data_2JG8
# 
_entry.id   2JG8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JG8         
PDBE  EBI-31358    
WWPDB D_1290031358 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JG9 unspecified 'CRYSTALLOGRAPHIC STRUCTURE OF HUMAN C1Q GLOBULAR HEADS (P1)' 
PDB 1PK6 unspecified 'GLOBULAR HEAD OF THE COMPLEMENT SYSTEM PROTEIN C1Q'          
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JG8 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Paidassi, H.'       1 
'Tacnet-Delorme, P.' 2 
'Garlatti, V.'       3 
'Darnault, C.'       4 
'Ghebrehiwet, B.'    5 
'Gaboriaud, C.'      6 
'Arlaud, G.J.'       7 
'Frachet, P.'        8 
# 
_citation.id                        primary 
_citation.title                     
'C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.' 
_citation.journal_abbrev            J.Immunol. 
_citation.journal_volume            180 
_citation.page_first                2329 
_citation.page_last                 2338 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           0022-1767 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18250442 
_citation.pdbx_database_id_DOI      10.4049/jimmunol.180.4.2329 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Paidassi, H.'       1 ? 
primary 'Tacnet-Delorme, P.' 2 ? 
primary 'Garlatti, V.'       3 ? 
primary 'Darnault, C.'       4 ? 
primary 'Ghebrehiwet, B.'    5 ? 
primary 'Gaboriaud, C.'      6 ? 
primary 'Arlaud, G.J.'       7 ? 
primary 'Frachet, P.'        8 ? 
# 
_cell.entry_id           2JG8 
_cell.length_a           48.090 
_cell.length_b           48.070 
_cell.length_c           84.700 
_cell.angle_alpha        91.34 
_cell.angle_beta         93.34 
_cell.angle_gamma        113.68 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JG8 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Complement C1q subcomponent subunit A'  14985.883 2   ? ? 'C-TERMINAL GLOBULAR REGION, RESIDUES 112-245' ? 
2 polymer     nat 'Complement C1q subcomponent subunit B'  15398.522 2   ? ? 'C TERMINAL GLOBULAR DOMAIN, RESIDUES 116-251' ? 
3 polymer     nat 'Complement C1q subcomponent subunit C'  14559.454 2   ? ? 'C TERMINAL GLOBULAR DOMAIN, RESIDUES 115-245' ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ? ? ?                                              ? 
5 non-polymer syn 'CALCIUM ION'                            40.078    2   ? ? ?                                              ? 
6 non-polymer syn PHOSPHOSERINE                            185.072   1   ? ? ?                                              ? 
7 water       nat water                                    18.015    302 ? ? ?                                              ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCD
TTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
;
;QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCD
TTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
;
A,D ? 
2 'polypeptide(L)' no no 
;ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTF
CDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
;
;ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTF
CDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
;
B,E ? 
3 'polypeptide(L)' no no 
;KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCG
HTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
;
;KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCG
HTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
;
C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   PRO n 
1 3   ARG n 
1 4   PRO n 
1 5   ALA n 
1 6   PHE n 
1 7   SER n 
1 8   ALA n 
1 9   ILE n 
1 10  ARG n 
1 11  ARG n 
1 12  ASN n 
1 13  PRO n 
1 14  PRO n 
1 15  MET n 
1 16  GLY n 
1 17  GLY n 
1 18  ASN n 
1 19  VAL n 
1 20  VAL n 
1 21  ILE n 
1 22  PHE n 
1 23  ASP n 
1 24  THR n 
1 25  VAL n 
1 26  ILE n 
1 27  THR n 
1 28  ASN n 
1 29  GLN n 
1 30  GLU n 
1 31  GLU n 
1 32  PRO n 
1 33  TYR n 
1 34  GLN n 
1 35  ASN n 
1 36  HIS n 
1 37  SER n 
1 38  GLY n 
1 39  ARG n 
1 40  PHE n 
1 41  VAL n 
1 42  CYS n 
1 43  THR n 
1 44  VAL n 
1 45  PRO n 
1 46  GLY n 
1 47  TYR n 
1 48  TYR n 
1 49  TYR n 
1 50  PHE n 
1 51  THR n 
1 52  PHE n 
1 53  GLN n 
1 54  VAL n 
1 55  LEU n 
1 56  SER n 
1 57  GLN n 
1 58  TRP n 
1 59  GLU n 
1 60  ILE n 
1 61  CYS n 
1 62  LEU n 
1 63  SER n 
1 64  ILE n 
1 65  VAL n 
1 66  SER n 
1 67  SER n 
1 68  SER n 
1 69  ARG n 
1 70  GLY n 
1 71  GLN n 
1 72  VAL n 
1 73  ARG n 
1 74  ARG n 
1 75  SER n 
1 76  LEU n 
1 77  GLY n 
1 78  PHE n 
1 79  CYS n 
1 80  ASP n 
1 81  THR n 
1 82  THR n 
1 83  ASN n 
1 84  LYS n 
1 85  GLY n 
1 86  LEU n 
1 87  PHE n 
1 88  GLN n 
1 89  VAL n 
1 90  VAL n 
1 91  SER n 
1 92  GLY n 
1 93  GLY n 
1 94  MET n 
1 95  VAL n 
1 96  LEU n 
1 97  GLN n 
1 98  LEU n 
1 99  GLN n 
1 100 GLN n 
1 101 GLY n 
1 102 ASP n 
1 103 GLN n 
1 104 VAL n 
1 105 TRP n 
1 106 VAL n 
1 107 GLU n 
1 108 LYS n 
1 109 ASP n 
1 110 PRO n 
1 111 LYS n 
1 112 LYS n 
1 113 GLY n 
1 114 HIS n 
1 115 ILE n 
1 116 TYR n 
1 117 GLN n 
1 118 GLY n 
1 119 SER n 
1 120 GLU n 
1 121 ALA n 
1 122 ASP n 
1 123 SER n 
1 124 VAL n 
1 125 PHE n 
1 126 SER n 
1 127 GLY n 
1 128 PHE n 
1 129 LEU n 
1 130 ILE n 
1 131 PHE n 
1 132 PRO n 
1 133 SER n 
1 134 ALA n 
2 1   ALA n 
2 2   THR n 
2 3   GLN n 
2 4   LYS n 
2 5   ILE n 
2 6   ALA n 
2 7   PHE n 
2 8   SER n 
2 9   ALA n 
2 10  THR n 
2 11  ARG n 
2 12  THR n 
2 13  ILE n 
2 14  ASN n 
2 15  VAL n 
2 16  PRO n 
2 17  LEU n 
2 18  ARG n 
2 19  ARG n 
2 20  ASP n 
2 21  GLN n 
2 22  THR n 
2 23  ILE n 
2 24  ARG n 
2 25  PHE n 
2 26  ASP n 
2 27  HIS n 
2 28  VAL n 
2 29  ILE n 
2 30  THR n 
2 31  ASN n 
2 32  MET n 
2 33  ASN n 
2 34  ASN n 
2 35  ASN n 
2 36  TYR n 
2 37  GLU n 
2 38  PRO n 
2 39  ARG n 
2 40  SER n 
2 41  GLY n 
2 42  LYS n 
2 43  PHE n 
2 44  THR n 
2 45  CYS n 
2 46  LYS n 
2 47  VAL n 
2 48  PRO n 
2 49  GLY n 
2 50  LEU n 
2 51  TYR n 
2 52  TYR n 
2 53  PHE n 
2 54  THR n 
2 55  TYR n 
2 56  HIS n 
2 57  ALA n 
2 58  SER n 
2 59  SER n 
2 60  ARG n 
2 61  GLY n 
2 62  ASN n 
2 63  LEU n 
2 64  CYS n 
2 65  VAL n 
2 66  ASN n 
2 67  LEU n 
2 68  MET n 
2 69  ARG n 
2 70  GLY n 
2 71  ARG n 
2 72  GLU n 
2 73  ARG n 
2 74  ALA n 
2 75  GLN n 
2 76  LYS n 
2 77  VAL n 
2 78  VAL n 
2 79  THR n 
2 80  PHE n 
2 81  CYS n 
2 82  ASP n 
2 83  TYR n 
2 84  ALA n 
2 85  TYR n 
2 86  ASN n 
2 87  THR n 
2 88  PHE n 
2 89  GLN n 
2 90  VAL n 
2 91  THR n 
2 92  THR n 
2 93  GLY n 
2 94  GLY n 
2 95  MET n 
2 96  VAL n 
2 97  LEU n 
2 98  LYS n 
2 99  LEU n 
2 100 GLU n 
2 101 GLN n 
2 102 GLY n 
2 103 GLU n 
2 104 ASN n 
2 105 VAL n 
2 106 PHE n 
2 107 LEU n 
2 108 GLN n 
2 109 ALA n 
2 110 THR n 
2 111 ASP n 
2 112 LYS n 
2 113 ASN n 
2 114 SER n 
2 115 LEU n 
2 116 LEU n 
2 117 GLY n 
2 118 MET n 
2 119 GLU n 
2 120 GLY n 
2 121 ALA n 
2 122 ASN n 
2 123 SER n 
2 124 ILE n 
2 125 PHE n 
2 126 SER n 
2 127 GLY n 
2 128 PHE n 
2 129 LEU n 
2 130 LEU n 
2 131 PHE n 
2 132 PRO n 
2 133 ASP n 
2 134 MET n 
2 135 GLU n 
2 136 ALA n 
3 1   LYS n 
3 2   GLN n 
3 3   LYS n 
3 4   PHE n 
3 5   GLN n 
3 6   SER n 
3 7   VAL n 
3 8   PHE n 
3 9   THR n 
3 10  VAL n 
3 11  THR n 
3 12  ARG n 
3 13  GLN n 
3 14  THR n 
3 15  HIS n 
3 16  GLN n 
3 17  PRO n 
3 18  PRO n 
3 19  ALA n 
3 20  PRO n 
3 21  ASN n 
3 22  SER n 
3 23  LEU n 
3 24  ILE n 
3 25  ARG n 
3 26  PHE n 
3 27  ASN n 
3 28  ALA n 
3 29  VAL n 
3 30  LEU n 
3 31  THR n 
3 32  ASN n 
3 33  PRO n 
3 34  GLN n 
3 35  GLY n 
3 36  ASP n 
3 37  TYR n 
3 38  ASP n 
3 39  THR n 
3 40  SER n 
3 41  THR n 
3 42  GLY n 
3 43  LYS n 
3 44  PHE n 
3 45  THR n 
3 46  CYS n 
3 47  LYS n 
3 48  VAL n 
3 49  PRO n 
3 50  GLY n 
3 51  LEU n 
3 52  TYR n 
3 53  TYR n 
3 54  PHE n 
3 55  VAL n 
3 56  TYR n 
3 57  HIS n 
3 58  ALA n 
3 59  SER n 
3 60  HIS n 
3 61  THR n 
3 62  ALA n 
3 63  ASN n 
3 64  LEU n 
3 65  CYS n 
3 66  VAL n 
3 67  LEU n 
3 68  LEU n 
3 69  TYR n 
3 70  ARG n 
3 71  SER n 
3 72  GLY n 
3 73  VAL n 
3 74  LYS n 
3 75  VAL n 
3 76  VAL n 
3 77  THR n 
3 78  PHE n 
3 79  CYS n 
3 80  GLY n 
3 81  HIS n 
3 82  THR n 
3 83  SER n 
3 84  LYS n 
3 85  THR n 
3 86  ASN n 
3 87  GLN n 
3 88  VAL n 
3 89  ASN n 
3 90  SER n 
3 91  GLY n 
3 92  GLY n 
3 93  VAL n 
3 94  LEU n 
3 95  LEU n 
3 96  ARG n 
3 97  LEU n 
3 98  GLN n 
3 99  VAL n 
3 100 GLY n 
3 101 GLU n 
3 102 GLU n 
3 103 VAL n 
3 104 TRP n 
3 105 LEU n 
3 106 ALA n 
3 107 VAL n 
3 108 ASN n 
3 109 ASP n 
3 110 TYR n 
3 111 TYR n 
3 112 ASP n 
3 113 MET n 
3 114 VAL n 
3 115 GLY n 
3 116 ILE n 
3 117 GLN n 
3 118 GLY n 
3 119 SER n 
3 120 ASP n 
3 121 SER n 
3 122 VAL n 
3 123 PHE n 
3 124 SER n 
3 125 GLY n 
3 126 PHE n 
3 127 LEU n 
3 128 LEU n 
3 129 PHE n 
3 130 PRO n 
3 131 ASP n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 134 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 1 136 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 1 131 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP C1QA_HUMAN P02745 ? 1 
;QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCD
TTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
;
112 
2 UNP C1QB_HUMAN P02746 ? 2 
;ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTF
CDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
;
118 
3 UNP C1QC_HUMAN P02747 ? 3 
;KQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCG
HTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
;
115 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JG8 A 1 ? 134 ? P02745 112 ? 245 ? 90 223 
2 2 2JG8 B 1 ? 136 ? P02746 118 ? 253 ? 91 226 
3 3 2JG8 C 1 ? 131 ? P02747 115 ? 245 ? 87 217 
4 1 2JG8 D 1 ? 134 ? P02745 112 ? 245 ? 90 223 
5 2 2JG8 E 1 ? 136 ? P02746 118 ? 253 ? 91 226 
6 3 2JG8 F 1 ? 131 ? P02747 115 ? 245 ? 87 217 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ?               'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                            ?               'Ca 2'           40.078  
CYS 'L-peptide linking'          y CYSTEINE                                 ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ?               'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ?               'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?               'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking'          n PHOSPHOSERINE                            PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking'          y SERINE                                   ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JG8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_percent_sol   54.78 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JG8 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.95 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   38993 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.7 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.50 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.92 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JG8 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     37012 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.94 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.184 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1948 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.888 
_refine.B_iso_mean                               16.43 
_refine.aniso_B[1][1]                            -0.55000 
_refine.aniso_B[2][2]                            -0.95000 
_refine.aniso_B[3][3]                            1.47000 
_refine.aniso_B[1][2]                            -0.06000 
_refine.aniso_B[1][3]                            0.21000 
_refine.aniso_B[2][3]                            -0.10000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1PK6' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.294 
_refine.pdbx_overall_ESU_R_Free                  0.211 
_refine.overall_SU_ML                            0.137 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.894 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6239 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             302 
_refine_hist.number_atoms_total               6568 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        19.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 6403 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.028  1.942  ? 8703 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.184  5.000  ? 781  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.445 23.973 ? 297  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.649 15.015 ? 990  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.364 15.000 ? 32   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.069  0.200  ? 961  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 4954 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.231  0.300  ? 2951 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.324  0.500  ? 4296 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.230  0.500  ? 739  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.269  0.300  ? 63   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.226  0.500  ? 22   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.812  2.000  ? 4036 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.286  3.000  ? 6404 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.176  3.000  ? 2652 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.553  4.000  ? 2299 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   15 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.12 
_refine_ls_shell.number_reflns_R_work             2349 
_refine_ls_shell.R_factor_R_work                  0.1840 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2770 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             123 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2JG8 
_struct.title                     'Crystallographic structure of human C1q globular heads complexed to phosphatidyl-serine' 
_struct.pdbx_descriptor           
'COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A, COMPLEMENT C1Q SUBCOMPONENT SUBUNIT B, COMPLEMENT C1Q SUBCOMPONENT SUBUNIT C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JG8 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;POLYMORPHISM, GLYCOPROTEIN, PHAGOCYTOSIS, DISEASE MUTATION, COMPLEMENT PATHWAY, IMMUNE SYSTEM, CELL SURFACE MOLECULE, PYRROLIDONE CARBOXYLIC ACID, HYDROXYLATION, INNATE IMMUNITY, IMMUNE RESPONSE, COLLAGEN, TOLERANCE, APOPOTOSIS, COMPLEMENT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 5 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
O N N 7 ? 
P N N 7 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LYS 
_struct_conf.beg_label_asym_id       C 
_struct_conf.beg_label_seq_id        1 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLN 
_struct_conf.end_label_asym_id       C 
_struct_conf.end_label_seq_id        5 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LYS 
_struct_conf.beg_auth_asym_id        C 
_struct_conf.beg_auth_seq_id         87 
_struct_conf.end_auth_comp_id        GLN 
_struct_conf.end_auth_asym_id        C 
_struct_conf.end_auth_seq_id         91 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 61 SG  ? ? ? 1_555 A CYS 79 SG ? ? A CYS 150  A CYS 168  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf2  disulf ? ? B CYS 64 SG  ? ? ? 1_555 B CYS 81 SG ? ? B CYS 154  B CYS 171  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf3  disulf ? ? C CYS 65 SG  ? ? ? 1_555 C CYS 79 SG ? ? C CYS 151  C CYS 165  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf4  disulf ? ? D CYS 61 SG  ? ? ? 1_555 D CYS 79 SG ? ? D CYS 150  D CYS 168  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf5  disulf ? ? E CYS 64 SG  ? ? ? 1_555 E CYS 81 SG ? ? E CYS 154  E CYS 171  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf6  disulf ? ? F CYS 65 SG  ? ? ? 1_555 F CYS 79 SG ? ? F CYS 151  F CYS 165  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
metalc1  metalc ? ? A GLN 88 OE1 ? ? ? 1_555 H CA  .  CA ? ? A GLN 177  B CA  1224 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc2  metalc ? ? B ASP 82 OD2 ? ? ? 1_555 H CA  .  CA ? ? B ASP 172  B CA  1224 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc3  metalc ? ? B TYR 83 O   ? ? ? 1_555 H CA  .  CA ? ? B TYR 173  B CA  1224 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc4  metalc ? ? B GLN 89 OE1 ? ? ? 1_555 H CA  .  CA ? ? B GLN 179  B CA  1224 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
metalc5  metalc ? ? H CA  .  CA  ? ? ? 1_555 M HOH .  O  ? ? B CA  1224 C HOH 2044 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc6  metalc ? ? D GLN 88 OE1 ? ? ? 1_555 J CA  .  CA ? ? D GLN 177  E CA  1224 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc7  metalc ? ? E ASP 82 OD2 ? ? ? 1_555 J CA  .  CA ? ? E ASP 172  E CA  1224 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc8  metalc ? ? E TYR 83 O   ? ? ? 1_555 J CA  .  CA ? ? E TYR 173  E CA  1224 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc9  metalc ? ? E GLN 89 OE1 ? ? ? 1_555 J CA  .  CA ? ? E GLN 179  E CA  1224 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc10 metalc ? ? J CA  .  CA  ? ? ? 1_555 P HOH .  O  ? ? E CA  1224 F HOH 2044 1_555 ? ? ? ? ? ? ? 2.681 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 5 ? 
AC ? 5 ? 
BA ? 5 ? 
BB ? 4 ? 
CA ? 5 ? 
CB ? 5 ? 
DA ? 5 ? 
DB ? 4 ? 
DC ? 4 ? 
EA ? 5 ? 
EB ? 4 ? 
FA ? 5 ? 
