 178 GLU 178 538 538 GLU GLU B . n 
B 1 179 PHE 179 539 539 PHE PHE B . n 
B 1 180 CYS 180 540 540 CYS CYS B . n 
B 1 181 GLY 181 541 541 GLY GLY B . n 
B 1 182 THR 182 542 542 THR THR B . n 
B 1 183 PRO 183 543 543 PRO PRO B . n 
B 1 184 ASP 184 544 544 ASP ASP B . n 
B 1 185 TYR 185 545 545 TYR TYR B . n 
B 1 186 ILE 186 546 546 ILE ILE B . n 
B 1 187 ALA 187 547 547 ALA ALA B . n 
B 1 188 PRO 188 548 548 PRO PRO B . n 
B 1 189 GLU 189 549 549 GLU GLU B . n 
B 1 190 ILE 190 550 550 ILE ILE B . n 
B 1 191 LEU 191 551 551 LEU LEU B . n 
B 1 192 LEU 192 552 552 LEU LEU B . n 
B 1 193 GLY 193 553 553 GLY GLY B . n 
B 1 194 GLN 194 554 554 GLN GLN B . n 
B 1 195 LYS 195 555 555 LYS LYS B . n 
B 1 196 TYR 196 556 556 TYR TYR B . n 
B 1 197 ASN 197 557 557 ASN ASN B . n 
B 1 198 HIS 198 558 558 HIS HIS B . n 
B 1 199 SER 199 559 559 SER SER B . n 
B 1 200 VAL 200 560 560 VAL VAL B . n 
B 1 201 ASP 201 561 561 ASP ASP B . n 
B 1 202 TRP 202 562 562 TRP TRP B . n 
B 1 203 TRP 203 563 563 TRP TRP B . n 
B 1 204 SER 204 564 564 SER SER B . n 
B 1 205 PHE 205 565 565 PHE PHE B . n 
B 1 206 GLY 206 566 566 GLY GLY B . n 
B 1 207 VAL 207 567 567 VAL VAL B . n 
B 1 208 LEU 208 568 568 LEU LEU B . n 
B 1 209 LEU 209 569 569 LEU LEU B . n 
B 1 210 TYR 210 570 570 TYR TYR B . n 
B 1 211 GLU 211 571 571 GLU GLU B . n 
B 1 212 MET 212 572 572 MET MET B . n 
B 1 213 LEU 213 573 573 LEU LEU B . n 
B 1 214 ILE 214 574 574 ILE ILE B . n 
B 1 215 GLY 215 575 575 GLY GLY B . n 
B 1 216 GLN 216 576 576 GLN GLN B . n 
B 1 217 SER 217 577 577 SER SER B . n 
B 1 218 PRO 218 578 578 PRO PRO B . n 
B 1 219 PHE 219 579 579 PHE PHE B . n 
B 1 220 HIS 220 580 580 HIS HIS B . n 
B 1 221 GLY 221 581 581 GLY GLY B . n 
B 1 222 GLN 222 582 582 GLN GLN B . n 
B 1 223 ASP 223 583 583 ASP ASP B . n 
B 1 224 GLU 224 584 584 GLU GLU B . n 
B 1 225 GLU 225 585 585 GLU GLU B . n 
B 1 226 GLU 226 586 586 GLU GLU B . n 
B 1 227 LEU 227 587 587 LEU LEU B . n 
B 1 228 PHE 228 588 588 PHE PHE B . n 
B 1 229 HIS 229 589 589 HIS HIS B . n 
B 1 230 SER 230 590 590 SER SER B . n 
B 1 231 ILE 231 591 591 ILE ILE B . n 
B 1 232 ARG 232 592 592 ARG ARG B . n 
B 1 233 MET 233 593 593 MET MET B . n 
B 1 234 ASP 234 594 594 ASP ASP B . n 
B 1 235 ASN 235 595 595 ASN ASN B . n 
B 1 236 PRO 236 596 596 PRO PRO B . n 
B 1 237 PHE 237 597 597 PHE PHE B . n 
B 1 238 TYR 238 598 598 TYR TYR B . n 
B 1 239 PRO 239 599 599 PRO PRO B . n 
B 1 240 ARG 240 600 600 ARG ARG B . n 
B 1 241 TRP 241 601 601 TRP TRP B . n 
B 1 242 LEU 242 602 602 LEU LEU B . n 
B 1 243 GLU 243 603 603 GLU GLU B . n 
B 1 244 LYS 244 604 604 LYS LYS B . n 
B 1 245 GLU 245 605 605 GLU GLU B . n 
B 1 246 ALA 246 606 606 ALA ALA B . n 
B 1 247 LYS 247 607 607 LYS LYS B . n 
B 1 248 ASP 248 608 608 ASP ASP B . n 
B 1 249 LEU 249 609 609 LEU LEU B . n 
B 1 250 LEU 250 610 610 LEU LEU B . n 
B 1 251 VAL 251 611 611 VAL VAL B . n 
B 1 252 LYS 252 612 612 LYS LYS B . n 
B 1 253 LEU 253 613 613 LEU LEU B . n 
B 1 254 PHE 254 614 614 PHE PHE B . n 
B 1 255 VAL 255 615 615 VAL VAL B . n 
B 1 256 ARG 256 616 616 ARG ARG B . n 
B 1 257 GLU 257 617 617 GLU GLU B . n 
B 1 258 PRO 258 618 618 PRO PRO B . n 
B 1 259 GLU 259 619 619 GLU GLU B . n 
B 1 260 LYS 260 620 620 LYS LYS B . n 
B 1 261 ARG 261 621 621 ARG ARG B . n 
B 1 262 LEU 262 622 622 LEU LEU B . n 
B 1 263 GLY 263 623 623 GLY GLY B . n 
B 1 264 VAL 264 624 624 VAL VAL B . n 
B 1 265 ARG 265 625 625 ARG ARG B . n 
