data_2JEF
# 
_entry.id   2JEF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JEF         
PDBE  EBI-31137    
WWPDB D_1290031137 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1JX4 unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1JXL unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1N48 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1N56 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1RYR unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1RYS unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1S0M unspecified 'CRYSTAL STRUCTURE OF A BENZO[A]PYRENE DIOL EPOXIDE ADDUCTIN A TERNARY COMPLEX WITH A DNA POLYMERASE' 
PDB 1S0N unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S0O unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S10 unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S97 unspecified 'DPO4 WITH GT MISMATCH' 
PDB 1S9F unspecified 'DPO WITH AT MATCHED' 
PDB 2AGO unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGP unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGQ unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2ASD unspecified 'OXOG-MODIFIED INSERTION TERNARY COMPLEX' 
PDB 2ASJ unspecified 'OXOG-MODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2ASL unspecified 'OXOG-MODIFIED POSTINSERTION BINARY COMPLEX' 
PDB 2ATL unspecified 'UNMODIFIED INSERTION TERNARY COMPLEX' 
PDB 2AU0 unspecified 'UNMODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2BQ3 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQR unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQU unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BR0 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2C22 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C28 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2D unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2E unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2R unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2J6S unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2J6T unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2J6U unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DGTP.' 
PDB 2JEG unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEI unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEJ unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JEF 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Eoff, R.L.'       1 ? 
'Angel, K.C.'      2 ? 
'Kosekov, I.D.'    3 ? 
'Egli, M.'         4 ? 
'Guengerich, F.P.' 5 ? 
# 
_citation.id                        primary 
_citation.title                     
;Molecular Basis of Selectivity of Nucleoside Triphosphate Incorporation Opposite O6-Benzylguanine by Sulfolobus Solfataricus DNA Polymerase Dpo4: Steady-State and Pre-Steady-State Kinetics and X-Ray Crystallography of Correct and Incorrect Pairing.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                13573 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17337730 
_citation.pdbx_database_id_DOI      10.1074/JBC.M700656200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Eoff, R.L.'       1 ? 
primary 'Angel, K.C.'      2 ? 
primary 'Egli, M.'         3 ? 
primary 'Guengerich, F.P.' 4 ? 
# 
_cell.entry_id           2JEF 
_cell.length_a           93.990 
_cell.length_b           102.660 
_cell.length_c           52.880 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JEF 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE IV'                                                41086.754 1   2.7.7.7 ? ? 
'HIS-TAG ADDED TO N-TERMINUS'                 
2 polymer     syn "5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP*TP*TP*CP*DOC)-3'"             4369.854  1   ?       ? ? 
'DOC INDICATES A DIDEOXY-CYTOSINE RESIDUE'    
3 polymer     syn 
;5'-D(*TP*CP*AP*CP*BZGP*GP*AP*AP*TP*CP*CP*TP*TP*CP*CP CP*CP*C)-3'
;
5462.604  1   ?       ? ? 'BZG INDICATES O6-BENZYLGUANINE MODIFICATION' 
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                507.181   1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                      40.078    3   ?       ? ? ? 
6 water       nat water                                                              18.015    182 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'POL IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A ? 
2 polydeoxyribonucleotide no yes '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DT)(DC)(DOC)' GGGGGAAGGATTCC P ? 
3 polydeoxyribonucleotide no yes '(DT)(DC)(DA)(DC)(BZG)(DG)(DA)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCACNGAATCCTTCCCCC T 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   ILE n 
1 9   VAL n 
1 10  LEU n 
1 11  PHE n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  ASP n 
1 16  TYR n 
1 17  PHE n 
1 18  TYR n 
1 19  ALA n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  ASN n 
1 27  PRO n 
1 28  SER n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  VAL n 
1 37  CYS n 
1 38  VAL n 
1 39  PHE n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  PHE n 
1 44  GLU n 
1 45  ASP n 
1 46  SER n 
1 47  GLY n 
1 48  ALA n 
1 49  VAL n 
1 50  ALA n 
1 51  THR n 
1 52  ALA n 
1 53  ASN n 
1 54  TYR n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  PRO n 
1 67  ILE n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LEU n 
1 81  PRO n 
1 82  MET n 
1 83  ARG n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  TYR n 
1 88  GLN n 
1 89  GLN n 
1 90  VAL n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  MET n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  ARG n 
1 100 GLU n 
1 101 TYR n 
1 102 SER n 
1 103 GLU n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 SER n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 ILE n 
1 118 SER n 
1 119 ASP n 
1 120 LYS n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 TYR n 
1 125 ARG n 
1 126 GLU n 
1 127 ALA n 
1 128 TYR n 
1 129 ASN n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLU n 
1 134 ILE n 
1 135 LYS n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 GLU n 
1 143 LYS n 
1 144 ILE n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 SER n 
1 152 LYS n 
1 153 ASN n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ASP n 
1 175 GLU n 
1 176 GLU n 
1 177 VAL n 
1 178 LYS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 ASP n 
1 186 ILE n 
1 187 ALA n 
1 188 ASP n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ILE n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 THR n 
1 197 ALA n 
1 198 GLU n 
1 199 LYS n 
1 200 LEU n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ASN n 
1 207 LYS n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 PHE n 
1 217 ASP n 
1 218 LYS n 
1 219 LEU n 
1 220 LYS n 
1 221 GLY n 
1 222 MET n 
1 223 ILE n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 LYS n 
1 228 ALA n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 ILE n 
1 233 SER n 
1 234 LEU n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 GLU n 
1 242 PRO n 
1 243 ILE n 
1 244 ARG n 
1 245 THR n 
1 246 ARG n 
1 247 VAL n 
1 248 ARG n 
1 249 LYS n 
1 250 SER n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 THR n 
1 257 MET n 
1 258 LYS n 
1 259 ARG n 
1 260 ASN n 
1 261 SER n 
1 262 ARG n 
1 263 ASN n 
1 264 LEU n 
1 265 GLU n 
1 266 GLU n 
1 267 ILE n 
1 268 LYS n 
1 269 PRO n 
1 270 TYR n 
1 271 LEU n 
1 272 PHE n 
1 273 ARG n 
1 274 ALA n 
1 275 ILE n 
1 276 GLU n 
1 277 GLU n 
1 278 SER n 
1 279 TYR n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ASP n 
1 284 LYS n 
1 285 ARG n 
1 286 ILE n 
1 287 PRO n 
1 288 LYS n 
1 289 ALA n 
1 290 ILE n 
1 291 HIS n 
1 292 VAL n 
1 293 VAL n 
1 294 ALA n 
1 295 VAL n 
1 296 THR n 
1 297 GLU n 
1 298 ASP n 
1 299 LEU n 
1 300 ASP n 
1 301 ILE n 
1 302 VAL n 
1 303 SER n 
1 304 ARG n 
1 305 GLY n 
1 306 ARG n 
1 307 THR n 
1 308 PHE n 
1 309 PRO n 
1 310 HIS n 
1 311 GLY n 
1 312 ILE n 
1 313 SER n 
1 314 LYS n 
1 315 GLU n 
1 316 THR n 
1 317 ALA n 
1 318 TYR n 
1 319 SER n 
1 320 GLU n 
1 321 SER n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 LYS n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 GLU n 
1 332 ASP n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 ILE n 
1 337 ARG n 
1 338 ARG n 
1 339 ILE n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 PHE n 
1 347 ILE n 
1 348 GLU n 
1 349 ALA n 
1 350 ILE n 
1 351 GLY n 
1 352 LEU n 
1 353 ASP n 
1 354 LYS n 
1 355 PHE n 
1 356 PHE n 
1 357 ASP n 
1 358 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DC  n 
2 14  DOC n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   BZG n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SULFOLOBUS SOLFATARICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B/DPO4-NHIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2JEF        1 ? ? 2JEF   ? 
2 UNP DPO42_SULSO 1 ? ? Q97W02 ? 
3 PDB 2JEF        2 ? ? 2JEF   ? 
4 PDB 2JEF        3 ? ? 2JEF   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JEF A 1 ? 6   ? 2JEF   -5 ? 0   ? -5 0   
2 2 2JEF A 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
3 3 2JEF P 1 ? 14  ? 2JEF   1  ? 14  ? 1  14  
4 4 2JEF T 1 ? 18  ? 2JEF   1  ? 18  ? 1  18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                  ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                 ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                               ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                          ? 'C4 H7 N O4' 
133.103 
BZG 'DNA linking'       . '6-(BENZYLOXY)-9-(2-DEOXY-5-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-9H-PURIN-2-AMINE' 
"O6-BENZYL-2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" 'C17 H20 N5 O7 P'   437.344 
CA  non-polymer         . 'CALCIUM ION'                                                                            ? 'Ca 2' 40.078 
CYS 'L-peptide linking' y CYSTEINE                                                                                 ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                     ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                      ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                     ? 
'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                                      ? 
'C10 H16 N5 O13 P3' 507.181 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                 ? 
'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                             ? 
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                          ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                  ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                    ? 'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                                               ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                  ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                   ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                               ? 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                            ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                  ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                   ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                ? 'C4 H9 N O3' 
119.119 
TYR 'L-peptide linking' y TYROSINE                                                                                 ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                   ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          2JEF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   53.08 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.40 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;10% POLYETHYLENE GLYCOL 3350 (W/V), 100MM CALCIUM ACETATE, 25 MM TRIS-HCL PH 7.4, 2.5% GLYCEROL, 5 MM CALCIUM CHLORIDE, 1 MM DGTP, AT 25 DEGREES CELSIUS.
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     110.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-12-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 5ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   5ID-B 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JEF 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             28.990 
_reflns.d_resolution_high            2.170 
_reflns.number_obs                   27743 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.4000 
_reflns.B_iso_Wilson_estimate        42.4 
_reflns.pdbx_redundancy              7.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.17 
_reflns_shell.d_res_low              2.24 
_reflns_shell.percent_possible_all   94.7 
_reflns_shell.Rmerge_I_obs           0.48000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.500 
_reflns_shell.pdbx_redundancy        7.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JEF 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27743 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               73882.65 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.99 
_refine.ls_d_res_high                            2.17 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.230 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.230 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1350 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               39.5 
_refine.aniso_B[1][1]                            4.78 
_refine.aniso_B[2][2]                            -1.64 
_refine.aniso_B[3][3]                            -3.14 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.380482 
_refine.solvent_model_param_bsol                 59.8696 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2J6U' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2JEF 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           29.96 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2754 
_refine_hist.pdbx_number_atoms_nucleic_acid   614 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             182 
_refine_hist.number_atoms_total               3584 
_refine_hist.d_res_high                       2.17 
_refine_hist.d_res_low                        28.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.79  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.38  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.17  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.12  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.19  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.17 
_refine_ls_shell.d_res_low                        2.31 
_refine_ls_shell.number_reflns_R_work             4313 
_refine_ls_shell.R_factor_R_work                  0.312 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.328 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             241 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP   
'X-RAY DIFFRACTION' 2 DNA-RNA_REP1.PARAM DNA-RNA1.TOP  
'X-RAY DIFFRACTION' 3 DGTP.PARAM         DGTP.TOP      
'X-RAY DIFFRACTION' 4 ION.PARAM          ION.TOP       
'X-RAY DIFFRACTION' 5 WATER_REP.PARAM    WATER_REP.TOP 
# 
_struct.entry_id                  2JEF 
_struct.title                     
;The Molecular Basis of Selectivity of Nucleotide Triphosphate Incorporation Opposite O6-Benzylguanine by Sulfolobus solfataricus DNA Polymerase IV: Steady-state and Pre-steady-state and X-Ray Crystallography of Correct and Incorrect Pairing
;
_struct.pdbx_descriptor           'DNA POLYMERASE IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JEF 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;DNA REPLICATION, MUTATOR PROTEIN, NUCLEOTIDYLTRANSFERASE, DNA-DIRECTED DNA POLYMERASE, DPO4, MAGNESIUM, DNA DAMAGE, DNA REPAIR, ALKYLATING AGENTS, TRANSLESION SYNTHESIS, TRANSFERASE-DNA COMPLEX, DNA-BINDING, METAL-BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 16  ? ASN A 26  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 27  ? LYS A 30  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 53  ? LYS A 58  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO A 66  ? LEU A 74  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 83  ? ARG A 99  ? ARG A 77  ARG A 93  1 ? 17 
HELX_P HELX_P6  6  SER A 118 ? VAL A 121 ? SER A 112 VAL A 115 5 ? 4  
HELX_P HELX_P7  7  ARG A 122 ? LYS A 143 ? ARG A 116 LYS A 137 1 ? 22 
HELX_P HELX_P8  8  ASN A 153 ? LYS A 165 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P9  9  ASP A 173 ? LEU A 184 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P10 10 ILE A 186 ? VAL A 189 ? ILE A 180 VAL A 183 5 ? 4  
HELX_P HELX_P11 11 GLY A 193 ? LEU A 203 ? GLY A 187 LEU A 197 1 ? 11 
HELX_P HELX_P12 12 LEU A 208 ? ILE A 214 ? LEU A 202 ILE A 208 5 ? 7  
HELX_P HELX_P13 13 GLU A 215 ? GLY A 224 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P14 14 GLY A 224 ? ARG A 236 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P15 15 ASN A 263 ? ASP A 283 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P16 16 SER A 313 ? ASP A 332 ? SER A 307 ASP A 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? E CA  .  CA    ? ? ? 1_555 I HOH .   O     ? ? A CA  1344 P HOH 2019 1_555 ? ? ? ? ? ? ?            2.436 ? 
metalc2  metalc ?    ? E CA  .  CA    ? ? ? 1_555 A GLU 112 OE1   ? ? A CA  1344 A GLU 106  1_555 ? ? ? ? ? ? ?            2.906 ? 
metalc3  metalc ?    ? E CA  .  CA    ? ? ? 1_555 A ASP 13  OD2   ? ? A CA  1344 A ASP 7    1_555 ? ? ? ? ? ? ?            2.837 ? 
metalc4  metalc ?    ? E CA  .  CA    ? ? ? 1_555 A ASP 111 OD2   ? ? A CA  1344 A ASP 105  1_555 ? ? ? ? ? ? ?            3.302 ? 
metalc5  metalc ?    ? E CA  .  CA    ? ? ? 1_555 D DGT .   O2A   ? ? A CA  1344 A DGT 1343 1_555 ? ? ? ? ? ? ?            2.693 ? 
metalc6  metalc ?    ? E CA  .  CA    ? ? ? 1_555 A ASP 111 OD1   ? ? A CA  1344 A ASP 105  1_555 ? ? ? ? ? ? ?            2.648 ? 
metalc7  metalc ?    ? F CA  .  CA    ? ? ? 1_555 D DGT .   O2A   ? ? A CA  1345 A DGT 1343 1_555 ? ? ? ? ? ? ?            2.504 ? 
metalc8  metalc ?    ? F CA  .  CA    ? ? ? 1_555 D DGT .   O1B   ? ? A CA  1345 A DGT 1343 1_555 ? ? ? ? ? ? ?            2.373 ? 
metalc9  metalc ?    ? F CA  .  CA    ? ? ? 1_555 D DGT .   O2G   ? ? A CA  1345 A DGT 1343 1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc10 metalc ?    ? F CA  .  CA    ? ? ? 1_555 A ASP 111 OD2   ? ? A CA  1345 A ASP 105  1_555 ? ? ? ? ? ? ?            2.437 ? 
metalc11 metalc ?    ? F CA  .  CA    ? ? ? 1_555 A ASP 13  OD2   ? ? A CA  1345 A ASP 7    1_555 ? ? ? ? ? ? ?            2.490 ? 
metalc12 metalc ?    ? F CA  .  CA    ? ? ? 1_555 A PHE 14  O     ? ? A CA  1345 A PHE 8    1_555 ? ? ? ? ? ? ?            2.424 ? 
metalc13 metalc ?    ? G CA  .  CA    ? ? ? 1_555 A ALA 187 O     ? ? A CA  1346 A ALA 181  1_555 ? ? ? ? ? ? ?            2.420 ? 
metalc14 metalc ?    ? G CA  .  CA    ? ? ? 1_555 I HOH .   O     ? ? A CA  1346 P HOH 2016 1_555 ? ? ? ? ? ? ?            2.693 ? 
metalc15 metalc ?    ? G CA  .  CA    ? ? ? 1_555 I HOH .   O     ? ? A CA  1346 P HOH 2015 1_555 ? ? ? ? ? ? ?            2.602 ? 
metalc16 metalc ?    ? G CA  .  CA    ? ? ? 1_555 A ILE 192 O     ? ? A CA  1346 A ILE 186  1_555 ? ? ? ? ? ? ?            2.647 ? 
metalc17 metalc ?    ? G CA  .  CA    ? ? ? 1_555 H HOH .   O     ? ? A CA  1346 A HOH 2089 1_555 ? ? ? ? ? ? ?            2.521 ? 
covale1  covale both ? B DC  13 "O3'" ? ? ? 1_555 B DOC 14  P     ? ? P DC  13   P DOC 14   1_555 ? ? ? ? ? ? ?            1.613 ? 
covale2  covale one  ? B DC  13 "O3'" ? ? ? 1_555 B DOC 14  "O5'" ? ? P DC  13   P DOC 14   1_555 ? ? ? ? ? ? ?            2.020 ? 
covale3  covale both ? C DC  4  "O3'" ? ? ? 1_555 C BZG 5   P     ? ? T DC  4    T BZG 5    1_555 ? ? ? ? ? ? ?            1.591 ? 
covale4  covale one  ? C BZG 5  "O3'" ? ? ? 1_555 C DG  6   P     ? ? T BZG 5    T DG  6    1_555 ? ? ? ? ? ? ?            1.592 ? 
hydrog1  hydrog ?    ? B DG  1  N1    ? ? ? 1_555 C DC  18  N3    ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DG  1  N2    ? ? ? 1_555 C DC  18  O2    ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DG  1  O6    ? ? ? 1_555 C DC  18  N4    ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DG  2  N1    ? ? ? 1_555 C DC  17  N3    ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DG  2  N2    ? ? ? 1_555 C DC  17  O2    ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  2  O6    ? ? ? 1_555 C DC  17  N4    ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  3  N1    ? ? ? 1_555 C DC  16  N3    ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DG  3  N2    ? ? ? 1_555 C DC  16  O2    ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DG  3  O6    ? ? ? 1_555 C DC  16  N4    ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DG  4  N1    ? ? ? 1_555 C DC  15  N3    ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DG  4  N2    ? ? ? 1_555 C DC  15  O2    ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DG  4  O6    ? ? ? 1_555 C DC  15  N4    ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DG  5  N1    ? ? ? 1_555 C DC  14  N3    ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DG  5  N2    ? ? ? 1_555 C DC  14  O2    ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DG  5  O6    ? ? ? 1_555 C DC  14  N4    ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DA  6  N1    ? ? ? 1_555 C DT  13  N3    ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DA  6  N6    ? ? ? 1_555 C DT  13  O4    ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DA  7  N1    ? ? ? 1_555 C DT  12  N3    ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DA  7  N6    ? ? ? 1_555 C DT  12  O4    ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DG  8  N1    ? ? ? 1_555 C DC  11  N3    ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DG  8  N2    ? ? ? 1_555 C DC  11  O2    ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DG  8  O6    ? ? ? 1_555 C DC  11  N4    ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DG  9  N1    ? ? ? 1_555 C DC  10  N3    ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DG  9  N2    ? ? ? 1_555 C DC  10  O2    ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DG  9  O6    ? ? ? 1_555 C DC  10  N4    ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DA  10 N1    ? ? ? 1_555 C DT  9   N3    ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DA  10 N6    ? ? ? 1_555 C DT  9   O4    ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DT  11 N3    ? ? ? 1_555 C DA  8   N1    ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DT  11 O4    ? ? ? 1_555 C DA  8   N6    ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DT  12 N3    ? ? ? 1_555 C DA  7   N1    ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DT  12 O4    ? ? ? 1_555 C DA  7   N6    ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DC  13 N3    ? ? ? 1_555 C DG  6   N1    ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DC  13 N4    ? ? ? 1_555 C DG  6   O6    ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DC  13 O2    ? ? ? 1_555 C DG  6   N2    ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           165 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    166 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 105 ? SER A 109 ? ILE A 99  SER A 103 
AA 2 GLU A 112 ? ASP A 116 ? GLU A 106 ASP A 110 
AA 3 VAL A 9   ? PHE A 14  ? VAL A 3   PHE A 8   
AA 4 VAL A 146 ? SER A 151 ? VAL A 140 SER A 145 
AA 5 ILE A 169 ? VAL A 171 ? ILE A 163 VAL A 165 
AB 1 GLY A 47  ? ALA A 52  ? GLY A 41  ALA A 46  
AB 2 VAL A 34  ? PHE A 39  ? VAL A 28  PHE A 33  
AB 3 VAL A 78  ? PRO A 81  ? VAL A 72  PRO A 75  
AC 1 SER A 250 ? SER A 261 ? SER A 244 SER A 255 
AC 2 ILE A 336 ? PHE A 346 ? ILE A 330 PHE A 340 
AC 3 PRO A 287 ? THR A 296 ? PRO A 281 THR A 290 
AC 4 ILE A 301 ? THR A 307 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N SER A 109 ? N SER A 103 O GLU A 112 ? O GLU A 106 
AA 2 3 N LEU A 115 ? N LEU A 109 O LEU A 10  ? O LEU A 4   
AA 3 4 N ASP A 13  ? N ASP A 7   O THR A 147 ? O THR A 141 
AA 4 5 N ILE A 150 ? N ILE A 144 O LYS A 170 ? O LYS A 164 
AB 1 2 N ALA A 50  ? N ALA A 44  O VAL A 36  ? O VAL A 30  
AB 2 3 N VAL A 35  ? N VAL A 29  O VAL A 78  ? O VAL A 72  
AC 1 2 N SER A 261 ? N SER A 255 O ILE A 336 ? O ILE A 330 
AC 2 3 O SER A 344 ? O SER A 338 N LYS A 288 ? N LYS A 282 
AC 3 4 N ALA A 294 ? N ALA A 288 O VAL A 302 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 1344'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1345'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1346'  
AC4 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE DGT A 1343' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 13  ? ASP A 7    . ? 1_555 ? 
2  AC1 7  ASP A 111 ? ASP A 105  . ? 1_555 ? 
3  AC1 7  GLU A 112 ? GLU A 106  . ? 1_555 ? 
4  AC1 7  DGT D .   ? DGT A 1343 . ? 1_555 ? 
5  AC1 7  CA  F .   ? CA  A 1345 . ? 1_555 ? 
6  AC1 7  DOC B 14  ? DOC P 14   . ? 1_555 ? 
7  AC1 7  HOH I .   ? HOH P 2019 . ? 1_555 ? 
8  AC2 5  ASP A 13  ? ASP A 7    . ? 1_555 ? 
9  AC2 5  PHE A 14  ? PHE A 8    . ? 1_555 ? 
10 AC2 5  ASP A 111 ? ASP A 105  . ? 1_555 ? 
11 AC2 5  DGT D .   ? DGT A 1343 . ? 1_555 ? 
12 AC2 5  CA  E .   ? CA  A 1344 . ? 1_555 ? 
13 AC3 5  ALA A 187 ? ALA A 181  . ? 1_555 ? 
14 AC3 5  ILE A 192 ? ILE A 186  . ? 1_555 ? 
15 AC3 5  HOH H .   ? HOH A 2089 . ? 1_555 ? 
16 AC3 5  HOH I .   ? HOH P 2015 . ? 1_555 ? 
17 AC3 5  HOH I .   ? HOH P 2016 . ? 1_555 ? 
18 AC4 20 PHE A 14  ? PHE A 8    . ? 1_555 ? 
19 AC4 20 ASP A 15  ? ASP A 9    . ? 1_555 ? 
20 AC4 20 TYR A 16  ? TYR A 10   . ? 1_555 ? 
21 AC4 20 PHE A 17  ? PHE A 11   . ? 1_555 ? 
22 AC4 20 TYR A 18  ? TYR A 12   . ? 1_555 ? 
23 AC4 20 ALA A 50  ? ALA A 44   . ? 1_555 ? 
24 AC4 20 THR A 51  ? THR A 45   . ? 1_555 ? 
25 AC4 20 TYR A 54  ? TYR A 48   . ? 1_555 ? 
26 AC4 20 ARG A 57  ? ARG A 51   . ? 1_555 ? 
27 AC4 20 ASP A 111 ? ASP A 105  . ? 1_555 ? 
28 AC4 20 LYS A 165 ? LYS A 159  . ? 1_555 ? 
29 AC4 20 CA  E .   ? CA  A 1344 . ? 1_555 ? 
30 AC4 20 CA  F .   ? CA  A 1345 . ? 1_555 ? 
31 AC4 20 HOH H .   ? HOH A 2142 . ? 1_555 ? 
32 AC4 20 HOH H .   ? HOH A 2143 . ? 1_555 ? 
33 AC4 20 HOH H .   ? HOH A 2144 . ? 1_555 ? 
34 AC4 20 HOH H .   ? HOH A 2145 . ? 1_555 ? 
35 AC4 20 DOC B 14  ? DOC P 14   . ? 1_555 ? 
36 AC4 20 DC  C 4   ? DC  T 4    . ? 1_555 ? 
37 AC4 20 BZG C 5   ? BZG T 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JEF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JEF 
_atom_sites.fract_transf_matrix[1][1]   0.010639 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018911 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . HIS A 1 6   ? -1.462 31.113 12.439  1.00  59.95  ? 0    HIS A N     1 
ATOM   2    C  CA    . HIS A 1 6   ? -2.065 32.475 12.201  1.00  59.61  ? 0    HIS A CA    1 
ATOM   3    C  C     . HIS A 1 6   ? -1.065 33.413 12.814  1.00  57.63  ? 0    HIS A C     1 
ATOM   4    O  O     . HIS A 1 6   ? -1.263 34.630 12.938  1.00  56.95  ? 0    HIS A O     1 
ATOM   5    C  CB    . HIS A 1 6   ? -3.406 32.591 12.954  1.00  60.49  ? 0    HIS A CB    1 
ATOM   6    C  CG    . HIS A 1 6   ? -4.142 31.298 13.033  1.00  61.98  ? 0    HIS A CG    1 
ATOM   7    N  ND1   . HIS A 1 6   ? -3.490 30.087 13.094  1.00  62.13  ? 0    HIS A ND1   1 
ATOM   8    C  CD2   . HIS A 1 6   ? -5.456 31.030 13.187  1.00  62.24  ? 0    HIS A CD2   1 
ATOM   9    C  CE1   . HIS A 1 6   ? -4.368 29.125 13.293  1.00  62.45  ? 0    HIS A CE1   1 
ATOM   10   N  NE2   . HIS A 1 6   ? -5.572 29.670 13.357  1.00  62.76  ? 0    HIS A NE2   1 
ATOM   11   N  N     . MET A 1 7   ? 0.024  32.829 13.275  1.00  56.12  ? 1    MET A N     1 
ATOM   12   C  CA    . MET A 1 7   ? 1.073  33.628 13.854  1.00  53.44  ? 1    MET A CA    1 
ATOM   13   C  C     . MET A 1 7   ? 1.537  34.196 12.483  1.00  50.55  ? 1    MET A C     1 
ATOM   14   O  O     . MET A 1 7   ? 1.594  33.459 11.465  1.00  49.43  ? 1    MET A O     1 
ATOM   15   C  CB    . MET A 1 7   ? 2.170  32.744 14.443  1.00  54.70  ? 1    MET A CB    1 
ATOM   16   C  CG    . MET A 1 7   ? 3.423  33.482 14.810  1.00  57.70  ? 1    MET A CG    1 
ATOM   17   S  SD    . MET A 1 7   ? 4.468  32.423 15.807  1.00  64.15  ? 1    MET A SD    1 
ATOM   18   C  CE    . MET A 1 7   ? 4.748  31.041 14.650  1.00  58.42  ? 1    MET A CE    1 
ATOM   19   N  N     . ILE A 1 8   ? 1.823  35.492 12.408  1.00  46.27  ? 2    ILE A N     1 
ATOM   20   C  CA    . ILE A 1 8   ? 2.327  36.108 11.176  1.00  42.16  ? 2    ILE A CA    1 
ATOM   21   C  C     . ILE A 1 8   ? 3.674  36.683 11.580  1.00  38.47  ? 2    ILE A C     1 
ATOM   22   O  O     . ILE A 1 8   ? 3.751  37.530 12.469  1.00  38.82  ? 2    ILE A O     1 
ATOM   23   C  CB    . ILE A 1 8   ? 1.439  37.259 10.679  1.00  43.92  ? 2    ILE A CB    1 
ATOM   24   C  CG1   . ILE A 1 8   ? 0.094  36.716 10.185  1.00  45.11  ? 2    ILE A CG1   1 
ATOM   25   C  CG2   . ILE A 1 8   ? 2.148  37.997 9.551   1.00  43.79  ? 2    ILE A CG2   1 
ATOM   26   C  CD1   . ILE A 1 8   ? -0.750 37.752 9.455   1.00  45.93  ? 2    ILE A CD1   1 
ATOM   27   N  N     . VAL A 1 9   ? 4.737  36.227 10.934  1.00  35.47  ? 3    VAL A N     1 
ATOM   28   C  CA    . VAL A 1 9   ? 6.071  36.689 11.292  1.00  31.57  ? 3    VAL A CA    1 
ATOM   29   C  C     . VAL A 1 9   ? 6.774  37.523 10.229  1.00  29.60  ? 3    VAL A C     1 
ATOM   30   O  O     . VAL A 1 9   ? 6.769  37.191 9.050   1.00  29.88  ? 3    VAL A O     1 
ATOM   31   C  CB    . VAL A 1 9   ? 6.961  35.484 11.678  1.00  30.10  ? 3    VAL A CB    1 
ATOM   32   C  CG1   . VAL A 1 9   ? 8.357  35.946 12.031  1.00  28.46  ? 3    VAL A CG1   1 
ATOM   33   C  CG2   . VAL A 1 9   ? 6.338  34.751 12.857  1.00  30.02  ? 3    VAL A CG2   1 
ATOM   34   N  N     . LEU A 1 10  ? 7.377  38.622 10.663  1.00  29.57  ? 4    LEU A N     1 
ATOM   35   C  CA    . LEU A 1 10  ? 8.104  39.495 9.755   1.00  29.35  ? 4    LEU A CA    1 
ATOM   36   C  C     . LEU A 1 10  ? 9.588  39.468 10.155  1.00  29.09  ? 4    LEU A C     1 
ATOM   37   O  O     . LEU A 1 10  ? 9.939  39.860 11.270  1.00  29.70  ? 4    LEU A O     1 
ATOM   38   C  CB    . LEU A 1 10  ? 7.535  40.914 9.834   1.00  29.32  ? 4    LEU A CB    1 
ATOM   39   C  CG    . LEU A 1 10  ? 8.013  41.927 8.786   1.00  31.46  ? 4    LEU A CG    1 
ATOM   40   C  CD1   . LEU A 1 10  ? 6.963  43.015 8.582   1.00  29.46  ? 4    LEU A CD1   1 
ATOM   41   C  CD2   . LEU A 1 10  ? 9.339  42.517 9.222   1.00  28.87  ? 4    LEU A CD2   1 
ATOM   42   N  N     . PHE A 1 11  ? 10.436 38.989 9.244   1.00  25.57  ? 5    PHE A N     1 
ATOM   43   C  CA    . PHE A 1 11  ? 11.883 38.869 9.473   1.00  25.60  ? 5    PHE A CA    1 
ATOM   44   C  C     . PHE A 1 11  ? 12.660 39.921 8.687   1.00  25.35  ? 5    PHE A C     1 
ATOM   45   O  O     . PHE A 1 11  ? 12.434 40.115 7.488   1.00  26.43  ? 5    PHE A O     1 
ATOM   46   C  CB    . PHE A 1 11  ? 12.347 37.465 9.054   1.00  23.31  ? 5    PHE A CB    1 
ATOM   47   C  CG    . PHE A 1 11  ? 13.850 37.260 9.077   1.00  22.71  ? 5    PHE A CG    1 
ATOM   48   C  CD1   . PHE A 1 11  ? 14.540 37.165 10.284  1.00  20.78  ? 5    PHE A CD1   1 
ATOM   49   C  CD2   . PHE A 1 11  ? 14.555 37.089 7.890   1.00  21.08  ? 5    PHE A CD2   1 
ATOM   50   C  CE1   . PHE A 1 11  ? 15.915 36.892 10.313  1.00  23.29  ? 5    PHE A CE1   1 
ATOM   51   C  CE2   . PHE A 1 11  ? 15.937 36.814 7.899   1.00  23.44  ? 5    PHE A CE2   1 
ATOM   52   C  CZ    . PHE A 1 11  ? 16.619 36.713 9.119   1.00  18.46  ? 5    PHE A CZ    1 
ATOM   53   N  N     . VAL A 1 12  ? 13.577 40.600 9.365   1.00  24.92  ? 6    VAL A N     1 
ATOM   54   C  CA    . VAL A 1 12  ? 14.381 41.630 8.717   1.00  25.98  ? 6    VAL A CA    1 
ATOM   55   C  C     . VAL A 1 12  ? 15.854 41.216 8.702   1.00  24.98  ? 6    VAL A C     1 
ATOM   56   O  O     . VAL A 1 12  ? 16.414 40.862 9.733   1.00  24.42  ? 6    VAL A O     1 
ATOM   57   C  CB    . VAL A 1 12  ? 14.264 42.982 9.453   1.00  25.85  ? 6    VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 12  ? 15.026 44.061 8.679   1.00  21.37  ? 6    VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 12  ? 12.776 43.373 9.629   1.00  26.80  ? 6    VAL A CG2   1 
ATOM   60   N  N     . ASP A 1 13  ? 16.471 41.277 7.528   1.00  25.71  ? 7    ASP A N     1 
ATOM   61   C  CA    . ASP A 1 13  ? 17.879 40.916 7.363   1.00  26.06  ? 7    ASP A CA    1 
ATOM   62   C  C     . ASP A 1 13  ? 18.591 42.036 6.573   1.00  25.81  ? 7    ASP A C     1 
ATOM   63   O  O     . ASP A 1 13  ? 18.345 42.202 5.385   1.00  22.24  ? 7    ASP A O     1 
ATOM   64   C  CB    . ASP A 1 13  ? 17.964 39.586 6.602   1.00  27.11  ? 7    ASP A CB    1 
ATOM   65   C  CG    . ASP A 1 13  ? 19.331 38.957 6.694   1.00  31.33  ? 7    ASP A CG    1 
ATOM   66   O  OD1   . ASP A 1 13  ? 19.495 37.789 6.283   1.00  35.44  ? 7    ASP A OD1   1 
ATOM   67   O  OD2   . ASP A 1 13  ? 20.240 39.635 7.188   1.00  30.83  ? 7    ASP A OD2   1 
ATOM   68   N  N     . PHE A 1 14  ? 19.476 42.790 7.226   1.00  25.65  ? 8    PHE A N     1 
ATOM   69   C  CA    . PHE A 1 14  ? 20.162 43.909 6.557   1.00  25.52  ? 8    PHE A CA    1 
ATOM   70   C  C     . PHE A 1 14  ? 21.071 43.470 5.409   1.00  24.11  ? 8    PHE A C     1 
ATOM   71   O  O     . PHE A 1 14  ? 21.811 42.528 5.546   1.00  22.56  ? 8    PHE A O     1 
ATOM   72   C  CB    . PHE A 1 14  ? 20.981 44.722 7.573   1.00  21.72  ? 8    PHE A CB    1 
ATOM   73   C  CG    . PHE A 1 14  ? 20.251 45.021 8.858   1.00  25.59  ? 8    PHE A CG    1 
ATOM   74   C  CD1   . PHE A 1 14  ? 18.866 45.094 8.896   1.00  22.90  ? 8    PHE A CD1   1 
ATOM   75   C  CD2   . PHE A 1 14  ? 20.962 45.226 10.044  1.00  23.59  ? 8    PHE A CD2   1 
ATOM   76   C  CE1   . PHE A 1 14  ? 18.198 45.365 10.089  1.00  23.37  ? 8    PHE A CE1   1 
ATOM   77   C  CE2   . PHE A 1 14  ? 20.297 45.496 11.233  1.00  22.96  ? 8    PHE A CE2   1 
ATOM   78   C  CZ    . PHE A 1 14  ? 18.914 45.564 11.251  1.00  23.77  ? 8    PHE A CZ    1 
ATOM   79   N  N     . ASP A 1 15  ? 21.041 44.165 4.278   1.00  25.64  ? 9    ASP A N     1 
ATOM   80   C  CA    . ASP A 1 15  ? 21.877 43.761 3.139   1.00  24.73  ? 9    ASP A CA    1 
ATOM   81   C  C     . ASP A 1 15  ? 23.388 43.967 3.333   1.00  22.64  ? 9    ASP A C     1 
ATOM   82   O  O     . ASP A 1 15  ? 23.811 45.001 3.842   1.00  19.56  ? 9    ASP A O     1 
ATOM   83   C  CB    . ASP A 1 15  ? 21.417 44.486 1.882   1.00  24.07  ? 9    ASP A CB    1 
ATOM   84   C  CG    . ASP A 1 15  ? 19.985 44.157 1.511   1.00  27.58  ? 9    ASP A CG    1 
ATOM   85   O  OD1   . ASP A 1 15  ? 19.529 43.034 1.802   1.00  27.67  ? 9    ASP A OD1   1 
ATOM   86   O  OD2   . ASP A 1 15  ? 19.311 45.019 0.909   1.00  30.79  ? 9    ASP A OD2   1 
ATOM   87   N  N     . TYR A 1 16  ? 24.178 42.978 2.903   1.00  22.11  ? 10   TYR A N     1 
ATOM   88   C  CA    . TYR A 1 16  ? 25.646 42.981 3.020   1.00  23.76  ? 10   TYR A CA    1 
ATOM   89   C  C     . TYR A 1 16  ? 26.072 43.993 4.064   1.00  23.99  ? 10   TYR A C     1 
ATOM   90   O  O     . TYR A 1 16  ? 26.913 44.856 3.816   1.00  23.42  ? 10   TYR A O     1 
ATOM   91   C  CB    . TYR A 1 16  ? 26.289 43.288 1.660   1.00  25.81  ? 10   TYR A CB    1 
ATOM   92   C  CG    . TYR A 1 16  ? 25.966 44.652 1.079   1.00  29.97  ? 10   TYR A CG    1 
ATOM   93   C  CD1   . TYR A 1 16  ? 26.907 45.682 1.110   1.00  30.39  ? 10   TYR A CD1   1 
ATOM   94   C  CD2   . TYR A 1 16  ? 24.721 44.912 0.496   1.00  30.96  ? 10   TYR A CD2   1 
ATOM   95   C  CE1   . TYR A 1 16  ? 26.622 46.938 0.576   1.00  32.71  ? 10   TYR A CE1   1 
ATOM   96   C  CE2   . TYR A 1 16  ? 24.420 46.168 -0.038  1.00  32.14  ? 10   TYR A CE2   1 
ATOM   97   C  CZ    . TYR A 1 16  ? 25.377 47.174 0.002   1.00  33.61  ? 10   TYR A CZ    1 
ATOM   98   O  OH    . TYR A 1 16  ? 25.097 48.410 -0.542  1.00  32.82  ? 10   TYR A OH    1 
ATOM   99   N  N     . PHE A 1 17  ? 25.499 43.829 5.257   1.00  23.61  ? 11   PHE A N     1 
ATOM   100  C  CA    . PHE A 1 17  ? 25.664 44.757 6.366   1.00  23.05  ? 11   PHE A CA    1 
ATOM   101  C  C     . PHE A 1 17  ? 26.963 45.487 6.676   1.00  22.39  ? 11   PHE A C     1 
ATOM   102  O  O     . PHE A 1 17  ? 26.982 46.708 6.628   1.00  21.29  ? 11   PHE A O     1 
ATOM   103  C  CB    . PHE A 1 17  ? 25.126 44.134 7.664   1.00  22.14  ? 11   PHE A CB    1 
ATOM   104  C  CG    . PHE A 1 17  ? 24.883 45.147 8.749   1.00  21.81  ? 11   PHE A CG    1 
ATOM   105  C  CD1   . PHE A 1 17  ? 24.130 46.295 8.489   1.00  23.03  ? 11   PHE A CD1   1 
ATOM   106  C  CD2   . PHE A 1 17  ? 25.434 44.987 10.006  1.00  20.55  ? 11   PHE A CD2   1 
ATOM   107  C  CE1   . PHE A 1 17  ? 23.942 47.273 9.481   1.00  21.65  ? 11   PHE A CE1   1 
ATOM   108  C  CE2   . PHE A 1 17  ? 25.252 45.953 10.998  1.00  21.03  ? 11   PHE A CE2   1 
ATOM   109  C  CZ    . PHE A 1 17  ? 24.505 47.097 10.734  1.00  17.43  ? 11   PHE A CZ    1 
ATOM   110  N  N     . TYR A 1 18  ? 28.031 44.777 7.030   1.00  23.15  ? 12   TYR A N     1 
ATOM   111  C  CA    . TYR A 1 18  ? 29.274 45.461 7.377   1.00  22.44  ? 12   TYR A CA    1 
ATOM   112  C  C     . TYR A 1 18  ? 29.790 46.360 6.251   1.00  22.68  ? 12   TYR A C     1 
ATOM   113  O  O     . TYR A 1 18  ? 30.228 47.485 6.485   1.00  21.94  ? 12   TYR A O     1 
ATOM   114  C  CB    . TYR A 1 18  ? 30.365 44.451 7.739   1.00  23.04  ? 12   TYR A CB    1 
ATOM   115  C  CG    . TYR A 1 18  ? 30.208 43.755 9.078   1.00  23.87  ? 12   TYR A CG    1 
ATOM   116  C  CD1   . TYR A 1 18  ? 28.989 43.769 9.774   1.00  23.94  ? 12   TYR A CD1   1 
ATOM   117  C  CD2   . TYR A 1 18  ? 31.260 43.009 9.609   1.00  22.78  ? 12   TYR A CD2   1 
ATOM   118  C  CE1   . TYR A 1 18  ? 28.828 43.053 10.953  1.00  22.64  ? 12   TYR A CE1   1 
ATOM   119  C  CE2   . TYR A 1 18  ? 31.109 42.285 10.786  1.00  24.57  ? 12   TYR A CE2   1 
ATOM   120  C  CZ    . TYR A 1 18  ? 29.890 42.310 11.451  1.00  25.64  ? 12   TYR A CZ    1 
ATOM   121  O  OH    . TYR A 1 18  ? 29.738 41.565 12.593  1.00  27.71  ? 12   TYR A OH    1 
ATOM   122  N  N     . ALA A 1 19  ? 29.745 45.858 5.026   1.00  21.87  ? 13   ALA A N     1 
ATOM   123  C  CA    . ALA A 1 19  ? 30.238 46.630 3.908   1.00  22.97  ? 13   ALA A CA    1 
ATOM   124  C  C     . ALA A 1 19  ? 29.300 47.808 3.637   1.00  22.69  ? 13   ALA A C     1 
ATOM   125  O  O     . ALA A 1 19  ? 29.752 48.898 3.273   1.00  22.56  ? 13   ALA A O     1 
ATOM   126  C  CB    . ALA A 1 19  ? 30.366 45.730 2.663   1.00  20.91  ? 13   ALA A CB    1 
ATOM   127  N  N     . GLN A 1 20  ? 28.000 47.600 3.818   1.00  20.95  ? 14   GLN A N     1 
ATOM   128  C  CA    . GLN A 1 20  ? 27.053 48.680 3.572   1.00  23.86  ? 14   GLN A CA    1 
ATOM   129  C  C     . GLN A 1 20  ? 27.219 49.823 4.559   1.00  25.43  ? 14   GLN A C     1 
ATOM   130  O  O     . GLN A 1 20  ? 27.039 50.984 4.185   1.00  26.39  ? 14   GLN A O     1 
ATOM   131  C  CB    . GLN A 1 20  ? 25.603 48.206 3.613   1.00  22.45  ? 14   GLN A CB    1 
ATOM   132  C  CG    . GLN A 1 20  ? 24.690 49.256 3.015   1.00  22.83  ? 14   GLN A CG    1 
ATOM   133  C  CD    . GLN A 1 20  ? 23.233 48.909 3.053   1.00  25.75  ? 14   GLN A CD    1 
ATOM   134  O  OE1   . GLN A 1 20  ? 22.405 49.667 2.553   1.00  28.05  ? 14   GLN A OE1   1 
ATOM   135  N  NE2   . GLN A 1 20  ? 22.898 47.763 3.643   1.00  25.08  ? 14   GLN A NE2   1 
ATOM   136  N  N     . VAL A 1 21  ? 27.543 49.498 5.811   1.00  23.72  ? 15   VAL A N     1 
ATOM   137  C  CA    . VAL A 1 21  ? 27.760 50.525 6.829   1.00  26.24  ? 15   VAL A CA    1 
ATOM   138  C  C     . VAL A 1 21  ? 28.976 51.345 6.411   1.00  27.44  ? 15   VAL A C     1 
ATOM   139  O  O     . VAL A 1 21  ? 28.989 52.568 6.546   1.00  29.02  ? 15   VAL A O     1 
ATOM   140  C  CB    . VAL A 1 21  ? 28.024 49.902 8.231   1.00  27.20  ? 15   VAL A CB    1 
ATOM   141  C  CG1   . VAL A 1 21  ? 28.492 50.977 9.215   1.00  27.62  ? 15   VAL A CG1   1 
ATOM   142  C  CG2   . VAL A 1 21  ? 26.752 49.241 8.756   1.00  24.73  ? 15   VAL A CG2   1 
ATOM   143  N  N     . GLU A 1 22  ? 30.005 50.672 5.905   1.00  27.94  ? 16   GLU A N     1 
ATOM   144  C  CA    . GLU A 1 22  ? 31.205 51.381 5.459   1.00  28.53  ? 16   GLU A CA    1 
ATOM   145  C  C     . GLU A 1 22  ? 30.841 52.323 4.302   1.00  27.82  ? 16   GLU A C     1 
ATOM   146  O  O     . GLU A 1 22  ? 31.379 53.430 4.205   1.00  26.97  ? 16   GLU A O     1 
ATOM   147  C  CB    . GLU A 1 22  ? 32.284 50.388 5.026   1.00  25.53  ? 16   GLU A CB    1 
ATOM   148  C  CG    . GLU A 1 22  ? 32.863 49.587 6.168   1.00  26.09  ? 16   GLU A CG    1 
ATOM   149  C  CD    . GLU A 1 22  ? 33.572 50.440 7.215   1.00  28.07  ? 16   GLU A CD    1 
ATOM   150  O  OE1   . GLU A 1 22  ? 33.702 51.671 7.041   1.00  30.04  ? 16   GLU A OE1   1 
ATOM   151  O  OE2   . GLU A 1 22  ? 34.017 49.874 8.229   1.00  29.65  ? 16   GLU A OE2   1 
ATOM   152  N  N     . GLU A 1 23  ? 29.923 51.882 3.441   1.00  28.65  ? 17   GLU A N     1 
ATOM   153  C  CA    . GLU A 1 23  ? 29.469 52.705 2.321   1.00  29.99  ? 17   GLU A CA    1 
ATOM   154  C  C     . GLU A 1 23  ? 28.713 53.915 2.874   1.00  30.85  ? 17   GLU A C     1 
ATOM   155  O  O     . GLU A 1 23  ? 28.988 55.046 2.482   1.00  29.64  ? 17   GLU A O     1 
ATOM   156  C  CB    . GLU A 1 23  ? 28.555 51.903 1.389   1.00  29.80  ? 17   GLU A CB    1 
ATOM   157  C  CG    . GLU A 1 23  ? 29.288 50.838 0.595   1.00  32.39  ? 17   GLU A CG    1 
ATOM   158  C  CD    . GLU A 1 23  ? 28.428 50.194 -0.472  1.00  33.31  ? 17   GLU A CD    1 
ATOM   159  O  OE1   . GLU A 1 23  ? 29.000 49.505 -1.338  1.00  34.99  ? 17   GLU A OE1   1 
ATOM   160  O  OE2   . GLU A 1 23  ? 27.190 50.366 -0.444  1.00  33.68  ? 17   GLU A OE2   1 
ATOM   161  N  N     . VAL A 1 24  ? 27.775 53.674 3.792   1.00  29.77  ? 18   VAL A N     1 
ATOM   162  C  CA    . VAL A 1 24  ? 27.006 54.758 4.405   1.00  31.03  ? 18   VAL A CA    1 
ATOM   163  C  C     . VAL A 1 24  ? 27.956 55.787 5.030   1.00  32.79  ? 18   VAL A C     1 
ATOM   164  O  O     . VAL A 1 24  ? 27.772 56.992 4.853   1.00  35.79  ? 18   VAL A O     1 
ATOM   165  C  CB    . VAL A 1 24  ? 26.029 54.228 5.497   1.00  30.67  ? 18   VAL A CB    1 
ATOM   166  C  CG1   . VAL A 1 24  ? 25.387 55.399 6.254   1.00  31.60  ? 18   VAL A CG1   1 
ATOM   167  C  CG2   . VAL A 1 24  ? 24.936 53.379 4.853   1.00  29.45  ? 18   VAL A CG2   1 
ATOM   168  N  N     . LEU A 1 25  ? 28.978 55.323 5.744   1.00  32.06  ? 19   LEU A N     1 
ATOM   169  C  CA    . LEU A 1 25  ? 29.944 56.231 6.365   1.00  31.26  ? 19   LEU A CA    1 
ATOM   170  C  C     . LEU A 1 25  ? 30.924 56.898 5.388   1.00  31.35  ? 19   LEU A C     1 
ATOM   171  O  O     . LEU A 1 25  ? 31.671 57.799 5.771   1.00  29.45  ? 19   LEU A O     1 
ATOM   172  C  CB    . LEU A 1 25  ? 30.731 55.498 7.448   1.00  32.28  ? 19   LEU A CB    1 
ATOM   173  C  CG    . LEU A 1 25  ? 30.153 55.551 8.867   1.00  35.10  ? 19   LEU A CG    1 
ATOM   174  C  CD1   . LEU A 1 25  ? 28.659 55.245 8.852   1.00  36.45  ? 19   LEU A CD1   1 
ATOM   175  C  CD2   . LEU A 1 25  ? 30.896 54.567 9.739   1.00  32.79  ? 19   LEU A CD2   1 
ATOM   176  N  N     . ASN A 1 26  ? 30.927 56.451 4.136   1.00  30.79  ? 20   ASN A N     1 
ATOM   177  C  CA    . ASN A 1 26  ? 31.802 57.017 3.114   1.00  30.69  ? 20   ASN A CA    1 
ATOM   178  C  C     . ASN A 1 26  ? 31.141 56.691 1.785   1.00  31.45  ? 20   ASN A C     1 
ATOM   179  O  O     . ASN A 1 26  ? 31.607 55.836 1.028   1.00  30.93  ? 20   ASN A O     1 
ATOM   180  C  CB    . ASN A 1 26  ? 33.190 56.386 3.195   1.00  32.03  ? 20   ASN A CB    1 
ATOM   181  C  CG    . ASN A 1 26  ? 34.139 56.928 2.144   1.00  34.20  ? 20   ASN A CG    1 
ATOM   182  O  OD1   . ASN A 1 26  ? 35.273 56.466 2.020   1.00  35.60  ? 20   ASN A OD1   1 
ATOM   183  N  ND2   . ASN A 1 26  ? 33.679 57.911 1.381   1.00  29.05  ? 20   ASN A ND2   1 
ATOM   184  N  N     . PRO A 1 27  ? 30.040 57.391 1.477   1.00  31.83  ? 21   PRO A N     1 
ATOM   185  C  CA    . PRO A 1 27  ? 29.262 57.201 0.250   1.00  32.31  ? 21   PRO A CA    1 
ATOM   186  C  C     . PRO A 1 27  ? 29.996 57.148 -1.076  1.00  34.37  ? 21   PRO A C     1 
ATOM   187  O  O     . PRO A 1 27  ? 29.481 56.584 -2.044  1.00  36.04  ? 21   PRO A O     1 
ATOM   188  C  CB    . PRO A 1 27  ? 28.216 58.318 0.319   1.00  32.72  ? 21   PRO A CB    1 
ATOM   189  C  CG    . PRO A 1 27  ? 28.870 59.355 1.185   1.00  33.21  ? 21   PRO A CG    1 
ATOM   190  C  CD    . PRO A 1 27  ? 29.535 58.541 2.248   1.00  30.14  ? 21   PRO A CD    1 
ATOM   191  N  N     . SER A 1 28  ? 31.194 57.711 -1.148  1.00  33.61  ? 22   SER A N     1 
ATOM   192  C  CA    . SER A 1 28  ? 31.906 57.650 -2.413  1.00  34.67  ? 22   SER A CA    1 
ATOM   193  C  C     . SER A 1 28  ? 32.203 56.193 -2.746  1.00  35.28  ? 22   SER A C     1 
ATOM   194  O  O     . SER A 1 28  ? 32.444 55.853 -3.903  1.00  35.90  ? 22   SER A O     1 
ATOM   195  C  CB    . SER A 1 28  ? 33.212 58.446 -2.354  1.00  35.27  ? 22   SER A CB    1 
ATOM   196  O  OG    . SER A 1 28  ? 34.193 57.778 -1.585  1.00  39.12  ? 22   SER A OG    1 
ATOM   197  N  N     . LEU A 1 29  ? 32.179 55.331 -1.730  1.00  34.16  ? 23   LEU A N     1 
ATOM   198  C  CA    . LEU A 1 29  ? 32.446 53.906 -1.923  1.00  33.61  ? 23   LEU A CA    1 
ATOM   199  C  C     . LEU A 1 29  ? 31.415 53.137 -2.753  1.00  34.11  ? 23   LEU A C     1 
ATOM   200  O  O     . LEU A 1 29  ? 31.743 52.118 -3.361  1.00  31.97  ? 23   LEU A O     1 
ATOM   201  C  CB    . LEU A 1 29  ? 32.587 53.204 -0.567  1.00  31.64  ? 23   LEU A CB    1 
ATOM   202  C  CG    . LEU A 1 29  ? 33.865 53.473 0.221   1.00  29.98  ? 23   LEU A CG    1 
ATOM   203  C  CD1   . LEU A 1 29  ? 33.846 52.674 1.520   1.00  29.18  ? 23   LEU A CD1   1 
ATOM   204  C  CD2   . LEU A 1 29  ? 35.062 53.091 -0.626  1.00  30.69  ? 23   LEU A CD2   1 
ATOM   205  N  N     . LYS A 1 30  ? 30.174 53.615 -2.766  1.00  36.03  ? 24   LYS A N     1 
ATOM   206  C  CA    . LYS A 1 30  ? 29.099 52.941 -3.488  1.00  36.98  ? 24   LYS A CA    1 
ATOM   207  C  C     . LYS A 1 30  ? 29.391 52.681 -4.956  1.00  37.90  ? 24   LYS A C     1 
ATOM   208  O  O     . LYS A 1 30  ? 29.928 53.532 -5.657  1.00  37.32  ? 24   LYS A O     1 
ATOM   209  C  CB    . LYS A 1 30  ? 27.802 53.735 -3.363  1.00  39.23  ? 24   LYS A CB    1 
ATOM   210  C  CG    . LYS A 1 30  ? 27.262 53.821 -1.942  1.00  42.61  ? 24   LYS A CG    1 
ATOM   211  C  CD    . LYS A 1 30  ? 25.870 54.460 -1.917  1.00  45.50  ? 24   LYS A CD    1 
ATOM   212  C  CE    . LYS A 1 30  ? 24.878 53.725 -2.828  1.00  46.53  ? 24   LYS A CE    1 
ATOM   213  N  NZ    . LYS A 1 30  ? 24.570 52.329 -2.388  1.00  49.70  ? 24   LYS A NZ    1 
ATOM   214  N  N     . GLY A 1 31  ? 29.015 51.496 -5.423  1.00  38.42  ? 25   GLY A N     1 
ATOM   215  C  CA    . GLY A 1 31  ? 29.264 51.160 -6.810  1.00  38.95  ? 25   GLY A CA    1 
ATOM   216  C  C     . GLY A 1 31  ? 30.629 50.521 -6.969  1.00  39.09  ? 25   GLY A C     1 
ATOM   217  O  O     . GLY A 1 31  ? 30.854 49.777 -7.915  1.00  39.78  ? 25   GLY A O     1 
ATOM   218  N  N     . LYS A 1 32  ? 31.547 50.826 -6.054  1.00  38.22  ? 26   LYS A N     1 
ATOM   219  C  CA    . LYS A 1 32  ? 32.888 50.235 -6.091  1.00  36.98  ? 26   LYS A CA    1 
ATOM   220  C  C     . LYS A 1 32  ? 32.857 48.930 -5.299  1.00  35.09  ? 26   LYS A C     1 
ATOM   221  O  O     . LYS A 1 32  ? 32.096 48.802 -4.341  1.00  33.76  ? 26   LYS A O     1 
ATOM   222  C  CB    . LYS A 1 32  ? 33.918 51.152 -5.422  1.00  37.79  ? 26   LYS A CB    1 
ATOM   223  C  CG    . LYS A 1 32  ? 34.194 52.468 -6.117  1.00  40.20  ? 26   LYS A CG    1 
ATOM   224  C  CD    . LYS A 1 32  ? 35.130 53.329 -5.263  1.00  41.93  ? 26   LYS A CD    1 
ATOM   225  C  CE    . LYS A 1 32  ? 35.428 54.654 -5.951  1.00  44.74  ? 26   LYS A CE    1 
ATOM   226  N  NZ    . LYS A 1 32  ? 36.215 55.589 -5.101  1.00  43.68  ? 26   LYS A NZ    1 
ATOM   227  N  N     . PRO A 1 33  ? 33.671 47.936 -5.697  1.00  34.65  ? 27   PRO A N     1 
ATOM   228  C  CA    . PRO A 1 33  ? 33.664 46.679 -4.935  1.00  31.48  ? 27   PRO A CA    1 
ATOM   229  C  C     . PRO A 1 33  ? 34.294 46.961 -3.560  1.00  29.42  ? 27   PRO A C     1 
ATOM   230  O  O     . PRO A 1 33  ? 35.400 47.500 -3.475  1.00  28.09  ? 27   PRO A O     1 
ATOM   231  C  CB    . PRO A 1 33  ? 34.506 45.740 -5.804  1.00  31.68  ? 27   PRO A CB    1 
ATOM   232  C  CG    . PRO A 1 33  ? 35.468 46.688 -6.488  1.00  35.16  ? 27   PRO A CG    1 
ATOM   233  C  CD    . PRO A 1 33  ? 34.581 47.858 -6.857  1.00  32.24  ? 27   PRO A CD    1 
ATOM   234  N  N     . VAL A 1 34  ? 33.578 46.622 -2.493  1.00  26.60  ? 28   VAL A N     1 
ATOM   235  C  CA    . VAL A 1 34  ? 34.071 46.868 -1.138  1.00  24.41  ? 28   VAL A CA    1 
ATOM   236  C  C     . VAL A 1 34  ? 34.241 45.561 -0.374  1.00  22.11  ? 28   VAL A C     1 
ATOM   237  O  O     . VAL A 1 34  ? 33.351 44.724 -0.361  1.00  21.23  ? 28   VAL A O     1 
ATOM   238  C  CB    . VAL A 1 34  ? 33.107 47.801 -0.362  1.00  24.86  ? 28   VAL A CB    1 
ATOM   239  C  CG1   . VAL A 1 34  ? 33.621 48.031 1.057   1.00  24.78  ? 28   VAL A CG1   1 
ATOM   240  C  CG2   . VAL A 1 34  ? 32.975 49.143 -1.092  1.00  25.18  ? 28   VAL A CG2   1 
ATOM   241  N  N     . VAL A 1 35  ? 35.391 45.393 0.265   1.00  22.44  ? 29   VAL A N     1 
ATOM   242  C  CA    . VAL A 1 35  ? 35.675 44.164 1.006   1.00  22.26  ? 29   VAL A CA    1 
ATOM   243  C  C     . VAL A 1 35  ? 36.120 44.457 2.439   1.00  22.83  ? 29   VAL A C     1 
ATOM   244  O  O     . VAL A 1 35  ? 37.177 45.051 2.664   1.00  20.83  ? 29   VAL A O     1 
ATOM   245  C  CB    . VAL A 1 35  ? 36.782 43.339 0.303   1.00  22.67  ? 29   VAL A CB    1 
ATOM   246  C  CG1   . VAL A 1 35  ? 36.847 41.943 0.896   1.00  20.10  ? 29   VAL A CG1   1 
ATOM   247  C  CG2   . VAL A 1 35  ? 36.511 43.265 -1.208  1.00  21.37  ? 29   VAL A CG2   1 
ATOM   248  N  N     . VAL A 1 36  ? 35.298 44.046 3.403   1.00  22.77  ? 30   VAL A N     1 
ATOM   249  C  CA    . VAL A 1 36  ? 35.606 44.263 4.819   1.00  24.82  ? 30   VAL A CA    1 
ATOM   250  C  C     . VAL A 1 36  ? 36.424 43.062 5.287   1.00  23.96  ? 30   VAL A C     1 