FB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DC 3 4 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EA 4 5 ? anti-parallel 
EB 1 2 ? anti-parallel 
EB 2 3 ? anti-parallel 
EB 3 4 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
FA 4 5 ? anti-parallel 
FB 1 2 ? anti-parallel 
FB 2 3 ? anti-parallel 
FB 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 24  ? GLN A 29  ? THR A 113 GLN A 118 
AA 2 ALA A 5   ? ILE A 9   ? ALA A 94  ILE A 98  
AA 3 VAL A 124 ? PRO A 132 ? VAL A 213 PRO A 221 
AA 4 GLY A 46  ? SER A 56  ? GLY A 135 SER A 145 
AA 5 GLN A 88  ? LEU A 98  ? GLN A 177 LEU A 187 
AB 1 TYR A 33  ? GLN A 34  ? TYR A 122 GLN A 123 
AB 2 ARG A 39  ? VAL A 41  ? ARG A 128 VAL A 130 
AB 3 GLN A 103 ? GLY A 113 ? GLN A 192 GLY A 202 
AB 4 ILE A 60  ? SER A 68  ? ILE A 149 SER A 157 
AB 5 GLY A 77  ? ASP A 80  ? GLY A 166 ASP A 169 
AC 1 TYR A 33  ? GLN A 34  ? TYR A 122 GLN A 123 
AC 2 ARG A 39  ? VAL A 41  ? ARG A 128 VAL A 130 
AC 3 GLN A 103 ? GLY A 113 ? GLN A 192 GLY A 202 
AC 4 ILE A 60  ? SER A 68  ? ILE A 149 SER A 157 
AC 5 GLN A 71  ? ARG A 73  ? GLN A 160 ARG A 162 
BA 1 HIS B 27  ? MET B 32  ? HIS B 117 MET B 122 
BA 2 ALA B 6   ? THR B 10  ? ALA B 96  THR B 100 
BA 3 ILE B 124 ? PRO B 132 ? ILE B 214 PRO B 222 
BA 4 GLY B 49  ? SER B 59  ? GLY B 139 SER B 149 
BA 5 GLN B 89  ? LEU B 99  ? GLN B 179 LEU B 189 
BB 1 PHE B 43  ? THR B 44  ? PHE B 133 THR B 134 
BB 2 ASN B 104 ? ASN B 113 ? ASN B 194 ASN B 203 
BB 3 LEU B 63  ? GLY B 70  ? LEU B 153 GLY B 160 
BB 4 ALA B 74  ? ASP B 82  ? ALA B 164 ASP B 172 
CA 1 ALA C 28  ? THR C 31  ? ALA C 114 THR C 117 
CA 2 VAL C 7   ? THR C 11  ? VAL C 93  THR C 97  
CA 3 VAL C 122 ? PRO C 130 ? VAL C 208 PRO C 216 
CA 4 GLY C 50  ? HIS C 60  ? GLY C 136 HIS C 146 
CA 5 GLN C 87  ? LEU C 97  ? GLN C 173 LEU C 183 
CB 1 TYR C 37  ? ASP C 38  ? TYR C 123 ASP C 124 
CB 2 LYS C 43  ? THR C 45  ? LYS C 129 THR C 131 
CB 3 GLU C 102 ? TYR C 111 ? GLU C 188 TYR C 197 
CB 4 LEU C 64  ? ARG C 70  ? LEU C 150 ARG C 156 
CB 5 VAL C 73  ? GLY C 80  ? VAL C 159 GLY C 166 
DA 1 THR D 24  ? GLN D 29  ? THR D 113 GLN D 118 
DA 2 ALA D 5   ? ILE D 9   ? ALA D 94  ILE D 98  
DA 3 VAL D 124 ? PRO D 132 ? VAL D 213 PRO D 221 
DA 4 GLY D 46  ? SER D 56  ? GLY D 135 SER D 145 
DA 5 GLN D 88  ? LEU D 98  ? GLN D 177 LEU D 187 
DB 1 ARG D 39  ? VAL D 41  ? ARG D 128 VAL D 130 
DB 2 GLN D 103 ? GLY D 113 ? GLN D 192 GLY D 202 
DB 3 ILE D 60  ? SER D 68  ? ILE D 149 SER D 157 
DB 4 GLY D 77  ? ASP D 80  ? GLY D 166 ASP D 169 
DC 1 ARG D 39  ? VAL D 41  ? ARG D 128 VAL D 130 
DC 2 GLN D 103 ? GLY D 113 ? GLN D 192 GLY D 202 
DC 3 ILE D 60  ? SER D 68  ? ILE D 149 SER D 157 
DC 4 GLN D 71  ? ARG D 73  ? GLN D 160 ARG D 162 
EA 1 HIS E 27  ? MET E 32  ? HIS E 117 MET E 122 
EA 2 ALA E 6   ? THR E 10  ? ALA E 96  THR E 100 
EA 3 ILE E 124 ? PRO E 132 ? ILE E 214 PRO E 222 
EA 4 GLY E 49  ? SER E 59  ? GLY E 139 SER E 149 
EA 5 GLN E 89  ? LEU E 99  ? GLN E 179 LEU E 189 
EB 1 PHE E 43  ? THR E 44  ? PHE E 133 THR E 134 
EB 2 ASN E 104 ? GLN E 108 ? ASN E 194 GLN E 198 
EB 3 LEU E 63  ? GLY E 70  ? LEU E 153 GLY E 160 
EB 4 GLN E 75  ? ASP E 82  ? GLN E 165 ASP E 172 
FA 1 ALA F 28  ? THR F 31  ? ALA F 114 THR F 117 
FA 2 VAL F 7   ? THR F 11  ? VAL F 93  THR F 97  
FA 3 SER F 121 ? PRO F 130 ? SER F 207 PRO F 216 
FA 4 GLY F 50  ? HIS F 60  ? GLY F 136 HIS F 146 
FA 5 GLN F 87  ? LEU F 97  ? GLN F 173 LEU F 183 
FB 1 PHE F 44  ? THR F 45  ? PHE F 130 THR F 131 
FB 2 GLU F 102 ? TYR F 111 ? GLU F 188 TYR F 197 
FB 3 LEU F 64  ? ARG F 70  ? LEU F 150 ARG F 156 
FB 4 VAL F 73  ? GLY F 80  ? VAL F 159 GLY F 166 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLN A 29  ? N GLN A 118 O ALA A 5   ? O ALA A 94  
AA 2 3 N ALA A 8   ? N ALA A 97  O PHE A 125 ? O PHE A 214 
AA 3 4 N ILE A 130 ? N ILE A 219 O TYR A 47  ? O TYR A 136 
AA 4 5 N SER A 56  ? N SER A 145 O GLN A 88  ? O GLN A 177 
AB 1 2 N GLN A 34  ? N GLN A 123 O ARG A 39  ? O ARG A 128 
AB 2 3 N PHE A 40  ? N PHE A 129 O VAL A 104 ? O VAL A 193 
AB 3 4 N ASP A 109 ? N ASP A 198 O CYS A 61  ? O CYS A 150 
AB 4 5 N LEU A 62  ? N LEU A 151 O PHE A 78  ? O PHE A 167 
AC 1 2 N GLN A 34  ? N GLN A 123 O ARG A 39  ? O ARG A 128 
AC 2 3 N PHE A 40  ? N PHE A 129 O VAL A 104 ? O VAL A 193 
AC 3 4 N ASP A 109 ? N ASP A 198 O CYS A 61  ? O CYS A 150 
AC 4 5 N SER A 68  ? N SER A 157 O GLN A 71  ? O GLN A 160 
BA 1 2 N MET B 32  ? N MET B 122 O ALA B 6   ? O ALA B 96  
BA 2 3 N ALA B 9   ? N ALA B 99  O PHE B 125 ? O PHE B 215 
BA 3 4 N LEU B 130 ? N LEU B 220 O LEU B 50  ? O LEU B 140 
BA 4 5 N SER B 59  ? N SER B 149 O GLN B 89  ? O GLN B 179 
BB 1 2 N PHE B 43  ? N PHE B 133 O VAL B 105 ? O VAL B 195 
BB 2 3 N THR B 110 ? N THR B 200 O CYS B 64  ? O CYS B 154 
BB 3 4 N ARG B 69  ? N ARG B 159 O GLN B 75  ? O GLN B 165 
CA 1 2 N LEU C 30  ? N LEU C 116 O THR C 9   ? O THR C 95  
CA 2 3 N VAL C 10  ? N VAL C 96  O PHE C 123 ? O PHE C 209 
CA 3 4 N LEU C 128 ? N LEU C 214 O LEU C 51  ? O LEU C 137 
CA 4 5 N HIS C 60  ? N HIS C 146 O GLN C 87  ? O GLN C 173 
CB 1 2 N ASP C 38  ? N ASP C 124 O LYS C 43  ? O LYS C 129 
CB 2 3 N PHE C 44  ? N PHE C 130 O VAL C 103 ? O VAL C 189 
CB 3 4 N ASN C 108 ? N ASN C 194 O CYS C 65  ? O CYS C 151 
CB 4 5 N ARG C 70  ? N ARG C 156 O VAL C 73  ? O VAL C 159 
DA 1 2 N GLN D 29  ? N GLN D 118 O ALA D 5   ? O ALA D 94  
DA 2 3 N ALA D 8   ? N ALA D 97  O PHE D 125 ? O PHE D 214 
DA 3 4 N ILE D 130 ? N ILE D 219 O TYR D 47  ? O TYR D 136 
DA 4 5 N SER D 56  ? N SER D 145 O GLN D 88  ? O GLN D 177 
DB 1 2 N PHE D 40  ? N PHE D 129 O VAL D 104 ? O VAL D 193 
DB 2 3 N ASP D 109 ? N ASP D 198 O CYS D 61  ? O CYS D 150 
DB 3 4 N LEU D 62  ? N LEU D 151 O PHE D 78  ? O PHE D 167 
DC 1 2 N PHE D 40  ? N PHE D 129 O VAL D 104 ? O VAL D 193 
DC 2 3 N ASP D 109 ? N ASP D 198 O CYS D 61  ? O CYS D 150 
DC 3 4 N SER D 68  ? N SER D 157 O GLN D 71  ? O GLN D 160 
EA 1 2 N MET E 32  ? N MET E 122 O ALA E 6   ? O ALA E 96  
EA 2 3 N ALA E 9   ? N ALA E 99  O PHE E 125 ? O PHE E 215 
EA 3 4 N LEU E 130 ? N LEU E 220 O LEU E 50  ? O LEU E 140 
EA 4 5 N SER E 59  ? N SER E 149 O GLN E 89  ? O GLN E 179 
EB 1 2 N PHE E 43  ? N PHE E 133 O VAL E 105 ? O VAL E 195 
EB 2 3 N GLN E 108 ? N GLN E 198 O ASN E 66  ? O ASN E 156 
EB 3 4 N ARG E 69  ? N ARG E 159 O GLN E 75  ? O GLN E 165 
FA 1 2 N LEU F 30  ? N LEU F 116 O THR F 9   ? O THR F 95  
FA 2 3 N VAL F 10  ? N VAL F 96  O PHE F 123 ? O PHE F 209 
FA 3 4 N LEU F 128 ? N LEU F 214 O LEU F 51  ? O LEU F 137 
FA 4 5 N HIS F 60  ? N HIS F 146 O GLN F 87  ? O GLN F 173 
FB 1 2 N PHE F 44  ? N PHE F 130 O VAL F 103 ? O VAL F 189 
FB 2 3 N ASN F 108 ? N ASN F 194 O CYS F 65  ? O CYS F 151 
FB 3 4 N ARG F 70  ? N ARG F 156 O VAL F 73  ? O VAL F 159 
# 
_database_PDB_matrix.entry_id          2JG8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JG8 
_atom_sites.fract_transf_matrix[1][1]   0.020794 
_atom_sites.fract_transf_matrix[1][2]   0.009119 
_atom_sites.fract_transf_matrix[1][3]   0.001682 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022716 
_atom_sites.fract_transf_matrix[2][3]   0.001164 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011842 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 1   ? 14.967  7.626   -27.037 1.00   49.97  ? 90   GLN A N   1 
ATOM   2    C  CA  . GLN A 1 1   ? 13.828  7.786   -26.090 1.00   50.03  ? 90   GLN A CA  1 
ATOM   3    C  C   . GLN A 1 1   ? 13.110  6.457   -25.845 1.00   50.00  ? 90   GLN A C   1 
ATOM   4    O  O   . GLN A 1 1   ? 12.748  5.759   -26.795 1.00   49.86  ? 90   GLN A O   1 
ATOM   5    C  CB  . GLN A 1 1   ? 12.840  8.830   -26.618 1.00   50.16  ? 90   GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 1   ? 10.849  8.863   -26.992 0.0000 20.00  ? 90   GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 1   ? 9.779   9.882   -26.654 0.0000 20.00  ? 90   GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 1   ? 10.057  11.074  -26.538 0.0000 20.00  ? 90   GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 1   ? 8.547   9.412   -26.496 0.0000 20.00  ? 90   GLN A NE2 1 
ATOM   10   N  N   . PRO A 1 2   ? 12.914  6.101   -24.563 1.00   50.00  ? 91   PRO A N   1 
ATOM   11   C  CA  . PRO A 1 2   ? 12.185  4.895   -24.156 1.00   49.84  ? 91   PRO A CA  1 
ATOM   12   C  C   . PRO A 1 2   ? 10.852  4.736   -24.892 1.00   49.73  ? 91   PRO A C   1 
ATOM   13   O  O   . PRO A 1 2   ? 9.940   5.551   -24.722 1.00   49.73  ? 91   PRO A O   1 
ATOM   14   C  CB  . PRO A 1 2   ? 11.949  5.101   -22.649 1.00   49.93  ? 91   PRO A CB  1 
ATOM   15   C  CG  . PRO A 1 2   ? 12.481  6.476   -22.316 1.00   49.77  ? 91   PRO A CG  1 
ATOM   16   C  CD  . PRO A 1 2   ? 13.424  6.857   -23.406 1.00   50.00  ? 91   PRO A CD  1 
ATOM   17   N  N   . ARG A 1 3   ? 10.751  3.695   -25.711 1.00   49.48  ? 92   ARG A N   1 
ATOM   18   C  CA  . ARG A 1 3   ? 9.002   3.051   -26.362 0.0000 27.43  ? 92   ARG A CA  1 
ATOM   19   C  C   . ARG A 1 3   ? 8.238   1.729   -25.914 1.00   16.48  ? 92   ARG A C   1 
ATOM   20   O  O   . ARG A 1 3   ? 8.018   1.218   -27.020 1.00   17.73  ? 92   ARG A O   1 
ATOM   21   C  CB  . ARG A 1 3   ? 9.022   3.420   -27.852 0.0000 27.14  ? 92   ARG A CB  1 
ATOM   22   C  CG  . ARG A 1 3   ? 8.645   4.863   -28.472 0.0000 20.00  ? 92   ARG A CG  1 
ATOM   23   C  CD  . ARG A 1 3   ? 8.519   5.116   -29.965 0.0000 20.00  ? 92   ARG A CD  1 
ATOM   24   N  NE  . ARG A 1 3   ? 9.603   4.491   -30.717 0.0000 20.00  ? 92   ARG A NE  1 
ATOM   25   C  CZ  . ARG A 1 3   ? 9.680   4.477   -32.044 0.0000 20.00  ? 92   ARG A CZ  1 
ATOM   26   N  NH1 . ARG A 1 3   ? 8.732   5.054   -32.770 0.0000 20.00  ? 92   ARG A NH1 1 
ATOM   27   N  NH2 . ARG A 1 3   ? 10.705  3.884   -32.643 0.0000 20.00  ? 92   ARG A NH2 1 
ATOM   28   N  N   . PRO A 1 4   ? 8.610   1.009   -24.851 1.00   15.41  ? 93   PRO A N   1 
ATOM   29   C  CA  . PRO A 1 4   ? 8.326   -0.423  -24.807 1.00   15.33  ? 93   PRO A CA  1 
ATOM   30   C  C   . PRO A 1 4   ? 6.823   -0.667  -24.762 1.00   15.27  ? 93   PRO A C   1 
ATOM   31   O  O   . PRO A 1 4   ? 6.136   -0.130  -23.899 1.00   15.43  ? 93   PRO A O   1 
ATOM   32   C  CB  . PRO A 1 4   ? 9.005   -0.880  -23.509 1.00   15.47  ? 93   PRO A CB  1 
ATOM   33   C  CG  . PRO A 1 4   ? 9.969   0.241   -23.161 1.00   14.44  ? 93   PRO A CG  1 
ATOM   34   C  CD  . PRO A 1 4   ? 9.308   1.476   -23.644 1.00   15.25  ? 93   PRO A CD  1 
ATOM   35   N  N   . ALA A 1 5   ? 6.323   -1.465  -25.700 1.00   15.37  ? 94   ALA A N   1 
ATOM   36   C  CA  . ALA A 1 5   ? 4.890   -1.717  -25.832 1.00   15.44  ? 94   ALA A CA  1 
ATOM   37   C  C   . ALA A 1 5   ? 4.640   -3.018  -26.596 1.00   15.59  ? 94   ALA A C   1 
ATOM   38   O  O   . ALA A 1 5   ? 5.229   -3.253  -27.659 1.00   15.65  ? 94   ALA A O   1 
ATOM   39   C  CB  . ALA A 1 5   ? 4.213   -0.552  -26.556 1.00   15.81  ? 94   ALA A CB  1 
ATOM   40   N  N   . PHE A 1 6   ? 3.753   -3.856  -26.073 1.00   14.52  ? 95   PHE A N   1 
ATOM   41   C  CA  . PHE A 1 6   ? 3.439   -5.109  -26.755 1.00   13.37  ? 95   PHE A CA  1 
ATOM   42   C  C   . PHE A 1 6   ? 1.971   -5.475  -26.637 1.00   12.62  ? 95   PHE A C   1 
ATOM   43   O  O   . PHE A 1 6   ? 1.274   -5.037  -25.706 1.00   11.07  ? 95   PHE A O   1 
ATOM   44   C  CB  . PHE A 1 6   ? 4.287   -6.254  -26.202 1.00   12.75  ? 95   PHE A CB  1 
ATOM   45   C  CG  . PHE A 1 6   ? 3.736   -6.860  -24.950 1.00   12.63  ? 95   PHE A CG  1 
ATOM   46   C  CD1 . PHE A 1 6   ? 2.987   -8.026  -25.002 1.00   10.79  ? 95   PHE A CD1 1 
ATOM   47   C  CD2 . PHE A 1 6   ? 3.964   -6.262  -23.714 1.00   12.69  ? 95   PHE A CD2 1 
ATOM   48   C  CE1 . PHE A 1 6   ? 2.471   -8.583  -23.854 1.00   12.46  ? 95   PHE A CE1 1 
ATOM   49   C  CE2 . PHE A 1 6   ? 3.452   -6.818  -22.547 1.00   12.59  ? 95   PHE A CE2 1 
ATOM   50   C  CZ  . PHE A 1 6   ? 2.702   -7.981  -22.617 1.00   12.78  ? 95   PHE A CZ  1 
ATOM   51   N  N   . SER A 1 7   ? 1.522   -6.271  -27.605 1.00   11.57  ? 96   SER A N   1 
ATOM   52   C  CA  . SER A 1 7   ? 0.279   -7.009  -27.529 1.00   10.93  ? 96   SER A CA  1 
ATOM   53   C  C   . SER A 1 7   ? 0.535   -8.394  -28.111 1.00   11.78  ? 96   SER A C   1 
ATOM   54   O  O   . SER A 1 7   ? 1.185   -8.538  -29.163 1.00   11.63  ? 96   SER A O   1 
ATOM   55   C  CB  . SER A 1 7   ? -0.833  -6.321  -28.330 1.00   11.66  ? 96   SER A CB  1 
ATOM   56   O  OG  . SER A 1 7   ? -1.555  -5.365  -27.568 1.00   9.64   ? 96   SER A OG  1 
ATOM   57   N  N   . ALA A 1 8   ? 0.023   -9.423  -27.444 1.00   11.63  ? 97   ALA A N   1 
ATOM   58   C  CA  . ALA A 1 8   ? 0.171   -10.775 -27.964 1.00   12.04  ? 97   ALA A CA  1 
ATOM   59   C  C   . ALA A 1 8   ? -1.106  -11.563 -27.774 1.00   13.06  ? 97   ALA A C   1 
ATOM   60   O  O   . ALA A 1 8   ? -1.828  -11.383 -26.777 1.00   12.29  ? 97   ALA A O   1 
ATOM   61   C  CB  . ALA A 1 8   ? 1.349   -11.488 -27.305 1.00   11.10  ? 97   ALA A CB  1 
ATOM   62   N  N   . ILE A 1 9   ? -1.382  -12.441 -28.736 1.00   13.47  ? 98   ILE A N   1 
ATOM   63   C  CA  . ILE A 1 9   ? -2.578  -13.256 -28.685 1.00   14.23  ? 98   ILE A CA  1 
ATOM   64   C  C   . ILE A 1 9   ? -2.236  -14.739 -28.716 1.00   15.40  ? 98   ILE A C   1 
ATOM   65   O  O   . ILE A 1 9   ? -1.076  -15.117 -28.929 1.00   14.73  ? 98   ILE A O   1 
ATOM   66   C  CB  . ILE A 1 9   ? -3.555  -12.881 -29.828 1.00   15.07  ? 98   ILE A CB  1 
ATOM   67   C  CG1 . ILE A 1 9   ? -2.963  -13.244 -31.198 1.00   14.18  ? 98   ILE A CG1 1 
ATOM   68   C  CG2 . ILE A 1 9   ? -3.897  -11.386 -29.750 1.00   14.76  ? 98   ILE A CG2 1 
ATOM   69   C  CD1 . ILE A 1 9   ? -3.902  -12.987 -32.372 1.00   15.25  ? 98   ILE A CD1 1 
ATOM   70   N  N   . ARG A 1 10  ? -3.253  -15.571 -28.501 1.00   17.24  ? 99   ARG A N   1 
ATOM   71   C  CA  . ARG A 1 10  ? -3.107  -17.024 -28.520 1.00   19.47  ? 99   ARG A CA  1 
ATOM   72   C  C   . ARG A 1 10  ? -3.613  -17.624 -29.826 1.00   21.48  ? 99   ARG A C   1 
ATOM   73   O  O   . ARG A 1 10  ? -4.662  -17.230 -30.324 1.00   22.10  ? 99   ARG A O   1 
ATOM   74   C  CB  . ARG A 1 10  ? -3.917  -17.637 -27.382 1.00   19.51  ? 99   ARG A CB  1 
ATOM   75   C  CG  . ARG A 1 10  ? -3.195  -17.726 -26.062 1.00   20.70  ? 99   ARG A CG  1 
ATOM   76   C  CD  . ARG A 1 10  ? -3.780  -18.860 -25.243 1.00   21.51  ? 99   ARG A CD  1 
ATOM   77   N  NE  . ARG A 1 10  ? -2.772  -19.379 -24.334 1.00   23.83  ? 99   ARG A NE  1 
ATOM   78   C  CZ  . ARG A 1 10  ? -2.730  -20.625 -23.888 1.00   22.91  ? 99   ARG A CZ  1 
ATOM   79   N  NH1 . ARG A 1 10  ? -3.650  -21.502 -24.263 1.00   22.85  ? 99   ARG A NH1 1 
ATOM   80   N  NH2 . ARG A 1 10  ? -1.764  -20.983 -23.060 1.00   22.98  ? 99   ARG A NH2 1 