B 1 266 GLY 266 626 626 GLY GLY B . n 
B 1 267 ASP 267 627 627 ASP ASP B . n 
B 1 268 ILE 268 628 628 ILE ILE B . n 
B 1 269 ARG 269 629 629 ARG ARG B . n 
B 1 270 GLN 270 630 630 GLN GLN B . n 
B 1 271 HIS 271 631 631 HIS HIS B . n 
B 1 272 PRO 272 632 632 PRO PRO B . n 
B 1 273 LEU 273 633 633 LEU LEU B . n 
B 1 274 PHE 274 634 634 PHE PHE B . n 
B 1 275 ARG 275 635 635 ARG ARG B . n 
B 1 276 GLU 276 636 636 GLU GLU B . n 
B 1 277 ILE 277 637 637 ILE ILE B . n 
B 1 278 ASN 278 638 638 ASN ASN B . n 
B 1 279 TRP 279 639 639 TRP TRP B . n 
B 1 280 GLU 280 640 640 GLU GLU B . n 
B 1 281 GLU 281 641 641 GLU GLU B . n 
B 1 282 LEU 282 642 642 LEU LEU B . n 
B 1 283 GLU 283 643 643 GLU GLU B . n 
B 1 284 ARG 284 644 644 ARG ARG B . n 
B 1 285 LYS 285 645 645 LYS LYS B . n 
B 1 286 GLU 286 646 646 GLU GLU B . n 
B 1 287 ILE 287 647 647 ILE ILE B . n 
B 1 288 ASP 288 648 648 ASP ASP B . n 
B 1 289 PRO 289 649 649 PRO PRO B . n 
B 1 290 PRO 290 650 650 PRO PRO B . n 
B 1 291 PHE 291 651 651 PHE PHE B . n 
B 1 292 ARG 292 652 652 ARG ARG B . n 
B 1 293 PRO 293 653 653 PRO PRO B . n 
B 1 294 LYS 294 654 654 LYS LYS B . n 
B 1 295 VAL 295 655 655 VAL VAL B . n 
B 1 296 LYS 296 656 656 LYS LYS B . n 
B 1 297 SER 297 657 657 SER SER B . n 
B 1 298 PRO 298 658 658 PRO PRO B . n 
B 1 299 PHE 299 659 ?   ?   ?   B . n 
B 1 300 ASP 300 660 ?   ?   ?   B . n 
B 1 301 CYS 301 661 ?   ?   ?   B . n 
B 1 302 SER 302 662 ?   ?   ?   B . n 
B 1 303 ASN 303 663 ?   ?   ?   B . n 
B 1 304 PHE 304 664 ?   ?   ?   B . n 
B 1 305 ASP 305 665 ?   ?   ?   B . n 
B 1 306 LYS 306 666 ?   ?   ?   B . n 
B 1 307 GLU 307 667 ?   ?   ?   B . n 
B 1 308 PHE 308 668 ?   ?   ?   B . n 
B 1 309 LEU 309 669 ?   ?   ?   B . n 
B 1 310 ASN 310 670 ?   ?   ?   B . n 
B 1 311 GLU 311 671 ?   ?   ?   B . n 
B 1 312 LYS 312 672 ?   ?   ?   B . n 
B 1 313 PRO 313 673 ?   ?   ?   B . n 
B 1 314 ARG 314 674 674 ARG ARG B . n 
B 1 315 LEU 315 675 675 LEU LEU B . n 
B 1 316 SEP 316 676 676 SEP SEP B . n 
B 1 317 PHE 317 677 677 PHE PHE B . n 
B 1 318 ALA 318 678 678 ALA ALA B . n 
B 1 319 ASP 319 679 679 ASP ASP B . n 
B 1 320 ARG 320 680 680 ARG ARG B . n 
B 1 321 ALA 321 681 681 ALA ALA B . n 
B 1 322 LEU 322 682 682 LEU LEU B . n 
B 1 323 ILE 323 683 683 ILE ILE B . n 
B 1 324 ASN 324 684 684 ASN ASN B . n 
B 1 325 SER 325 685 685 SER SER B . n 
B 1 326 MET 326 686 686 MET MET B . n 
B 1 327 ASP 327 687 687 ASP ASP B . n 
B 1 328 GLN 328 688 688 GLN GLN B . n 
B 1 329 ASN 329 689 689 ASN ASN B . n 
B 1 330 MET 330 690 690 MET MET B . n 
B 1 331 PHE 331 691 691 PHE PHE B . n 
B 1 332 ARG 332 692 692 ARG ARG B . n 
B 1 333 ASN 333 693 693 ASN ASN B . n 
B 1 334 PHE 334 694 694 PHE PHE B . n 
B 1 335 SEP 335 695 695 SEP SEP B . n 
B 1 336 PHE 336 696 696 PHE PHE B . n 
B 1 337 MET 337 697 697 MET MET B . n 
B 1 338 ASN 338 698 698 ASN ASN B . n 
B 1 339 PRO 339 699 699 PRO PRO B . n 
B 1 340 GLY 340 700 700 GLY GLY B . n 
B 1 341 MET 341 701 701 MET MET B . n 
B 1 342 GLU 342 702 702 GLU GLU B . n 
B 1 343 ARG 343 703 703 ARG ARG B . n 
B 1 344 LEU 344 704 704 LEU LEU B . n 
B 1 345 ILE 345 705 705 ILE ILE B . n 
B 1 346 SER 346 706 706 SER SER B . n 
B 1 347 HIS 347 707 707 HIS HIS B . n 
B 1 348 HIS 348 708 708 HIS HIS B . n 
B 1 349 HIS 349 709 709 HIS HIS B . n 
B 1 350 HIS 350 710 710 HIS HIS B . n 
B 1 351 HIS 351 711 711 HIS HIS B . n 
B 1 352 HIS 352 712 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 LG8 1   1701 1701 LG8 LG8 A . 