ATOM   251  O  O     . VAL A 1 36  ? 35.953 41.930 5.245   1.00  22.99  ? 30   VAL A O     1 
ATOM   252  C  CB    . VAL A 1 36  ? 34.317 44.384 5.667   1.00  23.46  ? 30   VAL A CB    1 
ATOM   253  C  CG1   . VAL A 1 36  ? 34.673 44.509 7.134   1.00  22.81  ? 30   VAL A CG1   1 
ATOM   254  C  CG2   . VAL A 1 36  ? 33.523 45.594 5.224   1.00  25.12  ? 30   VAL A CG2   1 
ATOM   255  N  N     . CYS A 1 37  ? 37.636 43.323 5.756   1.00  25.71  ? 31   CYS A N     1 
ATOM   256  C  CA    . CYS A 1 37  ? 38.544 42.249 6.151   1.00  27.39  ? 31   CYS A CA    1 
ATOM   257  C  C     . CYS A 1 37  ? 38.860 42.103 7.629   1.00  28.49  ? 31   CYS A C     1 
ATOM   258  O  O     . CYS A 1 37  ? 38.755 43.050 8.404   1.00  28.07  ? 31   CYS A O     1 
ATOM   259  C  CB    . CYS A 1 37  ? 39.881 42.418 5.419   1.00  29.74  ? 31   CYS A CB    1 
ATOM   260  S  SG    . CYS A 1 37  ? 39.765 42.763 3.650   1.00  32.05  ? 31   CYS A SG    1 
ATOM   261  N  N     . VAL A 1 38  ? 39.291 40.898 7.988   1.00  27.25  ? 32   VAL A N     1 
ATOM   262  C  CA    . VAL A 1 38  ? 39.698 40.578 9.346   1.00  27.98  ? 32   VAL A CA    1 
ATOM   263  C  C     . VAL A 1 38  ? 41.177 40.227 9.220   1.00  26.63  ? 32   VAL A C     1 
ATOM   264  O  O     . VAL A 1 38  ? 41.515 39.112 8.835   1.00  28.00  ? 32   VAL A O     1 
ATOM   265  C  CB    . VAL A 1 38  ? 38.925 39.353 9.898   1.00  26.48  ? 32   VAL A CB    1 
ATOM   266  C  CG1   . VAL A 1 38  ? 39.346 39.083 11.339  1.00  25.17  ? 32   VAL A CG1   1 
ATOM   267  C  CG2   . VAL A 1 38  ? 37.418 39.604 9.816   1.00  27.24  ? 32   VAL A CG2   1 
ATOM   268  N  N     . PHE A 1 39  ? 42.052 41.182 9.524   1.00  27.86  ? 33   PHE A N     1 
ATOM   269  C  CA    . PHE A 1 39  ? 43.501 40.970 9.413   1.00  31.29  ? 33   PHE A CA    1 
ATOM   270  C  C     . PHE A 1 39  ? 44.109 40.314 10.659  1.00  32.42  ? 33   PHE A C     1 
ATOM   271  O  O     . PHE A 1 39  ? 44.048 40.869 11.750  1.00  33.12  ? 33   PHE A O     1 
ATOM   272  C  CB    . PHE A 1 39  ? 44.219 42.299 9.165   1.00  28.92  ? 33   PHE A CB    1 
ATOM   273  C  CG    . PHE A 1 39  ? 43.802 43.003 7.907   1.00  30.32  ? 33   PHE A CG    1 
ATOM   274  C  CD1   . PHE A 1 39  ? 42.796 43.964 7.933   1.00  27.71  ? 33   PHE A CD1   1 
ATOM   275  C  CD2   . PHE A 1 39  ? 44.434 42.722 6.696   1.00  30.76  ? 33   PHE A CD2   1 
ATOM   276  C  CE1   . PHE A 1 39  ? 42.422 44.643 6.770   1.00  29.26  ? 33   PHE A CE1   1 
ATOM   277  C  CE2   . PHE A 1 39  ? 44.070 43.394 5.526   1.00  31.70  ? 33   PHE A CE2   1 
ATOM   278  C  CZ    . PHE A 1 39  ? 43.060 44.358 5.564   1.00  28.86  ? 33   PHE A CZ    1 
ATOM   279  N  N     . SER A 1 40  ? 44.735 39.156 10.489  1.00  34.94  ? 34   SER A N     1 
ATOM   280  C  CA    . SER A 1 40  ? 45.315 38.448 11.629  1.00  38.20  ? 34   SER A CA    1 
ATOM   281  C  C     . SER A 1 40  ? 46.733 38.850 12.038  1.00  40.49  ? 34   SER A C     1 
ATOM   282  O  O     . SER A 1 40  ? 47.167 38.530 13.135  1.00  42.20  ? 34   SER A O     1 
ATOM   283  C  CB    . SER A 1 40  ? 45.255 36.943 11.384  1.00  37.68  ? 34   SER A CB    1 
ATOM   284  O  OG    . SER A 1 40  ? 45.790 36.617 10.114  1.00  39.78  ? 34   SER A OG    1 
ATOM   285  N  N     . GLY A 1 41  ? 47.461 39.535 11.167  1.00  42.97  ? 35   GLY A N     1 
ATOM   286  C  CA    . GLY A 1 41  ? 48.803 39.966 11.525  1.00  45.55  ? 35   GLY A CA    1 
ATOM   287  C  C     . GLY A 1 41  ? 49.961 38.993 11.341  1.00  46.68  ? 35   GLY A C     1 
ATOM   288  O  O     . GLY A 1 41  ? 51.100 39.347 11.647  1.00  48.22  ? 35   GLY A O     1 
ATOM   289  N  N     . ARG A 1 42  ? 49.697 37.782 10.858  1.00  47.00  ? 36   ARG A N     1 
ATOM   290  C  CA    . ARG A 1 42  ? 50.770 36.809 10.642  1.00  48.53  ? 36   ARG A CA    1 
ATOM   291  C  C     . ARG A 1 42  ? 51.704 37.268 9.525   1.00  49.07  ? 36   ARG A C     1 
ATOM   292  O  O     . ARG A 1 42  ? 52.925 37.116 9.613   1.00  49.69  ? 36   ARG A O     1 
ATOM   293  C  CB    . ARG A 1 42  ? 50.208 35.443 10.263  1.00  50.25  ? 36   ARG A CB    1 
ATOM   294  C  CG    . ARG A 1 42  ? 49.396 34.767 11.337  1.00  53.28  ? 36   ARG A CG    1 
ATOM   295  C  CD    . ARG A 1 42  ? 48.952 33.376 10.879  1.00  55.54  ? 36   ARG A CD    1 
ATOM   296  N  NE    . ARG A 1 42  ? 49.580 32.253 11.585  1.00  56.83  ? 36   ARG A NE    1 
ATOM   297  C  CZ    . ARG A 1 42  ? 50.401 32.344 12.633  1.00  55.87  ? 36   ARG A CZ    1 
ATOM   298  N  NH1   . ARG A 1 42  ? 50.742 33.519 13.147  1.00  55.51  ? 36   ARG A NH1   1 
ATOM   299  N  NH2   . ARG A 1 42  ? 50.875 31.240 13.185  1.00  55.50  ? 36   ARG A NH2   1 
ATOM   300  N  N     . PHE A 1 43  ? 51.119 37.813 8.465   1.00  47.54  ? 37   PHE A N     1 
ATOM   301  C  CA    . PHE A 1 43  ? 51.898 38.300 7.336   1.00  46.97  ? 37   PHE A CA    1 
ATOM   302  C  C     . PHE A 1 43  ? 51.062 39.255 6.491   1.00  48.30  ? 37   PHE A C     1 
ATOM   303  O  O     . PHE A 1 43  ? 49.863 39.405 6.730   1.00  47.95  ? 37   PHE A O     1 
ATOM   304  C  CB    . PHE A 1 43  ? 52.414 37.114 6.497   1.00  44.53  ? 37   PHE A CB    1 
ATOM   305  C  CG    . PHE A 1 43  ? 51.330 36.206 5.971   1.00  41.06  ? 37   PHE A CG    1 
ATOM   306  C  CD1   . PHE A 1 43  ? 50.645 36.525 4.804   1.00  40.09  ? 37   PHE A CD1   1 
ATOM   307  C  CD2   . PHE A 1 43  ? 50.991 35.036 6.647   1.00  39.86  ? 37   PHE A CD2   1 
ATOM   308  C  CE1   . PHE A 1 43  ? 49.641 35.697 4.314   1.00  39.24  ? 37   PHE A CE1   1 
ATOM   309  C  CE2   . PHE A 1 43  ? 49.985 34.197 6.167   1.00  39.50  ? 37   PHE A CE2   1 
ATOM   310  C  CZ    . PHE A 1 43  ? 49.309 34.531 4.996   1.00  39.32  ? 37   PHE A CZ    1 
ATOM   311  N  N     . GLU A 1 44  ? 51.711 39.905 5.523   1.00  49.88  ? 38   GLU A N     1 
ATOM   312  C  CA    . GLU A 1 44  ? 51.070 40.865 4.615   1.00  49.45  ? 38   GLU A CA    1 
ATOM   313  C  C     . GLU A 1 44  ? 49.561 40.990 4.748   1.00  48.20  ? 38   GLU A C     1 
ATOM   314  O  O     . GLU A 1 44  ? 49.059 41.838 5.489   1.00  49.33  ? 38   GLU A O     1 
ATOM   315  C  CB    . GLU A 1 44  ? 51.396 40.524 3.160   1.00  52.24  ? 38   GLU A CB    1 
ATOM   316  C  CG    . GLU A 1 44  ? 52.719 41.075 2.671   1.00  56.67  ? 38   GLU A CG    1 
ATOM   317  C  CD    . GLU A 1 44  ? 52.803 42.578 2.818   1.00  57.83  ? 38   GLU A CD    1 
ATOM   318  O  OE1   . GLU A 1 44  ? 51.884 43.275 2.341   1.00  58.80  ? 38   GLU A OE1   1 
ATOM   319  O  OE2   . GLU A 1 44  ? 53.792 43.060 3.408   1.00  59.28  ? 38   GLU A OE2   1 
ATOM   320  N  N     . ASP A 1 45  ? 48.836 40.153 4.017   1.00  44.25  ? 39   ASP A N     1 
ATOM   321  C  CA    . ASP A 1 45  ? 47.379 40.193 4.070   1.00  39.20  ? 39   ASP A CA    1 
ATOM   322  C  C     . ASP A 1 45  ? 46.798 38.912 4.645   1.00  36.01  ? 39   ASP A C     1 
ATOM   323  O  O     . ASP A 1 45  ? 45.815 38.376 4.119   1.00  34.97  ? 39   ASP A O     1 
ATOM   324  C  CB    . ASP A 1 45  ? 46.801 40.441 2.675   1.00  39.91  ? 39   ASP A CB    1 
ATOM   325  C  CG    . ASP A 1 45  ? 47.114 41.828 2.156   1.00  42.04  ? 39   ASP A CG    1 
ATOM   326  O  OD1   . ASP A 1 45  ? 46.778 42.814 2.850   1.00  41.27  ? 39   ASP A OD1   1 
ATOM   327  O  OD2   . ASP A 1 45  ? 47.694 41.932 1.053   1.00  44.23  ? 39   ASP A OD2   1 
ATOM   328  N  N     . SER A 1 46  ? 47.416 38.410 5.712   1.00  31.69  ? 40   SER A N     1 
ATOM   329  C  CA    . SER A 1 46  ? 46.919 37.201 6.352   1.00  30.98  ? 40   SER A CA    1 
ATOM   330  C  C     . SER A 1 46  ? 45.574 37.586 6.938   1.00  28.11  ? 40   SER A C     1 
ATOM   331  O  O     . SER A 1 46  ? 45.404 38.691 7.446   1.00  26.91  ? 40   SER A O     1 
ATOM   332  C  CB    . SER A 1 46  ? 47.860 36.726 7.472   1.00  29.72  ? 40   SER A CB    1 
ATOM   333  O  OG    . SER A 1 46  ? 47.892 37.650 8.545   1.00  30.22  ? 40   SER A OG    1 
ATOM   334  N  N     . GLY A 1 47  ? 44.617 36.679 6.848   1.00  28.53  ? 41   GLY A N     1 
ATOM   335  C  CA    . GLY A 1 47  ? 43.299 36.966 7.367   1.00  28.57  ? 41   GLY A CA    1 
ATOM   336  C  C     . GLY A 1 47  ? 42.212 36.505 6.424   1.00  29.88  ? 41   GLY A C     1 
ATOM   337  O  O     . GLY A 1 47  ? 42.489 35.890 5.380   1.00  27.95  ? 41   GLY A O     1 
ATOM   338  N  N     . ALA A 1 48  ? 40.970 36.823 6.783   1.00  27.02  ? 42   ALA A N     1 
ATOM   339  C  CA    . ALA A 1 48  ? 39.821 36.429 5.988   1.00  25.69  ? 42   ALA A CA    1 
ATOM   340  C  C     . ALA A 1 48  ? 38.854 37.595 5.749   1.00  25.62  ? 42   ALA A C     1 
ATOM   341  O  O     . ALA A 1 48  ? 38.912 38.634 6.414   1.00  23.66  ? 42   ALA A O     1 
ATOM   342  C  CB    . ALA A 1 48  ? 39.085 35.273 6.690   1.00  25.10  ? 42   ALA A CB    1 
ATOM   343  N  N     . VAL A 1 49  ? 37.963 37.410 4.785   1.00  25.19  ? 43   VAL A N     1 
ATOM   344  C  CA    . VAL A 1 49  ? 36.962 38.415 4.468   1.00  25.51  ? 43   VAL A CA    1 
ATOM   345  C  C     . VAL A 1 49  ? 35.778 38.222 5.424   1.00  24.54  ? 43   VAL A C     1 
ATOM   346  O  O     . VAL A 1 49  ? 35.333 37.097 5.626   1.00  25.05  ? 43   VAL A O     1 
ATOM   347  C  CB    . VAL A 1 49  ? 36.459 38.240 3.014   1.00  25.70  ? 43   VAL A CB    1 
ATOM   348  C  CG1   . VAL A 1 49  ? 35.385 39.282 2.692   1.00  22.82  ? 43   VAL A CG1   1 
ATOM   349  C  CG2   . VAL A 1 49  ? 37.627 38.353 2.056   1.00  24.46  ? 43   VAL A CG2   1 
ATOM   350  N  N     . ALA A 1 50  ? 35.293 39.303 6.028   1.00  24.05  ? 44   ALA A N     1 
ATOM   351  C  CA    . ALA A 1 50  ? 34.140 39.220 6.923   1.00  25.89  ? 44   ALA A CA    1 
ATOM   352  C  C     . ALA A 1 50  ? 32.923 39.262 6.013   1.00  25.57  ? 44   ALA A C     1 
ATOM   353  O  O     . ALA A 1 50  ? 31.949 38.544 6.228   1.00  25.20  ? 44   ALA A O     1 
ATOM   354  C  CB    . ALA A 1 50  ? 34.123 40.404 7.908   1.00  26.39  ? 44   ALA A CB    1 
ATOM   355  N  N     . THR A 1 51  ? 32.989 40.115 4.991   1.00  25.26  ? 45   THR A N     1 
ATOM   356  C  CA    . THR A 1 51  ? 31.920 40.226 3.995   1.00  24.57  ? 45   THR A CA    1 
ATOM   357  C  C     . THR A 1 51  ? 32.287 41.222 2.906   1.00  22.45  ? 45   THR A C     1 
ATOM   358  O  O     . THR A 1 51  ? 33.202 42.022 3.076   1.00  21.87  ? 45   THR A O     1 
ATOM   359  C  CB    . THR A 1 51  ? 30.571 40.678 4.615   1.00  27.16  ? 45   THR A CB    1 
ATOM   360  O  OG1   . THR A 1 51  ? 29.511 40.404 3.691   1.00  27.42  ? 45   THR A OG1   1 
ATOM   361  C  CG2   . THR A 1 51  ? 30.572 42.177 4.893   1.00  25.55  ? 45   THR A CG2   1 
ATOM   362  N  N     . ALA A 1 52  ? 31.563 41.178 1.791   1.00  21.16  ? 46   ALA A N     1 
ATOM   363  C  CA    . ALA A 1 52  ? 31.812 42.113 0.696   1.00  21.24  ? 46   ALA A CA    1 
ATOM   364  C  C     . ALA A 1 52  ? 30.483 42.584 0.099   1.00  21.93  ? 46   ALA A C     1 
ATOM   365  O  O     . ALA A 1 52  ? 29.477 41.890 0.206   1.00  21.28  ? 46   ALA A O     1 
ATOM   366  C  CB    . ALA A 1 52  ? 32.663 41.434 -0.383  1.00  22.86  ? 46   ALA A CB    1 
ATOM   367  N  N     . ASN A 1 53  ? 30.458 43.753 -0.532  1.00  21.76  ? 47   ASN A N     1 
ATOM   368  C  CA    . ASN A 1 53  ? 29.206 44.176 -1.132  1.00  24.67  ? 47   ASN A CA    1 
ATOM   369  C  C     . ASN A 1 53  ? 28.974 43.329 -2.393  1.00  26.35  ? 47   ASN A C     1 
ATOM   370  O  O     . ASN A 1 53  ? 29.838 42.541 -2.790  1.00  24.03  ? 47   ASN A O     1 
ATOM   371  C  CB    . ASN A 1 53  ? 29.211 45.676 -1.459  1.00  25.20  ? 47   ASN A CB    1 
ATOM   372  C  CG    . ASN A 1 53  ? 30.335 46.080 -2.396  1.00  26.36  ? 47   ASN A CG    1 
ATOM   373  O  OD1   . ASN A 1 53  ? 30.943 45.244 -3.069  1.00  23.99  ? 47   ASN A OD1   1 
ATOM   374  N  ND2   . ASN A 1 53  ? 30.600 47.375 -2.459  1.00  24.45  ? 47   ASN A ND2   1 
ATOM   375  N  N     . TYR A 1 54  ? 27.802 43.467 -3.001  1.00  26.73  ? 48   TYR A N     1 
ATOM   376  C  CA    . TYR A 1 54  ? 27.477 42.673 -4.177  1.00  31.36  ? 48   TYR A CA    1 
ATOM   377  C  C     . TYR A 1 54  ? 28.365 42.918 -5.381  1.00  30.39  ? 48   TYR A C     1 
ATOM   378  O  O     . TYR A 1 54  ? 28.532 42.039 -6.216  1.00  32.30  ? 48   TYR A O     1 
ATOM   379  C  CB    . TYR A 1 54  ? 26.002 42.847 -4.553  1.00  33.81  ? 48   TYR A CB    1 
ATOM   380  C  CG    . TYR A 1 54  ? 25.078 42.120 -3.599  1.00  37.25  ? 48   TYR A CG    1 
ATOM   381  C  CD1   . TYR A 1 54  ? 24.811 42.634 -2.331  1.00  38.94  ? 48   TYR A CD1   1 
ATOM   382  C  CD2   . TYR A 1 54  ? 24.524 40.882 -3.938  1.00  40.13  ? 48   TYR A CD2   1 
ATOM   383  C  CE1   . TYR A 1 54  ? 24.023 41.940 -1.419  1.00  41.34  ? 48   TYR A CE1   1 
ATOM   384  C  CE2   . TYR A 1 54  ? 23.726 40.170 -3.032  1.00  42.03  ? 48   TYR A CE2   1 
ATOM   385  C  CZ    . TYR A 1 54  ? 23.481 40.708 -1.771  1.00  44.03  ? 48   TYR A CZ    1 
ATOM   386  O  OH    . TYR A 1 54  ? 22.691 40.026 -0.869  1.00  42.94  ? 48   TYR A OH    1 
ATOM   387  N  N     . GLU A 1 55  ? 28.938 44.109 -5.473  1.00  32.85  ? 49   GLU A N     1 
ATOM   388  C  CA    . GLU A 1 55  ? 29.825 44.420 -6.579  1.00  34.56  ? 49   GLU A CA    1 
ATOM   389  C  C     . GLU A 1 55  ? 30.988 43.420 -6.561  1.00  34.45  ? 49   GLU A C     1 
ATOM   390  O  O     . GLU A 1 55  ? 31.391 42.896 -7.603  1.00  34.41  ? 49   GLU A O     1 
ATOM   391  C  CB    . GLU A 1 55  ? 30.363 45.844 -6.433  1.00  37.66  ? 49   GLU A CB    1 
ATOM   392  C  CG    . GLU A 1 55  ? 29.370 46.958 -6.768  1.00  43.49  ? 49   GLU A CG    1 
ATOM   393  C  CD    . GLU A 1 55  ? 28.072 46.900 -5.966  1.00  45.53  ? 49   GLU A CD    1 
ATOM   394  O  OE1   . GLU A 1 55  ? 28.100 46.492 -4.781  1.00  44.00  ? 49   GLU A OE1   1 
ATOM   395  O  OE2   . GLU A 1 55  ? 27.020 47.288 -6.527  1.00  47.84  ? 49   GLU A OE2   1 
ATOM   396  N  N     . ALA A 1 56  ? 31.510 43.146 -5.367  1.00  29.67  ? 50   ALA A N     1 
ATOM   397  C  CA    . ALA A 1 56  ? 32.620 42.213 -5.218  1.00  29.52  ? 50   ALA A CA    1 
ATOM   398  C  C     . ALA A 1 56  ? 32.187 40.753 -5.287  1.00  28.90  ? 50   ALA A C     1 
ATOM   399  O  O     . ALA A 1 56  ? 32.921 39.911 -5.815  1.00  27.50  ? 50   ALA A O     1 
ATOM   400  C  CB    . ALA A 1 56  ? 33.362 42.485 -3.913  1.00  28.19  ? 50   ALA A CB    1 
ATOM   401  N  N     . ARG A 1 57  ? 30.998 40.449 -4.773  1.00  28.97  ? 51   ARG A N     1 
ATOM   402  C  CA    . ARG A 1 57  ? 30.490 39.080 -4.792  1.00  29.71  ? 51   ARG A CA    1 
ATOM   403  C  C     . ARG A 1 57  ? 30.239 38.543 -6.195  1.00  30.72  ? 51   ARG A C     1 
ATOM   404  O  O     . ARG A 1 57  ? 30.219 37.330 -6.395  1.00  31.90  ? 51   ARG A O     1 
ATOM   405  C  CB    . ARG A 1 57  ? 29.192 38.967 -3.998  1.00  29.90  ? 51   ARG A CB    1 
ATOM   406  C  CG    . ARG A 1 57  ? 29.361 39.056 -2.513  1.00  30.65  ? 51   ARG A CG    1 
ATOM   407  C  CD    . ARG A 1 57  ? 28.033 38.855 -1.806  1.00  28.29  ? 51   ARG A CD    1 
ATOM   408  N  NE    . ARG A 1 57  ? 28.079 39.409 -0.460  1.00  30.18  ? 51   ARG A NE    1 
ATOM   409  C  CZ    . ARG A 1 57  ? 27.059 39.394 0.390   1.00  30.53  ? 51   ARG A CZ    1 
ATOM   410  N  NH1   . ARG A 1 57  ? 25.905 38.844 0.036   1.00  30.19  ? 51   ARG A NH1   1 
ATOM   411  N  NH2   . ARG A 1 57  ? 27.190 39.944 1.590   1.00  30.62  ? 51   ARG A NH2   1 
ATOM   412  N  N     . LYS A 1 58  ? 30.003 39.442 -7.148  1.00  32.76  ? 52   LYS A N     1 
ATOM   413  C  CA    . LYS A 1 58  ? 29.771 39.058 -8.543  1.00  33.81  ? 52   LYS A CA    1 
ATOM   414  C  C     . LYS A 1 58  ? 30.952 38.219 -9.010  1.00  32.49  ? 52   LYS A C     1 
ATOM   415  O  O     . LYS A 1 58  ? 30.799 37.301 -9.817  1.00  33.46  ? 52   LYS A O     1 
ATOM   416  C  CB    . LYS A 1 58  ? 29.738 40.284 -9.472  1.00  35.51  ? 52   LYS A CB    1 
ATOM   417  C  CG    . LYS A 1 58  ? 28.585 41.257 -9.355  1.00  39.82  ? 52   LYS A CG    1 
ATOM   418  C  CD    . LYS A 1 58  ? 28.968 42.554 -10.109 1.00  43.73  ? 52   LYS A CD    1 
ATOM   419  C  CE    . LYS A 1 58  ? 27.819 43.559 -10.190 1.00  45.59  ? 52   LYS A CE    1 
ATOM   420  N  NZ    . LYS A 1 58  ? 28.301 44.915 -10.590 1.00  46.80  ? 52   LYS A NZ    1 
ATOM   421  N  N     . PHE A 1 59  ? 32.133 38.563 -8.508  1.00  30.24  ? 53   PHE A N     1 
ATOM   422  C  CA    . PHE A 1 59  ? 33.361 37.891 -8.908  1.00  29.71  ? 53   PHE A CA    1 
ATOM   423  C  C     . PHE A 1 59  ? 33.918 36.813 -7.983  1.00  30.10  ? 53   PHE A C     1 
ATOM   424  O  O     . PHE A 1 59  ? 35.057 36.362 -8.166  1.00  30.71  ? 53   PHE A O     1 
ATOM   425  C  CB    . PHE A 1 59  ? 34.425 38.949 -9.192  1.00  27.47  ? 53   PHE A CB    1 
ATOM   426  C  CG    . PHE A 1 59  ? 33.976 40.002 -10.175 1.00  29.76  ? 53   PHE A CG    1 
ATOM   427  C  CD1   . PHE A 1 59  ? 33.679 41.291 -9.753  1.00  29.97  ? 53   PHE A CD1   1 
ATOM   428  C  CD2   . PHE A 1 59  ? 33.826 39.695 -11.526 1.00  30.47  ? 53   PHE A CD2   1 
ATOM   429  C  CE1   . PHE A 1 59  ? 33.243 42.252 -10.655 1.00  31.60  ? 53   PHE A CE1   1 
ATOM   430  C  CE2   . PHE A 1 59  ? 33.388 40.653 -12.433 1.00  28.54  ? 53   PHE A CE2   1 
ATOM   431  C  CZ    . PHE A 1 59  ? 33.097 41.930 -12.000 1.00  30.01  ? 53   PHE A CZ    1 
ATOM   432  N  N     . GLY A 1 60  ? 33.125 36.386 -7.003  1.00  29.46  ? 54   GLY A N     1 
ATOM   433  C  CA    . GLY A 1 60  ? 33.579 35.339 -6.104  1.00  29.61  ? 54   GLY A CA    1 
ATOM   434  C  C     . GLY A 1 60  ? 34.143 35.796 -4.767  1.00  30.66  ? 54   GLY A C     1 
ATOM   435  O  O     . GLY A 1 60  ? 34.459 34.973 -3.914  1.00  29.98  ? 54   GLY A O     1 
ATOM   436  N  N     . VAL A 1 61  ? 34.287 37.103 -4.577  1.00  29.82  ? 55   VAL A N     1 
ATOM   437  C  CA    . VAL A 1 61  ? 34.795 37.593 -3.309  1.00  29.29  ? 55   VAL A CA    1 
ATOM   438  C  C     . VAL A 1 61  ? 33.627 37.657 -2.323  1.00  31.02  ? 55   VAL A C     1 
ATOM   439  O  O     . VAL A 1 61  ? 32.738 38.503 -2.425  1.00  28.96  ? 55   VAL A O     1 
ATOM   440  C  CB    . VAL A 1 61  ? 35.457 38.975 -3.470  1.00  28.50  ? 55   VAL A CB    1 
ATOM   441  C  CG1   . VAL A 1 61  ? 35.916 39.499 -2.108  1.00  25.45  ? 55   VAL A CG1   1 
ATOM   442  C  CG2   . VAL A 1 61  ? 36.656 38.859 -4.428  1.00  25.27  ? 55   VAL A CG2   1 
ATOM   443  N  N     . LYS A 1 62  ? 33.639 36.736 -1.373  1.00  32.04  ? 56   LYS A N     1 
ATOM   444  C  CA    . LYS A 1 62  ? 32.589 36.652 -0.382  1.00  33.73  ? 56   LYS A CA    1 
ATOM   445  C  C     . LYS A 1 62  ? 33.152 36.337 0.995   1.00  33.90  ? 56   LYS A C     1 
ATOM   446  O  O     . LYS A 1 62  ? 34.354 36.096 1.158   1.00  33.45  ? 56   LYS A O     1 
ATOM   447  C  CB    . LYS A 1 62  ? 31.598 35.568 -0.784  1.00  33.59  ? 56   LYS A CB    1 
ATOM   448  C  CG    . LYS A 1 62  ? 32.232 34.204 -0.953  1.00  35.77  ? 56   LYS A CG    1 
ATOM   449  C  CD    . LYS A 1 62  ? 31.174 33.160 -1.243  1.00  39.13  ? 56   LYS A CD    1 
ATOM   450  C  CE    . LYS A 1 62  ? 31.740 31.756 -1.147  1.00  39.30  ? 56   LYS A CE    1 
ATOM   451  N  NZ    . LYS A 1 62  ? 32.758 31.518 -2.205  1.00  42.57  ? 56   LYS A NZ    1 
ATOM   452  N  N     . ALA A 1 63  ? 32.261 36.329 1.979   1.00  33.31  ? 57   ALA A N     1 
ATOM   453  C  CA    . ALA A 1 63  ? 32.617 36.046 3.358   1.00  30.85  ? 57   ALA A CA    1 
ATOM   454  C  C     . ALA A 1 63  ? 33.307 34.698 3.475   1.00  32.20  ? 57   ALA A C     1 
ATOM   455  O  O     . ALA A 1 63  ? 32.910 33.725 2.830   1.00  29.53  ? 57   ALA A O     1 
ATOM   456  C  CB    . ALA A 1 63  ? 31.371 36.054 4.211   1.00  30.33  ? 57   ALA A CB    1 
ATOM   457  N  N     . GLY A 1 64  ? 34.345 34.643 4.302   1.00  33.75  ? 58   GLY A N     1 
ATOM   458  C  CA    . GLY A 1 64  ? 35.044 33.388 4.501   1.00  34.24  ? 58   GLY A CA    1 
ATOM   459  C  C     . GLY A 1 64  ? 36.309 33.137 3.702   1.00  35.49  ? 58   GLY A C     1 
ATOM   460  O  O     . GLY A 1 64  ? 37.138 32.362 4.148   1.00  36.24  ? 58   GLY A O     1 
ATOM   461  N  N     . ILE A 1 65  ? 36.490 33.766 2.544   1.00  34.78  ? 59   ILE A N     1 
ATOM   462  C  CA    . ILE A 1 65  ? 37.711 33.517 1.780   1.00  33.72  ? 59   ILE A CA    1 
ATOM   463  C  C     . ILE A 1 65  ? 38.886 34.365 2.257   1.00  33.77  ? 59   ILE A C     1 
ATOM   464  O  O     . ILE A 1 65  ? 38.706 35.458 2.790   1.00  35.29  ? 59   ILE A O     1 
ATOM   465  C  CB    . ILE A 1 65  ? 37.510 33.754 0.262   1.00  33.51  ? 59   ILE A CB    1 
ATOM   466  C  CG1   . ILE A 1 65  ? 37.534 35.244 -0.060  1.00  33.91  ? 59   ILE A CG1   1 
ATOM   467  C  CG2   . ILE A 1 65  ? 36.193 33.148 -0.190  1.00  33.56  ? 59   ILE A CG2   1 
ATOM   468  C  CD1   . ILE A 1 65  ? 37.455 35.523 -1.547  1.00  33.51  ? 59   ILE A CD1   1 
ATOM   469  N  N     . PRO A 1 66  ? 40.114 33.862 2.074   1.00  32.75  ? 60   PRO A N     1 
ATOM   470  C  CA    . PRO A 1 66  ? 41.335 34.562 2.482   1.00  30.66  ? 60   PRO A CA    1 
ATOM   471  C  C     . PRO A 1 66  ? 41.471 35.905 1.772   1.00  30.64  ? 60   PRO A C     1 
ATOM   472  O  O     . PRO A 1 66  ? 41.116 36.042 0.598   1.00  31.18  ? 60   PRO A O     1 
ATOM   473  C  CB    . PRO A 1 66  ? 42.450 33.588 2.077   1.00  30.04  ? 60   PRO A CB    1 
ATOM   474  C  CG    . PRO A 1 66  ? 41.799 32.258 2.166   1.00  29.49  ? 60   PRO A CG    1 
ATOM   475  C  CD    . PRO A 1 66  ? 40.437 32.532 1.532   1.00  32.49  ? 60   PRO A CD    1 
ATOM   476  N  N     . ILE A 1 67  ? 41.991 36.893 2.484   1.00  27.52  ? 61   ILE A N     1 
ATOM   477  C  CA    . ILE A 1 67  ? 42.163 38.211 1.908   1.00  30.33  ? 61   ILE A CA    1 
ATOM   478  C  C     . ILE A 1 67  ? 43.068 38.133 0.673   1.00  32.05  ? 61   ILE A C     1 
ATOM   479  O  O     . ILE A 1 67  ? 42.847 38.835 -0.322  1.00  29.02  ? 61   ILE A O     1 
ATOM   480  C  CB    . ILE A 1 67  ? 42.774 39.172 2.938   1.00  29.14  ? 61   ILE A CB    1 
ATOM   481  C  CG1   . ILE A 1 67  ? 41.828 39.297 4.141   1.00  28.46  ? 61   ILE A CG1   1 
ATOM   482  C  CG2   . ILE A 1 67  ? 43.052 40.527 2.287   1.00  27.53  ? 61   ILE A CG2   1 
ATOM   483  C  CD1   . ILE A 1 67  ? 42.399 40.085 5.303   1.00  26.14  ? 61   ILE A CD1   1 
ATOM   484  N  N     . VAL A 1 68  ? 44.075 37.266 0.748   1.00  32.71  ? 62   VAL A N     1 
ATOM   485  C  CA    . VAL A 1 68  ? 45.026 37.081 -0.344  1.00  34.82  ? 62   VAL A CA    1 
ATOM   486  C  C     . VAL A 1 68  ? 44.334 36.536 -1.596  1.00  33.74  ? 62   VAL A C     1 
ATOM   487  O  O     . VAL A 1 68  ? 44.658 36.939 -2.710  1.00  32.91  ? 62   VAL A O     1 
ATOM   488  C  CB    . VAL A 1 68  ? 46.184 36.122 0.076   1.00  35.73  ? 62   VAL A CB    1 
ATOM   489  C  CG1   . VAL A 1 68  ? 47.138 35.902 -1.091  1.00  38.92  ? 62   VAL A CG1   1 
ATOM   490  C  CG2   . VAL A 1 68  ? 46.954 36.718 1.249   1.00  35.96  ? 62   VAL A CG2   1 
ATOM   491  N  N     . GLU A 1 69  ? 43.390 35.617 -1.413  1.00  34.43  ? 63   GLU A N     1 
ATOM   492  C  CA    . GLU A 1 69  ? 42.670 35.066 -2.551  1.00  35.25  ? 63   GLU A CA    1 
ATOM   493  C  C     . GLU A 1 69  ? 41.752 36.142 -3.114  1.00  34.50  ? 63   GLU A C     1 
ATOM   494  O  O     . GLU A 1 69  ? 41.550 36.223 -4.322  1.00  34.36  ? 63   GLU A O     1 
ATOM   495  C  CB    . GLU A 1 69  ? 41.849 33.840 -2.149  1.00  36.34  ? 63   GLU A CB    1 
ATOM   496  C  CG    . GLU A 1 69  ? 42.680 32.636 -1.712  1.00  43.74  ? 63   GLU A CG    1 
ATOM   497  C  CD    . GLU A 1 69  ? 43.662 32.148 -2.775  1.00  45.52  ? 63   GLU A CD    1 
ATOM   498  O  OE1   . GLU A 1 69  ? 44.406 31.184 -2.487  1.00  49.32  ? 63   GLU A OE1   1 
ATOM   499  O  OE2   . GLU A 1 69  ? 43.689 32.716 -3.892  1.00  48.08  ? 63   GLU A OE2   1 
ATOM   500  N  N     . ALA A 1 70  ? 41.211 36.977 -2.232  1.00  33.11  ? 64   ALA A N     1 
ATOM   501  C  CA    . ALA A 1 70  ? 40.329 38.065 -2.649  1.00  31.03  ? 64   ALA A CA    1 
ATOM   502  C  C     . ALA A 1 70  ? 41.086 39.063 -3.524  1.00  30.42  ? 64   ALA A C     1 
ATOM   503  O  O     . ALA A 1 70  ? 40.609 39.449 -4.594  1.00  28.14  ? 64   ALA A O     1 
ATOM   504  C  CB    . ALA A 1 70  ? 39.755 38.775 -1.427  1.00  28.05  ? 64   ALA A CB    1 
ATOM   505  N  N     . LYS A 1 71  ? 42.268 39.471 -3.070  1.00  29.97  ? 65   LYS A N     1 
ATOM   506  C  CA    . LYS A 1 71  ? 43.079 40.430 -3.808  1.00  32.19  ? 65   LYS A CA    1 
ATOM   507  C  C     . LYS A 1 71  ? 43.592 39.918 -5.154  1.00  33.49  ? 65   LYS A C     1 
ATOM   508  O  O     . LYS A 1 71  ? 43.877 40.708 -6.055  1.00  34.20  ? 65   LYS A O     1 
ATOM   509  C  CB    . LYS A 1 71  ? 44.251 40.905 -2.948  1.00  30.88  ? 65   LYS A CB    1 
ATOM   510  C  CG    . LYS A 1 71  ? 43.836 41.892 -1.869  1.00  32.73  ? 65   LYS A CG    1 
ATOM   511  C  CD    . LYS A 1 71  ? 45.032 42.419 -1.087  1.00  33.12  ? 65   LYS A CD    1 
ATOM   512  C  CE    . LYS A 1 71  ? 44.608 43.519 -0.143  1.00  32.75  ? 65   LYS A CE    1 
ATOM   513  N  NZ    . LYS A 1 71  ? 45.767 44.110 0.575   1.00  35.35  ? 65   LYS A NZ    1 
ATOM   514  N  N     . LYS A 1 72  ? 43.726 38.603 -5.285  1.00  35.42  ? 66   LYS A N     1 
ATOM   515  C  CA    . LYS A 1 72  ? 44.174 38.013 -6.538  1.00  36.35  ? 66   LYS A CA    1 
ATOM   516  C  C     . LYS A 1 72  ? 43.042 38.231 -7.552  1.00  36.31  ? 66   LYS A C     1 
ATOM   517  O  O     . LYS A 1 72  ? 43.282 38.565 -8.714  1.00  35.66  ? 66   LYS A O     1 
ATOM   518  C  CB    . LYS A 1 72  ? 44.446 36.510 -6.354  1.00  38.84  ? 66   LYS A CB    1 
ATOM   519  C  CG    . LYS A 1 72  ? 45.924 36.128 -6.195  1.00  42.19  ? 66   LYS A CG    1 
ATOM   520  C  CD    . LYS A 1 72  ? 46.073 34.688 -5.685  1.00  45.47  ? 66   LYS A CD    1 
ATOM   521  C  CE    . LYS A 1 72  ? 47.502 34.135 -5.844  1.00  47.71  ? 66   LYS A CE    1 
ATOM   522  N  NZ    . LYS A 1 72  ? 47.787 33.545 -7.201  1.00  45.12  ? 66   LYS A NZ    1 
ATOM   523  N  N     . ILE A 1 73  ? 41.804 38.068 -7.093  1.00  33.28  ? 67   ILE A N     1 
ATOM   524  C  CA    . ILE A 1 73  ? 40.643 38.244 -7.956  1.00  31.06  ? 67   ILE A CA    1 
ATOM   525  C  C     . ILE A 1 73  ? 40.338 39.717 -8.249  1.00  32.46  ? 67   ILE A C     1 
ATOM   526  O  O     . ILE A 1 73  ? 40.149 40.103 -9.403  1.00  31.15  ? 67   ILE A O     1 
ATOM   527  C  CB    . ILE A 1 73  ? 39.402 37.603 -7.322  1.00  30.86  ? 67   ILE A CB    1 
ATOM   528  C  CG1   . ILE A 1 73  ? 39.625 36.096 -7.167  1.00  29.07  ? 67   ILE A CG1   1 
ATOM   529  C  CG2   . ILE A 1 73  ? 38.172 37.917 -8.153  1.00  28.90  ? 67   ILE A CG2   1 
ATOM   530  C  CD1   . ILE A 1 73  ? 38.537 35.385 -6.396  1.00  31.53  ? 67   ILE A CD1   1 
ATOM   531  N  N     . LEU A 1 74  ? 40.288 40.536 -7.204  1.00  30.33  ? 68   LEU A N     1 
ATOM   532  C  CA    . LEU A 1 74  ? 39.986 41.950 -7.358  1.00  31.76  ? 68   LEU A CA    1 
ATOM   533  C  C     . LEU A 1 74  ? 41.054 42.816 -6.720  1.00  33.29  ? 68   LEU A C     1 
ATOM   534  O  O     . LEU A 1 74  ? 40.818 43.419 -5.672  1.00  32.45  ? 68   LEU A O     1 
ATOM   535  C  CB    . LEU A 1 74  ? 38.649 42.292 -6.701  1.00  31.75  ? 68   LEU A CB    1 
ATOM   536  C  CG    . LEU A 1 74  ? 37.366 41.612 -7.177  1.00  32.48  ? 68   LEU A CG    1 
ATOM   537  C  CD1   . LEU A 1 74  ? 36.204 42.147 -6.343  1.00  30.16  ? 68   LEU A CD1   1 
ATOM   538  C  CD2   . LEU A 1 74  ? 37.139 41.899 -8.675  1.00  31.26  ? 68   LEU A CD2   1 
ATOM   539  N  N     . PRO A 1 75  ? 42.236 42.912 -7.347  1.00  33.52  ? 69   PRO A N     1 
ATOM   540  C  CA    . PRO A 1 75  ? 43.306 43.733 -6.778  1.00  34.29  ? 69   PRO A CA    1 
ATOM   541  C  C     . PRO A 1 75  ? 43.011 45.223 -6.595  1.00  34.74  ? 69   PRO A C     1 
ATOM   542  O  O     . PRO A 1 75  ? 43.653 45.882 -5.770  1.00  33.62  ? 69   PRO A O     1 
ATOM   543  C  CB    . PRO A 1 75  ? 44.488 43.475 -7.724  1.00  35.95  ? 69   PRO A CB    1 
ATOM   544  C  CG    . PRO A 1 75  ? 43.831 43.058 -9.017  1.00  35.41  ? 69   PRO A CG    1 
ATOM   545  C  CD    . PRO A 1 75  ? 42.704 42.183 -8.541  1.00  35.66  ? 69   PRO A CD    1 
ATOM   546  N  N     . ASN A 1 76  ? 42.053 45.766 -7.344  1.00  34.05  ? 70   ASN A N     1 
ATOM   547  C  CA    . ASN A 1 76  ? 41.738 47.189 -7.213  1.00  34.41  ? 70   ASN A CA    1 
ATOM   548  C  C     . ASN A 1 76  ? 40.493 47.479 -6.375  1.00  33.17  ? 70   ASN A C     1 
ATOM   549  O  O     . ASN A 1 76  ? 39.997 48.604 -6.352  1.00  31.57  ? 70   ASN A O     1 
ATOM   550  C  CB    . ASN A 1 76  ? 41.592 47.846 -8.593  1.00  35.29  ? 70   ASN A CB    1 
ATOM   551  C  CG    . ASN A 1 76  ? 42.847 47.712 -9.437  1.00  36.51  ? 70   ASN A CG    1 
ATOM   552  O  OD1   . ASN A 1 76  ? 43.944 48.060 -9.004  1.00  38.80  ? 70   ASN A OD1   1 
ATOM   553  N  ND2   . ASN A 1 76  ? 42.688 47.203 -10.652 1.00  36.24  ? 70   ASN A ND2   1 
ATOM   554  N  N     . ALA A 1 77  ? 39.977 46.466 -5.694  1.00  32.44  ? 71   ALA A N     1 
ATOM   555  C  CA    . ALA A 1 77  ? 38.819 46.676 -4.837  1.00  30.60  ? 71   ALA A CA    1 
ATOM   556  C  C     . ALA A 1 77  ? 39.258 47.520 -3.638  1.00  29.05  ? 71   ALA A C     1 
ATOM   557  O  O     . ALA A 1 77  ? 40.447 47.782 -3.458  1.00  28.07  ? 71   ALA A O     1 
ATOM   558  C  CB    . ALA A 1 77  ? 38.279 45.343 -4.361  1.00  29.77  ? 71   ALA A CB    1 
ATOM   559  N  N     . VAL A 1 78  ? 38.294 47.954 -2.829  1.00  29.87  ? 72   VAL A N     1 
ATOM   560  C  CA    . VAL A 1 78  ? 38.592 48.746 -1.635  1.00  26.82  ? 72   VAL A CA    1 
ATOM   561  C  C     . VAL A 1 78  ? 38.579 47.772 -0.461  1.00  26.98  ? 72   VAL A C     1 
ATOM   562  O  O     . VAL A 1 78  ? 37.560 47.130 -0.196  1.00  24.00  ? 72   VAL A O     1 
ATOM   563  C  CB    . VAL A 1 78  ? 37.518 49.817 -1.381  1.00  27.68  ? 72   VAL A CB    1 
ATOM   564  C  CG1   . VAL A 1 78  ? 37.764 50.497 -0.035  1.00  26.09  ? 72   VAL A CG1   1 
ATOM   565  C  CG2   . VAL A 1 78  ? 37.521 50.837 -2.506  1.00  28.55  ? 72   VAL A CG2   1 
ATOM   566  N  N     . TYR A 1 79  ? 39.711 47.661 0.228   1.00  27.35  ? 73   TYR A N     1 
ATOM   567  C  CA    . TYR A 1 79  ? 39.844 46.755 1.369   1.00  28.01  ? 73   TYR A CA    1 
ATOM   568  C  C     . TYR A 1 79  ? 39.922 47.537 2.670   1.00  28.72  ? 73   TYR A C     1 
ATOM   569  O  O     . TYR A 1 79  ? 40.835 48.334 2.864   1.00  30.43  ? 73   TYR A O     1 
ATOM   570  C  CB    . TYR A 1 79  ? 41.088 45.876 1.203   1.00  26.10  ? 73   TYR A CB    1 
ATOM   571  C  CG    . TYR A 1 79  ? 40.958 44.914 0.052   1.00  27.71  ? 73   TYR A CG    1 
ATOM   572  C  CD1   . TYR A 1 79  ? 41.339 45.278 -1.241  1.00  25.05  ? 73   TYR A CD1   1 
ATOM   573  C  CD2   . TYR A 1 79  ? 40.385 43.660 0.240   1.00  22.93  ? 73   TYR A CD2   1 
ATOM   574  C  CE1   . TYR A 1 79  ? 41.145 44.408 -2.319  1.00  23.58  ? 73   TYR A CE1   1 
ATOM   575  C  CE2   . TYR A 1 79  ? 40.187 42.795 -0.827  1.00  23.81  ? 73   TYR A CE2   1 
ATOM   576  C  CZ    . TYR A 1 79  ? 40.565 43.173 -2.100  1.00  23.16  ? 73   TYR A CZ    1 
ATOM   577  O  OH    . TYR A 1 79  ? 40.321 42.322 -3.154  1.00  22.34  ? 73   TYR A OH    1 
ATOM   578  N  N     . LEU A 1 80  ? 38.959 47.293 3.555   1.00  27.31  ? 74   LEU A N     1 
ATOM   579  C  CA    . LEU A 1 80  ? 38.864 47.993 4.836   1.00  26.04  ? 74   LEU A CA    1 
ATOM   580  C  C     . LEU A 1 80  ? 38.836 47.040 6.021   1.00  25.76  ? 74   LEU A C     1 
ATOM   581  O  O     . LEU A 1 80  ? 38.214 45.975 5.962   1.00  24.71  ? 74   LEU A O     1 
ATOM   582  C  CB    . LEU A 1 80  ? 37.576 48.808 4.882   1.00  26.63  ? 74   LEU A CB    1 
ATOM   583  C  CG    . LEU A 1 80  ? 37.151 49.520 3.600   1.00  27.03  ? 74   LEU A CG    1 
ATOM   584  C  CD1   . LEU A 1 80  ? 35.705 49.974 3.751   1.00  28.85  ? 74   LEU A CD1   1 
ATOM   585  C  CD2   . LEU A 1 80  ? 38.072 50.701 3.328   1.00  25.68  ? 74   LEU A CD2   1 
ATOM   586  N  N     . PRO A 1 81  ? 39.478 47.428 7.132   1.00  25.09  ? 75   PRO A N     1 
ATOM   587  C  CA    . PRO A 1 81  ? 39.489 46.564 8.314   1.00  26.75  ? 75   PRO A CA    1 
ATOM   588  C  C     . PRO A 1 81  ? 38.127 46.544 8.996   1.00  26.44  ? 75   PRO A C     1 
ATOM   589  O  O     . PRO A 1 81  ? 37.443 47.565 9.068   1.00  26.83  ? 75   PRO A O     1 
ATOM   590  C  CB    . PRO A 1 81  ? 40.561 47.197 9.195   1.00  27.21  ? 75   PRO A CB    1 
ATOM   591  C  CG    . PRO A 1 81  ? 40.409 48.657 8.888   1.00  29.91  ? 75   PRO A CG    1 
ATOM   592  C  CD    . PRO A 1 81  ? 40.272 48.648 7.363   1.00  26.68  ? 75   PRO A CD    1 
ATOM   593  N  N     . MET A 1 82  ? 37.729 45.377 9.484   1.00  25.96  ? 76   MET A N     1 
ATOM   594  C  CA    . MET A 1 82  ? 36.449 45.255 10.176  1.00  26.41  ? 76   MET A CA    1 
ATOM   595  C  C     . MET A 1 82  ? 36.356 46.176 11.406  1.00  25.21  ? 76   MET A C     1 
ATOM   596  O  O     . MET A 1 82  ? 37.260 46.184 12.244  1.00  22.43  ? 76   MET A O     1 
ATOM   597  C  CB    . MET A 1 82  ? 36.241 43.807 10.618  1.00  26.59  ? 76   MET A CB    1 
ATOM   598  C  CG    . MET A 1 82  ? 35.162 43.646 11.664  1.00  30.42  ? 76   MET A CG    1 
ATOM   599  S  SD    . MET A 1 82  ? 34.704 41.946 11.915  1.00  29.48  ? 76   MET A SD    1 
ATOM   600  C  CE    . MET A 1 82  ? 35.858 41.429 13.186  1.00  30.61  ? 76   MET A CE    1 
ATOM   601  N  N     . ARG A 1 83  ? 35.276 46.955 11.494  1.00  24.75  ? 77   ARG A N     1 
ATOM   602  C  CA    . ARG A 1 83  ? 35.031 47.849 12.642  1.00  26.55  ? 77   ARG A CA    1 
ATOM   603  C  C     . ARG A 1 83  ? 33.680 47.470 13.263  1.00  24.74  ? 77   ARG A C     1 
ATOM   604  O  O     . ARG A 1 83  ? 32.719 48.215 13.158  1.00  23.71  ? 77   ARG A O     1 
ATOM   605  C  CB    . ARG A 1 83  ? 34.989 49.317 12.199  1.00  27.03  ? 77   ARG A CB    1 
ATOM   606  C  CG    . ARG A 1 83  ? 36.326 49.878 11.750  1.00  28.51  ? 77   ARG A CG    1 
ATOM   607  C  CD    . ARG A 1 83  ? 36.258 51.397 11.598  1.00  28.27  ? 77   ARG A CD    1 
ATOM   608  N  NE    . ARG A 1 83  ? 35.386 51.823 10.509  1.00  29.54  ? 77   ARG A NE    1 
ATOM   609  C  CZ    . ARG A 1 83  ? 35.070 53.094 10.260  1.00  30.92  ? 77   ARG A CZ    1 
ATOM   610  N  NH1   . ARG A 1 83  ? 35.553 54.058 11.031  1.00  29.60  ? 77   ARG A NH1   1 
ATOM   611  N  NH2   . ARG A 1 83  ? 34.291 53.406 9.228   1.00  30.69  ? 77   ARG A NH2   1 
ATOM   612  N  N     . LYS A 1 84  ? 33.633 46.316 13.920  1.00  26.43  ? 78   LYS A N     1 
ATOM   613  C  CA    . LYS A 1 84  ? 32.409 45.782 14.513  1.00  28.64  ? 78   LYS A CA    1 
ATOM   614  C  C     . LYS A 1 84  ? 31.663 46.689 15.493  1.00  29.34  ? 78   LYS A C     1 
ATOM   615  O  O     . LYS A 1 84  ? 30.429 46.703 15.501  1.00  26.90  ? 78   LYS A O     1 
ATOM   616  C  CB    . LYS A 1 84  ? 32.699 44.420 15.162  1.00  31.36  ? 78   LYS A CB    1 
ATOM   617  C  CG    . LYS A 1 84  ? 31.427 43.634 15.465  1.00  35.47  ? 78   LYS A CG    1 
ATOM   618  C  CD    . LYS A 1 84  ? 31.680 42.145 15.613  1.00  37.84  ? 78   LYS A CD    1 
ATOM   619  C  CE    . LYS A 1 84  ? 30.367 41.391 15.815  1.00  38.25  ? 78   LYS A CE    1 
ATOM   620  N  NZ    . LYS A 1 84  ? 30.567 39.903 15.826  1.00  42.31  ? 78   LYS A NZ    1 
ATOM   621  N  N     . GLU A 1 85  ? 32.403 47.425 16.323  1.00  32.25  ? 79   GLU A N     1 
ATOM   622  C  CA    . GLU A 1 85  ? 31.804 48.361 17.278  1.00  33.96  ? 79   GLU A CA    1 
ATOM   623  C  C     . GLU A 1 85  ? 30.860 49.302 16.541  1.00  33.72  ? 79   GLU A C     1 
ATOM   624  O  O     . GLU A 1 85  ? 29.705 49.496 16.944  1.00  31.27  ? 79   GLU A O     1 
ATOM   625  C  CB    . GLU A 1 85  ? 32.887 49.207 17.948  1.00  39.49  ? 79   GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 85  ? 33.253 48.793 19.363  1.00  49.24  ? 79   GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 85  ? 33.912 47.441 19.434  1.00  54.69  ? 79   GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 85  ? 33.351 46.550 20.107  1.00  60.46  ? 79   GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 85  ? 34.990 47.269 18.822  1.00  59.50  ? 79   GLU A OE2   1 
ATOM   630  N  N     . VAL A 1 86  ? 31.370 49.884 15.455  1.00  30.41  ? 80   VAL A N     1 
ATOM   631  C  CA    . VAL A 1 86  ? 30.604 50.814 14.640  1.00  28.70  ? 80   VAL A CA    1 
ATOM   632  C  C     . VAL A 1 86  ? 29.365 50.153 14.051  1.00  28.97  ? 80   VAL A C     1 
ATOM   633  O  O     . VAL A 1 86  ? 28.268 50.702 14.135  1.00  28.91  ? 80   VAL A O     1 
ATOM   634  C  CB    . VAL A 1 86  ? 31.457 51.383 13.474  1.00  30.00  ? 80   VAL A CB    1 
ATOM   635  C  CG1   . VAL A 1 86  ? 30.620 52.354 12.643  1.00  27.82  ? 80   VAL A CG1   1 
ATOM   636  C  CG2   . VAL A 1 86  ? 32.695 52.088 14.026  1.00  25.06  ? 80   VAL A CG2   1 
ATOM   637  N  N     . TYR A 1 87  ? 29.537 48.975 13.455  1.00  27.42  ? 81   TYR A N     1 
ATOM   638  C  CA    . TYR A 1 87  ? 28.412 48.270 12.854  1.00  25.15  ? 81   TYR A CA    1 
ATOM   639  C  C     . TYR A 1 87  ? 27.364 47.919 13.914  1.00  25.33  ? 81   TYR A C     1 
ATOM   640  O  O     . TYR A 1 87  ? 26.161 47.947 13.648  1.00  25.74  ? 81   TYR A O     1 
ATOM   641  C  CB    . TYR A 1 87  ? 28.875 46.971 12.165  1.00  26.36  ? 81   TYR A CB    1 
ATOM   642  C  CG    . TYR A 1 87  ? 30.122 47.097 11.304  1.00  25.51  ? 81   TYR A CG    1 
ATOM   643  C  CD1   . TYR A 1 87  ? 30.343 48.226 10.516  1.00  24.23  ? 81   TYR A CD1   1 
ATOM   644  C  CD2   . TYR A 1 87  ? 31.094 46.097 11.311  1.00  23.50  ? 81   TYR A CD2   1 
ATOM   645  C  CE1   . TYR A 1 87  ? 31.502 48.363 9.770   1.00  26.10  ? 81   TYR A CE1   1 
ATOM   646  C  CE2   . TYR A 1 87  ? 32.261 46.218 10.562  1.00  24.23  ? 81   TYR A CE2   1 
ATOM   647  C  CZ    . TYR A 1 87  ? 32.459 47.352 9.801   1.00  25.32  ? 81   TYR A CZ    1 
ATOM   648  O  OH    . TYR A 1 87  ? 33.615 47.491 9.086   1.00  26.32  ? 81   TYR A OH    1 
ATOM   649  N  N     . GLN A 1 88  ? 27.824 47.569 15.109  1.00  24.65  ? 82   GLN A N     1 
ATOM   650  C  CA    . GLN A 1 88  ? 26.915 47.197 16.185  1.00  27.70  ? 82   GLN A CA    1 
ATOM   651  C  C     . GLN A 1 88  ? 26.059 48.382 16.633  1.00  28.03  ? 82   GLN A C     1 
ATOM   652  O  O     . GLN A 1 88  ? 24.850 48.239 16.859  1.00  27.17  ? 82   GLN A O     1 
ATOM   653  C  CB    . GLN A 1 88  ? 27.708 46.623 17.361  1.00  28.17  ? 82   GLN A CB    1 
ATOM   654  C  CG    . GLN A 1 88  ? 26.885 46.386 18.621  1.00  33.58  ? 82   GLN A CG    1 
ATOM   655  C  CD    . GLN A 1 88  ? 25.762 45.372 18.428  1.00  32.79  ? 82   GLN A CD    1 
ATOM   656  O  OE1   . GLN A 1 88  ? 26.012 44.201 18.162  1.00  33.03  ? 82   GLN A OE1   1 
ATOM   657  N  NE2   . GLN A 1 88  ? 24.518 45.828 18.559  1.00  32.20  ? 82   GLN A NE2   1 
ATOM   658  N  N     . GLN A 1 89  ? 26.668 49.559 16.740  1.00  27.89  ? 83   GLN A N     1 
ATOM   659  C  CA    . GLN A 1 89  ? 25.908 50.738 17.136  1.00  29.65  ? 83   GLN A CA    1 
ATOM   660  C  C     . GLN A 1 89  ? 24.904 51.141 16.053  1.00  30.31  ? 83   GLN A C     1 
ATOM   661  O  O     . GLN A 1 89  ? 23.793 51.577 16.367  1.00  28.60  ? 83   GLN A O     1 
ATOM   662  C  CB    . GLN A 1 89  ? 26.852 51.891 17.489  1.00  32.80  ? 83   GLN A CB    1 
ATOM   663  C  CG    . GLN A 1 89  ? 27.385 51.758 18.914  1.00  37.66  ? 83   GLN A CG    1 
ATOM   664  C  CD    . GLN A 1 89  ? 28.328 52.871 19.317  1.00  42.08  ? 83   GLN A CD    1 
ATOM   665  O  OE1   . GLN A 1 89  ? 28.093 54.044 19.017  1.00  42.11  ? 83   GLN A OE1   1 
ATOM   666  N  NE2   . GLN A 1 89  ? 29.400 52.509 20.019  1.00  42.66  ? 83   GLN A NE2   1 
ATOM   667  N  N     . VAL A 1 90  ? 25.269 50.986 14.781  1.00  27.99  ? 84   VAL A N     1 
ATOM   668  C  CA    . VAL A 1 90  ? 24.323 51.315 13.721  1.00  27.14  ? 84   VAL A CA    1 
ATOM   669  C  C     . VAL A 1 90  ? 23.183 50.293 13.796  1.00  26.61  ? 84   VAL A C     1 
ATOM   670  O  O     . VAL A 1 90  ? 22.017 50.629 13.601  1.00  26.01  ? 84   VAL A O     1 
ATOM   671  C  CB    . VAL A 1 90  ? 24.961 51.243 12.308  1.00  25.72  ? 84   VAL A CB    1 
ATOM   672  C  CG1   . VAL A 1 90  ? 23.888 51.378 11.259  1.00  24.23  ? 84   VAL A CG1   1 
ATOM   673  C  CG2   . VAL A 1 90  ? 25.987 52.356 12.127  1.00  26.60  ? 84   VAL A CG2   1 
ATOM   674  N  N     . SER A 1 91  ? 23.531 49.041 14.078  1.00  26.47  ? 85   SER A N     1 
ATOM   675  C  CA    . SER A 1 91  ? 22.536 47.977 14.183  1.00  25.60  ? 85   SER A CA    1 
ATOM   676  C  C     . SER A 1 91  ? 21.542 48.273 15.314  1.00  26.90  ? 85   SER A C     1 
ATOM   677  O  O     . SER A 1 91  ? 20.327 48.155 15.139  1.00  27.86  ? 85   SER A O     1 
ATOM   678  C  CB    . SER A 1 91  ? 23.232 46.635 14.444  1.00  25.53  ? 85   SER A CB    1 
ATOM   679  O  OG    . SER A 1 91  ? 22.294 45.615 14.749  1.00  23.51  ? 85   SER A OG    1 
ATOM   680  N  N     . SER A 1 92  ? 22.064 48.652 16.473  1.00  27.63  ? 86   SER A N     1 
ATOM   681  C  CA    . SER A 1 92  ? 21.219 48.954 17.623  1.00  31.50  ? 86   SER A CA    1 
ATOM   682  C  C     . SER A 1 92  ? 20.143 49.981 17.288  1.00  32.05  ? 86   SER A C     1 
ATOM   683  O  O     . SER A 1 92  ? 18.980 49.815 17.661  1.00  32.51  ? 86   SER A O     1 
ATOM   684  C  CB    . SER A 1 92  ? 22.069 49.473 18.775  1.00  31.36  ? 86   SER A CB    1 
ATOM   685  O  OG    . SER A 1 92  ? 22.953 48.468 19.219  1.00  35.70  ? 86   SER A OG    1 
ATOM   686  N  N     . ARG A 1 93  ? 20.538 51.040 16.586  1.00  31.46  ? 87   ARG A N     1 
ATOM   687  C  CA    . ARG A 1 93  ? 19.601 52.085 16.204  1.00  32.82  ? 87   ARG A CA    1 
ATOM   688  C  C     . ARG A 1 93  ? 18.534 51.536 15.276  1.00  31.28  ? 87   ARG A C     1 
ATOM   689  O  O     . ARG A 1 93  ? 17.368 51.907 15.376  1.00  32.15  ? 87   ARG A O     1 
ATOM   690  C  CB    . ARG A 1 93  ? 20.333 53.256 15.523  1.00  31.73  ? 87   ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 93  ? 21.396 53.933 16.399  1.00  32.40  ? 87   ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 93  ? 21.688 55.363 15.927  1.00  31.44  ? 87   ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 93  ? 22.153 55.431 14.543  1.00  30.01  ? 87   ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 93  ? 23.431 55.401 14.170  1.00  29.16  ? 87   ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 93  ? 24.394 55.311 15.066  1.00  27.45  ? 87   ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 93  ? 23.749 55.446 12.885  1.00  31.53  ? 87   ARG A NH2   1 
ATOM   697  N  N     . ILE A 1 94  ? 18.920 50.650 14.363  1.00  30.75  ? 88   ILE A N     1 
ATOM   698  C  CA    . ILE A 1 94  ? 17.934 50.092 13.450  1.00  31.40  ? 88   ILE A CA    1 
ATOM   699  C  C     . ILE A 1 94  ? 16.979 49.169 14.197  1.00  31.28  ? 88   ILE A C     1 
ATOM   700  O  O     . ILE A 1 94  ? 15.784 49.116 13.882  1.00  29.94  ? 88   ILE A O     1 
ATOM   701  C  CB    . ILE A 1 94  ? 18.581 49.313 12.291  1.00  31.08  ? 88   ILE A CB    1 
ATOM   702  C  CG1   . ILE A 1 94  ? 19.338 50.277 11.375  1.00  32.82  ? 88   ILE A CG1   1 
ATOM   703  C  CG2   . ILE A 1 94  ? 17.513 48.590 11.502  1.00  29.05  ? 88   ILE A CG2   1 
ATOM   704  C  CD1   . ILE A 1 94  ? 20.119 49.590 10.272  1.00  30.79  ? 88   ILE A CD1   1 
ATOM   705  N  N     . MET A 1 95  ? 17.501 48.443 15.181  1.00  29.66  ? 89   MET A N     1 
ATOM   706  C  CA    . MET A 1 95  ? 16.652 47.551 15.957  1.00  32.20  ? 89   MET A CA    1 
ATOM   707  C  C     . MET A 1 95  ? 15.642 48.384 16.747  1.00  32.24  ? 89   MET A C     1 
ATOM   708  O  O     . MET A 1 95  ? 14.519 47.955 16.951  1.00  32.04  ? 89   MET A O     1 
ATOM   709  C  CB    . MET A 1 95  ? 17.480 46.689 16.915  1.00  28.80  ? 89   MET A CB    1 
ATOM   710  C  CG    . MET A 1 95  ? 18.418 45.702 16.223  1.00  30.97  ? 89   MET A CG    1 
ATOM   711  S  SD    . MET A 1 95  ? 17.589 44.614 15.036  1.00  28.35  ? 89   MET A SD    1 
ATOM   712  C  CE    . MET A 1 95  ? 19.033 43.689 14.397  1.00  31.40  ? 89   MET A CE    1 
ATOM   713  N  N     . ASN A 1 96  ? 16.045 49.571 17.190  1.00  33.59  ? 90   ASN A N     1 
ATOM   714  C  CA    . ASN A 1 96  ? 15.140 50.424 17.942  1.00  35.89  ? 90   ASN A CA    1 
ATOM   715  C  C     . ASN A 1 96  ? 13.976 50.858 17.077  1.00  35.32  ? 90   ASN A C     1 
ATOM   716  O  O     . ASN A 1 96  ? 12.850 50.891 17.544  1.00  36.42  ? 90   ASN A O     1 
ATOM   717  C  CB    . ASN A 1 96  ? 15.872 51.640 18.516  1.00  36.19  ? 90   ASN A CB    1 
ATOM   718  C  CG    . ASN A 1 96  ? 16.706 51.284 19.736  1.00  37.26  ? 90   ASN A CG    1 
ATOM   719  O  OD1   . ASN A 1 96  ? 16.430 50.293 20.415  1.00  38.11  ? 90   ASN A OD1   1 
ATOM   720  N  ND2   . ASN A 1 96  ? 17.715 52.095 20.032  1.00  37.59  ? 90   ASN A ND2   1 
ATOM   721  N  N     . LEU A 1 97  ? 14.249 51.164 15.813  1.00  36.31  ? 91   LEU A N     1 
ATOM   722  C  CA    . LEU A 1 97  ? 13.206 51.567 14.876  1.00  36.78  ? 91   LEU A CA    1 
ATOM   723  C  C     . LEU A 1 97  ? 12.199 50.435 14.727  1.00  38.49  ? 91   LEU A C     1 
ATOM   724  O  O     . LEU A 1 97  ? 10.984 50.663 14.689  1.00  38.52  ? 91   LEU A O     1 
ATOM   725  C  CB    . LEU A 1 97  ? 13.804 51.873 13.502  1.00  35.44  ? 91   LEU A CB    1 
ATOM   726  C  CG    . LEU A 1 97  ? 14.955 52.875 13.447  1.00  36.77  ? 91   LEU A CG    1 
ATOM   727  C  CD1   . LEU A 1 97  ? 15.392 53.069 12.004  1.00  34.18  ? 91   LEU A CD1   1 
ATOM   728  C  CD2   . LEU A 1 97  ? 14.514 54.198 14.063  1.00  35.82  ? 91   LEU A CD2   1 
ATOM   729  N  N     . LEU A 1 98  ? 12.711 49.211 14.637  1.00  37.96  ? 92   LEU A N     1 
ATOM   730  C  CA    . LEU A 1 98  ? 11.858 48.042 14.488  1.00  39.00  ? 92   LEU A CA    1 
ATOM   731  C  C     . LEU A 1 98  ? 10.944 47.838 15.691  1.00  41.76  ? 92   LEU A C     1 
ATOM   732  O  O     . LEU A 1 98  ? 9.791  47.444 15.534  1.00  42.44  ? 92   LEU A O     1 
ATOM   733  C  CB    . LEU A 1 98  ? 12.708 46.787 14.265  1.00  36.03  ? 92   LEU A CB    1 
ATOM   734  C  CG    . LEU A 1 98  ? 13.415 46.646 12.910  1.00  35.22  ? 92   LEU A CG    1 
ATOM   735  C  CD1   . LEU A 1 98  ? 14.250 45.379 12.902  1.00  34.10  ? 92   LEU A CD1   1 
ATOM   736  C  CD2   . LEU A 1 98  ? 12.395 46.606 11.784  1.00  34.27  ? 92   LEU A CD2   1 
ATOM   737  N  N     . ARG A 1 99  ? 11.457 48.099 16.889  1.00  43.78  ? 93   ARG A N     1 
ATOM   738  C  CA    . ARG A 1 99  ? 10.662 47.942 18.102  1.00  47.86  ? 93   ARG A CA    1 
ATOM   739  C  C     . ARG A 1 99  ? 9.386  48.777 18.031  1.00  49.24  ? 93   ARG A C     1 
ATOM   740  O  O     . ARG A 1 99  ? 8.450  48.560 18.799  1.00  49.79  ? 93   ARG A O     1 
ATOM   741  C  CB    . ARG A 1 99  ? 11.470 48.370 19.326  1.00  49.34  ? 93   ARG A CB    1 
ATOM   742  C  CG    . ARG A 1 99  ? 12.677 47.507 19.611  1.00  49.48  ? 93   ARG A CG    1 
ATOM   743  C  CD    . ARG A 1 99  ? 13.517 48.110 20.725  1.00  51.05  ? 93   ARG A CD    1 
ATOM   744  N  NE    . ARG A 1 99  ? 14.552 47.192 21.185  1.00  53.62  ? 93   ARG A NE    1 
ATOM   745  C  CZ    . ARG A 1 99  ? 14.299 45.973 21.648  1.00  53.99  ? 93   ARG A CZ    1 
ATOM   746  N  NH1   . ARG A 1 99  ? 13.048 45.538 21.705  1.00  56.19  ? 93   ARG A NH1   1 
ATOM   747  N  NH2   . ARG A 1 99  ? 15.289 45.192 22.058  1.00  55.06  ? 93   ARG A NH2   1 
ATOM   748  N  N     . GLU A 1 100 ? 9.358  49.725 17.101  1.00  50.54  ? 94   GLU A N     1 
ATOM   749  C  CA    . GLU A 1 100 ? 8.212  50.613 16.924  1.00  51.17  ? 94   GLU A CA    1 
ATOM   750  C  C     . GLU A 1 100 ? 7.063  49.916 16.208  0.83  51.02  ? 94   GLU A C     1 
ATOM   751  O  O     . GLU A 1 100 ? 5.904  50.298 16.364  1.00  50.57  ? 94   GLU A O     1 
ATOM   752  C  CB    . GLU A 1 100 ? 8.625  51.840 16.109  1.00  51.99  ? 94   GLU A CB    1 
ATOM   753  C  CG    . GLU A 1 100 ? 9.911  52.506 16.579  0.92  53.78  ? 94   GLU A CG    1 
ATOM   754  C  CD    . GLU A 1 100 ? 9.690  53.528 17.669  0.26  54.56  ? 94   GLU A CD    1 
ATOM   755  O  OE1   . GLU A 1 100 ? 9.071  53.187 18.698  0.49  55.10  ? 94   GLU A OE1   1 
ATOM   756  O  OE2   . GLU A 1 100 ? 10.145 54.677 17.493  0.36  54.93  ? 94   GLU A OE2   1 
ATOM   757  N  N     . TYR A 1 101 ? 7.385  48.897 15.418  1.00  50.68  ? 95   TYR A N     1 
ATOM   758  C  CA    . TYR A 1 101 ? 6.364  48.178 14.672  1.00  50.52  ? 95   TYR A CA    1 
ATOM   759  C  C     . TYR A 1 101 ? 5.761  46.993 15.410  1.00  51.02  ? 95   TYR A C     1 
ATOM   760  O  O     . TYR A 1 101 ? 4.751  46.433 14.977  1.00  51.13  ? 95   TYR A O     1 
ATOM   761  C  CB    . TYR A 1 101 ? 6.919  47.740 13.317  1.00  49.57  ? 95   TYR A CB    1 
ATOM   762  C  CG    . TYR A 1 101 ? 7.172  48.906 12.391  1.00  47.74  ? 95   TYR A CG    1 
ATOM   763  C  CD1   . TYR A 1 101 ? 8.349  49.646 12.465  1.00  46.94  ? 95   TYR A CD1   1 
ATOM   764  C  CD2   . TYR A 1 101 ? 6.211  49.290 11.458  1.00  48.42  ? 95   TYR A CD2   1 
ATOM   765  C  CE1   . TYR A 1 101 ? 8.563  50.742 11.628  1.00  47.81  ? 95   TYR A CE1   1 
ATOM   766  C  CE2   . TYR A 1 101 ? 6.413  50.382 10.619  1.00  47.89  ? 95   TYR A CE2   1 
ATOM   767  C  CZ    . TYR A 1 101 ? 7.588  51.100 10.708  1.00  47.78  ? 95   TYR A CZ    1 
ATOM   768  O  OH    . TYR A 1 101 ? 7.782  52.168 9.867   1.00  48.91  ? 95   TYR A OH    1 
ATOM   769  N  N     . SER A 1 102 ? 6.379  46.609 16.520  1.00  51.36  ? 96   SER A N     1 
ATOM   770  C  CA    . SER A 1 102 ? 5.869  45.508 17.323  1.00  52.09  ? 96   SER A CA    1 
ATOM   771  C  C     . SER A 1 102 ? 6.562  45.470 18.665  1.00  52.25  ? 96   SER A C     1 
ATOM   772  O  O     . SER A 1 102 ? 7.695  45.916 18.801  1.00  52.11  ? 96   SER A O     1 
ATOM   773  C  CB    . SER A 1 102 ? 6.059  44.168 16.615  1.00  51.95  ? 96   SER A CB    1 
ATOM   774  O  OG    . SER A 1 102 ? 5.515  43.120 17.400  1.00  52.66  ? 96   SER A OG    1 
ATOM   775  N  N     . GLU A 1 103 ? 5.867  44.947 19.664  1.00  54.11  ? 97   GLU A N     1 
ATOM   776  C  CA    . GLU A 1 103 ? 6.430  44.859 20.997  1.00  55.63  ? 97   GLU A CA    1 
ATOM   777  C  C     . GLU A 1 103 ? 7.016  43.466 21.209  1.00  54.27  ? 97   GLU A C     1 
ATOM   778  O  O     . GLU A 1 103 ? 7.739  43.217 22.174  1.00  55.22  ? 97   GLU A O     1 
ATOM   779  C  CB    . GLU A 1 103 ? 5.353  45.221 22.026  1.00  58.17  ? 97   GLU A CB    1 
ATOM   780  C  CG    . GLU A 1 103 ? 5.032  46.724 21.969  1.00  62.05  ? 97   GLU A CG    1 
ATOM   781  C  CD    . GLU A 1 103 ? 3.549  47.039 21.865  1.00  63.91  ? 97   GLU A CD    1 
ATOM   782  O  OE1   . GLU A 1 103 ? 2.883  47.149 22.919  1.00  64.09  ? 97   GLU A OE1   1 