ATOM   81   N  N   . ARG A 1 11  ? -2.881  -18.590 -30.374 1.00   23.80  ? 100  ARG A N   1 
ATOM   82   C  CA  . ARG A 1 11  ? -3.381  -19.354 -31.520 1.00   26.11  ? 100  ARG A CA  1 
ATOM   83   C  C   . ARG A 1 11  ? -2.735  -20.730 -31.640 1.00   26.80  ? 100  ARG A C   1 
ATOM   84   O  O   . ARG A 1 11  ? -3.422  -21.724 -31.854 1.00   27.79  ? 100  ARG A O   1 
ATOM   85   C  CB  . ARG A 1 11  ? -3.304  -18.556 -32.829 1.00   26.77  ? 100  ARG A CB  1 
ATOM   86   C  CG  . ARG A 1 11  ? -4.636  -17.880 -33.151 1.00   29.25  ? 100  ARG A CG  1 
ATOM   87   C  CD  . ARG A 1 11  ? -4.530  -16.758 -34.158 1.00   31.21  ? 100  ARG A CD  1 
ATOM   88   N  NE  . ARG A 1 11  ? -5.638  -15.814 -34.003 1.00   32.42  ? 100  ARG A NE  1 
ATOM   89   C  CZ  . ARG A 1 11  ? -5.924  -14.852 -34.874 1.00   33.17  ? 100  ARG A CZ  1 
ATOM   90   N  NH1 . ARG A 1 11  ? -5.193  -14.713 -35.976 1.00   33.15  ? 100  ARG A NH1 1 
ATOM   91   N  NH2 . ARG A 1 11  ? -6.944  -14.033 -34.649 1.00   32.78  ? 100  ARG A NH2 1 
ATOM   92   N  N   A ASN A 1 12  ? -1.413  -20.782 -31.513 0.50   27.30  ? 101  ASN A N   1 
ATOM   93   N  N   B ASN A 1 12  ? -1.417  -20.776 -31.490 0.50   27.11  ? 101  ASN A N   1 
ATOM   94   C  CA  A ASN A 1 12  ? -0.699  -22.051 -31.447 0.50   27.73  ? 101  ASN A CA  1 
ATOM   95   C  CA  B ASN A 1 12  ? -0.695  -22.036 -31.458 0.50   27.38  ? 101  ASN A CA  1 
ATOM   96   C  C   A ASN A 1 12  ? 0.198   -22.078 -30.214 0.50   28.00  ? 101  ASN A C   1 
ATOM   97   C  C   B ASN A 1 12  ? 0.195   -22.103 -30.218 0.50   27.80  ? 101  ASN A C   1 
ATOM   98   O  O   A ASN A 1 12  ? 1.418   -22.185 -30.330 0.50   28.25  ? 101  ASN A O   1 
ATOM   99   O  O   B ASN A 1 12  ? 1.408   -22.275 -30.333 0.50   28.06  ? 101  ASN A O   1 
ATOM   100  C  CB  A ASN A 1 12  ? 0.130   -22.280 -32.717 0.50   28.05  ? 101  ASN A CB  1 
ATOM   101  C  CB  B ASN A 1 12  ? 0.145   -22.199 -32.730 0.50   27.37  ? 101  ASN A CB  1 
ATOM   102  C  CG  A ASN A 1 12  ? 0.868   -23.613 -32.706 0.50   28.58  ? 101  ASN A CG  1 
ATOM   103  C  CG  B ASN A 1 12  ? -0.699  -22.205 -33.996 0.50   27.38  ? 101  ASN A CG  1 
ATOM   104  O  OD1 A ASN A 1 12  ? 0.397   -24.596 -32.131 0.50   28.44  ? 101  ASN A OD1 1 
ATOM   105  O  OD1 B ASN A 1 12  ? -1.834  -22.686 -34.002 0.50   27.34  ? 101  ASN A OD1 1 
ATOM   106  N  ND2 A ASN A 1 12  ? 2.034   -23.648 -33.344 0.50   29.14  ? 101  ASN A ND2 1 
ATOM   107  N  ND2 B ASN A 1 12  ? -0.143  -21.673 -35.079 0.50   27.01  ? 101  ASN A ND2 1 
ATOM   108  N  N   . PRO A 1 13  ? -0.406  -21.972 -29.021 1.00   28.18  ? 102  PRO A N   1 
ATOM   109  C  CA  . PRO A 1 13  ? 0.406   -21.849 -27.821 1.00   28.64  ? 102  PRO A CA  1 
ATOM   110  C  C   . PRO A 1 13  ? 0.998   -23.167 -27.373 1.00   29.18  ? 102  PRO A C   1 
ATOM   111  O  O   . PRO A 1 13  ? 0.315   -24.188 -27.392 1.00   28.77  ? 102  PRO A O   1 
ATOM   112  C  CB  . PRO A 1 13  ? -0.581  -21.322 -26.775 1.00   28.80  ? 102  PRO A CB  1 
ATOM   113  C  CG  . PRO A 1 13  ? -1.915  -21.822 -27.221 1.00   28.94  ? 102  PRO A CG  1 
ATOM   114  C  CD  . PRO A 1 13  ? -1.853  -21.961 -28.728 1.00   28.16  ? 102  PRO A CD  1 
ATOM   115  N  N   . PRO A 1 14  ? 2.283   -23.150 -26.993 1.00   30.29  ? 103  PRO A N   1 
ATOM   116  C  CA  . PRO A 1 14  ? 2.855   -24.281 -26.278 1.00   30.93  ? 103  PRO A CA  1 
ATOM   117  C  C   . PRO A 1 14  ? 2.169   -24.395 -24.926 1.00   31.41  ? 103  PRO A C   1 
ATOM   118  O  O   . PRO A 1 14  ? 2.116   -23.426 -24.168 1.00   31.76  ? 103  PRO A O   1 
ATOM   119  C  CB  . PRO A 1 14  ? 4.326   -23.894 -26.107 1.00   30.76  ? 103  PRO A CB  1 
ATOM   120  C  CG  . PRO A 1 14  ? 4.376   -22.425 -26.302 1.00   30.95  ? 103  PRO A CG  1 
ATOM   121  C  CD  . PRO A 1 14  ? 3.265   -22.082 -27.236 1.00   30.35  ? 103  PRO A CD  1 
ATOM   122  N  N   A MET A 1 15  ? 1.632   -25.577 -24.636 0.50   31.77  ? 104  MET A N   1 
ATOM   123  N  N   B MET A 1 15  ? 1.618   -25.563 -24.632 0.50   31.51  ? 104  MET A N   1 
ATOM   124  C  CA  A MET A 1 15  ? 0.938   -25.818 -23.377 0.50   31.92  ? 104  MET A CA  1 
ATOM   125  C  CA  B MET A 1 15  ? 0.956   -25.751 -23.359 0.50   31.44  ? 104  MET A CA  1 
ATOM   126  C  C   A MET A 1 15  ? 1.796   -26.599 -22.391 0.50   31.58  ? 104  MET A C   1 
ATOM   127  C  C   B MET A 1 15  ? 2.006   -25.956 -22.283 0.50   31.35  ? 104  MET A C   1 
ATOM   128  O  O   A MET A 1 15  ? 2.644   -27.398 -22.785 0.50   31.68  ? 104  MET A O   1 
ATOM   129  O  O   B MET A 1 15  ? 3.196   -25.732 -22.508 0.50   31.58  ? 104  MET A O   1 
ATOM   130  C  CB  A MET A 1 15  ? -0.404  -26.514 -23.610 0.50   32.27  ? 104  MET A CB  1 
ATOM   131  C  CB  B MET A 1 15  ? 0.008   -26.950 -23.408 0.50   31.39  ? 104  MET A CB  1 
ATOM   132  C  CG  A MET A 1 15  ? -1.586  -25.561 -23.608 0.50   32.86  ? 104  MET A CG  1 
ATOM   133  C  CG  B MET A 1 15  ? 0.699   -28.298 -23.335 0.50   30.82  ? 104  MET A CG  1 
ATOM   134  S  SD  A MET A 1 15  ? -1.909  -24.885 -21.966 0.50   33.98  ? 104  MET A SD  1 
ATOM   135  S  SD  B MET A 1 15  ? -0.400  -29.571 -22.687 0.50   30.74  ? 104  MET A SD  1 
ATOM   136  C  CE  A MET A 1 15  ? -2.631  -26.304 -21.147 0.50   33.80  ? 104  MET A CE  1 
ATOM   137  C  CE  B MET A 1 15  ? -0.621  -29.030 -20.993 0.50   30.57  ? 104  MET A CE  1 
ATOM   138  N  N   . GLY A 1 16  ? 1.553   -26.364 -21.106 1.00   31.32  ? 105  GLY A N   1 
ATOM   139  C  CA  . GLY A 1 16  ? 2.444   -26.813 -20.059 1.00   30.37  ? 105  GLY A CA  1 
ATOM   140  C  C   . GLY A 1 16  ? 2.647   -25.736 -19.020 1.00   29.32  ? 105  GLY A C   1 
ATOM   141  O  O   . GLY A 1 16  ? 2.826   -24.561 -19.346 1.00   30.42  ? 105  GLY A O   1 
ATOM   142  N  N   . GLY A 1 17  ? 2.623   -26.145 -17.759 1.00   27.68  ? 106  GLY A N   1 
ATOM   143  C  CA  . GLY A 1 17  ? 2.768   -25.219 -16.666 1.00   24.83  ? 106  GLY A CA  1 
ATOM   144  C  C   . GLY A 1 17  ? 1.561   -24.313 -16.524 1.00   22.99  ? 106  GLY A C   1 
ATOM   145  O  O   . GLY A 1 17  ? 0.573   -24.426 -17.258 1.00   22.67  ? 106  GLY A O   1 
ATOM   146  N  N   . ASN A 1 18  ? 1.658   -23.398 -15.575 1.00   20.66  ? 107  ASN A N   1 
ATOM   147  C  CA  . ASN A 1 18  ? 0.558   -22.514 -15.255 1.00   19.36  ? 107  ASN A CA  1 
ATOM   148  C  C   . ASN A 1 18  ? 0.749   -21.130 -15.865 1.00   18.12  ? 107  ASN A C   1 
ATOM   149  O  O   . ASN A 1 18  ? -0.135  -20.283 -15.783 1.00   17.99  ? 107  ASN A O   1 
ATOM   150  C  CB  . ASN A 1 18  ? 0.388   -22.444 -13.739 1.00   19.18  ? 107  ASN A CB  1 
ATOM   151  C  CG  . ASN A 1 18  ? 0.147   -23.823 -13.120 1.00   19.51  ? 107  ASN A CG  1 
ATOM   152  O  OD1 . ASN A 1 18  ? -0.494  -24.684 -13.730 1.00   19.78  ? 107  ASN A OD1 1 
ATOM   153  N  ND2 . ASN A 1 18  ? 0.662   -24.035 -11.910 1.00   18.66  ? 107  ASN A ND2 1 
ATOM   154  N  N   . VAL A 1 19  ? 1.903   -20.912 -16.489 1.00   17.26  ? 108  VAL A N   1 
ATOM   155  C  CA  . VAL A 1 19  ? 2.143   -19.671 -17.226 1.00   16.25  ? 108  VAL A CA  1 
ATOM   156  C  C   . VAL A 1 19  ? 1.344   -19.693 -18.524 1.00   15.19  ? 108  VAL A C   1 
ATOM   157  O  O   . VAL A 1 19  ? 1.369   -20.683 -19.253 1.00   14.84  ? 108  VAL A O   1 
ATOM   158  C  CB  . VAL A 1 19  ? 3.640   -19.452 -17.521 1.00   16.68  ? 108  VAL A CB  1 
ATOM   159  C  CG1 . VAL A 1 19  ? 3.840   -18.346 -18.584 1.00   16.14  ? 108  VAL A CG1 1 
ATOM   160  C  CG2 . VAL A 1 19  ? 4.378   -19.107 -16.236 1.00   16.61  ? 108  VAL A CG2 1 
ATOM   161  N  N   . VAL A 1 20  ? 0.602   -18.620 -18.785 1.00   13.73  ? 109  VAL A N   1 
ATOM   162  C  CA  . VAL A 1 20  ? -0.207  -18.534 -19.998 1.00   12.88  ? 109  VAL A CA  1 
ATOM   163  C  C   . VAL A 1 20  ? 0.619   -17.933 -21.130 1.00   12.78  ? 109  VAL A C   1 
ATOM   164  O  O   . VAL A 1 20  ? 0.980   -16.755 -21.109 1.00   12.74  ? 109  VAL A O   1 
ATOM   165  C  CB  . VAL A 1 20  ? -1.509  -17.725 -19.776 1.00   12.20  ? 109  VAL A CB  1 
ATOM   166  C  CG1 . VAL A 1 20  ? -2.350  -17.697 -21.044 1.00   11.76  ? 109  VAL A CG1 1 
ATOM   167  C  CG2 . VAL A 1 20  ? -2.310  -18.329 -18.624 1.00   12.88  ? 109  VAL A CG2 1 
ATOM   168  N  N   . ILE A 1 21  ? 0.935   -18.751 -22.121 1.00   12.75  ? 110  ILE A N   1 
ATOM   169  C  CA  . ILE A 1 21  ? 1.784   -18.272 -23.200 1.00   13.30  ? 110  ILE A CA  1 
ATOM   170  C  C   . ILE A 1 21  ? 0.933   -17.747 -24.350 1.00   13.20  ? 110  ILE A C   1 
ATOM   171  O  O   . ILE A 1 21  ? 0.073   -18.458 -24.860 1.00   13.63  ? 110  ILE A O   1 
ATOM   172  C  CB  . ILE A 1 21  ? 2.764   -19.362 -23.681 1.00   13.39  ? 110  ILE A CB  1 
ATOM   173  C  CG1 . ILE A 1 21  ? 3.740   -19.705 -22.557 1.00   13.72  ? 110  ILE A CG1 1 
ATOM   174  C  CG2 . ILE A 1 21  ? 3.519   -18.889 -24.923 1.00   13.19  ? 110  ILE A CG2 1 
ATOM   175  C  CD1 . ILE A 1 21  ? 4.586   -20.943 -22.811 1.00   15.35  ? 110  ILE A CD1 1 
ATOM   176  N  N   . PHE A 1 22  ? 1.165   -16.496 -24.734 1.00   12.02  ? 111  PHE A N   1 
ATOM   177  C  CA  . PHE A 1 22  ? 0.499   -15.918 -25.893 1.00   12.05  ? 111  PHE A CA  1 
ATOM   178  C  C   . PHE A 1 22  ? 1.497   -15.934 -27.054 1.00   13.13  ? 111  PHE A C   1 
ATOM   179  O  O   . PHE A 1 22  ? 2.428   -15.135 -27.099 1.00   13.38  ? 111  PHE A O   1 
ATOM   180  C  CB  . PHE A 1 22  ? 0.019   -14.495 -25.575 1.00   10.49  ? 111  PHE A CB  1 
ATOM   181  C  CG  . PHE A 1 22  ? -0.939  -14.423 -24.401 1.00   8.37   ? 111  PHE A CG  1 
ATOM   182  C  CD1 . PHE A 1 22  ? -0.475  -14.528 -23.102 1.00   7.52   ? 111  PHE A CD1 1 
ATOM   183  C  CD2 . PHE A 1 22  ? -2.304  -14.260 -24.605 1.00   7.55   ? 111  PHE A CD2 1 
ATOM   184  C  CE1 . PHE A 1 22  ? -1.361  -14.466 -22.010 1.00   7.16   ? 111  PHE A CE1 1 
ATOM   185  C  CE2 . PHE A 1 22  ? -3.183  -14.193 -23.534 1.00   6.51   ? 111  PHE A CE2 1 
ATOM   186  C  CZ  . PHE A 1 22  ? -2.712  -14.299 -22.236 1.00   5.83   ? 111  PHE A CZ  1 
ATOM   187  N  N   . ASP A 1 23  ? 1.315   -16.868 -27.977 1.00   13.76  ? 112  ASP A N   1 
ATOM   188  C  CA  . ASP A 1 23  ? 2.380   -17.202 -28.926 1.00   15.19  ? 112  ASP A CA  1 
ATOM   189  C  C   . ASP A 1 23  ? 2.426   -16.304 -30.158 1.00   15.44  ? 112  ASP A C   1 
ATOM   190  O  O   . ASP A 1 23  ? 3.444   -16.241 -30.859 1.00   16.19  ? 112  ASP A O   1 
ATOM   191  C  CB  . ASP A 1 23  ? 2.214   -18.647 -29.382 1.00   16.46  ? 112  ASP A CB  1 
ATOM   192  C  CG  . ASP A 1 23  ? 0.863   -18.887 -30.016 1.00   17.84  ? 112  ASP A CG  1 
ATOM   193  O  OD1 . ASP A 1 23  ? -0.143  -18.884 -29.275 1.00   18.21  ? 112  ASP A OD1 1 
ATOM   194  O  OD2 . ASP A 1 23  ? 0.805   -19.060 -31.251 1.00   19.80  ? 112  ASP A OD2 1 
ATOM   195  N  N   . THR A 1 24  ? 1.323   -15.631 -30.451 1.00   14.55  ? 113  THR A N   1 
ATOM   196  C  CA  . THR A 1 24  ? 1.273   -14.822 -31.663 1.00   14.68  ? 113  THR A CA  1 
ATOM   197  C  C   . THR A 1 24  ? 1.398   -13.325 -31.379 1.00   14.31  ? 113  THR A C   1 
ATOM   198  O  O   . THR A 1 24  ? 0.522   -12.715 -30.767 1.00   13.98  ? 113  THR A O   1 
ATOM   199  C  CB  . THR A 1 24  ? 0.019   -15.147 -32.498 1.00   14.46  ? 113  THR A CB  1 
ATOM   200  O  OG1 . THR A 1 24  ? 0.031   -16.542 -32.852 1.00   14.29  ? 113  THR A OG1 1 
ATOM   201  C  CG2 . THR A 1 24  ? 0.000   -14.316 -33.756 1.00   16.03  ? 113  THR A CG2 1 
ATOM   202  N  N   . VAL A 1 25  ? 2.502   -12.740 -31.825 1.00   14.64  ? 114  VAL A N   1 
ATOM   203  C  CA  . VAL A 1 25  ? 2.791   -11.331 -31.554 1.00   14.35  ? 114  VAL A CA  1 
ATOM   204  C  C   . VAL A 1 25  ? 2.092   -10.400 -32.540 1.00   15.00  ? 114  VAL A C   1 
ATOM   205  O  O   . VAL A 1 25  ? 2.164   -10.593 -33.767 1.00   15.02  ? 114  VAL A O   1 
ATOM   206  C  CB  . VAL A 1 25  ? 4.306   -11.064 -31.537 1.00   14.40  ? 114  VAL A CB  1 
ATOM   207  C  CG1 . VAL A 1 25  ? 4.593   -9.575  -31.412 1.00   15.55  ? 114  VAL A CG1 1 
ATOM   208  C  CG2 . VAL A 1 25  ? 4.965   -11.824 -30.394 1.00   13.94  ? 114  VAL A CG2 1 
ATOM   209  N  N   . ILE A 1 26  ? 1.406   -9.394  -31.997 1.00   14.48  ? 115  ILE A N   1 
ATOM   210  C  CA  . ILE A 1 26  ? 0.747   -8.376  -32.803 1.00   14.38  ? 115  ILE A CA  1 
ATOM   211  C  C   . ILE A 1 26  ? 1.621   -7.125  -32.821 1.00   14.01  ? 115  ILE A C   1 
ATOM   212  O  O   . ILE A 1 26  ? 1.873   -6.535  -33.866 1.00   12.83  ? 115  ILE A O   1 
ATOM   213  C  CB  . ILE A 1 26  ? -0.646  -8.010  -32.230 1.00   14.47  ? 115  ILE A CB  1 
ATOM   214  C  CG1 . ILE A 1 26  ? -1.538  -9.254  -32.107 1.00   14.73  ? 115  ILE A CG1 1 
ATOM   215  C  CG2 . ILE A 1 26  ? -1.318  -6.949  -33.094 1.00   15.37  ? 115  ILE A CG2 1 
ATOM   216  C  CD1 . ILE A 1 26  ? -1.957  -9.853  -33.451 1.00   16.78  ? 115  ILE A CD1 1 
ATOM   217  N  N   . THR A 1 27  ? 2.081   -6.730  -31.637 1.00   14.44  ? 116  THR A N   1 
ATOM   218  C  CA  . THR A 1 27  ? 2.987   -5.602  -31.487 1.00   13.99  ? 116  THR A CA  1 
ATOM   219  C  C   . THR A 1 27  ? 4.038   -5.951  -30.441 1.00   14.61  ? 116  THR A C   1 
ATOM   220  O  O   . THR A 1 27  ? 3.739   -6.609  -29.440 1.00   13.53  ? 116  THR A O   1 
ATOM   221  C  CB  . THR A 1 27  ? 2.241   -4.335  -31.077 1.00   13.63  ? 116  THR A CB  1 
ATOM   222  O  OG1 . THR A 1 27  ? 1.136   -4.125  -31.970 1.00   13.28  ? 116  THR A OG1 1 
ATOM   223  C  CG2 . THR A 1 27  ? 3.161   -3.135  -31.151 1.00   13.89  ? 116  THR A CG2 1 
ATOM   224  N  N   . ASN A 1 28  ? 5.276   -5.547  -30.699 1.00   14.78  ? 117  ASN A N   1 
ATOM   225  C  CA  . ASN A 1 28  ? 6.372   -5.811  -29.775 1.00   15.58  ? 117  ASN A CA  1 
ATOM   226  C  C   . ASN A 1 28  ? 7.455   -4.754  -29.944 1.00   15.62  ? 117  ASN A C   1 
ATOM   227  O  O   . ASN A 1 28  ? 8.553   -5.054  -30.421 1.00   14.93  ? 117  ASN A O   1 
ATOM   228  C  CB  . ASN A 1 28  ? 6.954   -7.207  -30.024 1.00   15.55  ? 117  ASN A CB  1 
ATOM   229  C  CG  . ASN A 1 28  ? 7.578   -7.810  -28.783 1.00   16.61  ? 117  ASN A CG  1 
ATOM   230  O  OD1 . ASN A 1 28  ? 7.588   -7.189  -27.713 1.00   14.74  ? 117  ASN A OD1 1 
ATOM   231  N  ND2 . ASN A 1 28  ? 8.099   -9.037  -28.914 1.00   16.18  ? 117  ASN A ND2 1 
ATOM   232  N  N   . GLN A 1 29  ? 7.137   -3.519  -29.560 1.00   16.41  ? 118  GLN A N   1 
ATOM   233  C  CA  . GLN A 1 29  ? 8.068   -2.399  -29.715 1.00   18.15  ? 118  GLN A CA  1 
ATOM   234  C  C   . GLN A 1 29  ? 9.158   -2.452  -28.649 1.00   18.63  ? 118  GLN A C   1 
ATOM   235  O  O   . GLN A 1 29  ? 8.866   -2.416  -27.440 1.00   18.73  ? 118  GLN A O   1 
ATOM   236  C  CB  . GLN A 1 29  ? 7.341   -1.055  -29.686 1.00   18.30  ? 118  GLN A CB  1 
ATOM   237  C  CG  . GLN A 1 29  ? 8.213   0.113   -30.098 1.00   21.04  ? 118  GLN A CG  1 
ATOM   238  C  CD  . GLN A 1 29  ? 8.674   0.029   -31.555 1.00   22.13  ? 118  GLN A CD  1 