D 2 LG8 1   1712 1712 LG8 LG8 B . 
E 3 MPD 1   1713 1713 MPD MPD B . 
F 4 HOH 1   2001 2001 HOH HOH A . 
F 4 HOH 2   2002 2002 HOH HOH A . 
F 4 HOH 3   2003 2003 HOH HOH A . 
F 4 HOH 4   2004 2004 HOH HOH A . 
F 4 HOH 5   2005 2005 HOH HOH A . 
F 4 HOH 6   2006 2006 HOH HOH A . 
F 4 HOH 7   2007 2007 HOH HOH A . 
F 4 HOH 8   2008 2008 HOH HOH A . 
F 4 HOH 9   2009 2009 HOH HOH A . 
F 4 HOH 10  2010 2010 HOH HOH A . 
F 4 HOH 11  2011 2011 HOH HOH A . 
F 4 HOH 12  2012 2012 HOH HOH A . 
F 4 HOH 13  2013 2013 HOH HOH A . 
F 4 HOH 14  2014 2014 HOH HOH A . 
F 4 HOH 15  2015 2015 HOH HOH A . 
F 4 HOH 16  2016 2016 HOH HOH A . 
F 4 HOH 17  2017 2017 HOH HOH A . 
F 4 HOH 18  2018 2018 HOH HOH A . 
F 4 HOH 19  2019 2019 HOH HOH A . 
F 4 HOH 20  2020 2020 HOH HOH A . 
F 4 HOH 21  2021 2021 HOH HOH A . 
F 4 HOH 22  2022 2022 HOH HOH A . 
F 4 HOH 23  2023 2023 HOH HOH A . 
F 4 HOH 24  2024 2024 HOH HOH A . 
F 4 HOH 25  2025 2025 HOH HOH A . 
F 4 HOH 26  2026 2026 HOH HOH A . 
F 4 HOH 27  2027 2027 HOH HOH A . 
F 4 HOH 28  2028 2028 HOH HOH A . 
F 4 HOH 29  2029 2029 HOH HOH A . 
F 4 HOH 30  2030 2030 HOH HOH A . 
F 4 HOH 31  2031 2031 HOH HOH A . 
F 4 HOH 32  2032 2032 HOH HOH A . 
F 4 HOH 33  2033 2033 HOH HOH A . 
F 4 HOH 34  2034 2034 HOH HOH A . 
F 4 HOH 35  2035 2035 HOH HOH A . 
F 4 HOH 36  2036 2036 HOH HOH A . 
F 4 HOH 37  2037 2037 HOH HOH A . 
F 4 HOH 38  2038 2038 HOH HOH A . 
F 4 HOH 39  2039 2039 HOH HOH A . 
F 4 HOH 40  2040 2040 HOH HOH A . 
F 4 HOH 41  2041 2041 HOH HOH A . 
F 4 HOH 42  2042 2042 HOH HOH A . 
F 4 HOH 43  2043 2043 HOH HOH A . 
F 4 HOH 44  2044 2044 HOH HOH A . 
F 4 HOH 45  2045 2045 HOH HOH A . 
F 4 HOH 46  2046 2046 HOH HOH A . 
F 4 HOH 47  2047 2047 HOH HOH A . 
F 4 HOH 48  2048 2048 HOH HOH A . 
F 4 HOH 49  2049 2049 HOH HOH A . 
F 4 HOH 50  2050 2050 HOH HOH A . 
F 4 HOH 51  2051 2051 HOH HOH A . 
F 4 HOH 52  2052 2052 HOH HOH A . 
F 4 HOH 53  2053 2053 HOH HOH A . 
F 4 HOH 54  2054 2054 HOH HOH A . 
F 4 HOH 55  2055 2055 HOH HOH A . 
F 4 HOH 56  2056 2056 HOH HOH A . 
F 4 HOH 57  2057 2057 HOH HOH A . 
F 4 HOH 58  2058 2058 HOH HOH A . 
F 4 HOH 59  2059 2059 HOH HOH A . 
F 4 HOH 60  2060 2060 HOH HOH A . 
F 4 HOH 61  2061 2061 HOH HOH A . 
F 4 HOH 62  2062 2062 HOH HOH A . 
F 4 HOH 63  2063 2063 HOH HOH A . 
F 4 HOH 64  2064 2064 HOH HOH A . 
F 4 HOH 65  2065 2065 HOH HOH A . 
F 4 HOH 66  2066 2066 HOH HOH A . 
F 4 HOH 67  2067 2067 HOH HOH A . 
F 4 HOH 68  2068 2068 HOH HOH A . 
F 4 HOH 69  2069 2069 HOH HOH A . 
F 4 HOH 70  2070 2070 HOH HOH A . 
F 4 HOH 71  2071 2071 HOH HOH A . 
F 4 HOH 72  2072 2072 HOH HOH A . 
F 4 HOH 73  2073 2073 HOH HOH A . 
F 4 HOH 74  2074 2074 HOH HOH A . 
F 4 HOH 75  2075 2075 HOH HOH A . 
F 4 HOH 76  2076 2076 HOH HOH A . 
F 4 HOH 77  2077 2077 HOH HOH A . 
F 4 HOH 78  2078 2078 HOH HOH A . 
F 4 HOH 79  2079 2079 HOH HOH A . 
F 4 HOH 80  2080 2080 HOH HOH A . 
F 4 HOH 81  2081 2081 HOH HOH A . 
F 4 HOH 82  2082 2082 HOH HOH A . 
F 4 HOH 83  2083 2083 HOH HOH A . 
F 4 HOH 84  2084 2084 HOH HOH A . 