ATOM   783  O  OE2   . GLU A 1 103 ? 3.054  47.177 20.723  1.00  65.32  ? 97   GLU A OE2   1 
ATOM   784  N  N     . LYS A 1 104 ? 6.715  42.570 20.276  1.00  52.23  ? 98   LYS A N     1 
ATOM   785  C  CA    . LYS A 1 104 ? 7.239  41.214 20.317  1.00  50.40  ? 98   LYS A CA    1 
ATOM   786  C  C     . LYS A 1 104 ? 8.307  41.152 19.224  1.00  48.27  ? 98   LYS A C     1 
ATOM   787  O  O     . LYS A 1 104 ? 8.000  40.985 18.037  1.00  47.53  ? 98   LYS A O     1 
ATOM   788  C  CB    . LYS A 1 104 ? 6.120  40.211 20.043  1.00  51.46  ? 98   LYS A CB    1 
ATOM   789  C  CG    . LYS A 1 104 ? 4.962  40.347 21.015  1.00  54.25  ? 98   LYS A CG    1 
ATOM   790  C  CD    . LYS A 1 104 ? 3.676  39.837 20.397  1.00  55.98  ? 98   LYS A CD    1 
ATOM   791  C  CE    . LYS A 1 104 ? 2.502  40.042 21.334  1.00  57.99  ? 98   LYS A CE    1 
ATOM   792  N  NZ    . LYS A 1 104 ? 1.234  39.583 20.706  1.00  61.11  ? 98   LYS A NZ    1 
ATOM   793  N  N     . ILE A 1 105 ? 9.560  41.311 19.634  1.00  43.73  ? 99   ILE A N     1 
ATOM   794  C  CA    . ILE A 1 105 ? 10.676 41.302 18.703  1.00  41.48  ? 99   ILE A CA    1 
ATOM   795  C  C     . ILE A 1 105 ? 11.830 40.438 19.200  1.00  39.33  ? 99   ILE A C     1 
ATOM   796  O  O     . ILE A 1 105 ? 12.174 40.463 20.376  1.00  36.35  ? 99   ILE A O     1 
ATOM   797  C  CB    . ILE A 1 105 ? 11.205 42.739 18.467  1.00  41.77  ? 99   ILE A CB    1 
ATOM   798  C  CG1   . ILE A 1 105 ? 12.357 42.721 17.459  1.00  40.45  ? 99   ILE A CG1   1 
ATOM   799  C  CG2   . ILE A 1 105 ? 11.693 43.337 19.781  1.00  40.44  ? 99   ILE A CG2   1 
ATOM   800  C  CD1   . ILE A 1 105 ? 12.840 44.112 17.071  1.00  42.13  ? 99   ILE A CD1   1 
ATOM   801  N  N     . GLU A 1 106 ? 12.423 39.673 18.289  1.00  38.54  ? 100  GLU A N     1 
ATOM   802  C  CA    . GLU A 1 106 ? 13.552 38.823 18.632  1.00  36.89  ? 100  GLU A CA    1 
ATOM   803  C  C     . GLU A 1 106 ? 14.772 39.232 17.821  1.00  35.76  ? 100  GLU A C     1 
ATOM   804  O  O     . GLU A 1 106 ? 14.849 38.991 16.617  1.00  34.47  ? 100  GLU A O     1 
ATOM   805  C  CB    . GLU A 1 106 ? 13.218 37.353 18.371  1.00  36.90  ? 100  GLU A CB    1 
ATOM   806  C  CG    . GLU A 1 106 ? 14.393 36.395 18.517  1.00  36.52  ? 100  GLU A CG    1 
ATOM   807  C  CD    . GLU A 1 106 ? 13.945 34.941 18.570  1.00  38.41  ? 100  GLU A CD    1 
ATOM   808  O  OE1   . GLU A 1 106 ? 14.792 34.039 18.382  1.00  39.13  ? 100  GLU A OE1   1 
ATOM   809  O  OE2   . GLU A 1 106 ? 12.742 34.696 18.808  1.00  38.39  ? 100  GLU A OE2   1 
ATOM   810  N  N     . ILE A 1 107 ? 15.719 39.875 18.485  1.00  33.96  ? 101  ILE A N     1 
ATOM   811  C  CA    . ILE A 1 107 ? 16.933 40.291 17.815  1.00  33.33  ? 101  ILE A CA    1 
ATOM   812  C  C     . ILE A 1 107 ? 17.798 39.040 17.754  1.00  31.50  ? 101  ILE A C     1 
ATOM   813  O  O     . ILE A 1 107 ? 18.379 38.633 18.751  1.00  31.36  ? 101  ILE A O     1 
ATOM   814  C  CB    . ILE A 1 107 ? 17.615 41.423 18.605  1.00  34.67  ? 101  ILE A CB    1 
ATOM   815  C  CG1   . ILE A 1 107 ? 16.643 42.611 18.696  1.00  33.51  ? 101  ILE A CG1   1 
ATOM   816  C  CG2   . ILE A 1 107 ? 18.928 41.822 17.934  1.00  33.41  ? 101  ILE A CG2   1 
ATOM   817  C  CD1   . ILE A 1 107 ? 17.134 43.776 19.523  1.00  35.35  ? 101  ILE A CD1   1 
ATOM   818  N  N     . ALA A 1 108 ? 17.848 38.420 16.579  1.00  29.83  ? 102  ALA A N     1 
ATOM   819  C  CA    . ALA A 1 108 ? 18.594 37.185 16.390  1.00  28.36  ? 102  ALA A CA    1 
ATOM   820  C  C     . ALA A 1 108 ? 20.099 37.352 16.227  1.00  28.27  ? 102  ALA A C     1 
ATOM   821  O  O     . ALA A 1 108 ? 20.851 36.422 16.494  1.00  29.72  ? 102  ALA A O     1 
ATOM   822  C  CB    . ALA A 1 108 ? 18.025 36.421 15.203  1.00  27.26  ? 102  ALA A CB    1 
ATOM   823  N  N     . SER A 1 109 ? 20.543 38.522 15.783  1.00  28.11  ? 103  SER A N     1 
ATOM   824  C  CA    . SER A 1 109 ? 21.974 38.767 15.603  1.00  28.41  ? 103  SER A CA    1 
ATOM   825  C  C     . SER A 1 109 ? 22.207 40.244 15.330  1.00  27.17  ? 103  SER A C     1 
ATOM   826  O  O     . SER A 1 109 ? 21.283 41.051 15.394  1.00  27.27  ? 103  SER A O     1 
ATOM   827  C  CB    . SER A 1 109 ? 22.522 37.965 14.418  1.00  27.94  ? 103  SER A CB    1 
ATOM   828  O  OG    . SER A 1 109 ? 22.080 38.541 13.192  1.00  27.54  ? 103  SER A OG    1 
ATOM   829  N  N     . ILE A 1 110 ? 23.444 40.586 14.998  1.00  23.17  ? 104  ILE A N     1 
ATOM   830  C  CA    . ILE A 1 110 ? 23.795 41.968 14.716  1.00  23.47  ? 104  ILE A CA    1 
ATOM   831  C  C     . ILE A 1 110 ? 23.056 42.530 13.502  1.00  22.97  ? 104  ILE A C     1 
ATOM   832  O  O     . ILE A 1 110 ? 22.980 43.740 13.320  1.00  21.03  ? 104  ILE A O     1 
ATOM   833  C  CB    . ILE A 1 110 ? 25.305 42.123 14.469  1.00  22.62  ? 104  ILE A CB    1 
ATOM   834  C  CG1   . ILE A 1 110 ? 25.689 43.613 14.542  1.00  20.49  ? 104  ILE A CG1   1 
ATOM   835  C  CG2   . ILE A 1 110 ? 25.674 41.521 13.101  1.00  15.41  ? 104  ILE A CG2   1 
ATOM   836  C  CD1   . ILE A 1 110 ? 27.180 43.862 14.553  1.00  19.90  ? 104  ILE A CD1   1 
ATOM   837  N  N     . ASP A 1 111 ? 22.510 41.672 12.653  1.00  22.36  ? 105  ASP A N     1 
ATOM   838  C  CA    . ASP A 1 111 ? 21.812 42.223 11.509  1.00  25.89  ? 105  ASP A CA    1 
ATOM   839  C  C     . ASP A 1 111 ? 20.494 41.563 11.121  1.00  24.86  ? 105  ASP A C     1 
ATOM   840  O  O     . ASP A 1 111 ? 20.058 41.674 9.978   1.00  23.13  ? 105  ASP A O     1 
ATOM   841  C  CB    . ASP A 1 111 ? 22.750 42.268 10.315  1.00  24.96  ? 105  ASP A CB    1 
ATOM   842  C  CG    . ASP A 1 111 ? 22.730 41.000 9.524   1.00  28.69  ? 105  ASP A CG    1 
ATOM   843  O  OD1   . ASP A 1 111 ? 22.808 39.914 10.125  1.00  27.31  ? 105  ASP A OD1   1 
ATOM   844  O  OD2   . ASP A 1 111 ? 22.643 41.098 8.293   1.00  28.07  ? 105  ASP A OD2   1 
ATOM   845  N  N     . GLU A 1 112 ? 19.863 40.875 12.066  1.00  25.18  ? 106  GLU A N     1 
ATOM   846  C  CA    . GLU A 1 112 ? 18.575 40.260 11.784  1.00  29.19  ? 106  GLU A CA    1 
ATOM   847  C  C     . GLU A 1 112 ? 17.647 40.269 13.004  1.00  28.34  ? 106  GLU A C     1 
ATOM   848  O  O     . GLU A 1 112 ? 18.093 40.182 14.145  1.00  27.71  ? 106  GLU A O     1 
ATOM   849  C  CB    . GLU A 1 112 ? 18.748 38.828 11.230  1.00  31.07  ? 106  GLU A CB    1 
ATOM   850  C  CG    . GLU A 1 112 ? 19.422 37.817 12.136  1.00  37.84  ? 106  GLU A CG    1 
ATOM   851  C  CD    . GLU A 1 112 ? 19.604 36.464 11.452  1.00  38.88  ? 106  GLU A CD    1 
ATOM   852  O  OE1   . GLU A 1 112 ? 19.999 36.448 10.272  1.00  41.18  ? 106  GLU A OE1   1 
ATOM   853  O  OE2   . GLU A 1 112 ? 19.361 35.414 12.088  1.00  43.49  ? 106  GLU A OE2   1 
ATOM   854  N  N     . ALA A 1 113 ? 16.351 40.415 12.744  1.00  27.82  ? 107  ALA A N     1 
ATOM   855  C  CA    . ALA A 1 113 ? 15.350 40.423 13.798  1.00  28.28  ? 107  ALA A CA    1 
ATOM   856  C  C     . ALA A 1 113 ? 14.030 39.881 13.271  1.00  28.68  ? 107  ALA A C     1 
ATOM   857  O  O     . ALA A 1 113 ? 13.710 40.013 12.087  1.00  28.28  ? 107  ALA A O     1 
ATOM   858  C  CB    . ALA A 1 113 ? 15.149 41.836 14.335  1.00  26.40  ? 107  ALA A CB    1 
ATOM   859  N  N     . TYR A 1 114 ? 13.277 39.246 14.156  1.00  28.14  ? 108  TYR A N     1 
ATOM   860  C  CA    . TYR A 1 114 ? 11.982 38.715 13.792  1.00  28.05  ? 108  TYR A CA    1 
ATOM   861  C  C     . TYR A 1 114 ? 10.958 39.534 14.559  1.00  29.14  ? 108  TYR A C     1 
ATOM   862  O  O     . TYR A 1 114 ? 11.151 39.822 15.735  1.00  27.69  ? 108  TYR A O     1 
ATOM   863  C  CB    . TYR A 1 114 ? 11.829 37.255 14.217  1.00  28.15  ? 108  TYR A CB    1 
ATOM   864  C  CG    . TYR A 1 114 ? 12.780 36.264 13.593  1.00  27.22  ? 108  TYR A CG    1 
ATOM   865  C  CD1   . TYR A 1 114 ? 14.031 36.029 14.149  1.00  28.87  ? 108  TYR A CD1   1 
ATOM   866  C  CD2   . TYR A 1 114 ? 12.399 35.516 12.481  1.00  27.56  ? 108  TYR A CD2   1 
ATOM   867  C  CE1   . TYR A 1 114 ? 14.885 35.065 13.614  1.00  28.95  ? 108  TYR A CE1   1 
ATOM   868  C  CE2   . TYR A 1 114 ? 13.242 34.551 11.936  1.00  28.87  ? 108  TYR A CE2   1 
ATOM   869  C  CZ    . TYR A 1 114 ? 14.479 34.331 12.507  1.00  29.75  ? 108  TYR A CZ    1 
ATOM   870  O  OH    . TYR A 1 114 ? 15.312 33.380 11.974  1.00  31.79  ? 108  TYR A OH    1 
ATOM   871  N  N     . LEU A 1 115 ? 9.874  39.907 13.894  1.00  31.30  ? 109  LEU A N     1 
ATOM   872  C  CA    . LEU A 1 115 ? 8.806  40.659 14.548  1.00  33.16  ? 109  LEU A CA    1 
ATOM   873  C  C     . LEU A 1 115 ? 7.524  39.834 14.449  1.00  32.98  ? 109  LEU A C     1 
ATOM   874  O  O     . LEU A 1 115 ? 7.192  39.315 13.380  1.00  32.50  ? 109  LEU A O     1 
ATOM   875  C  CB    . LEU A 1 115 ? 8.571  42.002 13.850  1.00  33.19  ? 109  LEU A CB    1 
ATOM   876  C  CG    . LEU A 1 115 ? 9.700  43.015 13.695  1.00  34.51  ? 109  LEU A CG    1 
ATOM   877  C  CD1   . LEU A 1 115 ? 9.165  44.269 13.015  1.00  33.67  ? 109  LEU A CD1   1 
ATOM   878  C  CD2   . LEU A 1 115 ? 10.263 43.361 15.054  1.00  37.17  ? 109  LEU A CD2   1 
ATOM   879  N  N     . ASP A 1 116 ? 6.816  39.679 15.558  1.00  36.23  ? 110  ASP A N     1 
ATOM   880  C  CA    . ASP A 1 116 ? 5.552  38.954 15.507  1.00  37.94  ? 110  ASP A CA    1 
ATOM   881  C  C     . ASP A 1 116 ? 4.497  40.036 15.313  1.00  38.57  ? 110  ASP A C     1 
ATOM   882  O  O     . ASP A 1 116 ? 4.158  40.751 16.252  1.00  37.10  ? 110  ASP A O     1 
ATOM   883  C  CB    . ASP A 1 116 ? 5.266  38.211 16.806  1.00  39.73  ? 110  ASP A CB    1 
ATOM   884  C  CG    . ASP A 1 116 ? 3.972  37.411 16.736  1.00  43.97  ? 110  ASP A CG    1 
ATOM   885  O  OD1   . ASP A 1 116 ? 2.967  37.943 16.203  1.00  40.73  ? 110  ASP A OD1   1 
ATOM   886  O  OD2   . ASP A 1 116 ? 3.959  36.255 17.215  1.00  46.75  ? 110  ASP A OD2   1 
ATOM   887  N  N     . ILE A 1 117 ? 3.988  40.166 14.095  1.00  39.92  ? 111  ILE A N     1 
ATOM   888  C  CA    . ILE A 1 117 ? 2.996  41.197 13.819  1.00  42.43  ? 111  ILE A CA    1 
ATOM   889  C  C     . ILE A 1 117 ? 1.586  40.635 13.690  1.00  44.96  ? 111  ILE A C     1 
ATOM   890  O  O     . ILE A 1 117 ? 0.763  41.165 12.943  1.00  46.83  ? 111  ILE A O     1 
ATOM   891  C  CB    . ILE A 1 117 ? 3.356  41.971 12.532  1.00  40.75  ? 111  ILE A CB    1 
ATOM   892  C  CG1   . ILE A 1 117 ? 3.406  41.015 11.334  1.00  39.88  ? 111  ILE A CG1   1 
ATOM   893  C  CG2   . ILE A 1 117 ? 4.693  42.666 12.716  1.00  39.72  ? 111  ILE A CG2   1 
ATOM   894  C  CD1   . ILE A 1 117 ? 3.642  41.699 10.000  1.00  38.49  ? 111  ILE A CD1   1 
ATOM   895  N  N     . SER A 1 118 ? 1.309  39.565 14.429  1.00  47.16  ? 112  SER A N     1 
ATOM   896  C  CA    . SER A 1 118 ? -0.002 38.937 14.392  1.00  49.19  ? 112  SER A CA    1 
ATOM   897  C  C     . SER A 1 118 ? -1.099 39.892 14.860  1.00  51.45  ? 112  SER A C     1 
ATOM   898  O  O     . SER A 1 118 ? -2.009 40.208 14.096  1.00  51.35  ? 112  SER A O     1 
ATOM   899  C  CB    . SER A 1 118 ? -0.003 37.667 15.243  1.00  47.65  ? 112  SER A CB    1 
ATOM   900  O  OG    . SER A 1 118 ? 0.903  36.715 14.707  1.00  46.03  ? 112  SER A OG    1 
ATOM   901  N  N     . ASP A 1 119 ? -1.022 40.354 16.104  0.97  53.27  ? 113  ASP A N     1 
ATOM   902  C  CA    . ASP A 1 119 ? -2.041 41.272 16.597  1.00  55.33  ? 113  ASP A CA    1 
ATOM   903  C  C     . ASP A 1 119 ? -1.712 42.696 16.179  1.00  55.79  ? 113  ASP A C     1 
ATOM   904  O  O     . ASP A 1 119 ? -2.071 43.658 16.856  0.37  56.44  ? 113  ASP A O     1 
ATOM   905  C  CB    . ASP A 1 119 ? -2.188 41.184 18.128  1.00  56.50  ? 113  ASP A CB    1 
ATOM   906  C  CG    . ASP A 1 119 ? -0.988 41.735 18.883  1.00  57.45  ? 113  ASP A CG    1 
ATOM   907  O  OD1   . ASP A 1 119 ? -0.516 42.846 18.566  0.75  58.41  ? 113  ASP A OD1   1 
ATOM   908  O  OD2   . ASP A 1 119 ? -0.527 41.059 19.823  0.39  59.53  ? 113  ASP A OD2   1 
ATOM   909  N  N     . LYS A 1 120 ? -1.037 42.819 15.041  1.00  56.03  ? 114  LYS A N     1 
ATOM   910  C  CA    . LYS A 1 120 ? -0.644 44.119 14.520  1.00  54.98  ? 114  LYS A CA    1 
ATOM   911  C  C     . LYS A 1 120 ? -1.248 44.338 13.146  1.00  53.83  ? 114  LYS A C     1 
ATOM   912  O  O     . LYS A 1 120 ? -1.286 45.458 12.648  1.00  53.62  ? 114  LYS A O     1 
ATOM   913  C  CB    . LYS A 1 120 ? 0.878  44.203 14.413  1.00  56.21  ? 114  LYS A CB    1 
ATOM   914  C  CG    . LYS A 1 120 ? 1.462  45.499 14.933  1.00  56.91  ? 114  LYS A CG    1 
ATOM   915  C  CD    . LYS A 1 120 ? 1.370  45.569 16.447  1.00  58.79  ? 114  LYS A CD    1 
ATOM   916  C  CE    . LYS A 1 120 ? 2.330  44.582 17.115  1.00  61.72  ? 114  LYS A CE    1 
ATOM   917  N  NZ    . LYS A 1 120 ? 2.067  43.147 16.778  1.00  61.67  ? 114  LYS A NZ    1 
ATOM   918  N  N     . VAL A 1 121 ? -1.712 43.259 12.531  1.00  54.21  ? 115  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 121 ? -2.309 43.340 11.209  1.00  54.65  ? 115  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 121 ? -2.772 41.938 10.818  1.00  55.07  ? 115  VAL A C     1 
ATOM   921  O  O     . VAL A 1 121 ? -2.264 40.952 11.345  1.00  56.36  ? 115  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 121 ? -1.280 43.905 10.197  1.00  54.65  ? 115  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 121 ? -0.723 42.805 9.310   1.00  54.54  ? 115  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 121 ? -1.920 45.021 9.396   1.00  56.80  ? 115  VAL A CG2   1 
ATOM   925  N  N     . ARG A 1 122 ? -3.736 41.842 9.909   1.00  55.59  ? 116  ARG A N     1 
ATOM   926  C  CA    . ARG A 1 122 ? -4.250 40.535 9.502   1.00  55.74  ? 116  ARG A CA    1 
ATOM   927  C  C     . ARG A 1 122 ? -4.069 40.270 8.013   1.00  54.76  ? 116  ARG A C     1 
ATOM   928  O  O     . ARG A 1 122 ? -4.049 41.199 7.213   1.00  55.08  ? 116  ARG A O     1 
ATOM   929  C  CB    . ARG A 1 122 ? -5.729 40.425 9.869   1.00  57.83  ? 116  ARG A CB    1 
ATOM   930  C  CG    . ARG A 1 122 ? -6.635 41.384 9.099   1.00  61.20  ? 116  ARG A CG    1 
ATOM   931  C  CD    . ARG A 1 122 ? -7.412 42.338 10.014  1.00  62.89  ? 116  ARG A CD    1 
ATOM   932  N  NE    . ARG A 1 122 ? -6.928 43.715 9.906   1.00  64.90  ? 116  ARG A NE    1 
ATOM   933  C  CZ    . ARG A 1 122 ? -5.964 44.242 10.657  1.00  65.56  ? 116  ARG A CZ    1 
ATOM   934  N  NH1   . ARG A 1 122 ? -5.369 43.517 11.596  1.00  66.20  ? 116  ARG A NH1   1 
ATOM   935  N  NH2   . ARG A 1 122 ? -5.577 45.493 10.450  1.00  65.88  ? 116  ARG A NH2   1 
ATOM   936  N  N     . ASP A 1 123 ? -3.944 38.997 7.651   1.00  53.77  ? 117  ASP A N     1 
ATOM   937  C  CA    . ASP A 1 123 ? -3.748 38.605 6.257   1.00  52.67  ? 117  ASP A CA    1 
ATOM   938  C  C     . ASP A 1 123 ? -2.394 39.151 5.772   1.00  51.69  ? 117  ASP A C     1 
ATOM   939  O  O     . ASP A 1 123 ? -1.837 40.071 6.371   1.00  51.14  ? 117  ASP A O     1 
ATOM   940  C  CB    . ASP A 1 123 ? -4.909 39.127 5.403   1.00  53.72  ? 117  ASP A CB    1 
ATOM   941  C  CG    . ASP A 1 123 ? -4.479 40.173 4.404   1.00  54.40  ? 117  ASP A CG    1 
ATOM   942  O  OD1   . ASP A 1 123 ? -4.065 39.791 3.288   1.00  55.71  ? 117  ASP A OD1   1 
ATOM   943  O  OD2   . ASP A 1 123 ? -4.543 41.373 4.740   1.00  54.05  ? 117  ASP A OD2   1 
ATOM   944  N  N     . TYR A 1 124 ? -1.866 38.586 4.692   1.00  50.79  ? 118  TYR A N     1 
ATOM   945  C  CA    . TYR A 1 124 ? -0.565 38.998 4.182   1.00  49.71  ? 118  TYR A CA    1 
ATOM   946  C  C     . TYR A 1 124 ? -0.443 40.329 3.438   1.00  50.15  ? 118  TYR A C     1 
ATOM   947  O  O     . TYR A 1 124 ? 0.649  40.897 3.401   1.00  50.31  ? 118  TYR A O     1 
ATOM   948  C  CB    . TYR A 1 124 ? 0.032  37.865 3.344   1.00  48.56  ? 118  TYR A CB    1 
ATOM   949  C  CG    . TYR A 1 124 ? 0.468  36.694 4.198   1.00  49.44  ? 118  TYR A CG    1 
ATOM   950  C  CD1   . TYR A 1 124 ? 1.485  36.843 5.140   1.00  50.89  ? 118  TYR A CD1   1 
ATOM   951  C  CD2   . TYR A 1 124 ? -0.177 35.460 4.120   1.00  49.04  ? 118  TYR A CD2   1 
ATOM   952  C  CE1   . TYR A 1 124 ? 1.846  35.800 5.986   1.00  50.45  ? 118  TYR A CE1   1 
ATOM   953  C  CE2   . TYR A 1 124 ? 0.179  34.408 4.965   1.00  49.66  ? 118  TYR A CE2   1 
ATOM   954  C  CZ    . TYR A 1 124 ? 1.192  34.589 5.896   1.00  50.06  ? 118  TYR A CZ    1 
ATOM   955  O  OH    . TYR A 1 124 ? 1.561  33.569 6.747   1.00  51.38  ? 118  TYR A OH    1 
ATOM   956  N  N     . ARG A 1 125 ? -1.528 40.838 2.854   0.83  49.67  ? 119  ARG A N     1 
ATOM   957  C  CA    . ARG A 1 125 ? -1.442 42.116 2.145   1.00  49.11  ? 119  ARG A CA    1 
ATOM   958  C  C     . ARG A 1 125 ? -0.969 43.195 3.106   1.00  47.63  ? 119  ARG A C     1 
ATOM   959  O  O     . ARG A 1 125 ? -0.041 43.941 2.809   1.00  47.75  ? 119  ARG A O     1 
ATOM   960  C  CB    . ARG A 1 125 ? -2.794 42.533 1.550   0.80  50.21  ? 119  ARG A CB    1 
ATOM   961  C  CG    . ARG A 1 125 ? -2.674 43.740 0.611   0.99  51.69  ? 119  ARG A CG    1 
ATOM   962  C  CD    . ARG A 1 125 ? -4.002 44.142 -0.008  0.84  53.62  ? 119  ARG A CD    1 
ATOM   963  N  NE    . ARG A 1 125 ? -4.907 44.689 0.995   0.52  54.73  ? 119  ARG A NE    1 
ATOM   964  C  CZ    . ARG A 1 125 ? -4.722 45.847 1.620   0.46  55.68  ? 119  ARG A CZ    1 
ATOM   965  N  NH1   . ARG A 1 125 ? -3.663 46.599 1.345   0.59  56.30  ? 119  ARG A NH1   1 
ATOM   966  N  NH2   . ARG A 1 125 ? -5.590 46.244 2.540   0.96  56.26  ? 119  ARG A NH2   1 
ATOM   967  N  N     . GLU A 1 126 ? -1.616 43.279 4.261   1.00  48.30  ? 120  GLU A N     1 
ATOM   968  C  CA    . GLU A 1 126 ? -1.239 44.256 5.269   1.00  48.10  ? 120  GLU A CA    1 
ATOM   969  C  C     . GLU A 1 126 ? 0.173  43.950 5.752   1.00  47.16  ? 120  GLU A C     1 
ATOM   970  O  O     . GLU A 1 126 ? 0.911  44.846 6.163   1.00  47.60  ? 120  GLU A O     1 
ATOM   971  C  CB    . GLU A 1 126 ? -2.194 44.189 6.454   1.00  50.03  ? 120  GLU A CB    1 
ATOM   972  C  CG    . GLU A 1 126 ? -3.573 44.767 6.210   1.00  54.03  ? 120  GLU A CG    1 
ATOM   973  C  CD    . GLU A 1 126 ? -4.459 44.611 7.426   1.00  54.67  ? 120  GLU A CD    1 
ATOM   974  O  OE1   . GLU A 1 126 ? -5.196 45.559 7.761   1.00  56.64  ? 120  GLU A OE1   1 
ATOM   975  O  OE2   . GLU A 1 126 ? -4.418 43.530 8.050   1.00  57.17  ? 120  GLU A OE2   1 
ATOM   976  N  N     . ALA A 1 127 ? 0.528  42.670 5.722   1.00  45.62  ? 121  ALA A N     1 
ATOM   977  C  CA    . ALA A 1 127 ? 1.854  42.227 6.138   1.00  45.45  ? 121  ALA A CA    1 
ATOM   978  C  C     . ALA A 1 127 ? 2.872  42.838 5.174   1.00  44.09  ? 121  ALA A C     1 
ATOM   979  O  O     . ALA A 1 127 ? 3.810  43.527 5.579   1.00  43.19  ? 121  ALA A O     1 
ATOM   980  C  CB    . ALA A 1 127 ? 1.929  40.702 6.093   1.00  44.03  ? 121  ALA A CB    1 
ATOM   981  N  N     . TYR A 1 128 ? 2.650  42.587 3.892   1.00  43.70  ? 122  TYR A N     1 
ATOM   982  C  CA    . TYR A 1 128 ? 3.498  43.085 2.823   1.00  43.22  ? 122  TYR A CA    1 
ATOM   983  C  C     . TYR A 1 128 ? 3.698  44.606 2.922   1.00  43.22  ? 122  TYR A C     1 
ATOM   984  O  O     . TYR A 1 128 ? 4.829  45.095 2.886   1.00  43.05  ? 122  TYR A O     1 
ATOM   985  C  CB    . TYR A 1 128 ? 2.854  42.724 1.485   1.00  44.11  ? 122  TYR A CB    1 
ATOM   986  C  CG    . TYR A 1 128 ? 3.734  42.928 0.278   1.00  46.00  ? 122  TYR A CG    1 
ATOM   987  C  CD1   . TYR A 1 128 ? 4.709  41.995 -0.063  1.00  45.84  ? 122  TYR A CD1   1 
ATOM   988  C  CD2   . TYR A 1 128 ? 3.583  44.052 -0.532  1.00  46.78  ? 122  TYR A CD2   1 
ATOM   989  C  CE1   . TYR A 1 128 ? 5.514  42.173 -1.185  1.00  46.49  ? 122  TYR A CE1   1 
ATOM   990  C  CE2   . TYR A 1 128 ? 4.383  44.242 -1.656  1.00  48.19  ? 122  TYR A CE2   1 
ATOM   991  C  CZ    . TYR A 1 128 ? 5.343  43.296 -1.976  1.00  47.71  ? 122  TYR A CZ    1 
ATOM   992  O  OH    . TYR A 1 128 ? 6.119  43.466 -3.098  1.00  50.34  ? 122  TYR A OH    1 
ATOM   993  N  N     . ASN A 1 129 ? 2.599  45.348 3.050   1.00  41.64  ? 123  ASN A N     1 
ATOM   994  C  CA    . ASN A 1 129 ? 2.667  46.801 3.141   1.00  40.99  ? 123  ASN A CA    1 
ATOM   995  C  C     . ASN A 1 129 ? 3.415  47.280 4.374   1.00  40.11  ? 123  ASN A C     1 
ATOM   996  O  O     . ASN A 1 129 ? 4.148  48.265 4.315   1.00  38.96  ? 123  ASN A O     1 
ATOM   997  C  CB    . ASN A 1 129 ? 1.263  47.412 3.123   1.00  42.12  ? 123  ASN A CB    1 
ATOM   998  C  CG    . ASN A 1 129 ? 0.571  47.226 1.796   1.00  42.33  ? 123  ASN A CG    1 
ATOM   999  O  OD1   . ASN A 1 129 ? 1.211  47.254 0.742   1.00  42.36  ? 123  ASN A OD1   1 
ATOM   1000 N  ND2   . ASN A 1 129 ? -0.747 47.054 1.832   1.00  43.50  ? 123  ASN A ND2   1 
ATOM   1001 N  N     . LEU A 1 130 ? 3.227  46.598 5.496   1.00  39.35  ? 124  LEU A N     1 
ATOM   1002 C  CA    . LEU A 1 130 ? 3.940  46.989 6.699   1.00  40.16  ? 124  LEU A CA    1 
ATOM   1003 C  C     . LEU A 1 130 ? 5.439  46.792 6.450   1.00  38.77  ? 124  LEU A C     1 
ATOM   1004 O  O     . LEU A 1 130 ? 6.269  47.459 7.058   1.00  37.36  ? 124  LEU A O     1 
ATOM   1005 C  CB    . LEU A 1 130 ? 3.489  46.152 7.901   1.00  40.61  ? 124  LEU A CB    1 
ATOM   1006 C  CG    . LEU A 1 130 ? 4.142  46.586 9.217   1.00  41.73  ? 124  LEU A CG    1 
ATOM   1007 C  CD1   . LEU A 1 130 ? 3.979  48.082 9.384   1.00  43.47  ? 124  LEU A CD1   1 
ATOM   1008 C  CD2   . LEU A 1 130 ? 3.513  45.862 10.381  1.00  42.21  ? 124  LEU A CD2   1 
ATOM   1009 N  N     . GLY A 1 131 ? 5.768  45.883 5.535   1.00  39.44  ? 125  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 131 ? 7.159  45.616 5.210   1.00  40.90  ? 125  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 131 ? 7.810  46.759 4.454   1.00  41.50  ? 125  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 131 ? 8.924  47.185 4.784   1.00  39.22  ? 125  GLY A O     1 
ATOM   1013 N  N     . LEU A 1 132 ? 7.123  47.253 3.427   1.00  42.24  ? 126  LEU A N     1 
ATOM   1014 C  CA    . LEU A 1 132 ? 7.643  48.366 2.650   1.00  41.91  ? 126  LEU A CA    1 
ATOM   1015 C  C     . LEU A 1 132 ? 7.823  49.574 3.570   1.00  41.06  ? 126  LEU A C     1 
ATOM   1016 O  O     . LEU A 1 132 ? 8.820  50.294 3.466   1.00  40.15  ? 126  LEU A O     1 
ATOM   1017 C  CB    . LEU A 1 132 ? 6.696  48.691 1.492   1.00  43.74  ? 126  LEU A CB    1 
ATOM   1018 C  CG    . LEU A 1 132 ? 6.634  47.621 0.398   1.00  45.17  ? 126  LEU A CG    1 
ATOM   1019 C  CD1   . LEU A 1 132 ? 5.645  48.031 -0.677  1.00  46.97  ? 126  LEU A CD1   1 
ATOM   1020 C  CD2   . LEU A 1 132 ? 8.014  47.442 -0.212  1.00  45.33  ? 126  LEU A CD2   1 
ATOM   1021 N  N     . GLU A 1 133 ? 6.868  49.787 4.476   1.00  39.43  ? 127  GLU A N     1 
ATOM   1022 C  CA    . GLU A 1 133 ? 6.959  50.898 5.427   1.00  38.91  ? 127  GLU A CA    1 
ATOM   1023 C  C     . GLU A 1 133 ? 8.261  50.761 6.217   0.94  38.31  ? 127  GLU A C     1 
ATOM   1024 O  O     . GLU A 1 133 ? 9.051  51.701 6.288   1.00  37.87  ? 127  GLU A O     1 
ATOM   1025 C  CB    . GLU A 1 133 ? 5.778  50.895 6.410   1.00  38.24  ? 127  GLU A CB    1 
ATOM   1026 C  CG    . GLU A 1 133 ? 4.399  51.122 5.792   1.00  41.44  ? 127  GLU A CG    1 
ATOM   1027 C  CD    . GLU A 1 133 ? 3.269  50.969 6.810   0.010 43.06  ? 127  GLU A CD    1 
ATOM   1028 O  OE1   . GLU A 1 133 ? 2.299  50.232 6.528   0.92  43.91  ? 127  GLU A OE1   1 
ATOM   1029 O  OE2   . GLU A 1 133 ? 3.338  51.590 7.894   0.71  45.14  ? 127  GLU A OE2   1 
ATOM   1030 N  N     . ILE A 1 134 ? 8.472  49.583 6.813   1.00  37.92  ? 128  ILE A N     1 
ATOM   1031 C  CA    . ILE A 1 134 ? 9.681  49.307 7.594   1.00  36.22  ? 128  ILE A CA    1 
ATOM   1032 C  C     . ILE A 1 134 ? 10.949 49.466 6.748   1.00  35.25  ? 128  ILE A C     1 
ATOM   1033 O  O     . ILE A 1 134 ? 11.932 50.060 7.198   1.00  35.04  ? 128  ILE A O     1 
ATOM   1034 C  CB    . ILE A 1 134 ? 9.651  47.878 8.187   1.00  37.42  ? 128  ILE A CB    1 
ATOM   1035 C  CG1   . ILE A 1 134 ? 8.475  47.744 9.152   1.00  36.20  ? 128  ILE A CG1   1 
ATOM   1036 C  CG2   . ILE A 1 134 ? 10.962 47.578 8.912   1.00  37.66  ? 128  ILE A CG2   1 
ATOM   1037 C  CD1   . ILE A 1 134 ? 8.333  46.375 9.765   1.00  37.73  ? 128  ILE A CD1   1 
ATOM   1038 N  N     . LYS A 1 135 ? 10.933 48.927 5.533   1.00  35.08  ? 129  LYS A N     1 
ATOM   1039 C  CA    . LYS A 1 135 ? 12.087 49.049 4.648   1.00  37.90  ? 129  LYS A CA    1 
ATOM   1040 C  C     . LYS A 1 135 ? 12.359 50.537 4.422   1.00  39.28  ? 129  LYS A C     1 
ATOM   1041 O  O     . LYS A 1 135 ? 13.440 51.038 4.728   1.00  38.12  ? 129  LYS A O     1 
ATOM   1042 C  CB    . LYS A 1 135 ? 11.818 48.351 3.301   1.00  36.00  ? 129  LYS A CB    1 
ATOM   1043 C  CG    . LYS A 1 135 ? 12.030 46.840 3.330   1.00  36.62  ? 129  LYS A CG    1 
ATOM   1044 C  CD    . LYS A 1 135 ? 11.457 46.146 2.101   1.00  35.32  ? 129  LYS A CD    1 
ATOM   1045 C  CE    . LYS A 1 135 ? 12.211 46.489 0.822   1.00  36.40  ? 129  LYS A CE    1 
ATOM   1046 N  NZ    . LYS A 1 135 ? 13.618 46.013 0.834   1.00  36.60  ? 129  LYS A NZ    1 
ATOM   1047 N  N     . ASN A 1 136 ? 11.352 51.235 3.906   1.00  40.85  ? 130  ASN A N     1 
ATOM   1048 C  CA    . ASN A 1 136 ? 11.453 52.662 3.627   1.00  42.17  ? 130  ASN A CA    1 
ATOM   1049 C  C     . ASN A 1 136 ? 11.925 53.437 4.853   1.00  41.35  ? 130  ASN A C     1 
ATOM   1050 O  O     . ASN A 1 136 ? 12.856 54.238 4.774   1.00  40.16  ? 130  ASN A O     1 
ATOM   1051 C  CB    . ASN A 1 136 ? 10.099 53.205 3.167   1.00  44.12  ? 130  ASN A CB    1 
ATOM   1052 C  CG    . ASN A 1 136 ? 10.188 54.639 2.703   1.00  48.05  ? 130  ASN A CG    1 
ATOM   1053 O  OD1   . ASN A 1 136 ? 10.823 54.935 1.690   1.00  51.29  ? 130  ASN A OD1   1 
ATOM   1054 N  ND2   . ASN A 1 136 ? 9.566  55.546 3.449   1.00  48.71  ? 130  ASN A ND2   1 
ATOM   1055 N  N     . LYS A 1 137 ? 11.278 53.196 5.987   1.00  41.32  ? 131  LYS A N     1 
ATOM   1056 C  CA    . LYS A 1 137 ? 11.652 53.865 7.227   1.00  40.61  ? 131  LYS A CA    1 
ATOM   1057 C  C     . LYS A 1 137 ? 13.132 53.671 7.551   1.00  40.04  ? 131  LYS A C     1 
ATOM   1058 O  O     . LYS A 1 137 ? 13.811 54.613 7.969   1.00  39.60  ? 131  LYS A O     1 
ATOM   1059 C  CB    . LYS A 1 137 ? 10.804 53.340 8.387   1.00  42.94  ? 131  LYS A CB    1 
ATOM   1060 C  CG    . LYS A 1 137 ? 11.204 53.898 9.755   1.00  46.21  ? 131  LYS A CG    1 
ATOM   1061 C  CD    . LYS A 1 137 ? 10.976 55.411 9.864   1.00  51.01  ? 131  LYS A CD    1 
ATOM   1062 C  CE    . LYS A 1 137 ? 9.552  55.770 10.311  1.00  52.46  ? 131  LYS A CE    1 
ATOM   1063 N  NZ    . LYS A 1 137 ? 8.496  55.333 9.350   1.00  53.21  ? 131  LYS A NZ    1 
ATOM   1064 N  N     . ILE A 1 138 ? 13.634 52.451 7.371   1.00  39.15  ? 132  ILE A N     1 
ATOM   1065 C  CA    . ILE A 1 138 ? 15.039 52.173 7.656   1.00  37.55  ? 132  ILE A CA    1 
ATOM   1066 C  C     . ILE A 1 138 ? 15.934 52.811 6.595   1.00  37.39  ? 132  ILE A C     1 
ATOM   1067 O  O     . ILE A 1 138 ? 17.031 53.283 6.893   1.00  37.35  ? 132  ILE A O     1 
ATOM   1068 C  CB    . ILE A 1 138 ? 15.328 50.646 7.713   1.00  37.35  ? 132  ILE A CB    1 
ATOM   1069 C  CG1   . ILE A 1 138 ? 14.503 49.992 8.832   1.00  34.90  ? 132  ILE A CG1   1 
ATOM   1070 C  CG2   . ILE A 1 138 ? 16.829 50.411 7.947   1.00  33.75  ? 132  ILE A CG2   1 
ATOM   1071 C  CD1   . ILE A 1 138 ? 14.621 48.483 8.888   1.00  31.53  ? 132  ILE A CD1   1 
ATOM   1072 N  N     . LEU A 1 139 ? 15.471 52.827 5.351   1.00  38.12  ? 133  LEU A N     1 
ATOM   1073 C  CA    . LEU A 1 139 ? 16.254 53.432 4.284   1.00  39.96  ? 133  LEU A CA    1 
ATOM   1074 C  C     . LEU A 1 139 ? 16.353 54.943 4.518   1.00  42.42  ? 133  LEU A C     1 
ATOM   1075 O  O     . LEU A 1 139 ? 17.420 55.543 4.394   1.00  41.57  ? 133  LEU A O     1 
ATOM   1076 C  CB    . LEU A 1 139 ? 15.607 53.161 2.923   1.00  39.40  ? 133  LEU A CB    1 
ATOM   1077 C  CG    . LEU A 1 139 ? 16.384 53.721 1.726   1.00  38.95  ? 133  LEU A CG    1 
ATOM   1078 C  CD1   . LEU A 1 139 ? 17.794 53.149 1.735   1.00  36.60  ? 133  LEU A CD1   1 
ATOM   1079 C  CD2   . LEU A 1 139 ? 15.673 53.383 0.423   1.00  38.55  ? 133  LEU A CD2   1 
ATOM   1080 N  N     . GLU A 1 140 ? 15.230 55.554 4.875   1.00  44.10  ? 134  GLU A N     1 
ATOM   1081 C  CA    . GLU A 1 140 ? 15.189 56.991 5.117   1.00  46.72  ? 134  GLU A CA    1 
ATOM   1082 C  C     . GLU A 1 140 ? 15.938 57.431 6.370   1.00  45.89  ? 134  GLU A C     1 
ATOM   1083 O  O     . GLU A 1 140 ? 16.669 58.421 6.345   1.00  46.45  ? 134  GLU A O     1 
ATOM   1084 C  CB    . GLU A 1 140 ? 13.734 57.456 5.199   0.94  49.75  ? 134  GLU A CB    1 
ATOM   1085 C  CG    . GLU A 1 140 ? 13.523 58.720 6.011   0.85  55.02  ? 134  GLU A CG    1 
ATOM   1086 C  CD    . GLU A 1 140 ? 12.060 59.010 6.262   0.03  58.01  ? 134  GLU A CD    1 
ATOM   1087 O  OE1   . GLU A 1 140 ? 11.767 59.747 7.225   0.86  59.90  ? 134  GLU A OE1   1 
ATOM   1088 O  OE2   . GLU A 1 140 ? 11.206 58.511 5.498   0.60  60.45  ? 134  GLU A OE2   1 
ATOM   1089 N  N     . LYS A 1 141 ? 15.764 56.693 7.461   1.00  44.80  ? 135  LYS A N     1 
ATOM   1090 C  CA    . LYS A 1 141 ? 16.407 57.037 8.722   1.00  43.30  ? 135  LYS A CA    1 
ATOM   1091 C  C     . LYS A 1 141 ? 17.904 56.762 8.816   1.00  42.64  ? 135  LYS A C     1 
ATOM   1092 O  O     . LYS A 1 141 ? 18.663 57.619 9.255   1.00  41.90  ? 135  LYS A O     1 
ATOM   1093 C  CB    . LYS A 1 141 ? 15.703 56.325 9.881   1.00  45.96  ? 135  LYS A CB    1 
ATOM   1094 C  CG    . LYS A 1 141 ? 14.286 56.810 10.170  1.00  48.09  ? 135  LYS A CG    1 
ATOM   1095 C  CD    . LYS A 1 141 ? 14.275 58.303 10.449  1.00  51.03  ? 135  LYS A CD    1 
ATOM   1096 C  CE    . LYS A 1 141 ? 13.359 58.650 11.609  1.00  52.39  ? 135  LYS A CE    1 
ATOM   1097 N  NZ    . LYS A 1 141 ? 14.141 59.237 12.737  1.00  55.06  ? 135  LYS A NZ    1 
ATOM   1098 N  N     . GLU A 1 142 ? 18.328 55.564 8.425   1.00  42.13  ? 136  GLU A N     1 
ATOM   1099 C  CA    . GLU A 1 142 ? 19.744 55.198 8.502   1.00  40.69  ? 136  GLU A CA    1 
ATOM   1100 C  C     . GLU A 1 142 ? 20.393 55.003 7.136   1.00  38.95  ? 136  GLU A C     1 
ATOM   1101 O  O     . GLU A 1 142 ? 21.608 54.864 7.035   1.00  39.10  ? 136  GLU A O     1 
ATOM   1102 C  CB    . GLU A 1 142 ? 19.905 53.916 9.324   1.00  40.24  ? 136  GLU A CB    1 
ATOM   1103 C  CG    . GLU A 1 142 ? 19.597 54.069 10.799  1.00  40.18  ? 136  GLU A CG    1 
ATOM   1104 C  CD    . GLU A 1 142 ? 20.547 55.019 11.494  1.00  41.56  ? 136  GLU A CD    1 
ATOM   1105 O  OE1   . GLU A 1 142 ? 21.711 55.119 11.055  1.00  40.02  ? 136  GLU A OE1   1 
ATOM   1106 O  OE2   . GLU A 1 142 ? 20.141 55.658 12.490  1.00  43.63  ? 136  GLU A OE2   1 
ATOM   1107 N  N     . LYS A 1 143 ? 19.572 54.984 6.094   1.00  39.46  ? 137  LYS A N     1 
ATOM   1108 C  CA    . LYS A 1 143 ? 20.044 54.797 4.726   1.00  40.30  ? 137  LYS A CA    1 
ATOM   1109 C  C     . LYS A 1 143 ? 20.709 53.436 4.533   1.00  38.82  ? 137  LYS A C     1 
ATOM   1110 O  O     . LYS A 1 143 ? 21.802 53.327 3.977   1.00  37.83  ? 137  LYS A O     1 
ATOM   1111 C  CB    . LYS A 1 143 ? 21.003 55.929 4.336   1.00  42.95  ? 137  LYS A CB    1 
ATOM   1112 C  CG    . LYS A 1 143 ? 20.356 57.304 4.426   1.00  45.10  ? 137  LYS A CG    1 
ATOM   1113 C  CD    . LYS A 1 143 ? 21.325 58.413 4.072   1.00  48.45  ? 137  LYS A CD    1 
ATOM   1114 C  CE    . LYS A 1 143 ? 21.442 58.614 2.566   1.00  50.36  ? 137  LYS A CE    1 
ATOM   1115 N  NZ    . LYS A 1 143 ? 20.679 59.807 2.097   1.00  52.30  ? 137  LYS A NZ    1 
ATOM   1116 N  N     . ILE A 1 144 ? 20.020 52.402 5.001   1.00  36.73  ? 138  ILE A N     1 
ATOM   1117 C  CA    . ILE A 1 144 ? 20.489 51.030 4.901   1.00  34.78  ? 138  ILE A CA    1 
ATOM   1118 C  C     . ILE A 1 144 ? 19.368 50.235 4.240   1.00  34.65  ? 138  ILE A C     1 
ATOM   1119 O  O     . ILE A 1 144 ? 18.203 50.342 4.632   1.00  34.92  ? 138  ILE A O     1 
ATOM   1120 C  CB    . ILE A 1 144 ? 20.787 50.437 6.315   1.00  34.98  ? 138  ILE A CB    1 
ATOM   1121 C  CG1   . ILE A 1 144 ? 22.059 51.064 6.898   1.00  31.30  ? 138  ILE A CG1   1 
ATOM   1122 C  CG2   . ILE A 1 144 ? 20.925 48.916 6.239   1.00  33.44  ? 138  ILE A CG2   1 
ATOM   1123 C  CD1   . ILE A 1 144 ? 23.328 50.688 6.158   1.00  28.45  ? 138  ILE A CD1   1 
ATOM   1124 N  N     . THR A 1 145 ? 19.710 49.460 3.220   1.00  31.44  ? 139  THR A N     1 
ATOM   1125 C  CA    . THR A 1 145 ? 18.714 48.649 2.532   1.00  30.50  ? 139  THR A CA    1 
ATOM   1126 C  C     . THR A 1 145 ? 18.675 47.282 3.219   1.00  29.34  ? 139  THR A C     1 
ATOM   1127 O  O     . THR A 1 145 ? 19.704 46.759 3.628   1.00  26.27  ? 139  THR A O     1 
ATOM   1128 C  CB    . THR A 1 145 ? 19.076 48.476 1.038   1.00  30.77  ? 139  THR A CB    1 
ATOM   1129 O  OG1   . THR A 1 145 ? 20.362 47.858 0.932   1.00  33.91  ? 139  THR A OG1   1 
ATOM   1130 C  CG2   . THR A 1 145 ? 19.136 49.834 0.342   1.00  29.36  ? 139  THR A CG2   1 
ATOM   1131 N  N     . VAL A 1 146 ? 17.480 46.720 3.359   1.00  28.52  ? 140  VAL A N     1 
ATOM   1132 C  CA    . VAL A 1 146 ? 17.320 45.426 4.007   1.00  28.72  ? 140  VAL A CA    1 
ATOM   1133 C  C     . VAL A 1 146 ? 16.373 44.561 3.205   1.00  29.40  ? 140  VAL A C     1 
ATOM   1134 O  O     . VAL A 1 146 ? 15.711 45.039 2.275   1.00  30.42  ? 140  VAL A O     1 
ATOM   1135 C  CB    . VAL A 1 146 ? 16.738 45.585 5.436   1.00  28.39  ? 140  VAL A CB    1 
ATOM   1136 C  CG1   . VAL A 1 146 ? 17.562 46.572 6.217   1.00  30.11  ? 140  VAL A CG1   1 
ATOM   1137 C  CG2   . VAL A 1 146 ? 15.298 46.069 5.376   1.00  28.08  ? 140  VAL A CG2   1 
ATOM   1138 N  N     . THR A 1 147 ? 16.309 43.282 3.558   1.00  28.61  ? 141  THR A N     1 
ATOM   1139 C  CA    . THR A 1 147 ? 15.407 42.370 2.880   1.00  28.46  ? 141  THR A CA    1 
ATOM   1140 C  C     . THR A 1 147 ? 14.414 41.872 3.904   1.00  28.09  ? 141  THR A C     1 
ATOM   1141 O  O     . THR A 1 147 ? 14.786 41.532 5.025   1.00  27.90  ? 141  THR A O     1 
ATOM   1142 C  CB    . THR A 1 147 ? 16.153 41.186 2.249   1.00  27.76  ? 141  THR A CB    1 
ATOM   1143 O  OG1   . THR A 1 147 ? 17.014 41.676 1.215   1.00  27.72  ? 141  THR A OG1   1 
ATOM   1144 C  CG2   . THR A 1 147 ? 15.171 40.211 1.633   1.00  27.53  ? 141  THR A CG2   1 
ATOM   1145 N  N     . VAL A 1 148 ? 13.142 41.856 3.524   1.00  28.33  ? 142  VAL A N     1 
ATOM   1146 C  CA    . VAL A 1 148 ? 12.094 41.410 4.426   1.00  28.39  ? 142  VAL A CA    1 
ATOM   1147 C  C     . VAL A 1 148 ? 11.500 40.066 4.015   1.00  28.34  ? 142  VAL A C     1 
ATOM   1148 O  O     . VAL A 1 148 ? 11.247 39.821 2.839   1.00  27.51  ? 142  VAL A O     1 
ATOM   1149 C  CB    . VAL A 1 148 ? 10.967 42.463 4.513   1.00  28.52  ? 142  VAL A CB    1 
ATOM   1150 C  CG1   . VAL A 1 148 ? 9.820  41.954 5.394   1.00  29.55  ? 142  VAL A CG1   1 
ATOM   1151 C  CG2   . VAL A 1 148 ? 11.525 43.744 5.082   1.00  29.52  ? 142  VAL A CG2   1 
ATOM   1152 N  N     . GLY A 1 149 ? 11.309 39.192 5.004   1.00  28.13  ? 143  GLY A N     1 
ATOM   1153 C  CA    . GLY A 1 149 ? 10.716 37.891 4.761   1.00  26.62  ? 143  GLY A CA    1 
ATOM   1154 C  C     . GLY A 1 149 ? 9.473  37.786 5.625   1.00  27.56  ? 143  GLY A C     1 
ATOM   1155 O  O     . GLY A 1 149 ? 9.501  38.158 6.798   1.00  28.20  ? 143  GLY A O     1 
ATOM   1156 N  N     . ILE A 1 150 ? 8.376  37.295 5.059   1.00  28.73  ? 144  ILE A N     1 
ATOM   1157 C  CA    . ILE A 1 150 ? 7.131  37.169 5.812   1.00  30.81  ? 144  ILE A CA    1 
ATOM   1158 C  C     . ILE A 1 150 ? 6.476  35.811 5.601   1.00  30.62  ? 144  ILE A C     1 
ATOM   1159 O  O     . ILE A 1 150 ? 6.250  35.390 4.462   1.00  30.74  ? 144  ILE A O     1 
ATOM   1160 C  CB    . ILE A 1 150 ? 6.133  38.267 5.398   1.00  31.19  ? 144  ILE A CB    1 
ATOM   1161 C  CG1   . ILE A 1 150 ? 6.729  39.636 5.707   1.00  31.57  ? 144  ILE A CG1   1 
ATOM   1162 C  CG2   . ILE A 1 150 ? 4.813  38.090 6.140   1.00  30.22  ? 144  ILE A CG2   1 
ATOM   1163 C  CD1   . ILE A 1 150 ? 6.144  40.754 4.871   1.00  33.26  ? 144  ILE A CD1   1 
ATOM   1164 N  N     . SER A 1 151 ? 6.168  35.127 6.698   1.00  30.29  ? 145  SER A N     1 
ATOM   1165 C  CA    . SER A 1 151 ? 5.533  33.818 6.604   1.00  31.27  ? 145  SER A CA    1 
ATOM   1166 C  C     . SER A 1 151 ? 4.793  33.498 7.894   1.00  31.46  ? 145  SER A C     1 
ATOM   1167 O  O     . SER A 1 151 ? 4.583  34.385 8.721   1.00  32.44  ? 145  SER A O     1 
ATOM   1168 C  CB    . SER A 1 151 ? 6.585  32.741 6.312   1.00  30.17  ? 145  SER A CB    1 
ATOM   1169 O  OG    . SER A 1 151 ? 5.977  31.576 5.777   1.00  31.27  ? 145  SER A OG    1 
ATOM   1170 N  N     . LYS A 1 152 ? 4.413  32.235 8.073   1.00  32.60  ? 146  LYS A N     1 
ATOM   1171 C  CA    . LYS A 1 152 ? 3.677  31.813 9.264   1.00  33.72  ? 146  LYS A CA    1 
ATOM   1172 C  C     . LYS A 1 152 ? 4.521  31.538 10.508  1.00  35.08  ? 146  LYS A C     1 
ATOM   1173 O  O     . LYS A 1 152 ? 4.013  31.608 11.630  1.00  35.62  ? 146  LYS A O     1 
ATOM   1174 C  CB    . LYS A 1 152 ? 2.817  30.591 8.935   1.00  34.46  ? 146  LYS A CB    1 
ATOM   1175 C  CG    . LYS A 1 152 ? 3.570  29.443 8.279   1.00  38.74  ? 146  LYS A CG    1 
ATOM   1176 C  CD    . LYS A 1 152 ? 2.615  28.369 7.765   1.00  38.43  ? 146  LYS A CD    1 
ATOM   1177 C  CE    . LYS A 1 152 ? 1.783  27.794 8.898   1.00  40.83  ? 146  LYS A CE    1 
ATOM   1178 N  NZ    . LYS A 1 152 ? 0.918  26.676 8.428   1.00  42.60  ? 146  LYS A NZ    1 
ATOM   1179 N  N     . ASN A 1 153 ? 5.799  31.219 10.321  1.00  34.48  ? 147  ASN A N     1 
ATOM   1180 C  CA    . ASN A 1 153 ? 6.692  30.968 11.457  1.00  34.54  ? 147  ASN A CA    1 
ATOM   1181 C  C     . ASN A 1 153 ? 8.070  31.572 11.157  1.00  32.08  ? 147  ASN A C     1 
ATOM   1182 O  O     . ASN A 1 153 ? 8.323  32.017 10.040  1.00  30.99  ? 147  ASN A O     1 
ATOM   1183 C  CB    . ASN A 1 153 ? 6.814  29.462 11.739  1.00  35.33  ? 147  ASN A CB    1 
ATOM   1184 C  CG    . ASN A 1 153 ? 7.424  28.699 10.583  1.00  37.29  ? 147  ASN A CG    1 
ATOM   1185 O  OD1   . ASN A 1 153 ? 8.496  29.051 10.092  1.00  40.47  ? 147  ASN A OD1   1 
ATOM   1186 N  ND2   . ASN A 1 153 ? 6.751  27.643 10.147  1.00  36.77  ? 147  ASN A ND2   1 
ATOM   1187 N  N     . LYS A 1 154 ? 8.954  31.587 12.148  1.00  30.47  ? 148  LYS A N     1 
ATOM   1188 C  CA    . LYS A 1 154 ? 10.277 32.172 11.973  1.00  29.25  ? 148  LYS A CA    1 
ATOM   1189 C  C     . LYS A 1 154 ? 11.163 31.538 10.910  1.00  28.00  ? 148  LYS A C     1 
ATOM   1190 O  O     . LYS A 1 154 ? 11.898 32.238 10.216  1.00  24.45  ? 148  LYS A O     1 
ATOM   1191 C  CB    . LYS A 1 154 ? 11.023 32.173 13.299  1.00  30.73  ? 148  LYS A CB    1 
ATOM   1192 C  CG    . LYS A 1 154 ? 10.377 33.055 14.336  1.00  32.85  ? 148  LYS A CG    1 
ATOM   1193 C  CD    . LYS A 1 154 ? 11.225 33.123 15.578  1.00  32.68  ? 148  LYS A CD    1 
ATOM   1194 C  CE    . LYS A 1 154 ? 11.251 31.798 16.309  1.00  33.39  ? 148  LYS A CE    1 
ATOM   1195 N  NZ    . LYS A 1 154 ? 12.193 31.888 17.457  1.00  32.50  ? 148  LYS A NZ    1 
ATOM   1196 N  N     . VAL A 1 155 ? 11.101 30.221 10.778  1.00  26.00  ? 149  VAL A N     1 
ATOM   1197 C  CA    . VAL A 1 155 ? 11.937 29.549 9.799   1.00  26.65  ? 149  VAL A CA    1 
ATOM   1198 C  C     . VAL A 1 155 ? 11.584 29.933 8.366   1.00  26.37  ? 149  VAL A C     1 
ATOM   1199 O  O     . VAL A 1 155 ? 12.470 30.220 7.564   1.00  25.79  ? 149  VAL A O     1 
ATOM   1200 C  CB    . VAL A 1 155 ? 11.867 28.012 9.976   1.00  26.48  ? 149  VAL A CB    1 
ATOM   1201 C  CG1   . VAL A 1 155 ? 12.548 27.307 8.816   1.00  24.46  ? 149  VAL A CG1   1 
ATOM   1202 C  CG2   . VAL A 1 155 ? 12.521 27.623 11.287  1.00  24.70  ? 149  VAL A CG2   1 
ATOM   1203 N  N     . PHE A 1 156 ? 10.301 29.951 8.030   1.00  25.35  ? 150  PHE A N     1 
ATOM   1204 C  CA    . PHE A 1 156 ? 9.933  30.302 6.663   1.00  25.54  ? 150  PHE A CA    1 
ATOM   1205 C  C     . PHE A 1 156 ? 10.016 31.799 6.348   1.00  25.07  ? 150  PHE A C     1 
ATOM   1206 O  O     . PHE A 1 156 ? 10.125 32.192 5.182   1.00  23.65  ? 150  PHE A O     1 
ATOM   1207 C  CB    . PHE A 1 156 ? 8.557  29.726 6.315   1.00  27.19  ? 150  PHE A CB    1 
ATOM   1208 C  CG    . PHE A 1 156 ? 8.586  28.240 6.064   1.00  29.31  ? 150  PHE A CG    1 
ATOM   1209 C  CD1   . PHE A 1 156 ? 8.290  27.339 7.081   1.00  31.15  ? 150  PHE A CD1   1 
ATOM   1210 C  CD2   . PHE A 1 156 ? 9.008  27.743 4.831   1.00  31.85  ? 150  PHE A CD2   1 
ATOM   1211 C  CE1   . PHE A 1 156 ? 8.422  25.962 6.879   1.00  34.12  ? 150  PHE A CE1   1 
ATOM   1212 C  CE2   . PHE A 1 156 ? 9.144  26.368 4.617   1.00  32.32  ? 150  PHE A CE2   1 
ATOM   1213 C  CZ    . PHE A 1 156 ? 8.851  25.478 5.646   1.00  32.85  ? 150  PHE A CZ    1 
ATOM   1214 N  N     . ALA A 1 157 ? 9.983  32.632 7.381   1.00  22.80  ? 151  ALA A N     1 
ATOM   1215 C  CA    . ALA A 1 157 ? 10.111 34.069 7.179   1.00  25.21  ? 151  ALA A CA    1 
ATOM   1216 C  C     . ALA A 1 157 ? 11.571 34.309 6.772   1.00  26.66  ? 151  ALA A C     1 
ATOM   1217 O  O     . ALA A 1 157 ? 11.867 35.112 5.878   1.00  23.80  ? 151  ALA A O     1 
ATOM   1218 C  CB    . ALA A 1 157 ? 9.792  34.819 8.471   1.00  21.67  ? 151  ALA A CB    1 
ATOM   1219 N  N     . LYS A 1 158 ? 12.473 33.604 7.453   1.00  24.53  ? 152  LYS A N     1 
ATOM   1220 C  CA    . LYS A 1 158 ? 13.905 33.683 7.185   1.00  26.82  ? 152  LYS A CA    1 
ATOM   1221 C  C     . LYS A 1 158 ? 14.178 33.201 5.753   1.00  26.88  ? 152  LYS A C     1 
ATOM   1222 O  O     . LYS A 1 158 ? 14.899 33.849 4.993   1.00  26.03  ? 152  LYS A O     1 
ATOM   1223 C  CB    . LYS A 1 158 ? 14.649 32.810 8.202   1.00  26.49  ? 152  LYS A CB    1 
ATOM   1224 C  CG    . LYS A 1 158 ? 15.952 32.243 7.715   1.00  33.53  ? 152  LYS A CG    1 
ATOM   1225 C  CD    . LYS A 1 158 ? 17.017 33.305 7.590   1.00  36.34  ? 152  LYS A CD    1 
ATOM   1226 C  CE    . LYS A 1 158 ? 17.749 33.508 8.905   1.00  37.16  ? 152  LYS A CE    1 
ATOM   1227 N  NZ    . LYS A 1 158 ? 18.499 32.293 9.304   1.00  38.80  ? 152  LYS A NZ    1 
ATOM   1228 N  N     . ILE A 1 159 ? 13.593 32.059 5.399   1.00  25.69  ? 153  ILE A N     1 
ATOM   1229 C  CA    . ILE A 1 159 ? 13.729 31.473 4.064   1.00  26.37  ? 153  ILE A CA    1 
ATOM   1230 C  C     . ILE A 1 159 ? 13.218 32.442 3.002   1.00  25.42  ? 153  ILE A C     1 
ATOM   1231 O  O     . ILE A 1 159 ? 13.817 32.579 1.932   1.00  23.51  ? 153  ILE A O     1 
ATOM   1232 C  CB    . ILE A 1 159 ? 12.942 30.127 3.968   1.00  26.39  ? 153  ILE A CB    1 
ATOM   1233 C  CG1   . ILE A 1 159 ? 13.708 29.035 4.719   1.00  25.05  ? 153  ILE A CG1   1 
ATOM   1234 C  CG2   . ILE A 1 159 ? 12.772 29.696 2.526   1.00  28.87  ? 153  ILE A CG2   1 
ATOM   1235 C  CD1   . ILE A 1 159 ? 12.932 27.764 4.928   1.00  26.37  ? 153  ILE A CD1   1 
ATOM   1236 N  N     . ALA A 1 160 ? 12.110 33.111 3.302   1.00  26.70  ? 154  ALA A N     1 
ATOM   1237 C  CA    . ALA A 1 160 ? 11.519 34.081 2.383   1.00  27.45  ? 154  ALA A CA    1 
ATOM   1238 C  C     . ALA A 1 160 ? 12.549 35.178 2.097   1.00  27.58  ? 154  ALA A C     1 
ATOM   1239 O  O     . ALA A 1 160 ? 12.746 35.586 0.954   1.00  29.20  ? 154  ALA A O     1 
ATOM   1240 C  CB    . ALA A 1 160 ? 10.255 34.681 3.000   1.00  26.78  ? 154  ALA A CB    1 
ATOM   1241 N  N     . ALA A 1 161 ? 13.212 35.642 3.144   1.00  26.22  ? 155  ALA A N     1 
ATOM   1242 C  CA    . ALA A 1 161 ? 14.234 36.665 3.002   1.00  27.42  ? 155  ALA A CA    1 
ATOM   1243 C  C     . ALA A 1 161 ? 15.436 36.159 2.188   1.00  28.70  ? 155  ALA A C     1 
ATOM   1244 O  O     . ALA A 1 161 ? 15.955 36.883 1.339   1.00  31.05  ? 155  ALA A O     1 
ATOM   1245 C  CB    . ALA A 1 161 ? 14.693 37.125 4.375   1.00  24.30  ? 155  ALA A CB    1 
ATOM   1246 N  N     . ASP A 1 162 ? 15.896 34.937 2.447   1.00  28.86  ? 156  ASP A N     1 
ATOM   1247 C  CA    . ASP A 1 162 ? 17.036 34.416 1.694   1.00  32.23  ? 156  ASP A CA    1 
ATOM   1248 C  C     . ASP A 1 162 ? 16.720 34.435 0.193   1.00  33.41  ? 156  ASP A C     1 
ATOM   1249 O  O     . ASP A 1 162 ? 17.576 34.758 -0.626  1.00  33.50  ? 156  ASP A O     1 
ATOM   1250 C  CB    . ASP A 1 162 ? 17.377 32.974 2.097   1.00  33.53  ? 156  ASP A CB    1 
ATOM   1251 C  CG    . ASP A 1 162 ? 17.987 32.864 3.492   1.00  38.11  ? 156  ASP A CG    1 
ATOM   1252 O  OD1   . ASP A 1 162 ? 18.659 33.820 3.945   1.00  37.13  ? 156  ASP A OD1   1 
ATOM   1253 O  OD2   . ASP A 1 162 ? 17.809 31.794 4.126   1.00  40.63  ? 156  ASP A OD2   1 
ATOM   1254 N  N     . MET A 1 163 ? 15.483 34.089 -0.147  1.00  32.72  ? 157  MET A N     1 
ATOM   1255 C  CA    . MET A 1 163 ? 15.030 34.038 -1.534  1.00  34.91  ? 157  MET A CA    1 
ATOM   1256 C  C     . MET A 1 163 ? 14.908 35.388 -2.231  1.00  33.61  ? 157  MET A C     1 
ATOM   1257 O  O     . MET A 1 163 ? 15.039 35.470 -3.447  1.00  34.58  ? 157  MET A O     1 
ATOM   1258 C  CB    . MET A 1 163 ? 13.668 33.334 -1.611  1.00  37.59  ? 157  MET A CB    1 
ATOM   1259 C  CG    . MET A 1 163 ? 13.690 31.861 -1.228  1.00  39.06  ? 157  MET A CG    1 
ATOM   1260 S  SD    . MET A 1 163 ? 12.027 31.156 -1.221  1.00  43.85  ? 157  MET A SD    1 
ATOM   1261 C  CE    . MET A 1 163 ? 11.779 30.932 -3.005  1.00  43.78  ? 157  MET A CE    1 
ATOM   1262 N  N     . ALA A 1 164 ? 14.649 36.440 -1.463  1.00  33.71  ? 158  ALA A N     1 
ATOM   1263 C  CA    . ALA A 1 164 ? 14.465 37.768 -2.025  1.00  34.39  ? 158  ALA A CA    1 
ATOM   1264 C  C     . ALA A 1 164 ? 15.669 38.695 -1.935  1.00  36.42  ? 158  ALA A C     1 
ATOM   1265 O  O     . ALA A 1 164 ? 15.589 39.843 -2.372  1.00  35.45  ? 158  ALA A O     1 
ATOM   1266 C  CB    . ALA A 1 164 ? 13.272 38.436 -1.362  1.00  37.03  ? 158  ALA A CB    1 
ATOM   1267 N  N     . LYS A 1 165 ? 16.770 38.212 -1.366  1.00  36.68  ? 159  LYS A N     1 
ATOM   1268 C  CA    . LYS A 1 165 ? 17.972 39.032 -1.226  1.00  38.17  ? 159  LYS A CA    1 
ATOM   1269 C  C     . LYS A 1 165 ? 18.580 39.343 -2.595  1.00  36.62  ? 159  LYS A C     1 
ATOM   1270 O  O     . LYS A 1 165 ? 18.557 38.513 -3.499  1.00  36.04  ? 159  LYS A O     1 
ATOM   1271 C  CB    . LYS A 1 165 ? 19.006 38.315 -0.340  1.00  40.79  ? 159  LYS A CB    1 
ATOM   1272 C  CG    . LYS A 1 165 ? 20.203 37.739 -1.093  1.00  46.73  ? 159  LYS A CG    1 
ATOM   1273 C  CD    . LYS A 1 165 ? 21.108 36.907 -0.178  1.00  50.14  ? 159  LYS A CD    1 
ATOM   1274 C  CE    . LYS A 1 165 ? 22.311 36.354 -0.930  1.00  50.68  ? 159  LYS A CE    1 
ATOM   1275 N  NZ    . LYS A 1 165 ? 23.236 37.438 -1.324  1.00  51.57  ? 159  LYS A NZ    1 
ATOM   1276 N  N     . PRO A 1 166 ? 19.117 40.559 -2.773  1.00  36.01  ? 160  PRO A N     1 
ATOM   1277 C  CA    . PRO A 1 166 ? 19.209 41.673 -1.822  1.00  34.06  ? 160  PRO A CA    1 
ATOM   1278 C  C     . PRO A 1 166 ? 18.070 42.676 -1.983  1.00  33.54  ? 160  PRO A C     1 
ATOM   1279 O  O     . PRO A 1 166 ? 17.320 42.615 -2.954  1.00  30.85  ? 160  PRO A O     1 
ATOM   1280 C  CB    . PRO A 1 166 ? 20.546 42.293 -2.169  1.00  36.80  ? 160  PRO A CB    1 
ATOM   1281 C  CG    . PRO A 1 166 ? 20.542 42.191 -3.671  1.00  35.73  ? 160  PRO A CG    1 
ATOM   1282 C  CD    . PRO A 1 166 ? 20.005 40.788 -3.929  1.00  35.69  ? 160  PRO A CD    1 
ATOM   1283 N  N     . ASN A 1 167 ? 17.970 43.596 -1.025  1.00  33.36  ? 161  ASN A N     1 
ATOM   1284 C  CA    . ASN A 1 167 ? 16.946 44.637 -1.002  1.00  34.22  ? 161  ASN A CA    1 
ATOM   1285 C  C     . ASN A 1 167 ? 15.588 44.164 -1.500  1.00  34.37  ? 161  ASN A C     1 
ATOM   1286 O  O     . ASN A 1 167 ? 14.978 44.788 -2.370  1.00  34.32  ? 161  ASN A O     1 
ATOM   1287 C  CB    . ASN A 1 167 ? 17.394 45.848 -1.826  1.00  36.76  ? 161  ASN A CB    1 
ATOM   1288 C  CG    . ASN A 1 167 ? 16.351 46.951 -1.843  1.00  39.46  ? 161  ASN A CG    1 
ATOM   1289 O  OD1   . ASN A 1 167 ? 15.482 47.007 -0.971  1.00  39.74  ? 161  ASN A OD1   1 
ATOM   1290 N  ND2   . ASN A 1 167 ? 16.437 47.839 -2.827  1.00  40.53  ? 161  ASN A ND2   1 
ATOM   1291 N  N     . GLY A 1 168 ? 15.107 43.061 -0.948  1.00  32.21  ? 162  GLY A N     1 
ATOM   1292 C  CA    . GLY A 1 168 ? 13.819 42.567 -1.380  1.00  32.86  ? 162  GLY A CA    1 
ATOM   1293 C  C     . GLY A 1 168 ? 12.816 42.479 -0.255  1.00  31.82  ? 162  GLY A C     1 
ATOM   1294 O  O     . GLY A 1 168 ? 13.052 42.944 0.857   1.00  33.29  ? 162  GLY A O     1 
ATOM   1295 N  N     . ILE A 1 169 ? 11.675 41.883 -0.567  1.00  32.55  ? 163  ILE A N     1 
ATOM   1296 C  CA    . ILE A 1 169 ? 10.604 41.669 0.389   1.00  32.21  ? 163  ILE A CA    1 
ATOM   1297 C  C     . ILE A 1 169 ? 9.822  40.518 -0.194  1.00  32.72  ? 163  ILE A C     1 
ATOM   1298 O  O     . ILE A 1 169 ? 9.561  40.482 -1.393  1.00  32.43  ? 163  ILE A O     1 
ATOM   1299 C  CB    . ILE A 1 169 ? 9.679  42.895 0.534   1.00  34.16  ? 163  ILE A CB    1 
ATOM   1300 C  CG1   . ILE A 1 169 ? 8.461  42.512 1.384   1.00  34.85  ? 163  ILE A CG1   1 
ATOM   1301 C  CG2   . ILE A 1 169 ? 9.260  43.408 -0.840  1.00  34.08  ? 163  ILE A CG2   1 
ATOM   1302 C  CD1   . ILE A 1 169 ? 7.547  43.672 1.720   1.00  35.23  ? 163  ILE A CD1   1 
ATOM   1303 N  N     . LYS A 1 170 ? 9.477  39.554 0.641   1.00  32.46  ? 164  LYS A N     1 
ATOM   1304 C  CA    . LYS A 1 170 ? 8.733  38.417 0.147   1.00  34.54  ? 164  LYS A CA    1 
ATOM   1305 C  C     . LYS A 1 170 ? 7.804  37.810 1.173   1.00  34.92  ? 164  LYS A C     1 
ATOM   1306 O  O     . LYS A 1 170 ? 8.063  37.852 2.382   1.00  34.97  ? 164  LYS A O     1 
ATOM   1307 C  CB    . LYS A 1 170 ? 9.680  37.330 -0.359  1.00  35.85  ? 164  LYS A CB    1 
ATOM   1308 C  CG    . LYS A 1 170 ? 8.932  36.139 -0.911  1.00  39.67  ? 164  LYS A CG    1 
ATOM   1309 C  CD    . LYS A 1 170 ? 9.846  35.059 -1.411  1.00  42.36  ? 164  LYS A CD    1 
ATOM   1310 C  CE    . LYS A 1 170 ? 9.039  33.931 -2.033  1.00  43.12  ? 164  LYS A CE    1 
ATOM   1311 N  NZ    . LYS A 1 170 ? 8.259  34.401 -3.217  1.00  46.42  ? 164  LYS A NZ    1 
ATOM   1312 N  N     . VAL A 1 171 ? 6.717  37.245 0.662   1.00  34.97  ? 165  VAL A N     1 
ATOM   1313 C  CA    . VAL A 1 171 ? 5.724  36.575 1.474   1.00  35.86  ? 165  VAL A CA    1 