ATOM   239  O  OE1 . GLN A 1 29  ? 7.938   -0.436  -32.428 1.00   24.83  ? 118  GLN A OE1 1 
ATOM   240  N  NE2 . GLN A 1 29  ? 9.899   0.477   -31.818 1.00   22.69  ? 118  GLN A NE2 1 
ATOM   241  N  N   A GLU A 1 30  ? 10.411  -2.508  -29.101 0.50   18.43  ? 119  GLU A N   1 
ATOM   242  N  N   B GLU A 1 30  ? 10.403  -2.523  -29.119 0.50   18.25  ? 119  GLU A N   1 
ATOM   243  C  CA  A GLU A 1 30  ? 11.562  -2.763  -28.236 0.50   18.71  ? 119  GLU A CA  1 
ATOM   244  C  CA  B GLU A 1 30  ? 11.572  -2.764  -28.282 0.50   18.36  ? 119  GLU A CA  1 
ATOM   245  C  C   A GLU A 1 30  ? 11.720  -4.259  -27.977 0.50   18.40  ? 119  GLU A C   1 
ATOM   246  C  C   B GLU A 1 30  ? 11.685  -4.248  -27.945 0.50   18.18  ? 119  GLU A C   1 
ATOM   247  O  O   A GLU A 1 30  ? 12.600  -4.676  -27.236 0.50   18.50  ? 119  GLU A O   1 
ATOM   248  O  O   B GLU A 1 30  ? 12.495  -4.644  -27.117 0.50   18.24  ? 119  GLU A O   1 
ATOM   249  C  CB  A GLU A 1 30  ? 11.458  -2.005  -26.902 0.50   18.92  ? 119  GLU A CB  1 
ATOM   250  C  CB  B GLU A 1 30  ? 11.536  -1.917  -27.004 0.50   18.35  ? 119  GLU A CB  1 
ATOM   251  C  CG  A GLU A 1 30  ? 12.192  -0.665  -26.854 0.50   18.94  ? 119  GLU A CG  1 
ATOM   252  C  CG  B GLU A 1 30  ? 11.395  -0.420  -27.240 0.50   17.80  ? 119  GLU A CG  1 
ATOM   253  C  CD  A GLU A 1 30  ? 12.569  -0.250  -25.437 0.50   18.99  ? 119  GLU A CD  1 
ATOM   254  C  CD  B GLU A 1 30  ? 12.459  0.136   -28.162 0.50   17.31  ? 119  GLU A CD  1 
ATOM   255  O  OE1 A GLU A 1 30  ? 12.437  -1.078  -24.510 0.50   19.58  ? 119  GLU A OE1 1 
ATOM   256  O  OE1 B GLU A 1 30  ? 13.621  -0.318  -28.087 0.50   17.15  ? 119  GLU A OE1 1 
ATOM   257  O  OE2 A GLU A 1 30  ? 13.006  0.904   -25.243 0.50   19.44  ? 119  GLU A OE2 1 
ATOM   258  O  OE2 B GLU A 1 30  ? 12.128  1.037   -28.956 0.50   17.00  ? 119  GLU A OE2 1 
ATOM   259  N  N   . GLU A 1 31  ? 10.862  -5.061  -28.599 1.00   18.62  ? 120  GLU A N   1 
ATOM   260  C  CA  . GLU A 1 31  ? 10.839  -6.514  -28.371 1.00   18.60  ? 120  GLU A CA  1 
ATOM   261  C  C   . GLU A 1 31  ? 10.915  -6.942  -26.893 1.00   17.19  ? 120  GLU A C   1 
ATOM   262  O  O   . GLU A 1 31  ? 11.669  -7.859  -26.550 1.00   16.38  ? 120  GLU A O   1 
ATOM   263  C  CB  . GLU A 1 31  ? 11.943  -7.207  -29.178 1.00   20.25  ? 120  GLU A CB  1 
ATOM   264  C  CG  . GLU A 1 31  ? 11.843  -7.000  -30.679 1.00   23.22  ? 120  GLU A CG  1 
ATOM   265  C  CD  . GLU A 1 31  ? 13.106  -7.445  -31.400 1.00   26.36  ? 120  GLU A CD  1 
ATOM   266  O  OE1 . GLU A 1 31  ? 13.545  -8.601  -31.195 1.00   27.54  ? 120  GLU A OE1 1 
ATOM   267  O  OE2 . GLU A 1 31  ? 13.661  -6.636  -32.173 1.00   28.65  ? 120  GLU A OE2 1 
ATOM   268  N  N   . PRO A 1 32  ? 10.113  -6.305  -26.017 1.00   16.05  ? 121  PRO A N   1 
ATOM   269  C  CA  . PRO A 1 32  ? 10.211  -6.691  -24.602 1.00   15.76  ? 121  PRO A CA  1 
ATOM   270  C  C   . PRO A 1 32  ? 9.550   -8.038  -24.314 1.00   15.08  ? 121  PRO A C   1 
ATOM   271  O  O   . PRO A 1 32  ? 9.947   -8.734  -23.379 1.00   15.15  ? 121  PRO A O   1 
ATOM   272  C  CB  . PRO A 1 32  ? 9.475   -5.562  -23.873 1.00   15.44  ? 121  PRO A CB  1 
ATOM   273  C  CG  . PRO A 1 32  ? 8.503   -5.016  -24.881 1.00   15.95  ? 121  PRO A CG  1 
ATOM   274  C  CD  . PRO A 1 32  ? 9.106   -5.252  -26.250 1.00   15.85  ? 121  PRO A CD  1 
ATOM   275  N  N   . TYR A 1 33  ? 8.560   -8.408  -25.123 1.00   14.75  ? 122  TYR A N   1 
ATOM   276  C  CA  . TYR A 1 33  ? 7.790   -9.633  -24.882 1.00   14.07  ? 122  TYR A CA  1 
ATOM   277  C  C   . TYR A 1 33  ? 8.347   -10.878 -25.593 1.00   14.78  ? 122  TYR A C   1 
ATOM   278  O  O   . TYR A 1 33  ? 8.643   -10.840 -26.791 1.00   14.62  ? 122  TYR A O   1 
ATOM   279  C  CB  . TYR A 1 33  ? 6.304   -9.412  -25.226 1.00   13.07  ? 122  TYR A CB  1 
ATOM   280  C  CG  . TYR A 1 33  ? 5.477   -10.676 -25.107 1.00   13.22  ? 122  TYR A CG  1 
ATOM   281  C  CD1 . TYR A 1 33  ? 5.056   -11.138 -23.863 1.00   10.79  ? 122  TYR A CD1 1 
ATOM   282  C  CD2 . TYR A 1 33  ? 5.133   -11.415 -26.238 1.00   12.36  ? 122  TYR A CD2 1 
ATOM   283  C  CE1 . TYR A 1 33  ? 4.329   -12.290 -23.750 1.00   12.18  ? 122  TYR A CE1 1 
ATOM   284  C  CE2 . TYR A 1 33  ? 4.402   -12.564 -26.134 1.00   13.27  ? 122  TYR A CE2 1 
ATOM   285  C  CZ  . TYR A 1 33  ? 3.997   -13.000 -24.882 1.00   12.80  ? 122  TYR A CZ  1 
ATOM   286  O  OH  . TYR A 1 33  ? 3.264   -14.157 -24.770 1.00   14.35  ? 122  TYR A OH  1 
ATOM   287  N  N   A GLN A 1 34  ? 8.478   -11.968 -24.833 0.50   14.83  ? 123  GLN A N   1 
ATOM   288  N  N   B GLN A 1 34  ? 8.485   -11.981 -24.863 0.50   14.94  ? 123  GLN A N   1 
ATOM   289  C  CA  A GLN A 1 34  ? 8.981   -13.250 -25.332 0.50   15.31  ? 123  GLN A CA  1 
ATOM   290  C  CA  B GLN A 1 34  ? 9.032   -13.204 -25.449 0.50   15.55  ? 123  GLN A CA  1 
ATOM   291  C  C   A GLN A 1 34  ? 7.830   -14.195 -25.643 0.50   15.32  ? 123  GLN A C   1 
ATOM   292  C  C   B GLN A 1 34  ? 7.957   -14.267 -25.662 0.50   15.38  ? 123  GLN A C   1 
ATOM   293  O  O   A GLN A 1 34  ? 7.201   -14.731 -24.726 0.50   14.62  ? 123  GLN A O   1 
ATOM   294  O  O   B GLN A 1 34  ? 7.506   -14.919 -24.717 0.50   14.48  ? 123  GLN A O   1 
ATOM   295  C  CB  A GLN A 1 34  ? 9.853   -13.944 -24.285 0.50   15.48  ? 123  GLN A CB  1 
ATOM   296  C  CB  B GLN A 1 34  ? 10.197  -13.745 -24.616 0.50   15.95  ? 123  GLN A CB  1 
ATOM   297  C  CG  A GLN A 1 34  ? 11.075  -13.194 -23.792 0.50   15.95  ? 123  GLN A CG  1 
ATOM   298  C  CG  B GLN A 1 34  ? 11.416  -12.826 -24.598 0.50   17.12  ? 123  GLN A CG  1 
ATOM   299  C  CD  A GLN A 1 34  ? 11.865  -14.024 -22.790 0.50   16.53  ? 123  GLN A CD  1 
ATOM   300  C  CD  B GLN A 1 34  ? 12.068  -12.683 -25.962 0.50   17.95  ? 123  GLN A CD  1 
ATOM   301  O  OE1 A GLN A 1 34  ? 11.332  -14.970 -22.195 0.50   15.87  ? 123  GLN A OE1 1 
ATOM   302  O  OE1 B GLN A 1 34  ? 12.573  -13.654 -26.527 0.50   19.58  ? 123  GLN A OE1 1 
ATOM   303  N  NE2 A GLN A 1 34  ? 13.142  -13.686 -22.607 0.50   16.19  ? 123  GLN A NE2 1 
ATOM   304  N  NE2 B GLN A 1 34  ? 12.075  -11.465 -26.492 0.50   18.01  ? 123  GLN A NE2 1 
ATOM   305  N  N   . ASN A 1 35  ? 7.576   -14.435 -26.924 1.00   15.03  ? 124  ASN A N   1 
ATOM   306  C  CA  . ASN A 1 35  ? 6.418   -15.230 -27.307 1.00   16.71  ? 124  ASN A CA  1 
ATOM   307  C  C   . ASN A 1 35  ? 6.554   -16.746 -27.101 1.00   17.27  ? 124  ASN A C   1 
ATOM   308  O  O   . ASN A 1 35  ? 5.557   -17.471 -27.129 1.00   17.14  ? 124  ASN A O   1 
ATOM   309  C  CB  . ASN A 1 35  ? 6.005   -14.887 -28.744 1.00   17.64  ? 124  ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 35  ? 7.170   -14.945 -29.717 1.00   19.01  ? 124  ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 35  ? 8.170   -15.601 -29.457 1.00   20.93  ? 124  ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 35  ? 7.036   -14.269 -30.852 1.00   21.43  ? 124  ASN A ND2 1 
ATOM   313  N  N   . HIS A 1 36  ? 7.779   -17.219 -26.885 1.00   17.71  ? 125  HIS A N   1 
ATOM   314  C  CA  . HIS A 1 36  ? 8.005   -18.629 -26.605 1.00   18.68  ? 125  HIS A CA  1 
ATOM   315  C  C   . HIS A 1 36  ? 7.731   -18.962 -25.132 1.00   18.65  ? 125  HIS A C   1 
ATOM   316  O  O   . HIS A 1 36  ? 7.398   -20.100 -24.804 1.00   18.83  ? 125  HIS A O   1 
ATOM   317  C  CB  . HIS A 1 36  ? 9.435   -19.042 -26.990 1.00   19.73  ? 125  HIS A CB  1 
ATOM   318  C  CG  . HIS A 1 36  ? 10.489  -18.497 -26.074 1.00   21.29  ? 125  HIS A CG  1 
ATOM   319  N  ND1 . HIS A 1 36  ? 11.032  -19.235 -25.044 1.00   22.48  ? 125  HIS A ND1 1 
ATOM   320  C  CD2 . HIS A 1 36  ? 11.086  -17.281 -26.022 1.00   22.23  ? 125  HIS A CD2 1 
ATOM   321  C  CE1 . HIS A 1 36  ? 11.923  -18.499 -24.400 1.00   22.89  ? 125  HIS A CE1 1 
ATOM   322  N  NE2 . HIS A 1 36  ? 11.975  -17.310 -24.974 1.00   22.92  ? 125  HIS A NE2 1 
ATOM   323  N  N   . SER A 1 37  ? 7.862   -17.971 -24.254 1.00   18.31  ? 126  SER A N   1 
ATOM   324  C  CA  . SER A 1 37  ? 7.711   -18.197 -22.812 1.00   18.21  ? 126  SER A CA  1 
ATOM   325  C  C   . SER A 1 37  ? 6.495   -17.499 -22.203 1.00   18.24  ? 126  SER A C   1 
ATOM   326  O  O   . SER A 1 37  ? 6.047   -17.861 -21.106 1.00   18.73  ? 126  SER A O   1 
ATOM   327  C  CB  . SER A 1 37  ? 8.971   -17.749 -22.066 1.00   18.40  ? 126  SER A CB  1 
ATOM   328  O  OG  . SER A 1 37  ? 9.152   -16.345 -22.164 1.00   17.87  ? 126  SER A OG  1 
ATOM   329  N  N   . GLY A 1 38  ? 5.976   -16.489 -22.896 1.00   17.48  ? 127  GLY A N   1 
ATOM   330  C  CA  . GLY A 1 38  ? 4.859   -15.700 -22.373 1.00   16.89  ? 127  GLY A CA  1 
ATOM   331  C  C   . GLY A 1 38  ? 5.288   -14.638 -21.369 1.00   16.71  ? 127  GLY A C   1 
ATOM   332  O  O   . GLY A 1 38  ? 4.458   -14.083 -20.640 1.00   16.42  ? 127  GLY A O   1 
ATOM   333  N  N   . ARG A 1 39  ? 6.587   -14.346 -21.344 1.00   16.41  ? 128  ARG A N   1 
ATOM   334  C  CA  . ARG A 1 39  ? 7.154   -13.422 -20.372 1.00   15.92  ? 128  ARG A CA  1 
ATOM   335  C  C   . ARG A 1 39  ? 7.560   -12.084 -20.987 1.00   15.75  ? 128  ARG A C   1 
ATOM   336  O  O   . ARG A 1 39  ? 8.209   -12.029 -22.048 1.00   14.72  ? 128  ARG A O   1 
ATOM   337  C  CB  . ARG A 1 39  ? 8.348   -14.068 -19.647 1.00   17.46  ? 128  ARG A CB  1 
ATOM   338  C  CG  . ARG A 1 39  ? 7.946   -14.940 -18.468 1.00   18.78  ? 128  ARG A CG  1 
ATOM   339  C  CD  . ARG A 1 39  ? 8.973   -16.006 -18.146 1.00   22.19  ? 128  ARG A CD  1 
ATOM   340  N  NE  . ARG A 1 39  ? 8.367   -17.080 -17.351 1.00   24.48  ? 128  ARG A NE  1 
ATOM   341  C  CZ  . ARG A 1 39  ? 8.576   -17.274 -16.051 1.00   25.06  ? 128  ARG A CZ  1 
ATOM   342  N  NH1 . ARG A 1 39  ? 9.405   -16.488 -15.377 1.00   25.91  ? 128  ARG A NH1 1 
ATOM   343  N  NH2 . ARG A 1 39  ? 7.967   -18.270 -15.425 1.00   26.01  ? 128  ARG A NH2 1 
ATOM   344  N  N   . PHE A 1 40  ? 7.141   -11.010 -20.318 1.00   14.60  ? 129  PHE A N   1 
ATOM   345  C  CA  . PHE A 1 40  ? 7.571   -9.656  -20.632 1.00   13.53  ? 129  PHE A CA  1 
ATOM   346  C  C   . PHE A 1 40  ? 8.803   -9.362  -19.790 1.00   13.75  ? 129  PHE A C   1 
ATOM   347  O  O   . PHE A 1 40  ? 8.821   -9.659  -18.596 1.00   14.33  ? 129  PHE A O   1 
ATOM   348  C  CB  . PHE A 1 40  ? 6.455   -8.658  -20.294 1.00   12.93  ? 129  PHE A CB  1 
ATOM   349  C  CG  . PHE A 1 40  ? 6.871   -7.213  -20.368 1.00   12.87  ? 129  PHE A CG  1 
ATOM   350  C  CD1 . PHE A 1 40  ? 6.800   -6.514  -21.560 1.00   12.97  ? 129  PHE A CD1 1 
ATOM   351  C  CD2 . PHE A 1 40  ? 7.316   -6.545  -19.239 1.00   13.89  ? 129  PHE A CD2 1 
ATOM   352  C  CE1 . PHE A 1 40  ? 7.171   -5.180  -21.621 1.00   12.45  ? 129  PHE A CE1 1 
ATOM   353  C  CE2 . PHE A 1 40  ? 7.698   -5.204  -19.304 1.00   13.35  ? 129  PHE A CE2 1 
ATOM   354  C  CZ  . PHE A 1 40  ? 7.623   -4.528  -20.495 1.00   12.71  ? 129  PHE A CZ  1 
ATOM   355  N  N   . VAL A 1 41  ? 9.824   -8.782  -20.410 1.00   13.10  ? 130  VAL A N   1 
ATOM   356  C  CA  . VAL A 1 41  ? 11.053  -8.436  -19.711 1.00   13.44  ? 130  VAL A CA  1 
ATOM   357  C  C   . VAL A 1 41  ? 11.217  -6.931  -19.722 1.00   13.20  ? 130  VAL A C   1 
ATOM   358  O  O   . VAL A 1 41  ? 11.192  -6.315  -20.783 1.00   11.97  ? 130  VAL A O   1 
ATOM   359  C  CB  . VAL A 1 41  ? 12.295  -9.066  -20.391 1.00   12.77  ? 130  VAL A CB  1 
ATOM   360  C  CG1 . VAL A 1 41  ? 13.562  -8.733  -19.608 1.00   13.90  ? 130  VAL A CG1 1 
ATOM   361  C  CG2 . VAL A 1 41  ? 12.123  -10.571 -20.512 1.00   13.21  ? 130  VAL A CG2 1 
ATOM   362  N  N   . CYS A 1 42  ? 11.386  -6.343  -18.544 1.00   13.29  ? 131  CYS A N   1 
ATOM   363  C  CA  . CYS A 1 42  ? 11.578  -4.893  -18.445 1.00   14.75  ? 131  CYS A CA  1 
ATOM   364  C  C   . CYS A 1 42  ? 13.011  -4.493  -18.821 1.00   16.04  ? 131  CYS A C   1 
ATOM   365  O  O   . CYS A 1 42  ? 13.977  -4.988  -18.242 1.00   15.82  ? 131  CYS A O   1 
ATOM   366  C  CB  . CYS A 1 42  ? 11.233  -4.395  -17.035 1.00   13.88  ? 131  CYS A CB  1 
ATOM   367  S  SG  . CYS A 1 42  ? 11.676  -2.671  -16.701 1.00   14.03  ? 131  CYS A SG  1 
ATOM   368  N  N   . THR A 1 43  ? 13.144  -3.605  -19.802 1.00   17.42  ? 132  THR A N   1 
ATOM   369  C  CA  . THR A 1 43  ? 14.449  -3.038  -20.127 1.00   18.49  ? 132  THR A CA  1 
ATOM   370  C  C   . THR A 1 43  ? 14.555  -1.643  -19.532 1.00   19.18  ? 132  THR A C   1 
ATOM   371  O  O   . THR A 1 43  ? 15.529  -1.315  -18.858 1.00   20.67  ? 132  THR A O   1 
ATOM   372  C  CB  . THR A 1 43  ? 14.696  -2.977  -21.644 1.00   18.85  ? 132  THR A CB  1 
ATOM   373  O  OG1 . THR A 1 43  ? 15.019  -4.286  -22.131 1.00   19.25  ? 132  THR A OG1 1 
ATOM   374  C  CG2 . THR A 1 43  ? 15.862  -2.053  -21.939 1.00   20.02  ? 132  THR A CG2 1 
ATOM   375  N  N   . VAL A 1 44  ? 13.532  -0.828  -19.764 1.00   19.00  ? 133  VAL A N   1 
ATOM   376  C  CA  . VAL A 1 44  ? 13.495  0.511   -19.215 1.00   18.57  ? 133  VAL A CA  1 
ATOM   377  C  C   . VAL A 1 44  ? 12.734  0.500   -17.890 1.00   17.89  ? 133  VAL A C   1 
ATOM   378  O  O   . VAL A 1 44  ? 11.591  0.067   -17.836 1.00   18.02  ? 133  VAL A O   1 
ATOM   379  C  CB  . VAL A 1 44  ? 12.852  1.475   -20.210 1.00   18.91  ? 133  VAL A CB  1 
ATOM   380  C  CG1 . VAL A 1 44  ? 12.996  2.906   -19.738 1.00   19.13  ? 133  VAL A CG1 1 
ATOM   381  C  CG2 . VAL A 1 44  ? 13.504  1.293   -21.585 1.00   19.08  ? 133  VAL A CG2 1 
ATOM   382  N  N   . PRO A 1 45  ? 13.383  0.957   -16.810 1.00   17.24  ? 134  PRO A N   1 
ATOM   383  C  CA  . PRO A 1 45  ? 12.768  0.980   -15.484 1.00   16.58  ? 134  PRO A CA  1 
ATOM   384  C  C   . PRO A 1 45  ? 11.717  2.083   -15.412 1.00   16.24  ? 134  PRO A C   1 
ATOM   385  O  O   . PRO A 1 45  ? 11.906  3.150   -15.999 1.00   16.15  ? 134  PRO A O   1 
ATOM   386  C  CB  . PRO A 1 45  ? 13.942  1.306   -14.551 1.00   16.63  ? 134  PRO A CB  1 
ATOM   387  C  CG  . PRO A 1 45  ? 15.189  1.189   -15.395 1.00   17.48  ? 134  PRO A CG  1 
ATOM   388  C  CD  . PRO A 1 45  ? 14.755  1.483   -16.790 1.00   17.27  ? 134  PRO A CD  1 
ATOM   389  N  N   . GLY A 1 46  ? 10.621  1.833   -14.699 1.00   15.24  ? 135  GLY A N   1 
ATOM   390  C  CA  . GLY A 1 46  ? 9.501   2.771   -14.704 1.00   14.89  ? 135  GLY A CA  1 
ATOM   391  C  C   . GLY A 1 46  ? 8.157   2.160   -14.362 1.00   13.65  ? 135  GLY A C   1 
ATOM   392  O  O   . GLY A 1 46  ? 8.075   1.006   -13.938 1.00   13.50  ? 135  GLY A O   1 
ATOM   393  N  N   . TYR A 1 47  ? 7.103   2.948   -14.549 1.00   12.79  ? 136  TYR A N   1 
ATOM   394  C  CA  . TYR A 1 47  ? 5.733   2.504   -14.315 1.00   11.53  ? 136  TYR A CA  1 
ATOM   395  C  C   . TYR A 1 47  ? 5.102   2.010   -15.610 1.00   11.12  ? 136  TYR A C   1 
ATOM   396  O  O   . TYR A 1 47  ? 5.097   2.728   -16.619 1.00   10.39  ? 136  TYR A O   1 