F 4 HOH 85  2085 2085 HOH HOH A . 
F 4 HOH 86  2086 2086 HOH HOH A . 
F 4 HOH 87  2087 2087 HOH HOH A . 
F 4 HOH 88  2088 2088 HOH HOH A . 
F 4 HOH 89  2089 2089 HOH HOH A . 
F 4 HOH 90  2090 2090 HOH HOH A . 
F 4 HOH 91  2091 2091 HOH HOH A . 
F 4 HOH 92  2092 2092 HOH HOH A . 
F 4 HOH 93  2093 2093 HOH HOH A . 
F 4 HOH 94  2094 2094 HOH HOH A . 
F 4 HOH 95  2095 2095 HOH HOH A . 
F 4 HOH 96  2096 2096 HOH HOH A . 
F 4 HOH 97  2097 2097 HOH HOH A . 
F 4 HOH 98  2098 2098 HOH HOH A . 
F 4 HOH 99  2099 2099 HOH HOH A . 
F 4 HOH 100 2100 2100 HOH HOH A . 
F 4 HOH 101 2101 2101 HOH HOH A . 
F 4 HOH 102 2102 2102 HOH HOH A . 
F 4 HOH 103 2103 2103 HOH HOH A . 
F 4 HOH 104 2104 2104 HOH HOH A . 
F 4 HOH 105 2105 2105 HOH HOH A . 
F 4 HOH 106 2106 2106 HOH HOH A . 
F 4 HOH 107 2107 2107 HOH HOH A . 
F 4 HOH 108 2108 2108 HOH HOH A . 
F 4 HOH 109 2109 2109 HOH HOH A . 
F 4 HOH 110 2110 2110 HOH HOH A . 
F 4 HOH 111 2111 2111 HOH HOH A . 
F 4 HOH 112 2112 2112 HOH HOH A . 
F 4 HOH 113 2113 2113 HOH HOH A . 
F 4 HOH 114 2114 2114 HOH HOH A . 
F 4 HOH 115 2115 2115 HOH HOH A . 
F 4 HOH 116 2116 2116 HOH HOH A . 
F 4 HOH 117 2117 2117 HOH HOH A . 
F 4 HOH 118 2118 2118 HOH HOH A . 
F 4 HOH 119 2119 2119 HOH HOH A . 
F 4 HOH 120 2120 2120 HOH HOH A . 
F 4 HOH 121 2121 2121 HOH HOH A . 
F 4 HOH 122 2122 2122 HOH HOH A . 
F 4 HOH 123 2123 2123 HOH HOH A . 
F 4 HOH 124 2124 2124 HOH HOH A . 
F 4 HOH 125 2125 2125 HOH HOH A . 
F 4 HOH 126 2126 2126 HOH HOH A . 
F 4 HOH 127 2127 2127 HOH HOH A . 
F 4 HOH 128 2128 2128 HOH HOH A . 
F 4 HOH 129 2129 2129 HOH HOH A . 
F 4 HOH 130 2130 2130 HOH HOH A . 
F 4 HOH 131 2131 2131 HOH HOH A . 
F 4 HOH 132 2132 2132 HOH HOH A . 
F 4 HOH 133 2133 2133 HOH HOH A . 
F 4 HOH 134 2134 2134 HOH HOH A . 
F 4 HOH 135 2135 2135 HOH HOH A . 
F 4 HOH 136 2136 2136 HOH HOH A . 
F 4 HOH 137 2137 2137 HOH HOH A . 
F 4 HOH 138 2138 2138 HOH HOH A . 
F 4 HOH 139 2139 2139 HOH HOH A . 
F 4 HOH 140 2140 2140 HOH HOH A . 
F 4 HOH 141 2141 2141 HOH HOH A . 
F 4 HOH 142 2142 2142 HOH HOH A . 
F 4 HOH 143 2143 2143 HOH HOH A . 
F 4 HOH 144 2144 2144 HOH HOH A . 
F 4 HOH 145 2145 2145 HOH HOH A . 
F 4 HOH 146 2146 2146 HOH HOH A . 
F 4 HOH 147 2147 2147 HOH HOH A . 
F 4 HOH 148 2148 2148 HOH HOH A . 
F 4 HOH 149 2149 2149 HOH HOH A . 
F 4 HOH 150 2150 2150 HOH HOH A . 
F 4 HOH 151 2151 2151 HOH HOH A . 
F 4 HOH 152 2152 2152 HOH HOH A . 
F 4 HOH 153 2153 2153 HOH HOH A . 
F 4 HOH 154 2154 2154 HOH HOH A . 
F 4 HOH 155 2155 2155 HOH HOH A . 
F 4 HOH 156 2156 2156 HOH HOH A . 
F 4 HOH 157 2157 2157 HOH HOH A . 
F 4 HOH 158 2158 2158 HOH HOH A . 
F 4 HOH 159 2159 2159 HOH HOH A . 
F 4 HOH 160 2160 2160 HOH HOH A . 
F 4 HOH 161 2161 2161 HOH HOH A . 
F 4 HOH 162 2162 2162 HOH HOH A . 
F 4 HOH 163 2163 2163 HOH HOH A . 
F 4 HOH 164 2164 2164 HOH HOH A . 
F 4 HOH 165 2165 2165 HOH HOH A . 
F 4 HOH 166 2166 2166 HOH HOH A . 
F 4 HOH 167 2167 2167 HOH HOH A . 
F 4 HOH 168 2168 2168 HOH HOH A . 
F 4 HOH 169 2169 2169 HOH HOH A . 
F 4 HOH 170 2170 2170 HOH HOH A . 
F 4 HOH 171 2171 2171 HOH HOH A . 
F 4 HOH 172 2172 2172 HOH HOH A . 
F 4 HOH 173 2173 2173 HOH HOH A . 