ATOM   1314 C  C     . VAL A 1 171 ? 5.653  35.114 1.043   1.00  35.42  ? 165  VAL A C     1 
ATOM   1315 O  O     . VAL A 1 171 ? 5.650  34.800 -0.150  1.00  35.58  ? 165  VAL A O     1 
ATOM   1316 C  CB    . VAL A 1 171 ? 4.310  37.174 1.278   1.00  37.46  ? 165  VAL A CB    1 
ATOM   1317 C  CG1   . VAL A 1 171 ? 3.309  36.412 2.140   1.00  37.36  ? 165  VAL A CG1   1 
ATOM   1318 C  CG2   . VAL A 1 171 ? 4.301  38.648 1.636   1.00  36.68  ? 165  VAL A CG2   1 
ATOM   1319 N  N     . ILE A 1 172 ? 5.630  34.218 2.017   1.00  35.18  ? 166  ILE A N     1 
ATOM   1320 C  CA    . ILE A 1 172 ? 5.483  32.806 1.729   1.00  34.77  ? 166  ILE A CA    1 
ATOM   1321 C  C     . ILE A 1 172 ? 4.168  32.450 2.428   1.00  36.57  ? 166  ILE A C     1 
ATOM   1322 O  O     . ILE A 1 172 ? 4.116  32.321 3.651   1.00  36.07  ? 166  ILE A O     1 
ATOM   1323 C  CB    . ILE A 1 172 ? 6.665  31.964 2.286   1.00  32.70  ? 166  ILE A CB    1 
ATOM   1324 C  CG1   . ILE A 1 172 ? 7.923  32.205 1.435   1.00  32.96  ? 166  ILE A CG1   1 
ATOM   1325 C  CG2   . ILE A 1 172 ? 6.305  30.485 2.272   1.00  32.40  ? 166  ILE A CG2   1 
ATOM   1326 C  CD1   . ILE A 1 172 ? 9.120  31.304 1.775   1.00  27.31  ? 166  ILE A CD1   1 
ATOM   1327 N  N     . ASP A 1 173 ? 3.096  32.348 1.647   1.00  39.73  ? 167  ASP A N     1 
ATOM   1328 C  CA    . ASP A 1 173 ? 1.775  32.030 2.189   1.00  41.90  ? 167  ASP A CA    1 
ATOM   1329 C  C     . ASP A 1 173 ? 1.649  30.535 2.435   1.00  42.59  ? 167  ASP A C     1 
ATOM   1330 O  O     . ASP A 1 173 ? 2.432  29.747 1.912   1.00  42.95  ? 167  ASP A O     1 
ATOM   1331 C  CB    . ASP A 1 173 ? 0.665  32.481 1.230   1.00  42.00  ? 167  ASP A CB    1 
ATOM   1332 C  CG    . ASP A 1 173 ? 0.742  31.791 -0.131  1.00  42.74  ? 167  ASP A CG    1 
ATOM   1333 O  OD1   . ASP A 1 173 ? 1.012  30.571 -0.184  1.00  43.82  ? 167  ASP A OD1   1 
ATOM   1334 O  OD2   . ASP A 1 173 ? 0.515  32.471 -1.153  1.00  42.85  ? 167  ASP A OD2   1 
ATOM   1335 N  N     . ASP A 1 174 ? 0.651  30.148 3.219   1.00  46.02  ? 168  ASP A N     1 
ATOM   1336 C  CA    . ASP A 1 174 ? 0.440  28.742 3.542   1.00  48.11  ? 168  ASP A CA    1 
ATOM   1337 C  C     . ASP A 1 174 ? 0.567  27.780 2.363   1.00  48.23  ? 168  ASP A C     1 
ATOM   1338 O  O     . ASP A 1 174 ? 1.083  26.673 2.521   1.00  48.83  ? 168  ASP A O     1 
ATOM   1339 C  CB    . ASP A 1 174 ? -0.914 28.570 4.223   1.00  48.74  ? 168  ASP A CB    1 
ATOM   1340 C  CG    . ASP A 1 174 ? -0.977 29.282 5.560   1.00  51.25  ? 168  ASP A CG    1 
ATOM   1341 O  OD1   . ASP A 1 174 ? -1.978 29.105 6.288   1.00  54.03  ? 168  ASP A OD1   1 
ATOM   1342 O  OD2   . ASP A 1 174 ? -0.026 30.023 5.885   1.00  50.73  ? 168  ASP A OD2   1 
ATOM   1343 N  N     . GLU A 1 175 ? 0.117  28.196 1.183   0.72  48.63  ? 169  GLU A N     1 
ATOM   1344 C  CA    . GLU A 1 175 ? 0.210  27.336 0.008   1.00  48.94  ? 169  GLU A CA    1 
ATOM   1345 C  C     . GLU A 1 175 ? 1.639  27.089 -0.433  1.00  47.63  ? 169  GLU A C     1 
ATOM   1346 O  O     . GLU A 1 175 ? 2.013  25.951 -0.712  0.84  48.24  ? 169  GLU A O     1 
ATOM   1347 C  CB    . GLU A 1 175 ? -0.554 27.922 -1.175  1.00  50.05  ? 169  GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1 175 ? -1.751 27.090 -1.581  0.22  52.66  ? 169  GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1 175 ? -2.110 27.267 -3.031  0.010 54.05  ? 169  GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1 175 ? -2.245 28.423 -3.488  0.44  55.09  ? 169  GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1 175 ? -2.258 26.236 -3.716  0.62  54.99  ? 169  GLU A OE2   1 
ATOM   1352 N  N     . GLU A 1 176 ? 2.437  28.148 -0.522  1.00  46.33  ? 170  GLU A N     1 
ATOM   1353 C  CA    . GLU A 1 176 ? 3.821  27.967 -0.941  1.00  45.18  ? 170  GLU A CA    1 
ATOM   1354 C  C     . GLU A 1 176 ? 4.602  27.193 0.113   1.00  42.77  ? 170  GLU A C     1 
ATOM   1355 O  O     . GLU A 1 176 ? 5.530  26.455 -0.218  1.00  42.41  ? 170  GLU A O     1 
ATOM   1356 C  CB    . GLU A 1 176 ? 4.506  29.308 -1.220  1.00  47.19  ? 170  GLU A CB    1 
ATOM   1357 C  CG    . GLU A 1 176 ? 5.867  29.126 -1.881  1.00  51.68  ? 170  GLU A CG    1 
ATOM   1358 C  CD    . GLU A 1 176 ? 6.529  30.429 -2.289  1.00  55.01  ? 170  GLU A CD    1 
ATOM   1359 O  OE1   . GLU A 1 176 ? 5.846  31.475 -2.291  1.00  57.69  ? 170  GLU A OE1   1 
ATOM   1360 O  OE2   . GLU A 1 176 ? 7.736  30.400 -2.625  1.00  56.64  ? 170  GLU A OE2   1 
ATOM   1361 N  N     . VAL A 1 177 ? 4.235  27.366 1.381   1.00  40.50  ? 171  VAL A N     1 
ATOM   1362 C  CA    . VAL A 1 177 ? 4.899  26.640 2.459   1.00  40.32  ? 171  VAL A CA    1 
ATOM   1363 C  C     . VAL A 1 177 ? 4.783  25.156 2.124   1.00  41.26  ? 171  VAL A C     1 
ATOM   1364 O  O     . VAL A 1 177 ? 5.785  24.438 2.064   1.00  41.31  ? 171  VAL A O     1 
ATOM   1365 C  CB    . VAL A 1 177 ? 4.224  26.908 3.832   1.00  39.87  ? 171  VAL A CB    1 
ATOM   1366 C  CG1   . VAL A 1 177 ? 4.673  25.871 4.863   1.00  39.44  ? 171  VAL A CG1   1 
ATOM   1367 C  CG2   . VAL A 1 177 ? 4.577  28.294 4.318   1.00  38.28  ? 171  VAL A CG2   1 
ATOM   1368 N  N     . LYS A 1 178 ? 3.551  24.709 1.888   1.00  41.94  ? 172  LYS A N     1 
ATOM   1369 C  CA    . LYS A 1 178 ? 3.294  23.318 1.545   1.00  41.61  ? 172  LYS A CA    1 
ATOM   1370 C  C     . LYS A 1 178 ? 4.125  22.896 0.337   1.00  40.55  ? 172  LYS A C     1 
ATOM   1371 O  O     . LYS A 1 178 ? 4.620  21.767 0.283   1.00  40.57  ? 172  LYS A O     1 
ATOM   1372 C  CB    . LYS A 1 178 ? 1.794  23.106 1.281   1.00  44.07  ? 172  LYS A CB    1 
ATOM   1373 C  CG    . LYS A 1 178 ? 0.930  23.096 2.556   1.00  47.19  ? 172  LYS A CG    1 
ATOM   1374 C  CD    . LYS A 1 178 ? -0.538 22.891 2.215   1.00  51.51  ? 172  LYS A CD    1 
ATOM   1375 C  CE    . LYS A 1 178 ? -1.421 22.977 3.447   1.00  54.20  ? 172  LYS A CE    1 
ATOM   1376 N  NZ    . LYS A 1 178 ? -2.342 24.152 3.376   1.00  58.14  ? 172  LYS A NZ    1 
ATOM   1377 N  N     . ARG A 1 179 ? 4.288  23.787 -0.634  1.00  39.92  ? 173  ARG A N     1 
ATOM   1378 C  CA    . ARG A 1 179 ? 5.093  23.451 -1.805  1.00  39.88  ? 173  ARG A CA    1 
ATOM   1379 C  C     . ARG A 1 179 ? 6.579  23.309 -1.442  0.78  38.71  ? 173  ARG A C     1 
ATOM   1380 O  O     . ARG A 1 179 ? 7.275  22.430 -1.956  1.00  36.36  ? 173  ARG A O     1 
ATOM   1381 C  CB    . ARG A 1 179 ? 4.944  24.527 -2.874  1.00  42.06  ? 173  ARG A CB    1 
ATOM   1382 C  CG    . ARG A 1 179 ? 5.777  24.296 -4.116  1.00  46.49  ? 173  ARG A CG    1 
ATOM   1383 C  CD    . ARG A 1 179 ? 6.093  25.629 -4.786  1.00  50.62  ? 173  ARG A CD    1 
ATOM   1384 N  NE    . ARG A 1 179 ? 4.891  26.403 -5.092  0.63  54.58  ? 173  ARG A NE    1 
ATOM   1385 C  CZ    . ARG A 1 179 ? 4.042  26.116 -6.074  0.010 55.99  ? 173  ARG A CZ    1 
ATOM   1386 N  NH1   . ARG A 1 179 ? 2.975  26.878 -6.274  0.15  57.07  ? 173  ARG A NH1   1 
ATOM   1387 N  NH2   . ARG A 1 179 ? 4.265  25.075 -6.864  0.08  57.29  ? 173  ARG A NH2   1 
ATOM   1388 N  N     . LEU A 1 180 ? 7.063  24.178 -0.557  1.00  37.66  ? 174  LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 180 ? 8.472  24.154 -0.152  1.00  38.00  ? 174  LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 180 ? 8.848  22.932 0.684   1.00  36.78  ? 174  LEU A C     1 
ATOM   1391 O  O     . LEU A 1 180 ? 9.961  22.425 0.587   1.00  35.98  ? 174  LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 180 ? 8.828  25.446 0.597   1.00  36.61  ? 174  LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 180 ? 8.804  26.712 -0.270  1.00  37.72  ? 174  LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 180 ? 9.206  27.931 0.544   1.00  37.73  ? 174  LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 180 ? 9.761  26.541 -1.444  1.00  39.75  ? 174  LEU A CD2   1 
ATOM   1396 N  N     . ILE A 1 181 ? 7.910  22.459 1.491   1.00  37.03  ? 175  ILE A N     1 
ATOM   1397 C  CA    . ILE A 1 181 ? 8.132  21.292 2.330   1.00  37.99  ? 175  ILE A CA    1 
ATOM   1398 C  C     . ILE A 1 181 ? 8.440  20.082 1.453   1.00  40.89  ? 175  ILE A C     1 
ATOM   1399 O  O     . ILE A 1 181 ? 9.081  19.116 1.885   1.00  39.93  ? 175  ILE A O     1 
ATOM   1400 C  CB    . ILE A 1 181 ? 6.885  21.023 3.186   1.00  37.56  ? 175  ILE A CB    1 
ATOM   1401 C  CG1   . ILE A 1 181 ? 6.766  22.120 4.245   1.00  35.97  ? 175  ILE A CG1   1 
ATOM   1402 C  CG2   . ILE A 1 181 ? 6.952  19.641 3.818   1.00  37.87  ? 175  ILE A CG2   1 
ATOM   1403 C  CD1   . ILE A 1 181 ? 5.538  22.012 5.112   1.00  35.87  ? 175  ILE A CD1   1 
ATOM   1404 N  N     . ARG A 1 182 ? 7.988  20.161 0.206   1.00  41.76  ? 176  ARG A N     1 
ATOM   1405 C  CA    . ARG A 1 182 ? 8.181  19.098 -0.769  1.00  43.05  ? 176  ARG A CA    1 
ATOM   1406 C  C     . ARG A 1 182 ? 9.288  19.474 -1.741  1.00  41.66  ? 176  ARG A C     1 
ATOM   1407 O  O     . ARG A 1 182 ? 10.043 18.624 -2.199  1.00  40.82  ? 176  ARG A O     1 
ATOM   1408 C  CB    . ARG A 1 182 ? 6.876  18.887 -1.551  1.00  45.47  ? 176  ARG A CB    1 
ATOM   1409 C  CG    . ARG A 1 182 ? 6.893  17.737 -2.555  1.00  47.75  ? 176  ARG A CG    1 
ATOM   1410 C  CD    . ARG A 1 182 ? 5.734  17.849 -3.553  1.00  48.79  ? 176  ARG A CD    1 
ATOM   1411 N  NE    . ARG A 1 182 ? 4.495  18.299 -2.920  1.00  50.82  ? 176  ARG A NE    1 
ATOM   1412 C  CZ    . ARG A 1 182 ? 3.936  19.487 -3.135  1.00  50.52  ? 176  ARG A CZ    1 
ATOM   1413 N  NH1   . ARG A 1 182 ? 4.501  20.347 -3.972  1.00  50.81  ? 176  ARG A NH1   1 
ATOM   1414 N  NH2   . ARG A 1 182 ? 2.815  19.819 -2.507  1.00  50.01  ? 176  ARG A NH2   1 
ATOM   1415 N  N     . GLU A 1 183 ? 9.384  20.766 -2.025  1.00  41.67  ? 177  GLU A N     1 
ATOM   1416 C  CA    . GLU A 1 183 ? 10.336 21.300 -2.991  1.00  42.30  ? 177  GLU A CA    1 
ATOM   1417 C  C     . GLU A 1 183 ? 11.700 21.772 -2.519  1.00  40.91  ? 177  GLU A C     1 
ATOM   1418 O  O     . GLU A 1 183 ? 12.688 21.662 -3.244  1.00  39.46  ? 177  GLU A O     1 
ATOM   1419 C  CB    . GLU A 1 183 ? 9.694  22.479 -3.715  1.00  45.66  ? 177  GLU A CB    1 
ATOM   1420 C  CG    . GLU A 1 183 ? 9.890  22.445 -5.192  1.00  50.31  ? 177  GLU A CG    1 
ATOM   1421 C  CD    . GLU A 1 183 ? 9.041  21.383 -5.812  1.00  52.09  ? 177  GLU A CD    1 
ATOM   1422 O  OE1   . GLU A 1 183 ? 7.817  21.611 -5.929  1.00  55.71  ? 177  GLU A OE1   1 
ATOM   1423 O  OE2   . GLU A 1 183 ? 9.591  20.318 -6.160  1.00  52.47  ? 177  GLU A OE2   1 
ATOM   1424 N  N     . LEU A 1 184 ? 11.750 22.329 -1.320  1.00  38.61  ? 178  LEU A N     1 
ATOM   1425 C  CA    . LEU A 1 184 ? 12.991 22.886 -0.818  1.00  36.93  ? 178  LEU A CA    1 
ATOM   1426 C  C     . LEU A 1 184 ? 14.131 21.928 -0.511  1.00  35.84  ? 178  LEU A C     1 
ATOM   1427 O  O     . LEU A 1 184 ? 13.958 20.923 0.166   1.00  34.03  ? 178  LEU A O     1 
ATOM   1428 C  CB    . LEU A 1 184 ? 12.712 23.742 0.418   1.00  34.85  ? 178  LEU A CB    1 
ATOM   1429 C  CG    . LEU A 1 184 ? 13.910 24.544 0.928   1.00  33.79  ? 178  LEU A CG    1 
ATOM   1430 C  CD1   . LEU A 1 184 ? 14.383 25.465 -0.176  1.00  32.61  ? 178  LEU A CD1   1 
ATOM   1431 C  CD2   . LEU A 1 184 ? 13.529 25.344 2.165   1.00  32.97  ? 178  LEU A CD2   1 
ATOM   1432 N  N     . ASP A 1 185 ? 15.306 22.268 -1.024  1.00  36.49  ? 179  ASP A N     1 
ATOM   1433 C  CA    . ASP A 1 185 ? 16.505 21.493 -0.765  1.00  37.40  ? 179  ASP A CA    1 
ATOM   1434 C  C     . ASP A 1 185 ? 16.660 21.585 0.763   1.00  36.05  ? 179  ASP A C     1 
ATOM   1435 O  O     . ASP A 1 185 ? 16.710 22.685 1.318   1.00  34.32  ? 179  ASP A O     1 
ATOM   1436 C  CB    . ASP A 1 185 ? 17.688 22.158 -1.455  1.00  40.91  ? 179  ASP A CB    1 
ATOM   1437 C  CG    . ASP A 1 185 ? 18.854 21.227 -1.636  1.00  46.45  ? 179  ASP A CG    1 
ATOM   1438 O  OD1   . ASP A 1 185 ? 19.235 20.541 -0.658  1.00  46.83  ? 179  ASP A OD1   1 
ATOM   1439 O  OD2   . ASP A 1 185 ? 19.393 21.189 -2.765  1.00  50.52  ? 179  ASP A OD2   1 
ATOM   1440 N  N     . ILE A 1 186 ? 16.713 20.439 1.436   1.00  33.57  ? 180  ILE A N     1 
ATOM   1441 C  CA    . ILE A 1 186 ? 16.824 20.407 2.889   1.00  33.43  ? 180  ILE A CA    1 
ATOM   1442 C  C     . ILE A 1 186 ? 18.063 21.172 3.372   1.00  34.25  ? 180  ILE A C     1 
ATOM   1443 O  O     . ILE A 1 186 ? 18.100 21.696 4.489   1.00  33.66  ? 180  ILE A O     1 
ATOM   1444 C  CB    . ILE A 1 186 ? 16.848 18.932 3.398   1.00  32.00  ? 180  ILE A CB    1 
ATOM   1445 C  CG1   . ILE A 1 186 ? 16.776 18.886 4.922   1.00  32.79  ? 180  ILE A CG1   1 
ATOM   1446 C  CG2   . ILE A 1 186 ? 18.101 18.229 2.925   1.00  29.74  ? 180  ILE A CG2   1 
ATOM   1447 C  CD1   . ILE A 1 186 ? 15.413 19.150 5.480   1.00  31.83  ? 180  ILE A CD1   1 
ATOM   1448 N  N     . ALA A 1 187 ? 19.075 21.258 2.521   1.00  34.60  ? 181  ALA A N     1 
ATOM   1449 C  CA    . ALA A 1 187 ? 20.282 21.971 2.894   1.00  33.77  ? 181  ALA A CA    1 
ATOM   1450 C  C     . ALA A 1 187 ? 19.966 23.452 3.071   1.00  35.02  ? 181  ALA A C     1 
ATOM   1451 O  O     . ALA A 1 187 ? 20.609 24.123 3.844   1.00  36.12  ? 181  ALA A O     1 
ATOM   1452 C  CB    . ALA A 1 187 ? 21.365 21.776 1.836   1.00  33.70  ? 181  ALA A CB    1 
ATOM   1453 N  N     . ASP A 1 188 ? 18.955 23.968 2.383   1.00  35.47  ? 182  ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 188 ? 18.631 25.381 2.524   1.00  34.20  ? 182  ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 188 ? 17.800 25.713 3.760   1.00  32.39  ? 182  ASP A C     1 
ATOM   1456 O  O     . ASP A 1 188 ? 17.451 26.873 3.991   1.00  31.39  ? 182  ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 188 ? 17.933 25.888 1.264   1.00  37.81  ? 182  ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 188 ? 18.857 25.894 0.061   1.00  41.05  ? 182  ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 188 ? 19.951 26.484 0.161   1.00  42.46  ? 182  ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 188 ? 18.493 25.312 -0.982  1.00  45.31  ? 182  ASP A OD2   1 
ATOM   1461 N  N     . VAL A 1 189 ? 17.488 24.702 4.561   1.00  29.26  ? 183  VAL A N     1 
ATOM   1462 C  CA    . VAL A 1 189 ? 16.724 24.934 5.778   1.00  27.59  ? 183  VAL A CA    1 
ATOM   1463 C  C     . VAL A 1 189 ? 17.680 25.433 6.853   1.00  28.23  ? 183  VAL A C     1 
ATOM   1464 O  O     . VAL A 1 189 ? 18.696 24.799 7.133   1.00  28.02  ? 183  VAL A O     1 
ATOM   1465 C  CB    . VAL A 1 189 ? 16.060 23.639 6.286   1.00  26.87  ? 183  VAL A CB    1 
ATOM   1466 C  CG1   . VAL A 1 189 ? 15.404 23.887 7.640   1.00  22.90  ? 183  VAL A CG1   1 
ATOM   1467 C  CG2   . VAL A 1 189 ? 15.044 23.146 5.275   1.00  26.95  ? 183  VAL A CG2   1 
ATOM   1468 N  N     . PRO A 1 190 ? 17.374 26.581 7.468   1.00  29.17  ? 184  PRO A N     1 
ATOM   1469 C  CA    . PRO A 1 190 ? 18.252 27.118 8.516   1.00  29.19  ? 184  PRO A CA    1 
ATOM   1470 C  C     . PRO A 1 190 ? 18.576 26.076 9.586   1.00  29.31  ? 184  PRO A C     1 
ATOM   1471 O  O     . PRO A 1 190 ? 17.707 25.308 10.011  1.00  27.46  ? 184  PRO A O     1 
ATOM   1472 C  CB    . PRO A 1 190 ? 17.435 28.286 9.074   1.00  30.88  ? 184  PRO A CB    1 
ATOM   1473 C  CG    . PRO A 1 190 ? 16.692 28.771 7.851   1.00  29.32  ? 184  PRO A CG    1 
ATOM   1474 C  CD    . PRO A 1 190 ? 16.222 27.471 7.234   1.00  30.29  ? 184  PRO A CD    1 
ATOM   1475 N  N     . GLY A 1 191 ? 19.830 26.044 10.021  1.00  30.42  ? 185  GLY A N     1 
ATOM   1476 C  CA    . GLY A 1 191 ? 20.225 25.093 11.046  1.00  28.33  ? 185  GLY A CA    1 
ATOM   1477 C  C     . GLY A 1 191 ? 20.804 23.822 10.467  1.00  28.89  ? 185  GLY A C     1 
ATOM   1478 O  O     . GLY A 1 191 ? 21.295 22.956 11.191  1.00  29.90  ? 185  GLY A O     1 
ATOM   1479 N  N     . ILE A 1 192 ? 20.749 23.699 9.149   1.00  29.48  ? 186  ILE A N     1 
ATOM   1480 C  CA    . ILE A 1 192 ? 21.276 22.518 8.491   1.00  30.71  ? 186  ILE A CA    1 
ATOM   1481 C  C     . ILE A 1 192 ? 22.556 22.884 7.746   1.00  31.60  ? 186  ILE A C     1 
ATOM   1482 O  O     . ILE A 1 192 ? 22.503 23.523 6.703   1.00  30.11  ? 186  ILE A O     1 
ATOM   1483 C  CB    . ILE A 1 192 ? 20.265 21.954 7.477   1.00  32.06  ? 186  ILE A CB    1 
ATOM   1484 C  CG1   . ILE A 1 192 ? 18.897 21.766 8.146   1.00  32.23  ? 186  ILE A CG1   1 
ATOM   1485 C  CG2   . ILE A 1 192 ? 20.794 20.647 6.893   1.00  33.14  ? 186  ILE A CG2   1 
ATOM   1486 C  CD1   . ILE A 1 192 ? 18.888 20.798 9.326   1.00  35.82  ? 186  ILE A CD1   1 
ATOM   1487 N  N     . GLY A 1 193 ? 23.703 22.481 8.289   1.00  32.42  ? 187  GLY A N     1 
ATOM   1488 C  CA    . GLY A 1 193 ? 24.975 22.780 7.649   1.00  33.54  ? 187  GLY A CA    1 
ATOM   1489 C  C     . GLY A 1 193 ? 25.477 21.616 6.823   1.00  33.09  ? 187  GLY A C     1 
ATOM   1490 O  O     . GLY A 1 193 ? 24.787 20.608 6.700   1.00  34.57  ? 187  GLY A O     1 
ATOM   1491 N  N     . ASN A 1 194 ? 26.678 21.744 6.264   1.00  35.27  ? 188  ASN A N     1 
ATOM   1492 C  CA    . ASN A 1 194 ? 27.262 20.688 5.432   1.00  37.25  ? 188  ASN A CA    1 
ATOM   1493 C  C     . ASN A 1 194 ? 27.280 19.346 6.151   1.00  36.06  ? 188  ASN A C     1 
ATOM   1494 O  O     . ASN A 1 194 ? 26.989 18.313 5.559   1.00  37.57  ? 188  ASN A O     1 
ATOM   1495 C  CB    . ASN A 1 194 ? 28.692 21.046 5.036   1.00  42.06  ? 188  ASN A CB    1 
ATOM   1496 C  CG    . ASN A 1 194 ? 28.859 22.514 4.736   1.00  47.34  ? 188  ASN A CG    1 
ATOM   1497 O  OD1   . ASN A 1 194 ? 28.208 23.356 5.354   1.00  52.33  ? 188  ASN A OD1   1 
ATOM   1498 N  ND2   . ASN A 1 194 ? 29.749 22.838 3.804   1.00  48.22  ? 188  ASN A ND2   1 
ATOM   1499 N  N     . ILE A 1 195 ? 27.627 19.360 7.430   1.00  34.92  ? 189  ILE A N     1 
ATOM   1500 C  CA    . ILE A 1 195 ? 27.683 18.122 8.183   1.00  34.59  ? 189  ILE A CA    1 
ATOM   1501 C  C     . ILE A 1 195 ? 26.326 17.452 8.254   1.00  35.34  ? 189  ILE A C     1 
ATOM   1502 O  O     . ILE A 1 195 ? 26.184 16.295 7.862   1.00  34.40  ? 189  ILE A O     1 
ATOM   1503 C  CB    . ILE A 1 195 ? 28.196 18.350 9.609   1.00  35.86  ? 189  ILE A CB    1 
ATOM   1504 C  CG1   . ILE A 1 195 ? 29.644 18.844 9.563   1.00  36.32  ? 189  ILE A CG1   1 
ATOM   1505 C  CG2   . ILE A 1 195 ? 28.088 17.061 10.404  1.00  35.62  ? 189  ILE A CG2   1 
ATOM   1506 C  CD1   . ILE A 1 195 ? 30.588 17.914 8.801   1.00  40.63  ? 189  ILE A CD1   1 
ATOM   1507 N  N     . THR A 1 196 ? 25.323 18.168 8.753   1.00  33.95  ? 190  THR A N     1 
ATOM   1508 C  CA    . THR A 1 196 ? 23.996 17.583 8.848   1.00  32.96  ? 190  THR A CA    1 
ATOM   1509 C  C     . THR A 1 196 ? 23.439 17.310 7.451   1.00  33.05  ? 190  THR A C     1 
ATOM   1510 O  O     . THR A 1 196 ? 22.735 16.326 7.243   1.00  30.71  ? 190  THR A O     1 
ATOM   1511 C  CB    . THR A 1 196 ? 23.021 18.496 9.619   1.00  31.57  ? 190  THR A CB    1 
ATOM   1512 O  OG1   . THR A 1 196 ? 23.529 18.729 10.939  1.00  31.42  ? 190  THR A OG1   1 
ATOM   1513 C  CG2   . THR A 1 196 ? 21.639 17.829 9.723   1.00  27.34  ? 190  THR A CG2   1 
ATOM   1514 N  N     . ALA A 1 197 ? 23.762 18.176 6.496   1.00  33.23  ? 191  ALA A N     1 
ATOM   1515 C  CA    . ALA A 1 197 ? 23.293 18.002 5.121   1.00  33.84  ? 191  ALA A CA    1 
ATOM   1516 C  C     . ALA A 1 197 ? 23.767 16.658 4.577   1.00  35.60  ? 191  ALA A C     1 
ATOM   1517 O  O     . ALA A 1 197 ? 22.999 15.916 3.962   1.00  36.57  ? 191  ALA A O     1 
ATOM   1518 C  CB    . ALA A 1 197 ? 23.816 19.130 4.243   1.00  31.68  ? 191  ALA A CB    1 
ATOM   1519 N  N     A GLU A 1 198 ? 25.042 16.356 4.805   0.50  35.63  ? 192  GLU A N     1 
ATOM   1520 N  N     B GLU A 1 198 ? 25.038 16.354 4.813   0.50  36.82  ? 192  GLU A N     1 
ATOM   1521 C  CA    A GLU A 1 198 ? 25.645 15.108 4.356   0.50  36.02  ? 192  GLU A CA    1 
ATOM   1522 C  CA    B GLU A 1 198 ? 25.639 15.112 4.353   0.50  38.25  ? 192  GLU A CA    1 
ATOM   1523 C  C     A GLU A 1 198 ? 25.004 13.899 5.045   0.50  37.65  ? 192  GLU A C     1 
ATOM   1524 C  C     B GLU A 1 198 ? 25.005 13.900 5.044   0.50  38.91  ? 192  GLU A C     1 
ATOM   1525 O  O     A GLU A 1 198 ? 24.764 12.871 4.411   0.50  38.46  ? 192  GLU A O     1 
ATOM   1526 O  O     B GLU A 1 198 ? 24.766 12.872 4.410   0.50  39.55  ? 192  GLU A O     1 
ATOM   1527 C  CB    A GLU A 1 198 ? 27.157 15.150 4.623   0.50  34.98  ? 192  GLU A CB    1 
ATOM   1528 C  CB    B GLU A 1 198 ? 27.150 15.156 4.606   0.50  39.56  ? 192  GLU A CB    1 
ATOM   1529 C  CG    A GLU A 1 198 ? 27.706 13.996 5.452   0.50  32.22  ? 192  GLU A CG    1 
ATOM   1530 C  CG    B GLU A 1 198 ? 27.992 14.430 3.561   0.50  42.36  ? 192  GLU A CG    1 
ATOM   1531 C  CD    A GLU A 1 198 ? 28.636 14.463 6.562   0.50  31.47  ? 192  GLU A CD    1 
ATOM   1532 C  CD    B GLU A 1 198 ? 27.566 14.748 2.137   0.50  41.28  ? 192  GLU A CD    1 
ATOM   1533 O  OE1   A GLU A 1 198 ? 29.738 14.972 6.258   0.50  30.31  ? 192  GLU A OE1   1 
ATOM   1534 O  OE1   B GLU A 1 198 ? 26.469 14.312 1.739   0.50  41.11  ? 192  GLU A OE1   1 
ATOM   1535 O  OE2   A GLU A 1 198 ? 28.257 14.322 7.743   0.50  26.77  ? 192  GLU A OE2   1 
ATOM   1536 O  OE2   B GLU A 1 198 ? 28.321 15.432 1.417   0.50  42.06  ? 192  GLU A OE2   1 
ATOM   1537 N  N     . LYS A 1 199 ? 24.721 14.020 6.338   1.00  36.96  ? 193  LYS A N     1 
ATOM   1538 C  CA    . LYS A 1 199 ? 24.103 12.919 7.071   1.00  38.99  ? 193  LYS A CA    1 
ATOM   1539 C  C     . LYS A 1 199 ? 22.698 12.668 6.528   1.00  38.32  ? 193  LYS A C     1 
ATOM   1540 O  O     . LYS A 1 199 ? 22.290 11.524 6.350   1.00  37.84  ? 193  LYS A O     1 
ATOM   1541 C  CB    . LYS A 1 199 ? 24.008 13.224 8.571   1.00  39.51  ? 193  LYS A CB    1 
ATOM   1542 C  CG    . LYS A 1 199 ? 25.335 13.511 9.265   1.00  41.07  ? 193  LYS A CG    1 
ATOM   1543 C  CD    . LYS A 1 199 ? 25.101 13.852 10.737  1.00  40.42  ? 193  LYS A CD    1 
ATOM   1544 C  CE    . LYS A 1 199 ? 26.369 14.369 11.403  1.00  42.94  ? 193  LYS A CE    1 
ATOM   1545 N  NZ    . LYS A 1 199 ? 26.149 14.761 12.830  1.00  42.18  ? 193  LYS A NZ    1 
ATOM   1546 N  N     . LEU A 1 200 ? 21.960 13.740 6.265   1.00  38.41  ? 194  LEU A N     1 
ATOM   1547 C  CA    . LEU A 1 200 ? 20.598 13.616 5.750   1.00  39.61  ? 194  LEU A CA    1 
ATOM   1548 C  C     . LEU A 1 200 ? 20.541 12.956 4.369   1.00  41.70  ? 194  LEU A C     1 
ATOM   1549 O  O     . LEU A 1 200 ? 19.571 12.260 4.052   1.00  41.81  ? 194  LEU A O     1 
ATOM   1550 C  CB    . LEU A 1 200 ? 19.912 14.985 5.713   1.00  36.44  ? 194  LEU A CB    1 
ATOM   1551 C  CG    . LEU A 1 200 ? 19.681 15.624 7.088   1.00  37.24  ? 194  LEU A CG    1 
ATOM   1552 C  CD1   . LEU A 1 200 ? 19.052 17.008 6.926   1.00  37.48  ? 194  LEU A CD1   1 
ATOM   1553 C  CD2   . LEU A 1 200 ? 18.778 14.722 7.922   1.00  36.01  ? 194  LEU A CD2   1 
ATOM   1554 N  N     . LYS A 1 201 ? 21.567 13.166 3.547   1.00  42.10  ? 195  LYS A N     1 
ATOM   1555 C  CA    . LYS A 1 201 ? 21.586 12.539 2.228   1.00  45.44  ? 195  LYS A CA    1 
ATOM   1556 C  C     . LYS A 1 201 ? 21.681 11.022 2.351   1.00  45.14  ? 195  LYS A C     1 
ATOM   1557 O  O     . LYS A 1 201 ? 20.858 10.297 1.794   1.00  45.73  ? 195  LYS A O     1 
ATOM   1558 C  CB    . LYS A 1 201 ? 22.761 13.040 1.394   1.00  46.58  ? 195  LYS A CB    1 
ATOM   1559 C  CG    . LYS A 1 201 ? 22.541 14.408 0.786   1.00  50.10  ? 195  LYS A CG    1 
ATOM   1560 C  CD    . LYS A 1 201 ? 23.709 14.782 -0.105  1.00  52.93  ? 195  LYS A CD    1 
ATOM   1561 C  CE    . LYS A 1 201 ? 23.565 16.186 -0.649  1.00  54.78  ? 195  LYS A CE    1 
ATOM   1562 N  NZ    . LYS A 1 201 ? 24.823 16.616 -1.322  1.00  57.42  ? 195  LYS A NZ    1 
ATOM   1563 N  N     . LYS A 1 202 ? 22.689 10.551 3.078   1.00  44.74  ? 196  LYS A N     1 
ATOM   1564 C  CA    . LYS A 1 202 ? 22.882 9.121  3.273   1.00  45.10  ? 196  LYS A CA    1 
ATOM   1565 C  C     . LYS A 1 202 ? 21.610 8.448  3.772   1.00  44.17  ? 196  LYS A C     1 
ATOM   1566 O  O     . LYS A 1 202 ? 21.381 7.272  3.508   1.00  44.77  ? 196  LYS A O     1 
ATOM   1567 C  CB    . LYS A 1 202 ? 24.025 8.862  4.257   1.00  45.43  ? 196  LYS A CB    1 
ATOM   1568 C  CG    . LYS A 1 202 ? 25.389 9.185  3.691   1.00  47.33  ? 196  LYS A CG    1 
ATOM   1569 C  CD    . LYS A 1 202 ? 26.486 8.898  4.703   1.00  49.03  ? 196  LYS A CD    1 
ATOM   1570 C  CE    . LYS A 1 202 ? 27.836 9.355  4.171   1.00  50.77  ? 196  LYS A CE    1 
ATOM   1571 N  NZ    . LYS A 1 202 ? 27.811 10.799 3.795   1.00  53.15  ? 196  LYS A NZ    1 
ATOM   1572 N  N     . LEU A 1 203 ? 20.786 9.190  4.502   1.00  43.61  ? 197  LEU A N     1 
ATOM   1573 C  CA    . LEU A 1 203 ? 19.533 8.634  5.004   1.00  41.69  ? 197  LEU A CA    1 
ATOM   1574 C  C     . LEU A 1 203 ? 18.431 8.753  3.948   1.00  41.12  ? 197  LEU A C     1 
ATOM   1575 O  O     . LEU A 1 203 ? 17.304 8.307  4.164   1.00  40.90  ? 197  LEU A O     1 
ATOM   1576 C  CB    . LEU A 1 203 ? 19.097 9.353  6.285   1.00  39.31  ? 197  LEU A CB    1 
ATOM   1577 C  CG    . LEU A 1 203 ? 19.824 9.046  7.599   1.00  38.31  ? 197  LEU A CG    1 
ATOM   1578 C  CD1   . LEU A 1 203 ? 19.234 9.912  8.711   1.00  35.43  ? 197  LEU A CD1   1 
ATOM   1579 C  CD2   . LEU A 1 203 ? 19.680 7.568  7.946   1.00  35.15  ? 197  LEU A CD2   1 
ATOM   1580 N  N     . GLY A 1 204 ? 18.764 9.352  2.808   1.00  39.46  ? 198  GLY A N     1 
ATOM   1581 C  CA    . GLY A 1 204 ? 17.790 9.517  1.746   1.00  40.59  ? 198  GLY A CA    1 
ATOM   1582 C  C     . GLY A 1 204 ? 16.822 10.668 1.971   1.00  43.08  ? 198  GLY A C     1 
ATOM   1583 O  O     . GLY A 1 204 ? 15.682 10.634 1.506   1.00  44.51  ? 198  GLY A O     1 
ATOM   1584 N  N     . ILE A 1 205 ? 17.271 11.695 2.683   1.00  42.93  ? 199  ILE A N     1 
ATOM   1585 C  CA    . ILE A 1 205 ? 16.434 12.852 2.967   1.00  41.77  ? 199  ILE A CA    1 
ATOM   1586 C  C     . ILE A 1 205 ? 17.004 14.082 2.257   1.00  41.56  ? 199  ILE A C     1 
ATOM   1587 O  O     . ILE A 1 205 ? 18.003 14.647 2.700   1.00  41.58  ? 199  ILE A O     1 
ATOM   1588 C  CB    . ILE A 1 205 ? 16.373 13.100 4.495   1.00  41.60  ? 199  ILE A CB    1 
ATOM   1589 C  CG1   . ILE A 1 205 ? 15.762 11.876 5.186   1.00  43.23  ? 199  ILE A CG1   1 
ATOM   1590 C  CG2   . ILE A 1 205 ? 15.566 14.347 4.800   1.00  41.21  ? 199  ILE A CG2   1 
ATOM   1591 C  CD1   . ILE A 1 205 ? 15.599 12.014 6.690   1.00  40.06  ? 199  ILE A CD1   1 
ATOM   1592 N  N     . ASN A 1 206 ? 16.384 14.483 1.149   1.00  39.98  ? 200  ASN A N     1 
ATOM   1593 C  CA    . ASN A 1 206 ? 16.854 15.647 0.401   1.00  40.70  ? 200  ASN A CA    1 
ATOM   1594 C  C     . ASN A 1 206 ? 15.834 16.793 0.461   1.00  39.82  ? 200  ASN A C     1 
ATOM   1595 O  O     . ASN A 1 206 ? 16.076 17.890 -0.045  1.00  37.49  ? 200  ASN A O     1 
ATOM   1596 C  CB    . ASN A 1 206 ? 17.139 15.260 -1.060  1.00  42.30  ? 200  ASN A CB    1 
ATOM   1597 C  CG    . ASN A 1 206 ? 18.183 14.144 -1.187  1.00  46.37  ? 200  ASN A CG    1 
ATOM   1598 O  OD1   . ASN A 1 206 ? 17.921 12.989 -0.850  1.00  48.43  ? 200  ASN A OD1   1 
ATOM   1599 N  ND2   . ASN A 1 206 ? 19.370 14.491 -1.669  1.00  47.67  ? 200  ASN A ND2   1 
ATOM   1600 N  N     . LYS A 1 207 ? 14.695 16.526 1.095   1.00  40.52  ? 201  LYS A N     1 
ATOM   1601 C  CA    . LYS A 1 207 ? 13.626 17.510 1.234   1.00  40.01  ? 201  LYS A CA    1 
ATOM   1602 C  C     . LYS A 1 207 ? 13.014 17.334 2.617   1.00  40.80  ? 201  LYS A C     1 
ATOM   1603 O  O     . LYS A 1 207 ? 13.105 16.253 3.197   1.00  40.86  ? 201  LYS A O     1 
ATOM   1604 C  CB    . LYS A 1 207 ? 12.543 17.266 0.180   1.00  41.79  ? 201  LYS A CB    1 
ATOM   1605 C  CG    . LYS A 1 207 ? 13.055 17.116 -1.246  1.00  42.13  ? 201  LYS A CG    1 
ATOM   1606 C  CD    . LYS A 1 207 ? 13.474 18.442 -1.851  1.00  42.99  ? 201  LYS A CD    1 
ATOM   1607 C  CE    . LYS A 1 207 ? 13.920 18.246 -3.293  1.00  44.54  ? 201  LYS A CE    1 
ATOM   1608 N  NZ    . LYS A 1 207 ? 14.307 19.524 -3.954  1.00  46.95  ? 201  LYS A NZ    1 
ATOM   1609 N  N     . LEU A 1 208 ? 12.393 18.385 3.150   1.00  39.56  ? 202  LEU A N     1 
ATOM   1610 C  CA    . LEU A 1 208 ? 11.770 18.282 4.460   1.00  38.86  ? 202  LEU A CA    1 
ATOM   1611 C  C     . LEU A 1 208 ? 10.843 17.077 4.504   1.00  39.46  ? 202  LEU A C     1 
ATOM   1612 O  O     . LEU A 1 208 ? 10.903 16.261 5.426   1.00  38.56  ? 202  LEU A O     1 
ATOM   1613 C  CB    . LEU A 1 208 ? 10.977 19.551 4.784   1.00  37.83  ? 202  LEU A CB    1 
ATOM   1614 C  CG    . LEU A 1 208 ? 11.823 20.726 5.283   1.00  39.67  ? 202  LEU A CG    1 
ATOM   1615 C  CD1   . LEU A 1 208 ? 10.953 21.953 5.482   1.00  38.73  ? 202  LEU A CD1   1 
ATOM   1616 C  CD2   . LEU A 1 208 ? 12.498 20.330 6.586   1.00  36.28  ? 202  LEU A CD2   1 
ATOM   1617 N  N     . VAL A 1 209 ? 9.993  16.965 3.490   1.00  41.18  ? 203  VAL A N     1 
ATOM   1618 C  CA    . VAL A 1 209 ? 9.032  15.875 3.412   1.00  42.43  ? 203  VAL A CA    1 
ATOM   1619 C  C     . VAL A 1 209 ? 9.673  14.508 3.652   1.00  42.20  ? 203  VAL A C     1 
ATOM   1620 O  O     . VAL A 1 209 ? 9.099  13.664 4.334   1.00  42.09  ? 203  VAL A O     1 
ATOM   1621 C  CB    . VAL A 1 209 ? 8.299  15.880 2.044   1.00  42.48  ? 203  VAL A CB    1 
ATOM   1622 C  CG1   . VAL A 1 209 ? 9.284  15.658 0.909   1.00  40.28  ? 203  VAL A CG1   1 
ATOM   1623 C  CG2   . VAL A 1 209 ? 7.214  14.824 2.042   1.00  42.26  ? 203  VAL A CG2   1 
ATOM   1624 N  N     . ASP A 1 210 ? 10.869 14.300 3.113   1.00  42.43  ? 204  ASP A N     1 
ATOM   1625 C  CA    . ASP A 1 210 ? 11.559 13.026 3.286   1.00  42.74  ? 204  ASP A CA    1 
ATOM   1626 C  C     . ASP A 1 210 ? 11.812 12.606 4.735   1.00  43.56  ? 204  ASP A C     1 
ATOM   1627 O  O     . ASP A 1 210 ? 12.037 11.421 4.993   1.00  43.96  ? 204  ASP A O     1 
ATOM   1628 C  CB    . ASP A 1 210 ? 12.894 13.032 2.540   1.00  43.00  ? 204  ASP A CB    1 
ATOM   1629 C  CG    . ASP A 1 210 ? 12.723 13.152 1.051   1.00  42.98  ? 204  ASP A CG    1 
ATOM   1630 O  OD1   . ASP A 1 210 ? 11.643 12.775 0.557   1.00  46.80  ? 204  ASP A OD1   1 
ATOM   1631 O  OD2   . ASP A 1 210 ? 13.667 13.604 0.371   1.00  44.16  ? 204  ASP A OD2   1 
ATOM   1632 N  N     . THR A 1 211 ? 11.783 13.550 5.680   1.00  42.08  ? 205  THR A N     1 
ATOM   1633 C  CA    . THR A 1 211 ? 12.035 13.202 7.081   1.00  42.35  ? 205  THR A CA    1 
ATOM   1634 C  C     . THR A 1 211 ? 10.895 12.418 7.711   1.00  43.31  ? 205  THR A C     1 
ATOM   1635 O  O     . THR A 1 211 ? 11.078 11.770 8.744   1.00  44.08  ? 205  THR A O     1 
ATOM   1636 C  CB    . THR A 1 211 ? 12.322 14.456 7.980   1.00  41.25  ? 205  THR A CB    1 
ATOM   1637 O  OG1   . THR A 1 211 ? 11.138 15.248 8.124   1.00  39.37  ? 205  THR A OG1   1 
ATOM   1638 C  CG2   . THR A 1 211 ? 13.426 15.305 7.373   1.00  39.63  ? 205  THR A CG2   1 
ATOM   1639 N  N     . LEU A 1 212 ? 9.723  12.472 7.087   1.00  45.04  ? 206  LEU A N     1 
ATOM   1640 C  CA    . LEU A 1 212 ? 8.556  11.758 7.590   1.00  47.38  ? 206  LEU A CA    1 
ATOM   1641 C  C     . LEU A 1 212 ? 8.540  10.298 7.124   1.00  48.78  ? 206  LEU A C     1 
ATOM   1642 O  O     . LEU A 1 212 ? 7.825  9.468  7.685   1.00  49.25  ? 206  LEU A O     1 
ATOM   1643 C  CB    . LEU A 1 212 ? 7.272  12.452 7.123   1.00  48.53  ? 206  LEU A CB    1 
ATOM   1644 C  CG    . LEU A 1 212 ? 7.097  13.933 7.478   1.00  49.38  ? 206  LEU A CG    1 
ATOM   1645 C  CD1   . LEU A 1 212 ? 5.754  14.428 6.969   1.00  49.26  ? 206  LEU A CD1   1 
ATOM   1646 C  CD2   . LEU A 1 212 ? 7.187  14.119 8.979   1.00  49.67  ? 206  LEU A CD2   1 
ATOM   1647 N  N     . SER A 1 213 ? 9.336  9.991  6.102   1.00  49.98  ? 207  SER A N     1 
ATOM   1648 C  CA    . SER A 1 213 ? 9.400  8.638  5.550   1.00  50.39  ? 207  SER A CA    1 
ATOM   1649 C  C     . SER A 1 213 ? 10.548 7.847  6.161   1.00  51.24  ? 207  SER A C     1 
ATOM   1650 O  O     . SER A 1 213 ? 11.038 6.882  5.568   1.00  51.08  ? 207  SER A O     1 
ATOM   1651 C  CB    . SER A 1 213 ? 9.599  8.695  4.033   1.00  50.62  ? 207  SER A CB    1 
ATOM   1652 O  OG    . SER A 1 213 ? 10.962 8.923  3.713   1.00  51.04  ? 207  SER A OG    1 
ATOM   1653 N  N     . ILE A 1 214 ? 10.971 8.252  7.350   1.00  51.36  ? 208  ILE A N     1 
ATOM   1654 C  CA    . ILE A 1 214 ? 12.080 7.594  8.025   1.00  50.70  ? 208  ILE A CA    1 
ATOM   1655 C  C     . ILE A 1 214 ? 11.713 7.263  9.462   1.00  50.28  ? 208  ILE A C     1 
ATOM   1656 O  O     . ILE A 1 214 ? 10.832 7.890  10.047  1.00  49.24  ? 208  ILE A O     1 
ATOM   1657 C  CB    . ILE A 1 214 ? 13.332 8.513  8.018   1.00  50.71  ? 208  ILE A CB    1 
ATOM   1658 C  CG1   . ILE A 1 214 ? 13.757 8.796  6.571   1.00  50.64  ? 208  ILE A CG1   1 
ATOM   1659 C  CG2   . ILE A 1 214 ? 14.476 7.877  8.804   1.00  49.15  ? 208  ILE A CG2   1 
ATOM   1660 C  CD1   . ILE A 1 214 ? 14.300 7.593  5.827   1.00  48.70  ? 208  ILE A CD1   1 
ATOM   1661 N  N     . GLU A 1 215 ? 12.386 6.258  10.013  1.00  52.08  ? 209  GLU A N     1 
ATOM   1662 C  CA    . GLU A 1 215 ? 12.170 5.845  11.395  1.00  52.71  ? 209  GLU A CA    1 
ATOM   1663 C  C     . GLU A 1 215 ? 12.755 6.925  12.289  1.00  51.26  ? 209  GLU A C     1 
ATOM   1664 O  O     . GLU A 1 215 ? 13.948 7.221  12.206  1.00  49.84  ? 209  GLU A O     1 
ATOM   1665 C  CB    . GLU A 1 215 ? 12.900 4.536  11.692  1.00  55.27  ? 209  GLU A CB    1 
ATOM   1666 C  CG    . GLU A 1 215 ? 12.337 3.297  11.033  1.00  59.63  ? 209  GLU A CG    1 
ATOM   1667 C  CD    . GLU A 1 215 ? 13.176 2.071  11.354  1.00  62.60  ? 209  GLU A CD    1 
ATOM   1668 O  OE1   . GLU A 1 215 ? 14.266 1.918  10.754  1.00  64.42  ? 209  GLU A OE1   1 
ATOM   1669 O  OE2   . GLU A 1 215 ? 12.755 1.273  12.221  1.00  63.75  ? 209  GLU A OE2   1 
ATOM   1670 N  N     . PHE A 1 216 ? 11.922 7.498  13.151  1.00  50.48  ? 210  PHE A N     1 
ATOM   1671 C  CA    . PHE A 1 216 ? 12.368 8.550  14.051  1.00  50.09  ? 210  PHE A CA    1 
ATOM   1672 C  C     . PHE A 1 216 ? 13.667 8.210  14.774  1.00  49.74  ? 210  PHE A C     1 
ATOM   1673 O  O     . PHE A 1 216 ? 14.603 9.004  14.761  1.00  48.74  ? 210  PHE A O     1 
ATOM   1674 C  CB    . PHE A 1 216 ? 11.286 8.867  15.080  1.00  49.63  ? 210  PHE A CB    1 
ATOM   1675 C  CG    . PHE A 1 216 ? 11.680 9.938  16.053  1.00  49.78  ? 210  PHE A CG    1 
ATOM   1676 C  CD1   . PHE A 1 216 ? 11.879 11.246 15.624  1.00  50.14  ? 210  PHE A CD1   1 
ATOM   1677 C  CD2   . PHE A 1 216 ? 11.856 9.641  17.399  1.00  49.24  ? 210  PHE A CD2   1 
ATOM   1678 C  CE1   . PHE A 1 216 ? 12.247 12.245 16.522  1.00  49.87  ? 210  PHE A CE1   1 
ATOM   1679 C  CE2   . PHE A 1 216 ? 12.222 10.627 18.304  1.00  50.41  ? 210  PHE A CE2   1 
ATOM   1680 C  CZ    . PHE A 1 216 ? 12.418 11.934 17.866  1.00  50.10  ? 210  PHE A CZ    1 
ATOM   1681 N  N     . ASP A 1 217 ? 13.730 7.038  15.402  1.00  49.60  ? 211  ASP A N     1 
ATOM   1682 C  CA    . ASP A 1 217 ? 14.938 6.642  16.123  1.00  49.56  ? 211  ASP A CA    1 
ATOM   1683 C  C     . ASP A 1 217 ? 16.152 6.573  15.215  1.00  47.96  ? 211  ASP A C     1 
ATOM   1684 O  O     . ASP A 1 217 ? 17.286 6.691  15.678  1.00  48.17  ? 211  ASP A O     1 
ATOM   1685 C  CB    . ASP A 1 217 ? 14.751 5.291  16.814  1.00  52.18  ? 211  ASP A CB    1 
ATOM   1686 C  CG    . ASP A 1 217 ? 13.914 5.391  18.067  1.00  54.62  ? 211  ASP A CG    1 
ATOM   1687 O  OD1   . ASP A 1 217 ? 13.861 4.393  18.818  1.00  56.33  ? 211  ASP A OD1   1 
ATOM   1688 O  OD2   . ASP A 1 217 ? 13.309 6.461  18.301  1.00  56.72  ? 211  ASP A OD2   1 
ATOM   1689 N  N     . LYS A 1 218 ? 15.922 6.363  13.925  1.00  46.38  ? 212  LYS A N     1 
ATOM   1690 C  CA    . LYS A 1 218 ? 17.036 6.318  12.996  1.00  45.63  ? 212  LYS A CA    1 
ATOM   1691 C  C     . LYS A 1 218 ? 17.478 7.766  12.794  1.00  42.59  ? 212  LYS A C     1 
ATOM   1692 O  O     . LYS A 1 218 ? 18.665 8.065  12.825  1.00  41.49  ? 212  LYS A O     1 
ATOM   1693 C  CB    . LYS A 1 218 ? 16.631 5.690  11.656  1.00  46.28  ? 212  LYS A CB    1 
ATOM   1694 C  CG    . LYS A 1 218 ? 17.847 5.183  10.875  1.00  48.31  ? 212  LYS A CG    1 
ATOM   1695 C  CD    . LYS A 1 218 ? 17.525 4.729  9.454   1.00  48.96  ? 212  LYS A CD    1 
ATOM   1696 C  CE    . LYS A 1 218 ? 18.815 4.314  8.748   1.00  48.97  ? 212  LYS A CE    1 
ATOM   1697 N  NZ    . LYS A 1 218 ? 18.649 4.000  7.299   1.00  49.44  ? 212  LYS A NZ    1 
ATOM   1698 N  N     . LEU A 1 219 ? 16.511 8.661  12.603  1.00  41.33  ? 213  LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 219 ? 16.808 10.085 12.430  1.00  40.94  ? 213  LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 219 ? 17.544 10.566 13.676  1.00  40.09  ? 213  LEU A C     1 
ATOM   1701 O  O     . LEU A 1 219 ? 18.675 11.039 13.606  1.00  39.19  ? 213  LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 219 ? 15.525 10.900 12.293  1.00  38.49  ? 213  LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 219 ? 15.407 11.878 11.122  1.00  40.69  ? 213  LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 219 ? 14.303 12.875 11.448  1.00  34.22  ? 213  LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 219 ? 16.731 12.603 10.864  1.00  37.63  ? 213  LEU A CD2   1 
ATOM   1706 N  N     . LYS A 1 220 ? 16.876 10.448 14.815  1.00  39.96  ? 214  LYS A N     1 
ATOM   1707 C  CA    . LYS A 1 220 ? 17.448 10.849 16.092  1.00  41.99  ? 214  LYS A CA    1 
ATOM   1708 C  C     . LYS A 1 220 ? 18.846 10.265 16.233  1.00  41.64  ? 214  LYS A C     1 
ATOM   1709 O  O     . LYS A 1 220 ? 19.761 10.930 16.717  1.00  41.63  ? 214  LYS A O     1 
ATOM   1710 C  CB    . LYS A 1 220 ? 16.558 10.355 17.236  1.00  42.83  ? 214  LYS A CB    1 
ATOM   1711 C  CG    . LYS A 1 220 ? 17.142 10.566 18.624  1.00  45.26  ? 214  LYS A CG    1 
ATOM   1712 C  CD    . LYS A 1 220 ? 16.133 10.216 19.707  1.00  46.17  ? 214  LYS A CD    1 
ATOM   1713 C  CE    . LYS A 1 220 ? 16.708 10.498 21.088  1.00  49.50  ? 214  LYS A CE    1 
ATOM   1714 N  NZ    . LYS A 1 220 ? 15.706 10.353 22.186  1.00  48.34  ? 214  LYS A NZ    1 
ATOM   1715 N  N     . GLY A 1 221 ? 19.007 9.023  15.792  1.00  40.88  ? 215  GLY A N     1 
ATOM   1716 C  CA    . GLY A 1 221 ? 20.299 8.376  15.889  1.00  41.79  ? 215  GLY A CA    1 
ATOM   1717 C  C     . GLY A 1 221 ? 21.391 9.059  15.090  1.00  42.37  ? 215  GLY A C     1 
ATOM   1718 O  O     . GLY A 1 221 ? 22.532 9.147  15.551  1.00  44.01  ? 215  GLY A O     1 
ATOM   1719 N  N     . MET A 1 222 ? 21.060 9.567  13.906  1.00  41.87  ? 216  MET A N     1 
ATOM   1720 C  CA    . MET A 1 222 ? 22.080 10.201 13.085  1.00  42.69  ? 216  MET A CA    1 
ATOM   1721 C  C     . MET A 1 222 ? 22.261 11.714 13.201  1.00  41.02  ? 216  MET A C     1 
ATOM   1722 O  O     . MET A 1 222 ? 23.350 12.211 12.915  1.00  40.53  ? 216  MET A O     1 
ATOM   1723 C  CB    . MET A 1 222 ? 21.893 9.826  11.609  1.00  47.73  ? 216  MET A CB    1 
ATOM   1724 C  CG    . MET A 1 222 ? 23.220 9.808  10.834  1.00  54.06  ? 216  MET A CG    1 
ATOM   1725 S  SD    . MET A 1 222 ? 23.097 9.235  9.118   1.00  62.95  ? 216  MET A SD    1 
ATOM   1726 C  CE    . MET A 1 222 ? 24.767 9.541  8.504   1.00  59.95  ? 216  MET A CE    1 
ATOM   1727 N  N     . ILE A 1 223 ? 21.237 12.464 13.604  1.00  36.32  ? 217  ILE A N     1 
ATOM   1728 C  CA    . ILE A 1 223 ? 21.438 13.904 13.713  1.00  34.26  ? 217  ILE A CA    1 
ATOM   1729 C  C     . ILE A 1 223 ? 21.121 14.466 15.084  1.00  34.61  ? 217  ILE A C     1 
ATOM   1730 O  O     . ILE A 1 223 ? 21.337 15.647 15.339  1.00  34.68  ? 217  ILE A O     1 
ATOM   1731 C  CB    . ILE A 1 223 ? 20.639 14.692 12.632  1.00  33.43  ? 217  ILE A CB    1 
ATOM   1732 C  CG1   . ILE A 1 223 ? 19.137 14.614 12.898  1.00  30.27  ? 217  ILE A CG1   1 
ATOM   1733 C  CG2   . ILE A 1 223 ? 20.973 14.149 11.247  1.00  29.76  ? 217  ILE A CG2   1 
ATOM   1734 C  CD1   . ILE A 1 223 ? 18.324 15.446 11.936  1.00  27.07  ? 217  ILE A CD1   1 
ATOM   1735 N  N     . GLY A 1 224 ? 20.628 13.612 15.975  1.00  35.10  ? 218  GLY A N     1 
ATOM   1736 C  CA    . GLY A 1 224 ? 20.306 14.060 17.313  1.00  34.09  ? 218  GLY A CA    1 
ATOM   1737 C  C     . GLY A 1 224 ? 18.822 14.293 17.507  1.00  33.66  ? 218  GLY A C     1 
ATOM   1738 O  O     . GLY A 1 224 ? 18.096 14.592 16.562  1.00  32.53  ? 218  GLY A O     1 
ATOM   1739 N  N     . GLU A 1 225 ? 18.379 14.159 18.749  1.00  34.34  ? 219  GLU A N     1 
ATOM   1740 C  CA    . GLU A 1 225 ? 16.978 14.333 19.097  1.00  36.73  ? 219  GLU A CA    1 
ATOM   1741 C  C     . GLU A 1 225 ? 16.407 15.706 18.759  1.00  34.70  ? 219  GLU A C     1 
ATOM   1742 O  O     . GLU A 1 225 ? 15.341 15.812 18.154  1.00  33.93  ? 219  GLU A O     1 
ATOM   1743 C  CB    . GLU A 1 225 ? 16.783 14.054 20.589  1.00  39.41  ? 219  GLU A CB    1 
ATOM   1744 C  CG    . GLU A 1 225 ? 15.373 14.307 21.077  1.00  46.48  ? 219  GLU A CG    1 
ATOM   1745 C  CD    . GLU A 1 225 ? 14.923 13.290 22.109  1.00  49.59  ? 219  GLU A CD    1 
ATOM   1746 O  OE1   . GLU A 1 225 ? 15.292 13.434 23.294  1.00  50.84  ? 219  GLU A OE1   1 
ATOM   1747 O  OE2   . GLU A 1 225 ? 14.209 12.336 21.721  1.00  51.89  ? 219  GLU A OE2   1 
ATOM   1748 N  N     . ALA A 1 226 ? 17.118 16.755 19.156  1.00  34.21  ? 220  ALA A N     1 
ATOM   1749 C  CA    . ALA A 1 226 ? 16.671 18.127 18.920  1.00  31.85  ? 220  ALA A CA    1 
ATOM   1750 C  C     . ALA A 1 226 ? 16.492 18.444 17.441  1.00  31.65  ? 220  ALA A C     1 
ATOM   1751 O  O     . ALA A 1 226 ? 15.439 18.927 17.019  1.00  29.99  ? 220  ALA A O     1 
ATOM   1752 C  CB    . ALA A 1 226 ? 17.658 19.109 19.549  1.00  32.80  ? 220  ALA A CB    1 
ATOM   1753 N  N     . LYS A 1 227 ? 17.522 18.169 16.652  1.00  30.12  ? 221  LYS A N     1 
ATOM   1754 C  CA    . LYS A 1 227 ? 17.470 18.446 15.224  1.00  29.16  ? 221  LYS A CA    1 
ATOM   1755 C  C     . LYS A 1 227 ? 16.381 17.609 14.556  1.00  29.26  ? 221  LYS A C     1 
ATOM   1756 O  O     . LYS A 1 227 ? 15.656 18.092 13.680  1.00  28.53  ? 221  LYS A O     1 
ATOM   1757 C  CB    . LYS A 1 227 ? 18.825 18.145 14.593  1.00  31.68  ? 221  LYS A CB    1 
ATOM   1758 C  CG    . LYS A 1 227 ? 19.019 18.760 13.219  1.00  35.23  ? 221  LYS A CG    1 
ATOM   1759 C  CD    . LYS A 1 227 ? 19.499 20.200 13.298  1.00  40.14  ? 221  LYS A CD    1 
ATOM   1760 C  CE    . LYS A 1 227 ? 20.972 20.264 13.682  1.00  41.60  ? 221  LYS A CE    1 
ATOM   1761 N  NZ    . LYS A 1 227 ? 21.725 19.160 13.026  1.00  47.40  ? 221  LYS A NZ    1 
ATOM   1762 N  N     . ALA A 1 228 ? 16.271 16.352 14.979  1.00  27.75  ? 222  ALA A N     1 
ATOM   1763 C  CA    . ALA A 1 228 ? 15.276 15.435 14.439  1.00  29.20  ? 222  ALA A CA    1 
ATOM   1764 C  C     . ALA A 1 228 ? 13.860 15.974 14.626  1.00  28.38  ? 222  ALA A C     1 
ATOM   1765 O  O     . ALA A 1 228 ? 13.059 15.958 13.694  1.00  29.45  ? 222  ALA A O     1 
ATOM   1766 C  CB    . ALA A 1 228 ? 15.411 14.064 15.113  1.00  28.59  ? 222  ALA A CB    1 
ATOM   1767 N  N     . LYS A 1 229 ? 13.560 16.453 15.830  1.00  28.27  ? 223  LYS A N     1 
ATOM   1768 C  CA    . LYS A 1 229 ? 12.234 16.994 16.136  1.00  29.88  ? 223  LYS A CA    1 
ATOM   1769 C  C     . LYS A 1 229 ? 11.975 18.313 15.418  1.00  28.78  ? 223  LYS A C     1 
ATOM   1770 O  O     . LYS A 1 229 ? 10.840 18.618 15.056  1.00  29.57  ? 223  LYS A O     1 
ATOM   1771 C  CB    . LYS A 1 229 ? 12.072 17.169 17.650  1.00  30.58  ? 223  LYS A CB    1 
ATOM   1772 C  CG    . LYS A 1 229 ? 12.040 15.845 18.401  1.00  32.06  ? 223  LYS A CG    1 
ATOM   1773 C  CD    . LYS A 1 229 ? 11.819 16.035 19.894  1.00  33.88  ? 223  LYS A CD    1 
ATOM   1774 C  CE    . LYS A 1 229 ? 11.675 14.686 20.590  1.00  38.96  ? 223  LYS A CE    1 
ATOM   1775 N  NZ    . LYS A 1 229 ? 11.494 14.811 22.067  1.00  41.76  ? 223  LYS A NZ    1 
ATOM   1776 N  N     . TYR A 1 230 ? 13.035 19.087 15.213  1.00  28.68  ? 224  TYR A N     1 
ATOM   1777 C  CA    . TYR A 1 230 ? 12.960 20.364 14.508  1.00  28.11  ? 224  TYR A CA    1 
ATOM   1778 C  C     . TYR A 1 230 ? 12.524 20.125 13.064  1.00  25.54  ? 224  TYR A C     1 
ATOM   1779 O  O     . TYR A 1 230 ? 11.578 20.745 12.575  1.00  26.02  ? 224  TYR A O     1 
ATOM   1780 C  CB    . TYR A 1 230 ? 14.344 21.038 14.532  1.00  28.51  ? 224  TYR A CB    1 
ATOM   1781 C  CG    . TYR A 1 230 ? 14.538 22.227 13.604  1.00  29.70  ? 224  TYR A CG    1 
ATOM   1782 C  CD1   . TYR A 1 230 ? 13.804 23.409 13.769  1.00  29.34  ? 224  TYR A CD1   1 
ATOM   1783 C  CD2   . TYR A 1 230 ? 15.525 22.199 12.614  1.00  30.84  ? 224  TYR A CD2   1 
ATOM   1784 C  CE1   . TYR A 1 230 ? 14.061 24.536 12.975  1.00  27.81  ? 224  TYR A CE1   1 
ATOM   1785 C  CE2   . TYR A 1 230 ? 15.786 23.312 11.820  1.00  28.96  ? 224  TYR A CE2   1 
ATOM   1786 C  CZ    . TYR A 1 230 ? 15.054 24.480 12.006  1.00  30.07  ? 224  TYR A CZ    1 
ATOM   1787 O  OH    . TYR A 1 230 ? 15.344 25.583 11.221  1.00  27.72  ? 224  TYR A OH    1 
ATOM   1788 N  N     . LEU A 1 231 ? 13.218 19.228 12.377  1.00  23.76  ? 225  LEU A N     1 
ATOM   1789 C  CA    . LEU A 1 231 ? 12.888 18.936 10.989  1.00  25.33  ? 225  LEU A CA    1 
ATOM   1790 C  C     . LEU A 1 231 ? 11.526 18.258 10.813  1.00  27.62  ? 225  LEU A C     1 
ATOM   1791 O  O     . LEU A 1 231 ? 10.750 18.640 9.931   1.00  27.41  ? 225  LEU A O     1 
ATOM   1792 C  CB    . LEU A 1 231 ? 13.981 18.079 10.354  1.00  25.97  ? 225  LEU A CB    1 
ATOM   1793 C  CG    . LEU A 1 231 ? 15.302 18.815 10.123  1.00  26.44  ? 225  LEU A CG    1 
ATOM   1794 C  CD1   . LEU A 1 231 ? 16.346 17.861 9.579   1.00  27.31  ? 225  LEU A CD1   1 
ATOM   1795 C  CD2   . LEU A 1 231 ? 15.061 19.954 9.144   1.00  27.41  ? 225  LEU A CD2   1 
ATOM   1796 N  N     . ILE A 1 232 ? 11.237 17.252 11.634  1.00  28.25  ? 226  ILE A N     1 
ATOM   1797 C  CA    . ILE A 1 232 ? 9.955  16.569 11.527  1.00  32.67  ? 226  ILE A CA    1 
ATOM   1798 C  C     . ILE A 1 232 ? 8.866  17.610 11.699  1.00  32.47  ? 226  ILE A C     1 
ATOM   1799 O  O     . ILE A 1 232 ? 7.942  17.691 10.893  1.00  33.47  ? 226  ILE A O     1 
ATOM   1800 C  CB    . ILE A 1 232 ? 9.808  15.468 12.601  1.00  33.71  ? 226  ILE A CB    1 
ATOM   1801 C  CG1   . ILE A 1 232 ? 10.721 14.292 12.249  1.00  34.87  ? 226  ILE A CG1   1 
ATOM   1802 C  CG2   . ILE A 1 232 ? 8.361  15.000 12.683  1.00  37.50  ? 226  ILE A CG2   1 
ATOM   1803 C  CD1   . ILE A 1 232 ? 10.873 13.271 13.367  1.00  38.82  ? 226  ILE A CD1   1 
ATOM   1804 N  N     . SER A 1 233 ? 9.011  18.429 12.735  1.00  32.35  ? 227  SER A N     1 
ATOM   1805 C  CA    . SER A 1 233 ? 8.052  19.476 13.040  1.00  33.34  ? 227  SER A CA    1 
ATOM   1806 C  C     . SER A 1 233 ? 7.788  20.411 11.865  1.00  35.35  ? 227  SER A C     1 
ATOM   1807 O  O     . SER A 1 233 ? 6.645  20.812 11.634  1.00  34.40  ? 227  SER A O     1 
ATOM   1808 C  CB    . SER A 1 233 ? 8.540  20.289 14.233  1.00  35.64  ? 227  SER A CB    1 
ATOM   1809 O  OG    . SER A 1 233 ? 7.528  21.167 14.690  1.00  41.47  ? 227  SER A OG    1 
ATOM   1810 N  N     . LEU A 1 234 ? 8.844  20.769 11.132  1.00  35.58  ? 228  LEU A N     1 
ATOM   1811 C  CA    . LEU A 1 234 ? 8.712  21.656 9.979   1.00  35.87  ? 228  LEU A CA    1 
ATOM   1812 C  C     . LEU A 1 234 ? 8.067  20.939 8.804   1.00  37.50  ? 228  LEU A C     1 
ATOM   1813 O  O     . LEU A 1 234 ? 7.327  21.542 8.038   1.00  38.21  ? 228  LEU A O     1 
ATOM   1814 C  CB    . LEU A 1 234 ? 10.081 22.198 9.552   1.00  33.70  ? 228  LEU A CB    1 
ATOM   1815 C  CG    . LEU A 1 234 ? 10.694 23.330 10.381  1.00  35.59  ? 228  LEU A CG    1 
ATOM   1816 C  CD1   . LEU A 1 234 ? 12.201 23.365 10.145  1.00  35.05  ? 228  LEU A CD1   1 
ATOM   1817 C  CD2   . LEU A 1 234 ? 10.046 24.666 10.009  1.00  31.22  ? 228  LEU A CD2   1 
ATOM   1818 N  N     . ALA A 1 235 ? 8.362  19.653 8.655   1.00  39.25  ? 229  ALA A N     1 
ATOM   1819 C  CA    . ALA A 1 235 ? 7.793  18.864 7.571   1.00  39.93  ? 229  ALA A CA    1 
ATOM   1820 C  C     . ALA A 1 235 ? 6.290  18.708 7.774   1.00  40.95  ? 229  ALA A C     1 
ATOM   1821 O  O     . ALA A 1 235 ? 5.532  18.638 6.807   1.00  40.79  ? 229  ALA A O     1 
ATOM   1822 C  CB    . ALA A 1 235 ? 8.460  17.490 7.515   1.00  39.52  ? 229  ALA A CB    1 
ATOM   1823 N  N     . ARG A 1 236 ? 5.865  18.654 9.035   1.00  41.52  ? 230  ARG A N     1 
ATOM   1824 C  CA    . ARG A 1 236 ? 4.450  18.506 9.360   1.00  42.65  ? 230  ARG A CA    1 
ATOM   1825 C  C     . ARG A 1 236 ? 3.748  19.844 9.366   1.00  43.70  ? 230  ARG A C     1 
ATOM   1826 O  O     . ARG A 1 236 ? 2.609  19.948 9.824   1.00  43.14  ? 230  ARG A O     1 
ATOM   1827 C  CB    . ARG A 1 236 ? 4.273  17.873 10.735  1.00  42.93  ? 230  ARG A CB    1 
ATOM   1828 C  CG    . ARG A 1 236 ? 4.720  16.443 10.824  1.00  45.23  ? 230  ARG A CG    1 
ATOM   1829 C  CD    . ARG A 1 236 ? 4.403  15.876 12.193  1.00  47.29  ? 230  ARG A CD    1 
ATOM   1830 N  NE    . ARG A 1 236 ? 4.846  14.491 12.289  1.00  50.93  ? 230  ARG A NE    1 
ATOM   1831 C  CZ    . ARG A 1 236 ? 5.024  13.835 13.430  1.00  51.19  ? 230  ARG A CZ    1 
ATOM   1832 N  NH1   . ARG A 1 236 ? 4.797  14.437 14.592  1.00  52.31  ? 230  ARG A NH1   1 
ATOM   1833 N  NH2   . ARG A 1 236 ? 5.439  12.575 13.406  1.00  50.58  ? 230  ARG A NH2   1 
ATOM   1834 N  N     . ASP A 1 237 ? 4.433  20.866 8.862   1.00  44.57  ? 231  ASP A N     1 
ATOM   1835 C  CA    . ASP A 1 237 ? 3.882  22.214 8.830   1.00  44.07  ? 231  ASP A CA    1 
ATOM   1836 C  C     . ASP A 1 237 ? 3.381  22.492 10.237  1.00  42.58  ? 231  ASP A C     1 
ATOM   1837 O  O     . ASP A 1 237 ? 2.282  23.013 10.432  1.00  41.04  ? 231  ASP A O     1 
ATOM   1838 C  CB    . ASP A 1 237 ? 2.721  22.306 7.831   1.00  45.84  ? 231  ASP A CB    1 
ATOM   1839 C  CG    . ASP A 1 237 ? 2.364  23.748 7.478   1.00  48.21  ? 231  ASP A CG    1 
ATOM   1840 O  OD1   . ASP A 1 237 ? 2.514  24.634 8.348   1.00  50.10  ? 231  ASP A OD1   1 
ATOM   1841 O  OD2   . ASP A 1 237 ? 1.924  23.995 6.333   1.00  49.79  ? 231  ASP A OD2   1 
ATOM   1842 N  N     . GLU A 1 238 ? 4.198  22.121 11.217  1.00  42.87  ? 232  GLU A N     1 
ATOM   1843 C  CA    . GLU A 1 238 ? 3.850  22.313 12.620  1.00  44.00  ? 232  GLU A CA    1 
ATOM   1844 C  C     . GLU A 1 238 ? 4.848  23.138 13.432  1.00  43.08  ? 232  GLU A C     1 