ATOM   397  C  CB  . TYR A 1 47  ? 4.906   3.648   -13.735 1.00   12.02  ? 136  TYR A CB  1 
ATOM   398  C  CG  . TYR A 1 47  ? 5.379   4.087   -12.365 1.00   13.59  ? 136  TYR A CG  1 
ATOM   399  C  CD1 . TYR A 1 47  ? 6.425   4.990   -12.231 1.00   13.52  ? 136  TYR A CD1 1 
ATOM   400  C  CD2 . TYR A 1 47  ? 4.783   3.598   -11.206 1.00   13.03  ? 136  TYR A CD2 1 
ATOM   401  C  CE1 . TYR A 1 47  ? 6.870   5.395   -10.984 1.00   14.04  ? 136  TYR A CE1 1 
ATOM   402  C  CE2 . TYR A 1 47  ? 5.225   4.000   -9.947  1.00   13.77  ? 136  TYR A CE2 1 
ATOM   403  C  CZ  . TYR A 1 47  ? 6.269   4.898   -9.849  1.00   14.57  ? 136  TYR A CZ  1 
ATOM   404  O  OH  . TYR A 1 47  ? 6.731   5.314   -8.615  1.00   15.94  ? 136  TYR A OH  1 
ATOM   405  N  N   . TYR A 1 48  ? 4.560   0.794   -15.561 1.00   10.39  ? 137  TYR A N   1 
ATOM   406  C  CA  . TYR A 1 48  ? 3.981   0.117   -16.722 1.00   10.24  ? 137  TYR A CA  1 
ATOM   407  C  C   . TYR A 1 48  ? 2.520   -0.245  -16.487 1.00   10.58  ? 137  TYR A C   1 
ATOM   408  O  O   . TYR A 1 48  ? 2.125   -0.562  -15.354 1.00   11.06  ? 137  TYR A O   1 
ATOM   409  C  CB  . TYR A 1 48  ? 4.740   -1.187  -16.994 1.00   9.76   ? 137  TYR A CB  1 
ATOM   410  C  CG  . TYR A 1 48  ? 6.124   -0.993  -17.569 1.00   9.47   ? 137  TYR A CG  1 
ATOM   411  C  CD1 . TYR A 1 48  ? 7.208   -0.673  -16.752 1.00   8.92   ? 137  TYR A CD1 1 
ATOM   412  C  CD2 . TYR A 1 48  ? 6.345   -1.135  -18.926 1.00   9.52   ? 137  TYR A CD2 1 
ATOM   413  C  CE1 . TYR A 1 48  ? 8.465   -0.508  -17.284 1.00   10.35  ? 137  TYR A CE1 1 
ATOM   414  C  CE2 . TYR A 1 48  ? 7.594   -0.958  -19.470 1.00   9.91   ? 137  TYR A CE2 1 
ATOM   415  C  CZ  . TYR A 1 48  ? 8.646   -0.643  -18.656 1.00   10.24  ? 137  TYR A CZ  1 
ATOM   416  O  OH  . TYR A 1 48  ? 9.885   -0.472  -19.218 1.00   11.96  ? 137  TYR A OH  1 
ATOM   417  N  N   . TYR A 1 49  ? 1.717   -0.217  -17.546 1.00   9.25   ? 138  TYR A N   1 
ATOM   418  C  CA  . TYR A 1 49  ? 0.379   -0.790  -17.461 1.00   9.17   ? 138  TYR A CA  1 
ATOM   419  C  C   . TYR A 1 49  ? 0.334   -2.165  -18.126 1.00   9.33   ? 138  TYR A C   1 
ATOM   420  O  O   . TYR A 1 49  ? 0.868   -2.354  -19.223 1.00   8.98   ? 138  TYR A O   1 
ATOM   421  C  CB  . TYR A 1 49  ? -0.709  0.121   -18.060 1.00   9.26   ? 138  TYR A CB  1 
ATOM   422  C  CG  . TYR A 1 49  ? -2.091  -0.335  -17.635 1.00   8.75   ? 138  TYR A CG  1 
ATOM   423  C  CD1 . TYR A 1 49  ? -2.408  -0.420  -16.285 1.00   8.67   ? 138  TYR A CD1 1 
ATOM   424  C  CD2 . TYR A 1 49  ? -3.059  -0.709  -18.566 1.00   7.20   ? 138  TYR A CD2 1 
ATOM   425  C  CE1 . TYR A 1 49  ? -3.648  -0.849  -15.857 1.00   8.77   ? 138  TYR A CE1 1 
ATOM   426  C  CE2 . TYR A 1 49  ? -4.326  -1.139  -18.146 1.00   7.72   ? 138  TYR A CE2 1 
ATOM   427  C  CZ  . TYR A 1 49  ? -4.601  -1.217  -16.779 1.00   9.74   ? 138  TYR A CZ  1 
ATOM   428  O  OH  . TYR A 1 49  ? -5.826  -1.654  -16.306 1.00   9.70   ? 138  TYR A OH  1 
ATOM   429  N  N   . PHE A 1 50  ? -0.292  -3.123  -17.444 1.00   8.39   ? 139  PHE A N   1 
ATOM   430  C  CA  . PHE A 1 50  ? -0.498  -4.456  -18.000 1.00   8.51   ? 139  PHE A CA  1 
ATOM   431  C  C   . PHE A 1 50  ? -1.968  -4.821  -17.916 1.00   8.52   ? 139  PHE A C   1 
ATOM   432  O  O   . PHE A 1 50  ? -2.620  -4.566  -16.905 1.00   6.72   ? 139  PHE A O   1 
ATOM   433  C  CB  . PHE A 1 50  ? 0.319   -5.505  -17.249 1.00   8.08   ? 139  PHE A CB  1 
ATOM   434  C  CG  . PHE A 1 50  ? 1.799   -5.324  -17.387 1.00   7.88   ? 139  PHE A CG  1 
ATOM   435  C  CD1 . PHE A 1 50  ? 2.522   -4.659  -16.410 1.00   6.68   ? 139  PHE A CD1 1 
ATOM   436  C  CD2 . PHE A 1 50  ? 2.468   -5.827  -18.488 1.00   6.90   ? 139  PHE A CD2 1 
ATOM   437  C  CE1 . PHE A 1 50  ? 3.884   -4.484  -16.538 1.00   7.27   ? 139  PHE A CE1 1 
ATOM   438  C  CE2 . PHE A 1 50  ? 3.831   -5.661  -18.625 1.00   7.60   ? 139  PHE A CE2 1 
ATOM   439  C  CZ  . PHE A 1 50  ? 4.545   -4.982  -17.644 1.00   7.42   ? 139  PHE A CZ  1 
ATOM   440  N  N   . THR A 1 51  ? -2.482  -5.440  -18.976 1.00   9.05   ? 140  THR A N   1 
ATOM   441  C  CA  . THR A 1 51  ? -3.870  -5.851  -18.991 1.00   9.39   ? 140  THR A CA  1 
ATOM   442  C  C   . THR A 1 51  ? -4.069  -7.136  -19.818 1.00   9.56   ? 140  THR A C   1 
ATOM   443  O  O   . THR A 1 51  ? -3.272  -7.443  -20.706 1.00   9.57   ? 140  THR A O   1 
ATOM   444  C  CB  . THR A 1 51  ? -4.766  -4.676  -19.477 1.00   10.46  ? 140  THR A CB  1 
ATOM   445  O  OG1 . THR A 1 51  ? -6.151  -5.041  -19.400 1.00   10.45  ? 140  THR A OG1 1 
ATOM   446  C  CG2 . THR A 1 51  ? -4.396  -4.259  -20.913 1.00   9.55   ? 140  THR A CG2 1 
ATOM   447  N  N   . PHE A 1 52  ? -5.106  -7.906  -19.501 1.00   9.52   ? 141  PHE A N   1 
ATOM   448  C  CA  . PHE A 1 52  ? -5.432  -9.101  -20.301 1.00   10.30  ? 141  PHE A CA  1 
ATOM   449  C  C   . PHE A 1 52  ? -6.928  -9.252  -20.454 1.00   10.48  ? 141  PHE A C   1 
ATOM   450  O  O   . PHE A 1 52  ? -7.689  -8.868  -19.569 1.00   10.29  ? 141  PHE A O   1 
ATOM   451  C  CB  . PHE A 1 52  ? -4.839  -10.384 -19.697 1.00   10.03  ? 141  PHE A CB  1 
ATOM   452  C  CG  . PHE A 1 52  ? -5.363  -10.717 -18.312 1.00   9.05   ? 141  PHE A CG  1 
ATOM   453  C  CD1 . PHE A 1 52  ? -6.579  -11.356 -18.148 1.00   9.40   ? 141  PHE A CD1 1 
ATOM   454  C  CD2 . PHE A 1 52  ? -4.615  -10.414 -17.182 1.00   9.85   ? 141  PHE A CD2 1 
ATOM   455  C  CE1 . PHE A 1 52  ? -7.062  -11.660 -16.868 1.00   10.15  ? 141  PHE A CE1 1 
ATOM   456  C  CE2 . PHE A 1 52  ? -5.082  -10.723 -15.900 1.00   9.79   ? 141  PHE A CE2 1 
ATOM   457  C  CZ  . PHE A 1 52  ? -6.304  -11.348 -15.747 1.00   9.61   ? 141  PHE A CZ  1 
ATOM   458  N  N   . GLN A 1 53  ? -7.340  -9.792  -21.598 1.00   10.86  ? 142  GLN A N   1 
ATOM   459  C  CA  . GLN A 1 53  ? -8.715  -10.175 -21.818 1.00   10.87  ? 142  GLN A CA  1 
ATOM   460  C  C   . GLN A 1 53  ? -8.692  -11.592 -22.395 1.00   11.26  ? 142  GLN A C   1 
ATOM   461  O  O   . GLN A 1 53  ? -8.341  -11.799 -23.560 1.00   11.27  ? 142  GLN A O   1 
ATOM   462  C  CB  . GLN A 1 53  ? -9.399  -9.191  -22.767 1.00   11.13  ? 142  GLN A CB  1 
ATOM   463  C  CG  . GLN A 1 53  ? -9.382  -7.730  -22.273 1.00   11.86  ? 142  GLN A CG  1 
ATOM   464  C  CD  . GLN A 1 53  ? -8.149  -6.950  -22.700 1.00   12.42  ? 142  GLN A CD  1 
ATOM   465  O  OE1 . GLN A 1 53  ? -7.650  -7.113  -23.808 1.00   13.73  ? 142  GLN A OE1 1 
ATOM   466  N  NE2 . GLN A 1 53  ? -7.672  -6.075  -21.827 1.00   13.76  ? 142  GLN A NE2 1 
ATOM   467  N  N   . VAL A 1 54  ? -9.052  -12.564 -21.564 1.00   11.08  ? 143  VAL A N   1 
ATOM   468  C  CA  . VAL A 1 54  ? -8.828  -13.965 -21.884 1.00   11.92  ? 143  VAL A CA  1 
ATOM   469  C  C   . VAL A 1 54  ? -10.142 -14.726 -21.936 1.00   12.30  ? 143  VAL A C   1 
ATOM   470  O  O   . VAL A 1 54  ? -10.950 -14.659 -21.015 1.00   11.66  ? 143  VAL A O   1 
ATOM   471  C  CB  . VAL A 1 54  ? -7.862  -14.637 -20.875 1.00   11.46  ? 143  VAL A CB  1 
ATOM   472  C  CG1 . VAL A 1 54  ? -7.812  -16.148 -21.094 1.00   10.94  ? 143  VAL A CG1 1 
ATOM   473  C  CG2 . VAL A 1 54  ? -6.472  -14.028 -20.981 1.00   10.78  ? 143  VAL A CG2 1 
ATOM   474  N  N   . LEU A 1 55  ? -10.325 -15.455 -23.028 1.00   12.59  ? 144  LEU A N   1 
ATOM   475  C  CA  . LEU A 1 55  ? -11.551 -16.161 -23.309 1.00   13.46  ? 144  LEU A CA  1 
ATOM   476  C  C   . LEU A 1 55  ? -11.594 -17.551 -22.677 1.00   14.54  ? 144  LEU A C   1 
ATOM   477  O  O   . LEU A 1 55  ? -10.653 -18.360 -22.818 1.00   13.86  ? 144  LEU A O   1 
ATOM   478  C  CB  . LEU A 1 55  ? -11.713 -16.283 -24.823 1.00   14.52  ? 144  LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 55  ? -13.000 -16.895 -25.358 1.00   14.87  ? 144  LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 55  ? -14.213 -16.196 -24.763 1.00   14.09  ? 144  LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 55  ? -12.977 -16.759 -26.867 1.00   15.41  ? 144  LEU A CD2 1 
ATOM   482  N  N   . SER A 1 56  ? -12.700 -17.826 -21.991 1.00   14.15  ? 145  SER A N   1 
ATOM   483  C  CA  . SER A 1 56  ? -12.923 -19.132 -21.383 1.00   14.58  ? 145  SER A CA  1 
ATOM   484  C  C   . SER A 1 56  ? -14.347 -19.586 -21.663 1.00   14.41  ? 145  SER A C   1 
ATOM   485  O  O   . SER A 1 56  ? -15.206 -18.775 -22.005 1.00   13.06  ? 145  SER A O   1 
ATOM   486  C  CB  . SER A 1 56  ? -12.692 -19.057 -19.870 1.00   14.51  ? 145  SER A CB  1 
ATOM   487  O  OG  . SER A 1 56  ? -12.703 -20.347 -19.287 1.00   16.24  ? 145  SER A OG  1 
ATOM   488  N  N   . GLN A 1 57  ? -14.590 -20.882 -21.508 1.00   14.62  ? 146  GLN A N   1 
ATOM   489  C  CA  . GLN A 1 57  ? -15.930 -21.430 -21.656 1.00   14.88  ? 146  GLN A CA  1 
ATOM   490  C  C   . GLN A 1 57  ? -16.403 -22.099 -20.357 1.00   14.89  ? 146  GLN A C   1 
ATOM   491  O  O   . GLN A 1 57  ? -17.593 -22.345 -20.175 1.00   14.55  ? 146  GLN A O   1 
ATOM   492  C  CB  . GLN A 1 57  ? -15.985 -22.406 -22.840 1.00   15.23  ? 146  GLN A CB  1 
ATOM   493  C  CG  . GLN A 1 57  ? -16.136 -21.726 -24.193 1.00   16.01  ? 146  GLN A CG  1 
ATOM   494  C  CD  . GLN A 1 57  ? -15.857 -22.653 -25.361 1.00   17.96  ? 146  GLN A CD  1 
ATOM   495  O  OE1 . GLN A 1 57  ? -14.896 -23.431 -25.346 1.00   18.98  ? 146  GLN A OE1 1 
ATOM   496  N  NE2 . GLN A 1 57  ? -16.683 -22.556 -26.398 1.00   18.77  ? 146  GLN A NE2 1 
ATOM   497  N  N   . TRP A 1 58  ? -15.470 -22.346 -19.442 1.00   14.96  ? 147  TRP A N   1 
ATOM   498  C  CA  . TRP A 1 58  ? -15.767 -23.094 -18.223 1.00   15.51  ? 147  TRP A CA  1 
ATOM   499  C  C   . TRP A 1 58  ? -15.364 -22.355 -16.945 1.00   15.17  ? 147  TRP A C   1 
ATOM   500  O  O   . TRP A 1 58  ? -16.078 -21.454 -16.510 1.00   15.10  ? 147  TRP A O   1 
ATOM   501  C  CB  . TRP A 1 58  ? -15.162 -24.507 -18.302 1.00   15.89  ? 147  TRP A CB  1 
ATOM   502  C  CG  . TRP A 1 58  ? -15.745 -25.278 -19.465 1.00   17.68  ? 147  TRP A CG  1 
ATOM   503  C  CD1 . TRP A 1 58  ? -15.150 -25.524 -20.667 1.00   17.35  ? 147  TRP A CD1 1 
ATOM   504  C  CD2 . TRP A 1 58  ? -17.056 -25.842 -19.547 1.00   18.10  ? 147  TRP A CD2 1 
ATOM   505  N  NE1 . TRP A 1 58  ? -15.998 -26.224 -21.482 1.00   17.72  ? 147  TRP A NE1 1 
ATOM   506  C  CE2 . TRP A 1 58  ? -17.177 -26.434 -20.821 1.00   18.59  ? 147  TRP A CE2 1 
ATOM   507  C  CE3 . TRP A 1 58  ? -18.137 -25.915 -18.665 1.00   18.05  ? 147  TRP A CE3 1 
ATOM   508  C  CZ2 . TRP A 1 58  ? -18.335 -27.090 -21.236 1.00   19.09  ? 147  TRP A CZ2 1 
ATOM   509  C  CZ3 . TRP A 1 58  ? -19.290 -26.568 -19.079 1.00   18.68  ? 147  TRP A CZ3 1 
ATOM   510  C  CH2 . TRP A 1 58  ? -19.378 -27.146 -20.351 1.00   19.28  ? 147  TRP A CH2 1 
ATOM   511  N  N   . GLU A 1 59  ? -14.244 -22.730 -16.334 1.00   15.25  ? 148  GLU A N   1 
ATOM   512  C  CA  . GLU A 1 59  ? -13.742 -21.976 -15.178 1.00   15.52  ? 148  GLU A CA  1 
ATOM   513  C  C   . GLU A 1 59  ? -12.336 -21.461 -15.432 1.00   15.13  ? 148  GLU A C   1 
ATOM   514  O  O   . GLU A 1 59  ? -11.481 -22.200 -15.921 1.00   15.69  ? 148  GLU A O   1 
ATOM   515  C  CB  . GLU A 1 59  ? -13.746 -22.830 -13.908 1.00   15.86  ? 148  GLU A CB  1 
ATOM   516  C  CG  . GLU A 1 59  ? -15.110 -23.273 -13.431 1.00   16.19  ? 148  GLU A CG  1 
ATOM   517  C  CD  . GLU A 1 59  ? -15.049 -23.845 -12.027 1.00   17.51  ? 148  GLU A CD  1 
ATOM   518  O  OE1 . GLU A 1 59  ? -15.832 -23.403 -11.168 1.00   17.56  ? 148  GLU A OE1 1 
ATOM   519  O  OE2 . GLU A 1 59  ? -14.199 -24.720 -11.775 1.00   18.37  ? 148  GLU A OE2 1 
ATOM   520  N  N   . ILE A 1 60  ? -12.093 -20.200 -15.088 1.00   14.75  ? 149  ILE A N   1 
ATOM   521  C  CA  . ILE A 1 60  ? -10.770 -19.605 -15.268 1.00   14.74  ? 149  ILE A CA  1 
ATOM   522  C  C   . ILE A 1 60  ? -10.431 -18.577 -14.189 1.00   14.54  ? 149  ILE A C   1 
ATOM   523  O  O   . ILE A 1 60  ? -11.206 -17.662 -13.921 1.00   14.64  ? 149  ILE A O   1 
ATOM   524  C  CB  . ILE A 1 60  ? -10.641 -18.945 -16.663 1.00   14.91  ? 149  ILE A CB  1 
ATOM   525  C  CG1 . ILE A 1 60  ? -9.199  -18.532 -16.940 1.00   15.11  ? 149  ILE A CG1 1 
ATOM   526  C  CG2 . ILE A 1 60  ? -11.569 -17.742 -16.785 1.00   15.45  ? 149  ILE A CG2 1 
ATOM   527  C  CD1 . ILE A 1 60  ? -9.038  -17.902 -18.305 1.00   17.01  ? 149  ILE A CD1 1 
ATOM   528  N  N   . CYS A 1 61  ? -9.274  -18.746 -13.560 1.00   14.60  ? 150  CYS A N   1 
ATOM   529  C  CA  . CYS A 1 61  ? -8.730  -17.727 -12.669 1.00   14.14  ? 150  CYS A CA  1 
ATOM   530  C  C   . CYS A 1 61  ? -7.325  -17.386 -13.146 1.00   13.53  ? 150  CYS A C   1 
ATOM   531  O  O   . CYS A 1 61  ? -6.495  -18.279 -13.311 1.00   12.52  ? 150  CYS A O   1 
ATOM   532  C  CB  . CYS A 1 61  ? -8.701  -18.212 -11.212 1.00   14.27  ? 150  CYS A CB  1 
ATOM   533  S  SG  . CYS A 1 61  ? -10.319 -18.234 -10.414 1.00   16.74  ? 150  CYS A SG  1 
ATOM   534  N  N   . LEU A 1 62  ? -7.074  -16.096 -13.381 1.00   12.73  ? 151  LEU A N   1 
ATOM   535  C  CA  . LEU A 1 62  ? -5.793  -15.639 -13.907 1.00   12.21  ? 151  LEU A CA  1 
ATOM   536  C  C   . LEU A 1 62  ? -5.170  -14.593 -12.995 1.00   12.41  ? 151  LEU A C   1 
ATOM   537  O  O   . LEU A 1 62  ? -5.871  -13.813 -12.360 1.00   11.28  ? 151  LEU A O   1 
ATOM   538  C  CB  . LEU A 1 62  ? -5.959  -15.030 -15.309 1.00   11.58  ? 151  LEU A CB  1 
ATOM   539  C  CG  . LEU A 1 62  ? -6.407  -15.965 -16.431 1.00   12.02  ? 151  LEU A CG  1 
ATOM   540  C  CD1 . LEU A 1 62  ? -6.589  -15.189 -17.712 1.00   11.72  ? 151  LEU A CD1 1 
ATOM   541  C  CD2 . LEU A 1 62  ? -5.411  -17.102 -16.627 1.00   12.13  ? 151  LEU A CD2 1 
ATOM   542  N  N   . SER A 1 63  ? -3.845  -14.554 -12.976 1.00   12.57  ? 152  SER A N   1 
ATOM   543  C  CA  . SER A 1 63  ? -3.141  -13.577 -12.179 1.00   13.49  ? 152  SER A CA  1 
ATOM   544  C  C   . SER A 1 63  ? -1.985  -12.993 -12.978 1.00   13.90  ? 152  SER A C   1 
ATOM   545  O  O   . SER A 1 63  ? -1.310  -13.705 -13.719 1.00   14.88  ? 152  SER A O   1 
ATOM   546  C  CB  . SER A 1 63  ? -2.643  -14.238 -10.893 1.00   13.14  ? 152  SER A CB  1 
ATOM   547  O  OG  . SER A 1 63  ? -2.012  -13.296 -10.054 1.00   15.25  ? 152  SER A OG  1 
ATOM   548  N  N   . ILE A 1 64  ? -1.781  -11.685 -12.864 1.00   14.58  ? 153  ILE A N   1 
ATOM   549  C  CA  . ILE A 1 64  ? -0.593  -11.072 -13.425 1.00   14.00  ? 153  ILE A CA  1 
ATOM   550  C  C   . ILE A 1 64  ? 0.487   -11.184 -12.356 1.00   14.30  ? 153  ILE A C   1 
ATOM   551  O  O   . ILE A 1 64  ? 0.348   -10.641 -11.254 1.00   14.71  ? 153  ILE A O   1 
ATOM   552  C  CB  . ILE A 1 64  ? -0.827  -9.602  -13.820 1.00   14.73  ? 153  ILE A CB  1 
ATOM   553  C  CG1 . ILE A 1 64  ? -1.731  -9.507  -15.056 1.00   13.64  ? 153  ILE A CG1 1 
ATOM   554  C  CG2 . ILE A 1 64  ? 0.498   -8.903  -14.109 1.00   13.24  ? 153  ILE A CG2 1 