F 4 HOH 174 2174 2174 HOH HOH A . 
F 4 HOH 175 2175 2175 HOH HOH A . 
F 4 HOH 176 2176 2176 HOH HOH A . 
F 4 HOH 177 2177 2177 HOH HOH A . 
F 4 HOH 178 2178 2178 HOH HOH A . 
F 4 HOH 179 2179 2179 HOH HOH A . 
F 4 HOH 180 2180 2180 HOH HOH A . 
F 4 HOH 181 2181 2181 HOH HOH A . 
F 4 HOH 182 2182 2182 HOH HOH A . 
F 4 HOH 183 2183 2183 HOH HOH A . 
F 4 HOH 184 2184 2184 HOH HOH A . 
F 4 HOH 185 2185 2185 HOH HOH A . 
F 4 HOH 186 2186 2186 HOH HOH A . 
F 4 HOH 187 2187 2187 HOH HOH A . 
F 4 HOH 188 2188 2188 HOH HOH A . 
F 4 HOH 189 2189 2189 HOH HOH A . 
F 4 HOH 190 2190 2190 HOH HOH A . 
F 4 HOH 191 2191 2191 HOH HOH A . 
F 4 HOH 192 2192 2192 HOH HOH A . 
F 4 HOH 193 2193 2193 HOH HOH A . 
F 4 HOH 194 2194 2194 HOH HOH A . 
F 4 HOH 195 2195 2195 HOH HOH A . 
G 4 HOH 1   2001 2001 HOH HOH B . 
G 4 HOH 2   2002 2002 HOH HOH B . 
G 4 HOH 3   2003 2003 HOH HOH B . 
G 4 HOH 4   2004 2004 HOH HOH B . 
G 4 HOH 5   2005 2005 HOH HOH B . 
G 4 HOH 6   2006 2006 HOH HOH B . 
G 4 HOH 7   2007 2007 HOH HOH B . 
G 4 HOH 8   2008 2008 HOH HOH B . 
G 4 HOH 9   2009 2009 HOH HOH B . 
G 4 HOH 10  2010 2010 HOH HOH B . 
G 4 HOH 11  2011 2011 HOH HOH B . 
G 4 HOH 12  2012 2012 HOH HOH B . 
G 4 HOH 13  2013 2013 HOH HOH B . 
G 4 HOH 14  2014 2014 HOH HOH B . 
G 4 HOH 15  2015 2015 HOH HOH B . 
G 4 HOH 16  2016 2016 HOH HOH B . 
G 4 HOH 17  2017 2017 HOH HOH B . 
G 4 HOH 18  2018 2018 HOH HOH B . 
G 4 HOH 19  2019 2019 HOH HOH B . 
G 4 HOH 20  2020 2020 HOH HOH B . 
G 4 HOH 21  2021 2021 HOH HOH B . 
G 4 HOH 22  2022 2022 HOH HOH B . 
G 4 HOH 23  2023 2023 HOH HOH B . 
G 4 HOH 24  2024 2024 HOH HOH B . 
G 4 HOH 25  2025 2025 HOH HOH B . 
G 4 HOH 26  2026 2026 HOH HOH B . 
G 4 HOH 27  2027 2027 HOH HOH B . 
G 4 HOH 28  2028 2028 HOH HOH B . 
G 4 HOH 29  2029 2029 HOH HOH B . 
G 4 HOH 30  2030 2030 HOH HOH B . 
G 4 HOH 31  2031 2031 HOH HOH B . 
G 4 HOH 32  2032 2032 HOH HOH B . 
G 4 HOH 33  2033 2033 HOH HOH B . 
G 4 HOH 34  2034 2034 HOH HOH B . 
G 4 HOH 35  2035 2035 HOH HOH B . 
G 4 HOH 36  2036 2036 HOH HOH B . 
G 4 HOH 37  2037 2037 HOH HOH B . 
G 4 HOH 38  2038 2038 HOH HOH B . 
G 4 HOH 39  2039 2039 HOH HOH B . 
G 4 HOH 40  2040 2040 HOH HOH B . 
G 4 HOH 41  2041 2041 HOH HOH B . 
G 4 HOH 42  2042 2042 HOH HOH B . 
G 4 HOH 43  2043 2043 HOH HOH B . 
G 4 HOH 44  2044 2044 HOH HOH B . 
G 4 HOH 45  2045 2045 HOH HOH B . 
G 4 HOH 46  2046 2046 HOH HOH B . 
G 4 HOH 47  2047 2047 HOH HOH B . 
G 4 HOH 48  2048 2048 HOH HOH B . 
G 4 HOH 49  2049 2049 HOH HOH B . 
G 4 HOH 50  2050 2050 HOH HOH B . 
G 4 HOH 51  2051 2051 HOH HOH B . 
G 4 HOH 52  2052 2052 HOH HOH B . 
G 4 HOH 53  2053 2053 HOH HOH B . 
G 4 HOH 54  2054 2054 HOH HOH B . 
G 4 HOH 55  2055 2055 HOH HOH B . 
G 4 HOH 56  2056 2056 HOH HOH B . 
G 4 HOH 57  2057 2057 HOH HOH B . 
G 4 HOH 58  2058 2058 HOH HOH B . 
G 4 HOH 59  2059 2059 HOH HOH B . 
G 4 HOH 60  2060 2060 HOH HOH B . 
G 4 HOH 61  2061 2061 HOH HOH B . 
G 4 HOH 62  2062 2062 HOH HOH B . 
G 4 HOH 63  2063 2063 HOH HOH B . 
G 4 HOH 64  2064 2064 HOH HOH B . 
G 4 HOH 65  2065 2065 HOH HOH B . 
G 4 HOH 66  2066 2066 HOH HOH B . 
G 4 HOH 67  2067 2067 HOH HOH B . 