ATOM   1845 O  O     . GLU A 1 238 ? 4.591  23.432 14.597  1.00  42.27  ? 232  GLU A O     1 
ATOM   1846 C  CB    . GLU A 1 238 ? 3.657  20.956 13.303  1.00  44.81  ? 232  GLU A CB    1 
ATOM   1847 C  CG    . GLU A 1 238 ? 2.430  20.203 12.840  1.00  47.14  ? 232  GLU A CG    1 
ATOM   1848 C  CD    . GLU A 1 238 ? 2.099  19.014 13.727  1.00  48.81  ? 232  GLU A CD    1 
ATOM   1849 O  OE1   . GLU A 1 238 ? 2.523  18.987 14.906  1.00  48.31  ? 232  GLU A OE1   1 
ATOM   1850 O  OE2   . GLU A 1 238 ? 1.393  18.111 13.241  1.00  50.84  ? 232  GLU A OE2   1 
ATOM   1851 N  N     . TYR A 1 239 ? 5.991  23.492 12.842  1.00  43.28  ? 233  TYR A N     1 
ATOM   1852 C  CA    . TYR A 1 239 ? 6.978  24.292 13.573  1.00  40.04  ? 233  TYR A CA    1 
ATOM   1853 C  C     . TYR A 1 239 ? 6.289  25.586 13.968  1.00  38.83  ? 233  TYR A C     1 
ATOM   1854 O  O     . TYR A 1 239 ? 5.619  26.213 13.151  1.00  36.64  ? 233  TYR A O     1 
ATOM   1855 C  CB    . TYR A 1 239 ? 8.194  24.613 12.703  1.00  39.09  ? 233  TYR A CB    1 
ATOM   1856 C  CG    . TYR A 1 239 ? 9.200  25.518 13.392  1.00  38.92  ? 233  TYR A CG    1 
ATOM   1857 C  CD1   . TYR A 1 239 ? 10.222 24.995 14.194  1.00  37.36  ? 233  TYR A CD1   1 
ATOM   1858 C  CD2   . TYR A 1 239 ? 9.132  26.903 13.234  1.00  38.45  ? 233  TYR A CD2   1 
ATOM   1859 C  CE1   . TYR A 1 239 ? 11.158 25.842 14.816  1.00  38.17  ? 233  TYR A CE1   1 
ATOM   1860 C  CE2   . TYR A 1 239 ? 10.052 27.753 13.848  1.00  38.37  ? 233  TYR A CE2   1 
ATOM   1861 C  CZ    . TYR A 1 239 ? 11.063 27.222 14.632  1.00  39.29  ? 233  TYR A CZ    1 
ATOM   1862 O  OH    . TYR A 1 239 ? 11.974 28.091 15.198  1.00  39.00  ? 233  TYR A OH    1 
ATOM   1863 N  N     . ASN A 1 240 ? 6.457  26.010 15.211  1.00  39.01  ? 234  ASN A N     1 
ATOM   1864 C  CA    . ASN A 1 240 ? 5.773  27.221 15.614  1.00  41.10  ? 234  ASN A CA    1 
ATOM   1865 C  C     . ASN A 1 240 ? 6.393  27.902 16.824  1.00  41.30  ? 234  ASN A C     1 
ATOM   1866 O  O     . ASN A 1 240 ? 5.682  28.320 17.733  1.00  41.09  ? 234  ASN A O     1 
ATOM   1867 C  CB    . ASN A 1 240 ? 4.308  26.872 15.890  1.00  42.91  ? 234  ASN A CB    1 
ATOM   1868 C  CG    . ASN A 1 240 ? 3.375  28.021 15.615  1.00  45.19  ? 234  ASN A CG    1 
ATOM   1869 O  OD1   . ASN A 1 240 ? 3.319  28.987 16.370  1.00  48.46  ? 234  ASN A OD1   1 
ATOM   1870 N  ND2   . ASN A 1 240 ? 2.637  27.926 14.519  1.00  48.12  ? 234  ASN A ND2   1 
ATOM   1871 N  N     . GLU A 1 241 ? 7.716  28.026 16.834  1.00  42.07  ? 235  GLU A N     1 
ATOM   1872 C  CA    . GLU A 1 241 ? 8.387  28.662 17.959  1.00  41.59  ? 235  GLU A CA    1 
ATOM   1873 C  C     . GLU A 1 241 ? 8.003  30.119 18.113  1.00  40.99  ? 235  GLU A C     1 
ATOM   1874 O  O     . GLU A 1 241 ? 7.894  30.861 17.139  1.00  39.72  ? 235  GLU A O     1 
ATOM   1875 C  CB    . GLU A 1 241 ? 9.908  28.549 17.828  1.00  43.77  ? 235  GLU A CB    1 
ATOM   1876 C  CG    . GLU A 1 241 ? 10.416 27.133 18.006  1.00  48.88  ? 235  GLU A CG    1 
ATOM   1877 C  CD    . GLU A 1 241 ? 9.877  26.491 19.277  1.00  50.51  ? 235  GLU A CD    1 
ATOM   1878 O  OE1   . GLU A 1 241 ? 10.241 26.949 20.376  1.00  52.21  ? 235  GLU A OE1   1 
ATOM   1879 O  OE2   . GLU A 1 241 ? 9.080  25.534 19.177  1.00  53.35  ? 235  GLU A OE2   1 
ATOM   1880 N  N     . PRO A 1 242 ? 7.785  30.546 19.359  1.00  40.14  ? 236  PRO A N     1 
ATOM   1881 C  CA    . PRO A 1 242 ? 7.411  31.923 19.679  1.00  40.16  ? 236  PRO A CA    1 
ATOM   1882 C  C     . PRO A 1 242 ? 8.597  32.866 19.524  1.00  40.16  ? 236  PRO A C     1 
ATOM   1883 O  O     . PRO A 1 242 ? 9.752  32.465 19.668  1.00  38.63  ? 236  PRO A O     1 
ATOM   1884 C  CB    . PRO A 1 242 ? 6.949  31.819 21.127  1.00  39.87  ? 236  PRO A CB    1 
ATOM   1885 C  CG    . PRO A 1 242 ? 7.845  30.766 21.665  1.00  40.18  ? 236  PRO A CG    1 
ATOM   1886 C  CD    . PRO A 1 242 ? 7.809  29.718 20.576  1.00  40.34  ? 236  PRO A CD    1 
ATOM   1887 N  N     . ILE A 1 243 ? 8.302  34.122 19.226  1.00  39.65  ? 237  ILE A N     1 
ATOM   1888 C  CA    . ILE A 1 243 ? 9.337  35.124 19.060  1.00  41.63  ? 237  ILE A CA    1 
ATOM   1889 C  C     . ILE A 1 243 ? 9.648  35.748 20.419  1.00  43.06  ? 237  ILE A C     1 
ATOM   1890 O  O     . ILE A 1 243 ? 8.840  36.494 20.962  1.00  43.00  ? 237  ILE A O     1 
ATOM   1891 C  CB    . ILE A 1 243 ? 8.864  36.184 18.062  1.00  40.93  ? 237  ILE A CB    1 
ATOM   1892 C  CG1   . ILE A 1 243 ? 8.770  35.540 16.674  1.00  40.70  ? 237  ILE A CG1   1 
ATOM   1893 C  CG2   . ILE A 1 243 ? 9.795  37.381 18.083  1.00  41.80  ? 237  ILE A CG2   1 
ATOM   1894 C  CD1   . ILE A 1 243 ? 7.922  36.298 15.697  1.00  42.17  ? 237  ILE A CD1   1 
ATOM   1895 N  N     . ARG A 1 244 ? 10.817 35.428 20.971  0.72  43.77  ? 238  ARG A N     1 
ATOM   1896 C  CA    . ARG A 1 244 ? 11.205 35.953 22.278  1.00  44.60  ? 238  ARG A CA    1 
ATOM   1897 C  C     . ARG A 1 244 ? 12.468 36.794 22.267  1.00  44.18  ? 238  ARG A C     1 
ATOM   1898 O  O     . ARG A 1 244 ? 13.271 36.748 21.338  1.00  42.81  ? 238  ARG A O     1 
ATOM   1899 C  CB    . ARG A 1 244 ? 11.420 34.825 23.296  0.91  46.63  ? 238  ARG A CB    1 
ATOM   1900 C  CG    . ARG A 1 244 ? 10.212 33.964 23.610  0.91  49.31  ? 238  ARG A CG    1 
ATOM   1901 C  CD    . ARG A 1 244 ? 10.432 33.218 24.925  0.14  52.96  ? 238  ARG A CD    1 
ATOM   1902 N  NE    . ARG A 1 244 ? 9.707  31.953 24.978  0.55  56.31  ? 238  ARG A NE    1 
ATOM   1903 C  CZ    . ARG A 1 244 ? 9.408  31.306 26.100  1.00  57.91  ? 238  ARG A CZ    1 
ATOM   1904 N  NH1   . ARG A 1 244 ? 9.765  31.807 27.276  0.49  58.95  ? 238  ARG A NH1   1 
ATOM   1905 N  NH2   . ARG A 1 244 ? 8.752  30.154 26.047  0.57  59.27  ? 238  ARG A NH2   1 
ATOM   1906 N  N     . THR A 1 245 ? 12.636 37.546 23.344  1.00  43.34  ? 239  THR A N     1 
ATOM   1907 C  CA    . THR A 1 245 ? 13.784 38.407 23.524  1.00  44.21  ? 239  THR A CA    1 
ATOM   1908 C  C     . THR A 1 245 ? 14.977 37.555 23.932  1.00  44.25  ? 239  THR A C     1 
ATOM   1909 O  O     . THR A 1 245 ? 14.917 36.830 24.918  1.00  44.34  ? 239  THR A O     1 
ATOM   1910 C  CB    . THR A 1 245 ? 13.502 39.444 24.627  1.00  44.74  ? 239  THR A CB    1 
ATOM   1911 O  OG1   . THR A 1 245 ? 12.323 40.185 24.285  1.00  46.29  ? 239  THR A OG1   1 
ATOM   1912 C  CG2   . THR A 1 245 ? 14.681 40.406 24.786  1.00  44.05  ? 239  THR A CG2   1 
ATOM   1913 N  N     . ARG A 1 246 ? 16.057 37.634 23.164  1.00  44.80  ? 240  ARG A N     1 
ATOM   1914 C  CA    . ARG A 1 246 ? 17.255 36.873 23.478  1.00  44.78  ? 240  ARG A CA    1 
ATOM   1915 C  C     . ARG A 1 246 ? 18.185 37.771 24.266  1.00  43.95  ? 240  ARG A C     1 
ATOM   1916 O  O     . ARG A 1 246 ? 18.272 38.968 24.009  1.00  45.55  ? 240  ARG A O     1 
ATOM   1917 C  CB    . ARG A 1 246 ? 17.979 36.422 22.209  1.00  47.53  ? 240  ARG A CB    1 
ATOM   1918 C  CG    . ARG A 1 246 ? 17.185 35.523 21.273  1.00  50.68  ? 240  ARG A CG    1 
ATOM   1919 C  CD    . ARG A 1 246 ? 18.061 35.088 20.100  1.00  53.44  ? 240  ARG A CD    1 
ATOM   1920 N  NE    . ARG A 1 246 ? 17.296 34.440 19.039  1.00  55.59  ? 240  ARG A NE    1 
ATOM   1921 C  CZ    . ARG A 1 246 ? 17.824 33.979 17.909  1.00  57.26  ? 240  ARG A CZ    1 
ATOM   1922 N  NH1   . ARG A 1 246 ? 19.129 34.093 17.687  1.00  58.58  ? 240  ARG A NH1   1 
ATOM   1923 N  NH2   . ARG A 1 246 ? 17.046 33.406 16.997  1.00  57.11  ? 240  ARG A NH2   1 
ATOM   1924 N  N     . VAL A 1 247 ? 18.874 37.193 25.234  1.00  42.83  ? 241  VAL A N     1 
ATOM   1925 C  CA    . VAL A 1 247 ? 19.814 37.953 26.025  1.00  42.05  ? 241  VAL A CA    1 
ATOM   1926 C  C     . VAL A 1 247 ? 21.201 37.336 25.865  1.00  41.75  ? 241  VAL A C     1 
ATOM   1927 O  O     . VAL A 1 247 ? 21.358 36.124 25.737  1.00  38.68  ? 241  VAL A O     1 
ATOM   1928 C  CB    . VAL A 1 247 ? 19.419 37.961 27.527  1.00  42.85  ? 241  VAL A CB    1 
ATOM   1929 C  CG1   . VAL A 1 247 ? 19.412 36.545 28.056  1.00  44.32  ? 241  VAL A CG1   1 
ATOM   1930 C  CG2   . VAL A 1 247 ? 20.382 38.842 28.339  1.00  42.53  ? 241  VAL A CG2   1 
ATOM   1931 N  N     A ARG A 1 248 ? 22.195 38.210 25.842  0.50  42.25  ? 242  ARG A N     1 
ATOM   1932 N  N     B ARG A 1 248 ? 22.191 38.218 25.847  0.50  42.17  ? 242  ARG A N     1 
ATOM   1933 C  CA    A ARG A 1 248 ? 23.606 37.874 25.743  0.50  43.11  ? 242  ARG A CA    1 
ATOM   1934 C  CA    B ARG A 1 248 ? 23.591 37.867 25.729  0.50  42.95  ? 242  ARG A CA    1 
ATOM   1935 C  C     A ARG A 1 248 ? 23.838 36.789 26.805  0.50  42.60  ? 242  ARG A C     1 
ATOM   1936 C  C     B ARG A 1 248 ? 23.871 36.815 26.813  0.50  42.46  ? 242  ARG A C     1 
ATOM   1937 O  O     A ARG A 1 248 ? 23.242 36.843 27.882  0.50  43.18  ? 242  ARG A O     1 
ATOM   1938 O  O     B ARG A 1 248 ? 23.350 36.919 27.917  0.50  42.87  ? 242  ARG A O     1 
ATOM   1939 C  CB    A ARG A 1 248 ? 24.377 39.148 26.107  0.50  45.37  ? 242  ARG A CB    1 
ATOM   1940 C  CB    B ARG A 1 248 ? 24.425 39.130 25.960  0.50  45.09  ? 242  ARG A CB    1 
ATOM   1941 C  CG    A ARG A 1 248 ? 25.711 39.415 25.460  0.50  47.66  ? 242  ARG A CG    1 
ATOM   1942 C  CG    B ARG A 1 248 ? 25.811 39.012 25.358  0.50  47.41  ? 242  ARG A CG    1 
ATOM   1943 C  CD    A ARG A 1 248 ? 25.615 39.923 24.043  0.50  50.99  ? 242  ARG A CD    1 
ATOM   1944 C  CD    B ARG A 1 248 ? 25.964 39.759 24.026  0.50  50.71  ? 242  ARG A CD    1 
ATOM   1945 N  NE    A ARG A 1 248 ? 26.453 39.010 23.320  0.50  51.95  ? 242  ARG A NE    1 
ATOM   1946 N  NE    B ARG A 1 248 ? 26.406 41.055 24.473  0.50  52.27  ? 242  ARG A NE    1 
ATOM   1947 C  CZ    A ARG A 1 248 ? 25.979 38.065 22.541  0.50  52.86  ? 242  ARG A CZ    1 
ATOM   1948 C  CZ    B ARG A 1 248 ? 25.578 42.040 24.768  0.50  53.37  ? 242  ARG A CZ    1 
ATOM   1949 N  NH1   A ARG A 1 248 ? 26.812 37.259 21.971  0.50  54.77  ? 242  ARG A NH1   1 
ATOM   1950 N  NH1   B ARG A 1 248 ? 24.274 41.893 24.589  0.50  54.18  ? 242  ARG A NH1   1 
ATOM   1951 N  NH2   A ARG A 1 248 ? 24.687 37.981 22.272  0.50  52.38  ? 242  ARG A NH2   1 
ATOM   1952 N  NH2   B ARG A 1 248 ? 26.028 43.091 25.438  0.50  52.92  ? 242  ARG A NH2   1 
ATOM   1953 N  N     . LYS A 1 249 ? 24.675 35.804 26.508  1.00  41.16  ? 243  LYS A N     1 
ATOM   1954 C  CA    . LYS A 1 249 ? 24.966 34.758 27.486  1.00  40.99  ? 243  LYS A CA    1 
ATOM   1955 C  C     . LYS A 1 249 ? 26.475 34.563 27.623  1.00  39.24  ? 243  LYS A C     1 
ATOM   1956 O  O     . LYS A 1 249 ? 26.954 33.968 28.586  1.00  39.22  ? 243  LYS A O     1 
ATOM   1957 C  CB    . LYS A 1 249 ? 24.287 33.446 27.085  1.00  40.26  ? 243  LYS A CB    1 
ATOM   1958 C  CG    . LYS A 1 249 ? 22.770 33.505 27.192  1.00  42.91  ? 243  LYS A CG    1 
ATOM   1959 C  CD    . LYS A 1 249 ? 22.136 32.163 26.894  1.00  41.41  ? 243  LYS A CD    1 
ATOM   1960 C  CE    . LYS A 1 249 ? 20.695 32.117 27.361  1.00  43.35  ? 243  LYS A CE    1 
ATOM   1961 N  NZ    . LYS A 1 249 ? 20.157 30.754 27.174  1.00  41.35  ? 243  LYS A NZ    1 
ATOM   1962 N  N     . SER A 1 250 ? 27.218 35.091 26.659  1.00  37.00  ? 244  SER A N     1 
ATOM   1963 C  CA    . SER A 1 250 ? 28.671 34.971 26.664  1.00  35.89  ? 244  SER A CA    1 
ATOM   1964 C  C     . SER A 1 250 ? 29.371 36.159 26.051  1.00  34.38  ? 244  SER A C     1 
ATOM   1965 O  O     . SER A 1 250 ? 28.861 36.787 25.127  1.00  35.05  ? 244  SER A O     1 
ATOM   1966 C  CB    . SER A 1 250 ? 29.119 33.720 25.898  1.00  35.07  ? 244  SER A CB    1 
ATOM   1967 O  OG    . SER A 1 250 ? 28.931 32.554 26.672  1.00  41.31  ? 244  SER A OG    1 
ATOM   1968 N  N     . ILE A 1 251 ? 30.550 36.456 26.582  1.00  33.86  ? 245  ILE A N     1 
ATOM   1969 C  CA    . ILE A 1 251 ? 31.395 37.530 26.083  1.00  32.56  ? 245  ILE A CA    1 
ATOM   1970 C  C     . ILE A 1 251 ? 32.787 36.921 26.053  1.00  31.39  ? 245  ILE A C     1 
ATOM   1971 O  O     . ILE A 1 251 ? 33.219 36.316 27.033  1.00  31.19  ? 245  ILE A O     1 
ATOM   1972 C  CB    . ILE A 1 251 ? 31.383 38.764 27.012  1.00  34.18  ? 245  ILE A CB    1 
ATOM   1973 C  CG1   . ILE A 1 251 ? 29.959 39.320 27.099  1.00  37.16  ? 245  ILE A CG1   1 
ATOM   1974 C  CG2   . ILE A 1 251 ? 32.327 39.847 26.465  1.00  33.62  ? 245  ILE A CG2   1 
ATOM   1975 C  CD1   . ILE A 1 251 ? 29.342 39.611 25.739  1.00  37.64  ? 245  ILE A CD1   1 
ATOM   1976 N  N     . GLY A 1 252 ? 33.479 37.072 24.931  1.00  30.53  ? 246  GLY A N     1 
ATOM   1977 C  CA    . GLY A 1 252 ? 34.800 36.491 24.797  1.00  30.80  ? 246  GLY A CA    1 
ATOM   1978 C  C     . GLY A 1 252 ? 35.691 37.259 23.857  1.00  31.12  ? 246  GLY A C     1 
ATOM   1979 O  O     . GLY A 1 252 ? 35.278 38.247 23.256  1.00  33.93  ? 246  GLY A O     1 
ATOM   1980 N  N     . ARG A 1 253 ? 36.922 36.788 23.730  1.00  31.44  ? 247  ARG A N     1 
ATOM   1981 C  CA    . ARG A 1 253 ? 37.917 37.423 22.891  1.00  31.30  ? 247  ARG A CA    1 
ATOM   1982 C  C     . ARG A 1 253 ? 38.989 36.391 22.578  1.00  33.23  ? 247  ARG A C     1 
ATOM   1983 O  O     . ARG A 1 253 ? 39.403 35.621 23.454  1.00  30.74  ? 247  ARG A O     1 
ATOM   1984 C  CB    . ARG A 1 253 ? 38.557 38.588 23.634  1.00  33.80  ? 247  ARG A CB    1 
ATOM   1985 C  CG    . ARG A 1 253 ? 39.559 39.360 22.800  1.00  36.45  ? 247  ARG A CG    1 
ATOM   1986 C  CD    . ARG A 1 253 ? 38.844 40.344 21.887  1.00  41.56  ? 247  ARG A CD    1 
ATOM   1987 N  NE    . ARG A 1 253 ? 39.751 40.947 20.916  1.00  43.99  ? 247  ARG A NE    1 
ATOM   1988 C  CZ    . ARG A 1 253 ? 40.114 40.355 19.785  1.00  45.81  ? 247  ARG A CZ    1 
ATOM   1989 N  NH1   . ARG A 1 253 ? 39.638 39.146 19.492  1.00  46.19  ? 247  ARG A NH1   1 
ATOM   1990 N  NH2   . ARG A 1 253 ? 40.948 40.966 18.951  1.00  46.10  ? 247  ARG A NH2   1 
ATOM   1991 N  N     . ILE A 1 254 ? 39.439 36.380 21.331  1.00  32.41  ? 248  ILE A N     1 
ATOM   1992 C  CA    . ILE A 1 254 ? 40.454 35.437 20.909  1.00  33.62  ? 248  ILE A CA    1 
ATOM   1993 C  C     . ILE A 1 254 ? 41.290 36.119 19.839  1.00  34.23  ? 248  ILE A C     1 
ATOM   1994 O  O     . ILE A 1 254 ? 40.753 36.692 18.888  1.00  36.29  ? 248  ILE A O     1 
ATOM   1995 C  CB    . ILE A 1 254 ? 39.786 34.168 20.383  1.00  34.52  ? 248  ILE A CB    1 
ATOM   1996 C  CG1   . ILE A 1 254 ? 40.834 33.115 20.040  1.00  35.39  ? 248  ILE A CG1   1 
ATOM   1997 C  CG2   . ILE A 1 254 ? 38.941 34.502 19.179  1.00  37.08  ? 248  ILE A CG2   1 
ATOM   1998 C  CD1   . ILE A 1 254 ? 40.237 31.741 19.898  1.00  37.11  ? 248  ILE A CD1   1 
ATOM   1999 N  N     . VAL A 1 255 ? 42.605 36.078 20.014  1.00  33.29  ? 249  VAL A N     1 
ATOM   2000 C  CA    . VAL A 1 255 ? 43.523 36.727 19.101  1.00  32.81  ? 249  VAL A CA    1 
ATOM   2001 C  C     . VAL A 1 255 ? 44.554 35.764 18.529  1.00  33.90  ? 249  VAL A C     1 
ATOM   2002 O  O     . VAL A 1 255 ? 44.926 34.783 19.169  1.00  34.51  ? 249  VAL A O     1 
ATOM   2003 C  CB    . VAL A 1 255 ? 44.272 37.878 19.813  1.00  33.97  ? 249  VAL A CB    1 
ATOM   2004 C  CG1   . VAL A 1 255 ? 43.271 38.910 20.331  1.00  36.32  ? 249  VAL A CG1   1 
ATOM   2005 C  CG2   . VAL A 1 255 ? 45.102 37.328 20.972  1.00  31.74  ? 249  VAL A CG2   1 
ATOM   2006 N  N     . THR A 1 256 ? 45.007 36.055 17.315  1.00  34.29  ? 250  THR A N     1 
ATOM   2007 C  CA    . THR A 1 256 ? 46.013 35.245 16.646  1.00  35.19  ? 250  THR A CA    1 
ATOM   2008 C  C     . THR A 1 256 ? 47.389 35.711 17.103  1.00  35.93  ? 250  THR A C     1 
ATOM   2009 O  O     . THR A 1 256 ? 47.667 36.907 17.130  1.00  35.38  ? 250  THR A O     1 
ATOM   2010 C  CB    . THR A 1 256 ? 45.932 35.412 15.112  1.00  37.72  ? 250  THR A CB    1 
ATOM   2011 O  OG1   . THR A 1 256 ? 44.860 34.616 14.602  1.00  37.56  ? 250  THR A OG1   1 
ATOM   2012 C  CG2   . THR A 1 256 ? 47.248 34.995 14.449  1.00  37.70  ? 250  THR A CG2   1 
ATOM   2013 N  N     . MET A 1 257 ? 48.250 34.769 17.463  1.00  36.68  ? 251  MET A N     1 
ATOM   2014 C  CA    . MET A 1 257 ? 49.589 35.124 17.900  1.00  39.40  ? 251  MET A CA    1 
ATOM   2015 C  C     . MET A 1 257 ? 50.464 35.345 16.670  1.00  40.05  ? 251  MET A C     1 
ATOM   2016 O  O     . MET A 1 257 ? 50.191 34.793 15.608  1.00  37.99  ? 251  MET A O     1 
ATOM   2017 C  CB    . MET A 1 257 ? 50.164 34.014 18.782  1.00  38.52  ? 251  MET A CB    1 
ATOM   2018 C  CG    . MET A 1 257 ? 49.334 33.755 20.036  1.00  40.07  ? 251  MET A CG    1 
ATOM   2019 S  SD    . MET A 1 257 ? 50.113 32.624 21.211  1.00  37.47  ? 251  MET A SD    1 
ATOM   2020 C  CE    . MET A 1 257 ? 49.530 31.062 20.548  1.00  37.60  ? 251  MET A CE    1 
ATOM   2021 N  N     . LYS A 1 258 ? 51.497 36.169 16.805  1.00  43.32  ? 252  LYS A N     1 
ATOM   2022 C  CA    . LYS A 1 258 ? 52.388 36.435 15.685  1.00  47.26  ? 252  LYS A CA    1 
ATOM   2023 C  C     . LYS A 1 258 ? 52.865 35.123 15.074  1.00  49.21  ? 252  LYS A C     1 
ATOM   2024 O  O     . LYS A 1 258 ? 52.940 34.986 13.850  1.00  49.85  ? 252  LYS A O     1 
ATOM   2025 C  CB    . LYS A 1 258 ? 53.589 37.266 16.144  1.00  49.70  ? 252  LYS A CB    1 
ATOM   2026 C  CG    . LYS A 1 258 ? 53.494 38.750 15.784  1.00  52.47  ? 252  LYS A CG    1 
ATOM   2027 C  CD    . LYS A 1 258 ? 53.481 38.943 14.270  1.00  54.73  ? 252  LYS A CD    1 
ATOM   2028 C  CE    . LYS A 1 258 ? 53.432 40.419 13.888  1.00  57.65  ? 252  LYS A CE    1 
ATOM   2029 N  NZ    . LYS A 1 258 ? 53.588 40.627 12.417  1.00  58.06  ? 252  LYS A NZ    1 
ATOM   2030 N  N     . ARG A 1 259 ? 53.164 34.156 15.939  0.70  49.30  ? 253  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 259 ? 53.644 32.839 15.527  0.77  50.29  ? 253  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 259 ? 53.031 31.777 16.443  1.00  48.76  ? 253  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 259 ? 52.601 32.089 17.552  1.00  48.84  ? 253  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 259 ? 55.184 32.806 15.623  1.00  53.28  ? 253  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 259 ? 55.728 33.222 17.036  1.00  57.28  ? 253  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 259 ? 57.095 33.798 17.005  0.010 60.51  ? 253  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 259 ? 57.878 32.595 16.863  0.58  62.72  ? 253  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 259 ? 58.678 32.058 17.775  0.53  63.61  ? 253  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 259 ? 59.326 30.946 17.467  0.87  64.04  ? 253  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 259 ? 58.798 32.603 18.974  0.93  63.96  ? 253  ARG A NH2   1 
ATOM   2041 N  N     . ASN A 1 260 ? 52.971 30.531 15.984  1.00  46.51  ? 254  ASN A N     1 
ATOM   2042 C  CA    . ASN A 1 260 ? 52.414 29.468 16.816  1.00  46.31  ? 254  ASN A CA    1 
ATOM   2043 C  C     . ASN A 1 260 ? 53.374 29.177 17.958  1.00  46.12  ? 254  ASN A C     1 
ATOM   2044 O  O     . ASN A 1 260 ? 54.570 29.456 17.849  1.00  46.75  ? 254  ASN A O     1 
ATOM   2045 C  CB    . ASN A 1 260 ? 52.177 28.205 15.995  1.00  44.32  ? 254  ASN A CB    1 
ATOM   2046 C  CG    . ASN A 1 260 ? 51.279 28.457 14.813  1.00  44.90  ? 254  ASN A CG    1 
ATOM   2047 O  OD1   . ASN A 1 260 ? 50.539 29.441 14.789  1.00  42.72  ? 254  ASN A OD1   1 
ATOM   2048 N  ND2   . ASN A 1 260 ? 51.328 27.570 13.825  1.00  43.23  ? 254  ASN A ND2   1 
ATOM   2049 N  N     . SER A 1 261 ? 52.861 28.622 19.051  1.00  45.44  ? 255  SER A N     1 
ATOM   2050 C  CA    . SER A 1 261 ? 53.715 28.341 20.199  1.00  44.77  ? 255  SER A CA    1 
ATOM   2051 C  C     . SER A 1 261 ? 53.136 27.405 21.253  1.00  44.13  ? 255  SER A C     1 
ATOM   2052 O  O     . SER A 1 261 ? 51.950 27.077 21.239  1.00  44.06  ? 255  SER A O     1 
ATOM   2053 C  CB    . SER A 1 261 ? 54.104 29.658 20.878  1.00  44.75  ? 255  SER A CB    1 
ATOM   2054 O  OG    . SER A 1 261 ? 54.759 29.426 22.114  1.00  45.67  ? 255  SER A OG    1 
ATOM   2055 N  N     . ARG A 1 262 ? 54.011 26.977 22.159  1.00  43.92  ? 256  ARG A N     1 
ATOM   2056 C  CA    . ARG A 1 262 ? 53.654 26.107 23.267  1.00  43.95  ? 256  ARG A CA    1 
ATOM   2057 C  C     . ARG A 1 262 ? 54.334 26.681 24.489  1.00  43.43  ? 256  ARG A C     1 
ATOM   2058 O  O     . ARG A 1 262 ? 54.206 26.145 25.583  1.00  44.80  ? 256  ARG A O     1 
ATOM   2059 C  CB    . ARG A 1 262 ? 54.154 24.677 23.055  1.00  45.04  ? 256  ARG A CB    1 
ATOM   2060 C  CG    . ARG A 1 262 ? 53.478 23.932 21.928  1.00  47.23  ? 256  ARG A CG    1 
ATOM   2061 C  CD    . ARG A 1 262 ? 53.882 22.458 21.912  1.00  49.03  ? 256  ARG A CD    1 
ATOM   2062 N  NE    . ARG A 1 262 ? 52.920 21.585 22.587  1.00  50.05  ? 256  ARG A NE    1 
ATOM   2063 C  CZ    . ARG A 1 262 ? 52.722 21.543 23.901  1.00  51.59  ? 256  ARG A CZ    1 
ATOM   2064 N  NH1   . ARG A 1 262 ? 53.420 22.327 24.710  1.00  54.66  ? 256  ARG A NH1   1 
ATOM   2065 N  NH2   . ARG A 1 262 ? 51.826 20.710 24.408  1.00  52.27  ? 256  ARG A NH2   1 
ATOM   2066 N  N     . ASN A 1 263 ? 55.075 27.768 24.296  1.00  43.65  ? 257  ASN A N     1 
ATOM   2067 C  CA    . ASN A 1 263 ? 55.766 28.405 25.408  1.00  43.68  ? 257  ASN A CA    1 
ATOM   2068 C  C     . ASN A 1 263 ? 54.803 29.290 26.186  1.00  42.71  ? 257  ASN A C     1 
ATOM   2069 O  O     . ASN A 1 263 ? 54.311 30.294 25.677  1.00  40.52  ? 257  ASN A O     1 
ATOM   2070 C  CB    . ASN A 1 263 ? 56.964 29.220 24.908  1.00  46.23  ? 257  ASN A CB    1 
ATOM   2071 C  CG    . ASN A 1 263 ? 57.594 30.070 26.008  1.00  49.35  ? 257  ASN A CG    1 
ATOM   2072 O  OD1   . ASN A 1 263 ? 57.503 29.749 27.197  1.00  51.36  ? 257  ASN A OD1   1 
ATOM   2073 N  ND2   . ASN A 1 263 ? 58.242 31.156 25.613  1.00  51.65  ? 257  ASN A ND2   1 
ATOM   2074 N  N     . LEU A 1 264 ? 54.545 28.890 27.427  1.00  42.18  ? 258  LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 264 ? 53.637 29.585 28.332  1.00  42.75  ? 258  LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 264 ? 53.819 31.101 28.424  1.00  42.70  ? 258  LEU A C     1 
ATOM   2077 O  O     . LEU A 1 264 ? 52.855 31.856 28.295  1.00  43.13  ? 258  LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 264 ? 53.761 28.979 29.731  1.00  41.92  ? 258  LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 264 ? 52.797 29.487 30.804  1.00  43.73  ? 258  LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 264 ? 51.380 29.071 30.447  1.00  41.74  ? 258  LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 264 ? 53.193 28.915 32.168  1.00  42.30  ? 258  LEU A CD2   1 
ATOM   2082 N  N     . GLU A 1 265 ? 55.050 31.543 28.656  1.00  42.41  ? 259  GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 265 ? 55.348 32.967 28.792  1.00  41.18  ? 259  GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 265 ? 55.155 33.752 27.514  1.00  40.91  ? 259  GLU A C     1 
ATOM   2085 O  O     . GLU A 1 265 ? 54.998 34.975 27.527  1.00  40.44  ? 259  GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 265 ? 56.777 33.151 29.289  1.00  42.31  ? 259  GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 265 ? 56.967 32.747 30.739  1.00  42.68  ? 259  GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 265 ? 56.074 33.538 31.675  1.00  43.10  ? 259  GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 265 ? 55.996 34.776 31.522  1.00  45.27  ? 259  GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 265 ? 55.459 32.928 32.570  1.00  44.11  ? 259  GLU A OE2   1 
ATOM   2091 N  N     . GLU A 1 266 ? 55.159 33.030 26.407  1.00  40.95  ? 260  GLU A N     1 
ATOM   2092 C  CA    . GLU A 1 266 ? 54.994 33.613 25.088  1.00  40.04  ? 260  GLU A CA    1 
ATOM   2093 C  C     . GLU A 1 266 ? 53.511 33.812 24.781  1.00  38.67  ? 260  GLU A C     1 
ATOM   2094 O  O     . GLU A 1 266 ? 53.116 34.788 24.126  1.00  37.34  ? 260  GLU A O     1 
ATOM   2095 C  CB    . GLU A 1 266 ? 55.629 32.658 24.090  1.00  41.89  ? 260  GLU A CB    1 
ATOM   2096 C  CG    . GLU A 1 266 ? 55.799 33.133 22.686  1.00  43.37  ? 260  GLU A CG    1 
ATOM   2097 C  CD    . GLU A 1 266 ? 56.808 32.263 21.983  1.00  45.54  ? 260  GLU A CD    1 
ATOM   2098 O  OE1   . GLU A 1 266 ? 58.014 32.523 22.142  1.00  49.36  ? 260  GLU A OE1   1 
ATOM   2099 O  OE2   . GLU A 1 266 ? 56.409 31.297 21.304  1.00  47.42  ? 260  GLU A OE2   1 
ATOM   2100 N  N     . ILE A 1 267 ? 52.691 32.884 25.267  1.00  36.40  ? 261  ILE A N     1 
ATOM   2101 C  CA    . ILE A 1 267 ? 51.250 32.941 25.031  1.00  35.35  ? 261  ILE A CA    1 
ATOM   2102 C  C     . ILE A 1 267 ? 50.510 33.859 25.994  1.00  35.19  ? 261  ILE A C     1 
ATOM   2103 O  O     . ILE A 1 267 ? 49.553 34.525 25.601  1.00  34.98  ? 261  ILE A O     1 
ATOM   2104 C  CB    . ILE A 1 267 ? 50.628 31.546 25.117  1.00  32.74  ? 261  ILE A CB    1 
ATOM   2105 C  CG1   . ILE A 1 267 ? 51.286 30.632 24.086  1.00  32.46  ? 261  ILE A CG1   1 
ATOM   2106 C  CG2   . ILE A 1 267 ? 49.130 31.633 24.885  1.00  30.76  ? 261  ILE A CG2   1 
ATOM   2107 C  CD1   . ILE A 1 267 ? 50.901 29.160 24.207  1.00  33.27  ? 261  ILE A CD1   1 
ATOM   2108 N  N     . LYS A 1 268 ? 50.961 33.892 27.248  1.00  34.74  ? 262  LYS A N     1 
ATOM   2109 C  CA    . LYS A 1 268 ? 50.345 34.716 28.289  1.00  36.76  ? 262  LYS A CA    1 
ATOM   2110 C  C     . LYS A 1 268 ? 49.877 36.116 27.888  1.00  36.78  ? 262  LYS A C     1 
ATOM   2111 O  O     . LYS A 1 268 ? 48.714 36.468 28.099  1.00  35.80  ? 262  LYS A O     1 
ATOM   2112 C  CB    . LYS A 1 268 ? 51.292 34.856 29.482  1.00  37.47  ? 262  LYS A CB    1 
ATOM   2113 C  CG    . LYS A 1 268 ? 51.177 33.774 30.535  1.00  39.29  ? 262  LYS A CG    1 
ATOM   2114 C  CD    . LYS A 1 268 ? 52.097 34.133 31.689  1.00  40.03  ? 262  LYS A CD    1 
ATOM   2115 C  CE    . LYS A 1 268 ? 51.952 33.207 32.866  1.00  41.39  ? 262  LYS A CE    1 
ATOM   2116 N  NZ    . LYS A 1 268 ? 52.869 33.647 33.965  1.00  41.78  ? 262  LYS A NZ    1 
ATOM   2117 N  N     . PRO A 1 269 ? 50.781 36.941 27.327  1.00  37.45  ? 263  PRO A N     1 
ATOM   2118 C  CA    . PRO A 1 269 ? 50.462 38.313 26.903  1.00  37.72  ? 263  PRO A CA    1 
ATOM   2119 C  C     . PRO A 1 269 ? 49.235 38.425 26.005  1.00  37.05  ? 263  PRO A C     1 
ATOM   2120 O  O     . PRO A 1 269 ? 48.480 39.395 26.081  1.00  37.74  ? 263  PRO A O     1 
ATOM   2121 C  CB    . PRO A 1 269 ? 51.737 38.760 26.188  1.00  38.23  ? 263  PRO A CB    1 
ATOM   2122 C  CG    . PRO A 1 269 ? 52.801 38.003 26.916  1.00  38.81  ? 263  PRO A CG    1 
ATOM   2123 C  CD    . PRO A 1 269 ? 52.193 36.631 27.035  1.00  37.24  ? 263  PRO A CD    1 
ATOM   2124 N  N     . TYR A 1 270 ? 49.050 37.439 25.141  1.00  36.33  ? 264  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 270 ? 47.907 37.433 24.248  1.00  35.26  ? 264  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 270 ? 46.679 37.050 25.054  1.00  33.99  ? 264  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 270 ? 45.609 37.644 24.910  1.00  32.76  ? 264  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 270 ? 48.115 36.415 23.134  1.00  38.57  ? 264  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 270 ? 49.218 36.760 22.165  1.00  42.08  ? 264  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 270 ? 49.018 37.697 21.150  1.00  43.52  ? 264  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 270 ? 50.454 36.129 22.245  1.00  43.51  ? 264  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 270 ? 50.028 37.986 20.231  1.00  45.73  ? 264  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 270 ? 51.467 36.412 21.337  1.00  45.66  ? 264  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 270 ? 51.248 37.336 20.332  1.00  46.63  ? 264  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 270 ? 52.243 37.582 19.412  1.00  49.65  ? 264  TYR A OH    1 
ATOM   2136 N  N     . LEU A 1 271 ? 46.839 36.041 25.902  1.00  32.43  ? 265  LEU A N     1 
ATOM   2137 C  CA    . LEU A 1 271 ? 45.738 35.571 26.732  1.00  32.21  ? 265  LEU A CA    1 
ATOM   2138 C  C     . LEU A 1 271 ? 45.273 36.691 27.661  1.00  31.69  ? 265  LEU A C     1 
ATOM   2139 O  O     . LEU A 1 271 ? 44.079 36.915 27.818  1.00  29.94  ? 265  LEU A O     1 
ATOM   2140 C  CB    . LEU A 1 271 ? 46.170 34.349 27.545  1.00  32.12  ? 265  LEU A CB    1 
ATOM   2141 C  CG    . LEU A 1 271 ? 45.175 33.807 28.571  1.00  32.39  ? 265  LEU A CG    1 
ATOM   2142 C  CD1   . LEU A 1 271 ? 43.876 33.399 27.883  1.00  29.02  ? 265  LEU A CD1   1 
ATOM   2143 C  CD2   . LEU A 1 271 ? 45.799 32.624 29.301  1.00  31.35  ? 265  LEU A CD2   1 
ATOM   2144 N  N     . PHE A 1 272 ? 46.214 37.409 28.262  1.00  31.96  ? 266  PHE A N     1 
ATOM   2145 C  CA    . PHE A 1 272 ? 45.844 38.494 29.155  1.00  33.90  ? 266  PHE A CA    1 
ATOM   2146 C  C     . PHE A 1 272 ? 45.221 39.656 28.393  1.00  35.93  ? 266  PHE A C     1 
ATOM   2147 O  O     . PHE A 1 272 ? 44.332 40.340 28.908  1.00  36.23  ? 266  PHE A O     1 
ATOM   2148 C  CB    . PHE A 1 272 ? 47.055 38.963 29.963  1.00  34.02  ? 266  PHE A CB    1 
ATOM   2149 C  CG    . PHE A 1 272 ? 47.598 37.915 30.895  1.00  34.74  ? 266  PHE A CG    1 
ATOM   2150 C  CD1   . PHE A 1 272 ? 46.778 36.897 31.362  1.00  32.98  ? 266  PHE A CD1   1 
ATOM   2151 C  CD2   . PHE A 1 272 ? 48.925 37.950 31.313  1.00  35.44  ? 266  PHE A CD2   1 
ATOM   2152 C  CE1   . PHE A 1 272 ? 47.263 35.925 32.231  1.00  35.28  ? 266  PHE A CE1   1 
ATOM   2153 C  CE2   . PHE A 1 272 ? 49.424 36.978 32.187  1.00  35.08  ? 266  PHE A CE2   1 
ATOM   2154 C  CZ    . PHE A 1 272 ? 48.589 35.963 32.645  1.00  34.78  ? 266  PHE A CZ    1 
ATOM   2155 N  N     . ARG A 1 273 ? 45.681 39.876 27.166  1.00  36.97  ? 267  ARG A N     1 
ATOM   2156 C  CA    . ARG A 1 273 ? 45.124 40.938 26.336  1.00  36.61  ? 267  ARG A CA    1 
ATOM   2157 C  C     . ARG A 1 273 ? 43.667 40.566 26.110  1.00  34.53  ? 267  ARG A C     1 
ATOM   2158 O  O     . ARG A 1 273 ? 42.781 41.410 26.144  1.00  33.89  ? 267  ARG A O     1 
ATOM   2159 C  CB    . ARG A 1 273 ? 45.841 41.000 24.981  1.00  39.59  ? 267  ARG A CB    1 
ATOM   2160 C  CG    . ARG A 1 273 ? 45.394 42.150 24.069  1.00  44.91  ? 267  ARG A CG    1 
ATOM   2161 C  CD    . ARG A 1 273 ? 45.931 42.027 22.624  1.00  48.23  ? 267  ARG A CD    1 
ATOM   2162 N  NE    . ARG A 1 273 ? 47.211 41.316 22.509  1.00  50.96  ? 267  ARG A NE    1 
ATOM   2163 C  CZ    . ARG A 1 273 ? 48.320 41.619 23.184  1.00  53.17  ? 267  ARG A CZ    1 
ATOM   2164 N  NH1   . ARG A 1 273 ? 48.328 42.631 24.044  1.00  52.56  ? 267  ARG A NH1   1 
ATOM   2165 N  NH2   . ARG A 1 273 ? 49.427 40.905 23.003  1.00  52.79  ? 267  ARG A NH2   1 
ATOM   2166 N  N     . ALA A 1 274 ? 43.430 39.279 25.888  1.00  33.83  ? 268  ALA A N     1 
ATOM   2167 C  CA    . ALA A 1 274 ? 42.086 38.783 25.630  1.00  33.75  ? 268  ALA A CA    1 
ATOM   2168 C  C     . ALA A 1 274 ? 41.146 39.044 26.804  1.00  34.75  ? 268  ALA A C     1 
ATOM   2169 O  O     . ALA A 1 274 ? 40.009 39.488 26.614  1.00  34.53  ? 268  ALA A O     1 
ATOM   2170 C  CB    . ALA A 1 274 ? 42.134 37.300 25.315  1.00  30.36  ? 268  ALA A CB    1 
ATOM   2171 N  N     . ILE A 1 275 ? 41.626 38.766 28.013  1.00  33.49  ? 269  ILE A N     1 
ATOM   2172 C  CA    . ILE A 1 275 ? 40.824 38.965 29.215  1.00  34.53  ? 269  ILE A CA    1 
ATOM   2173 C  C     . ILE A 1 275 ? 40.529 40.444 29.437  1.00  34.37  ? 269  ILE A C     1 
ATOM   2174 O  O     . ILE A 1 275 ? 39.404 40.816 29.750  1.00  33.20  ? 269  ILE A O     1 
ATOM   2175 C  CB    . ILE A 1 275 ? 41.543 38.378 30.451  1.00  33.81  ? 269  ILE A CB    1 
ATOM   2176 C  CG1   . ILE A 1 275 ? 41.597 36.854 30.319  1.00  33.43  ? 269  ILE A CG1   1 
ATOM   2177 C  CG2   . ILE A 1 275 ? 40.826 38.796 31.734  1.00  32.58  ? 269  ILE A CG2   1 
ATOM   2178 C  CD1   . ILE A 1 275 ? 42.387 36.168 31.396  1.00  33.99  ? 269  ILE A CD1   1 
ATOM   2179 N  N     . GLU A 1 276 ? 41.544 41.283 29.267  1.00  36.23  ? 270  GLU A N     1 
ATOM   2180 C  CA    . GLU A 1 276 ? 41.373 42.719 29.441  1.00  39.22  ? 270  GLU A CA    1 
ATOM   2181 C  C     . GLU A 1 276 ? 40.183 43.232 28.648  1.00  39.50  ? 270  GLU A C     1 
ATOM   2182 O  O     . GLU A 1 276 ? 39.300 43.906 29.180  1.00  38.05  ? 270  GLU A O     1 
ATOM   2183 C  CB    . GLU A 1 276 ? 42.618 43.457 28.967  1.00  41.95  ? 270  GLU A CB    1 
ATOM   2184 C  CG    . GLU A 1 276 ? 43.822 43.260 29.837  1.00  46.81  ? 270  GLU A CG    1 
ATOM   2185 C  CD    . GLU A 1 276 ? 43.668 43.921 31.186  1.00  49.47  ? 270  GLU A CD    1 
ATOM   2186 O  OE1   . GLU A 1 276 ? 44.604 43.814 32.002  1.00  54.62  ? 270  GLU A OE1   1 
ATOM   2187 O  OE2   . GLU A 1 276 ? 42.618 44.554 31.431  1.00  49.11  ? 270  GLU A OE2   1 
ATOM   2188 N  N     . GLU A 1 277 ? 40.177 42.914 27.361  1.00  39.01  ? 271  GLU A N     1 
ATOM   2189 C  CA    . GLU A 1 277 ? 39.118 43.362 26.482  1.00  39.98  ? 271  GLU A CA    1 
ATOM   2190 C  C     . GLU A 1 277 ? 37.807 42.617 26.746  1.00  39.66  ? 271  GLU A C     1 
ATOM   2191 O  O     . GLU A 1 277 ? 36.727 43.138 26.477  1.00  38.38  ? 271  GLU A O     1 
ATOM   2192 C  CB    . GLU A 1 277 ? 39.599 43.223 25.032  1.00  42.00  ? 271  GLU A CB    1 
ATOM   2193 C  CG    . GLU A 1 277 ? 40.987 43.860 24.853  1.00  46.38  ? 271  GLU A CG    1 
ATOM   2194 C  CD    . GLU A 1 277 ? 41.506 43.836 23.422  1.00  50.32  ? 271  GLU A CD    1 
ATOM   2195 O  OE1   . GLU A 1 277 ? 42.658 44.277 23.199  1.00  52.88  ? 271  GLU A OE1   1 
ATOM   2196 O  OE2   . GLU A 1 277 ? 40.768 43.384 22.523  1.00  52.05  ? 271  GLU A OE2   1 
ATOM   2197 N  N     . SER A 1 278 ? 37.891 41.407 27.285  1.00  39.15  ? 272  SER A N     1 
ATOM   2198 C  CA    . SER A 1 278 ? 36.673 40.665 27.590  1.00  39.43  ? 272  SER A CA    1 
ATOM   2199 C  C     . SER A 1 278 ? 35.981 41.333 28.774  1.00  39.78  ? 272  SER A C     1 
ATOM   2200 O  O     . SER A 1 278 ? 34.755 41.401 28.835  1.00  38.18  ? 272  SER A O     1 
ATOM   2201 C  CB    . SER A 1 278 ? 36.993 39.213 27.935  1.00  39.15  ? 272  SER A CB    1 
ATOM   2202 O  OG    . SER A 1 278 ? 37.370 38.492 26.778  1.00  41.28  ? 272  SER A OG    1 
ATOM   2203 N  N     . TYR A 1 279 ? 36.776 41.832 29.714  1.00  40.08  ? 273  TYR A N     1 
ATOM   2204 C  CA    . TYR A 1 279 ? 36.225 42.497 30.889  1.00  42.65  ? 273  TYR A CA    1 
ATOM   2205 C  C     . TYR A 1 279 ? 35.629 43.852 30.572  1.00  43.66  ? 273  TYR A C     1 
ATOM   2206 O  O     . TYR A 1 279 ? 34.574 44.212 31.100  1.00  45.07  ? 273  TYR A O     1 
ATOM   2207 C  CB    . TYR A 1 279 ? 37.291 42.614 31.983  1.00  41.28  ? 273  TYR A CB    1 
ATOM   2208 C  CG    . TYR A 1 279 ? 37.157 41.492 32.970  1.00  40.99  ? 273  TYR A CG    1 
ATOM   2209 C  CD1   . TYR A 1 279 ? 36.388 41.639 34.123  1.00  40.97  ? 273  TYR A CD1   1 
ATOM   2210 C  CD2   . TYR A 1 279 ? 37.676 40.237 32.681  1.00  41.25  ? 273  TYR A CD2   1 
ATOM   2211 C  CE1   . TYR A 1 279 ? 36.129 40.554 34.956  1.00  42.28  ? 273  TYR A CE1   1 
ATOM   2212 C  CE2   . TYR A 1 279 ? 37.426 39.150 33.501  1.00  43.10  ? 273  TYR A CE2   1 
ATOM   2213 C  CZ    . TYR A 1 279 ? 36.650 39.310 34.632  1.00  42.00  ? 273  TYR A CZ    1 
ATOM   2214 O  OH    . TYR A 1 279 ? 36.377 38.211 35.408  1.00  42.52  ? 273  TYR A OH    1 
ATOM   2215 N  N     . TYR A 1 280 ? 36.291 44.604 29.705  1.00  44.58  ? 274  TYR A N     1 
ATOM   2216 C  CA    . TYR A 1 280 ? 35.774 45.905 29.329  1.00  46.58  ? 274  TYR A CA    1 
ATOM   2217 C  C     . TYR A 1 280 ? 34.425 45.726 28.647  1.00  46.71  ? 274  TYR A C     1 
ATOM   2218 O  O     . TYR A 1 280 ? 33.550 46.581 28.751  0.97  46.49  ? 274  TYR A O     1 
ATOM   2219 C  CB    . TYR A 1 280 ? 36.725 46.618 28.373  1.00  49.19  ? 274  TYR A CB    1 
ATOM   2220 C  CG    . TYR A 1 280 ? 36.215 47.980 27.967  0.91  52.16  ? 274  TYR A CG    1 
ATOM   2221 C  CD1   . TYR A 1 280 ? 36.190 49.033 28.879  0.39  53.06  ? 274  TYR A CD1   1 
ATOM   2222 C  CD2   . TYR A 1 280 ? 35.717 48.206 26.684  0.70  53.31  ? 274  TYR A CD2   1 
ATOM   2223 C  CE1   . TYR A 1 280 ? 35.681 50.280 28.525  0.12  54.28  ? 274  TYR A CE1   1 
ATOM   2224 C  CE2   . TYR A 1 280 ? 35.205 49.449 26.320  0.91  54.35  ? 274  TYR A CE2   1 
ATOM   2225 C  CZ    . TYR A 1 280 ? 35.190 50.480 27.245  1.00  54.09  ? 274  TYR A CZ    1 
ATOM   2226 O  OH    . TYR A 1 280 ? 34.687 51.709 26.888  0.12  55.25  ? 274  TYR A OH    1 
ATOM   2227 N  N     . LYS A 1 281 ? 34.261 44.610 27.944  1.00  46.87  ? 275  LYS A N     1 
ATOM   2228 C  CA    . LYS A 1 281 ? 33.008 44.338 27.248  1.00  46.11  ? 275  LYS A CA    1 
ATOM   2229 C  C     . LYS A 1 281 ? 31.957 43.764 28.187  1.00  44.92  ? 275  LYS A C     1 
ATOM   2230 O  O     . LYS A 1 281 ? 30.764 43.803 27.890  1.00  45.04  ? 275  LYS A O     1 
ATOM   2231 C  CB    . LYS A 1 281 ? 33.244 43.379 26.071  1.00  45.06  ? 275  LYS A CB    1 
ATOM   2232 C  CG    . LYS A 1 281 ? 33.881 44.050 24.860  1.00  46.31  ? 275  LYS A CG    1 
ATOM   2233 C  CD    . LYS A 1 281 ? 34.423 43.046 23.837  1.00  47.44  ? 275  LYS A CD    1 
ATOM   2234 C  CE    . LYS A 1 281 ? 33.327 42.364 23.026  1.00  49.10  ? 275  LYS A CE    1 
ATOM   2235 N  NZ    . LYS A 1 281 ? 33.880 41.263 22.173  1.00  47.75  ? 275  LYS A NZ    1 
ATOM   2236 N  N     . LEU A 1 282 ? 32.389 43.234 29.324  1.00  43.46  ? 276  LEU A N     1 
ATOM   2237 C  CA    . LEU A 1 282 ? 31.429 42.672 30.257  1.00  44.12  ? 276  LEU A CA    1 
ATOM   2238 C  C     . LEU A 1 282 ? 30.495 43.740 30.822  1.00  44.90  ? 276  LEU A C     1 
ATOM   2239 O  O     . LEU A 1 282 ? 29.400 43.423 31.279  1.00  44.52  ? 276  LEU A O     1 
ATOM   2240 C  CB    . LEU A 1 282 ? 32.144 41.913 31.386  1.00  41.46  ? 276  LEU A CB    1 
ATOM   2241 C  CG    . LEU A 1 282 ? 32.500 40.461 31.023  1.00  40.35  ? 276  LEU A CG    1 
ATOM   2242 C  CD1   . LEU A 1 282 ? 33.342 39.829 32.116  1.00  37.56  ? 276  LEU A CD1   1 
ATOM   2243 C  CD2   . LEU A 1 282 ? 31.221 39.658 30.813  1.00  38.51  ? 276  LEU A CD2   1 
ATOM   2244 N  N     . ASP A 1 283 ? 30.915 45.001 30.779  1.00  46.85  ? 277  ASP A N     1 
ATOM   2245 C  CA    . ASP A 1 283 ? 30.070 46.078 31.289  1.00  50.80  ? 277  ASP A CA    1 
ATOM   2246 C  C     . ASP A 1 283 ? 29.988 45.981 32.813  1.00  51.42  ? 277  ASP A C     1 
ATOM   2247 O  O     . ASP A 1 283 ? 30.995 46.126 33.509  1.00  52.65  ? 277  ASP A O     1 
ATOM   2248 C  CB    . ASP A 1 283 ? 28.673 45.962 30.645  1.00  53.46  ? 277  ASP A CB    1 
ATOM   2249 C  CG    . ASP A 1 283 ? 27.609 46.780 31.361  1.00  56.23  ? 277  ASP A CG    1 
ATOM   2250 O  OD1   . ASP A 1 283 ? 27.740 48.025 31.420  1.00  57.51  ? 277  ASP A OD1   1 
ATOM   2251 O  OD2   . ASP A 1 283 ? 26.635 46.164 31.861  1.00  54.32  ? 277  ASP A OD2   1 
ATOM   2252 N  N     . LYS A 1 284 ? 28.794 45.725 33.328  1.00  51.30  ? 278  LYS A N     1 
ATOM   2253 C  CA    . LYS A 1 284 ? 28.583 45.602 34.762  1.00  50.58  ? 278  LYS A CA    1 
ATOM   2254 C  C     . LYS A 1 284 ? 28.264 44.143 35.047  1.00  49.26  ? 278  LYS A C     1 
ATOM   2255 O  O     . LYS A 1 284 ? 28.030 43.756 36.194  1.00  49.31  ? 278  LYS A O     1 
ATOM   2256 C  CB    . LYS A 1 284 ? 27.410 46.482 35.198  1.00  51.89  ? 278  LYS A CB    1 
ATOM   2257 C  CG    . LYS A 1 284 ? 27.555 47.955 34.824  1.00  54.34  ? 278  LYS A CG    1 
ATOM   2258 C  CD    . LYS A 1 284 ? 28.777 48.583 35.478  1.00  55.76  ? 278  LYS A CD    1 
ATOM   2259 C  CE    . LYS A 1 284 ? 28.800 50.097 35.285  1.00  57.18  ? 278  LYS A CE    1 
ATOM   2260 N  NZ    . LYS A 1 284 ? 28.896 50.503 33.855  1.00  58.33  ? 278  LYS A NZ    1 
ATOM   2261 N  N     . ARG A 1 285 ? 28.253 43.345 33.981  1.00  46.19  ? 279  ARG A N     1 
ATOM   2262 C  CA    . ARG A 1 285 ? 27.965 41.920 34.072  1.00  42.68  ? 279  ARG A CA    1 
ATOM   2263 C  C     . ARG A 1 285 ? 29.088 41.166 34.768  1.00  39.89  ? 279  ARG A C     1 
ATOM   2264 O  O     . ARG A 1 285 ? 30.263 41.347 34.456  1.00  39.25  ? 279  ARG A O     1 
ATOM   2265 C  CB    . ARG A 1 285 ? 27.729 41.349 32.670  1.00  42.69  ? 279  ARG A CB    1 
ATOM   2266 C  CG    . ARG A 1 285 ? 26.405 41.787 32.071  1.00  43.20  ? 279  ARG A CG    1 
ATOM   2267 C  CD    . ARG A 1 285 ? 26.306 41.426 30.604  1.00  44.66  ? 279  ARG A CD    1 
ATOM   2268 N  NE    . ARG A 1 285 ? 27.302 42.147 29.822  1.00  46.97  ? 279  ARG A NE    1 
ATOM   2269 C  CZ    . ARG A 1 285 ? 27.270 42.263 28.500  1.00  47.07  ? 279  ARG A CZ    1 
ATOM   2270 N  NH1   . ARG A 1 285 ? 26.286 41.704 27.814  1.00  48.73  ? 279  ARG A NH1   1 
ATOM   2271 N  NH2   . ARG A 1 285 ? 28.223 42.936 27.866  1.00  46.48  ? 279  ARG A NH2   1 
ATOM   2272 N  N     . ILE A 1 286 ? 28.711 40.321 35.718  1.00  38.03  ? 280  ILE A N     1 
ATOM   2273 C  CA    . ILE A 1 286 ? 29.672 39.530 36.470  1.00  36.64  ? 280  ILE A CA    1 
ATOM   2274 C  C     . ILE A 1 286 ? 29.472 38.060 36.127  1.00  36.30  ? 280  ILE A C     1 
ATOM   2275 O  O     . ILE A 1 286 ? 28.394 37.507 36.354  1.00  36.96  ? 280  ILE A O     1 
ATOM   2276 C  CB    . ILE A 1 286 ? 29.474 39.710 37.991  1.00  37.13  ? 280  ILE A CB    1 
ATOM   2277 C  CG1   . ILE A 1 286 ? 29.529 41.196 38.354  1.00  35.36  ? 280  ILE A CG1   1 
ATOM   2278 C  CG2   . ILE A 1 286 ? 30.545 38.937 38.749  1.00  36.41  ? 280  ILE A CG2   1 
ATOM   2279 C  CD1   . ILE A 1 286 ? 30.835 41.869 37.985  1.00  32.74  ? 280  ILE A CD1   1 
ATOM   2280 N  N     . PRO A 1 287 ? 30.508 37.407 35.574  1.00  32.27  ? 281  PRO A N     1 
ATOM   2281 C  CA    . PRO A 1 287 ? 30.402 35.994 35.212  1.00  31.87  ? 281  PRO A CA    1 
ATOM   2282 C  C     . PRO A 1 287 ? 30.852 35.016 36.305  1.00  31.58  ? 281  PRO A C     1 
ATOM   2283 O  O     . PRO A 1 287 ? 31.734 35.323 37.110  1.00  29.18  ? 281  PRO A O     1 
ATOM   2284 C  CB    . PRO A 1 287 ? 31.284 35.902 33.966  1.00  29.70  ? 281  PRO A CB    1 
ATOM   2285 C  CG    . PRO A 1 287 ? 32.410 36.820 34.322  1.00  32.66  ? 281  PRO A CG    1 
ATOM   2286 C  CD    . PRO A 1 287 ? 31.717 38.014 34.982  1.00  32.84  ? 281  PRO A CD    1 
ATOM   2287 N  N     . LYS A 1 288 ? 30.235 33.837 36.320  1.00  29.85  ? 282  LYS A N     1 
ATOM   2288 C  CA    . LYS A 1 288 ? 30.597 32.803 37.279  1.00  31.75  ? 282  LYS A CA    1 
ATOM   2289 C  C     . LYS A 1 288 ? 31.441 31.729 36.589  1.00  30.87  ? 282  LYS A C     1 
ATOM   2290 O  O     . LYS A 1 288 ? 32.099 30.930 37.253  1.00  31.42  ? 282  LYS A O     1 
ATOM   2291 C  CB    . LYS A 1 288 ? 29.341 32.165 37.896  1.00  32.21  ? 282  LYS A CB    1 
ATOM   2292 C  CG    . LYS A 1 288 ? 28.463 33.144 38.679  1.00  33.58  ? 282  LYS A CG    1 
ATOM   2293 C  CD    . LYS A 1 288 ? 27.391 32.427 39.499  1.00  35.47  ? 282  LYS A CD    1 
ATOM   2294 C  CE    . LYS A 1 288 ? 26.464 31.579 38.626  1.00  37.83  ? 282  LYS A CE    1 
ATOM   2295 N  NZ    . LYS A 1 288 ? 25.770 32.412 37.609  1.00  40.29  ? 282  LYS A NZ    1 
ATOM   2296 N  N     . ALA A 1 289 ? 31.418 31.713 35.254  1.00  29.21  ? 283  ALA A N     1 
ATOM   2297 C  CA    . ALA A 1 289 ? 32.190 30.739 34.482  1.00  27.76  ? 283  ALA A CA    1 
ATOM   2298 C  C     . ALA A 1 289 ? 33.203 31.391 33.547  1.00  26.63  ? 283  ALA A C     1 
ATOM   2299 O  O     . ALA A 1 289 ? 32.956 32.453 32.981  1.00  26.27  ? 283  ALA A O     1 
ATOM   2300 C  CB    . ALA A 1 289 ? 31.254 29.839 33.673  1.00  26.68  ? 283  ALA A CB    1 
ATOM   2301 N  N     . ILE A 1 290 ? 34.350 30.740 33.391  1.00  26.60  ? 284  ILE A N     1 
ATOM   2302 C  CA    . ILE A 1 290 ? 35.403 31.235 32.510  1.00  27.37  ? 284  ILE A CA    1 
ATOM   2303 C  C     . ILE A 1 290 ? 35.988 30.059 31.745  1.00  26.94  ? 284  ILE A C     1 
ATOM   2304 O  O     . ILE A 1 290 ? 36.215 28.997 32.314  1.00  28.98  ? 284  ILE A O     1 
ATOM   2305 C  CB    . ILE A 1 290 ? 36.559 31.900 33.292  1.00  27.64  ? 284  ILE A CB    1 
ATOM   2306 C  CG1   . ILE A 1 290 ? 37.614 32.422 32.310  1.00  27.97  ? 284  ILE A CG1   1 
ATOM   2307 C  CG2   . ILE A 1 290 ? 37.215 30.878 34.237  1.00  28.10  ? 284  ILE A CG2   1 
ATOM   2308 C  CD1   . ILE A 1 290 ? 38.856 33.027 32.973  1.00  26.97  ? 284  ILE A CD1   1 
ATOM   2309 N  N     . HIS A 1 291 ? 36.226 30.250 30.455  1.00  28.30  ? 285  HIS A N     1 
ATOM   2310 C  CA    . HIS A 1 291 ? 36.813 29.205 29.625  1.00  27.51  ? 285  HIS A CA    1 
ATOM   2311 C  C     . HIS A 1 291 ? 37.956 29.778 28.841  1.00  28.13  ? 285  HIS A C     1 
ATOM   2312 O  O     . HIS A 1 291 ? 37.862 30.889 28.320  1.00  28.99  ? 285  HIS A O     1 
ATOM   2313 C  CB    . HIS A 1 291 ? 35.802 28.643 28.626  1.00  30.02  ? 285  HIS A CB    1 
ATOM   2314 C  CG    . HIS A 1 291 ? 34.756 27.777 29.245  1.00  29.61  ? 285  HIS A CG    1 
ATOM   2315 N  ND1   . HIS A 1 291 ? 33.762 28.277 30.057  1.00  30.93  ? 285  HIS A ND1   1 
ATOM   2316 C  CD2   . HIS A 1 291 ? 34.565 26.439 29.191  1.00  30.89  ? 285  HIS A CD2   1 
ATOM   2317 C  CE1   . HIS A 1 291 ? 33.003 27.281 30.480  1.00  33.32  ? 285  HIS A CE1   1 
ATOM   2318 N  NE2   . HIS A 1 291 ? 33.469 26.156 29.969  1.00  33.22  ? 285  HIS A NE2   1 
ATOM   2319 N  N     . VAL A 1 292 ? 39.051 29.033 28.769  1.00  27.05  ? 286  VAL A N     1 
ATOM   2320 C  CA    . VAL A 1 292 ? 40.184 29.474 27.971  1.00  26.66  ? 286  VAL A CA    1 
ATOM   2321 C  C     . VAL A 1 292 ? 40.012 28.693 26.668  1.00  26.04  ? 286  VAL A C     1 
ATOM   2322 O  O     . VAL A 1 292 ? 39.785 27.481 26.690  1.00  24.43  ? 286  VAL A O     1 
ATOM   2323 C  CB    . VAL A 1 292 ? 41.544 29.135 28.658  1.00  28.76  ? 286  VAL A CB    1 
ATOM   2324 C  CG1   . VAL A 1 292 ? 42.666 29.064 27.623  1.00  27.24  ? 286  VAL A CG1   1 
ATOM   2325 C  CG2   . VAL A 1 292 ? 41.877 30.215 29.687  1.00  25.42  ? 286  VAL A CG2   1 
ATOM   2326 N  N     . VAL A 1 293 ? 40.075 29.392 25.540  1.00  25.85  ? 287  VAL A N     1 
ATOM   2327 C  CA    . VAL A 1 293 ? 39.909 28.738 24.248  1.00  27.76  ? 287  VAL A CA    1 
ATOM   2328 C  C     . VAL A 1 293 ? 41.171 28.833 23.406  1.00  29.43  ? 287  VAL A C     1 
ATOM   2329 O  O     . VAL A 1 293 ? 41.725 29.920 23.200  1.00  30.48  ? 287  VAL A O     1 
ATOM   2330 C  CB    . VAL A 1 293 ? 38.739 29.352 23.440  1.00  30.15  ? 287  VAL A CB    1 
ATOM   2331 C  CG1   . VAL A 1 293 ? 38.541 28.577 22.144  1.00  29.54  ? 287  VAL A CG1   1 
ATOM   2332 C  CG2   . VAL A 1 293 ? 37.454 29.320 24.266  1.00  29.16  ? 287  VAL A CG2   1 
ATOM   2333 N  N     . ALA A 1 294 ? 41.606 27.684 22.911  1.00  29.57  ? 288  ALA A N     1 
ATOM   2334 C  CA    . ALA A 1 294 ? 42.801 27.592 22.093  1.00  31.38  ? 288  ALA A CA    1 
ATOM   2335 C  C     . ALA A 1 294 ? 42.492 27.074 20.694  1.00  32.40  ? 288  ALA A C     1 
ATOM   2336 O  O     . ALA A 1 294 ? 41.712 26.142 20.520  1.00  31.93  ? 288  ALA A O     1 
ATOM   2337 C  CB    . ALA A 1 294 ? 43.820 26.656 22.769  1.00  30.53  ? 288  ALA A CB    1 
ATOM   2338 N  N     . VAL A 1 295 ? 43.101 27.694 19.695  1.00  34.20  ? 289  VAL A N     1 
ATOM   2339 C  CA    . VAL A 1 295 ? 42.947 27.238 18.324  1.00  35.03  ? 289  VAL A CA    1 
ATOM   2340 C  C     . VAL A 1 295 ? 44.351 26.744 17.989  1.00  35.52  ? 289  VAL A C     1 
ATOM   2341 O  O     . VAL A 1 295 ? 45.309 27.515 18.019  1.00  36.78  ? 289  VAL A O     1 
ATOM   2342 C  CB    . VAL A 1 295 ? 42.545 28.380 17.365  1.00  35.71  ? 289  VAL A CB    1 
ATOM   2343 C  CG1   . VAL A 1 295 ? 42.431 27.841 15.946  1.00  37.36  ? 289  VAL A CG1   1 
ATOM   2344 C  CG2   . VAL A 1 295 ? 41.224 28.983 17.793  1.00  33.89  ? 289  VAL A CG2   1 
ATOM   2345 N  N     . THR A 1 296 ? 44.478 25.456 17.702  1.00  37.69  ? 290  THR A N     1 
ATOM   2346 C  CA    . THR A 1 296 ? 45.786 24.879 17.409  1.00  40.55  ? 290  THR A CA    1 
ATOM   2347 C  C     . THR A 1 296 ? 46.265 25.085 15.977  1.00  43.41  ? 290  THR A C     1 
ATOM   2348 O  O     . THR A 1 296 ? 45.484 25.427 15.087  1.00  44.38  ? 290  THR A O     1 
ATOM   2349 C  CB    . THR A 1 296 ? 45.800 23.373 17.713  1.00  40.01  ? 290  THR A CB    1 
ATOM   2350 O  OG1   . THR A 1 296 ? 44.807 22.719 16.922  1.00  41.41  ? 290  THR A OG1   1 
ATOM   2351 C  CG2   . THR A 1 296 ? 45.518 23.127 19.186  1.00  39.96  ? 290  THR A CG2   1 
ATOM   2352 N  N     . GLU A 1 297 ? 47.558 24.862 15.762  1.00  44.99  ? 291  GLU A N     1 
ATOM   2353 C  CA    . GLU A 1 297 ? 48.150 25.033 14.441  1.00  46.80  ? 291  GLU A CA    1 
ATOM   2354 C  C     . GLU A 1 297 ? 47.383 24.341 13.312  1.00  46.55  ? 291  GLU A C     1 
ATOM   2355 O  O     . GLU A 1 297 ? 47.459 24.774 12.167  1.00  47.06  ? 291  GLU A O     1 
ATOM   2356 C  CB    . GLU A 1 297 ? 49.618 24.573 14.449  1.00  47.42  ? 291  GLU A CB    1 
ATOM   2357 C  CG    . GLU A 1 297 ? 49.848 23.117 14.840  1.00  51.81  ? 291  GLU A CG    1 
ATOM   2358 C  CD    . GLU A 1 297 ? 51.334 22.760 14.908  1.00  54.15  ? 291  GLU A CD    1 
ATOM   2359 O  OE1   . GLU A 1 297 ? 52.076 23.108 13.960  1.00  53.62  ? 291  GLU A OE1   1 
ATOM   2360 O  OE2   . GLU A 1 297 ? 51.757 22.132 15.906  1.00  52.78  ? 291  GLU A OE2   1 
ATOM   2361 N  N     . ASP A 1 298 ? 46.636 23.285 13.621  1.00  47.45  ? 292  ASP A N     1 
ATOM   2362 C  CA    . ASP A 1 298 ? 45.871 22.584 12.584  1.00  48.16  ? 292  ASP A CA    1 
ATOM   2363 C  C     . ASP A 1 298 ? 44.431 23.068 12.555  1.00  48.41  ? 292  ASP A C     1 
ATOM   2364 O  O     . ASP A 1 298 ? 43.533 22.376 12.071  1.00  49.52  ? 292  ASP A O     1 
ATOM   2365 C  CB    . ASP A 1 298 ? 45.903 21.067 12.810  1.00  48.33  ? 292  ASP A CB    1 
ATOM   2366 C  CG    . ASP A 1 298 ? 45.282 20.655 14.131  1.00  50.75  ? 292  ASP A CG    1 
ATOM   2367 O  OD1   . ASP A 1 298 ? 45.602 21.277 15.165  1.00  51.80  ? 292  ASP A OD1   1 
ATOM   2368 O  OD2   . ASP A 1 298 ? 44.482 19.697 14.141  1.00  52.06  ? 292  ASP A OD2   1 
ATOM   2369 N  N     . LEU A 1 299 ? 44.224 24.266 13.086  1.00  48.39  ? 293  LEU A N     1 
ATOM   2370 C  CA    . LEU A 1 299 ? 42.909 24.888 13.136  1.00  48.08  ? 293  LEU A CA    1 
ATOM   2371 C  C     . LEU A 1 299 ? 41.833 24.090 13.848  1.00  46.69  ? 293  LEU A C     1 
ATOM   2372 O  O     . LEU A 1 299 ? 40.660 24.091 13.472  1.00  46.88  ? 293  LEU A O     1 
ATOM   2373 C  CB    . LEU A 1 299 ? 42.465 25.269 11.732  1.00  48.73  ? 293  LEU A CB    1 