ATOM   555  C  CD1 . ILE A 1 64  ? -2.334  -8.132  -15.242 1.00   12.89  ? 153  ILE A CD1 1 
ATOM   556  N  N   . VAL A 1 65  ? 1.534   -11.934 -12.688 1.00   13.63  ? 154  VAL A N   1 
ATOM   557  C  CA  . VAL A 1 65  ? 2.625   -12.243 -11.780 1.00   13.69  ? 154  VAL A CA  1 
ATOM   558  C  C   . VAL A 1 65  ? 3.889   -11.527 -12.261 1.00   13.05  ? 154  VAL A C   1 
ATOM   559  O  O   . VAL A 1 65  ? 4.089   -11.334 -13.465 1.00   10.75  ? 154  VAL A O   1 
ATOM   560  C  CB  . VAL A 1 65  ? 2.896   -13.772 -11.752 1.00   13.87  ? 154  VAL A CB  1 
ATOM   561  C  CG1 . VAL A 1 65  ? 3.876   -14.133 -10.659 1.00   15.12  ? 154  VAL A CG1 1 
ATOM   562  C  CG2 . VAL A 1 65  ? 1.600   -14.540 -11.526 1.00   14.65  ? 154  VAL A CG2 1 
ATOM   563  N  N   . SER A 1 66  ? 4.754   -11.147 -11.333 1.00   12.64  ? 155  SER A N   1 
ATOM   564  C  CA  . SER A 1 66  ? 6.021   -10.561 -11.739 1.00   13.47  ? 155  SER A CA  1 
ATOM   565  C  C   . SER A 1 66  ? 7.157   -11.207 -10.974 1.00   13.88  ? 155  SER A C   1 
ATOM   566  O  O   . SER A 1 66  ? 6.916   -12.013 -10.066 1.00   13.91  ? 155  SER A O   1 
ATOM   567  C  CB  . SER A 1 66  ? 6.019   -9.033  -11.566 1.00   13.70  ? 155  SER A CB  1 
ATOM   568  O  OG  . SER A 1 66  ? 6.118   -8.634  -10.204 1.00   15.64  ? 155  SER A OG  1 
ATOM   569  N  N   . SER A 1 67  ? 8.389   -10.878 -11.357 1.00   13.63  ? 156  SER A N   1 
ATOM   570  C  CA  . SER A 1 67  ? 9.554   -11.315 -10.599 1.00   14.60  ? 156  SER A CA  1 
ATOM   571  C  C   . SER A 1 67  ? 10.667  -10.270 -10.600 1.00   15.54  ? 156  SER A C   1 
ATOM   572  O  O   . SER A 1 67  ? 10.820  -9.499  -11.552 1.00   14.52  ? 156  SER A O   1 
ATOM   573  C  CB  . SER A 1 67  ? 10.076  -12.673 -11.091 1.00   14.39  ? 156  SER A CB  1 
ATOM   574  O  OG  . SER A 1 67  ? 10.782  -12.558 -12.311 1.00   14.30  ? 156  SER A OG  1 
ATOM   575  N  N   . SER A 1 68  ? 11.417  -10.244 -9.506  1.00   16.49  ? 157  SER A N   1 
ATOM   576  C  CA  . SER A 1 68  ? 12.584  -9.388  -9.367  1.00   18.68  ? 157  SER A CA  1 
ATOM   577  C  C   . SER A 1 68  ? 13.714  -10.249 -8.820  1.00   18.78  ? 157  SER A C   1 
ATOM   578  O  O   . SER A 1 68  ? 13.567  -10.891 -7.776  1.00   18.91  ? 157  SER A O   1 
ATOM   579  C  CB  . SER A 1 68  ? 12.305  -8.226  -8.413  1.00   18.82  ? 157  SER A CB  1 
ATOM   580  O  OG  . SER A 1 68  ? 13.303  -7.210  -8.533  1.00   22.31  ? 157  SER A OG  1 
ATOM   581  N  N   . ARG A 1 69  ? 14.830  -10.277 -9.540  1.00   19.73  ? 158  ARG A N   1 
ATOM   582  C  CA  . ARG A 1 69  ? 15.977  -11.092 -9.160  1.00   20.68  ? 158  ARG A CA  1 
ATOM   583  C  C   . ARG A 1 69  ? 15.585  -12.563 -9.103  1.00   21.48  ? 158  ARG A C   1 
ATOM   584  O  O   . ARG A 1 69  ? 16.130  -13.328 -8.304  1.00   21.79  ? 158  ARG A O   1 
ATOM   585  C  CB  . ARG A 1 69  ? 16.533  -10.640 -7.805  1.00   21.43  ? 158  ARG A CB  1 
ATOM   586  C  CG  . ARG A 1 69  ? 16.693  -9.125  -7.667  1.00   22.15  ? 158  ARG A CG  1 
ATOM   587  C  CD  . ARG A 1 69  ? 16.565  -8.709  -6.203  1.00   24.53  ? 158  ARG A CD  1 
ATOM   588  N  NE  . ARG A 1 69  ? 16.910  -7.308  -5.970  1.00   24.60  ? 158  ARG A NE  1 
ATOM   589  C  CZ  . ARG A 1 69  ? 18.157  -6.853  -5.884  1.00   25.98  ? 158  ARG A CZ  1 
ATOM   590  N  NH1 . ARG A 1 69  ? 19.182  -7.682  -6.041  1.00   26.50  ? 158  ARG A NH1 1 
ATOM   591  N  NH2 . ARG A 1 69  ? 18.383  -5.566  -5.656  1.00   26.33  ? 158  ARG A NH2 1 
ATOM   592  N  N   . GLY A 1 70  ? 14.617  -12.948 -9.932  1.00   21.78  ? 159  GLY A N   1 
ATOM   593  C  CA  . GLY A 1 70  ? 14.173  -14.340 -9.999  1.00   22.50  ? 159  GLY A CA  1 
ATOM   594  C  C   . GLY A 1 70  ? 13.217  -14.778 -8.901  1.00   22.52  ? 159  GLY A C   1 
ATOM   595  O  O   . GLY A 1 70  ? 12.680  -15.887 -8.945  1.00   23.71  ? 159  GLY A O   1 
ATOM   596  N  N   . GLN A 1 71  ? 13.003  -13.916 -7.914  1.00   21.31  ? 160  GLN A N   1 
ATOM   597  C  CA  . GLN A 1 71  ? 12.032  -14.191 -6.863  1.00   19.75  ? 160  GLN A CA  1 
ATOM   598  C  C   . GLN A 1 71  ? 10.626  -13.850 -7.353  1.00   18.88  ? 160  GLN A C   1 
ATOM   599  O  O   . GLN A 1 71  ? 10.378  -12.737 -7.823  1.00   17.84  ? 160  GLN A O   1 
ATOM   600  C  CB  . GLN A 1 71  ? 12.369  -13.383 -5.609  1.00   19.53  ? 160  GLN A CB  1 
ATOM   601  C  CG  . GLN A 1 71  ? 13.793  -12.820 -5.219  0.0000 46.65  ? 160  GLN A CG  1 
ATOM   602  C  CD  . GLN A 1 71  ? 14.411  -14.197 -5.383  0.0000 55.29  ? 160  GLN A CD  1 
ATOM   603  O  OE1 . GLN A 1 71  ? 14.098  -15.117 -4.622  0.0000 60.20  ? 160  GLN A OE1 1 
ATOM   604  N  NE2 . GLN A 1 71  ? 15.282  -14.345 -6.374  0.0000 60.61  ? 160  GLN A NE2 1 
ATOM   605  N  N   . VAL A 1 72  ? 9.706   -14.805 -7.239  1.00   17.87  ? 161  VAL A N   1 
ATOM   606  C  CA  . VAL A 1 72  ? 8.359   -14.609 -7.758  1.00   17.61  ? 161  VAL A CA  1 
ATOM   607  C  C   . VAL A 1 72  ? 7.544   -13.701 -6.847  1.00   17.48  ? 161  VAL A C   1 
ATOM   608  O  O   . VAL A 1 72  ? 7.588   -13.844 -5.626  1.00   17.43  ? 161  VAL A O   1 
ATOM   609  C  CB  . VAL A 1 72  ? 7.615   -15.941 -7.943  1.00   17.92  ? 161  VAL A CB  1 
ATOM   610  C  CG1 . VAL A 1 72  ? 6.259   -15.696 -8.571  1.00   16.92  ? 161  VAL A CG1 1 
ATOM   611  C  CG2 . VAL A 1 72  ? 8.440   -16.901 -8.798  1.00   18.71  ? 161  VAL A CG2 1 
ATOM   612  N  N   . ARG A 1 73  ? 6.826   -12.754 -7.451  1.00   16.58  ? 162  ARG A N   1 
ATOM   613  C  CA  . ARG A 1 73  ? 5.952   -11.847 -6.719  1.00   16.37  ? 162  ARG A CA  1 
ATOM   614  C  C   . ARG A 1 73  ? 4.513   -12.019 -7.193  1.00   17.03  ? 162  ARG A C   1 
ATOM   615  O  O   . ARG A 1 73  ? 4.124   -11.486 -8.247  1.00   16.77  ? 162  ARG A O   1 
ATOM   616  C  CB  . ARG A 1 73  ? 6.409   -10.397 -6.906  1.00   16.01  ? 162  ARG A CB  1 
ATOM   617  C  CG  . ARG A 1 73  ? 7.899   -10.196 -6.682  1.00   14.29  ? 162  ARG A CG  1 
ATOM   618  C  CD  . ARG A 1 73  ? 8.282   -8.735  -6.720  1.00   14.07  ? 162  ARG A CD  1 
ATOM   619  N  NE  . ARG A 1 73  ? 8.167   -8.162  -8.059  1.00   14.08  ? 162  ARG A NE  1 
ATOM   620  C  CZ  . ARG A 1 73  ? 8.793   -7.054  -8.445  1.00   13.16  ? 162  ARG A CZ  1 
ATOM   621  N  NH1 . ARG A 1 73  ? 9.574   -6.404  -7.591  1.00   12.66  ? 162  ARG A NH1 1 
ATOM   622  N  NH2 . ARG A 1 73  ? 8.646   -6.603  -9.687  1.00   10.55  ? 162  ARG A NH2 1 
ATOM   623  N  N   . ARG A 1 74  ? 3.733   -12.783 -6.426  1.00   16.98  ? 163  ARG A N   1 
ATOM   624  C  CA  . ARG A 1 74  ? 2.327   -13.014 -6.743  1.00   17.94  ? 163  ARG A CA  1 
ATOM   625  C  C   . ARG A 1 74  ? 1.536   -11.743 -6.498  1.00   17.95  ? 163  ARG A C   1 
ATOM   626  O  O   . ARG A 1 74  ? 1.941   -10.878 -5.711  1.00   17.83  ? 163  ARG A O   1 
ATOM   627  C  CB  . ARG A 1 74  ? 1.738   -14.122 -5.869  1.00   18.67  ? 163  ARG A CB  1 
ATOM   628  C  CG  . ARG A 1 74  ? 2.602   -15.336 -5.707  1.00   19.82  ? 163  ARG A CG  1 
ATOM   629  C  CD  . ARG A 1 74  ? 2.353   -16.332 -6.809  1.00   21.15  ? 163  ARG A CD  1 
ATOM   630  N  NE  . ARG A 1 74  ? 3.396   -17.351 -6.836  1.00   21.95  ? 163  ARG A NE  1 
ATOM   631  C  CZ  . ARG A 1 74  ? 3.514   -18.270 -7.780  1.00   21.72  ? 163  ARG A CZ  1 
ATOM   632  N  NH1 . ARG A 1 74  ? 2.643   -18.308 -8.782  1.00   21.75  ? 163  ARG A NH1 1 
ATOM   633  N  NH2 . ARG A 1 74  ? 4.506   -19.144 -7.720  1.00   21.48  ? 163  ARG A NH2 1 
ATOM   634  N  N   . SER A 1 75  ? 0.384   -11.653 -7.147  1.00   18.17  ? 164  SER A N   1 
ATOM   635  C  CA  . SER A 1 75  ? -0.424  -10.450 -7.100  1.00   17.97  ? 164  SER A CA  1 
ATOM   636  C  C   . SER A 1 75  ? -1.905  -10.804 -7.176  1.00   17.78  ? 164  SER A C   1 
ATOM   637  O  O   . SER A 1 75  ? -2.308  -11.917 -6.816  1.00   17.97  ? 164  SER A O   1 
ATOM   638  C  CB  . SER A 1 75  ? -0.032  -9.522  -8.251  1.00   18.47  ? 164  SER A CB  1 
ATOM   639  O  OG  . SER A 1 75  ? -0.568  -8.220  -8.083  1.00   19.69  ? 164  SER A OG  1 
ATOM   640  N  N   . LEU A 1 76  ? -2.702  -9.858  -7.661  1.00   17.14  ? 165  LEU A N   1 
ATOM   641  C  CA  . LEU A 1 76  ? -4.156  -9.982  -7.674  1.00   17.04  ? 165  LEU A CA  1 
ATOM   642  C  C   . LEU A 1 76  ? -4.599  -11.024 -8.697  1.00   16.08  ? 165  LEU A C   1 
ATOM   643  O  O   . LEU A 1 76  ? -3.854  -11.369 -9.604  1.00   16.89  ? 165  LEU A O   1 
ATOM   644  C  CB  . LEU A 1 76  ? -4.812  -8.633  -8.006  1.00   17.60  ? 165  LEU A CB  1 
ATOM   645  C  CG  . LEU A 1 76  ? -4.737  -7.420  -7.061  1.00   18.06  ? 165  LEU A CG  1 
ATOM   646  C  CD1 A LEU A 1 76  ? -3.322  -6.903  -6.967  0.50   17.89  ? 165  LEU A CD1 1 
ATOM   647  C  CD1 B LEU A 1 76  ? -6.050  -7.169  -6.334  0.50   18.34  ? 165  LEU A CD1 1 
ATOM   648  C  CD2 A LEU A 1 76  ? -5.676  -6.322  -7.553  0.50   17.76  ? 165  LEU A CD2 1 
ATOM   649  C  CD2 B LEU A 1 76  ? -3.578  -7.494  -6.060  0.50   17.23  ? 165  LEU A CD2 1 
ATOM   650  N  N   . GLY A 1 77  ? -5.813  -11.526 -8.540  1.00   14.45  ? 166  GLY A N   1 
ATOM   651  C  CA  . GLY A 1 77  ? -6.359  -12.475 -9.492  1.00   13.15  ? 166  GLY A CA  1 
ATOM   652  C  C   . GLY A 1 77  ? -7.682  -12.004 -10.046 1.00   11.77  ? 166  GLY A C   1 
ATOM   653  O  O   . GLY A 1 77  ? -8.298  -11.066 -9.527  1.00   11.15  ? 166  GLY A O   1 
ATOM   654  N  N   . PHE A 1 78  ? -8.125  -12.657 -11.114 1.00   11.53  ? 167  PHE A N   1 
ATOM   655  C  CA  . PHE A 1 78  ? -9.391  -12.316 -11.743 1.00   10.70  ? 167  PHE A CA  1 
ATOM   656  C  C   . PHE A 1 78  ? -10.003 -13.581 -12.314 1.00   11.19  ? 167  PHE A C   1 
ATOM   657  O  O   . PHE A 1 78  ? -9.309  -14.355 -12.988 1.00   10.70  ? 167  PHE A O   1 
ATOM   658  C  CB  . PHE A 1 78  ? -9.167  -11.279 -12.845 1.00   9.43   ? 167  PHE A CB  1 
ATOM   659  C  CG  . PHE A 1 78  ? -8.555  -10.003 -12.348 1.00   9.41   ? 167  PHE A CG  1 
ATOM   660  C  CD1 . PHE A 1 78  ? -7.178  -9.825  -12.375 1.00   9.40   ? 167  PHE A CD1 1 
ATOM   661  C  CD2 . PHE A 1 78  ? -9.350  -8.994  -11.830 1.00   8.58   ? 167  PHE A CD2 1 
ATOM   662  C  CE1 . PHE A 1 78  ? -6.602  -8.665  -11.905 1.00   8.64   ? 167  PHE A CE1 1 
ATOM   663  C  CE2 . PHE A 1 78  ? -8.784  -7.830  -11.363 1.00   10.32  ? 167  PHE A CE2 1 
ATOM   664  C  CZ  . PHE A 1 78  ? -7.403  -7.664  -11.395 1.00   9.79   ? 167  PHE A CZ  1 
ATOM   665  N  N   . CYS A 1 79  ? -11.298 -13.784 -12.062 1.00   10.86  ? 168  CYS A N   1 
ATOM   666  C  CA  . CYS A 1 79  ? -11.939 -15.062 -12.389 1.00   11.74  ? 168  CYS A CA  1 
ATOM   667  C  C   . CYS A 1 79  ? -13.280 -14.927 -13.118 1.00   11.50  ? 168  CYS A C   1 
ATOM   668  O  O   . CYS A 1 79  ? -14.023 -13.958 -12.917 1.00   11.26  ? 168  CYS A O   1 
ATOM   669  C  CB  . CYS A 1 79  ? -12.155 -15.900 -11.115 1.00   12.30  ? 168  CYS A CB  1 
ATOM   670  S  SG  . CYS A 1 79  ? -10.690 -16.261 -10.058 1.00   14.00  ? 168  CYS A SG  1 
ATOM   671  N  N   . ASP A 1 80  ? -13.574 -15.910 -13.967 1.00   11.55  ? 169  ASP A N   1 
ATOM   672  C  CA  . ASP A 1 80  ? -14.936 -16.153 -14.438 1.00   12.25  ? 169  ASP A CA  1 
ATOM   673  C  C   . ASP A 1 80  ? -15.266 -17.621 -14.181 1.00   12.55  ? 169  ASP A C   1 
ATOM   674  O  O   . ASP A 1 80  ? -14.577 -18.516 -14.678 1.00   12.83  ? 169  ASP A O   1 
ATOM   675  C  CB  . ASP A 1 80  ? -15.096 -15.819 -15.921 1.00   12.38  ? 169  ASP A CB  1 
ATOM   676  C  CG  . ASP A 1 80  ? -16.555 -15.648 -16.322 1.00   12.71  ? 169  ASP A CG  1 
ATOM   677  O  OD1 . ASP A 1 80  ? -17.295 -16.655 -16.368 1.00   13.98  ? 169  ASP A OD1 1 
ATOM   678  O  OD2 . ASP A 1 80  ? -16.966 -14.510 -16.595 1.00   11.57  ? 169  ASP A OD2 1 
ATOM   679  N  N   . THR A 1 81  ? -16.292 -17.870 -13.378 1.00   12.30  ? 170  THR A N   1 
ATOM   680  C  CA  . THR A 1 81  ? -16.637 -19.242 -13.024 1.00   12.77  ? 170  THR A CA  1 
ATOM   681  C  C   . THR A 1 81  ? -18.062 -19.595 -13.457 1.00   13.64  ? 170  THR A C   1 
ATOM   682  O  O   . THR A 1 81  ? -18.693 -20.506 -12.900 1.00   13.60  ? 170  THR A O   1 
ATOM   683  C  CB  . THR A 1 81  ? -16.427 -19.505 -11.525 1.00   12.83  ? 170  THR A CB  1 
ATOM   684  O  OG1 . THR A 1 81  ? -17.238 -18.610 -10.753 1.00   11.00  ? 170  THR A OG1 1 
ATOM   685  C  CG2 . THR A 1 81  ? -14.951 -19.300 -11.159 1.00   13.41  ? 170  THR A CG2 1 
ATOM   686  N  N   . THR A 1 82  ? -18.547 -18.888 -14.479 1.00   13.70  ? 171  THR A N   1 
ATOM   687  C  CA  . THR A 1 82  ? -19.881 -19.125 -15.028 1.00   14.82  ? 171  THR A CA  1 
ATOM   688  C  C   . THR A 1 82  ? -20.074 -20.607 -15.372 1.00   15.38  ? 171  THR A C   1 
ATOM   689  O  O   . THR A 1 82  ? -21.132 -21.178 -15.108 1.00   15.21  ? 171  THR A O   1 
ATOM   690  C  CB  . THR A 1 82  ? -20.148 -18.245 -16.269 1.00   14.92  ? 171  THR A CB  1 
ATOM   691  O  OG1 . THR A 1 82  ? -19.726 -16.900 -16.001 1.00   14.02  ? 171  THR A OG1 1 
ATOM   692  C  CG2 . THR A 1 82  ? -21.629 -18.242 -16.609 1.00   15.00  ? 171  THR A CG2 1 
ATOM   693  N  N   . ASN A 1 83  ? -19.046 -21.221 -15.950 1.00   15.96  ? 172  ASN A N   1 
ATOM   694  C  CA  . ASN A 1 83  ? -19.004 -22.677 -16.134 1.00   16.80  ? 172  ASN A CA  1 
ATOM   695  C  C   . ASN A 1 83  ? -20.227 -23.245 -16.857 1.00   17.62  ? 172  ASN A C   1 
ATOM   696  O  O   . ASN A 1 83  ? -20.827 -24.211 -16.398 1.00   18.51  ? 172  ASN A O   1 
ATOM   697  C  CB  . ASN A 1 83  ? -18.826 -23.354 -14.771 1.00   16.78  ? 172  ASN A CB  1 
ATOM   698  C  CG  . ASN A 1 83  ? -18.215 -24.743 -14.865 1.00   17.20  ? 172  ASN A CG  1 
ATOM   699  O  OD1 . ASN A 1 83  ? -18.544 -25.627 -14.068 1.00   18.60  ? 172  ASN A OD1 1 
ATOM   700  N  ND2 . ASN A 1 83  ? -17.310 -24.936 -15.810 1.00   15.22  ? 172  ASN A ND2 1 
ATOM   701  N  N   . LYS A 1 84  ? -20.607 -22.645 -17.980 1.00   17.93  ? 173  LYS A N   1 
ATOM   702  C  CA  . LYS A 1 84  ? -21.773 -23.118 -18.722 1.00   18.64  ? 173  LYS A CA  1 
ATOM   703  C  C   . LYS A 1 84  ? -21.404 -23.509 -20.148 1.00   18.96  ? 173  LYS A C   1 
ATOM   704  O  O   . LYS A 1 84  ? -22.268 -23.855 -20.945 1.00   19.18  ? 173  LYS A O   1 
ATOM   705  C  CB  . LYS A 1 84  ? -22.877 -22.055 -18.746 1.00   19.54  ? 173  LYS A CB  1 
ATOM   706  C  CG  . LYS A 1 84  ? -23.530 -21.781 -17.395 1.00   20.71  ? 173  LYS A CG  1 
ATOM   707  C  CD  . LYS A 1 84  ? -24.287 -22.997 -16.858 1.00   21.54  ? 173  LYS A CD  1 
ATOM   708  C  CE  . LYS A 1 84  ? -25.046 -22.645 -15.584 1.00   23.10  ? 173  LYS A CE  1 
ATOM   709  N  NZ  . LYS A 1 84  ? -25.940 -23.748 -15.140 1.00   23.13  ? 173  LYS A NZ  1 
ATOM   710  N  N   . GLY A 1 85  ? -20.115 -23.445 -20.463 1.00   18.97  ? 174  GLY A N   1 
ATOM   711  C  CA  . GLY A 1 85  ? -19.628 -23.837 -21.781 1.00   19.23  ? 174  GLY A CA  1 
ATOM   712  C  C   . GLY A 1 85  ? -19.788 -22.783 -22.853 1.00   19.49  ? 174  GLY A C   1 