G 4 HOH 68  2068 2068 HOH HOH B . 
G 4 HOH 69  2069 2069 HOH HOH B . 
G 4 HOH 70  2070 2070 HOH HOH B . 
G 4 HOH 71  2071 2071 HOH HOH B . 
G 4 HOH 72  2072 2072 HOH HOH B . 
G 4 HOH 73  2073 2073 HOH HOH B . 
G 4 HOH 74  2074 2074 HOH HOH B . 
G 4 HOH 75  2075 2075 HOH HOH B . 
G 4 HOH 76  2076 2076 HOH HOH B . 
G 4 HOH 77  2077 2077 HOH HOH B . 
G 4 HOH 78  2078 2078 HOH HOH B . 
G 4 HOH 79  2079 2079 HOH HOH B . 
G 4 HOH 80  2080 2080 HOH HOH B . 
G 4 HOH 81  2081 2081 HOH HOH B . 
G 4 HOH 82  2082 2082 HOH HOH B . 
G 4 HOH 83  2083 2083 HOH HOH B . 
G 4 HOH 84  2084 2084 HOH HOH B . 
G 4 HOH 85  2085 2085 HOH HOH B . 
G 4 HOH 86  2086 2086 HOH HOH B . 
G 4 HOH 87  2087 2087 HOH HOH B . 
G 4 HOH 88  2088 2088 HOH HOH B . 
G 4 HOH 89  2089 2089 HOH HOH B . 
G 4 HOH 90  2090 2090 HOH HOH B . 
G 4 HOH 91  2091 2091 HOH HOH B . 
G 4 HOH 92  2092 2092 HOH HOH B . 
G 4 HOH 93  2093 2093 HOH HOH B . 
G 4 HOH 94  2094 2094 HOH HOH B . 
G 4 HOH 95  2095 2095 HOH HOH B . 
G 4 HOH 96  2096 2096 HOH HOH B . 
G 4 HOH 97  2097 2097 HOH HOH B . 
G 4 HOH 98  2098 2098 HOH HOH B . 
G 4 HOH 99  2099 2099 HOH HOH B . 
G 4 HOH 100 2100 2100 HOH HOH B . 
G 4 HOH 101 2101 2101 HOH HOH B . 
G 4 HOH 102 2102 2102 HOH HOH B . 
G 4 HOH 103 2103 2103 HOH HOH B . 
G 4 HOH 104 2104 2104 HOH HOH B . 
G 4 HOH 105 2105 2105 HOH HOH B . 
G 4 HOH 106 2106 2106 HOH HOH B . 
G 4 HOH 107 2107 2107 HOH HOH B . 
G 4 HOH 108 2108 2108 HOH HOH B . 
G 4 HOH 109 2109 2109 HOH HOH B . 
G 4 HOH 110 2110 2110 HOH HOH B . 
G 4 HOH 111 2111 2111 HOH HOH B . 
G 4 HOH 112 2112 2112 HOH HOH B . 
G 4 HOH 113 2113 2113 HOH HOH B . 
G 4 HOH 114 2114 2114 HOH HOH B . 
G 4 HOH 115 2115 2115 HOH HOH B . 
G 4 HOH 116 2116 2116 HOH HOH B . 
G 4 HOH 117 2117 2117 HOH HOH B . 
G 4 HOH 118 2118 2118 HOH HOH B . 
G 4 HOH 119 2119 2119 HOH HOH B . 
G 4 HOH 120 2120 2120 HOH HOH B . 
G 4 HOH 121 2121 2121 HOH HOH B . 
G 4 HOH 122 2122 2122 HOH HOH B . 
G 4 HOH 123 2123 2123 HOH HOH B . 
G 4 HOH 124 2124 2124 HOH HOH B . 
G 4 HOH 125 2125 2125 HOH HOH B . 
G 4 HOH 126 2126 2126 HOH HOH B . 
G 4 HOH 127 2127 2127 HOH HOH B . 
G 4 HOH 128 2128 2128 HOH HOH B . 
G 4 HOH 129 2129 2129 HOH HOH B . 
G 4 HOH 130 2130 2130 HOH HOH B . 
G 4 HOH 131 2131 2131 HOH HOH B . 
G 4 HOH 132 2132 2132 HOH HOH B . 
G 4 HOH 133 2133 2133 HOH HOH B . 
G 4 HOH 134 2134 2134 HOH HOH B . 
G 4 HOH 135 2135 2135 HOH HOH B . 
G 4 HOH 136 2136 2136 HOH HOH B . 
G 4 HOH 137 2137 2137 HOH HOH B . 
G 4 HOH 138 2138 2138 HOH HOH B . 
G 4 HOH 139 2139 2139 HOH HOH B . 
G 4 HOH 140 2140 2140 HOH HOH B . 
G 4 HOH 141 2141 2141 HOH HOH B . 
G 4 HOH 142 2142 2142 HOH HOH B . 
G 4 HOH 143 2143 2143 HOH HOH B . 
G 4 HOH 144 2144 2144 HOH HOH B . 
G 4 HOH 145 2145 2145 HOH HOH B . 
G 4 HOH 146 2146 2146 HOH HOH B . 
G 4 HOH 147 2147 2147 HOH HOH B . 
G 4 HOH 148 2148 2148 HOH HOH B . 
G 4 HOH 149 2149 2149 HOH HOH B . 
G 4 HOH 150 2150 2150 HOH HOH B . 
G 4 HOH 151 2151 2151 HOH HOH B . 
G 4 HOH 152 2152 2152 HOH HOH B . 
G 4 HOH 153 2153 2153 HOH HOH B . 
G 4 HOH 154 2154 2154 HOH HOH B . 
G 4 HOH 155 2155 2155 HOH HOH B . 
G 4 HOH 156 2156 2156 HOH HOH B . 