ATOM   2374 C  CG    . LEU A 1 299 ? 42.659 26.780 11.638  1.00  50.71  ? 293  LEU A CG    1 
ATOM   2375 C  CD1   . LEU A 1 299 ? 44.111 27.168 11.924  1.00  51.39  ? 293  LEU A CD1   1 
ATOM   2376 C  CD2   . LEU A 1 299 ? 42.246 27.240 10.274  1.00  53.24  ? 293  LEU A CD2   1 
ATOM   2377 N  N     . ASP A 1 300 ? 42.264 23.425 14.907  1.00  46.22  ? 294  ASP A N     1 
ATOM   2378 C  CA    . ASP A 1 300 ? 41.395 22.636 15.756  1.00  44.80  ? 294  ASP A CA    1 
ATOM   2379 C  C     . ASP A 1 300 ? 41.078 23.566 16.934  1.00  43.31  ? 294  ASP A C     1 
ATOM   2380 O  O     . ASP A 1 300 ? 41.850 24.485 17.219  1.00  40.11  ? 294  ASP A O     1 
ATOM   2381 C  CB    . ASP A 1 300 ? 42.155 21.407 16.236  1.00  46.59  ? 294  ASP A CB    1 
ATOM   2382 C  CG    . ASP A 1 300 ? 41.300 20.167 16.253  1.00  50.04  ? 294  ASP A CG    1 
ATOM   2383 O  OD1   . ASP A 1 300 ? 40.383 20.081 17.096  1.00  51.26  ? 294  ASP A OD1   1 
ATOM   2384 O  OD2   . ASP A 1 300 ? 41.544 19.276 15.411  1.00  52.11  ? 294  ASP A OD2   1 
ATOM   2385 N  N     . ILE A 1 301 ? 39.949 23.342 17.604  1.00  42.39  ? 295  ILE A N     1 
ATOM   2386 C  CA    . ILE A 1 301 ? 39.575 24.178 18.742  1.00  42.18  ? 295  ILE A CA    1 
ATOM   2387 C  C     . ILE A 1 301 ? 39.435 23.354 20.017  1.00  42.56  ? 295  ILE A C     1 
ATOM   2388 O  O     . ILE A 1 301 ? 38.558 22.493 20.120  1.00  43.47  ? 295  ILE A O     1 
ATOM   2389 C  CB    . ILE A 1 301 ? 38.243 24.923 18.489  1.00  41.99  ? 295  ILE A CB    1 
ATOM   2390 C  CG1   . ILE A 1 301 ? 38.345 25.741 17.199  1.00  40.78  ? 295  ILE A CG1   1 
ATOM   2391 C  CG2   . ILE A 1 301 ? 37.932 25.850 19.667  1.00  40.87  ? 295  ILE A CG2   1 
ATOM   2392 C  CD1   . ILE A 1 301 ? 37.080 26.478 16.828  1.00  39.73  ? 295  ILE A CD1   1 
ATOM   2393 N  N     . VAL A 1 302 ? 40.306 23.625 20.986  1.00  39.83  ? 296  VAL A N     1 
ATOM   2394 C  CA    . VAL A 1 302 ? 40.295 22.912 22.261  1.00  38.41  ? 296  VAL A CA    1 
ATOM   2395 C  C     . VAL A 1 302 ? 40.004 23.919 23.374  1.00  36.02  ? 296  VAL A C     1 
ATOM   2396 O  O     . VAL A 1 302 ? 40.316 25.098 23.237  1.00  36.25  ? 296  VAL A O     1 
ATOM   2397 C  CB    . VAL A 1 302 ? 41.658 22.220 22.506  1.00  38.36  ? 296  VAL A CB    1 
ATOM   2398 C  CG1   . VAL A 1 302 ? 42.761 23.237 22.490  1.00  38.73  ? 296  VAL A CG1   1 
ATOM   2399 C  CG2   . VAL A 1 302 ? 41.646 21.466 23.821  1.00  40.30  ? 296  VAL A CG2   1 
ATOM   2400 N  N     . SER A 1 303 ? 39.390 23.478 24.463  1.00  34.31  ? 297  SER A N     1 
ATOM   2401 C  CA    . SER A 1 303 ? 39.095 24.423 25.533  1.00  34.06  ? 297  SER A CA    1 
ATOM   2402 C  C     . SER A 1 303 ? 38.976 23.777 26.900  1.00  31.84  ? 297  SER A C     1 
ATOM   2403 O  O     . SER A 1 303 ? 38.604 22.616 27.026  1.00  33.38  ? 297  SER A O     1 
ATOM   2404 C  CB    . SER A 1 303 ? 37.803 25.180 25.228  1.00  32.58  ? 297  SER A CB    1 
ATOM   2405 O  OG    . SER A 1 303 ? 36.676 24.347 25.443  1.00  36.13  ? 297  SER A OG    1 
ATOM   2406 N  N     . ARG A 1 304 ? 39.287 24.557 27.927  1.00  30.90  ? 298  ARG A N     1 
ATOM   2407 C  CA    . ARG A 1 304 ? 39.219 24.089 29.304  1.00  31.39  ? 298  ARG A CA    1 
ATOM   2408 C  C     . ARG A 1 304 ? 38.601 25.210 30.117  1.00  31.11  ? 298  ARG A C     1 
ATOM   2409 O  O     . ARG A 1 304 ? 39.021 26.363 30.015  1.00  31.47  ? 298  ARG A O     1 
ATOM   2410 C  CB    . ARG A 1 304 ? 40.620 23.776 29.825  1.00  29.52  ? 298  ARG A CB    1 
ATOM   2411 C  CG    . ARG A 1 304 ? 41.309 22.620 29.113  1.00  31.48  ? 298  ARG A CG    1 
ATOM   2412 C  CD    . ARG A 1 304 ? 40.569 21.313 29.324  1.00  31.85  ? 298  ARG A CD    1 
ATOM   2413 N  NE    . ARG A 1 304 ? 41.297 20.181 28.759  1.00  36.75  ? 298  ARG A NE    1 
ATOM   2414 C  CZ    . ARG A 1 304 ? 41.344 19.878 27.463  1.00  39.47  ? 298  ARG A CZ    1 
ATOM   2415 N  NH1   . ARG A 1 304 ? 40.692 20.618 26.571  1.00  38.71  ? 298  ARG A NH1   1 
ATOM   2416 N  NH2   . ARG A 1 304 ? 42.056 18.836 27.055  1.00  39.06  ? 298  ARG A NH2   1 
ATOM   2417 N  N     . GLY A 1 305 ? 37.599 24.887 30.919  1.00  30.28  ? 299  GLY A N     1 
ATOM   2418 C  CA    . GLY A 1 305 ? 36.965 25.931 31.696  1.00  30.61  ? 299  GLY A CA    1 
ATOM   2419 C  C     . GLY A 1 305 ? 36.636 25.521 33.106  1.00  30.53  ? 299  GLY A C     1 
ATOM   2420 O  O     . GLY A 1 305 ? 36.958 24.416 33.527  1.00  32.14  ? 299  GLY A O     1 
ATOM   2421 N  N     . ARG A 1 306 ? 35.999 26.426 33.838  1.00  30.90  ? 300  ARG A N     1 
ATOM   2422 C  CA    . ARG A 1 306 ? 35.609 26.163 35.218  1.00  32.74  ? 300  ARG A CA    1 
ATOM   2423 C  C     . ARG A 1 306 ? 34.529 27.133 35.653  1.00  30.14  ? 300  ARG A C     1 
ATOM   2424 O  O     . ARG A 1 306 ? 34.609 28.319 35.365  1.00  28.00  ? 300  ARG A O     1 
ATOM   2425 C  CB    . ARG A 1 306 ? 36.810 26.306 36.156  1.00  36.12  ? 300  ARG A CB    1 
ATOM   2426 C  CG    . ARG A 1 306 ? 36.435 26.358 37.640  1.00  40.76  ? 300  ARG A CG    1 
ATOM   2427 C  CD    . ARG A 1 306 ? 37.651 26.555 38.538  1.00  44.77  ? 300  ARG A CD    1 
ATOM   2428 N  NE    . ARG A 1 306 ? 37.275 26.555 39.950  1.00  50.42  ? 300  ARG A NE    1 
ATOM   2429 C  CZ    . ARG A 1 306 ? 38.091 26.884 40.950  1.00  52.48  ? 300  ARG A CZ    1 
ATOM   2430 N  NH1   . ARG A 1 306 ? 39.343 27.248 40.698  1.00  51.98  ? 300  ARG A NH1   1 
ATOM   2431 N  NH2   . ARG A 1 306 ? 37.655 26.843 42.205  1.00  54.54  ? 300  ARG A NH2   1 
ATOM   2432 N  N     . THR A 1 307 ? 33.516 26.613 36.336  1.00  32.68  ? 301  THR A N     1 
ATOM   2433 C  CA    . THR A 1 307 ? 32.420 27.432 36.847  1.00  34.91  ? 301  THR A CA    1 
ATOM   2434 C  C     . THR A 1 307 ? 32.682 27.613 38.337  1.00  34.53  ? 301  THR A C     1 
ATOM   2435 O  O     . THR A 1 307 ? 33.036 26.656 39.028  1.00  36.11  ? 301  THR A O     1 
ATOM   2436 C  CB    . THR A 1 307 ? 31.049 26.727 36.691  1.00  37.06  ? 301  THR A CB    1 
ATOM   2437 O  OG1   . THR A 1 307 ? 30.812 26.424 35.311  1.00  40.16  ? 301  THR A OG1   1 
ATOM   2438 C  CG2   . THR A 1 307 ? 29.923 27.625 37.214  1.00  36.98  ? 301  THR A CG2   1 
ATOM   2439 N  N     . PHE A 1 308 ? 32.523 28.831 38.831  1.00  35.17  ? 302  PHE A N     1 
ATOM   2440 C  CA    . PHE A 1 308 ? 32.729 29.107 40.249  1.00  34.72  ? 302  PHE A CA    1 
ATOM   2441 C  C     . PHE A 1 308 ? 31.371 29.314 40.931  1.00  36.06  ? 302  PHE A C     1 
ATOM   2442 O  O     . PHE A 1 308 ? 30.370 29.560 40.265  1.00  34.88  ? 302  PHE A O     1 
ATOM   2443 C  CB    . PHE A 1 308 ? 33.584 30.370 40.432  1.00  34.88  ? 302  PHE A CB    1 
ATOM   2444 C  CG    . PHE A 1 308 ? 35.039 30.200 40.043  1.00  36.56  ? 302  PHE A CG    1 
ATOM   2445 C  CD1   . PHE A 1 308 ? 35.425 30.199 38.704  1.00  35.87  ? 302  PHE A CD1   1 
ATOM   2446 C  CD2   . PHE A 1 308 ? 36.024 30.064 41.022  1.00  34.78  ? 302  PHE A CD2   1 
ATOM   2447 C  CE1   . PHE A 1 308 ? 36.767 30.072 38.344  1.00  36.17  ? 302  PHE A CE1   1 
ATOM   2448 C  CE2   . PHE A 1 308 ? 37.363 29.935 40.675  1.00  35.70  ? 302  PHE A CE2   1 
ATOM   2449 C  CZ    . PHE A 1 308 ? 37.739 29.939 39.331  1.00  36.51  ? 302  PHE A CZ    1 
ATOM   2450 N  N     . PRO A 1 309 ? 31.319 29.199 42.271  1.00  36.40  ? 303  PRO A N     1 
ATOM   2451 C  CA    . PRO A 1 309 ? 30.057 29.392 42.990  1.00  36.85  ? 303  PRO A CA    1 
ATOM   2452 C  C     . PRO A 1 309 ? 29.850 30.864 43.317  1.00  37.55  ? 303  PRO A C     1 
ATOM   2453 O  O     . PRO A 1 309 ? 29.055 31.216 44.181  1.00  41.63  ? 303  PRO A O     1 
ATOM   2454 C  CB    . PRO A 1 309 ? 30.239 28.543 44.240  1.00  37.08  ? 303  PRO A CB    1 
ATOM   2455 C  CG    . PRO A 1 309 ? 31.679 28.693 44.522  1.00  37.73  ? 303  PRO A CG    1 
ATOM   2456 C  CD    . PRO A 1 309 ? 32.324 28.574 43.148  1.00  36.65  ? 303  PRO A CD    1 
ATOM   2457 N  N     . HIS A 1 310 ? 30.576 31.723 42.619  1.00  36.84  ? 304  HIS A N     1 
ATOM   2458 C  CA    . HIS A 1 310 ? 30.479 33.159 42.828  1.00  35.75  ? 304  HIS A CA    1 
ATOM   2459 C  C     . HIS A 1 310 ? 31.068 33.842 41.600  1.00  34.68  ? 304  HIS A C     1 
ATOM   2460 O  O     . HIS A 1 310 ? 31.601 33.173 40.716  1.00  34.47  ? 304  HIS A O     1 
ATOM   2461 C  CB    . HIS A 1 310 ? 31.248 33.553 44.099  1.00  35.12  ? 304  HIS A CB    1 
ATOM   2462 C  CG    . HIS A 1 310 ? 32.690 33.156 44.083  1.00  34.31  ? 304  HIS A CG    1 
ATOM   2463 N  ND1   . HIS A 1 310 ? 33.643 33.847 43.367  1.00  34.67  ? 304  HIS A ND1   1 
ATOM   2464 C  CD2   . HIS A 1 310 ? 33.334 32.112 44.657  1.00  34.97  ? 304  HIS A CD2   1 
ATOM   2465 C  CE1   . HIS A 1 310 ? 34.812 33.244 43.497  1.00  37.68  ? 304  HIS A CE1   1 
ATOM   2466 N  NE2   . HIS A 1 310 ? 34.653 32.188 44.275  1.00  37.47  ? 304  HIS A NE2   1 
ATOM   2467 N  N     . GLY A 1 311 ? 30.970 35.165 41.541  1.00  33.24  ? 305  GLY A N     1 
ATOM   2468 C  CA    . GLY A 1 311 ? 31.498 35.887 40.395  1.00  32.42  ? 305  GLY A CA    1 
ATOM   2469 C  C     . GLY A 1 311 ? 33.008 35.833 40.304  1.00  32.20  ? 305  GLY A C     1 
ATOM   2470 O  O     . GLY A 1 311 ? 33.683 35.537 41.288  1.00  31.86  ? 305  GLY A O     1 
ATOM   2471 N  N     . ILE A 1 312 ? 33.541 36.142 39.127  1.00  31.20  ? 306  ILE A N     1 
ATOM   2472 C  CA    . ILE A 1 312 ? 34.979 36.113 38.900  1.00  30.09  ? 306  ILE A CA    1 
ATOM   2473 C  C     . ILE A 1 312 ? 35.580 37.513 38.782  1.00  29.83  ? 306  ILE A C     1 
ATOM   2474 O  O     . ILE A 1 312 ? 35.277 38.248 37.844  1.00  29.88  ? 306  ILE A O     1 
ATOM   2475 C  CB    . ILE A 1 312 ? 35.303 35.306 37.605  1.00  30.50  ? 306  ILE A CB    1 
ATOM   2476 C  CG1   . ILE A 1 312 ? 34.710 33.900 37.715  1.00  30.70  ? 306  ILE A CG1   1 
ATOM   2477 C  CG2   . ILE A 1 312 ? 36.810 35.211 37.389  1.00  30.09  ? 306  ILE A CG2   1 
ATOM   2478 C  CD1   . ILE A 1 312 ? 34.929 33.033 36.486  1.00  29.56  ? 306  ILE A CD1   1 
ATOM   2479 N  N     . SER A 1 313 ? 36.420 37.888 39.746  1.00  29.46  ? 307  SER A N     1 
ATOM   2480 C  CA    . SER A 1 313 ? 37.079 39.194 39.697  1.00  29.51  ? 307  SER A CA    1 
ATOM   2481 C  C     . SER A 1 313 ? 38.126 39.074 38.583  1.00  28.54  ? 307  SER A C     1 
ATOM   2482 O  O     . SER A 1 313 ? 38.480 37.964 38.182  1.00  27.08  ? 307  SER A O     1 
ATOM   2483 C  CB    . SER A 1 313 ? 37.784 39.495 41.020  1.00  27.27  ? 307  SER A CB    1 
ATOM   2484 O  OG    . SER A 1 313 ? 38.790 38.530 41.270  1.00  26.66  ? 307  SER A OG    1 
ATOM   2485 N  N     . LYS A 1 314 ? 38.627 40.198 38.090  1.00  28.48  ? 308  LYS A N     1 
ATOM   2486 C  CA    . LYS A 1 314 ? 39.610 40.138 37.021  1.00  32.52  ? 308  LYS A CA    1 
ATOM   2487 C  C     . LYS A 1 314 ? 40.921 39.498 37.494  1.00  31.23  ? 308  LYS A C     1 
ATOM   2488 O  O     . LYS A 1 314 ? 41.618 38.861 36.707  1.00  29.17  ? 308  LYS A O     1 
ATOM   2489 C  CB    . LYS A 1 314 ? 39.891 41.529 36.438  1.00  33.81  ? 308  LYS A CB    1 
ATOM   2490 C  CG    . LYS A 1 314 ? 40.569 41.440 35.073  1.00  37.11  ? 308  LYS A CG    1 
ATOM   2491 C  CD    . LYS A 1 314 ? 41.549 42.565 34.820  1.00  40.37  ? 308  LYS A CD    1 
ATOM   2492 C  CE    . LYS A 1 314 ? 40.902 43.745 34.160  1.00  39.89  ? 308  LYS A CE    1 
ATOM   2493 N  NZ    . LYS A 1 314 ? 41.942 44.768 33.877  1.00  44.37  ? 308  LYS A NZ    1 
ATOM   2494 N  N     . GLU A 1 315 ? 41.262 39.663 38.771  1.00  29.94  ? 309  GLU A N     1 
ATOM   2495 C  CA    . GLU A 1 315 ? 42.485 39.049 39.274  1.00  30.42  ? 309  GLU A CA    1 
ATOM   2496 C  C     . GLU A 1 315 ? 42.285 37.536 39.294  1.00  29.01  ? 309  GLU A C     1 
ATOM   2497 O  O     . GLU A 1 315 ? 43.215 36.780 39.035  1.00  28.49  ? 309  GLU A O     1 
ATOM   2498 C  CB    . GLU A 1 315 ? 42.848 39.583 40.676  1.00  32.15  ? 309  GLU A CB    1 
ATOM   2499 C  CG    . GLU A 1 315 ? 43.523 40.963 40.633  1.00  37.82  ? 309  GLU A CG    1 
ATOM   2500 C  CD    . GLU A 1 315 ? 44.887 40.922 39.952  1.00  40.00  ? 309  GLU A CD    1 
ATOM   2501 O  OE1   . GLU A 1 315 ? 45.299 41.942 39.355  1.00  46.41  ? 309  GLU A OE1   1 
ATOM   2502 O  OE2   . GLU A 1 315 ? 45.553 39.866 40.024  1.00  40.97  ? 309  GLU A OE2   1 
ATOM   2503 N  N     . THR A 1 316 ? 41.066 37.091 39.587  1.00  28.09  ? 310  THR A N     1 
ATOM   2504 C  CA    . THR A 1 316 ? 40.780 35.661 39.605  1.00  27.50  ? 310  THR A CA    1 
ATOM   2505 C  C     . THR A 1 316 ? 40.839 35.097 38.188  1.00  27.98  ? 310  THR A C     1 
ATOM   2506 O  O     . THR A 1 316 ? 41.391 34.016 37.954  1.00  27.33  ? 310  THR A O     1 
ATOM   2507 C  CB    . THR A 1 316 ? 39.385 35.361 40.164  1.00  28.57  ? 310  THR A CB    1 
ATOM   2508 O  OG1   . THR A 1 316 ? 39.325 35.749 41.536  1.00  30.87  ? 310  THR A OG1   1 
ATOM   2509 C  CG2   . THR A 1 316 ? 39.076 33.879 40.057  1.00  28.50  ? 310  THR A CG2   1 
ATOM   2510 N  N     . ALA A 1 317 ? 40.250 35.823 37.244  1.00  25.94  ? 311  ALA A N     1 
ATOM   2511 C  CA    . ALA A 1 317 ? 40.242 35.387 35.846  1.00  26.92  ? 311  ALA A CA    1 
ATOM   2512 C  C     . ALA A 1 317 ? 41.676 35.209 35.348  1.00  26.78  ? 311  ALA A C     1 
ATOM   2513 O  O     . ALA A 1 317 ? 42.002 34.216 34.709  1.00  26.97  ? 311  ALA A O     1 
ATOM   2514 C  CB    . ALA A 1 317 ? 39.509 36.410 34.992  1.00  24.10  ? 311  ALA A CB    1 
ATOM   2515 N  N     . TYR A 1 318 ? 42.534 36.174 35.647  1.00  28.21  ? 312  TYR A N     1 
ATOM   2516 C  CA    . TYR A 1 318 ? 43.936 36.103 35.241  1.00  32.09  ? 312  TYR A CA    1 
ATOM   2517 C  C     . TYR A 1 318 ? 44.605 34.838 35.768  1.00  32.73  ? 312  TYR A C     1 
ATOM   2518 O  O     . TYR A 1 318 ? 45.241 34.090 35.022  1.00  32.15  ? 312  TYR A O     1 
ATOM   2519 C  CB    . TYR A 1 318 ? 44.689 37.319 35.778  1.00  35.84  ? 312  TYR A CB    1 
ATOM   2520 C  CG    . TYR A 1 318 ? 44.879 38.441 34.786  1.00  38.56  ? 312  TYR A CG    1 
ATOM   2521 C  CD1   . TYR A 1 318 ? 46.125 38.670 34.215  1.00  42.31  ? 312  TYR A CD1   1 
ATOM   2522 C  CD2   . TYR A 1 318 ? 43.831 39.299 34.449  1.00  41.09  ? 312  TYR A CD2   1 
ATOM   2523 C  CE1   . TYR A 1 318 ? 46.335 39.723 33.341  1.00  43.65  ? 312  TYR A CE1   1 
ATOM   2524 C  CE2   . TYR A 1 318 ? 44.032 40.366 33.569  1.00  42.62  ? 312  TYR A CE2   1 
ATOM   2525 C  CZ    . TYR A 1 318 ? 45.292 40.566 33.024  1.00  43.46  ? 312  TYR A CZ    1 
ATOM   2526 O  OH    . TYR A 1 318 ? 45.536 41.618 32.174  1.00  47.87  ? 312  TYR A OH    1 
ATOM   2527 N  N     . SER A 1 319 ? 44.455 34.608 37.069  1.00  32.77  ? 313  SER A N     1 
ATOM   2528 C  CA    . SER A 1 319 ? 45.051 33.453 37.722  1.00  31.73  ? 313  SER A CA    1 
ATOM   2529 C  C     . SER A 1 319 ? 44.490 32.126 37.222  1.00  30.86  ? 313  SER A C     1 
ATOM   2530 O  O     . SER A 1 319 ? 45.245 31.187 36.963  1.00  29.98  ? 313  SER A O     1 
ATOM   2531 C  CB    . SER A 1 319 ? 44.861 33.563 39.238  1.00  32.66  ? 313  SER A CB    1 
ATOM   2532 O  OG    . SER A 1 319 ? 45.502 32.475 39.883  1.00  39.44  ? 313  SER A OG    1 
ATOM   2533 N  N     . GLU A 1 320 ? 43.167 32.040 37.090  1.00  28.79  ? 314  GLU A N     1 
ATOM   2534 C  CA    . GLU A 1 320 ? 42.534 30.813 36.611  1.00  28.98  ? 314  GLU A CA    1 
ATOM   2535 C  C     . GLU A 1 320 ? 42.847 30.559 35.129  1.00  27.28  ? 314  GLU A C     1 
ATOM   2536 O  O     . GLU A 1 320 ? 43.026 29.419 34.713  1.00  28.05  ? 314  GLU A O     1 
ATOM   2537 C  CB    . GLU A 1 320 ? 41.015 30.894 36.820  1.00  31.01  ? 314  GLU A CB    1 
ATOM   2538 C  CG    . GLU A 1 320 ? 40.222 29.628 36.502  1.00  33.64  ? 314  GLU A CG    1 
ATOM   2539 C  CD    . GLU A 1 320 ? 40.537 28.459 37.436  1.00  38.24  ? 314  GLU A CD    1 
ATOM   2540 O  OE1   . GLU A 1 320 ? 40.839 28.697 38.622  1.00  38.01  ? 314  GLU A OE1   1 
ATOM   2541 O  OE2   . GLU A 1 320 ? 40.465 27.294 36.986  1.00  40.61  ? 314  GLU A OE2   1 
ATOM   2542 N  N     . SER A 1 321 ? 42.935 31.619 34.335  1.00  26.50  ? 315  SER A N     1 
ATOM   2543 C  CA    . SER A 1 321 ? 43.205 31.450 32.910  1.00  28.71  ? 315  SER A CA    1 
ATOM   2544 C  C     . SER A 1 321 ? 44.546 30.768 32.655  1.00  29.08  ? 315  SER A C     1 
ATOM   2545 O  O     . SER A 1 321 ? 44.673 29.954 31.744  1.00  26.83  ? 315  SER A O     1 
ATOM   2546 C  CB    . SER A 1 321 ? 43.161 32.802 32.184  1.00  26.75  ? 315  SER A CB    1 
ATOM   2547 O  OG    . SER A 1 321 ? 44.189 33.669 32.634  1.00  30.63  ? 315  SER A OG    1 
ATOM   2548 N  N     . VAL A 1 322 ? 45.549 31.105 33.458  1.00  28.95  ? 316  VAL A N     1 
ATOM   2549 C  CA    . VAL A 1 322 ? 46.856 30.496 33.292  1.00  30.80  ? 316  VAL A CA    1 
ATOM   2550 C  C     . VAL A 1 322 ? 46.798 29.011 33.635  1.00  31.49  ? 316  VAL A C     1 
ATOM   2551 O  O     . VAL A 1 322 ? 47.462 28.199 32.999  1.00  30.51  ? 316  VAL A O     1 
ATOM   2552 C  CB    . VAL A 1 322 ? 47.925 31.189 34.178  1.00  33.09  ? 316  VAL A CB    1 
ATOM   2553 C  CG1   . VAL A 1 322 ? 49.227 30.395 34.134  1.00  32.21  ? 316  VAL A CG1   1 
ATOM   2554 C  CG2   . VAL A 1 322 ? 48.172 32.604 33.680  1.00  29.54  ? 316  VAL A CG2   1 
ATOM   2555 N  N     . LYS A 1 323 ? 46.001 28.657 34.638  1.00  31.97  ? 317  LYS A N     1 
ATOM   2556 C  CA    . LYS A 1 323 ? 45.869 27.261 35.025  1.00  33.55  ? 317  LYS A CA    1 
ATOM   2557 C  C     . LYS A 1 323 ? 45.204 26.444 33.912  1.00  32.46  ? 317  LYS A C     1 
ATOM   2558 O  O     . LYS A 1 323 ? 45.600 25.311 33.655  1.00  32.32  ? 317  LYS A O     1 
ATOM   2559 C  CB    . LYS A 1 323 ? 45.037 27.129 36.306  1.00  35.90  ? 317  LYS A CB    1 
ATOM   2560 C  CG    . LYS A 1 323 ? 45.706 27.637 37.577  1.00  37.21  ? 317  LYS A CG    1 
ATOM   2561 C  CD    . LYS A 1 323 ? 44.891 27.206 38.794  1.00  38.65  ? 317  LYS A CD    1 
ATOM   2562 C  CE    . LYS A 1 323 ? 45.564 27.595 40.109  1.00  40.91  ? 317  LYS A CE    1 
ATOM   2563 N  NZ    . LYS A 1 323 ? 45.656 29.067 40.288  1.00  41.23  ? 317  LYS A NZ    1 
ATOM   2564 N  N     . LEU A 1 324 ? 44.191 27.023 33.265  1.00  32.27  ? 318  LEU A N     1 
ATOM   2565 C  CA    . LEU A 1 324 ? 43.461 26.353 32.179  1.00  31.41  ? 318  LEU A CA    1 
ATOM   2566 C  C     . LEU A 1 324 ? 44.314 26.225 30.917  1.00  30.97  ? 318  LEU A C     1 
ATOM   2567 O  O     . LEU A 1 324 ? 44.214 25.234 30.189  1.00  32.87  ? 318  LEU A O     1 
ATOM   2568 C  CB    . LEU A 1 324 ? 42.173 27.118 31.866  1.00  31.43  ? 318  LEU A CB    1 
ATOM   2569 C  CG    . LEU A 1 324 ? 41.196 27.226 33.039  1.00  31.31  ? 318  LEU A CG    1 
ATOM   2570 C  CD1   . LEU A 1 324 ? 40.234 28.383 32.809  1.00  32.20  ? 318  LEU A CD1   1 
ATOM   2571 C  CD2   . LEU A 1 324 ? 40.452 25.907 33.206  1.00  30.35  ? 318  LEU A CD2   1 
ATOM   2572 N  N     . LEU A 1 325 ? 45.139 27.233 30.652  1.00  28.92  ? 319  LEU A N     1 
ATOM   2573 C  CA    . LEU A 1 325 ? 46.037 27.197 29.500  1.00  30.14  ? 319  LEU A CA    1 
ATOM   2574 C  C     . LEU A 1 325 ? 47.069 26.083 29.728  1.00  31.60  ? 319  LEU A C     1 
ATOM   2575 O  O     . LEU A 1 325 ? 47.524 25.446 28.776  1.00  31.53  ? 319  LEU A O     1 
ATOM   2576 C  CB    . LEU A 1 325 ? 46.761 28.538 29.338  1.00  27.65  ? 319  LEU A CB    1 
ATOM   2577 C  CG    . LEU A 1 325 ? 47.896 28.575 28.301  1.00  30.82  ? 319  LEU A CG    1 
ATOM   2578 C  CD1   . LEU A 1 325 ? 47.366 28.256 26.893  1.00  30.90  ? 319  LEU A CD1   1 
ATOM   2579 C  CD2   . LEU A 1 325 ? 48.542 29.949 28.322  1.00  29.72  ? 319  LEU A CD2   1 
ATOM   2580 N  N     . GLN A 1 326 ? 47.433 25.860 30.995  1.00  31.40  ? 320  GLN A N     1 
ATOM   2581 C  CA    . GLN A 1 326 ? 48.401 24.816 31.357  1.00  32.37  ? 320  GLN A CA    1 
ATOM   2582 C  C     . GLN A 1 326 ? 47.768 23.447 31.151  1.00  31.91  ? 320  GLN A C     1 
ATOM   2583 O  O     . GLN A 1 326 ? 48.428 22.502 30.725  1.00  32.29  ? 320  GLN A O     1 
ATOM   2584 C  CB    . GLN A 1 326 ? 48.842 24.964 32.819  1.00  31.62  ? 320  GLN A CB    1 
ATOM   2585 C  CG    . GLN A 1 326 ? 49.538 26.285 33.122  1.00  33.22  ? 320  GLN A CG    1 
ATOM   2586 C  CD    . GLN A 1 326 ? 49.793 26.507 34.605  1.00  34.69  ? 320  GLN A CD    1 
ATOM   2587 O  OE1   . GLN A 1 326 ? 48.916 26.284 35.446  1.00  34.21  ? 320  GLN A OE1   1 
ATOM   2588 N  NE2   . GLN A 1 326 ? 50.996 26.965 34.930  1.00  35.23  ? 320  GLN A NE2   1 
ATOM   2589 N  N     . LYS A 1 327 ? 46.484 23.343 31.467  1.00  32.60  ? 321  LYS A N     1 
ATOM   2590 C  CA    . LYS A 1 327 ? 45.752 22.094 31.286  1.00  34.06  ? 321  LYS A CA    1 
ATOM   2591 C  C     . LYS A 1 327 ? 45.755 21.791 29.780  1.00  34.35  ? 321  LYS A C     1 
ATOM   2592 O  O     . LYS A 1 327 ? 46.033 20.672 29.360  1.00  35.64  ? 321  LYS A O     1 
ATOM   2593 C  CB    . LYS A 1 327 ? 44.320 22.264 31.807  1.00  35.21  ? 321  LYS A CB    1 
ATOM   2594 C  CG    . LYS A 1 327 ? 43.590 20.977 32.145  1.00  39.29  ? 321  LYS A CG    1 
ATOM   2595 C  CD    . LYS A 1 327 ? 42.419 21.269 33.080  1.00  41.13  ? 321  LYS A CD    1 
ATOM   2596 C  CE    . LYS A 1 327 ? 41.666 19.998 33.468  1.00  44.70  ? 321  LYS A CE    1 
ATOM   2597 N  NZ    . LYS A 1 327 ? 40.986 19.348 32.308  1.00  44.11  ? 321  LYS A NZ    1 
ATOM   2598 N  N     . ILE A 1 328 ? 45.471 22.803 28.967  1.00  34.93  ? 322  ILE A N     1 
ATOM   2599 C  CA    . ILE A 1 328 ? 45.464 22.616 27.518  1.00  36.23  ? 322  ILE A CA    1 
ATOM   2600 C  C     . ILE A 1 328 ? 46.829 22.156 26.984  1.00  37.48  ? 322  ILE A C     1 
ATOM   2601 O  O     . ILE A 1 328 ? 46.921 21.128 26.314  1.00  38.16  ? 322  ILE A O     1 
ATOM   2602 C  CB    . ILE A 1 328 ? 45.045 23.913 26.787  1.00  32.75  ? 322  ILE A CB    1 
ATOM   2603 C  CG1   . ILE A 1 328 ? 43.585 24.231 27.108  1.00  31.30  ? 322  ILE A CG1   1 
ATOM   2604 C  CG2   . ILE A 1 328 ? 45.243 23.757 25.287  1.00  33.46  ? 322  ILE A CG2   1 
ATOM   2605 C  CD1   . ILE A 1 328 ? 43.082 25.507 26.472  1.00  28.05  ? 322  ILE A CD1   1 
ATOM   2606 N  N     . LEU A 1 329 ? 47.883 22.913 27.277  1.00  38.07  ? 323  LEU A N     1 
ATOM   2607 C  CA    . LEU A 1 329 ? 49.231 22.562 26.822  1.00  38.89  ? 323  LEU A CA    1 
ATOM   2608 C  C     . LEU A 1 329 ? 49.634 21.163 27.281  1.00  39.90  ? 323  LEU A C     1 
ATOM   2609 O  O     . LEU A 1 329 ? 50.272 20.406 26.551  1.00  40.01  ? 323  LEU A O     1 
ATOM   2610 C  CB    . LEU A 1 329 ? 50.246 23.572 27.357  1.00  37.28  ? 323  LEU A CB    1 
ATOM   2611 C  CG    . LEU A 1 329 ? 50.152 24.990 26.797  1.00  36.97  ? 323  LEU A CG    1 
ATOM   2612 C  CD1   . LEU A 1 329 ? 51.036 25.912 27.610  1.00  36.96  ? 323  LEU A CD1   1 
ATOM   2613 C  CD2   . LEU A 1 329 ? 50.561 24.997 25.324  1.00  36.63  ? 323  LEU A CD2   1 
ATOM   2614 N  N     . GLU A 1 330 ? 49.253 20.829 28.504  0.76  42.47  ? 324  GLU A N     1 
ATOM   2615 C  CA    . GLU A 1 330 ? 49.565 19.533 29.089  1.00  44.49  ? 324  GLU A CA    1 
ATOM   2616 C  C     . GLU A 1 330 ? 48.793 18.409 28.414  1.00  44.25  ? 324  GLU A C     1 
ATOM   2617 O  O     . GLU A 1 330 ? 49.355 17.368 28.082  1.00  44.45  ? 324  GLU A O     1 
ATOM   2618 C  CB    . GLU A 1 330 ? 49.226 19.564 30.582  0.99  46.23  ? 324  GLU A CB    1 
ATOM   2619 C  CG    . GLU A 1 330 ? 49.164 18.213 31.271  0.61  50.04  ? 324  GLU A CG    1 
ATOM   2620 C  CD    . GLU A 1 330 ? 48.310 18.252 32.528  0.53  51.32  ? 324  GLU A CD    1 
ATOM   2621 O  OE1   . GLU A 1 330 ? 48.639 19.023 33.455  0.010 52.03  ? 324  GLU A OE1   1 
ATOM   2622 O  OE2   . GLU A 1 330 ? 47.306 17.515 32.587  0.65  52.70  ? 324  GLU A OE2   1 
ATOM   2623 N  N     . GLU A 1 331 ? 47.502 18.629 28.196  1.00  45.26  ? 325  GLU A N     1 
ATOM   2624 C  CA    . GLU A 1 331 ? 46.651 17.605 27.604  1.00  45.34  ? 325  GLU A CA    1 
ATOM   2625 C  C     . GLU A 1 331 ? 46.655 17.529 26.076  1.00  46.49  ? 325  GLU A C     1 
ATOM   2626 O  O     . GLU A 1 331 ? 46.280 16.504 25.505  1.00  46.57  ? 325  GLU A O     1 
ATOM   2627 C  CB    . GLU A 1 331 ? 45.222 17.769 28.139  1.00  45.46  ? 325  GLU A CB    1 
ATOM   2628 C  CG    . GLU A 1 331 ? 45.162 17.866 29.673  1.00  45.12  ? 325  GLU A CG    1 
ATOM   2629 C  CD    . GLU A 1 331 ? 43.754 17.718 30.234  1.00  47.51  ? 325  GLU A CD    1 
ATOM   2630 O  OE1   . GLU A 1 331 ? 42.804 18.233 29.608  1.00  46.10  ? 325  GLU A OE1   1 
ATOM   2631 O  OE2   . GLU A 1 331 ? 43.597 17.096 31.309  1.00  47.23  ? 325  GLU A OE2   1 
ATOM   2632 N  N     . ASP A 1 332 ? 47.088 18.599 25.415  1.00  47.31  ? 326  ASP A N     1 
ATOM   2633 C  CA    . ASP A 1 332 ? 47.147 18.624 23.954  1.00  47.71  ? 326  ASP A CA    1 
ATOM   2634 C  C     . ASP A 1 332 ? 48.602 18.851 23.563  1.00  48.49  ? 326  ASP A C     1 
ATOM   2635 O  O     . ASP A 1 332 ? 49.255 19.743 24.094  1.00  49.57  ? 326  ASP A O     1 
ATOM   2636 C  CB    . ASP A 1 332 ? 46.282 19.758 23.397  1.00  47.96  ? 326  ASP A CB    1 
ATOM   2637 C  CG    . ASP A 1 332 ? 45.627 19.399 22.075  1.00  48.72  ? 326  ASP A CG    1 
ATOM   2638 O  OD1   . ASP A 1 332 ? 44.614 18.665 22.089  1.00  47.81  ? 326  ASP A OD1   1 
ATOM   2639 O  OD2   . ASP A 1 332 ? 46.128 19.841 21.020  1.00  49.61  ? 326  ASP A OD2   1 
ATOM   2640 N  N     . GLU A 1 333 ? 49.105 18.055 22.627  1.00  48.52  ? 327  GLU A N     1 
ATOM   2641 C  CA    . GLU A 1 333 ? 50.495 18.156 22.201  1.00  48.79  ? 327  GLU A CA    1 
ATOM   2642 C  C     . GLU A 1 333 ? 50.784 19.213 21.128  1.00  47.94  ? 327  GLU A C     1 
ATOM   2643 O  O     . GLU A 1 333 ? 51.916 19.678 20.995  1.00  47.55  ? 327  GLU A O     1 
ATOM   2644 C  CB    . GLU A 1 333 ? 50.970 16.784 21.701  0.80  51.05  ? 327  GLU A CB    1 
ATOM   2645 C  CG    . GLU A 1 333 ? 50.386 15.612 22.492  0.73  54.62  ? 327  GLU A CG    1 
ATOM   2646 C  CD    . GLU A 1 333 ? 51.116 14.301 22.253  0.91  56.60  ? 327  GLU A CD    1 
ATOM   2647 O  OE1   . GLU A 1 333 ? 52.302 14.338 21.865  0.35  57.96  ? 327  GLU A OE1   1 
ATOM   2648 O  OE2   . GLU A 1 333 ? 50.511 13.230 22.477  0.19  57.89  ? 327  GLU A OE2   1 
ATOM   2649 N  N     . ARG A 1 334 ? 49.770 19.599 20.362  1.00  47.41  ? 328  ARG A N     1 
ATOM   2650 C  CA    . ARG A 1 334 ? 49.966 20.573 19.288  1.00  45.86  ? 328  ARG A CA    1 
ATOM   2651 C  C     . ARG A 1 334 ? 50.336 21.982 19.718  1.00  45.22  ? 328  ARG A C     1 
ATOM   2652 O  O     . ARG A 1 334 ? 50.113 22.377 20.862  1.00  44.25  ? 328  ARG A O     1 
ATOM   2653 C  CB    . ARG A 1 334 ? 48.717 20.644 18.418  1.00  45.75  ? 328  ARG A CB    1 
ATOM   2654 C  CG    . ARG A 1 334 ? 48.508 19.440 17.536  1.00  46.20  ? 328  ARG A CG    1 
ATOM   2655 C  CD    . ARG A 1 334 ? 47.068 19.377 17.071  1.00  45.77  ? 328  ARG A CD    1 
ATOM   2656 N  NE    . ARG A 1 334 ? 46.173 19.148 18.197  1.00  45.97  ? 328  ARG A NE    1 
ATOM   2657 C  CZ    . ARG A 1 334 ? 44.851 19.085 18.101  1.00  46.99  ? 328  ARG A CZ    1 
ATOM   2658 N  NH1   . ARG A 1 334 ? 44.261 19.240 16.925  1.00  47.01  ? 328  ARG A NH1   1 
ATOM   2659 N  NH2   . ARG A 1 334 ? 44.117 18.861 19.182  1.00  45.86  ? 328  ARG A NH2   1 
ATOM   2660 N  N     . LYS A 1 335 ? 50.921 22.727 18.781  1.00  44.62  ? 329  LYS A N     1 
ATOM   2661 C  CA    . LYS A 1 335 ? 51.301 24.114 19.012  1.00  44.44  ? 329  LYS A CA    1 
ATOM   2662 C  C     . LYS A 1 335 ? 50.010 24.922 18.971  1.00  43.03  ? 329  LYS A C     1 
ATOM   2663 O  O     . LYS A 1 335 ? 49.044 24.532 18.306  1.00  41.86  ? 329  LYS A O     1 
ATOM   2664 C  CB    . LYS A 1 335 ? 52.230 24.619 17.901  1.00  47.12  ? 329  LYS A CB    1 
ATOM   2665 C  CG    . LYS A 1 335 ? 53.632 24.026 17.882  1.00  48.61  ? 329  LYS A CG    1 
ATOM   2666 C  CD    . LYS A 1 335 ? 54.173 24.026 16.455  1.00  49.84  ? 329  LYS A CD    1 
ATOM   2667 C  CE    . LYS A 1 335 ? 55.631 23.585 16.379  1.00  50.74  ? 329  LYS A CE    1 
ATOM   2668 N  NZ    . LYS A 1 335 ? 56.559 24.642 16.883  1.00  52.22  ? 329  LYS A NZ    1 
ATOM   2669 N  N     . ILE A 1 336 ? 49.997 26.044 19.678  1.00  41.42  ? 330  ILE A N     1 
ATOM   2670 C  CA    . ILE A 1 336 ? 48.821 26.900 19.710  1.00  39.85  ? 330  ILE A CA    1 
ATOM   2671 C  C     . ILE A 1 336 ? 48.977 28.050 18.731  1.00  38.46  ? 330  ILE A C     1 
ATOM   2672 O  O     . ILE A 1 336 ? 50.019 28.703 18.679  1.00  37.85  ? 330  ILE A O     1 
ATOM   2673 C  CB    . ILE A 1 336 ? 48.585 27.484 21.118  1.00  39.39  ? 330  ILE A CB    1 
ATOM   2674 C  CG1   . ILE A 1 336 ? 48.331 26.354 22.111  1.00  39.10  ? 330  ILE A CG1   1 
ATOM   2675 C  CG2   . ILE A 1 336 ? 47.401 28.437 21.095  1.00  39.21  ? 330  ILE A CG2   1 
ATOM   2676 C  CD1   . ILE A 1 336 ? 47.173 25.463 21.725  1.00  41.35  ? 330  ILE A CD1   1 
ATOM   2677 N  N     . ARG A 1 337 ? 47.927 28.296 17.962  1.00  38.33  ? 331  ARG A N     1 
ATOM   2678 C  CA    . ARG A 1 337 ? 47.938 29.364 16.983  1.00  39.54  ? 331  ARG A CA    1 
ATOM   2679 C  C     . ARG A 1 337 ? 47.147 30.568 17.494  1.00  37.60  ? 331  ARG A C     1 
ATOM   2680 O  O     . ARG A 1 337 ? 47.617 31.707 17.443  1.00  36.08  ? 331  ARG A O     1 
ATOM   2681 C  CB    . ARG A 1 337 ? 47.339 28.853 15.681  1.00  42.08  ? 331  ARG A CB    1 
ATOM   2682 C  CG    . ARG A 1 337 ? 47.295 29.886 14.615  1.00  46.86  ? 331  ARG A CG    1 
ATOM   2683 C  CD    . ARG A 1 337 ? 46.868 29.294 13.303  1.00  50.41  ? 331  ARG A CD    1 
ATOM   2684 N  NE    . ARG A 1 337 ? 46.840 30.358 12.312  1.00  54.84  ? 331  ARG A NE    1 
ATOM   2685 C  CZ    . ARG A 1 337 ? 46.655 30.179 11.011  1.00  56.89  ? 331  ARG A CZ    1 
ATOM   2686 N  NH1   . ARG A 1 337 ? 46.480 28.962 10.517  1.00  57.93  ? 331  ARG A NH1   1 
ATOM   2687 N  NH2   . ARG A 1 337 ? 46.646 31.227 10.204  1.00  56.09  ? 331  ARG A NH2   1 
ATOM   2688 N  N     . ARG A 1 338 ? 45.939 30.304 17.978  1.00  35.06  ? 332  ARG A N     1 
ATOM   2689 C  CA    . ARG A 1 338 ? 45.078 31.350 18.513  1.00  35.11  ? 332  ARG A CA    1 
ATOM   2690 C  C     . ARG A 1 338 ? 44.688 31.043 19.964  1.00  33.80  ? 332  ARG A C     1 
ATOM   2691 O  O     . ARG A 1 338 ? 44.386 29.897 20.315  1.00  29.69  ? 332  ARG A O     1 
ATOM   2692 C  CB    . ARG A 1 338 ? 43.823 31.488 17.650  1.00  36.35  ? 332  ARG A CB    1 
ATOM   2693 C  CG    . ARG A 1 338 ? 44.133 31.765 16.188  1.00  39.07  ? 332  ARG A CG    1 
ATOM   2694 C  CD    . ARG A 1 338 ? 43.127 32.721 15.593  1.00  40.43  ? 332  ARG A CD    1 
ATOM   2695 N  NE    . ARG A 1 338 ? 41.904 32.071 15.140  1.00  43.48  ? 332  ARG A NE    1 
ATOM   2696 C  CZ    . ARG A 1 338 ? 41.792 31.401 13.998  1.00  42.17  ? 332  ARG A CZ    1 
ATOM   2697 N  NH1   . ARG A 1 338 ? 42.834 31.290 13.192  1.00  40.92  ? 332  ARG A NH1   1 
ATOM   2698 N  NH2   . ARG A 1 338 ? 40.630 30.855 13.655  1.00  43.56  ? 332  ARG A NH2   1 
ATOM   2699 N  N     . ILE A 1 339 ? 44.693 32.073 20.802  1.00  31.37  ? 333  ILE A N     1 
ATOM   2700 C  CA    . ILE A 1 339 ? 44.345 31.892 22.202  1.00  31.33  ? 333  ILE A CA    1 
ATOM   2701 C  C     . ILE A 1 339 ? 43.381 32.989 22.678  1.00  31.35  ? 333  ILE A C     1 
ATOM   2702 O  O     . ILE A 1 339 ? 43.495 34.163 22.303  1.00  30.59  ? 333  ILE A O     1 
ATOM   2703 C  CB    . ILE A 1 339 ? 45.626 31.885 23.069  1.00  27.85  ? 333  ILE A CB    1 
ATOM   2704 C  CG1   . ILE A 1 339 ? 45.304 31.464 24.502  1.00  27.97  ? 333  ILE A CG1   1 
ATOM   2705 C  CG2   . ILE A 1 339 ? 46.286 33.251 23.031  1.00  28.07  ? 333  ILE A CG2   1 
ATOM   2706 C  CD1   . ILE A 1 339 ? 44.978 30.006 24.648  1.00  24.75  ? 333  ILE A CD1   1 
ATOM   2707 N  N     . GLY A 1 340 ? 42.420 32.597 23.496  1.00  30.17  ? 334  GLY A N     1 
ATOM   2708 C  CA    . GLY A 1 340 ? 41.465 33.563 23.989  1.00  30.00  ? 334  GLY A CA    1 
ATOM   2709 C  C     . GLY A 1 340 ? 40.702 33.058 25.192  1.00  29.44  ? 334  GLY A C     1 
ATOM   2710 O  O     . GLY A 1 340 ? 40.999 31.990 25.733  1.00  28.45  ? 334  GLY A O     1 
ATOM   2711 N  N     . VAL A 1 341 ? 39.700 33.827 25.598  1.00  28.87  ? 335  VAL A N     1 
ATOM   2712 C  CA    . VAL A 1 341 ? 38.882 33.484 26.751  1.00  28.23  ? 335  VAL A CA    1 
ATOM   2713 C  C     . VAL A 1 341 ? 37.417 33.770 26.504  1.00  26.34  ? 335  VAL A C     1 
ATOM   2714 O  O     . VAL A 1 341 ? 37.067 34.596 25.665  1.00  27.05  ? 335  VAL A O     1 
ATOM   2715 C  CB    . VAL A 1 341 ? 39.295 34.303 27.988  1.00  26.94  ? 335  VAL A CB    1 
ATOM   2716 C  CG1   . VAL A 1 341 ? 40.717 33.977 28.369  1.00  29.85  ? 335  VAL A CG1   1 
ATOM   2717 C  CG2   . VAL A 1 341 ? 39.160 35.779 27.697  1.00  21.49  ? 335  VAL A CG2   1 
ATOM   2718 N  N     A ARG A 1 342 ? 36.559 33.086 27.252  0.50  27.54  ? 336  ARG A N     1 
ATOM   2719 N  N     B ARG A 1 342 ? 36.567 33.085 27.256  0.50  28.28  ? 336  ARG A N     1 
ATOM   2720 C  CA    A ARG A 1 342 ? 35.117 33.268 27.156  0.50  27.98  ? 336  ARG A CA    1 
ATOM   2721 C  CA    B ARG A 1 342 ? 35.131 33.255 27.154  0.50  29.27  ? 336  ARG A CA    1 
ATOM   2722 C  C     A ARG A 1 342 ? 34.528 33.257 28.558  0.50  28.04  ? 336  ARG A C     1 
ATOM   2723 C  C     B ARG A 1 342 ? 34.530 33.256 28.558  0.50  28.84  ? 336  ARG A C     1 
ATOM   2724 O  O     A ARG A 1 342 ? 34.783 32.342 29.340  0.50  28.73  ? 336  ARG A O     1 
ATOM   2725 O  O     B ARG A 1 342 ? 34.781 32.342 29.343  0.50  29.40  ? 336  ARG A O     1 
ATOM   2726 C  CB    A ARG A 1 342 ? 34.492 32.153 26.316  0.50  28.30  ? 336  ARG A CB    1 
ATOM   2727 C  CB    B ARG A 1 342 ? 34.535 32.119 26.334  0.50  31.09  ? 336  ARG A CB    1 
ATOM   2728 C  CG    A ARG A 1 342 ? 32.977 32.243 26.173  0.50  29.51  ? 336  ARG A CG    1 
ATOM   2729 C  CG    B ARG A 1 342 ? 33.060 32.266 26.181  0.50  34.49  ? 336  ARG A CG    1 
ATOM   2730 C  CD    A ARG A 1 342 ? 32.540 31.654 24.835  0.50  29.64  ? 336  ARG A CD    1 
ATOM   2731 C  CD    B ARG A 1 342 ? 32.393 31.101 25.392  0.50  37.00  ? 336  ARG A CD    1 
ATOM   2732 N  NE    A ARG A 1 342 ? 33.091 32.427 23.722  0.50  29.77  ? 336  ARG A NE    1 
ATOM   2733 N  NE    B ARG A 1 342 ? 32.601 29.714 25.868  0.50  39.76  ? 336  ARG A NE    1 
ATOM   2734 C  CZ    A ARG A 1 342 ? 32.584 33.578 23.283  0.50  29.94  ? 336  ARG A CZ    1 
ATOM   2735 C  CZ    B ARG A 1 342 ? 31.803 29.057 26.716  0.50  39.80  ? 336  ARG A CZ    1 
ATOM   2736 N  NH1   A ARG A 1 342 ? 33.149 34.225 22.272  0.50  28.10  ? 336  ARG A NH1   1 
ATOM   2737 N  NH1   B ARG A 1 342 ? 32.076 27.803 27.075  0.50  39.21  ? 336  ARG A NH1   1 
ATOM   2738 N  NH2   A ARG A 1 342 ? 31.493 34.075 23.840  0.50  30.68  ? 336  ARG A NH2   1 
ATOM   2739 N  NH2   B ARG A 1 342 ? 30.718 29.652 27.191  0.50  39.62  ? 336  ARG A NH2   1 
ATOM   2740 N  N     . PHE A 1 343 ? 33.750 34.288 28.870  1.00  28.49  ? 337  PHE A N     1 
ATOM   2741 C  CA    . PHE A 1 343 ? 33.110 34.420 30.177  1.00  28.26  ? 337  PHE A CA    1 
ATOM   2742 C  C     . PHE A 1 343 ? 31.621 34.215 30.031  1.00  29.28  ? 337  PHE A C     1 
ATOM   2743 O  O     . PHE A 1 343 ? 31.008 34.755 29.107  1.00  29.49  ? 337  PHE A O     1 
ATOM   2744 C  CB    . PHE A 1 343 ? 33.373 35.813 30.751  1.00  27.34  ? 337  PHE A CB    1 
ATOM   2745 C  CG    . PHE A 1 343 ? 34.803 36.040 31.133  1.00  28.83  ? 337  PHE A CG    1 
ATOM   2746 C  CD1   . PHE A 1 343 ? 35.291 35.563 32.348  1.00  26.36  ? 337  PHE A CD1   1 
ATOM   2747 C  CD2   . PHE A 1 343 ? 35.680 36.668 30.255  1.00  26.80  ? 337  PHE A CD2   1 
ATOM   2748 C  CE1   . PHE A 1 343 ? 36.635 35.707 32.683  1.00  28.42  ? 337  PHE A CE1   1 
ATOM   2749 C  CE2   . PHE A 1 343 ? 37.033 36.815 30.581  1.00  26.79  ? 337  PHE A CE2   1 
ATOM   2750 C  CZ    . PHE A 1 343 ? 37.508 36.331 31.799  1.00  27.48  ? 337  PHE A CZ    1 
ATOM   2751 N  N     . SER A 1 344 ? 31.027 33.451 30.941  1.00  29.85  ? 338  SER A N     1 
ATOM   2752 C  CA    . SER A 1 344 ? 29.594 33.202 30.860  1.00  32.04  ? 338  SER A CA    1 
ATOM   2753 C  C     . SER A 1 344 ? 28.940 32.962 32.222  1.00  34.01  ? 338  SER A C     1 
ATOM   2754 O  O     . SER A 1 344 ? 29.578 33.100 33.267  1.00  31.88  ? 338  SER A O     1 
ATOM   2755 C  CB    . SER A 1 344 ? 29.330 32.008 29.942  1.00  32.15  ? 338  SER A CB    1 
ATOM   2756 O  OG    . SER A 1 344 ? 29.957 30.837 30.439  1.00  32.66  ? 338  SER A OG    1 
ATOM   2757 N  N     . LYS A 1 345 ? 27.657 32.599 32.183  1.00  35.26  ? 339  LYS A N     1 
ATOM   2758 C  CA    . LYS A 1 345 ? 26.861 32.337 33.376  1.00  36.03  ? 339  LYS A CA    1 
ATOM   2759 C  C     . LYS A 1 345 ? 26.856 33.555 34.283  1.00  36.93  ? 339  LYS A C     1 
ATOM   2760 O  O     . LYS A 1 345 ? 27.200 33.467 35.463  1.00  36.85  ? 339  LYS A O     1 
ATOM   2761 C  CB    . LYS A 1 345 ? 27.405 31.117 34.122  1.00  37.73  ? 339  LYS A CB    1 
ATOM   2762 C  CG    . LYS A 1 345 ? 27.250 29.814 33.354  1.00  37.68  ? 339  LYS A CG    1 
ATOM   2763 C  CD    . LYS A 1 345 ? 27.711 28.632 34.177  1.00  40.87  ? 339  LYS A CD    1 
ATOM   2764 C  CE    . LYS A 1 345 ? 27.537 27.322 33.415  1.00  41.88  ? 339  LYS A CE    1 
ATOM   2765 N  NZ    . LYS A 1 345 ? 28.025 26.146 34.201  1.00  43.42  ? 339  LYS A NZ    1 
ATOM   2766 N  N     . PHE A 1 346 ? 26.458 34.687 33.706  1.00  37.57  ? 340  PHE A N     1 
ATOM   2767 C  CA    . PHE A 1 346 ? 26.396 35.963 34.399  1.00  37.91  ? 340  PHE A CA    1 
ATOM   2768 C  C     . PHE A 1 346 ? 25.441 35.970 35.584  1.00  38.23  ? 340  PHE A C     1 
ATOM   2769 O  O     . PHE A 1 346 ? 24.284 35.561 35.472  1.00  38.22  ? 340  PHE A O     1 
ATOM   2770 C  CB    . PHE A 1 346 ? 25.975 37.075 33.434  1.00  37.65  ? 340  PHE A CB    1 
ATOM   2771 C  CG    . PHE A 1 346 ? 26.830 37.181 32.202  1.00  39.65  ? 340  PHE A CG    1 
ATOM   2772 C  CD1   . PHE A 1 346 ? 28.216 37.118 32.289  1.00  39.68  ? 340  PHE A CD1   1 
ATOM   2773 C  CD2   . PHE A 1 346 ? 26.247 37.388 30.955  1.00  38.21  ? 340  PHE A CD2   1 
ATOM   2774 C  CE1   . PHE A 1 346 ? 29.009 37.263 31.155  1.00  39.69  ? 340  PHE A CE1   1 
ATOM   2775 C  CE2   . PHE A 1 346 ? 27.026 37.535 29.823  1.00  39.29  ? 340  PHE A CE2   1 
ATOM   2776 C  CZ    . PHE A 1 346 ? 28.415 37.473 29.920  1.00  39.70  ? 340  PHE A CZ    1 
ATOM   2777 N  N     . ILE A 1 347 ? 25.937 36.457 36.715  1.00  39.62  ? 341  ILE A N     1 
ATOM   2778 C  CA    . ILE A 1 347 ? 25.143 36.551 37.934  1.00  41.84  ? 341  ILE A CA    1 
ATOM   2779 C  C     . ILE A 1 347 ? 23.833 37.280 37.657  1.00  41.37  ? 341  ILE A C     1 
ATOM   2780 O  O     . ILE A 1 347 ? 23.883 38.392 37.091  1.00  41.71  ? 341  ILE A O     1 
ATOM   2781 C  CB    . ILE A 1 347 ? 25.912 37.310 39.033  1.00  41.22  ? 341  ILE A CB    1 
ATOM   2782 C  CG1   . ILE A 1 347 ? 27.004 36.414 39.613  1.00  42.50  ? 341  ILE A CG1   1 
ATOM   2783 C  CG2   . ILE A 1 347 ? 24.962 37.764 40.127  1.00  42.92  ? 341  ILE A CG2   1 
ATOM   2784 C  CD1   . ILE A 1 347 ? 27.895 37.130 40.613  1.00  46.16  ? 341  ILE A CD1   1 
ATOM   2785 N  N     . GLU A 1 348 ? 22.775 36.728 38.017  1.00  43.17  ? 342  GLU A N     1 
ATOM   2786 O  "O5'" . DG  B 2 1   ? 14.718 1.227  33.678  1.00  47.41  ? 1    DG  P "O5'" 1 
ATOM   2787 C  "C5'" . DG  B 2 1   ? 15.519 1.542  34.826  1.00  43.09  ? 1    DG  P "C5'" 1 
ATOM   2788 C  "C4'" . DG  B 2 1   ? 15.004 2.818  35.492  1.00  41.71  ? 1    DG  P "C4'" 1 
ATOM   2789 O  "O4'" . DG  B 2 1   ? 15.704 3.050  36.733  1.00  38.29  ? 1    DG  P "O4'" 1 
ATOM   2790 C  "C3'" . DG  B 2 1   ? 15.154 4.098  34.667  1.00  40.47  ? 1    DG  P "C3'" 1 
ATOM   2791 O  "O3'" . DG  B 2 1   ? 13.958 4.865  34.817  1.00  45.59  ? 1    DG  P "O3'" 1 
ATOM   2792 C  "C2'" . DG  B 2 1   ? 16.313 4.813  35.332  1.00  37.03  ? 1    DG  P "C2'" 1 
ATOM   2793 C  "C1'" . DG  B 2 1   ? 16.166 4.386  36.781  1.00  37.83  ? 1    DG  P "C1'" 1 
ATOM   2794 N  N9    . DG  B 2 1   ? 17.416 4.389  37.531  1.00  33.90  ? 1    DG  P N9    1 
ATOM   2795 C  C8    . DG  B 2 1   ? 18.567 3.721  37.207  1.00  32.91  ? 1    DG  P C8    1 
ATOM   2796 N  N7    . DG  B 2 1   ? 19.526 3.902  38.076  1.00  34.32  ? 1    DG  P N7    1 
ATOM   2797 C  C5    . DG  B 2 1   ? 18.970 4.745  39.028  1.00  31.97  ? 1    DG  P C5    1 
ATOM   2798 C  C6    . DG  B 2 1   ? 19.529 5.291  40.212  1.00  31.43  ? 1    DG  P C6    1 
ATOM   2799 O  O6    . DG  B 2 1   ? 20.660 5.129  40.682  1.00  31.53  ? 1    DG  P O6    1 
ATOM   2800 N  N1    . DG  B 2 1   ? 18.622 6.109  40.876  1.00  32.64  ? 1    DG  P N1    1 
ATOM   2801 C  C2    . DG  B 2 1   ? 17.334 6.357  40.465  1.00  31.53  ? 1    DG  P C2    1 
ATOM   2802 N  N2    . DG  B 2 1   ? 16.608 7.171  41.243  1.00  32.74  ? 1    DG  P N2    1 
ATOM   2803 N  N3    . DG  B 2 1   ? 16.799 5.846  39.368  1.00  32.05  ? 1    DG  P N3    1 
ATOM   2804 C  C4    . DG  B 2 1   ? 17.667 5.058  38.705  1.00  33.35  ? 1    DG  P C4    1 
ATOM   2805 P  P     . DG  B 2 2   ? 13.429 5.764  33.606  1.00  48.04  ? 2    DG  P P     1 
ATOM   2806 O  OP1   . DG  B 2 2   ? 12.032 5.425  33.255  1.00  49.41  ? 2    DG  P OP1   1 
ATOM   2807 O  OP2   . DG  B 2 2   ? 14.327 5.677  32.442  1.00  48.80  ? 2    DG  P OP2   1 
ATOM   2808 O  "O5'" . DG  B 2 2   ? 13.573 7.226  34.227  1.00  47.68  ? 2    DG  P "O5'" 1 
ATOM   2809 C  "C5'" . DG  B 2 2   ? 14.785 7.483  34.701  1.00  52.06  ? 2    DG  P "C5'" 1 
ATOM   2810 C  "C4'" . DG  B 2 2   ? 14.661 8.310  35.973  1.00  53.03  ? 2    DG  P "C4'" 1 
ATOM   2811 O  "O4'" . DG  B 2 2   ? 15.734 7.966  36.889  1.00  51.77  ? 2    DG  P "O4'" 1 
ATOM   2812 C  "C3'" . DG  B 2 2   ? 15.010 9.646  35.355  1.00  55.38  ? 2    DG  P "C3'" 1 
ATOM   2813 O  "O3'" . DG  B 2 2   ? 14.138 10.735 35.629  1.00  58.38  ? 2    DG  P "O3'" 1 
ATOM   2814 C  "C2'" . DG  B 2 2   ? 16.481 9.910  35.747  1.00  53.56  ? 2    DG  P "C2'" 1 
ATOM   2815 C  "C1'" . DG  B 2 2   ? 16.747 8.999  36.883  1.00  49.76  ? 2    DG  P "C1'" 1 
ATOM   2816 N  N9    . DG  B 2 2   ? 18.047 8.339  36.904  1.00  44.98  ? 2    DG  P N9    1 
ATOM   2817 C  C8    . DG  B 2 2   ? 18.603 7.491  35.963  1.00  43.80  ? 2    DG  P C8    1 
ATOM   2818 N  N7    . DG  B 2 2   ? 19.798 7.062  36.294  1.00  44.25  ? 2    DG  P N7    1 
ATOM   2819 C  C5    . DG  B 2 2   ? 20.049 7.648  37.517  1.00  42.06  ? 2    DG  P C5    1 
ATOM   2820 C  C6    . DG  B 2 2   ? 21.162 7.545  38.385  1.00  41.10  ? 2    DG  P C6    1 
ATOM   2821 O  O6    . DG  B 2 2   ? 22.183 6.869  38.254  1.00  43.20  ? 2    DG  P O6    1 
ATOM   2822 N  N1    . DG  B 2 2   ? 21.001 8.337  39.515  1.00  41.26  ? 2    DG  P N1    1 
ATOM   2823 C  C2    . DG  B 2 2   ? 19.891 9.100  39.796  1.00  40.98  ? 2    DG  P C2    1 
ATOM   2824 N  N2    . DG  B 2 2   ? 19.918 9.812  40.912  1.00  41.45  ? 2    DG  P N2    1 
ATOM   2825 N  N3    . DG  B 2 2   ? 18.839 9.168  39.023  1.00  40.14  ? 2    DG  P N3    1 
ATOM   2826 C  C4    . DG  B 2 2   ? 18.982 8.433  37.911  1.00  43.24  ? 2    DG  P C4    1 
ATOM   2827 P  P     . DG  B 2 3   ? 14.319 12.087 34.707  1.00  59.87  ? 3    DG  P P     1 
ATOM   2828 O  OP1   . DG  B 2 3   ? 13.093 12.549 34.027  1.00  60.05  ? 3    DG  P OP1   1 
ATOM   2829 O  OP2   . DG  B 2 3   ? 15.388 11.782 33.750  1.00  60.32  ? 3    DG  P OP2   1 
ATOM   2830 O  "O5'" . DG  B 2 3   ? 14.820 13.091 35.857  1.00  58.91  ? 3    DG  P "O5'" 1 
ATOM   2831 C  "C5'" . DG  B 2 3   ? 13.975 13.376 36.968  1.00  56.08  ? 3    DG  P "C5'" 1 
ATOM   2832 C  "C4'" . DG  B 2 3   ? 14.755 14.211 37.982  1.00  54.66  ? 3    DG  P "C4'" 1 
ATOM   2833 O  "O4'" . DG  B 2 3   ? 15.917 13.452 38.390  1.00  50.82  ? 3    DG  P "O4'" 1 
ATOM   2834 C  "C3'" . DG  B 2 3   ? 15.294 15.534 37.441  1.00  54.96  ? 3    DG  P "C3'" 1 
ATOM   2835 O  "O3'" . DG  B 2 3   ? 15.278 16.494 38.500  1.00  59.02  ? 3    DG  P "O3'" 1 
ATOM   2836 C  "C2'" . DG  B 2 3   ? 16.725 15.204 37.060  1.00  52.79  ? 3    DG  P "C2'" 1 
ATOM   2837 C  "C1'" . DG  B 2 3   ? 17.098 14.197 38.128  1.00  50.41  ? 3    DG  P "C1'" 1 
ATOM   2838 N  N9    . DG  B 2 3   ? 18.150 13.260 37.739  1.00  46.82  ? 3    DG  P N9    1 
ATOM   2839 C  C8    . DG  B 2 3   ? 18.145 12.394 36.671  1.00  44.54  ? 3    DG  P C8    1 
ATOM   2840 N  N7    . DG  B 2 3   ? 19.232 11.677 36.588  1.00  43.77  ? 3    DG  P N7    1 
ATOM   2841 C  C5    . DG  B 2 3   ? 20.004 12.102 37.663  1.00  42.13  ? 3    DG  P C5    1 
ATOM   2842 C  C6    . DG  B 2 3   ? 21.294 11.696 38.087  1.00  39.77  ? 3    DG  P C6    1 
ATOM   2843 O  O6    . DG  B 2 3   ? 22.038 10.844 37.586  1.00  37.84  ? 3    DG  P O6    1 
ATOM   2844 N  N1    . DG  B 2 3   ? 21.702 12.394 39.221  1.00  40.18  ? 3    DG  P N1    1 
ATOM   2845 C  C2    . DG  B 2 3   ? 20.966 13.355 39.866  1.00  39.86  ? 3    DG  P C2    1 
ATOM   2846 N  N2    . DG  B 2 3   ? 21.534 13.912 40.938  1.00  40.89  ? 3    DG  P N2    1 
ATOM   2847 N  N3    . DG  B 2 3   ? 19.763 13.740 39.485  1.00  42.44  ? 3    DG  P N3    1 
ATOM   2848 C  C4    . DG  B 2 3   ? 19.347 13.079 38.382  1.00  43.63  ? 3    DG  P C4    1 
ATOM   2849 P  P     . DG  B 2 4   ? 15.535 18.043 38.167  1.00  60.92  ? 4    DG  P P     1 
ATOM   2850 O  OP1   . DG  B 2 4   ? 14.264 18.798 38.272  1.00  60.67  ? 4    DG  P OP1   1 
ATOM   2851 O  OP2   . DG  B 2 4   ? 16.106 18.182 36.802  1.00  59.54  ? 4    DG  P OP2   1 
ATOM   2852 O  "O5'" . DG  B 2 4   ? 16.595 18.520 39.281  1.00  60.62  ? 4    DG  P "O5'" 1 
ATOM   2853 C  "C5'" . DG  B 2 4   ? 17.689 17.673 39.614  1.00  60.69  ? 4    DG  P "C5'" 1 
ATOM   2854 C  "C4'" . DG  B 2 4   ? 19.013 18.431 39.504  1.00  59.46  ? 4    DG  P "C4'" 1 
ATOM   2855 O  "O4'" . DG  B 2 4   ? 20.035 17.467 39.138  1.00  58.09  ? 4    DG  P "O4'" 1 
ATOM   2856 C  "C3'" . DG  B 2 4   ? 19.046 19.498 38.411  1.00  59.85  ? 4    DG  P "C3'" 1 
ATOM   2857 O  "O3'" . DG  B 2 4   ? 19.908 20.556 38.835  1.00  62.06  ? 4    DG  P "O3'" 1 
ATOM   2858 C  "C2'" . DG  B 2 4   ? 19.658 18.777 37.227  1.00  57.66  ? 4    DG  P "C2'" 1 
ATOM   2859 C  "C1'" . DG  B 2 4   ? 20.627 17.825 37.898  1.00  54.99  ? 4    DG  P "C1'" 1 
ATOM   2860 N  N9    . DG  B 2 4   ? 20.854 16.610 37.121  1.00  51.69  ? 4    DG  P N9    1 
ATOM   2861 C  C8    . DG  B 2 4   ? 20.055 16.113 36.116  1.00  50.73  ? 4    DG  P C8    1 
ATOM   2862 N  N7    . DG  B 2 4   ? 20.563 15.063 35.529  1.00  49.06  ? 4    DG  P N7    1 
ATOM   2863 C  C5    . DG  B 2 4   ? 21.758 14.840 36.200  1.00  46.97  ? 4    DG  P C5    1 
ATOM   2864 C  C6    . DG  B 2 4   ? 22.761 13.856 35.989  1.00  43.48  ? 4    DG  P C6    1 
ATOM   2865 O  O6    . DG  B 2 4   ? 22.806 12.974 35.132  1.00  41.33  ? 4    DG  P O6    1 
ATOM   2866 N  N1    . DG  B 2 4   ? 23.801 13.983 36.902  1.00  44.03  ? 4    DG  P N1    1 
ATOM   2867 C  C2    . DG  B 2 4   ? 23.880 14.942 37.881  1.00  44.46  ? 4    DG  P C2    1 
ATOM   2868 N  N2    . DG  B 2 4   ? 24.967 14.896 38.661  1.00  42.81  ? 4    DG  P N2    1 
ATOM   2869 N  N3    . DG  B 2 4   ? 22.963 15.878 38.078  1.00  46.58  ? 4    DG  P N3    1 
ATOM   2870 C  C4    . DG  B 2 4   ? 21.937 15.768 37.205  1.00  48.20  ? 4    DG  P C4    1 
ATOM   2871 P  P     . DG  B 2 5   ? 20.172 21.800 37.860  1.00  63.55  ? 5    DG  P P     1 
ATOM   2872 O  OP1   . DG  B 2 5   ? 19.598 23.025 38.463  1.00  64.97  ? 5    DG  P OP1   1 
ATOM   2873 O  OP2   . DG  B 2 5   ? 19.620 21.582 36.502  1.00  64.55  ? 5    DG  P OP2   1 
ATOM   2874 O  "O5'" . DG  B 2 5   ? 21.774 21.902 37.770  1.00  63.73  ? 5    DG  P "O5'" 1 
ATOM   2875 C  "C5'" . DG  B 2 5   ? 22.584 21.499 38.859  1.00  59.80  ? 5    DG  P "C5'" 1 
ATOM   2876 C  "C4'" . DG  B 2 5   ? 23.965 21.094 38.343  1.00  58.19  ? 5    DG  P "C4'" 1 
ATOM   2877 O  "O4'" . DG  B 2 5   ? 23.956 19.742 37.823  1.00  56.00  ? 5    DG  P "O4'" 1 
ATOM   2878 C  "C3'" . DG  B 2 5   ? 24.466 21.980 37.203  1.00  57.30  ? 5    DG  P "C3'" 1 
ATOM   2879 O  "O3'" . DG  B 2 5   ? 25.863 22.214 37.384  1.00  59.21  ? 5    DG  P "O3'" 1 
ATOM   2880 C  "C2'" . DG  B 2 5   ? 24.303 21.104 35.980  1.00  56.26  ? 5    DG  P "C2'" 1 
ATOM   2881 C  "C1'" . DG  B 2 5   ? 24.628 19.759 36.583  1.00  53.60  ? 5    DG  P "C1'" 1 
ATOM   2882 N  N9    . DG  B 2 5   ? 24.201 18.616 35.786  1.00  51.21  ? 5    DG  P N9    1 
ATOM   2883 C  C8    . DG  B 2 5   ? 22.996 18.426 35.155  1.00  48.93  ? 5    DG  P C8    1 
ATOM   2884 N  N7    . DG  B 2 5   ? 22.967 17.339 34.429  1.00  48.81  ? 5    DG  P N7    1 
ATOM   2885 C  C5    . DG  B 2 5   ? 24.222 16.771 34.613  1.00  46.11  ? 5    DG  P C5    1 
ATOM   2886 C  C6    . DG  B 2 5   ? 24.792 15.597 34.061  1.00  44.27  ? 5    DG  P C6    1 
ATOM   2887 O  O6    . DG  B 2 5   ? 24.292 14.797 33.262  1.00  43.57  ? 5    DG  P O6    1 
ATOM   2888 N  N1    . DG  B 2 5   ? 26.085 15.394 34.521  1.00  42.58  ? 5    DG  P N1    1 
ATOM   2889 C  C2    . DG  B 2 5   ? 26.753 16.214 35.392  1.00  42.33  ? 5    DG  P C2    1 
ATOM   2890 N  N2    . DG  B 2 5   ? 28.000 15.846 35.716  1.00  39.15  ? 5    DG  P N2    1 
ATOM   2891 N  N3    . DG  B 2 5   ? 26.240 17.314 35.905  1.00  44.82  ? 5    DG  P N3    1 
ATOM   2892 C  C4    . DG  B 2 5   ? 24.981 17.531 35.473  1.00  48.10  ? 5    DG  P C4    1 
ATOM   2893 P  P     . DA  B 2 6   ? 26.488 23.602 36.904  1.00  60.11  ? 6    DA  P P     1 
ATOM   2894 O  OP1   . DA  B 2 6   ? 26.217 24.644 37.919  1.00  60.84  ? 6    DA  P OP1   1 
ATOM   2895 O  OP2   . DA  B 2 6   ? 25.948 23.994 35.581  1.00  59.75  ? 6    DA  P OP2   1 
ATOM   2896 O  "O5'" . DA  B 2 6   ? 28.064 23.299 36.818  1.00  57.33  ? 6    DA  P "O5'" 1 
ATOM   2897 C  "C5'" . DA  B 2 6   ? 28.660 22.405 37.734  1.00  53.92  ? 6    DA  P "C5'" 1 
ATOM   2898 C  "C4'" . DA  B 2 6   ? 29.666 21.528 36.993  1.00  50.71  ? 6    DA  P "C4'" 1 
ATOM   2899 O  "O4'" . DA  B 2 6   ? 28.988 20.483 36.259  1.00  49.63  ? 6    DA  P "O4'" 1 
ATOM   2900 C  "C3'" . DA  B 2 6   ? 30.431 22.340 35.956  1.00  49.14  ? 6    DA  P "C3'" 1 
ATOM   2901 O  "O3'" . DA  B 2 6   ? 31.802 21.945 35.985  1.00  49.61  ? 6    DA  P "O3'" 1 
ATOM   2902 C  "C2'" . DA  B 2 6   ? 29.794 21.950 34.635  1.00  48.56  ? 6    DA  P "C2'" 1 
ATOM   2903 C  "C1'" . DA  B 2 6   ? 29.411 20.510 34.904  1.00  46.10  ? 6    DA  P "C1'" 1 
ATOM   2904 N  N9    . DA  B 2 6   ? 28.327 19.973 34.083  1.00  42.74  ? 6    DA  P N9    1 
ATOM   2905 C  C8    . DA  B 2 6   ? 27.070 20.484 33.880  1.00  40.04  ? 6    DA  P C8    1 
ATOM   2906 N  N7    . DA  B 2 6   ? 26.320 19.744 33.096  1.00  39.73  ? 6    DA  P N7    1 