ATOM   713  O  O   . GLY A 1 85  ? -19.626 -23.070 -24.040 1.00   20.21  ? 174  GLY A O   1 
ATOM   714  N  N   . LEU A 1 86  ? -20.109 -21.559 -22.446 1.00   19.13  ? 175  LEU A N   1 
ATOM   715  C  CA  . LEU A 1 86  ? -20.273 -20.470 -23.398 1.00   18.36  ? 175  LEU A CA  1 
ATOM   716  C  C   . LEU A 1 86  ? -19.202 -19.414 -23.191 1.00   17.37  ? 175  LEU A C   1 
ATOM   717  O  O   . LEU A 1 86  ? -18.747 -19.195 -22.071 1.00   15.87  ? 175  LEU A O   1 
ATOM   718  C  CB  . LEU A 1 86  ? -21.671 -19.856 -23.291 1.00   19.56  ? 175  LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 86  ? -22.840 -20.756 -23.719 1.00   20.71  ? 175  LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 86  ? -24.164 -20.041 -23.552 1.00   21.54  ? 175  LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 86  ? -22.665 -21.239 -25.154 1.00   21.51  ? 175  LEU A CD2 1 
ATOM   722  N  N   . PHE A 1 87  ? -18.795 -18.772 -24.281 1.00   16.49  ? 176  PHE A N   1 
ATOM   723  C  CA  . PHE A 1 87  ? -17.765 -17.737 -24.217 1.00   16.51  ? 176  PHE A CA  1 
ATOM   724  C  C   . PHE A 1 87  ? -18.003 -16.739 -23.087 1.00   15.72  ? 176  PHE A C   1 
ATOM   725  O  O   . PHE A 1 87  ? -19.043 -16.100 -23.023 1.00   15.77  ? 176  PHE A O   1 
ATOM   726  C  CB  . PHE A 1 87  ? -17.691 -16.973 -25.540 1.00   16.58  ? 176  PHE A CB  1 
ATOM   727  C  CG  . PHE A 1 87  ? -17.189 -17.793 -26.689 1.00   16.57  ? 176  PHE A CG  1 
ATOM   728  C  CD1 . PHE A 1 87  ? -17.785 -17.695 -27.931 1.00   16.66  ? 176  PHE A CD1 1 
ATOM   729  C  CD2 . PHE A 1 87  ? -16.112 -18.654 -26.528 1.00   16.16  ? 176  PHE A CD2 1 
ATOM   730  C  CE1 . PHE A 1 87  ? -17.322 -18.439 -28.999 1.00   17.26  ? 176  PHE A CE1 1 
ATOM   731  C  CE2 . PHE A 1 87  ? -15.640 -19.402 -27.590 1.00   16.62  ? 176  PHE A CE2 1 
ATOM   732  C  CZ  . PHE A 1 87  ? -16.242 -19.299 -28.825 1.00   16.64  ? 176  PHE A CZ  1 
ATOM   733  N  N   . GLN A 1 88  ? -17.034 -16.632 -22.189 1.00   15.22  ? 177  GLN A N   1 
ATOM   734  C  CA  . GLN A 1 88  ? -16.973 -15.533 -21.241 1.00   14.83  ? 177  GLN A CA  1 
ATOM   735  C  C   . GLN A 1 88  ? -15.557 -14.961 -21.297 1.00   14.06  ? 177  GLN A C   1 
ATOM   736  O  O   . GLN A 1 88  ? -14.592 -15.711 -21.453 1.00   14.64  ? 177  GLN A O   1 
ATOM   737  C  CB  . GLN A 1 88  ? -17.284 -16.016 -19.823 1.00   14.90  ? 177  GLN A CB  1 
ATOM   738  C  CG  . GLN A 1 88  ? -18.492 -16.937 -19.712 1.00   16.50  ? 177  GLN A CG  1 
ATOM   739  C  CD  . GLN A 1 88  ? -19.813 -16.202 -19.695 1.00   17.34  ? 177  GLN A CD  1 
ATOM   740  O  OE1 . GLN A 1 88  ? -19.863 -14.970 -19.691 1.00   17.74  ? 177  GLN A OE1 1 
ATOM   741  N  NE2 . GLN A 1 88  ? -20.898 -16.960 -19.696 1.00   18.57  ? 177  GLN A NE2 1 
ATOM   742  N  N   . VAL A 1 89  ? -15.431 -13.643 -21.194 1.00   13.23  ? 178  VAL A N   1 
ATOM   743  C  CA  . VAL A 1 89  ? -14.113 -13.003 -21.184 1.00   12.83  ? 178  VAL A CA  1 
ATOM   744  C  C   . VAL A 1 89  ? -13.772 -12.544 -19.776 1.00   13.13  ? 178  VAL A C   1 
ATOM   745  O  O   . VAL A 1 89  ? -14.497 -11.740 -19.172 1.00   13.72  ? 178  VAL A O   1 
ATOM   746  C  CB  . VAL A 1 89  ? -14.023 -11.795 -22.158 1.00   12.58  ? 178  VAL A CB  1 
ATOM   747  C  CG1 . VAL A 1 89  ? -12.715 -11.018 -21.949 1.00   12.22  ? 178  VAL A CG1 1 
ATOM   748  C  CG2 . VAL A 1 89  ? -14.115 -12.259 -23.603 1.00   12.09  ? 178  VAL A CG2 1 
ATOM   749  N  N   . VAL A 1 90  ? -12.680 -13.069 -19.243 1.00   12.23  ? 179  VAL A N   1 
ATOM   750  C  CA  . VAL A 1 90  ? -12.197 -12.610 -17.950 1.00   12.45  ? 179  VAL A CA  1 
ATOM   751  C  C   . VAL A 1 90  ? -11.137 -11.558 -18.246 1.00   12.76  ? 179  VAL A C   1 
ATOM   752  O  O   . VAL A 1 90  ? -10.371 -11.693 -19.205 1.00   13.08  ? 179  VAL A O   1 
ATOM   753  C  CB  . VAL A 1 90  ? -11.619 -13.774 -17.105 1.00   12.53  ? 179  VAL A CB  1 
ATOM   754  C  CG1 . VAL A 1 90  ? -10.354 -14.337 -17.749 1.00   12.87  ? 179  VAL A CG1 1 
ATOM   755  C  CG2 . VAL A 1 90  ? -11.358 -13.334 -15.669 1.00   10.96  ? 179  VAL A CG2 1 
ATOM   756  N  N   . SER A 1 91  ? -11.100 -10.501 -17.444 1.00   12.55  ? 180  SER A N   1 
ATOM   757  C  CA  . SER A 1 91  ? -10.134 -9.437  -17.662 1.00   11.43  ? 180  SER A CA  1 
ATOM   758  C  C   . SER A 1 91  ? -9.544  -8.920  -16.363 1.00   11.12  ? 180  SER A C   1 
ATOM   759  O  O   . SER A 1 91  ? -10.099 -9.111  -15.278 1.00   10.68  ? 180  SER A O   1 
ATOM   760  C  CB  . SER A 1 91  ? -10.765 -8.287  -18.458 1.00   12.19  ? 180  SER A CB  1 
ATOM   761  O  OG  . SER A 1 91  ? -11.912 -7.777  -17.804 1.00   11.56  ? 180  SER A OG  1 
ATOM   762  N  N   . GLY A 1 92  ? -8.393  -8.276  -16.480 1.00   10.81  ? 181  GLY A N   1 
ATOM   763  C  CA  . GLY A 1 92  ? -7.746  -7.669  -15.329 1.00   10.15  ? 181  GLY A CA  1 
ATOM   764  C  C   . GLY A 1 92  ? -6.611  -6.809  -15.831 1.00   10.19  ? 181  GLY A C   1 
ATOM   765  O  O   . GLY A 1 92  ? -6.206  -6.913  -16.991 1.00   9.42   ? 181  GLY A O   1 
ATOM   766  N  N   . GLY A 1 93  ? -6.092  -5.953  -14.962 1.00   10.23  ? 182  GLY A N   1 
ATOM   767  C  CA  . GLY A 1 93  ? -4.994  -5.084  -15.335 1.00   10.17  ? 182  GLY A CA  1 
ATOM   768  C  C   . GLY A 1 93  ? -4.497  -4.327  -14.123 1.00   11.12  ? 182  GLY A C   1 
ATOM   769  O  O   . GLY A 1 93  ? -5.222  -4.197  -13.133 1.00   10.51  ? 182  GLY A O   1 
ATOM   770  N  N   . MET A 1 94  ? -3.266  -3.824  -14.202 1.00   10.98  ? 183  MET A N   1 
ATOM   771  C  CA  . MET A 1 94  ? -2.709  -3.014  -13.125 1.00   12.37  ? 183  MET A CA  1 
ATOM   772  C  C   . MET A 1 94  ? -1.486  -2.228  -13.573 1.00   12.27  ? 183  MET A C   1 
ATOM   773  O  O   . MET A 1 94  ? -0.849  -2.559  -14.583 1.00   12.02  ? 183  MET A O   1 
ATOM   774  C  CB  . MET A 1 94  ? -2.346  -3.892  -11.925 1.00   12.98  ? 183  MET A CB  1 
ATOM   775  C  CG  . MET A 1 94  ? -1.236  -4.912  -12.205 1.00   15.13  ? 183  MET A CG  1 
ATOM   776  S  SD  . MET A 1 94  ? -0.898  -5.994  -10.789 1.00   16.89  ? 183  MET A SD  1 
ATOM   777  C  CE  A MET A 1 94  ? -0.064  -4.871  -9.680  0.50   16.63  ? 183  MET A CE  1 
ATOM   778  C  CE  B MET A 1 94  ? -2.543  -6.621  -10.461 0.50   14.98  ? 183  MET A CE  1 
ATOM   779  N  N   . VAL A 1 95  ? -1.169  -1.184  -12.815 1.00   12.07  ? 184  VAL A N   1 
ATOM   780  C  CA  . VAL A 1 95  ? 0.112   -0.501  -12.941 1.00   11.35  ? 184  VAL A CA  1 
ATOM   781  C  C   . VAL A 1 95  ? 1.120   -1.302  -12.113 1.00   12.26  ? 184  VAL A C   1 
ATOM   782  O  O   . VAL A 1 95  ? 0.815   -1.734  -10.988 1.00   12.49  ? 184  VAL A O   1 
ATOM   783  C  CB  . VAL A 1 95  ? 0.038   0.949   -12.430 1.00   10.98  ? 184  VAL A CB  1 
ATOM   784  C  CG1 . VAL A 1 95  ? 1.405   1.621   -12.492 1.00   10.32  ? 184  VAL A CG1 1 
ATOM   785  C  CG2 . VAL A 1 95  ? -0.990  1.762   -13.223 1.00   9.70   ? 184  VAL A CG2 1 
ATOM   786  N  N   . LEU A 1 96  ? 2.298   -1.536  -12.682 1.00   12.09  ? 185  LEU A N   1 
ATOM   787  C  CA  . LEU A 1 96  ? 3.407   -2.153  -11.943 1.00   11.92  ? 185  LEU A CA  1 
ATOM   788  C  C   . LEU A 1 96  ? 4.641   -1.296  -12.114 1.00   11.43  ? 185  LEU A C   1 
ATOM   789  O  O   . LEU A 1 96  ? 5.028   -0.989  -13.245 1.00   10.13  ? 185  LEU A O   1 
ATOM   790  C  CB  . LEU A 1 96  ? 3.737   -3.541  -12.475 1.00   12.77  ? 185  LEU A CB  1 
ATOM   791  C  CG  . LEU A 1 96  ? 2.999   -4.786  -11.986 1.00   13.71  ? 185  LEU A CG  1 
ATOM   792  C  CD1 . LEU A 1 96  ? 3.391   -5.961  -12.873 1.00   14.19  ? 185  LEU A CD1 1 
ATOM   793  C  CD2 . LEU A 1 96  ? 3.323   -5.070  -10.512 1.00   13.81  ? 185  LEU A CD2 1 
ATOM   794  N  N   . GLN A 1 97  ? 5.256   -0.910  -11.001 1.00   11.00  ? 186  GLN A N   1 
ATOM   795  C  CA  . GLN A 1 97  ? 6.571   -0.269  -11.060 1.00   12.42  ? 186  GLN A CA  1 
ATOM   796  C  C   . GLN A 1 97  ? 7.652   -1.350  -11.169 1.00   12.86  ? 186  GLN A C   1 
ATOM   797  O  O   . GLN A 1 97  ? 7.783   -2.202  -10.282 1.00   12.92  ? 186  GLN A O   1 
ATOM   798  C  CB  . GLN A 1 97  ? 6.822   0.606   -9.830  1.00   12.46  ? 186  GLN A CB  1 
ATOM   799  C  CG  . GLN A 1 97  ? 8.020   1.538   -9.996  1.00   13.42  ? 186  GLN A CG  1 
ATOM   800  C  CD  . GLN A 1 97  ? 8.455   2.179   -8.698  1.00   16.06  ? 186  GLN A CD  1 
ATOM   801  O  OE1 . GLN A 1 97  ? 9.412   2.958   -8.670  1.00   17.81  ? 186  GLN A OE1 1 
ATOM   802  N  NE2 . GLN A 1 97  ? 7.764   1.858   -7.615  1.00   14.34  ? 186  GLN A NE2 1 
ATOM   803  N  N   . LEU A 1 98  ? 8.423   -1.311  -12.253 1.00   12.19  ? 187  LEU A N   1 
ATOM   804  C  CA  . LEU A 1 98  ? 9.405   -2.353  -12.536 1.00   12.03  ? 187  LEU A CA  1 
ATOM   805  C  C   . LEU A 1 98  ? 10.844  -1.832  -12.567 1.00   12.51  ? 187  LEU A C   1 
ATOM   806  O  O   . LEU A 1 98  ? 11.098  -0.680  -12.959 1.00   11.86  ? 187  LEU A O   1 
ATOM   807  C  CB  . LEU A 1 98  ? 9.096   -3.019  -13.887 1.00   11.86  ? 187  LEU A CB  1 
ATOM   808  C  CG  . LEU A 1 98  ? 7.725   -3.670  -14.057 1.00   11.05  ? 187  LEU A CG  1 
ATOM   809  C  CD1 . LEU A 1 98  ? 7.605   -4.307  -15.437 1.00   11.28  ? 187  LEU A CD1 1 
ATOM   810  C  CD2 . LEU A 1 98  ? 7.469   -4.680  -12.946 1.00   11.21  ? 187  LEU A CD2 1 
ATOM   811  N  N   . GLN A 1 99  ? 11.778  -2.694  -12.167 1.00   12.49  ? 188  GLN A N   1 
ATOM   812  C  CA  . GLN A 1 99  ? 13.208  -2.432  -12.348 1.00   14.32  ? 188  GLN A CA  1 
ATOM   813  C  C   . GLN A 1 99  ? 13.759  -3.249  -13.525 1.00   14.16  ? 188  GLN A C   1 
ATOM   814  O  O   . GLN A 1 99  ? 13.171  -4.253  -13.935 1.00   13.53  ? 188  GLN A O   1 
ATOM   815  C  CB  . GLN A 1 99  ? 13.992  -2.762  -11.072 1.00   15.13  ? 188  GLN A CB  1 
ATOM   816  C  CG  . GLN A 1 99  ? 13.537  -1.981  -9.857  1.00   17.41  ? 188  GLN A CG  1 
ATOM   817  C  CD  . GLN A 1 99  ? 14.074  -2.552  -8.552  1.00   20.18  ? 188  GLN A CD  1 
ATOM   818  O  OE1 . GLN A 1 99  ? 15.275  -2.485  -8.281  1.00   21.57  ? 188  GLN A OE1 1 
ATOM   819  N  NE2 . GLN A 1 99  ? 13.179  -3.097  -7.725  1.00   20.97  ? 188  GLN A NE2 1 
ATOM   820  N  N   . GLN A 1 100 ? 14.897  -2.815  -14.054 1.00   14.87  ? 189  GLN A N   1 
ATOM   821  C  CA  . GLN A 1 100 ? 15.531  -3.477  -15.194 1.00   15.30  ? 189  GLN A CA  1 
ATOM   822  C  C   . GLN A 1 100 ? 15.673  -4.979  -14.942 1.00   14.85  ? 189  GLN A C   1 
ATOM   823  O  O   . GLN A 1 100 ? 16.078  -5.414  -13.859 1.00   14.50  ? 189  GLN A O   1 
ATOM   824  C  CB  . GLN A 1 100 ? 16.873  -2.796  -15.477 1.00   16.47  ? 189  GLN A CB  1 
ATOM   825  C  CG  . GLN A 1 100 ? 17.871  -3.563  -16.315 1.00   18.02  ? 189  GLN A CG  1 
ATOM   826  C  CD  . GLN A 1 100 ? 19.294  -3.096  -16.025 1.00   18.97  ? 189  GLN A CD  1 
ATOM   827  O  OE1 . GLN A 1 100 ? 19.951  -3.605  -15.113 1.00   18.87  ? 189  GLN A OE1 1 
ATOM   828  N  NE2 . GLN A 1 100 ? 19.755  -2.095  -16.768 1.00   19.43  ? 189  GLN A NE2 1 
ATOM   829  N  N   . GLY A 1 101 ? 15.273  -5.782  -15.921 1.00   13.94  ? 190  GLY A N   1 
ATOM   830  C  CA  . GLY A 1 101 ? 15.339  -7.231  -15.772 1.00   12.70  ? 190  GLY A CA  1 
ATOM   831  C  C   . GLY A 1 101 ? 14.116  -7.884  -15.154 1.00   12.69  ? 190  GLY A C   1 
ATOM   832  O  O   . GLY A 1 101 ? 13.943  -9.097  -15.271 1.00   12.70  ? 190  GLY A O   1 
ATOM   833  N  N   . ASP A 1 102 ? 13.268  -7.100  -14.480 1.00   12.38  ? 191  ASP A N   1 
ATOM   834  C  CA  . ASP A 1 102 ? 12.035  -7.637  -13.914 1.00   11.31  ? 191  ASP A CA  1 
ATOM   835  C  C   . ASP A 1 102 ? 11.238  -8.315  -15.037 1.00   11.05  ? 191  ASP A C   1 
ATOM   836  O  O   . ASP A 1 102 ? 11.206  -7.814  -16.160 1.00   10.18  ? 191  ASP A O   1 
ATOM   837  C  CB  . ASP A 1 102 ? 11.197  -6.519  -13.285 1.00   11.82  ? 191  ASP A CB  1 
ATOM   838  C  CG  . ASP A 1 102 ? 11.660  -6.146  -11.875 1.00   11.85  ? 191  ASP A CG  1 
ATOM   839  O  OD1 . ASP A 1 102 ? 11.003  -5.283  -11.259 1.00   10.34  ? 191  ASP A OD1 1 
ATOM   840  O  OD2 . ASP A 1 102 ? 12.673  -6.706  -11.385 1.00   13.78  ? 191  ASP A OD2 1 
ATOM   841  N  N   . GLN A 1 103 ? 10.610  -9.449  -14.734 1.00   10.66  ? 192  GLN A N   1 
ATOM   842  C  CA  . GLN A 1 103 ? 9.770   -10.155 -15.707 1.00   11.33  ? 192  GLN A CA  1 
ATOM   843  C  C   . GLN A 1 103 ? 8.308   -10.147 -15.273 1.00   10.56  ? 192  GLN A C   1 
ATOM   844  O  O   . GLN A 1 103 ? 8.000   -10.102 -14.079 1.00   10.07  ? 192  GLN A O   1 
ATOM   845  C  CB  . GLN A 1 103 ? 10.276  -11.586 -15.970 1.00   11.52  ? 192  GLN A CB  1 
ATOM   846  C  CG  . GLN A 1 103 ? 11.615  -11.624 -16.725 1.00   15.39  ? 192  GLN A CG  1 
ATOM   847  C  CD  . GLN A 1 103 ? 12.204  -13.037 -16.895 1.00   17.29  ? 192  GLN A CD  1 
ATOM   848  O  OE1 . GLN A 1 103 ? 11.623  -14.031 -16.460 1.00   19.29  ? 192  GLN A OE1 1 
ATOM   849  N  NE2 . GLN A 1 103 ? 13.373  -13.115 -17.525 1.00   19.23  ? 192  GLN A NE2 1 
ATOM   850  N  N   . VAL A 1 104 ? 7.415   -10.163 -16.257 1.00   9.65   ? 193  VAL A N   1 
ATOM   851  C  CA  . VAL A 1 104 ? 5.983   -10.062 -16.014 1.00   9.51   ? 193  VAL A CA  1 
ATOM   852  C  C   . VAL A 1 104 ? 5.249   -11.065 -16.907 1.00   9.17   ? 193  VAL A C   1 
ATOM   853  O  O   . VAL A 1 104 ? 5.545   -11.181 -18.104 1.00   7.58   ? 193  VAL A O   1 
ATOM   854  C  CB  . VAL A 1 104 ? 5.463   -8.637  -16.302 1.00   9.70   ? 193  VAL A CB  1 
ATOM   855  C  CG1 . VAL A 1 104 ? 3.974   -8.540  -16.028 1.00   10.05  ? 193  VAL A CG1 1 
ATOM   856  C  CG2 . VAL A 1 104 ? 6.222   -7.605  -15.471 1.00   9.91   ? 193  VAL A CG2 1 
ATOM   857  N  N   . TRP A 1 105 ? 4.304   -11.801 -16.329 1.00   9.45   ? 194  TRP A N   1 
ATOM   858  C  CA  . TRP A 1 105 ? 3.577   -12.811 -17.099 1.00   10.84  ? 194  TRP A CA  1 
ATOM   859  C  C   . TRP A 1 105 ? 2.208   -13.132 -16.508 1.00   11.91  ? 194  TRP A C   1 
ATOM   860  O  O   . TRP A 1 105 ? 1.905   -12.766 -15.367 1.00   11.62  ? 194  TRP A O   1 
ATOM   861  C  CB  . TRP A 1 105 ? 4.409   -14.097 -17.220 1.00   10.61  ? 194  TRP A CB  1 
ATOM   862  C  CG  . TRP A 1 105 ? 4.594   -14.834 -15.917 1.00   11.09  ? 194  TRP A CG  1 
ATOM   863  C  CD1 . TRP A 1 105 ? 3.817   -15.845 -15.424 1.00   11.16  ? 194  TRP A CD1 1 
ATOM   864  C  CD2 . TRP A 1 105 ? 5.638   -14.629 -14.956 1.00   11.44  ? 194  TRP A CD2 1 
ATOM   865  N  NE1 . TRP A 1 105 ? 4.312   -16.278 -14.211 1.00   11.94  ? 194  TRP A NE1 1 
ATOM   866  C  CE2 . TRP A 1 105 ? 5.427   -15.544 -13.903 1.00   12.69  ? 194  TRP A CE2 1 
ATOM   867  C  CE3 . TRP A 1 105 ? 6.722   -13.753 -14.877 1.00   12.12  ? 194  TRP A CE3 1 
ATOM   868  C  CZ2 . TRP A 1 105 ? 6.268   -15.604 -12.788 1.00   12.29  ? 194  TRP A CZ2 1 
ATOM   869  C  CZ3 . TRP A 1 105 ? 7.552   -13.818 -13.770 1.00   11.85  ? 194  TRP A CZ3 1 