G 4 HOH 157 2157 2157 HOH HOH B . 
G 4 HOH 158 2158 2158 HOH HOH B . 
G 4 HOH 159 2159 2159 HOH HOH B . 
G 4 HOH 160 2160 2160 HOH HOH B . 
G 4 HOH 161 2161 2161 HOH HOH B . 
G 4 HOH 162 2162 2162 HOH HOH B . 
G 4 HOH 163 2163 2163 HOH HOH B . 
G 4 HOH 164 2164 2164 HOH HOH B . 
G 4 HOH 165 2165 2165 HOH HOH B . 
G 4 HOH 166 2166 2166 HOH HOH B . 
G 4 HOH 167 2167 2167 HOH HOH B . 
G 4 HOH 168 2168 2168 HOH HOH B . 
G 4 HOH 169 2169 2169 HOH HOH B . 
G 4 HOH 170 2170 2170 HOH HOH B . 
G 4 HOH 171 2171 2171 HOH HOH B . 
G 4 HOH 172 2172 2172 HOH HOH B . 
G 4 HOH 173 2173 2173 HOH HOH B . 
G 4 HOH 174 2174 2174 HOH HOH B . 
G 4 HOH 175 2175 2175 HOH HOH B . 
G 4 HOH 176 2176 2176 HOH HOH B . 
G 4 HOH 177 2177 2177 HOH HOH B . 
G 4 HOH 178 2178 2178 HOH HOH B . 
G 4 HOH 179 2179 2179 HOH HOH B . 
G 4 HOH 180 2180 2180 HOH HOH B . 
G 4 HOH 181 2181 2181 HOH HOH B . 
G 4 HOH 182 2182 2182 HOH HOH B . 
G 4 HOH 183 2183 2183 HOH HOH B . 
G 4 HOH 184 2184 2184 HOH HOH B . 
G 4 HOH 185 2185 2185 HOH HOH B . 
G 4 HOH 186 2186 2186 HOH HOH B . 
G 4 HOH 187 2187 2187 HOH HOH B . 
G 4 HOH 188 2188 2188 HOH HOH B . 
G 4 HOH 189 2189 2189 HOH HOH B . 
G 4 HOH 190 2190 2190 HOH HOH B . 
G 4 HOH 191 2191 2191 HOH HOH B . 
G 4 HOH 192 2192 2192 HOH HOH B . 
G 4 HOH 193 2193 2193 HOH HOH B . 
G 4 HOH 194 2194 2194 HOH HOH B . 
G 4 HOH 195 2195 2195 HOH HOH B . 
G 4 HOH 196 2196 2196 HOH HOH B . 
G 4 HOH 197 2197 2197 HOH HOH B . 
G 4 HOH 198 2198 2198 HOH HOH B . 
G 4 HOH 199 2199 2199 HOH HOH B . 
G 4 HOH 200 2200 2200 HOH HOH B . 
G 4 HOH 201 2201 2201 HOH HOH B . 
G 4 HOH 202 2202 2202 HOH HOH B . 
G 4 HOH 203 2203 2203 HOH HOH B . 
G 4 HOH 204 2204 2204 HOH HOH B . 
G 4 HOH 205 2205 2205 HOH HOH B . 
G 4 HOH 206 2206 2206 HOH HOH B . 
G 4 HOH 207 2207 2207 HOH HOH B . 
G 4 HOH 208 2208 2208 HOH HOH B . 
G 4 HOH 209 2209 2209 HOH HOH B . 
G 4 HOH 210 2210 2210 HOH HOH B . 
G 4 HOH 211 2211 2211 HOH HOH B . 
G 4 HOH 212 2212 2212 HOH HOH B . 
G 4 HOH 213 2213 2213 HOH HOH B . 
G 4 HOH 214 2214 2214 HOH HOH B . 
G 4 HOH 215 2215 2215 HOH HOH B . 
G 4 HOH 216 2216 2216 HOH HOH B . 
G 4 HOH 217 2217 2217 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A SEP 316 A SEP 676 ? SER PHOSPHOSERINE 
2 A SEP 335 A SEP 695 ? SER PHOSPHOSERINE 
3 B SEP 316 B SEP 676 ? SER PHOSPHOSERINE 
4 B SEP 335 B SEP 695 ? SER PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-05 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-15 
5 'Structure model' 1 4 2019-09-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Experimental preparation'  
9 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow   
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_conn          
5 5 'Structure model' exptl_crystal_grow   
6 5 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.temp'                    
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
4 5 'Structure model' '_exptl_crystal_grow.method'                  
5 5 'Structure model' '_pdbx_database_status.status_code_sf'        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC    refinement       5.2.0019 ? 1 ? ? ? ? 
DENZO     'data reduction' .        ? 2 ? ? ? ? 
SCALEPACK 'data scaling'   .        ? 3 ? ? ? ? 