ATOM   2907 C  C5    . DA  B 2 6   ? 27.140 18.675 32.759  1.00  38.73  ? 6    DA  P C5    1 
ATOM   2908 C  C6    . DA  B 2 6   ? 26.933 17.532 31.957  1.00  37.44  ? 6    DA  P C6    1 
ATOM   2909 N  N6    . DA  B 2 6   ? 25.786 17.253 31.337  1.00  34.41  ? 6    DA  P N6    1 
ATOM   2910 N  N1    . DA  B 2 6   ? 27.963 16.668 31.820  1.00  36.43  ? 6    DA  P N1    1 
ATOM   2911 C  C2    . DA  B 2 6   ? 29.110 16.932 32.456  1.00  37.80  ? 6    DA  P C2    1 
ATOM   2912 N  N3    . DA  B 2 6   ? 29.421 17.963 33.244  1.00  39.55  ? 6    DA  P N3    1 
ATOM   2913 C  C4    . DA  B 2 6   ? 28.381 18.809 33.353  1.00  40.81  ? 6    DA  P C4    1 
ATOM   2914 P  P     . DA  B 2 7   ? 32.885 22.861 35.275  1.00  48.02  ? 7    DA  P P     1 
ATOM   2915 O  OP1   . DA  B 2 7   ? 33.880 23.355 36.256  1.00  51.17  ? 7    DA  P OP1   1 
ATOM   2916 O  OP2   . DA  B 2 7   ? 32.266 23.964 34.512  1.00  47.54  ? 7    DA  P OP2   1 
ATOM   2917 O  "O5'" . DA  B 2 7   ? 33.575 21.832 34.259  1.00  47.28  ? 7    DA  P "O5'" 1 
ATOM   2918 C  "C5'" . DA  B 2 7   ? 33.587 20.419 34.553  1.00  49.27  ? 7    DA  P "C5'" 1 
ATOM   2919 C  "C4'" . DA  B 2 7   ? 33.840 19.672 33.244  1.00  46.67  ? 7    DA  P "C4'" 1 
ATOM   2920 O  "O4'" . DA  B 2 7   ? 32.631 19.254 32.603  1.00  46.10  ? 7    DA  P "O4'" 1 
ATOM   2921 C  "C3'" . DA  B 2 7   ? 34.519 20.628 32.251  1.00  47.18  ? 7    DA  P "C3'" 1 
ATOM   2922 O  "O3'" . DA  B 2 7   ? 35.500 19.949 31.452  1.00  47.99  ? 7    DA  P "O3'" 1 
ATOM   2923 C  "C2'" . DA  B 2 7   ? 33.354 21.025 31.363  1.00  46.11  ? 7    DA  P "C2'" 1 
ATOM   2924 C  "C1'" . DA  B 2 7   ? 32.689 19.689 31.229  1.00  44.31  ? 7    DA  P "C1'" 1 
ATOM   2925 N  N9    . DA  B 2 7   ? 31.340 19.809 30.762  1.00  39.83  ? 7    DA  P N9    1 
ATOM   2926 C  C8    . DA  B 2 7   ? 30.446 20.814 30.980  1.00  38.32  ? 7    DA  P C8    1 
ATOM   2927 N  N7    . DA  B 2 7   ? 29.316 20.644 30.423  1.00  35.67  ? 7    DA  P N7    1 
ATOM   2928 C  C5    . DA  B 2 7   ? 29.443 19.412 29.784  1.00  35.82  ? 7    DA  P C5    1 
ATOM   2929 C  C6    . DA  B 2 7   ? 28.571 18.639 29.009  1.00  35.07  ? 7    DA  P C6    1 
ATOM   2930 N  N6    . DA  B 2 7   ? 27.314 19.007 28.732  1.00  35.03  ? 7    DA  P N6    1 
ATOM   2931 N  N1    . DA  B 2 7   ? 29.024 17.467 28.520  1.00  34.44  ? 7    DA  P N1    1 
ATOM   2932 C  C2    . DA  B 2 7   ? 30.275 17.088 28.815  1.00  34.87  ? 7    DA  P C2    1 
ATOM   2933 N  N3    . DA  B 2 7   ? 31.189 17.729 29.549  1.00  35.33  ? 7    DA  P N3    1 
ATOM   2934 C  C4    . DA  B 2 7   ? 30.674 18.893 29.993  1.00  36.18  ? 7    DA  P C4    1 
ATOM   2935 P  P     . DG  B 2 8   ? 36.673 20.780 30.719  1.00  47.08  ? 8    DG  P P     1 
ATOM   2936 O  OP1   . DG  B 2 8   ? 37.836 20.360 31.532  1.00  45.15  ? 8    DG  P OP1   1 
ATOM   2937 O  OP2   . DG  B 2 8   ? 36.372 22.209 30.781  1.00  46.23  ? 8    DG  P OP2   1 
ATOM   2938 O  "O5'" . DG  B 2 8   ? 36.675 20.202 29.218  1.00  42.17  ? 8    DG  P "O5'" 1 
ATOM   2939 C  "C5'" . DG  B 2 8   ? 36.844 18.830 28.979  1.00  40.47  ? 8    DG  P "C5'" 1 
ATOM   2940 C  "C4'" . DG  B 2 8   ? 36.398 18.514 27.553  1.00  40.22  ? 8    DG  P "C4'" 1 
ATOM   2941 O  "O4'" . DG  B 2 8   ? 34.954 18.570 27.459  1.00  38.45  ? 8    DG  P "O4'" 1 
ATOM   2942 C  "C3'" . DG  B 2 8   ? 36.938 19.494 26.515  1.00  39.30  ? 8    DG  P "C3'" 1 
ATOM   2943 O  "O3'" . DG  B 2 8   ? 37.436 18.725 25.420  1.00  42.13  ? 8    DG  P "O3'" 1 
ATOM   2944 C  "C2'" . DG  B 2 8   ? 35.723 20.315 26.116  1.00  39.02  ? 8    DG  P "C2'" 1 
ATOM   2945 C  "C1'" . DG  B 2 8   ? 34.577 19.343 26.337  1.00  38.47  ? 8    DG  P "C1'" 1 
ATOM   2946 N  N9    . DG  B 2 8   ? 33.284 19.963 26.630  1.00  37.46  ? 8    DG  P N9    1 
ATOM   2947 C  C8    . DG  B 2 8   ? 33.053 21.093 27.382  1.00  36.84  ? 8    DG  P C8    1 
ATOM   2948 N  N7    . DG  B 2 8   ? 31.787 21.414 27.455  1.00  35.24  ? 8    DG  P N7    1 
ATOM   2949 C  C5    . DG  B 2 8   ? 31.139 20.437 26.707  1.00  36.47  ? 8    DG  P C5    1 
ATOM   2950 C  C6    . DG  B 2 8   ? 29.752 20.263 26.405  1.00  34.06  ? 8    DG  P C6    1 
ATOM   2951 O  O6    . DG  B 2 8   ? 28.787 20.959 26.748  1.00  34.14  ? 8    DG  P O6    1 
ATOM   2952 N  N1    . DG  B 2 8   ? 29.539 19.141 25.618  1.00  34.19  ? 8    DG  P N1    1 
ATOM   2953 C  C2    . DG  B 2 8   ? 30.517 18.287 25.180  1.00  33.79  ? 8    DG  P C2    1 
ATOM   2954 N  N2    . DG  B 2 8   ? 30.095 17.237 24.470  1.00  32.96  ? 8    DG  P N2    1 
ATOM   2955 N  N3    . DG  B 2 8   ? 31.808 18.444 25.430  1.00  34.69  ? 8    DG  P N3    1 
ATOM   2956 C  C4    . DG  B 2 8   ? 32.047 19.529 26.197  1.00  35.88  ? 8    DG  P C4    1 
ATOM   2957 P  P     . DG  B 2 9   ? 38.039 19.458 24.134  1.00  40.00  ? 9    DG  P P     1 
ATOM   2958 O  OP1   . DG  B 2 9   ? 39.459 19.064 23.988  1.00  45.44  ? 9    DG  P OP1   1 
ATOM   2959 O  OP2   . DG  B 2 9   ? 37.911 20.929 24.164  1.00  42.06  ? 9    DG  P OP2   1 
ATOM   2960 O  "O5'" . DG  B 2 9   ? 37.145 18.840 22.952  1.00  42.65  ? 9    DG  P "O5'" 1 
ATOM   2961 C  "C5'" . DG  B 2 9   ? 36.542 17.570 23.139  1.00  42.34  ? 9    DG  P "C5'" 1 
ATOM   2962 C  "C4'" . DG  B 2 9   ? 35.275 17.459 22.293  1.00  43.19  ? 9    DG  P "C4'" 1 
ATOM   2963 O  "O4'" . DG  B 2 9   ? 34.143 18.133 22.896  1.00  42.51  ? 9    DG  P "O4'" 1 
ATOM   2964 C  "C3'" . DG  B 2 9   ? 35.430 18.045 20.896  1.00  43.18  ? 9    DG  P "C3'" 1 
ATOM   2965 O  "O3'" . DG  B 2 9   ? 34.905 17.090 19.973  1.00  45.39  ? 9    DG  P "O3'" 1 
ATOM   2966 C  "C2'" . DG  B 2 9   ? 34.574 19.303 20.923  1.00  40.59  ? 9    DG  P "C2'" 1 
ATOM   2967 C  "C1'" . DG  B 2 9   ? 33.491 18.923 21.912  1.00  41.02  ? 9    DG  P "C1'" 1 
ATOM   2968 N  N9    . DG  B 2 9   ? 32.826 20.040 22.585  1.00  39.37  ? 9    DG  P N9    1 
ATOM   2969 C  C8    . DG  B 2 9   ? 33.396 20.995 23.398  1.00  39.71  ? 9    DG  P C8    1 
ATOM   2970 N  N7    . DG  B 2 9   ? 32.526 21.859 23.859  1.00  38.96  ? 9    DG  P N7    1 
ATOM   2971 C  C5    . DG  B 2 9   ? 31.313 21.452 23.317  1.00  36.16  ? 9    DG  P C5    1 
ATOM   2972 C  C6    . DG  B 2 9   ? 30.001 21.996 23.461  1.00  35.52  ? 9    DG  P C6    1 
ATOM   2973 O  O6    . DG  B 2 9   ? 29.630 22.965 24.136  1.00  34.41  ? 9    DG  P O6    1 
ATOM   2974 N  N1    . DG  B 2 9   ? 29.067 21.280 22.721  1.00  35.87  ? 9    DG  P N1    1 
ATOM   2975 C  C2    . DG  B 2 9   ? 29.345 20.179 21.948  1.00  35.22  ? 9    DG  P C2    1 
ATOM   2976 N  N2    . DG  B 2 9   ? 28.305 19.640 21.289  1.00  34.38  ? 9    DG  P N2    1 
ATOM   2977 N  N3    . DG  B 2 9   ? 30.552 19.650 21.822  1.00  36.96  ? 9    DG  P N3    1 
ATOM   2978 C  C4    . DG  B 2 9   ? 31.481 20.334 22.525  1.00  37.58  ? 9    DG  P C4    1 
ATOM   2979 P  P     . DA  B 2 10  ? 34.981 17.385 18.413  1.00  42.80  ? 10   DA  P P     1 
ATOM   2980 O  OP1   . DA  B 2 10  ? 35.475 16.150 17.760  1.00  46.31  ? 10   DA  P OP1   1 
ATOM   2981 O  OP2   . DA  B 2 10  ? 35.840 18.548 18.089  1.00  41.91  ? 10   DA  P OP2   1 
ATOM   2982 O  "O5'" . DA  B 2 10  ? 33.448 17.677 18.029  1.00  42.00  ? 10   DA  P "O5'" 1 
ATOM   2983 C  "C5'" . DA  B 2 10  ? 32.450 16.746 18.388  1.00  37.67  ? 10   DA  P "C5'" 1 
ATOM   2984 C  "C4'" . DA  B 2 10  ? 31.118 17.148 17.760  1.00  36.22  ? 10   DA  P "C4'" 1 
ATOM   2985 O  "O4'" . DA  B 2 10  ? 30.569 18.276 18.467  1.00  35.04  ? 10   DA  P "O4'" 1 
ATOM   2986 C  "C3'" . DA  B 2 10  ? 31.224 17.571 16.300  1.00  36.93  ? 10   DA  P "C3'" 1 
ATOM   2987 O  "O3'" . DA  B 2 10  ? 30.081 17.063 15.608  1.00  35.90  ? 10   DA  P "O3'" 1 
ATOM   2988 C  "C2'" . DA  B 2 10  ? 31.215 19.091 16.367  1.00  35.22  ? 10   DA  P "C2'" 1 
ATOM   2989 C  "C1'" . DA  B 2 10  ? 30.343 19.356 17.582  1.00  35.04  ? 10   DA  P "C1'" 1 
ATOM   2990 N  N9    . DA  B 2 10  ? 30.634 20.579 18.328  1.00  35.87  ? 10   DA  P N9    1 
ATOM   2991 C  C8    . DA  B 2 10  ? 31.852 21.072 18.734  1.00  34.18  ? 10   DA  P C8    1 
ATOM   2992 N  N7    . DA  B 2 10  ? 31.767 22.162 19.453  1.00  34.75  ? 10   DA  P N7    1 
ATOM   2993 C  C5    . DA  B 2 10  ? 30.401 22.415 19.511  1.00  37.07  ? 10   DA  P C5    1 
ATOM   2994 C  C6    . DA  B 2 10  ? 29.653 23.428 20.128  1.00  36.19  ? 10   DA  P C6    1 
ATOM   2995 N  N6    . DA  B 2 10  ? 30.198 24.418 20.838  1.00  35.84  ? 10   DA  P N6    1 
ATOM   2996 N  N1    . DA  B 2 10  ? 28.311 23.389 19.990  1.00  35.60  ? 10   DA  P N1    1 
ATOM   2997 C  C2    . DA  B 2 10  ? 27.767 22.396 19.278  1.00  35.54  ? 10   DA  P C2    1 
ATOM   2998 N  N3    . DA  B 2 10  ? 28.361 21.390 18.651  1.00  36.12  ? 10   DA  P N3    1 
ATOM   2999 C  C4    . DA  B 2 10  ? 29.694 21.457 18.810  1.00  35.53  ? 10   DA  P C4    1 
ATOM   3000 P  P     . DT  B 2 11  ? 29.985 17.237 14.025  1.00  39.46  ? 11   DT  P P     1 
ATOM   3001 O  OP1   . DT  B 2 11  ? 29.352 16.048 13.415  1.00  38.78  ? 11   DT  P OP1   1 
ATOM   3002 O  OP2   . DT  B 2 11  ? 31.315 17.513 13.429  1.00  38.17  ? 11   DT  P OP2   1 
ATOM   3003 O  "O5'" . DT  B 2 11  ? 29.040 18.526 13.858  1.00  35.44  ? 11   DT  P "O5'" 1 
ATOM   3004 C  "C5'" . DT  B 2 11  ? 27.762 18.530 14.445  1.00  33.51  ? 11   DT  P "C5'" 1 
ATOM   3005 C  "C4'" . DT  B 2 11  ? 27.075 19.862 14.156  1.00  30.87  ? 11   DT  P "C4'" 1 
ATOM   3006 O  "O4'" . DT  B 2 11  ? 27.473 20.855 15.127  1.00  31.76  ? 11   DT  P "O4'" 1 
ATOM   3007 C  "C3'" . DT  B 2 11  ? 27.423 20.428 12.781  1.00  31.19  ? 11   DT  P "C3'" 1 
ATOM   3008 O  "O3'" . DT  B 2 11  ? 26.197 20.663 12.089  1.00  29.57  ? 11   DT  P "O3'" 1 
ATOM   3009 C  "C2'" . DT  B 2 11  ? 28.183 21.714 13.082  1.00  31.73  ? 11   DT  P "C2'" 1 
ATOM   3010 C  "C1'" . DT  B 2 11  ? 27.689 22.088 14.471  1.00  32.18  ? 11   DT  P "C1'" 1 
ATOM   3011 N  N1    . DT  B 2 11  ? 28.607 22.901 15.315  1.00  31.28  ? 11   DT  P N1    1 
ATOM   3012 C  C2    . DT  B 2 11  ? 28.046 23.870 16.134  1.00  30.44  ? 11   DT  P C2    1 
ATOM   3013 O  O2    . DT  B 2 11  ? 26.847 24.071 16.212  1.00  28.21  ? 11   DT  P O2    1 
ATOM   3014 N  N3    . DT  B 2 11  ? 28.950 24.591 16.876  1.00  29.29  ? 11   DT  P N3    1 
ATOM   3015 C  C4    . DT  B 2 11  ? 30.318 24.443 16.895  1.00  30.65  ? 11   DT  P C4    1 
ATOM   3016 O  O4    . DT  B 2 11  ? 31.000 25.160 17.624  1.00  30.73  ? 11   DT  P O4    1 
ATOM   3017 C  C5    . DT  B 2 11  ? 30.842 23.413 16.023  1.00  31.02  ? 11   DT  P C5    1 
ATOM   3018 C  C7    . DT  B 2 11  ? 32.322 23.196 15.976  1.00  29.28  ? 11   DT  P C7    1 
ATOM   3019 C  C6    . DT  B 2 11  ? 29.973 22.700 15.288  1.00  29.60  ? 11   DT  P C6    1 
ATOM   3020 P  P     . DT  B 2 12  ? 26.201 21.388 10.666  1.00  32.05  ? 12   DT  P P     1 
ATOM   3021 O  OP1   . DT  B 2 12  ? 25.190 20.712 9.822   1.00  30.75  ? 12   DT  P OP1   1 
ATOM   3022 O  OP2   . DT  B 2 12  ? 27.506 21.428 9.976   1.00  31.62  ? 12   DT  P OP2   1 
ATOM   3023 O  "O5'" . DT  B 2 12  ? 25.718 22.870 11.058  1.00  30.83  ? 12   DT  P "O5'" 1 
ATOM   3024 C  "C5'" . DT  B 2 12  ? 24.636 23.021 11.958  1.00  29.62  ? 12   DT  P "C5'" 1 
ATOM   3025 C  "C4'" . DT  B 2 12  ? 24.369 24.505 12.193  1.00  29.52  ? 12   DT  P "C4'" 1 
ATOM   3026 O  "O4'" . DT  B 2 12  ? 25.271 25.030 13.199  1.00  26.60  ? 12   DT  P "O4'" 1 
ATOM   3027 C  "C3'" . DT  B 2 12  ? 24.597 25.328 10.927  1.00  31.07  ? 12   DT  P "C3'" 1 
ATOM   3028 O  "O3'" . DT  B 2 12  ? 23.415 26.065 10.612  1.00  32.17  ? 12   DT  P "O3'" 1 
ATOM   3029 C  "C2'" . DT  B 2 12  ? 25.760 26.249 11.269  1.00  29.05  ? 12   DT  P "C2'" 1 
ATOM   3030 C  "C1'" . DT  B 2 12  ? 25.735 26.305 12.789  1.00  28.08  ? 12   DT  P "C1'" 1 
ATOM   3031 N  N1    . DT  B 2 12  ? 27.067 26.512 13.390  1.00  27.21  ? 12   DT  P N1    1 
ATOM   3032 C  C2    . DT  B 2 12  ? 27.213 27.437 14.406  1.00  25.11  ? 12   DT  P C2    1 
ATOM   3033 O  O2    . DT  B 2 12  ? 26.294 28.097 14.855  1.00  25.25  ? 12   DT  P O2    1 
ATOM   3034 N  N3    . DT  B 2 12  ? 28.487 27.558 14.885  1.00  24.37  ? 12   DT  P N3    1 
ATOM   3035 C  C4    . DT  B 2 12  ? 29.602 26.865 14.475  1.00  27.83  ? 12   DT  P C4    1 
ATOM   3036 O  O4    . DT  B 2 12  ? 30.683 27.071 15.016  1.00  29.19  ? 12   DT  P O4    1 
ATOM   3037 C  C5    . DT  B 2 12  ? 29.382 25.917 13.407  1.00  28.68  ? 12   DT  P C5    1 
ATOM   3038 C  C7    . DT  B 2 12  ? 30.544 25.132 12.887  1.00  26.57  ? 12   DT  P C7    1 
ATOM   3039 C  C6    . DT  B 2 12  ? 28.142 25.787 12.928  1.00  26.84  ? 12   DT  P C6    1 
ATOM   3040 P  P     . DC  B 2 13  ? 23.344 26.866 9.233   1.00  32.42  ? 13   DC  P P     1 
ATOM   3041 O  OP1   . DC  B 2 13  ? 22.010 26.711 8.609   1.00  32.97  ? 13   DC  P OP1   1 
ATOM   3042 O  OP2   . DC  B 2 13  ? 24.394 26.436 8.306   1.00  30.68  ? 13   DC  P OP2   1 
ATOM   3043 O  "O5'" . DC  B 2 13  ? 23.582 28.385 9.700   1.00  33.56  ? 13   DC  P "O5'" 1 
ATOM   3044 C  "C5'" . DC  B 2 13  ? 22.986 28.844 10.898  1.00  36.76  ? 13   DC  P "C5'" 1 
ATOM   3045 C  "C4'" . DC  B 2 13  ? 23.551 30.214 11.268  1.00  40.03  ? 13   DC  P "C4'" 1 
ATOM   3046 O  "O4'" . DC  B 2 13  ? 24.811 30.075 11.979  1.00  37.59  ? 13   DC  P "O4'" 1 
ATOM   3047 C  "C3'" . DC  B 2 13  ? 23.816 31.101 10.056  1.00  41.94  ? 13   DC  P "C3'" 1 
ATOM   3048 O  "O3'" . DC  B 2 13  ? 23.233 32.388 10.292  1.00  46.89  ? 13   DC  P "O3'" 1 
ATOM   3049 C  "C2'" . DC  B 2 13  ? 25.338 31.110 9.955   1.00  40.71  ? 13   DC  P "C2'" 1 
ATOM   3050 C  "C1'" . DC  B 2 13  ? 25.759 30.956 11.410  1.00  38.73  ? 13   DC  P "C1'" 1 
ATOM   3051 N  N1    . DC  B 2 13  ? 27.110 30.397 11.626  1.00  36.21  ? 13   DC  P N1    1 
ATOM   3052 C  C2    . DC  B 2 13  ? 27.862 30.858 12.714  1.00  34.75  ? 13   DC  P C2    1 
ATOM   3053 O  O2    . DC  B 2 13  ? 27.367 31.703 13.468  1.00  36.36  ? 13   DC  P O2    1 
ATOM   3054 N  N3    . DC  B 2 13  ? 29.105 30.378 12.912  1.00  32.01  ? 13   DC  P N3    1 
ATOM   3055 C  C4    . DC  B 2 13  ? 29.611 29.473 12.075  1.00  33.70  ? 13   DC  P C4    1 
ATOM   3056 N  N4    . DC  B 2 13  ? 30.858 29.038 12.307  1.00  30.55  ? 13   DC  P N4    1 
ATOM   3057 C  C5    . DC  B 2 13  ? 28.867 28.976 10.962  1.00  32.73  ? 13   DC  P C5    1 
ATOM   3058 C  C6    . DC  B 2 13  ? 27.632 29.460 10.779  1.00  34.86  ? 13   DC  P C6    1 
HETATM 3059 N  N1    . DOC B 2 14  ? 27.284 35.378 11.729  1.00  48.97  ? 14   DOC P N1    1 
HETATM 3060 C  C2    . DOC B 2 14  ? 28.485 35.668 12.327  1.00  48.00  ? 14   DOC P C2    1 
HETATM 3061 N  N3    . DOC B 2 14  ? 29.552 34.952 12.044  1.00  48.20  ? 14   DOC P N3    1 
HETATM 3062 C  C4    . DOC B 2 14  ? 29.469 33.930 11.172  1.00  48.00  ? 14   DOC P C4    1 
HETATM 3063 C  C5    . DOC B 2 14  ? 28.234 33.619 10.569  1.00  46.73  ? 14   DOC P C5    1 
HETATM 3064 C  C6    . DOC B 2 14  ? 27.157 34.351 10.855  1.00  48.18  ? 14   DOC P C6    1 
HETATM 3065 O  O2    . DOC B 2 14  ? 28.601 36.604 13.141  1.00  46.32  ? 14   DOC P O2    1 
HETATM 3066 N  N4    . DOC B 2 14  ? 30.572 33.169 10.857  1.00  46.00  ? 14   DOC P N4    1 
HETATM 3067 C  "C1'" . DOC B 2 14  ? 26.134 36.162 12.078  1.00  51.39  ? 14   DOC P "C1'" 1 
HETATM 3068 C  "C2'" . DOC B 2 14  ? 25.668 37.616 11.532  1.00  51.67  ? 14   DOC P "C2'" 1 
HETATM 3069 C  "C3'" . DOC B 2 14  ? 24.053 37.571 11.520  1.00  52.57  ? 14   DOC P "C3'" 1 
HETATM 3070 C  "C4'" . DOC B 2 14  ? 24.006 36.083 11.356  1.00  53.59  ? 14   DOC P "C4'" 1 
HETATM 3071 O  "O4'" . DOC B 2 14  ? 25.022 35.368 12.095  1.00  53.91  ? 14   DOC P "O4'" 1 
HETATM 3072 C  "C5'" . DOC B 2 14  ? 23.152 35.458 10.321  1.00  53.52  ? 14   DOC P "C5'" 1 
HETATM 3073 O  "O5'" . DOC B 2 14  ? 23.826 34.308 10.083  1.00  51.57  ? 14   DOC P "O5'" 1 
HETATM 3074 P  P     . DOC B 2 14  ? 22.990 33.376 9.041   1.00  49.96  ? 14   DOC P P     1 
HETATM 3075 O  OP1   . DOC B 2 14  ? 21.662 33.674 8.456   1.00  50.65  ? 14   DOC P OP1   1 
HETATM 3076 O  OP2   . DOC B 2 14  ? 24.074 32.650 8.231   1.00  47.85  ? 14   DOC P OP2   1 
ATOM   3077 O  "O5'" . DA  C 3 3   ? 45.426 31.908 4.873   1.00  100.35 ? 3    DA  T "O5'" 1 
ATOM   3078 C  "C5'" . DA  C 3 3   ? 44.467 31.183 5.665   1.00  94.72  ? 3    DA  T "C5'" 1 
ATOM   3079 C  "C4'" . DA  C 3 3   ? 43.529 32.110 6.440   1.00  90.57  ? 3    DA  T "C4'" 1 
ATOM   3080 O  "O4'" . DA  C 3 3   ? 42.146 31.688 6.263   1.00  91.45  ? 3    DA  T "O4'" 1 
ATOM   3081 C  "C3'" . DA  C 3 3   ? 43.797 32.049 7.939   1.00  85.78  ? 3    DA  T "C3'" 1 
ATOM   3082 O  "O3'" . DA  C 3 3   ? 43.921 33.360 8.491   1.00  75.66  ? 3    DA  T "O3'" 1 
ATOM   3083 C  "C2'" . DA  C 3 3   ? 42.581 31.346 8.513   1.00  88.20  ? 3    DA  T "C2'" 1 
ATOM   3084 C  "C1'" . DA  C 3 3   ? 41.497 31.695 7.530   1.00  91.60  ? 3    DA  T "C1'" 1 
ATOM   3085 N  N9    . DA  C 3 3   ? 40.421 30.700 7.539   1.00  93.57  ? 3    DA  T N9    1 
ATOM   3086 C  C8    . DA  C 3 3   ? 40.034 29.903 8.597   1.00  94.25  ? 3    DA  T C8    1 
ATOM   3087 N  N7    . DA  C 3 3   ? 39.037 29.097 8.318   1.00  95.35  ? 3    DA  T N7    1 
ATOM   3088 C  C5    . DA  C 3 3   ? 38.745 29.381 6.990   1.00  95.67  ? 3    DA  T C5    1 
ATOM   3089 C  C6    . DA  C 3 3   ? 37.791 28.860 6.092   1.00  96.51  ? 3    DA  T C6    1 
ATOM   3090 N  N6    . DA  C 3 3   ? 36.913 27.904 6.406   1.00  96.93  ? 3    DA  T N6    1 
ATOM   3091 N  N1    . DA  C 3 3   ? 37.774 29.362 4.839   1.00  97.01  ? 3    DA  T N1    1 
ATOM   3092 C  C2    . DA  C 3 3   ? 38.655 30.318 4.518   1.00  96.71  ? 3    DA  T C2    1 
ATOM   3093 N  N3    . DA  C 3 3   ? 39.591 30.890 5.266   1.00  95.86  ? 3    DA  T N3    1 
ATOM   3094 C  C4    . DA  C 3 3   ? 39.587 30.370 6.502   1.00  95.11  ? 3    DA  T C4    1 
ATOM   3095 P  P     . DC  C 3 4   ? 44.111 33.498 10.060  1.00  67.33  ? 4    DC  T P     1 
ATOM   3096 O  OP1   . DC  C 3 4   ? 45.548 33.612 10.408  1.00  67.33  ? 4    DC  T OP1   1 
ATOM   3097 O  OP2   . DC  C 3 4   ? 43.468 32.357 10.767  1.00  66.79  ? 4    DC  T OP2   1 
ATOM   3098 O  "O5'" . DC  C 3 4   ? 43.298 34.840 10.385  1.00  62.09  ? 4    DC  T "O5'" 1 
ATOM   3099 C  "C5'" . DC  C 3 4   ? 42.012 34.991 9.847   1.00  50.93  ? 4    DC  T "C5'" 1 
ATOM   3100 C  "C4'" . DC  C 3 4   ? 41.272 36.060 10.643  1.00  44.43  ? 4    DC  T "C4'" 1 
ATOM   3101 O  "O4'" . DC  C 3 4   ? 39.903 36.103 10.227  1.00  39.74  ? 4    DC  T "O4'" 1 
ATOM   3102 C  "C3'" . DC  C 3 4   ? 41.250 35.746 12.127  1.00  41.45  ? 4    DC  T "C3'" 1 
ATOM   3103 O  "O3'" . DC  C 3 4   ? 41.308 37.007 12.796  1.00  42.68  ? 4    DC  T "O3'" 1 
ATOM   3104 C  "C2'" . DC  C 3 4   ? 39.927 35.023 12.316  1.00  39.62  ? 4    DC  T "C2'" 1 
ATOM   3105 C  "C1'" . DC  C 3 4   ? 39.051 35.698 11.279  1.00  37.38  ? 4    DC  T "C1'" 1 
ATOM   3106 N  N1    . DC  C 3 4   ? 38.011 34.883 10.661  1.00  34.87  ? 4    DC  T N1    1 
ATOM   3107 C  C2    . DC  C 3 4   ? 36.731 35.423 10.550  1.00  34.55  ? 4    DC  T C2    1 
ATOM   3108 O  O2    . DC  C 3 4   ? 36.496 36.523 11.094  1.00  30.87  ? 4    DC  T O2    1 
ATOM   3109 N  N3    . DC  C 3 4   ? 35.785 34.744 9.861   1.00  31.31  ? 4    DC  T N3    1 
ATOM   3110 C  C4    . DC  C 3 4   ? 36.084 33.568 9.301   1.00  32.05  ? 4    DC  T C4    1 
ATOM   3111 N  N4    . DC  C 3 4   ? 35.138 32.967 8.568   1.00  28.13  ? 4    DC  T N4    1 
ATOM   3112 C  C5    . DC  C 3 4   ? 37.369 32.965 9.454   1.00  31.02  ? 4    DC  T C5    1 
ATOM   3113 C  C6    . DC  C 3 4   ? 38.290 33.648 10.144  1.00  33.83  ? 4    DC  T C6    1 
HETATM 3114 P  P     . BZG C 3 5   ? 41.721 37.076 14.331  1.00  39.51  ? 5    BZG T P     1 
HETATM 3115 O  O1P   . BZG C 3 5   ? 42.514 35.899 14.756  1.00  38.25  ? 5    BZG T O1P   1 
HETATM 3116 O  O2P   . BZG C 3 5   ? 42.451 38.328 14.605  1.00  39.40  ? 5    BZG T O2P   1 
HETATM 3117 O  "O5'" . BZG C 3 5   ? 40.308 37.145 15.088  1.00  37.60  ? 5    BZG T "O5'" 1 
HETATM 3118 C  CZ1   . BZG C 3 5   ? 35.221 29.229 10.992  1.00  56.18  ? 5    BZG T CZ1   1 
HETATM 3119 C  CT1   . BZG C 3 5   ? 35.457 28.223 10.058  1.00  56.26  ? 5    BZG T CT1   1 
HETATM 3120 C  CI    . BZG C 3 5   ? 34.684 28.149 8.907   1.00  55.81  ? 5    BZG T CI    1 
HETATM 3121 C  CT2   . BZG C 3 5   ? 33.672 29.080 8.687   1.00  54.54  ? 5    BZG T CT2   1 
HETATM 3122 C  CZ2   . BZG C 3 5   ? 33.438 30.081 9.619   1.00  55.01  ? 5    BZG T CZ2   1 
HETATM 3123 C  CE    . BZG C 3 5   ? 34.214 30.157 10.773  1.00  54.16  ? 5    BZG T CE    1 
HETATM 3124 C  CW    . BZG C 3 5   ? 34.003 31.194 11.676  1.00  51.39  ? 5    BZG T CW    1 
HETATM 3125 O  OL    . BZG C 3 5   ? 34.185 32.533 11.201  1.00  47.68  ? 5    BZG T OL    1 
HETATM 3126 C  CK    . BZG C 3 5   ? 34.010 33.491 12.154  1.00  44.96  ? 5    BZG T CK    1 
HETATM 3127 N  NJ    . BZG C 3 5   ? 32.865 34.183 12.187  1.00  43.65  ? 5    BZG T NJ    1 
HETATM 3128 C  CH    . BZG C 3 5   ? 32.754 35.288 12.943  1.00  42.40  ? 5    BZG T CH    1 
HETATM 3129 N  NI    . BZG C 3 5   ? 31.612 35.971 12.942  1.00  41.27  ? 5    BZG T NI    1 
HETATM 3130 N  NG    . BZG C 3 5   ? 33.778 35.726 13.685  1.00  41.97  ? 5    BZG T NG    1 
HETATM 3131 C  CF    . BZG C 3 5   ? 34.941 35.063 13.697  1.00  41.86  ? 5    BZG T CF    1 
HETATM 3132 C  CM    . BZG C 3 5   ? 35.082 33.911 12.931  1.00  43.37  ? 5    BZG T CM    1 
HETATM 3133 N  NN    . BZG C 3 5   ? 36.316 33.460 13.125  1.00  42.72  ? 5    BZG T NN    1 
HETATM 3134 C  CO    . BZG C 3 5   ? 36.933 34.290 13.960  1.00  40.52  ? 5    BZG T CO    1 
HETATM 3135 N  NE    . BZG C 3 5   ? 36.104 35.276 14.303  1.00  40.57  ? 5    BZG T NE    1 
HETATM 3136 C  "CT'" . BZG C 3 5   ? 36.486 36.490 15.056  1.00  39.54  ? 5    BZG T "CT'" 1 
HETATM 3137 O  "OS'" . BZG C 3 5   ? 37.602 37.096 14.389  1.00  37.80  ? 5    BZG T "OS'" 1 
HETATM 3138 C  "CP'" . BZG C 3 5   ? 37.070 36.182 16.434  1.00  39.68  ? 5    BZG T "CP'" 1 
HETATM 3139 C  "C5'" . BZG C 3 5   ? 39.576 38.353 15.063  1.00  39.13  ? 5    BZG T "C5'" 1 
HETATM 3140 C  "C4'" . BZG C 3 5   ? 38.102 38.058 15.332  1.00  38.89  ? 5    BZG T "C4'" 1 
HETATM 3141 C  "C3'" . BZG C 3 5   ? 37.830 37.479 16.716  1.00  39.25  ? 5    BZG T "C3'" 1 
HETATM 3142 O  "O3'" . BZG C 3 5   ? 37.007 38.419 17.407  1.00  41.70  ? 5    BZG T "O3'" 1 
ATOM   3143 P  P     . DG  C 3 6   ? 36.712 38.226 18.959  1.00  41.33  ? 6    DG  T P     1 
ATOM   3144 O  OP1   . DG  C 3 6   ? 36.866 39.529 19.643  1.00  43.02  ? 6    DG  T OP1   1 
ATOM   3145 O  OP2   . DG  C 3 6   ? 37.539 37.177 19.586  1.00  44.59  ? 6    DG  T OP2   1 
ATOM   3146 O  "O5'" . DG  C 3 6   ? 35.170 37.779 18.969  1.00  45.25  ? 6    DG  T "O5'" 1 
ATOM   3147 C  "C5'" . DG  C 3 6   ? 34.218 38.597 18.321  1.00  46.01  ? 6    DG  T "C5'" 1 
ATOM   3148 C  "C4'" . DG  C 3 6   ? 32.842 37.944 18.414  1.00  45.38  ? 6    DG  T "C4'" 1 
ATOM   3149 O  "O4'" . DG  C 3 6   ? 32.665 36.937 17.395  1.00  45.27  ? 6    DG  T "O4'" 1 
ATOM   3150 C  "C3'" . DG  C 3 6   ? 32.644 37.238 19.745  1.00  45.39  ? 6    DG  T "C3'" 1 
ATOM   3151 O  "O3'" . DG  C 3 6   ? 31.302 37.493 20.155  1.00  47.55  ? 6    DG  T "O3'" 1 
ATOM   3152 C  "C2'" . DG  C 3 6   ? 32.783 35.770 19.395  1.00  45.72  ? 6    DG  T "C2'" 1 
ATOM   3153 C  "C1'" . DG  C 3 6   ? 32.186 35.762 18.004  1.00  42.46  ? 6    DG  T "C1'" 1 
ATOM   3154 N  N9    . DG  C 3 6   ? 32.548 34.636 17.153  1.00  41.88  ? 6    DG  T N9    1 
ATOM   3155 C  C8    . DG  C 3 6   ? 33.780 34.044 17.004  1.00  41.64  ? 6    DG  T C8    1 
ATOM   3156 N  N7    . DG  C 3 6   ? 33.764 33.035 16.175  1.00  40.15  ? 6    DG  T N7    1 
ATOM   3157 C  C5    . DG  C 3 6   ? 32.442 32.965 15.751  1.00  37.81  ? 6    DG  T C5    1 
ATOM   3158 C  C6    . DG  C 3 6   ? 31.809 32.069 14.854  1.00  36.91  ? 6    DG  T C6    1 
ATOM   3159 O  O6    . DG  C 3 6   ? 32.305 31.124 14.236  1.00  33.27  ? 6    DG  T O6    1 
ATOM   3160 N  N1    . DG  C 3 6   ? 30.455 32.362 14.709  1.00  36.05  ? 6    DG  T N1    1 
ATOM   3161 C  C2    . DG  C 3 6   ? 29.797 33.385 15.343  1.00  35.82  ? 6    DG  T C2    1 
ATOM   3162 N  N2    . DG  C 3 6   ? 28.495 33.514 15.077  1.00  33.85  ? 6    DG  T N2    1 
ATOM   3163 N  N3    . DG  C 3 6   ? 30.376 34.224 16.180  1.00  37.64  ? 6    DG  T N3    1 
ATOM   3164 C  C4    . DG  C 3 6   ? 31.686 33.954 16.338  1.00  38.47  ? 6    DG  T C4    1 
ATOM   3165 P  P     . DA  C 3 7   ? 30.951 37.530 21.701  1.00  49.59  ? 7    DA  T P     1 
ATOM   3166 O  OP1   . DA  C 3 7   ? 30.832 38.950 22.105  1.00  46.04  ? 7    DA  T OP1   1 
ATOM   3167 O  OP2   . DA  C 3 7   ? 31.950 36.808 22.519  1.00  44.43  ? 7    DA  T OP2   1 
ATOM   3168 O  "O5'" . DA  C 3 7   ? 29.523 36.796 21.702  1.00  44.62  ? 7    DA  T "O5'" 1 
ATOM   3169 C  "C5'" . DA  C 3 7   ? 28.715 36.897 20.545  1.00  42.72  ? 7    DA  T "C5'" 1 
ATOM   3170 C  "C4'" . DA  C 3 7   ? 27.791 35.685 20.448  1.00  39.74  ? 7    DA  T "C4'" 1 
ATOM   3171 O  "O4'" . DA  C 3 7   ? 28.288 34.732 19.497  1.00  37.44  ? 7    DA  T "O4'" 1 
ATOM   3172 C  "C3'" . DA  C 3 7   ? 27.580 34.928 21.756  1.00  38.86  ? 7    DA  T "C3'" 1 
ATOM   3173 O  "O3'" . DA  C 3 7   ? 26.199 34.571 21.813  1.00  43.75  ? 7    DA  T "O3'" 1 
ATOM   3174 C  "C2'" . DA  C 3 7   ? 28.419 33.682 21.569  1.00  37.64  ? 7    DA  T "C2'" 1 
ATOM   3175 C  "C1'" . DA  C 3 7   ? 28.224 33.460 20.084  1.00  35.91  ? 7    DA  T "C1'" 1 
ATOM   3176 N  N9    . DA  C 3 7   ? 29.221 32.629 19.437  1.00  32.68  ? 7    DA  T N9    1 
ATOM   3177 C  C8    . DA  C 3 7   ? 30.570 32.547 19.654  1.00  32.49  ? 7    DA  T C8    1 
ATOM   3178 N  N7    . DA  C 3 7   ? 31.165 31.634 18.924  1.00  31.30  ? 7    DA  T N7    1 
ATOM   3179 C  C5    . DA  C 3 7   ? 30.136 31.092 18.169  1.00  31.22  ? 7    DA  T C5    1 
ATOM   3180 C  C6    . DA  C 3 7   ? 30.103 30.059 17.219  1.00  30.53  ? 7    DA  T C6    1 
ATOM   3181 N  N6    . DA  C 3 7   ? 31.171 29.334 16.874  1.00  26.36  ? 7    DA  T N6    1 
ATOM   3182 N  N1    . DA  C 3 7   ? 28.917 29.782 16.640  1.00  27.98  ? 7    DA  T N1    1 
ATOM   3183 C  C2    . DA  C 3 7   ? 27.837 30.485 17.014  1.00  30.77  ? 7    DA  T C2    1 
ATOM   3184 N  N3    . DA  C 3 7   ? 27.737 31.458 17.910  1.00  31.43  ? 7    DA  T N3    1 
ATOM   3185 C  C4    . DA  C 3 7   ? 28.939 31.714 18.458  1.00  32.98  ? 7    DA  T C4    1 
ATOM   3186 P  P     . DA  C 3 8   ? 25.543 34.137 23.200  1.00  42.90  ? 8    DA  T P     1 
ATOM   3187 O  OP1   . DA  C 3 8   ? 24.975 35.325 23.874  1.00  44.56  ? 8    DA  T OP1   1 
ATOM   3188 O  OP2   . DA  C 3 8   ? 26.494 33.432 24.078  1.00  43.77  ? 8    DA  T OP2   1 
ATOM   3189 O  "O5'" . DA  C 3 8   ? 24.370 33.148 22.723  1.00  43.32  ? 8    DA  T "O5'" 1 
ATOM   3190 C  "C5'" . DA  C 3 8   ? 23.716 33.386 21.487  1.00  41.92  ? 8    DA  T "C5'" 1 
ATOM   3191 C  "C4'" . DA  C 3 8   ? 23.136 32.073 20.964  1.00  40.57  ? 8    DA  T "C4'" 1 
ATOM   3192 O  "O4'" . DA  C 3 8   ? 24.132 31.344 20.208  1.00  39.30  ? 8    DA  T "O4'" 1 
ATOM   3193 C  "C3'" . DA  C 3 8   ? 22.727 31.176 22.121  1.00  40.43  ? 8    DA  T "C3'" 1 
ATOM   3194 O  "O3'" . DA  C 3 8   ? 21.419 30.657 21.886  1.00  45.57  ? 8    DA  T "O3'" 1 
ATOM   3195 C  "C2'" . DA  C 3 8   ? 23.767 30.070 22.136  1.00  38.10  ? 8    DA  T "C2'" 1 
ATOM   3196 C  "C1'" . DA  C 3 8   ? 24.247 30.019 20.696  1.00  36.09  ? 8    DA  T "C1'" 1 
ATOM   3197 N  N9    . DA  C 3 8   ? 25.652 29.623 20.568  1.00  33.25  ? 8    DA  T N9    1 
ATOM   3198 C  C8    . DA  C 3 8   ? 26.721 30.129 21.263  1.00  30.72  ? 8    DA  T C8    1 
ATOM   3199 N  N7    . DA  C 3 8   ? 27.864 29.564 20.959  1.00  32.88  ? 8    DA  T N7    1 
ATOM   3200 C  C5    . DA  C 3 8   ? 27.530 28.627 19.994  1.00  31.28  ? 8    DA  T C5    1 
ATOM   3201 C  C6    . DA  C 3 8   ? 28.298 27.689 19.278  1.00  29.84  ? 8    DA  T C6    1 
ATOM   3202 N  N6    . DA  C 3 8   ? 29.620 27.549 19.413  1.00  28.97  ? 8    DA  T N6    1 
ATOM   3203 N  N1    . DA  C 3 8   ? 27.653 26.892 18.403  1.00  29.29  ? 8    DA  T N1    1 
ATOM   3204 C  C2    . DA  C 3 8   ? 26.332 27.041 18.253  1.00  30.42  ? 8    DA  T C2    1 
ATOM   3205 N  N3    . DA  C 3 8   ? 25.503 27.885 18.861  1.00  30.45  ? 8    DA  T N3    1 
ATOM   3206 C  C4    . DA  C 3 8   ? 26.170 28.657 19.735  1.00  31.97  ? 8    DA  T C4    1 
ATOM   3207 P  P     . DT  C 3 9   ? 20.743 29.742 23.003  1.00  45.89  ? 9    DT  T P     1 
ATOM   3208 O  OP1   . DT  C 3 9   ? 19.334 30.156 23.193  1.00  50.12  ? 9    DT  T OP1   1 
ATOM   3209 O  OP2   . DT  C 3 9   ? 21.477 29.789 24.284  1.00  46.84  ? 9    DT  T OP2   1 
ATOM   3210 O  "O5'" . DT  C 3 9   ? 20.832 28.281 22.344  1.00  45.51  ? 9    DT  T "O5'" 1 
ATOM   3211 C  "C5'" . DT  C 3 9   ? 20.431 28.106 21.005  1.00  43.29  ? 9    DT  T "C5'" 1 
ATOM   3212 C  "C4'" . DT  C 3 9   ? 20.620 26.645 20.610  1.00  43.57  ? 9    DT  T "C4'" 1 
ATOM   3213 O  "O4'" . DT  C 3 9   ? 22.014 26.382 20.357  1.00  42.63  ? 9    DT  T "O4'" 1 
ATOM   3214 C  "C3'" . DT  C 3 9   ? 20.202 25.697 21.723  1.00  45.88  ? 9    DT  T "C3'" 1 
ATOM   3215 O  "O3'" . DT  C 3 9   ? 19.531 24.589 21.122  1.00  50.18  ? 9    DT  T "O3'" 1 
ATOM   3216 C  "C2'" . DT  C 3 9   ? 21.519 25.276 22.351  1.00  42.47  ? 9    DT  T "C2'" 1 
ATOM   3217 C  "C1'" . DT  C 3 9   ? 22.455 25.309 21.160  1.00  40.49  ? 9    DT  T "C1'" 1 
ATOM   3218 N  N1    . DT  C 3 9   ? 23.878 25.543 21.468  1.00  37.80  ? 9    DT  T N1    1 
ATOM   3219 C  C2    . DT  C 3 9   ? 24.790 24.787 20.776  1.00  36.91  ? 9    DT  T C2    1 
ATOM   3220 O  O2    . DT  C 3 9   ? 24.462 23.977 19.927  1.00  38.12  ? 9    DT  T O2    1 
ATOM   3221 N  N3    . DT  C 3 9   ? 26.100 25.020 21.103  1.00  34.24  ? 9    DT  T N3    1 
ATOM   3222 C  C4    . DT  C 3 9   ? 26.581 25.929 22.025  1.00  35.13  ? 9    DT  T C4    1 
ATOM   3223 O  O4    . DT  C 3 9   ? 27.793 26.037 22.200  1.00  33.49  ? 9    DT  T O4    1 
ATOM   3224 C  C5    . DT  C 3 9   ? 25.566 26.699 22.716  1.00  35.16  ? 9    DT  T C5    1 
ATOM   3225 C  C7    . DT  C 3 9   ? 25.990 27.702 23.741  1.00  33.90  ? 9    DT  T C7    1 
ATOM   3226 C  C6    . DT  C 3 9   ? 24.280 26.470 22.405  1.00  35.31  ? 9    DT  T C6    1 
ATOM   3227 P  P     . DC  C 3 10  ? 18.743 23.559 22.045  1.00  51.34  ? 10   DC  T P     1 
ATOM   3228 O  OP1   . DC  C 3 10  ? 17.290 23.706 21.798  1.00  53.35  ? 10   DC  T OP1   1 
ATOM   3229 O  OP2   . DC  C 3 10  ? 19.065 23.755 23.480  1.00  50.68  ? 10   DC  T OP2   1 
ATOM   3230 O  "O5'" . DC  C 3 10  ? 19.281 22.141 21.515  1.00  49.96  ? 10   DC  T "O5'" 1 
ATOM   3231 C  "C5'" . DC  C 3 10  ? 19.755 22.039 20.190  1.00  48.00  ? 10   DC  T "C5'" 1 
ATOM   3232 C  "C4'" . DC  C 3 10  ? 20.930 21.064 20.135  1.00  46.63  ? 10   DC  T "C4'" 1 
ATOM   3233 O  "O4'" . DC  C 3 10  ? 22.171 21.675 20.562  1.00  45.50  ? 10   DC  T "O4'" 1 
ATOM   3234 C  "C3'" . DC  C 3 10  ? 20.719 19.851 21.028  1.00  46.78  ? 10   DC  T "C3'" 1 
ATOM   3235 O  "O3'" . DC  C 3 10  ? 20.950 18.677 20.248  1.00  47.33  ? 10   DC  T "O3'" 1 
ATOM   3236 C  "C2'" . DC  C 3 10  ? 21.767 20.002 22.121  1.00  46.85  ? 10   DC  T "C2'" 1 
ATOM   3237 C  "C1'" . DC  C 3 10  ? 22.860 20.769 21.403  1.00  45.05  ? 10   DC  T "C1'" 1 
ATOM   3238 N  N1    . DC  C 3 10  ? 23.776 21.539 22.272  1.00  40.70  ? 10   DC  T N1    1 
ATOM   3239 C  C2    . DC  C 3 10  ? 25.158 21.368 22.108  1.00  40.48  ? 10   DC  T C2    1 
ATOM   3240 O  O2    . DC  C 3 10  ? 25.567 20.597 21.229  1.00  40.16  ? 10   DC  T O2    1 
ATOM   3241 N  N3    . DC  C 3 10  ? 26.013 22.046 22.907  1.00  39.00  ? 10   DC  T N3    1 
ATOM   3242 C  C4    . DC  C 3 10  ? 25.539 22.871 23.841  1.00  37.94  ? 10   DC  T C4    1 
ATOM   3243 N  N4    . DC  C 3 10  ? 26.424 23.505 24.616  1.00  37.30  ? 10   DC  T N4    1 
ATOM   3244 C  C5    . DC  C 3 10  ? 24.138 23.076 24.024  1.00  38.87  ? 10   DC  T C5    1 
ATOM   3245 C  C6    . DC  C 3 10  ? 23.299 22.395 23.225  1.00  39.67  ? 10   DC  T C6    1 
ATOM   3246 P  P     . DC  C 3 11  ? 20.544 17.253 20.842  1.00  45.22  ? 11   DC  T P     1 
ATOM   3247 O  OP1   . DC  C 3 11  ? 19.607 16.560 19.929  1.00  43.56  ? 11   DC  T OP1   1 
ATOM   3248 O  OP2   . DC  C 3 11  ? 19.959 17.380 22.189  1.00  44.34  ? 11   DC  T OP2   1 
ATOM   3249 O  "O5'" . DC  C 3 11  ? 21.958 16.492 20.894  1.00  45.89  ? 11   DC  T "O5'" 1 
ATOM   3250 C  "C5'" . DC  C 3 11  ? 22.874 16.637 19.824  1.00  47.37  ? 11   DC  T "C5'" 1 
ATOM   3251 C  "C4'" . DC  C 3 11  ? 24.150 15.872 20.162  1.00  49.48  ? 11   DC  T "C4'" 1 
ATOM   3252 O  "O4'" . DC  C 3 11  ? 25.053 16.697 20.939  1.00  49.25  ? 11   DC  T "O4'" 1 
ATOM   3253 C  "C3'" . DC  C 3 11  ? 23.784 14.689 21.043  1.00  50.22  ? 11   DC  T "C3'" 1 
ATOM   3254 O  "O3'" . DC  C 3 11  ? 24.518 13.537 20.630  1.00  53.06  ? 11   DC  T "O3'" 1 
ATOM   3255 C  "C2'" . DC  C 3 11  ? 24.175 15.130 22.443  1.00  49.81  ? 11   DC  T "C2'" 1 
ATOM   3256 C  "C1'" . DC  C 3 11  ? 25.331 16.080 22.185  1.00  48.06  ? 11   DC  T "C1'" 1 
ATOM   3257 N  N1    . DC  C 3 11  ? 25.484 17.146 23.194  1.00  45.15  ? 11   DC  T N1    1 
ATOM   3258 C  C2    . DC  C 3 11  ? 26.771 17.467 23.645  1.00  42.50  ? 11   DC  T C2    1 
ATOM   3259 O  O2    . DC  C 3 11  ? 27.740 16.836 23.195  1.00  42.18  ? 11   DC  T O2    1 
ATOM   3260 N  N3    . DC  C 3 11  ? 26.929 18.448 24.558  1.00  39.26  ? 11   DC  T N3    1 
ATOM   3261 C  C4    . DC  C 3 11  ? 25.863 19.094 25.033  1.00  40.44  ? 11   DC  T C4    1 
ATOM   3262 N  N4    . DC  C 3 11  ? 26.073 20.052 25.941  1.00  34.78  ? 11   DC  T N4    1 
ATOM   3263 C  C5    . DC  C 3 11  ? 24.537 18.785 24.601  1.00  41.04  ? 11   DC  T C5    1 
ATOM   3264 C  C6    . DC  C 3 11  ? 24.396 17.813 23.685  1.00  43.92  ? 11   DC  T C6    1 
ATOM   3265 P  P     . DT  C 3 12  ? 24.336 12.180 21.444  1.00  54.81  ? 12   DT  T P     1 
ATOM   3266 O  OP1   . DT  C 3 12  ? 24.103 11.058 20.506  1.00  55.92  ? 12   DT  T OP1   1 
ATOM   3267 O  OP2   . DT  C 3 12  ? 23.232 12.285 22.428  1.00  53.26  ? 12   DT  T OP2   1 
ATOM   3268 O  "O5'" . DT  C 3 12  ? 25.743 12.028 22.204  1.00  54.60  ? 12   DT  T "O5'" 1 
ATOM   3269 C  "C5'" . DT  C 3 12  ? 26.948 12.259 21.504  1.00  53.45  ? 12   DT  T "C5'" 1 
ATOM   3270 C  "C4'" . DT  C 3 12  ? 28.123 12.011 22.446  1.00  53.67  ? 12   DT  T "C4'" 1 
ATOM   3271 O  "O4'" . DT  C 3 12  ? 28.294 13.150 23.318  1.00  52.15  ? 12   DT  T "O4'" 1 
ATOM   3272 C  "C3'" . DT  C 3 12  ? 27.853 10.814 23.347  1.00  54.45  ? 12   DT  T "C3'" 1 
ATOM   3273 O  "O3'" . DT  C 3 12  ? 29.055 10.052 23.470  1.00  57.64  ? 12   DT  T "O3'" 1 
ATOM   3274 C  "C2'" . DT  C 3 12  ? 27.432 11.430 24.670  1.00  52.69  ? 12   DT  T "C2'" 1 
ATOM   3275 C  "C1'" . DT  C 3 12  ? 28.168 12.761 24.678  1.00  51.14  ? 12   DT  T "C1'" 1 
ATOM   3276 N  N1    . DT  C 3 12  ? 27.476 13.859 25.395  1.00  48.32  ? 12   DT  T N1    1 
ATOM   3277 C  C2    . DT  C 3 12  ? 28.238 14.708 26.167  1.00  46.27  ? 12   DT  T C2    1 
ATOM   3278 O  O2    . DT  C 3 12  ? 29.446 14.590 26.295  1.00  45.93  ? 12   DT  T O2    1 
ATOM   3279 N  N3    . DT  C 3 12  ? 27.530 15.706 26.791  1.00  44.36  ? 12   DT  T N3    1 
ATOM   3280 C  C4    . DT  C 3 12  ? 26.169 15.927 26.731  1.00  45.82  ? 12   DT  T C4    1 
ATOM   3281 O  O4    . DT  C 3 12  ? 25.671 16.862 27.356  1.00  44.54  ? 12   DT  T O4    1 
ATOM   3282 C  C5    . DT  C 3 12  ? 25.430 14.997 25.910  1.00  46.43  ? 12   DT  T C5    1 
ATOM   3283 C  C7    . DT  C 3 12  ? 23.947 15.158 25.791  1.00  45.93  ? 12   DT  T C7    1 
ATOM   3284 C  C6    . DT  C 3 12  ? 26.111 14.023 25.290  1.00  46.80  ? 12   DT  T C6    1 
ATOM   3285 P  P     . DT  C 3 13  ? 29.053 8.725  24.355  1.00  59.50  ? 13   DT  T P     1 
ATOM   3286 O  OP1   . DT  C 3 13  ? 29.829 7.683  23.645  1.00  60.33  ? 13   DT  T OP1   1 
ATOM   3287 O  OP2   . DT  C 3 13  ? 27.675 8.258  24.640  1.00  59.67  ? 13   DT  T OP2   1 
ATOM   3288 O  "O5'" . DT  C 3 13  ? 29.804 9.194  25.696  1.00  57.93  ? 13   DT  T "O5'" 1 
ATOM   3289 C  "C5'" . DT  C 3 13  ? 30.954 10.012 25.585  1.00  55.76  ? 13   DT  T "C5'" 1 
ATOM   3290 C  "C4'" . DT  C 3 13  ? 31.359 10.547 26.957  1.00  54.50  ? 13   DT  T "C4'" 1 
ATOM   3291 O  "O4'" . DT  C 3 13  ? 30.528 11.666 27.350  1.00  52.17  ? 13   DT  T "O4'" 1 
ATOM   3292 C  "C3'" . DT  C 3 13  ? 31.266 9.516  28.079  1.00  54.97  ? 13   DT  T "C3'" 1 
ATOM   3293 O  "O3'" . DT  C 3 13  ? 32.506 9.533  28.791  1.00  57.88  ? 13   DT  T "O3'" 1 
ATOM   3294 C  "C2'" . DT  C 3 13  ? 30.108 10.018 28.932  1.00  52.81  ? 13   DT  T "C2'" 1 
ATOM   3295 C  "C1'" . DT  C 3 13  ? 30.186 11.520 28.712  1.00  50.53  ? 13   DT  T "C1'" 1 
ATOM   3296 N  N1    . DT  C 3 13  ? 28.948 12.297 28.972  1.00  46.90  ? 13   DT  T N1    1 
ATOM   3297 C  C2    . DT  C 3 13  ? 29.053 13.463 29.714  1.00  45.67  ? 13   DT  T C2    1 
ATOM   3298 O  O2    . DT  C 3 13  ? 30.106 13.891 30.155  1.00  45.38  ? 13   DT  T O2    1 
ATOM   3299 N  N3    . DT  C 3 13  ? 27.867 14.113 29.930  1.00  44.14  ? 13   DT  T N3    1 
ATOM   3300 C  C4    . DT  C 3 13  ? 26.616 13.732 29.501  1.00  43.97  ? 13   DT  T C4    1 
ATOM   3301 O  O4    . DT  C 3 13  ? 25.643 14.416 29.789  1.00  43.12  ? 13   DT  T O4    1 
ATOM   3302 C  C5    . DT  C 3 13  ? 26.572 12.510 28.728  1.00  45.34  ? 13   DT  T C5    1 
ATOM   3303 C  C7    . DT  C 3 13  ? 25.249 12.017 28.230  1.00  44.27  ? 13   DT  T C7    1 
ATOM   3304 C  C6    . DT  C 3 13  ? 27.727 11.865 28.498  1.00  46.31  ? 13   DT  T C6    1 
ATOM   3305 P  P     . DC  C 3 14  ? 32.972 8.234  29.610  1.00  59.64  ? 14   DC  T P     1 
ATOM   3306 O  OP1   . DC  C 3 14  ? 34.387 7.913  29.306  1.00  59.67  ? 14   DC  T OP1   1 
ATOM   3307 O  OP2   . DC  C 3 14  ? 32.091 7.065  29.350  1.00  59.27  ? 14   DC  T OP2   1 
ATOM   3308 O  "O5'" . DC  C 3 14  ? 32.799 8.707  31.134  1.00  58.04  ? 14   DC  T "O5'" 1 
ATOM   3309 C  "C5'" . DC  C 3 14  ? 31.927 9.778  31.407  1.00  57.35  ? 14   DC  T "C5'" 1 
ATOM   3310 C  "C4'" . DC  C 3 14  ? 32.522 10.660 32.500  1.00  55.54  ? 14   DC  T "C4'" 1 
ATOM   3311 O  "O4'" . DC  C 3 14  ? 31.737 11.861 32.585  1.00  54.10  ? 14   DC  T "O4'" 1 
ATOM   3312 C  "C3'" . DC  C 3 14  ? 32.438 9.993  33.859  1.00  55.40  ? 14   DC  T "C3'" 1 
ATOM   3313 O  "O3'" . DC  C 3 14  ? 33.598 10.340 34.617  1.00  57.15  ? 14   DC  T "O3'" 1 
ATOM   3314 C  "C2'" . DC  C 3 14  ? 31.158 10.544 34.458  1.00  53.09  ? 14   DC  T "C2'" 1 
ATOM   3315 C  "C1'" . DC  C 3 14  ? 30.967 11.887 33.770  1.00  51.14  ? 14   DC  T "C1'" 1 
ATOM   3316 N  N1    . DC  C 3 14  ? 29.578 12.137 33.367  1.00  48.17  ? 14   DC  T N1    1 
ATOM   3317 C  C2    . DC  C 3 14  ? 28.922 13.269 33.856  1.00  46.33  ? 14   DC  T C2    1 
ATOM   3318 O  O2    . DC  C 3 14  ? 29.539 14.050 34.595  1.00  44.31  ? 14   DC  T O2    1 
ATOM   3319 N  N3    . DC  C 3 14  ? 27.633 13.488 33.506  1.00  45.17  ? 14   DC  T N3    1 
ATOM   3320 C  C4    . DC  C 3 14  ? 27.007 12.633 32.697  1.00  45.76  ? 14   DC  T C4    1 
ATOM   3321 N  N4    . DC  C 3 14  ? 25.738 12.892 32.380  1.00  47.00  ? 14   DC  T N4    1 
ATOM   3322 C  C5    . DC  C 3 14  ? 27.655 11.476 32.175  1.00  46.71  ? 14   DC  T C5    1 
ATOM   3323 C  C6    . DC  C 3 14  ? 28.931 11.269 32.532  1.00  47.89  ? 14   DC  T C6    1 
ATOM   3324 P  P     . DC  C 3 15  ? 33.809 9.679  36.049  1.00  59.57  ? 15   DC  T P     1 
ATOM   3325 O  OP1   . DC  C 3 15  ? 35.221 9.856  36.461  1.00  59.99  ? 15   DC  T OP1   1 
ATOM   3326 O  OP2   . DC  C 3 15  ? 33.431 8.242  36.038  1.00  58.74  ? 15   DC  T OP2   1 
ATOM   3327 O  "O5'" . DC  C 3 15  ? 32.820 10.534 36.986  1.00  57.51  ? 15   DC  T "O5'" 1 
ATOM   3328 C  "C5'" . DC  C 3 15  ? 32.906 11.951 36.986  1.00  54.63  ? 15   DC  T "C5'" 1 
ATOM   3329 C  "C4'" . DC  C 3 15  ? 31.899 12.536 37.976  1.00  52.47  ? 15   DC  T "C4'" 1 
ATOM   3330 O  "O4'" . DC  C 3 15  ? 30.620 12.778 37.346  1.00  50.27  ? 15   DC  T "O4'" 1 
ATOM   3331 C  "C3'" . DC  C 3 15  ? 31.629 11.628 39.171  1.00  53.10  ? 15   DC  T "C3'" 1 
ATOM   3332 O  "O3'" . DC  C 3 15  ? 31.722 12.401 40.368  1.00  55.66  ? 15   DC  T "O3'" 1 
ATOM   3333 C  "C2'" . DC  C 3 15  ? 30.201 11.153 38.961  1.00  50.54  ? 15   DC  T "C2'" 1 
ATOM   3334 C  "C1'" . DC  C 3 15  ? 29.587 12.305 38.188  1.00  47.26  ? 15   DC  T "C1'" 1 
ATOM   3335 N  N1    . DC  C 3 15  ? 28.451 11.930 37.335  1.00  43.78  ? 15   DC  T N1    1 
ATOM   3336 C  C2    . DC  C 3 15  ? 27.280 12.710 37.373  1.00  44.01  ? 15   DC  T C2    1 
ATOM   3337 O  O2    . DC  C 3 15  ? 27.241 13.708 38.115  1.00  43.92  ? 15   DC  T O2    1 
ATOM   3338 N  N3    . DC  C 3 15  ? 26.225 12.355 36.605  1.00  40.58  ? 15   DC  T N3    1 
ATOM   3339 C  C4    . DC  C 3 15  ? 26.301 11.274 35.828  1.00  40.30  ? 15   DC  T C4    1 
ATOM   3340 N  N4    . DC  C 3 15  ? 25.227 10.945 35.110  1.00  39.72  ? 15   DC  T N4    1 
ATOM   3341 C  C5    . DC  C 3 15  ? 27.481 10.475 35.760  1.00  41.02  ? 15   DC  T C5    1 
ATOM   3342 C  C6    . DC  C 3 15  ? 28.521 10.836 36.521  1.00  42.04  ? 15   DC  T C6    1 
ATOM   3343 P  P     . DC  C 3 16  ? 31.851 11.645 41.766  1.00  59.03  ? 16   DC  T P     1 
ATOM   3344 O  OP1   . DC  C 3 16  ? 33.094 12.055 42.457  1.00  58.98  ? 16   DC  T OP1   1 
ATOM   3345 O  OP2   . DC  C 3 16  ? 31.812 10.177 41.562  1.00  57.68  ? 16   DC  T OP2   1 
ATOM   3346 O  "O5'" . DC  C 3 16  ? 30.559 12.148 42.578  1.00  57.00  ? 16   DC  T "O5'" 1 
ATOM   3347 C  "C5'" . DC  C 3 16  ? 30.299 13.533 42.703  1.00  56.25  ? 16   DC  T "C5'" 1 
ATOM   3348 C  "C4'" . DC  C 3 16  ? 28.911 13.728 43.309  1.00  54.98  ? 16   DC  T "C4'" 1 
ATOM   3349 O  "O4'" . DC  C 3 16  ? 27.908 13.533 42.285  1.00  52.41  ? 16   DC  T "O4'" 1 
ATOM   3350 C  "C3'" . DC  C 3 16  ? 28.639 12.682 44.386  1.00  56.25  ? 16   DC  T "C3'" 1 
ATOM   3351 O  "O3'" . DC  C 3 16  ? 28.041 13.308 45.522  1.00  60.31  ? 16   DC  T "O3'" 1 
ATOM   3352 C  "C2'" . DC  C 3 16  ? 27.683 11.704 43.726  1.00  54.84  ? 16   DC  T "C2'" 1 
ATOM   3353 C  "C1'" . DC  C 3 16  ? 26.956 12.577 42.721  1.00  52.07  ? 16   DC  T "C1'" 1 
ATOM   3354 N  N1    . DC  C 3 16  ? 26.449 11.862 41.538  1.00  47.37  ? 16   DC  T N1    1 
ATOM   3355 C  C2    . DC  C 3 16  ? 25.196 12.201 41.040  1.00  46.92  ? 16   DC  T C2    1 
ATOM   3356 O  O2    . DC  C 3 16  ? 24.570 13.120 41.581  1.00  45.66  ? 16   DC  T O2    1 
ATOM   3357 N  N3    . DC  C 3 16  ? 24.694 11.526 39.978  1.00  45.81  ? 16   DC  T N3    1 
ATOM   3358 C  C4    . DC  C 3 16  ? 25.404 10.548 39.416  1.00  44.44  ? 16   DC  T C4    1 
ATOM   3359 N  N4    . DC  C 3 16  ? 24.854 9.888  38.393  1.00  42.24  ? 16   DC  T N4    1 
ATOM   3360 C  C5    . DC  C 3 16  ? 26.701 10.196 39.885  1.00  45.41  ? 16   DC  T C5    1 
ATOM   3361 C  C6    . DC  C 3 16  ? 27.180 10.872 40.941  1.00  48.53  ? 16   DC  T C6    1 
ATOM   3362 P  P     . DC  C 3 17  ? 27.594 12.406 46.765  1.00  61.20  ? 17   DC  T P     1 
ATOM   3363 O  OP1   . DC  C 3 17  ? 27.783 13.173 48.017  1.00  63.31  ? 17   DC  T OP1   1 
ATOM   3364 O  OP2   . DC  C 3 17  ? 28.347 11.128 46.817  1.00  60.80  ? 17   DC  T OP2   1 
ATOM   3365 O  "O5'" . DC  C 3 17  ? 26.036 12.141 46.469  1.00  60.51  ? 17   DC  T "O5'" 1 
ATOM   3366 C  "C5'" . DC  C 3 17  ? 25.246 13.174 45.899  1.00  59.29  ? 17   DC  T "C5'" 1 
ATOM   3367 C  "C4'" . DC  C 3 17  ? 23.810 12.687 45.715  1.00  58.73  ? 17   DC  T "C4'" 1 
ATOM   3368 O  "O4'" . DC  C 3 17  ? 23.628 12.044 44.433  1.00  57.25  ? 17   DC  T "O4'" 1 
ATOM   3369 C  "C3'" . DC  C 3 17  ? 23.388 11.669 46.769  1.00  58.78  ? 17   DC  T "C3'" 1 
ATOM   3370 O  "O3'" . DC  C 3 17  ? 22.079 12.002 47.231  1.00  60.11  ? 17   DC  T "O3'" 1 
ATOM   3371 C  "C2'" . DC  C 3 17  ? 23.352 10.354 46.009  1.00  57.15  ? 17   DC  T "C2'" 1 
ATOM   3372 C  "C1'" . DC  C 3 17  ? 22.934 10.824 44.631  1.00  55.21  ? 17   DC  T "C1'" 1 
ATOM   3373 N  N1    . DC  C 3 17  ? 23.264 9.913  43.522  1.00  50.79  ? 17   DC  T N1    1 
ATOM   3374 C  C2    . DC  C 3 17  ? 22.363 9.804  42.472  1.00  48.76  ? 17   DC  T C2    1 
ATOM   3375 O  O2    . DC  C 3 17  ? 21.349 10.513 42.495  1.00  48.80  ? 17   DC  T O2    1 
ATOM   3376 N  N3    . DC  C 3 17  ? 22.617 8.938  41.462  1.00  46.30  ? 17   DC  T N3    1 
ATOM   3377 C  C4    . DC  C 3 17  ? 23.734 8.207  41.481  1.00  46.54  ? 17   DC  T C4    1 
ATOM   3378 N  N4    . DC  C 3 17  ? 23.944 7.354  40.476  1.00  44.95  ? 17   DC  T N4    1 
ATOM   3379 C  C5    . DC  C 3 17  ? 24.685 8.318  42.535  1.00  47.12  ? 17   DC  T C5    1 
ATOM   3380 C  C6    . DC  C 3 17  ? 24.413 9.177  43.525  1.00  48.58  ? 17   DC  T C6    1 
ATOM   3381 P  P     . DC  C 3 18  ? 21.668 11.638 48.732  1.00  60.63  ? 18   DC  T P     1 
ATOM   3382 O  OP1   . DC  C 3 18  ? 21.879 12.828 49.589  1.00  58.85  ? 18   DC  T OP1   1 
ATOM   3383 O  OP2   . DC  C 3 18  ? 22.450 10.478 49.229  1.00  59.49  ? 18   DC  T OP2   1 
ATOM   3384 O  "O5'" . DC  C 3 18  ? 20.108 11.268 48.627  1.00  55.36  ? 18   DC  T "O5'" 1 
ATOM   3385 C  "C5'" . DC  C 3 18  ? 19.211 12.165 48.006  1.00  48.63  ? 18   DC  T "C5'" 1 
ATOM   3386 C  "C4'" . DC  C 3 18  ? 18.137 11.378 47.257  1.00  46.39  ? 18   DC  T "C4'" 1 
ATOM   3387 O  "O4'" . DC  C 3 18  ? 18.723 10.722 46.103  1.00  42.30  ? 18   DC  T "O4'" 1 
ATOM   3388 C  "C3'" . DC  C 3 18  ? 17.500 10.268 48.097  1.00  45.33  ? 18   DC  T "C3'" 1 
ATOM   3389 O  "O3'" . DC  C 3 18  ? 16.127 10.148 47.725  1.00  48.98  ? 18   DC  T "O3'" 1 
ATOM   3390 C  "C2'" . DC  C 3 18  ? 18.184 9.016  47.581  1.00  42.14  ? 18   DC  T "C2'" 1 
ATOM   3391 C  "C1'" . DC  C 3 18  ? 18.321 9.368  46.114  1.00  40.53  ? 18   DC  T "C1'" 1 
ATOM   3392 N  N1    . DC  C 3 18  ? 19.292 8.578  45.343  1.00  35.98  ? 18   DC  T N1    1 
ATOM   3393 C  C2    . DC  C 3 18  ? 18.877 8.034  44.134  1.00  36.61  ? 18   DC  T C2    1 
ATOM   3394 O  O2    . DC  C 3 18  ? 17.733 8.277  43.734  1.00  37.13  ? 18   DC  T O2    1 
ATOM   3395 N  N3    . DC  C 3 18  ? 19.726 7.257  43.426  1.00  36.42  ? 18   DC  T N3    1 
ATOM   3396 C  C4    . DC  C 3 18  ? 20.957 7.034  43.882  1.00  35.76  ? 18   DC  T C4    1 
ATOM   3397 N  N4    . DC  C 3 18  ? 21.753 6.244  43.157  1.00  37.71  ? 18   DC  T N4    1 
ATOM   3398 C  C5    . DC  C 3 18  ? 21.422 7.604  45.102  1.00  35.72  ? 18   DC  T C5    1 
ATOM   3399 C  C6    . DC  C 3 18  ? 20.562 8.362  45.797  1.00  35.87  ? 18   DC  T C6    1 
HETATM 3400 P  PG    . DGT D 4 .   ? 23.698 39.408 2.753   1.00  26.20  ? 1343 DGT A PG    1 
HETATM 3401 O  O1G   . DGT D 4 .   ? 23.735 38.070 1.859   1.00  29.24  ? 1343 DGT A O1G   1 
HETATM 3402 O  O2G   . DGT D 4 .   ? 22.763 39.043 4.009   1.00  25.20  ? 1343 DGT A O2G   1 
HETATM 3403 O  O3G   . DGT D 4 .   ? 23.181 40.562 1.984   1.00  28.54  ? 1343 DGT A O3G   1 
HETATM 3404 O  O3B   . DGT D 4 .   ? 25.214 39.609 3.264   1.00  27.56  ? 1343 DGT A O3B   1 
HETATM 3405 P  PB    . DGT D 4 .   ? 25.685 40.070 4.735   1.00  25.71  ? 1343 DGT A PB    1 
HETATM 3406 O  O1B   . DGT D 4 .   ? 24.693 40.570 5.713   1.00  29.28  ? 1343 DGT A O1B   1 
HETATM 3407 O  O2B   . DGT D 4 .   ? 27.103 40.491 4.713   1.00  25.87  ? 1343 DGT A O2B   1 
HETATM 3408 O  O3A   . DGT D 4 .   ? 25.872 38.558 5.268   1.00  25.67  ? 1343 DGT A O3A   1 
HETATM 3409 P  PA    . DGT D 4 .   ? 25.157 37.911 6.562   1.00  27.66  ? 1343 DGT A PA    1 
HETATM 3410 O  O1A   . DGT D 4 .   ? 25.426 36.328 6.459   1.00  28.68  ? 1343 DGT A O1A   1 
HETATM 3411 O  O2A   . DGT D 4 .   ? 23.708 38.196 6.652   1.00  25.31  ? 1343 DGT A O2A   1 
HETATM 3412 O  "O5'" . DGT D 4 .   ? 25.989 38.382 7.857   1.00  24.21  ? 1343 DGT A "O5'" 1 
HETATM 3413 C  "C5'" . DGT D 4 .   ? 25.817 39.686 8.416   1.00  23.23  ? 1343 DGT A "C5'" 1 
HETATM 3414 C  "C4'" . DGT D 4 .   ? 27.168 40.170 8.942   1.00  25.61  ? 1343 DGT A "C4'" 1 
HETATM 3415 O  "O4'" . DGT D 4 .   ? 27.764 39.195 9.811   1.00  25.06  ? 1343 DGT A "O4'" 1 
HETATM 3416 C  "C3'" . DGT D 4 .   ? 28.172 40.270 7.795   1.00  28.15  ? 1343 DGT A "C3'" 1 
HETATM 3417 O  "O3'" . DGT D 4 .   ? 27.946 41.483 7.074   1.00  23.62  ? 1343 DGT A "O3'" 1 
HETATM 3418 C  "C2'" . DGT D 4 .   ? 29.430 40.414 8.647   1.00  27.82  ? 1343 DGT A "C2'" 1 
HETATM 3419 C  "C1'" . DGT D 4 .   ? 29.194 39.315 9.686   1.00  25.76  ? 1343 DGT A "C1'" 1 
HETATM 3420 N  N9    . DGT D 4 .   ? 29.740 38.020 9.218   1.00  26.45  ? 1343 DGT A N9    1 
HETATM 3421 C  C8    . DGT D 4 .   ? 29.104 37.106 8.491   1.00  27.95  ? 1343 DGT A C8    1 
HETATM 3422 N  N7    . DGT D 4 .   ? 29.920 36.082 8.248   1.00  27.02  ? 1343 DGT A N7    1 
HETATM 3423 C  C5    . DGT D 4 .   ? 31.087 36.342 8.828   1.00  27.70  ? 1343 DGT A C5    1 
HETATM 3424 C  C6    . DGT D 4 .   ? 32.293 35.649 8.906   1.00  28.89  ? 1343 DGT A C6    1 
HETATM 3425 O  O6    . DGT D 4 .   ? 32.435 34.564 8.348   1.00  29.39  ? 1343 DGT A O6    1 
HETATM 3426 N  N1    . DGT D 4 .   ? 33.354 36.221 9.619   1.00  28.65  ? 1343 DGT A N1    1 
HETATM 3427 C  C2    . DGT D 4 .   ? 33.181 37.467 10.232  1.00  28.26  ? 1343 DGT A C2    1 
HETATM 3428 N  N2    . DGT D 4 .   ? 34.186 38.005 10.921  1.00  26.36  ? 1343 DGT A N2    1 
HETATM 3429 N  N3    . DGT D 4 .   ? 32.006 38.105 10.132  1.00  26.45  ? 1343 DGT A N3    1 
HETATM 3430 C  C4    . DGT D 4 .   ? 30.975 37.578 9.454   1.00  27.40  ? 1343 DGT A C4    1 
HETATM 3431 CA CA    . CA  E 5 .   ? 21.933 37.893 8.654   1.00  44.26  ? 1344 CA  A CA    1 
HETATM 3432 CA CA    . CA  F 5 .   ? 22.368 40.220 6.036   1.00  26.40  ? 1345 CA  A CA    1 
HETATM 3433 CA CA    . CA  G 5 .   ? 22.765 24.993 4.517   1.00  41.90  ? 1346 CA  A CA    1 
HETATM 3434 O  O     . HOH H 6 .   ? -1.000 31.064 9.654   1.00  66.41  ? 2001 HOH A O     1 
HETATM 3435 O  O     . HOH H 6 .   ? 40.750 51.866 7.471   1.00  43.61  ? 2002 HOH A O     1 
HETATM 3436 O  O     . HOH H 6 .   ? 40.768 52.993 5.448   1.00  45.81  ? 2003 HOH A O     1 
HETATM 3437 O  O     . HOH H 6 .   ? 18.995 56.580 -2.498  1.00  53.81  ? 2004 HOH A O     1 
HETATM 3438 O  O     . HOH H 6 .   ? 38.658 52.102 8.378   1.00  44.23  ? 2005 HOH A O     1 