AMoRE     phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             2JED 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, ILE 381 TO GLU
ENGINEERED RESIDUE IN CHAIN A, THR 538 TO GLU
ENGINEERED RESIDUE IN CHAIN B, ILE 381 TO GLU
ENGINEERED RESIDUE IN CHAIN B, THR 538 TO GLU
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'MUTATIONS I381E, T538E' 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    545 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2114 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  A CYS 540 ? ? N  A GLY 541 ? ? 1.121 1.336 -0.215 0.023 Y 
2 1 CB B CYS 540 ? ? SG B CYS 540 ? ? 1.685 1.812 -0.127 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  A PHE 539 ? ? C  A PHE 539 ? ? N  A CYS 540 ? ? 110.43 122.70 -12.27 1.60 Y 
2 1 C  A PHE 539 ? ? N  A CYS 540 ? ? CA A CYS 540 ? ? 138.65 121.70 16.95  2.50 Y 
3 1 CA B LEU 434 ? ? CB B LEU 434 ? ? CG B LEU 434 ? ? 132.04 115.30 16.74  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 401 ? ? 168.11  -31.10  
2  1 THR A 402 ? ? -146.23 -21.08  
3  1 HIS A 474 ? ? 80.87   -52.31  
4  1 ARG A 503 ? ? 69.15   -8.62   
5  1 ASP A 522 ? ? 67.55   92.49   
6  1 MET A 530 ? ? -107.03 54.10   
7  1 ASN A 557 ? ? -122.94 -148.23 
8  1 PHE A 614 ? ? -81.54  34.12   
9  1 ARG A 635 ? ? -38.44  -38.67  
10 1 ASP A 679 ? ? -69.67  88.55   
11 1 LYS B 376 ? ? 124.18  -154.90 
12 1 ILE B 377 ? ? 64.65   -45.07  
13 1 THR B 450 ? ? -114.40 -167.06 
14 1 HIS B 474 ? ? 74.58   -29.93  
15 1 ARG B 503 ? ? 72.97   -12.75  
16 1 ASP B 513 ? ? -47.95  164.72  
17 1 ASP B 522 ? ? 69.71   89.68   
18 1 MET B 530 ? ? -107.03 40.35   
19 1 ASN B 557 ? ? -125.91 -148.03 
20 1 LEU B 675 ? ? 51.46   86.32   
21 1 PHE B 677 ? ? -135.49 -151.46 
22 1 ALA B 678 ? ? -45.61  95.81   
23 1 ALA B 681 ? ? 69.72   104.79  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    400 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    401 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -52.28 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   CYS 
_pdbx_validate_polymer_linkage.auth_seq_id_1    540 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   GLY 
_pdbx_validate_polymer_linkage.auth_seq_id_2    541 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.12 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 361 ? A GLU 1   
2  1 Y 1 A PRO 362 ? A PRO 2   
3  1 Y 1 A GLU 363 ? A GLU 3   
4  1 Y 1 A LEU 364 ? A LEU 4   
5  1 Y 1 A ASN 365 ? A ASN 5   
6  1 Y 1 A LYS 366 ? A LYS 6   
7  1 Y 1 A GLU 367 ? A GLU 7   
8  1 Y 1 A ARG 368 ? A ARG 8   
9  1 Y 1 A PRO 369 ? A PRO 9   
10 1 Y 1 A SER 370 ? A SER 10  
11 1 Y 1 A LEU 371 ? A LEU 11  
12 1 Y 1 A GLN 372 ? A GLN 12  
13 1 Y 1 A ILE 373 ? A ILE 13  
14 1 Y 1 A LYS 374 ? A LYS 14  
15 1 Y 1 A MET 701 ? A MET 341 
16 1 Y 1 A GLU 702 ? A GLU 342 
17 1 Y 1 A ARG 703 ? A ARG 343 
18 1 Y 1 A LEU 704 ? A LEU 344 
19 1 Y 1 A ILE 705 ? A ILE 345 
20 1 Y 1 A SER 706 ? A SER 346 
21 1 Y 1 A HIS 707 ? A HIS 347 
22 1 Y 1 A HIS 708 ? A HIS 348 
23 1 Y 1 A HIS 709 ? A HIS 349 
24 1 Y 1 A HIS 710 ? A HIS 350 
25 1 Y 1 A HIS 711 ? A HIS 351 
26 1 Y 1 A HIS 712 ? A HIS 352 
27 1 Y 1 B GLU 361 ? B GLU 1   
28 1 Y 1 B PRO 362 ? B PRO 2   
29 1 Y 1 B GLU 363 ? B GLU 3   
30 1 Y 1 B LEU 364 ? B LEU 4   
31 1 Y 1 B ASN 365 ? B ASN 5   
32 1 Y 1 B LYS 366 ? B LYS 6   
33 1 Y 1 B GLU 367 ? B GLU 7   
34 1 Y 1 B ARG 368 ? B ARG 8   
35 1 Y 1 B PRO 369 ? B PRO 9   
36 1 Y 1 B SER 370 ? B SER 10  
37 1 Y 1 B LEU 371 ? B LEU 11  
38 1 Y 1 B GLN 372 ? B GLN 12  
39 1 Y 1 B ILE 373 ? B ILE 13  
40 1 Y 1 B LYS 374 ? B LYS 14  
41 1 Y 1 B PHE 659 ? B PHE 299 
42 1 Y 1 B ASP 660 ? B ASP 300 
43 1 Y 1 B CYS 661 ? B CYS 301 
44 1 Y 1 B SER 662 ? B SER 302 
45 1 Y 1 B ASN 663 ? B ASN 303 
46 1 Y 1 B PHE 664 ? B PHE 304 
47 1 Y 1 B ASP 665 ? B ASP 305 
48 1 Y 1 B LYS 666 ? B LYS 306 
49 1 Y 1 B GLU 667 ? B GLU 307 
50 1 Y 1 B PHE 668 ? B PHE 308 
51 1 Y 1 B LEU 669 ? B LEU 309 
52 1 Y 1 B ASN 670 ? B ASN 310 
53 1 Y 1 B GLU 671 ? B GLU 311 
54 1 Y 1 B LYS 672 ? B LYS 312 
55 1 Y 1 B PRO 673 ? B PRO 313 
56 1 Y 1 B HIS 712 ? B HIS 352 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '3-(8-DIMETHYLAMINOMETHYL-6,7,8,9-TETRAHYDRO-PYRIDO[1,2-A]INDOL-10-YL)-4-(1-METHYL-1H-INDOL-3-YL)-PYRROLE-2,5-DIONE' LG8 
3 '(4S)-2-METHYL-2,4-PENTANEDIOL'                                                                                      MPD 
4 water                                                                                                                HOH 
#