HETATM 3439 O  O     . HOH H 6 .   ? 38.501 54.796 5.040   1.00  47.29  ? 2006 HOH A O     1 
HETATM 3440 O  O     . HOH H 6 .   ? 39.861 42.608 13.201  1.00  32.82  ? 2007 HOH A O     1 
HETATM 3441 O  O     . HOH H 6 .   ? 43.404 45.207 12.185  1.00  46.84  ? 2008 HOH A O     1 
HETATM 3442 O  O     . HOH H 6 .   ? 54.303 41.741 8.641   1.00  66.94  ? 2009 HOH A O     1 
HETATM 3443 O  O     . HOH H 6 .   ? 25.327 37.518 -5.064  1.00  50.00  ? 2010 HOH A O     1 
HETATM 3444 O  O     . HOH H 6 .   ? 11.737 51.109 -0.306  1.00  63.50  ? 2011 HOH A O     1 
HETATM 3445 O  O     . HOH H 6 .   ? 18.108 53.873 -2.596  1.00  78.37  ? 2012 HOH A O     1 
HETATM 3446 O  O     . HOH H 6 .   ? 25.638 28.496 37.554  1.00  56.60  ? 2013 HOH A O     1 
HETATM 3447 O  O     . HOH H 6 .   ? 28.616 25.903 41.329  1.00  65.32  ? 2014 HOH A O     1 
HETATM 3448 O  O     . HOH H 6 .   ? 33.400 29.966 5.054   1.00  47.82  ? 2015 HOH A O     1 
HETATM 3449 O  O     . HOH H 6 .   ? 37.680 46.425 -8.932  1.00  45.72  ? 2016 HOH A O     1 
HETATM 3450 O  O     . HOH H 6 .   ? 44.389 47.794 -1.301  1.00  46.82  ? 2017 HOH A O     1 
HETATM 3451 O  O     . HOH H 6 .   ? 21.312 45.844 -1.817  1.00  50.18  ? 2018 HOH A O     1 
HETATM 3452 O  O     . HOH H 6 .   ? 23.833 47.349 -3.740  1.00  52.12  ? 2019 HOH A O     1 
HETATM 3453 O  O     . HOH H 6 .   ? 15.186 57.331 1.197   1.00  63.11  ? 2020 HOH A O     1 
HETATM 3454 O  O     . HOH H 6 .   ? 33.866 53.946 5.396   1.00  29.61  ? 2021 HOH A O     1 
HETATM 3455 O  O     . HOH H 6 .   ? 36.746 50.221 8.094   1.00  31.12  ? 2022 HOH A O     1 
HETATM 3456 O  O     . HOH H 6 .   ? 37.595 31.238 16.789  1.00  51.49  ? 2023 HOH A O     1 
HETATM 3457 O  O     . HOH H 6 .   ? 27.760 49.679 -3.504  1.00  38.67  ? 2024 HOH A O     1 
HETATM 3458 O  O     . HOH H 6 .   ? 25.474 58.198 3.906   1.00  36.71  ? 2025 HOH A O     1 
HETATM 3459 O  O     . HOH H 6 .   ? 22.762 32.050 33.172  1.00  71.61  ? 2026 HOH A O     1 
HETATM 3460 O  O     . HOH H 6 .   ? 31.711 59.307 7.827   1.00  39.50  ? 2027 HOH A O     1 
HETATM 3461 O  O     . HOH H 6 .   ? 36.353 54.205 3.769   1.00  29.68  ? 2028 HOH A O     1 
HETATM 3462 O  O     . HOH H 6 .   ? 35.182 59.657 0.223   1.00  31.19  ? 2029 HOH A O     1 
HETATM 3463 O  O     . HOH H 6 .   ? 31.561 55.630 -5.988  1.00  43.54  ? 2030 HOH A O     1 
HETATM 3464 O  O     . HOH H 6 .   ? 37.132 57.858 -0.314  1.00  50.94  ? 2031 HOH A O     1 
HETATM 3465 O  O     . HOH H 6 .   ? 24.719 52.430 0.322   1.00  39.13  ? 2032 HOH A O     1 
HETATM 3466 O  O     . HOH H 6 .   ? 40.946 43.520 11.310  1.00  23.83  ? 2033 HOH A O     1 
HETATM 3467 O  O     . HOH H 6 .   ? 51.028 42.053 9.315   1.00  55.29  ? 2034 HOH A O     1 
HETATM 3468 O  O     . HOH H 6 .   ? 47.082 40.883 8.757   1.00  31.73  ? 2035 HOH A O     1 
HETATM 3469 O  O     . HOH H 6 .   ? 54.379 44.307 5.317   1.00  70.86  ? 2036 HOH A O     1 
HETATM 3470 O  O     . HOH H 6 .   ? 48.259 43.405 6.893   1.00  67.53  ? 2037 HOH A O     1 
HETATM 3471 O  O     . HOH H 6 .   ? 44.643 36.226 3.489   1.00  29.40  ? 2038 HOH A O     1 
HETATM 3472 O  O     . HOH H 6 .   ? 26.161 45.888 -2.691  1.00  32.85  ? 2039 HOH A O     1 
HETATM 3473 O  O     . HOH H 6 .   ? 30.410 35.357 -4.327  1.00  36.70  ? 2040 HOH A O     1 
HETATM 3474 O  O     . HOH H 6 .   ? 35.635 31.860 -4.532  1.00  47.02  ? 2041 HOH A O     1 
HETATM 3475 O  O     . HOH H 6 .   ? 33.284 29.256 -2.061  1.00  49.82  ? 2042 HOH A O     1 
HETATM 3476 O  O     . HOH H 6 .   ? 32.137 30.434 -4.749  1.00  65.53  ? 2043 HOH A O     1 
HETATM 3477 O  O     . HOH H 6 .   ? 34.277 31.129 2.341   1.00  60.94  ? 2044 HOH A O     1 
HETATM 3478 O  O     . HOH H 6 .   ? 29.729 37.852 1.666   1.00  43.19  ? 2045 HOH A O     1 
HETATM 3479 O  O     . HOH H 6 .   ? 44.594 46.587 2.573   1.00  45.20  ? 2046 HOH A O     1 
HETATM 3480 O  O     . HOH H 6 .   ? 43.187 35.547 -10.185 1.00  50.91  ? 2047 HOH A O     1 
HETATM 3481 O  O     . HOH H 6 .   ? 40.229 44.548 -9.160  1.00  33.06  ? 2048 HOH A O     1 
HETATM 3482 O  O     . HOH H 6 .   ? 46.489 45.659 -10.346 1.00  48.26  ? 2049 HOH A O     1 
HETATM 3483 O  O     . HOH H 6 .   ? 43.286 47.805 -3.670  1.00  41.23  ? 2050 HOH A O     1 
HETATM 3484 O  O     . HOH H 6 .   ? 41.595 51.177 -3.296  1.00  53.22  ? 2051 HOH A O     1 
HETATM 3485 O  O     . HOH H 6 .   ? 41.864 49.357 -0.201  1.00  32.66  ? 2052 HOH A O     1 
HETATM 3486 O  O     . HOH H 6 .   ? 39.209 48.060 12.586  1.00  41.53  ? 2053 HOH A O     1 
HETATM 3487 O  O     . HOH H 6 .   ? 36.252 44.834 14.824  1.00  32.00  ? 2054 HOH A O     1 
HETATM 3488 O  O     . HOH H 6 .   ? 37.134 53.931 13.419  1.00  40.91  ? 2055 HOH A O     1 
HETATM 3489 O  O     . HOH H 6 .   ? 34.803 55.774 7.159   1.00  46.79  ? 2056 HOH A O     1 
HETATM 3490 O  O     . HOH H 6 .   ? 30.324 37.311 15.163  1.00  60.65  ? 2057 HOH A O     1 
HETATM 3491 O  O     . HOH H 6 .   ? 29.582 49.380 20.056  1.00  60.25  ? 2058 HOH A O     1 
HETATM 3492 O  O     . HOH H 6 .   ? 24.923 42.086 18.453  1.00  43.72  ? 2059 HOH A O     1 
HETATM 3493 O  O     . HOH H 6 .   ? 21.981 44.920 17.175  1.00  33.23  ? 2060 HOH A O     1 
HETATM 3494 O  O     . HOH H 6 .   ? 20.659 46.007 19.548  1.00  37.73  ? 2061 HOH A O     1 
HETATM 3495 O  O     . HOH H 6 .   ? 24.434 51.139 21.591  1.00  69.92  ? 2062 HOH A O     1 
HETATM 3496 O  O     . HOH H 6 .   ? 17.076 54.762 16.311  1.00  46.41  ? 2063 HOH A O     1 
HETATM 3497 O  O     . HOH H 6 .   ? 18.579 54.946 18.443  1.00  48.97  ? 2064 HOH A O     1 
HETATM 3498 O  O     . HOH H 6 .   ? 18.867 48.205 20.529  1.00  39.85  ? 2065 HOH A O     1 
HETATM 3499 O  O     . HOH H 6 .   ? 3.262  44.859 19.915  1.00  61.77  ? 2066 HOH A O     1 
HETATM 3500 O  O     . HOH H 6 .   ? 15.721 40.288 21.448  1.00  34.77  ? 2067 HOH A O     1 
HETATM 3501 O  O     . HOH H 6 .   ? 22.461 42.016 17.896  1.00  42.66  ? 2068 HOH A O     1 
HETATM 3502 O  O     . HOH H 6 .   ? 25.789 38.619 15.597  1.00  47.49  ? 2069 HOH A O     1 
HETATM 3503 O  O     . HOH H 6 .   ? 17.793 33.488 12.887  1.00  39.63  ? 2070 HOH A O     1 
HETATM 3504 O  O     . HOH H 6 .   ? 5.277  34.997 19.428  1.00  40.01  ? 2071 HOH A O     1 
HETATM 3505 O  O     . HOH H 6 .   ? -7.649 46.765 -0.620  1.00  46.78  ? 2072 HOH A O     1 
HETATM 3506 O  O     . HOH H 6 .   ? -0.329 47.771 7.030   1.00  59.78  ? 2073 HOH A O     1 
HETATM 3507 O  O     . HOH H 6 .   ? 18.292 57.435 1.770   1.00  54.42  ? 2074 HOH A O     1 
HETATM 3508 O  O     . HOH H 6 .   ? 13.652 57.843 14.754  1.00  49.57  ? 2075 HOH A O     1 
HETATM 3509 O  O     . HOH H 6 .   ? 15.651 49.472 4.199   1.00  39.18  ? 2076 HOH A O     1 
HETATM 3510 O  O     . HOH H 6 .   ? 22.125 49.142 -1.164  1.00  54.80  ? 2077 HOH A O     1 
HETATM 3511 O  O     . HOH H 6 .   ? 6.394  24.501 9.667   1.00  34.86  ? 2078 HOH A O     1 
HETATM 3512 O  O     . HOH H 6 .   ? 25.255 36.619 -2.037  1.00  43.27  ? 2079 HOH A O     1 
HETATM 3513 O  O     . HOH H 6 .   ? 14.755 49.067 -0.312  1.00  51.59  ? 2080 HOH A O     1 
HETATM 3514 O  O     . HOH H 6 .   ? 16.183 51.288 -2.159  1.00  46.70  ? 2081 HOH A O     1 
HETATM 3515 O  O     . HOH H 6 .   ? 5.636  38.148 -1.889  1.00  45.10  ? 2082 HOH A O     1 
HETATM 3516 O  O     . HOH H 6 .   ? 2.513  31.338 5.515   1.00  42.25  ? 2083 HOH A O     1 
HETATM 3517 O  O     . HOH H 6 .   ? -2.169 31.787 3.127   1.00  40.51  ? 2084 HOH A O     1 
HETATM 3518 O  O     . HOH H 6 .   ? -2.771 28.735 -0.140  1.00  50.56  ? 2085 HOH A O     1 
HETATM 3519 O  O     . HOH H 6 .   ? 4.300  14.413 -1.243  1.00  45.55  ? 2086 HOH A O     1 
HETATM 3520 O  O     . HOH H 6 .   ? 12.317 20.946 1.965   1.00  36.21  ? 2087 HOH A O     1 
HETATM 3521 O  O     . HOH H 6 .   ? 20.538 20.241 -4.914  1.00  57.33  ? 2088 HOH A O     1 
HETATM 3522 O  O     . HOH H 6 .   ? 22.408 27.138 3.241   1.00  47.49  ? 2089 HOH A O     1 
HETATM 3523 O  O     . HOH H 6 .   ? 16.882 29.350 2.507   1.00  47.36  ? 2090 HOH A O     1 
HETATM 3524 O  O     . HOH H 6 .   ? 28.027 24.600 7.333   1.00  48.24  ? 2091 HOH A O     1 
HETATM 3525 O  O     . HOH H 6 .   ? 24.356 16.849 12.514  1.00  47.45  ? 2092 HOH A O     1 
HETATM 3526 O  O     . HOH H 6 .   ? 20.906 16.617 2.500   1.00  46.18  ? 2093 HOH A O     1 
HETATM 3527 O  O     . HOH H 6 .   ? 24.279 4.962  3.099   1.00  51.21  ? 2094 HOH A O     1 
HETATM 3528 O  O     . HOH H 6 .   ? 14.705 9.268  -0.751  1.00  35.22  ? 2095 HOH A O     1 
HETATM 3529 O  O     . HOH H 6 .   ? 16.387 20.462 -4.765  1.00  56.63  ? 2096 HOH A O     1 
HETATM 3530 O  O     . HOH H 6 .   ? 9.540  11.193 0.879   1.00  45.75  ? 2097 HOH A O     1 
HETATM 3531 O  O     . HOH H 6 .   ? 11.102 13.636 -2.127  1.00  50.99  ? 2098 HOH A O     1 
HETATM 3532 O  O     . HOH H 6 .   ? 8.786  10.801 11.758  1.00  51.89  ? 2099 HOH A O     1 
HETATM 3533 O  O     . HOH H 6 .   ? 14.117 3.979  8.095   1.00  42.92  ? 2100 HOH A O     1 
HETATM 3534 O  O     . HOH H 6 .   ? 23.970 10.976 16.730  1.00  46.76  ? 2101 HOH A O     1 
HETATM 3535 O  O     . HOH H 6 .   ? 25.356 8.506  14.195  1.00  57.52  ? 2102 HOH A O     1 
HETATM 3536 O  O     . HOH H 6 .   ? 20.037 12.971 20.840  1.00  52.50  ? 2103 HOH A O     1 
HETATM 3537 O  O     . HOH H 6 .   ? 13.486 20.438 19.059  1.00  47.89  ? 2104 HOH A O     1 
HETATM 3538 O  O     . HOH H 6 .   ? 12.983 16.622 23.327  1.00  51.16  ? 2105 HOH A O     1 
HETATM 3539 O  O     . HOH H 6 .   ? 8.381  17.241 16.506  1.00  40.40  ? 2106 HOH A O     1 
HETATM 3540 O  O     . HOH H 6 .   ? 16.351 27.585 13.890  1.00  43.08  ? 2107 HOH A O     1 
HETATM 3541 O  O     . HOH H 6 .   ? 6.169  17.372 14.963  1.00  30.78  ? 2108 HOH A O     1 
HETATM 3542 O  O     . HOH H 6 .   ? 3.578  27.149 12.074  1.00  44.16  ? 2109 HOH A O     1 
HETATM 3543 O  O     . HOH H 6 .   ? 14.321 29.828 13.853  1.00  38.59  ? 2110 HOH A O     1 
HETATM 3544 O  O     . HOH H 6 .   ? 13.797 26.909 16.182  1.00  49.33  ? 2111 HOH A O     1 
HETATM 3545 O  O     . HOH H 6 .   ? 7.614  24.483 17.510  1.00  44.64  ? 2112 HOH A O     1 
HETATM 3546 O  O     . HOH H 6 .   ? 7.679  30.569 14.610  1.00  40.75  ? 2113 HOH A O     1 
HETATM 3547 O  O     . HOH H 6 .   ? 21.381 35.963 20.703  1.00  59.15  ? 2114 HOH A O     1 
HETATM 3548 O  O     . HOH H 6 .   ? 22.699 35.617 30.872  1.00  48.77  ? 2115 HOH A O     1 
HETATM 3549 O  O     . HOH H 6 .   ? 23.915 39.633 29.016  1.00  52.81  ? 2116 HOH A O     1 
HETATM 3550 O  O     . HOH H 6 .   ? 24.394 40.571 21.088  1.00  52.21  ? 2117 HOH A O     1 
HETATM 3551 O  O     . HOH H 6 .   ? 24.784 37.214 18.773  1.00  50.97  ? 2118 HOH A O     1 
HETATM 3552 O  O     . HOH H 6 .   ? 49.664 26.912 12.096  1.00  43.45  ? 2119 HOH A O     1 
HETATM 3553 O  O     . HOH H 6 .   ? 56.811 26.508 20.912  1.00  43.71  ? 2120 HOH A O     1 
HETATM 3554 O  O     . HOH H 6 .   ? 56.556 27.933 29.038  1.00  47.42  ? 2121 HOH A O     1 
HETATM 3555 O  O     . HOH H 6 .   ? 54.931 37.208 23.869  1.00  42.88  ? 2122 HOH A O     1 
HETATM 3556 O  O     . HOH H 6 .   ? 52.556 31.530 35.445  1.00  52.38  ? 2123 HOH A O     1 
HETATM 3557 O  O     . HOH H 6 .   ? 31.629 42.698 19.349  1.00  59.40  ? 2124 HOH A O     1 
HETATM 3558 O  O     . HOH H 6 .   ? 32.557 30.546 29.925  1.00  30.64  ? 2125 HOH A O     1 
HETATM 3559 O  O     . HOH H 6 .   ? 39.565 17.234 17.131  1.00  50.48  ? 2126 HOH A O     1 
HETATM 3560 O  O     . HOH H 6 .   ? 36.835 22.783 35.897  1.00  51.70  ? 2127 HOH A O     1 
HETATM 3561 O  O     . HOH H 6 .   ? 28.082 28.638 39.937  1.00  45.94  ? 2128 HOH A O     1 
HETATM 3562 O  O     . HOH H 6 .   ? 36.525 36.085 41.985  1.00  34.86  ? 2129 HOH A O     1 
HETATM 3563 O  O     . HOH H 6 .   ? 42.379 29.998 40.000  1.00  48.93  ? 2130 HOH A O     1 
HETATM 3564 O  O     . HOH H 6 .   ? 41.527 24.700 37.264  1.00  52.83  ? 2131 HOH A O     1 
HETATM 3565 O  O     . HOH H 6 .   ? 45.947 23.220 35.756  1.00  48.97  ? 2132 HOH A O     1 
HETATM 3566 O  O     . HOH H 6 .   ? 46.329 30.624 42.593  1.00  38.59  ? 2133 HOH A O     1 
HETATM 3567 O  O     . HOH H 6 .   ? 47.891 14.454 24.546  1.00  49.23  ? 2134 HOH A O     1 
HETATM 3568 O  O     . HOH H 6 .   ? 38.038 31.123 12.303  1.00  41.32  ? 2135 HOH A O     1 
HETATM 3569 O  O     . HOH H 6 .   ? 39.517 32.643 16.445  1.00  35.36  ? 2136 HOH A O     1 
HETATM 3570 O  O     . HOH H 6 .   ? 35.346 33.380 22.255  1.00  49.42  ? 2137 HOH A O     1 
HETATM 3571 O  O     . HOH H 6 .   ? 25.753 32.127 30.263  1.00  37.12  ? 2138 HOH A O     1 
HETATM 3572 O  O     . HOH H 6 .   ? 24.582 33.850 31.432  1.00  43.48  ? 2139 HOH A O     1 
HETATM 3573 O  O     . HOH H 6 .   ? 20.723 38.775 37.803  1.00  51.19  ? 2140 HOH A O     1 
HETATM 3574 O  O     . HOH H 6 .   ? 34.416 38.874 13.985  1.00  44.12  ? 2141 HOH A O     1 
HETATM 3575 O  O     . HOH H 6 .   ? 31.689 39.321 12.576  1.00  27.94  ? 2142 HOH A O     1 
HETATM 3576 O  O     . HOH H 6 .   ? 24.169 34.014 5.122   1.00  56.43  ? 2143 HOH A O     1 
HETATM 3577 O  O     . HOH H 6 .   ? 31.533 32.779 6.504   1.00  44.81  ? 2144 HOH A O     1 
HETATM 3578 O  O     . HOH H 6 .   ? 26.294 34.136 6.914   1.00  30.01  ? 2145 HOH A O     1 
HETATM 3579 O  O     . HOH I 6 .   ? 19.416 11.088 32.090  1.00  53.08  ? 2001 HOH P O     1 
HETATM 3580 O  O     . HOH I 6 .   ? 13.013 4.849  39.295  1.00  74.98  ? 2002 HOH P O     1 
HETATM 3581 O  O     . HOH I 6 .   ? 20.550 5.498  34.982  1.00  49.57  ? 2003 HOH P O     1 
HETATM 3582 O  O     . HOH I 6 .   ? 24.212 7.079  36.580  1.00  38.38  ? 2004 HOH P O     1 
HETATM 3583 O  O     . HOH I 6 .   ? 17.664 7.218  32.857  1.00  45.07  ? 2005 HOH P O     1 
HETATM 3584 O  O     . HOH I 6 .   ? 21.845 12.623 32.684  1.00  56.81  ? 2006 HOH P O     1 
HETATM 3585 O  O     . HOH I 6 .   ? 17.350 22.786 37.375  1.00  56.98  ? 2007 HOH P O     1 
HETATM 3586 O  O     . HOH I 6 .   ? 36.688 16.854 32.395  1.00  51.56  ? 2008 HOH P O     1 
HETATM 3587 O  O     . HOH I 6 .   ? 29.284 23.356 27.743  1.00  49.21  ? 2009 HOH P O     1 
HETATM 3588 O  O     . HOH I 6 .   ? 38.978 22.300 33.248  1.00  29.86  ? 2010 HOH P O     1 
HETATM 3589 O  O     . HOH I 6 .   ? 36.320 22.654 23.506  1.00  41.37  ? 2011 HOH P O     1 
HETATM 3590 O  O     . HOH I 6 .   ? 31.618 24.865 25.444  1.00  54.50  ? 2012 HOH P O     1 
HETATM 3591 O  O     . HOH I 6 .   ? 33.312 26.014 18.290  1.00  42.96  ? 2013 HOH P O     1 
HETATM 3592 O  O     . HOH I 6 .   ? 33.106 26.832 14.629  1.00  38.29  ? 2014 HOH P O     1 
HETATM 3593 O  O     . HOH I 6 .   ? 24.608 26.209 5.893   1.00  24.75  ? 2015 HOH P O     1 
HETATM 3594 O  O     . HOH I 6 .   ? 21.034 26.168 6.212   1.00  32.15  ? 2016 HOH P O     1 
HETATM 3595 O  O     . HOH I 6 .   ? 20.250 29.872 6.660   1.00  58.23  ? 2017 HOH P O     1 
HETATM 3596 O  O     . HOH I 6 .   ? 22.093 32.293 14.101  1.00  70.07  ? 2018 HOH P O     1 
HETATM 3597 O  O     . HOH I 6 .   ? 21.114 35.929 7.469   1.00  31.35  ? 2019 HOH P O     1 
HETATM 3598 O  O     . HOH I 6 .   ? 28.322 38.965 14.054  1.00  39.93  ? 2020 HOH P O     1 
HETATM 3599 O  O     . HOH I 6 .   ? 30.335 31.063 8.679   1.00  44.87  ? 2021 HOH P O     1 
HETATM 3600 O  O     . HOH I 6 .   ? 23.095 29.894 5.604   1.00  54.67  ? 2022 HOH P O     1 
HETATM 3601 O  O     . HOH J 6 .   ? 41.010 34.486 16.584  1.00  36.13  ? 2001 HOH T O     1 
HETATM 3602 O  O     . HOH J 6 .   ? 34.788 40.064 16.090  1.00  39.53  ? 2002 HOH T O     1 
HETATM 3603 O  O     . HOH J 6 .   ? 44.152 38.800 16.242  1.00  34.52  ? 2003 HOH T O     1 
HETATM 3604 O  O     . HOH J 6 .   ? 34.686 29.290 15.146  1.00  55.02  ? 2004 HOH T O     1 
HETATM 3605 O  O     . HOH J 6 .   ? 28.271 36.173 16.737  1.00  40.02  ? 2005 HOH T O     1 
HETATM 3606 O  O     . HOH J 6 .   ? 30.027 30.321 22.476  1.00  35.85  ? 2006 HOH T O     1 
HETATM 3607 O  O     . HOH J 6 .   ? 26.675 31.206 24.632  1.00  47.16  ? 2007 HOH T O     1 
HETATM 3608 O  O     . HOH J 6 .   ? 31.916 28.637 21.278  1.00  42.23  ? 2008 HOH T O     1 
HETATM 3609 O  O     . HOH J 6 .   ? 16.409 21.224 23.659  1.00  71.08  ? 2009 HOH T O     1 
HETATM 3610 O  O     . HOH J 6 .   ? 19.166 26.060 25.696  1.00  57.44  ? 2010 HOH T O     1 
HETATM 3611 O  O     . HOH J 6 .   ? 20.087 17.304 17.716  1.00  34.23  ? 2011 HOH T O     1 
HETATM 3612 O  O     . HOH J 6 .   ? 31.732 12.902 22.918  1.00  53.13  ? 2012 HOH T O     1 
HETATM 3613 O  O     . HOH J 6 .   ? 26.482 8.892  26.581  1.00  51.00  ? 2013 HOH T O     1 
HETATM 3614 O  O     . HOH J 6 .   ? 30.748 5.628  27.817  1.00  57.41  ? 2014 HOH T O     1 
HETATM 3615 O  O     . HOH J 6 .   ? 23.871 5.144  43.663  1.00  47.10  ? 2015 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   0   HIS HIS A . n 
A 1 7   MET 7   1   1   MET MET A . n 
A 1 8   ILE 8   2   2   ILE ILE A . n 
A 1 9   VAL 9   3   3   VAL VAL A . n 
A 1 10  LEU 10  4   4   LEU LEU A . n 
A 1 11  PHE 11  5   5   PHE PHE A . n 
A 1 12  VAL 12  6   6   VAL VAL A . n 
A 1 13  ASP 13  7   7   ASP ASP A . n 
A 1 14  PHE 14  8   8   PHE PHE A . n 
A 1 15  ASP 15  9   9   ASP ASP A . n 
A 1 16  TYR 16  10  10  TYR TYR A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  TYR 18  12  12  TYR TYR A . n 
A 1 19  ALA 19  13  13  ALA ALA A . n 
A 1 20  GLN 20  14  14  GLN GLN A . n 
A 1 21  VAL 21  15  15  VAL VAL A . n 
A 1 22  GLU 22  16  16  GLU GLU A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  LEU 25  19  19  LEU LEU A . n 
A 1 26  ASN 26  20  20  ASN ASN A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  LYS 30  24  24  LYS LYS A . n 
A 1 31  GLY 31  25  25  GLY GLY A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  VAL 34  28  28  VAL VAL A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  VAL 38  32  32  VAL VAL A . n 
A 1 39  PHE 39  33  33  PHE PHE A . n 
A 1 40  SER 40  34  34  SER SER A . n 
A 1 41  GLY 41  35  35  GLY GLY A . n 
A 1 42  ARG 42  36  36  ARG ARG A . n 
A 1 43  PHE 43  37  37  PHE PHE A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  ALA 48  42  42  ALA ALA A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  THR 51  45  45  THR THR A . n 
A 1 52  ALA 52  46  46  ALA ALA A . n 
A 1 53  ASN 53  47  47  ASN ASN A . n 
A 1 54  TYR 54  48  48  TYR TYR A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  ALA 56  50  50  ALA ALA A . n 
A 1 57  ARG 57  51  51  ARG ARG A . n 
A 1 58  LYS 58  52  52  LYS LYS A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  VAL 61  55  55  VAL VAL A . n 
A 1 62  LYS 62  56  56  LYS LYS A . n 
A 1 63  ALA 63  57  57  ALA ALA A . n 
A 1 64  GLY 64  58  58  GLY GLY A . n 
A 1 65  ILE 65  59  59  ILE ILE A . n 
A 1 66  PRO 66  60  60  PRO PRO A . n 
A 1 67  ILE 67  61  61  ILE ILE A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLU 69  63  63  GLU GLU A . n 
A 1 70  ALA 70  64  64  ALA ALA A . n 
A 1 71  LYS 71  65  65  LYS LYS A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  ILE 73  67  67  ILE ILE A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  PRO 75  69  69  PRO PRO A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ALA 77  71  71  ALA ALA A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  TYR 79  73  73  TYR TYR A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  PRO 81  75  75  PRO PRO A . n 
A 1 82  MET 82  76  76  MET MET A . n 
A 1 83  ARG 83  77  77  ARG ARG A . n 
A 1 84  LYS 84  78  78  LYS LYS A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  VAL 86  80  80  VAL VAL A . n 
A 1 87  TYR 87  81  81  TYR TYR A . n 
A 1 88  GLN 88  82  82  GLN GLN A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  VAL 90  84  84  VAL VAL A . n 
A 1 91  SER 91  85  85  SER SER A . n 
A 1 92  SER 92  86  86  SER SER A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  ILE 94  88  88  ILE ILE A . n 
A 1 95  MET 95  89  89  MET MET A . n 
A 1 96  ASN 96  90  90  ASN ASN A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  LEU 98  92  92  LEU LEU A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 GLU 100 94  94  GLU GLU A . n 
A 1 101 TYR 101 95  95  TYR TYR A . n 
A 1 102 SER 102 96  96  SER SER A . n 
A 1 103 GLU 103 97  97  GLU GLU A . n 
A 1 104 LYS 104 98  98  LYS LYS A . n 
A 1 105 ILE 105 99  99  ILE ILE A . n 
A 1 106 GLU 106 100 100 GLU GLU A . n 
A 1 107 ILE 107 101 101 ILE ILE A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 SER 109 103 103 SER SER A . n 
A 1 110 ILE 110 104 104 ILE ILE A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 ALA 113 107 107 ALA ALA A . n 
A 1 114 TYR 114 108 108 TYR TYR A . n 
A 1 115 LEU 115 109 109 LEU LEU A . n 
A 1 116 ASP 116 110 110 ASP ASP A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 SER 118 112 112 SER SER A . n 
A 1 119 ASP 119 113 113 ASP ASP A . n 
A 1 120 LYS 120 114 114 LYS LYS A . n 
A 1 121 VAL 121 115 115 VAL VAL A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ASP 123 117 117 ASP ASP A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ASN 129 123 123 ASN ASN A . n 
A 1 130 LEU 130 124 124 LEU LEU A . n 
A 1 131 GLY 131 125 125 GLY GLY A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 GLU 133 127 127 GLU GLU A . n 
A 1 134 ILE 134 128 128 ILE ILE A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 LYS 137 131 131 LYS LYS A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 GLU 142 136 136 GLU GLU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 ILE 144 138 138 ILE ILE A . n 
A 1 145 THR 145 139 139 THR THR A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 THR 147 141 141 THR THR A . n 
A 1 148 VAL 148 142 142 VAL VAL A . n 
A 1 149 GLY 149 143 143 GLY GLY A . n 
A 1 150 ILE 150 144 144 ILE ILE A . n 
A 1 151 SER 151 145 145 SER SER A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 ASN 153 147 147 ASN ASN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 VAL 155 149 149 VAL VAL A . n 
A 1 156 PHE 156 150 150 PHE PHE A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ILE 159 153 153 ILE ILE A . n 
A 1 160 ALA 160 154 154 ALA ALA A . n 
A 1 161 ALA 161 155 155 ALA ALA A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 MET 163 157 157 MET MET A . n 
A 1 164 ALA 164 158 158 ALA ALA A . n 
A 1 165 LYS 165 159 159 LYS LYS A . n 
A 1 166 PRO 166 160 160 PRO PRO A . n 
A 1 167 ASN 167 161 161 ASN ASN A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 LYS 170 164 164 LYS LYS A . n 
A 1 171 VAL 171 165 165 VAL VAL A . n 
A 1 172 ILE 172 166 166 ILE ILE A . n 
A 1 173 ASP 173 167 167 ASP ASP A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 GLU 176 170 170 GLU GLU A . n 
A 1 177 VAL 177 171 171 VAL VAL A . n 
A 1 178 LYS 178 172 172 LYS LYS A . n 
A 1 179 ARG 179 173 173 ARG ARG A . n 
A 1 180 LEU 180 174 174 LEU LEU A . n 
A 1 181 ILE 181 175 175 ILE ILE A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 GLU 183 177 177 GLU GLU A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ILE 186 180 180 ILE ILE A . n 
A 1 187 ALA 187 181 181 ALA ALA A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 VAL 189 183 183 VAL VAL A . n 
A 1 190 PRO 190 184 184 PRO PRO A . n 
A 1 191 GLY 191 185 185 GLY GLY A . n 
A 1 192 ILE 192 186 186 ILE ILE A . n 
A 1 193 GLY 193 187 187 GLY GLY A . n 
A 1 194 ASN 194 188 188 ASN ASN A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 THR 196 190 190 THR THR A . n 
A 1 197 ALA 197 191 191 ALA ALA A . n 
A 1 198 GLU 198 192 192 GLU GLU A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 LEU 200 194 194 LEU LEU A . n 
A 1 201 LYS 201 195 195 LYS LYS A . n 
A 1 202 LYS 202 196 196 LYS LYS A . n 
A 1 203 LEU 203 197 197 LEU LEU A . n 
A 1 204 GLY 204 198 198 GLY GLY A . n 
A 1 205 ILE 205 199 199 ILE ILE A . n 
A 1 206 ASN 206 200 200 ASN ASN A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 LEU 208 202 202 LEU LEU A . n 
A 1 209 VAL 209 203 203 VAL VAL A . n 
A 1 210 ASP 210 204 204 ASP ASP A . n 
A 1 211 THR 211 205 205 THR THR A . n 
A 1 212 LEU 212 206 206 LEU LEU A . n 
A 1 213 SER 213 207 207 SER SER A . n 
A 1 214 ILE 214 208 208 ILE ILE A . n 
A 1 215 GLU 215 209 209 GLU GLU A . n 
A 1 216 PHE 216 210 210 PHE PHE A . n 
A 1 217 ASP 217 211 211 ASP ASP A . n 
A 1 218 LYS 218 212 212 LYS LYS A . n 
A 1 219 LEU 219 213 213 LEU LEU A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 GLY 221 215 215 GLY GLY A . n 
A 1 222 MET 222 216 216 MET MET A . n 
A 1 223 ILE 223 217 217 ILE ILE A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 GLU 225 219 219 GLU GLU A . n 
A 1 226 ALA 226 220 220 ALA ALA A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ALA 228 222 222 ALA ALA A . n 
A 1 229 LYS 229 223 223 LYS LYS A . n 
A 1 230 TYR 230 224 224 TYR TYR A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 SER 233 227 227 SER SER A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ALA 235 229 229 ALA ALA A . n 
A 1 236 ARG 236 230 230 ARG ARG A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 GLU 238 232 232 GLU GLU A . n 
A 1 239 TYR 239 233 233 TYR TYR A . n 
A 1 240 ASN 240 234 234 ASN ASN A . n 
A 1 241 GLU 241 235 235 GLU GLU A . n 
A 1 242 PRO 242 236 236 PRO PRO A . n 
A 1 243 ILE 243 237 237 ILE ILE A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 THR 245 239 239 THR THR A . n 
A 1 246 ARG 246 240 240 ARG ARG A . n 
A 1 247 VAL 247 241 241 VAL VAL A . n 
A 1 248 ARG 248 242 242 ARG ARG A . n 
A 1 249 LYS 249 243 243 LYS LYS A . n 
A 1 250 SER 250 244 244 SER SER A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 GLY 252 246 246 GLY GLY A . n 
A 1 253 ARG 253 247 247 ARG ARG A . n 
A 1 254 ILE 254 248 248 ILE ILE A . n 
A 1 255 VAL 255 249 249 VAL VAL A . n 
A 1 256 THR 256 250 250 THR THR A . n 
A 1 257 MET 257 251 251 MET MET A . n 
A 1 258 LYS 258 252 252 LYS LYS A . n 
A 1 259 ARG 259 253 253 ARG ARG A . n 
A 1 260 ASN 260 254 254 ASN ASN A . n 
A 1 261 SER 261 255 255 SER SER A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 ASN 263 257 257 ASN ASN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 GLU 265 259 259 GLU GLU A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 ILE 267 261 261 ILE ILE A . n 
A 1 268 LYS 268 262 262 LYS LYS A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 TYR 270 264 264 TYR TYR A . n 
A 1 271 LEU 271 265 265 LEU LEU A . n 
A 1 272 PHE 272 266 266 PHE PHE A . n 
A 1 273 ARG 273 267 267 ARG ARG A . n 
A 1 274 ALA 274 268 268 ALA ALA A . n 
A 1 275 ILE 275 269 269 ILE ILE A . n 
A 1 276 GLU 276 270 270 GLU GLU A . n 
A 1 277 GLU 277 271 271 GLU GLU A . n 
A 1 278 SER 278 272 272 SER SER A . n 
A 1 279 TYR 279 273 273 TYR TYR A . n 
A 1 280 TYR 280 274 274 TYR TYR A . n 
A 1 281 LYS 281 275 275 LYS LYS A . n 
A 1 282 LEU 282 276 276 LEU LEU A . n 
A 1 283 ASP 283 277 277 ASP ASP A . n 
A 1 284 LYS 284 278 278 LYS LYS A . n 
A 1 285 ARG 285 279 279 ARG ARG A . n 
A 1 286 ILE 286 280 280 ILE ILE A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 LYS 288 282 282 LYS LYS A . n 
A 1 289 ALA 289 283 283 ALA ALA A . n 
A 1 290 ILE 290 284 284 ILE ILE A . n 
A 1 291 HIS 291 285 285 HIS HIS A . n 
A 1 292 VAL 292 286 286 VAL VAL A . n 
A 1 293 VAL 293 287 287 VAL VAL A . n 
A 1 294 ALA 294 288 288 ALA ALA A . n 
A 1 295 VAL 295 289 289 VAL VAL A . n 
A 1 296 THR 296 290 290 THR THR A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 ASP 298 292 292 ASP ASP A . n 
A 1 299 LEU 299 293 293 LEU LEU A . n 
A 1 300 ASP 300 294 294 ASP ASP A . n 
A 1 301 ILE 301 295 295 ILE ILE A . n 
A 1 302 VAL 302 296 296 VAL VAL A . n 
A 1 303 SER 303 297 297 SER SER A . n 
A 1 304 ARG 304 298 298 ARG ARG A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 ARG 306 300 300 ARG ARG A . n 
A 1 307 THR 307 301 301 THR THR A . n 
A 1 308 PHE 308 302 302 PHE PHE A . n 
A 1 309 PRO 309 303 303 PRO PRO A . n 
A 1 310 HIS 310 304 304 HIS HIS A . n 
A 1 311 GLY 311 305 305 GLY GLY A . n 
A 1 312 ILE 312 306 306 ILE ILE A . n 
A 1 313 SER 313 307 307 SER SER A . n 
A 1 314 LYS 314 308 308 LYS LYS A . n 
A 1 315 GLU 315 309 309 GLU GLU A . n 
A 1 316 THR 316 310 310 THR THR A . n 
A 1 317 ALA 317 311 311 ALA ALA A . n 
A 1 318 TYR 318 312 312 TYR TYR A . n 
A 1 319 SER 319 313 313 SER SER A . n 
A 1 320 GLU 320 314 314 GLU GLU A . n 
A 1 321 SER 321 315 315 SER SER A . n 
A 1 322 VAL 322 316 316 VAL VAL A . n 
A 1 323 LYS 323 317 317 LYS LYS A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 GLN 326 320 320 GLN GLN A . n 
A 1 327 LYS 327 321 321 LYS LYS A . n 
A 1 328 ILE 328 322 322 ILE ILE A . n 
A 1 329 LEU 329 323 323 LEU LEU A . n 
A 1 330 GLU 330 324 324 GLU GLU A . n 
A 1 331 GLU 331 325 325 GLU GLU A . n 
A 1 332 ASP 332 326 326 ASP ASP A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 ARG 334 328 328 ARG ARG A . n 
A 1 335 LYS 335 329 329 LYS LYS A . n 
A 1 336 ILE 336 330 330 ILE ILE A . n 
A 1 337 ARG 337 331 331 ARG ARG A . n 
A 1 338 ARG 338 332 332 ARG ARG A . n 
A 1 339 ILE 339 333 333 ILE ILE A . n 
A 1 340 GLY 340 334 334 GLY GLY A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 ARG 342 336 336 ARG ARG A . n 
A 1 343 PHE 343 337 337 PHE PHE A . n 
A 1 344 SER 344 338 338 SER SER A . n 
A 1 345 LYS 345 339 339 LYS LYS A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 ILE 347 341 341 ILE ILE A . n 
A 1 348 GLU 348 342 342 GLU GLU A . n 
A 1 349 ALA 349 343 ?   ?   ?   A . n 
A 1 350 ILE 350 344 ?   ?   ?   A . n 
A 1 351 GLY 351 345 ?   ?   ?   A . n 
A 1 352 LEU 352 346 ?   ?   ?   A . n 
A 1 353 ASP 353 347 ?   ?   ?   A . n 
A 1 354 LYS 354 348 ?   ?   ?   A . n 
A 1 355 PHE 355 349 ?   ?   ?   A . n 
A 1 356 PHE 356 350 ?   ?   ?   A . n 
A 1 357 ASP 357 351 ?   ?   ?   A . n 
A 1 358 THR 358 352 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DG  3   3   3   DG  DG  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DG  5   5   5   DG  DG  P . n 
B 2 6   DA  6   6   6   DA  DA  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DG  8   8   8   DG  DG  P . n 
B 2 9   DG  9   9   9   DG  DG  P . n 
B 2 10  DA  10  10  10  DA  DA  P . n 
B 2 11  DT  11  11  11  DT  DT  P . n 
B 2 12  DT  12  12  12  DT  DT  P . n 
B 2 13  DC  13  13  13  DC  DC  P . n 
B 2 14  DOC 14  14  14  DOC DOC P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DC  2   2   ?   ?   ?   T . n 
C 3 3   DA  3   3   3   DA  DA  T . n 
C 3 4   DC  4   4   4   DC  DC  T . n 
C 3 5   BZG 5   5   5   BZG BZG T . n 
C 3 6   DG  6   6   6   DG  DG  T . n 
C 3 7   DA  7   7   7   DA  DA  T . n 
C 3 8   DA  8   8   8   DA  DA  T . n 
C 3 9   DT  9   9   9   DT  DT  T . n 
C 3 10  DC  10  10  10  DC  DC  T . n 
C 3 11  DC  11  11  11  DC  DC  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DT  13  13  13  DT  DT  T . n 
C 3 14  DC  14  14  14  DC  DC  T . n 
C 3 15  DC  15  15  15  DC  DC  T . n 
C 3 16  DC  16  16  16  DC  DC  T . n 
C 3 17  DC  17  17  17  DC  DC  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DGT 1   1343 1343 DGT DGT A . 
E 5 CA  1   1344 1344 CA  CA  A . 
F 5 CA  1   1345 1345 CA  CA  A . 
G 5 CA  1   1346 1346 CA  CA  A . 
H 6 HOH 1   2001 2001 HOH HOH A . 
H 6 HOH 2   2002 2002 HOH HOH A . 
H 6 HOH 3   2003 2003 HOH HOH A . 
H 6 HOH 4   2004 2004 HOH HOH A . 
H 6 HOH 5   2005 2005 HOH HOH A . 
H 6 HOH 6   2006 2006 HOH HOH A . 
H 6 HOH 7   2007 2007 HOH HOH A . 
H 6 HOH 8   2008 2008 HOH HOH A . 
H 6 HOH 9   2009 2009 HOH HOH A . 
H 6 HOH 10  2010 2010 HOH HOH A . 
H 6 HOH 11  2011 2011 HOH HOH A . 
H 6 HOH 12  2012 2012 HOH HOH A . 
H 6 HOH 13  2013 2013 HOH HOH A . 
H 6 HOH 14  2014 2014 HOH HOH A . 
H 6 HOH 15  2015 2015 HOH HOH A . 
H 6 HOH 16  2016 2016 HOH HOH A . 
H 6 HOH 17  2017 2017 HOH HOH A . 
H 6 HOH 18  2018 2018 HOH HOH A . 
H 6 HOH 19  2019 2019 HOH HOH A . 
H 6 HOH 20  2020 2020 HOH HOH A . 
H 6 HOH 21  2021 2021 HOH HOH A . 
H 6 HOH 22  2022 2022 HOH HOH A . 
H 6 HOH 23  2023 2023 HOH HOH A . 
H 6 HOH 24  2024 2024 HOH HOH A . 
H 6 HOH 25  2025 2025 HOH HOH A . 
H 6 HOH 26  2026 2026 HOH HOH A . 
H 6 HOH 27  2027 2027 HOH HOH A . 
H 6 HOH 28  2028 2028 HOH HOH A . 
H 6 HOH 29  2029 2029 HOH HOH A . 
H 6 HOH 30  2030 2030 HOH HOH A . 
H 6 HOH 31  2031 2031 HOH HOH A . 
H 6 HOH 32  2032 2032 HOH HOH A . 
H 6 HOH 33  2033 2033 HOH HOH A . 
H 6 HOH 34  2034 2034 HOH HOH A . 
H 6 HOH 35  2035 2035 HOH HOH A . 
H 6 HOH 36  2036 2036 HOH HOH A . 
H 6 HOH 37  2037 2037 HOH HOH A . 
H 6 HOH 38  2038 2038 HOH HOH A . 
H 6 HOH 39  2039 2039 HOH HOH A . 
H 6 HOH 40  2040 2040 HOH HOH A . 
H 6 HOH 41  2041 2041 HOH HOH A . 
H 6 HOH 42  2042 2042 HOH HOH A . 
H 6 HOH 43  2043 2043 HOH HOH A . 
H 6 HOH 44  2044 2044 HOH HOH A . 
H 6 HOH 45  2045 2045 HOH HOH A . 
H 6 HOH 46  2046 2046 HOH HOH A . 
H 6 HOH 47  2047 2047 HOH HOH A . 
H 6 HOH 48  2048 2048 HOH HOH A . 
H 6 HOH 49  2049 2049 HOH HOH A . 
H 6 HOH 50  2050 2050 HOH HOH A . 
H 6 HOH 51  2051 2051 HOH HOH A . 
H 6 HOH 52  2052 2052 HOH HOH A . 
H 6 HOH 53  2053 2053 HOH HOH A . 
H 6 HOH 54  2054 2054 HOH HOH A . 
H 6 HOH 55  2055 2055 HOH HOH A . 
H 6 HOH 56  2056 2056 HOH HOH A . 
H 6 HOH 57  2057 2057 HOH HOH A . 
H 6 HOH 58  2058 2058 HOH HOH A . 
H 6 HOH 59  2059 2059 HOH HOH A . 
H 6 HOH 60  2060 2060 HOH HOH A . 
H 6 HOH 61  2061 2061 HOH HOH A . 
H 6 HOH 62  2062 2062 HOH HOH A . 
H 6 HOH 63  2063 2063 HOH HOH A . 
H 6 HOH 64  2064 2064 HOH HOH A . 
H 6 HOH 65  2065 2065 HOH HOH A . 
H 6 HOH 66  2066 2066 HOH HOH A . 
H 6 HOH 67  2067 2067 HOH HOH A . 
H 6 HOH 68  2068 2068 HOH HOH A . 
H 6 HOH 69  2069 2069 HOH HOH A . 
H 6 HOH 70  2070 2070 HOH HOH A . 
H 6 HOH 71  2071 2071 HOH HOH A . 
H 6 HOH 72  2072 2072 HOH HOH A . 
H 6 HOH 73  2073 2073 HOH HOH A . 
H 6 HOH 74  2074 2074 HOH HOH A . 
H 6 HOH 75  2075 2075 HOH HOH A . 
H 6 HOH 76  2076 2076 HOH HOH A . 
H 6 HOH 77  2077 2077 HOH HOH A . 
H 6 HOH 78  2078 2078 HOH HOH A . 
H 6 HOH 79  2079 2079 HOH HOH A . 
H 6 HOH 80  2080 2080 HOH HOH A . 
H 6 HOH 81  2081 2081 HOH HOH A . 
H 6 HOH 82  2082 2082 HOH HOH A . 
H 6 HOH 83  2083 2083 HOH HOH A . 
H 6 HOH 84  2084 2084 HOH HOH A . 
H 6 HOH 85  2085 2085 HOH HOH A . 
H 6 HOH 86  2086 2086 HOH HOH A . 
H 6 HOH 87  2087 2087 HOH HOH A . 
H 6 HOH 88  2088 2088 HOH HOH A . 
H 6 HOH 89  2089 2089 HOH HOH A . 
H 6 HOH 90  2090 2090 HOH HOH A . 
H 6 HOH 91  2091 2091 HOH HOH A . 
H 6 HOH 92  2092 2092 HOH HOH A . 
H 6 HOH 93  2093 2093 HOH HOH A . 
H 6 HOH 94  2094 2094 HOH HOH A . 
H 6 HOH 95  2095 2095 HOH HOH A . 
H 6 HOH 96  2096 2096 HOH HOH A . 
H 6 HOH 97  2097 2097 HOH HOH A . 
H 6 HOH 98  2098 2098 HOH HOH A . 
H 6 HOH 99  2099 2099 HOH HOH A . 
H 6 HOH 100 2100 2100 HOH HOH A . 
H 6 HOH 101 2101 2101 HOH HOH A . 
H 6 HOH 102 2102 2102 HOH HOH A . 
H 6 HOH 103 2103 2103 HOH HOH A . 
H 6 HOH 104 2104 2104 HOH HOH A . 
H 6 HOH 105 2105 2105 HOH HOH A . 
H 6 HOH 106 2106 2106 HOH HOH A . 
H 6 HOH 107 2107 2107 HOH HOH A . 
H 6 HOH 108 2108 2108 HOH HOH A . 
H 6 HOH 109 2109 2109 HOH HOH A . 
H 6 HOH 110 2110 2110 HOH HOH A . 
H 6 HOH 111 2111 2111 HOH HOH A . 
H 6 HOH 112 2112 2112 HOH HOH A . 
H 6 HOH 113 2113 2113 HOH HOH A . 
H 6 HOH 114 2114 2114 HOH HOH A . 
H 6 HOH 115 2115 2115 HOH HOH A . 
H 6 HOH 116 2116 2116 HOH HOH A . 
H 6 HOH 117 2117 2117 HOH HOH A . 
H 6 HOH 118 2118 2118 HOH HOH A . 
H 6 HOH 119 2119 2119 HOH HOH A . 
H 6 HOH 120 2120 2120 HOH HOH A . 
H 6 HOH 121 2121 2121 HOH HOH A . 
H 6 HOH 122 2122 2122 HOH HOH A . 
H 6 HOH 123 2123 2123 HOH HOH A . 
H 6 HOH 124 2124 2124 HOH HOH A . 
H 6 HOH 125 2125 2125 HOH HOH A . 
H 6 HOH 126 2126 2126 HOH HOH A . 
H 6 HOH 127 2127 2127 HOH HOH A . 
H 6 HOH 128 2128 2128 HOH HOH A . 
H 6 HOH 129 2129 2129 HOH HOH A . 
H 6 HOH 130 2130 2130 HOH HOH A . 
H 6 HOH 131 2131 2131 HOH HOH A . 
H 6 HOH 132 2132 2132 HOH HOH A . 
H 6 HOH 133 2133 2133 HOH HOH A . 
H 6 HOH 134 2134 2134 HOH HOH A . 
H 6 HOH 135 2135 2135 HOH HOH A . 
H 6 HOH 136 2136 2136 HOH HOH A . 
H 6 HOH 137 2137 2137 HOH HOH A . 
H 6 HOH 138 2138 2138 HOH HOH A . 
H 6 HOH 139 2139 2139 HOH HOH A . 
H 6 HOH 140 2140 2140 HOH HOH A . 
H 6 HOH 141 2141 2141 HOH HOH A . 
H 6 HOH 142 2142 2142 HOH HOH A . 
H 6 HOH 143 2143 2143 HOH HOH A . 
H 6 HOH 144 2144 2144 HOH HOH A . 
H 6 HOH 145 2145 2145 HOH HOH A . 
I 6 HOH 1   2001 2001 HOH HOH P . 
I 6 HOH 2   2002 2002 HOH HOH P . 
I 6 HOH 3   2003 2003 HOH HOH P . 
I 6 HOH 4   2004 2004 HOH HOH P . 
I 6 HOH 5   2005 2005 HOH HOH P . 
I 6 HOH 6   2006 2006 HOH HOH P . 
I 6 HOH 7   2007 2007 HOH HOH P . 
I 6 HOH 8   2008 2008 HOH HOH P . 
I 6 HOH 9   2009 2009 HOH HOH P . 
I 6 HOH 10  2010 2010 HOH HOH P . 
I 6 HOH 11  2011 2011 HOH HOH P . 
I 6 HOH 12  2012 2012 HOH HOH P . 
I 6 HOH 13  2013 2013 HOH HOH P . 
I 6 HOH 14  2014 2014 HOH HOH P . 
I 6 HOH 15  2015 2015 HOH HOH P . 
I 6 HOH 16  2016 2016 HOH HOH P . 
I 6 HOH 17  2017 2017 HOH HOH P . 
I 6 HOH 18  2018 2018 HOH HOH P . 
I 6 HOH 19  2019 2019 HOH HOH P . 
I 6 HOH 20  2020 2020 HOH HOH P . 
I 6 HOH 21  2021 2021 HOH HOH P . 
I 6 HOH 22  2022 2022 HOH HOH P . 
J 6 HOH 1   2001 2001 HOH HOH T . 
J 6 HOH 2   2002 2002 HOH HOH T . 
J 6 HOH 3   2003 2003 HOH HOH T . 
J 6 HOH 4   2004 2004 HOH HOH T . 
J 6 HOH 5   2005 2005 HOH HOH T . 
J 6 HOH 6   2006 2006 HOH HOH T . 
J 6 HOH 7   2007 2007 HOH HOH T . 
J 6 HOH 8   2008 2008 HOH HOH T . 
J 6 HOH 9   2009 2009 HOH HOH T . 
J 6 HOH 10  2010 2010 HOH HOH T . 
J 6 HOH 11  2011 2011 HOH HOH T . 
J 6 HOH 12  2012 2012 HOH HOH T . 
J 6 HOH 13  2013 2013 HOH HOH T . 
J 6 HOH 14  2014 2014 HOH HOH T . 
J 6 HOH 15  2015 2015 HOH HOH T . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    DOC 
_pdbx_struct_mod_residue.label_seq_id     14 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     DOC 
_pdbx_struct_mod_residue.auth_seq_id      14 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DC 
_pdbx_struct_mod_residue.details          "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5760  ? 
1 MORE         -60.5 ? 
1 'SSA (A^2)'  20220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? I HOH .   ? P HOH 2019 ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 69.3  ? 
2  O   ? I HOH .   ? P HOH 2019 ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 92.5  ? 
3  OE1 ? A GLU 112 ? A GLU 106  ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 101.3 ? 
4  O   ? I HOH .   ? P HOH 2019 ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 143.3 ? 
5  OE1 ? A GLU 112 ? A GLU 106  ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 133.3 ? 
6  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 58.4  ? 
7  O   ? I HOH .   ? P HOH 2019 ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 O2A ? D DGT .   ? A DGT 1343 ? 1_555 87.2  ? 
8  OE1 ? A GLU 112 ? A GLU 106  ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 O2A ? D DGT .   ? A DGT 1343 ? 1_555 155.3 ? 
9  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 O2A ? D DGT .   ? A DGT 1343 ? 1_555 86.6  ? 
10 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 O2A ? D DGT .   ? A DGT 1343 ? 1_555 70.6  ? 
11 O   ? I HOH .   ? P HOH 2019 ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 175.3 ? 
12 OE1 ? A GLU 112 ? A GLU 106  ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 106.9 ? 
13 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 90.9  ? 
14 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 41.3  ? 
15 O2A ? D DGT .   ? A DGT 1343 ? 1_555 CA ? E CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 96.3  ? 
16 O2A ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O1B ? D DGT .   ? A DGT 1343 ? 1_555 68.2  ? 
17 O2A ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O2G ? D DGT .   ? A DGT 1343 ? 1_555 73.8  ? 
18 O1B ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O2G ? D DGT .   ? A DGT 1343 ? 1_555 78.1  ? 
19 O2A ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 90.2  ? 
20 O1B ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 87.8  ? 
21 O2G ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 161.7 ? 
22 O2A ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 98.8  ? 
23 O1B ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 159.2 ? 
24 O2G ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 114.9 ? 
25 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 75.7  ? 
26 O2A ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 160.4 ? 
27 O1B ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 93.3  ? 
28 O2G ? D DGT .   ? A DGT 1343 ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 109.7 ? 
29 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 82.5  ? 
30 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 1345 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 96.9  ? 
31 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? I HOH .   ? P HOH 2016 ? 1_555 76.1  ? 
32 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? I HOH .   ? P HOH 2015 ? 1_555 161.1 ? 
33 O   ? I HOH .   ? P HOH 2016 ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? I HOH .   ? P HOH 2015 ? 1_555 85.3  ? 
34 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? A ILE 192 ? A ILE 186  ? 1_555 86.7  ? 
35 O   ? I HOH .   ? P HOH 2016 ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? A ILE 192 ? A ILE 186  ? 1_555 70.1  ? 
36 O   ? I HOH .   ? P HOH 2015 ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? A ILE 192 ? A ILE 186  ? 1_555 83.9  ? 
37 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? H HOH .   ? A HOH 2089 ? 1_555 92.2  ? 
38 O   ? I HOH .   ? P HOH 2016 ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? H HOH .   ? A HOH 2089 ? 1_555 81.7  ? 
39 O   ? I HOH .   ? P HOH 2015 ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? H HOH .   ? A HOH 2089 ? 1_555 88.3  ? 
40 O   ? A ILE 192 ? A ILE 186  ? 1_555 CA ? G CA . ? A CA 1346 ? 1_555 O   ? H HOH .   ? A HOH 2089 ? 1_555 151.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-03-13 
2 'Structure model' 1 1 2013-01-23 
3 'Structure model' 1 2 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Derived calculations'      
2  2 'Structure model' 'Non-polymer description'   
3  2 'Structure model' Other                       
4  2 'Structure model' 'Refinement description'    
5  2 'Structure model' 'Structure summary'         
6  2 'Structure model' 'Version format compliance' 
7  3 'Structure model' 'Data collection'           
8  3 'Structure model' 'Derived calculations'      
9  3 'Structure model' 'Experimental preparation'  
10 3 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow          
2 3 'Structure model' pdbx_database_proc          
3 3 'Structure model' pdbx_database_status        
4 3 'Structure model' pdbx_seq_map_depositor_info 
5 3 'Structure model' struct_biol                 
6 3 'Structure model' struct_conn                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                       
2 3 'Structure model' '_exptl_crystal_grow.temp'                         
3 3 'Structure model' '_pdbx_database_status.recvd_author_approval'      
4 3 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
CNS refinement       1.1 ? 1 ? ? ? ? 
XDS 'data reduction' .   ? 2 ? ? ? ? 
XDS 'data scaling'   .   ? 3 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             2JEF 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;6 HISTIDINES ADDED TO N-TERMINUS AND MISSING LAST 11
RESIDUES.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N7 
_pdbx_validate_close_contact.auth_asym_id_1   P 
_pdbx_validate_close_contact.auth_comp_id_1   DG 
_pdbx_validate_close_contact.auth_seq_id_1    2 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   P 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2003 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N     A MET 1  ? ? CA    A MET 1  ? ? C     A MET 1  ? ? 93.76  111.00 -17.24 2.70 N 
2  1 "C5'" P DG  2  ? ? "C4'" P DG  2  ? ? "C3'" P DG  2  ? ? 96.87  114.10 -17.23 1.80 N 
3  1 OP1   P DG  4  ? ? P     P DG  4  ? ? OP2   P DG  4  ? ? 110.30 119.60 -9.30  1.50 N 
4  1 OP1   P DG  5  ? ? P     P DG  5  ? ? OP2   P DG  5  ? ? 110.51 119.60 -9.09  1.50 N 
5  1 OP1   P DG  9  ? ? P     P DG  9  ? ? OP2   P DG  9  ? ? 110.49 119.60 -9.11  1.50 N 
6  1 OP1   P DT  12 ? ? P     P DT  12 ? ? OP2   P DT  12 ? ? 110.46 119.60 -9.14  1.50 N 
7  1 OP1   P DC  13 ? ? P     P DC  13 ? ? OP2   P DC  13 ? ? 110.38 119.60 -9.22  1.50 N 
8  1 "O3'" P DC  13 ? ? P     P DOC 14 ? ? "O5'" P DOC 14 ? ? 77.11  104.00 -26.89 1.90 Y 
9  1 "O3'" P DC  13 ? ? P     P DOC 14 ? ? OP2   P DOC 14 ? ? 90.75  105.20 -14.45 2.20 Y 
10 1 "O3'" P DC  13 ? ? P     P DOC 14 ? ? OP1   P DOC 14 ? ? 124.38 110.50 13.88  1.10 Y 
11 1 OP1   T DC  17 ? ? P     T DC  17 ? ? OP2   T DC  17 ? ? 110.59 119.60 -9.01  1.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 10  ? ? 18.50   54.61   
2 1 ASN A 20  ? ? -157.12 73.23   
3 1 GLU A 38  ? ? -5.71   -88.24  
4 1 ASP A 117 ? ? 64.74   160.83  
5 1 ASN A 161 ? ? 37.44   51.49   
6 1 ASN A 234 ? ? -158.71 45.34   
7 1 ASP A 277 ? ? 70.10   -115.69 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DC 
_pdbx_validate_planes.auth_asym_id    T 
_pdbx_validate_planes.auth_seq_id     4 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.060 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    "C4'" 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    P 
_pdbx_validate_chiral.auth_comp_id    DOC 
_pdbx_validate_chiral.auth_seq_id     14 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2004 ? 5.86 . 
2 1 O ? A HOH 2012 ? 6.27 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 342 ? CA  ? A GLU 348 CA  
2  1 Y 1 A GLU 342 ? C   ? A GLU 348 C   
3  1 Y 1 A GLU 342 ? O   ? A GLU 348 O   
4  1 Y 1 A GLU 342 ? CB  ? A GLU 348 CB  
5  1 Y 1 A GLU 342 ? CG  ? A GLU 348 CG  
6  1 Y 1 A GLU 342 ? CD  ? A GLU 348 CD  
7  1 Y 1 A GLU 342 ? OE1 ? A GLU 348 OE1 
8  1 Y 1 A GLU 342 ? OE2 ? A GLU 348 OE2 
9  1 Y 1 T DA  3   ? P   ? C DA  3   P   
10 1 Y 1 T DA  3   ? OP1 ? C DA  3   OP1 
11 1 Y 1 T DA  3   ? OP2 ? C DA  3   OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A ALA 343 ? A ALA 349 
7  1 Y 1 A ILE 344 ? A ILE 350 
8  1 Y 1 A GLY 345 ? A GLY 351 
9  1 Y 1 A LEU 346 ? A LEU 352 
10 1 Y 1 A ASP 347 ? A ASP 353 
11 1 Y 1 A LYS 348 ? A LYS 354 
12 1 Y 1 A PHE 349 ? A PHE 355 
13 1 Y 1 A PHE 350 ? A PHE 356 
14 1 Y 1 A ASP 351 ? A ASP 357 
15 1 Y 1 A THR 352 ? A THR 358 
16 1 Y 1 T DT  1   ? C DT  1   
17 1 Y 1 T DC  2   ? C DC  2   
# 
_ndb_struct_conf_na.entry_id   2JEF 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 18 1_555 -0.306 -0.065 -0.023 -1.994 0.214   -1.562 1  P_DG1:DC18_T P 1  ? T 18 ? 19 1 
1 B DG 2  1_555 C DC 17 1_555 0.320  -0.326 -0.189 -0.285 -5.179  7.826  2  P_DG2:DC17_T P 2  ? T 17 ? 19 1 
1 B DG 3  1_555 C DC 16 1_555 -0.483 0.073  -0.155 0.714  -3.031  -2.716 3  P_DG3:DC16_T P 3  ? T 16 ? 19 1 
1 B DG 4  1_555 C DC 15 1_555 -0.182 -0.025 -0.091 5.739  -7.853  5.813  4  P_DG4:DC15_T P 4  ? T 15 ? 19 1 
1 B DG 5  1_555 C DC 14 1_555 0.206  -0.375 -0.276 1.680  -2.350  -1.997 5  P_DG5:DC14_T P 5  ? T 14 ? 19 1 
1 B DA 6  1_555 C DT 13 1_555 0.062  0.219  -0.104 0.219  -11.527 -0.447 6  P_DA6:DT13_T P 6  ? T 13 ? 20 1 
1 B DA 7  1_555 C DT 12 1_555 0.101  -0.070 0.013  1.126  -13.756 0.774  7  P_DA7:DT12_T P 7  ? T 12 ? 20 1 
1 B DG 8  1_555 C DC 11 1_555 0.066  -0.065 -0.034 3.194  -7.867  2.586  8  P_DG8:DC11_T P 8  ? T 11 ? 19 1 
1 B DG 9  1_555 C DC 10 1_555 -0.205 0.190  -0.120 -9.231 -11.343 3.895  9  P_DG9:DC10_T P 9  ? T 10 ? 19 1 
1 B DA 10 1_555 C DT 9  1_555 0.385  0.063  -0.106 -8.392 -7.097  3.862  10 P_DA10:DT9_T P 10 ? T 9  ? 20 1 
1 B DT 11 1_555 C DA 8  1_555 0.076  0.117  -0.258 -0.004 -4.342  4.372  11 P_DT11:DA8_T P 11 ? T 8  ? 20 1 
1 B DT 12 1_555 C DA 7  1_555 -0.056 -0.119 -0.458 3.104  -0.144  0.652  12 P_DT12:DA7_T P 12 ? T 7  ? 20 1 
1 B DC 13 1_555 C DG 6  1_555 0.658  -0.098 -0.760 15.520 -1.351  5.274  13 P_DC13:DG6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DG 2  1_555 C DC 17 1_555 1.100  -0.009 3.317 3.266  7.040  32.634 -1.209 -1.354 3.335 12.312 
-5.712 33.519 1  PP_DG1DG2:DC17DC18_TT P 1  ? T 18 ? P 2  ? T 17 ? 
1 B DG 2  1_555 C DC 17 1_555 B DG 3  1_555 C DC 16 1_555 -1.704 -0.283 3.333 -5.659 5.577  27.742 -1.890 2.081  3.483 11.340 
11.506 28.836 2  PP_DG2DG3:DC16DC17_TT P 2  ? T 17 ? P 3  ? T 16 ? 
1 B DG 3  1_555 C DC 16 1_555 B DG 4  1_555 C DC 15 1_555 0.724  -0.188 3.240 0.491  7.971  32.885 -1.593 -1.167 3.121 13.827 
-0.851 33.814 3  PP_DG3DG4:DC15DC16_TT P 3  ? T 16 ? P 4  ? T 15 ? 
1 B DG 4  1_555 C DC 15 1_555 B DG 5  1_555 C DC 14 1_555 -0.366 -0.596 3.394 -0.612 7.904  27.800 -2.977 0.595  3.117 16.042 
1.243  28.887 4  PP_DG4DG5:DC14DC15_TT P 4  ? T 15 ? P 5  ? T 14 ? 
1 B DG 5  1_555 C DC 14 1_555 B DA 6  1_555 C DT 13 1_555 -0.375 -0.509 3.296 -0.832 6.073  34.946 -1.724 0.493  3.174 10.017 
1.373  35.463 5  PP_DG5DA6:DT13DC14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 B DA 6  1_555 C DT 13 1_555 B DA 7  1_555 C DT 12 1_555 -0.224 -0.555 3.321 -0.918 0.060  30.990 -1.050 0.240  3.325 0.111  
1.718  31.003 6  PP_DA6DA7:DT12DT13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 B DA 7  1_555 C DT 12 1_555 B DG 8  1_555 C DC 11 1_555 0.178  0.030  3.227 2.079  9.449  34.538 -1.296 0.007  3.132 15.540 
-3.419 35.828 7  PP_DA7DG8:DC11DT12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 B DG 8  1_555 C DC 11 1_555 B DG 9  1_555 C DC 10 1_555 0.427  -0.514 3.625 -0.873 4.197  33.496 -1.630 -0.891 3.525 7.245  
1.507  33.761 8  PP_DG8DG9:DC10DC11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 B DG 9  1_555 C DC 10 1_555 B DA 10 1_555 C DT 9  1_555 -0.499 -0.264 3.375 0.296  -4.061 38.488 0.118  0.791  3.380 -6.140 
-0.447 38.695 9  PP_DG9DA10:DT9DC10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 B DA 10 1_555 C DT 9  1_555 B DT 11 1_555 C DA 8  1_555 0.285  -0.504 3.105 1.235  4.738  28.040 -2.045 -0.313 2.990 9.686  
-2.524 28.456 10 PP_DA10DT11:DA8DT9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 B DT 11 1_555 C DA 8  1_555 B DT 12 1_555 C DA 7  1_555 0.413  -0.522 3.300 1.983  4.028  32.830 -1.595 -0.389 3.234 7.086  
-3.488 33.127 11 PP_DT11DT12:DA7DA8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 B DT 12 1_555 C DA 7  1_555 B DC 13 1_555 C DG 6  1_555 0.540  -0.208 3.193 3.448  5.676  29.176 -1.557 -0.345 3.139 11.087 
-6.734 29.906 12 PP_DT12DC13:DG6DA7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
#