ATOM   870  C  CH2 . TRP A 1 105 ? 7.322   -14.733 -12.748 1.00   11.80  ? 194  TRP A CH2 1 
ATOM   871  N  N   . VAL A 1 106 ? 1.385   -13.823 -17.296 1.00   12.32  ? 195  VAL A N   1 
ATOM   872  C  CA  . VAL A 1 106 ? 0.067   -14.256 -16.839 1.00   12.32  ? 195  VAL A CA  1 
ATOM   873  C  C   . VAL A 1 106 ? 0.148   -15.715 -16.398 1.00   12.81  ? 195  VAL A C   1 
ATOM   874  O  O   . VAL A 1 106 ? 0.712   -16.559 -17.109 1.00   12.14  ? 195  VAL A O   1 
ATOM   875  C  CB  . VAL A 1 106 ? -0.993  -14.120 -17.952 1.00   12.28  ? 195  VAL A CB  1 
ATOM   876  C  CG1 . VAL A 1 106 ? -2.398  -14.416 -17.410 1.00   11.58  ? 195  VAL A CG1 1 
ATOM   877  C  CG2 . VAL A 1 106 ? -0.939  -12.726 -18.570 1.00   12.05  ? 195  VAL A CG2 1 
ATOM   878  N  N   . GLU A 1 107 ? -0.388  -15.993 -15.211 1.00   12.97  ? 196  GLU A N   1 
ATOM   879  C  CA  . GLU A 1 107 ? -0.473  -17.350 -14.692 1.00   14.23  ? 196  GLU A CA  1 
ATOM   880  C  C   . GLU A 1 107 ? -1.899  -17.740 -14.365 1.00   14.01  ? 196  GLU A C   1 
ATOM   881  O  O   . GLU A 1 107 ? -2.653  -16.945 -13.825 1.00   14.12  ? 196  GLU A O   1 
ATOM   882  C  CB  . GLU A 1 107 ? 0.391   -17.523 -13.441 1.00   15.25  ? 196  GLU A CB  1 
ATOM   883  C  CG  . GLU A 1 107 ? 1.682   -18.241 -13.722 1.00   17.92  ? 196  GLU A CG  1 
ATOM   884  C  CD  . GLU A 1 107 ? 2.435   -18.589 -12.465 1.00   19.42  ? 196  GLU A CD  1 
ATOM   885  O  OE1 . GLU A 1 107 ? 1.801   -19.049 -11.494 1.00   20.93  ? 196  GLU A OE1 1 
ATOM   886  O  OE2 . GLU A 1 107 ? 3.667   -18.413 -12.457 1.00   21.84  ? 196  GLU A OE2 1 
ATOM   887  N  N   . LYS A 1 108 ? -2.257  -18.972 -14.703 1.00   15.01  ? 197  LYS A N   1 
ATOM   888  C  CA  . LYS A 1 108 ? -3.574  -19.508 -14.379 1.00   15.73  ? 197  LYS A CA  1 
ATOM   889  C  C   . LYS A 1 108 ? -3.585  -20.311 -13.088 1.00   16.10  ? 197  LYS A C   1 
ATOM   890  O  O   . LYS A 1 108 ? -2.556  -20.817 -12.639 1.00   16.53  ? 197  LYS A O   1 
ATOM   891  C  CB  . LYS A 1 108 ? -4.099  -20.379 -15.526 1.00   15.85  ? 197  LYS A CB  1 
ATOM   892  C  CG  . LYS A 1 108 ? -3.224  -21.579 -15.860 1.00   16.41  ? 197  LYS A CG  1 
ATOM   893  C  CD  . LYS A 1 108 ? -3.744  -22.305 -17.101 1.00   17.99  ? 197  LYS A CD  1 
ATOM   894  C  CE  . LYS A 1 108 ? -2.817  -23.441 -17.517 1.00   19.23  ? 197  LYS A CE  1 
ATOM   895  N  NZ  . LYS A 1 108 ? -2.654  -24.452 -16.422 1.00   19.97  ? 197  LYS A NZ  1 
ATOM   896  N  N   . ASP A 1 109 ? -4.772  -20.409 -12.504 1.00   16.86  ? 198  ASP A N   1 
ATOM   897  C  CA  . ASP A 1 109 ? -5.053  -21.282 -11.382 1.00   17.70  ? 198  ASP A CA  1 
ATOM   898  C  C   . ASP A 1 109 ? -5.009  -22.734 -11.868 1.00   18.11  ? 198  ASP A C   1 
ATOM   899  O  O   . ASP A 1 109 ? -5.720  -23.100 -12.803 1.00   17.04  ? 198  ASP A O   1 
ATOM   900  C  CB  . ASP A 1 109 ? -6.449  -20.949 -10.855 1.00   18.15  ? 198  ASP A CB  1 
ATOM   901  C  CG  . ASP A 1 109 ? -6.811  -21.718 -9.602  1.00   19.46  ? 198  ASP A CG  1 
ATOM   902  O  OD1 . ASP A 1 109 ? -6.237  -22.796 -9.357  1.00   19.20  ? 198  ASP A OD1 1 
ATOM   903  O  OD2 . ASP A 1 109 ? -7.697  -21.237 -8.865  1.00   20.62  ? 198  ASP A OD2 1 
ATOM   904  N  N   . PRO A 1 110 ? -4.167  -23.567 -11.239 1.00   18.81  ? 199  PRO A N   1 
ATOM   905  C  CA  . PRO A 1 110 ? -4.069  -24.947 -11.689 1.00   19.61  ? 199  PRO A CA  1 
ATOM   906  C  C   . PRO A 1 110 ? -5.403  -25.688 -11.576 1.00   20.40  ? 199  PRO A C   1 
ATOM   907  O  O   . PRO A 1 110 ? -5.613  -26.669 -12.278 1.00   20.84  ? 199  PRO A O   1 
ATOM   908  C  CB  . PRO A 1 110 ? -3.020  -25.559 -10.746 1.00   19.61  ? 199  PRO A CB  1 
ATOM   909  C  CG  . PRO A 1 110 ? -2.958  -24.646 -9.573  1.00   19.47  ? 199  PRO A CG  1 
ATOM   910  C  CD  . PRO A 1 110 ? -3.271  -23.282 -10.103 1.00   19.16  ? 199  PRO A CD  1 
ATOM   911  N  N   . LYS A 1 111 ? -6.303  -25.212 -10.715 1.00   21.10  ? 200  LYS A N   1 
ATOM   912  C  CA  . LYS A 1 111 ? -7.616  -25.841 -10.564 1.00   21.59  ? 200  LYS A CA  1 
ATOM   913  C  C   . LYS A 1 111 ? -8.719  -25.175 -11.386 1.00   21.35  ? 200  LYS A C   1 
ATOM   914  O  O   . LYS A 1 111 ? -9.809  -25.725 -11.524 1.00   21.66  ? 200  LYS A O   1 
ATOM   915  C  CB  . LYS A 1 111 ? -8.017  -25.881 -9.093  1.00   22.54  ? 200  LYS A CB  1 
ATOM   916  C  CG  . LYS A 1 111 ? -7.002  -26.586 -8.220  1.00   24.71  ? 200  LYS A CG  1 
ATOM   917  C  CD  . LYS A 1 111 ? -7.384  -26.503 -6.758  1.00   26.85  ? 200  LYS A CD  1 
ATOM   918  C  CE  . LYS A 1 111 ? -6.336  -27.181 -5.877  1.00   28.16  ? 200  LYS A CE  1 
ATOM   919  N  NZ  . LYS A 1 111 ? -6.669  -27.006 -4.419  1.00   30.20  ? 200  LYS A NZ  1 
ATOM   920  N  N   . LYS A 1 112 ? -8.438  -23.984 -11.908 1.00   20.50  ? 201  LYS A N   1 
ATOM   921  C  CA  . LYS A 1 112 ? -9.378  -23.247 -12.743 1.00   19.28  ? 201  LYS A CA  1 
ATOM   922  C  C   . LYS A 1 112 ? -8.590  -22.589 -13.867 1.00   18.43  ? 201  LYS A C   1 
ATOM   923  O  O   . LYS A 1 112 ? -8.176  -21.435 -13.759 1.00   16.53  ? 201  LYS A O   1 
ATOM   924  C  CB  . LYS A 1 112 ? -10.104 -22.164 -11.935 1.00   19.61  ? 201  LYS A CB  1 
ATOM   925  C  CG  . LYS A 1 112 ? -11.127 -22.654 -10.907 1.00   19.09  ? 201  LYS A CG  1 
ATOM   926  C  CD  . LYS A 1 112 ? -11.422 -21.527 -9.909  1.00   20.50  ? 201  LYS A CD  1 
ATOM   927  C  CE  . LYS A 1 112 ? -12.591 -21.843 -8.997  1.00   20.68  ? 201  LYS A CE  1 
ATOM   928  N  NZ  . LYS A 1 112 ? -12.314 -23.050 -8.180  1.00   21.74  ? 201  LYS A NZ  1 
ATOM   929  N  N   . GLY A 1 113 ? -8.376  -23.335 -14.945 1.00   18.29  ? 202  GLY A N   1 
ATOM   930  C  CA  . GLY A 1 113 ? -7.505  -22.880 -16.010 1.00   18.21  ? 202  GLY A CA  1 
ATOM   931  C  C   . GLY A 1 113 ? -7.975  -23.224 -17.408 1.00   18.72  ? 202  GLY A C   1 
ATOM   932  O  O   . GLY A 1 113 ? -7.167  -23.599 -18.260 1.00   18.64  ? 202  GLY A O   1 
ATOM   933  N  N   . HIS A 1 114 ? -9.275  -23.102 -17.661 1.00   18.32  ? 203  HIS A N   1 
ATOM   934  C  CA  . HIS A 1 114 ? -9.746  -23.297 -19.026 1.00   18.10  ? 203  HIS A CA  1 
ATOM   935  C  C   . HIS A 1 114 ? -9.628  -22.039 -19.866 1.00   17.22  ? 203  HIS A C   1 
ATOM   936  O  O   . HIS A 1 114 ? -10.203 -20.999 -19.557 1.00   16.87  ? 203  HIS A O   1 
ATOM   937  C  CB  . HIS A 1 114 ? -11.179 -23.824 -19.107 1.00   17.85  ? 203  HIS A CB  1 
ATOM   938  C  CG  . HIS A 1 114 ? -11.628 -24.073 -20.514 1.00   18.55  ? 203  HIS A CG  1 
ATOM   939  N  ND1 . HIS A 1 114 ? -12.408 -23.180 -21.221 1.00   18.09  ? 203  HIS A ND1 1 
ATOM   940  C  CD2 . HIS A 1 114 ? -11.369 -25.099 -21.359 1.00   18.16  ? 203  HIS A CD2 1 
ATOM   941  C  CE1 . HIS A 1 114 ? -12.628 -23.657 -22.433 1.00   18.88  ? 203  HIS A CE1 1 
ATOM   942  N  NE2 . HIS A 1 114 ? -12.008 -24.821 -22.543 1.00   18.70  ? 203  HIS A NE2 1 
ATOM   943  N  N   . ILE A 1 115 ? -8.886  -22.166 -20.950 1.00   16.70  ? 204  ILE A N   1 
ATOM   944  C  CA  . ILE A 1 115 ? -8.685  -21.084 -21.877 1.00   16.51  ? 204  ILE A CA  1 
ATOM   945  C  C   . ILE A 1 115 ? -9.097  -21.613 -23.236 1.00   17.24  ? 204  ILE A C   1 
ATOM   946  O  O   . ILE A 1 115 ? -8.585  -22.634 -23.689 1.00   17.42  ? 204  ILE A O   1 
ATOM   947  C  CB  . ILE A 1 115 ? -7.201  -20.644 -21.876 1.00   16.22  ? 204  ILE A CB  1 
ATOM   948  C  CG1 . ILE A 1 115 ? -6.850  -20.000 -20.529 1.00   14.39  ? 204  ILE A CG1 1 
ATOM   949  C  CG2 . ILE A 1 115 ? -6.905  -19.722 -23.057 1.00   15.30  ? 204  ILE A CG2 1 
ATOM   950  C  CD1 . ILE A 1 115 ? -5.365  -19.894 -20.250 1.00   15.56  ? 204  ILE A CD1 1 
ATOM   951  N  N   . TYR A 1 116 ? -10.044 -20.938 -23.874 1.00   17.74  ? 205  TYR A N   1 
ATOM   952  C  CA  . TYR A 1 116 ? -10.536 -21.381 -25.169 1.00   18.39  ? 205  TYR A CA  1 
ATOM   953  C  C   . TYR A 1 116 ? -9.389  -21.526 -26.160 1.00   18.63  ? 205  TYR A C   1 
ATOM   954  O  O   . TYR A 1 116 ? -8.473  -20.708 -26.195 1.00   17.71  ? 205  TYR A O   1 
ATOM   955  C  CB  . TYR A 1 116 ? -11.593 -20.408 -25.700 1.00   18.66  ? 205  TYR A CB  1 
ATOM   956  C  CG  . TYR A 1 116 ? -11.947 -20.610 -27.157 1.00   19.14  ? 205  TYR A CG  1 
ATOM   957  C  CD1 . TYR A 1 116 ? -12.857 -21.586 -27.550 1.00   19.29  ? 205  TYR A CD1 1 
ATOM   958  C  CD2 . TYR A 1 116 ? -11.376 -19.819 -28.142 1.00   19.70  ? 205  TYR A CD2 1 
ATOM   959  C  CE1 . TYR A 1 116 ? -13.182 -21.765 -28.891 1.00   18.23  ? 205  TYR A CE1 1 
ATOM   960  C  CE2 . TYR A 1 116 ? -11.690 -19.992 -29.469 1.00   19.18  ? 205  TYR A CE2 1 
ATOM   961  C  CZ  . TYR A 1 116 ? -12.589 -20.969 -29.840 1.00   19.52  ? 205  TYR A CZ  1 
ATOM   962  O  OH  . TYR A 1 116 ? -12.890 -21.122 -31.181 1.00   20.32  ? 205  TYR A OH  1 
ATOM   963  N  N   . GLN A 1 117 ? -9.442  -22.587 -26.953 1.00   19.65  ? 206  GLN A N   1 
ATOM   964  C  CA  . GLN A 1 117 ? -8.486  -22.798 -28.020 1.00   19.95  ? 206  GLN A CA  1 
ATOM   965  C  C   . GLN A 1 117 ? -9.233  -22.991 -29.333 1.00   20.26  ? 206  GLN A C   1 
ATOM   966  O  O   . GLN A 1 117 ? -9.971  -23.964 -29.501 1.00   19.91  ? 206  GLN A O   1 
ATOM   967  C  CB  . GLN A 1 117 ? -7.614  -24.017 -27.722 1.00   21.17  ? 206  GLN A CB  1 
ATOM   968  C  CG  . GLN A 1 117 ? -6.866  -24.565 -28.936 1.00   22.75  ? 206  GLN A CG  1 
ATOM   969  C  CD  . GLN A 1 117 ? -5.714  -23.675 -29.364 1.00   24.27  ? 206  GLN A CD  1 
ATOM   970  O  OE1 . GLN A 1 117 ? -4.888  -23.275 -28.538 1.00   24.54  ? 206  GLN A OE1 1 
ATOM   971  N  NE2 . GLN A 1 117 ? -5.643  -23.367 -30.663 1.00   23.43  ? 206  GLN A NE2 1 
ATOM   972  N  N   . GLY A 1 118 ? -9.042  -22.062 -30.263 1.00   19.81  ? 207  GLY A N   1 
ATOM   973  C  CA  . GLY A 1 118 ? -9.675  -22.170 -31.571 1.00   20.65  ? 207  GLY A CA  1 
ATOM   974  C  C   . GLY A 1 118 ? -9.623  -20.879 -32.362 1.00   20.88  ? 207  GLY A C   1 
ATOM   975  O  O   . GLY A 1 118 ? -8.907  -19.941 -32.001 1.00   20.50  ? 207  GLY A O   1 
ATOM   976  N  N   . SER A 1 119 ? -10.403 -20.821 -33.433 1.00   21.09  ? 208  SER A N   1 
ATOM   977  C  CA  . SER A 1 119 ? -10.308 -19.702 -34.360 1.00   22.07  ? 208  SER A CA  1 
ATOM   978  C  C   . SER A 1 119 ? -11.518 -18.768 -34.334 1.00   21.71  ? 208  SER A C   1 
ATOM   979  O  O   . SER A 1 119 ? -11.554 -17.794 -35.075 1.00   22.08  ? 208  SER A O   1 
ATOM   980  C  CB  . SER A 1 119 ? -10.063 -20.218 -35.789 1.00   22.97  ? 208  SER A CB  1 
ATOM   981  O  OG  . SER A 1 119 ? -11.180 -20.946 -36.264 1.00   23.42  ? 208  SER A OG  1 
ATOM   982  N  N   . GLU A 1 120 ? -12.499 -19.044 -33.477 1.00   21.31  ? 209  GLU A N   1 
ATOM   983  C  CA  . GLU A 1 120 ? -13.683 -18.184 -33.405 1.00   21.09  ? 209  GLU A CA  1 
ATOM   984  C  C   . GLU A 1 120 ? -13.425 -16.833 -32.730 1.00   19.78  ? 209  GLU A C   1 
ATOM   985  O  O   . GLU A 1 120 ? -14.063 -15.830 -33.057 1.00   19.52  ? 209  GLU A O   1 
ATOM   986  C  CB  . GLU A 1 120 ? -14.835 -18.884 -32.687 1.00   22.20  ? 209  GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 120 ? -15.571 -19.915 -33.526 1.00   25.26  ? 209  GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 120 ? -16.952 -20.214 -32.977 1.00   27.12  ? 209  GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 120 ? -17.794 -19.285 -32.936 1.00   28.11  ? 209  GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 120 ? -17.195 -21.376 -32.586 1.00   28.86  ? 209  GLU A OE2 1 
ATOM   991  N  N   . ALA A 1 121 ? -12.505 -16.812 -31.777 1.00   17.72  ? 210  ALA A N   1 
ATOM   992  C  CA  . ALA A 1 121 ? -12.298 -15.612 -30.986 1.00   15.61  ? 210  ALA A CA  1 
ATOM   993  C  C   . ALA A 1 121 ? -10.935 -15.650 -30.324 1.00   14.10  ? 210  ALA A C   1 
ATOM   994  O  O   . ALA A 1 121 ? -10.294 -16.690 -30.263 1.00   13.29  ? 210  ALA A O   1 
ATOM   995  C  CB  . ALA A 1 121 ? -13.405 -15.462 -29.943 1.00   15.66  ? 210  ALA A CB  1 
ATOM   996  N  N   . ASP A 1 122 ? -10.513 -14.503 -29.811 1.00   13.20  ? 211  ASP A N   1 
ATOM   997  C  CA  . ASP A 1 122 ? -9.142  -14.314 -29.384 1.00   12.86  ? 211  ASP A CA  1 
ATOM   998  C  C   . ASP A 1 122 ? -9.002  -13.986 -27.907 1.00   12.22  ? 211  ASP A C   1 
ATOM   999  O  O   . ASP A 1 122 ? -9.925  -13.457 -27.306 1.00   12.64  ? 211  ASP A O   1 
ATOM   1000 C  CB  . ASP A 1 122 ? -8.521  -13.211 -30.228 1.00   12.31  ? 211  ASP A CB  1 
ATOM   1001 C  CG  . ASP A 1 122 ? -8.205  -13.687 -31.620 1.00   12.89  ? 211  ASP A CG  1 
ATOM   1002 O  OD1 . ASP A 1 122 ? -7.427  -14.656 -31.719 1.00   12.00  ? 211  ASP A OD1 1 
ATOM   1003 O  OD2 . ASP A 1 122 ? -8.748  -13.127 -32.595 1.00   12.44  ? 211  ASP A OD2 1 
ATOM   1004 N  N   . SER A 1 123 ? -7.849  -14.339 -27.338 1.00   11.44  ? 212  SER A N   1 
ATOM   1005 C  CA  . SER A 1 123 ? -7.446  -13.914 -25.995 1.00   10.96  ? 212  SER A CA  1 
ATOM   1006 C  C   . SER A 1 123 ? -6.175  -13.081 -26.162 1.00   10.74  ? 212  SER A C   1 
ATOM   1007 O  O   . SER A 1 123 ? -5.301  -13.443 -26.958 1.00   10.07  ? 212  SER A O   1 
ATOM   1008 C  CB  . SER A 1 123 ? -7.140  -15.118 -25.091 1.00   10.84  ? 212  SER A CB  1 
ATOM   1009 O  OG  . SER A 1 123 ? -8.272  -15.966 -24.929 1.00   12.72  ? 212  SER A OG  1 
ATOM   1010 N  N   . VAL A 1 124 ? -6.055  -12.000 -25.391 1.00   9.74   ? 213  VAL A N   1 
ATOM   1011 C  CA  . VAL A 1 124 ? -4.984  -11.024 -25.592 1.00   9.00   ? 213  VAL A CA  1 
ATOM   1012 C  C   . VAL A 1 124 ? -4.274  -10.672 -24.289 1.00   8.85   ? 213  VAL A C   1 
ATOM   1013 O  O   . VAL A 1 124 ? -4.901  -10.608 -23.217 1.00   7.74   ? 213  VAL A O   1 
ATOM   1014 C  CB  . VAL A 1 124 ? -5.529  -9.708  -26.223 1.00   9.15   ? 213  VAL A CB  1 
ATOM   1015 C  CG1 A VAL A 1 124 ? -4.377  -8.830  -26.730 0.60   8.72   ? 213  VAL A CG1 1 
ATOM   1016 C  CG1 B VAL A 1 124 ? -6.648  -9.136  -25.385 0.40   9.14   ? 213  VAL A CG1 1 
ATOM   1017 C  CG2 A VAL A 1 124 ? -6.521  -10.005 -27.332 0.60   8.86   ? 213  VAL A CG2 1 
ATOM   1018 C  CG2 B VAL A 1 124 ? -4.405  -8.683  -26.419 0.40   8.88   ? 213  VAL A CG2 1 
ATOM   1019 N  N   . PHE A 1 125 ? -2.965  -10.451 -24.396 1.00   8.41   ? 214  PHE A N   1 
ATOM   1020 C  CA  . PHE A 1 125 ? -2.159  -9.914  -23.300 1.00   9.87   ? 214  PHE A CA  1 
ATOM   1021 C  C   . PHE A 1 125 ? -1.383  -8.708  -23.830 1.00   9.63   ? 214  PHE A C   1 
ATOM   1022 O  O   . PHE A 1 125 ? -0.712  -8.803  -24.864 1.00   10.28  ? 214  PHE A O   1 
ATOM   1023 C  CB  . PHE A 1 125 ? -1.228  -11.007 -22.771 1.00   10.46  ? 214  PHE A CB  1 
ATOM   1024 C  CG  . PHE A 1 125 ? -0.327  -10.581 -21.635 1.00   10.73  ? 214  PHE A CG  1 
ATOM   1025 C  CD1 . PHE A 1 125 ? -0.739  -9.658  -20.694 1.00   10.53  ? 214  PHE A CD1 1 
ATOM   1026 C  CD2 . PHE A 1 125 ? 0.928   -11.164 -21.492 1.00   10.20  ? 214  PHE A CD2 1 
ATOM   1027 C  CE1 . PHE A 1 125 ? 0.100   -9.292  -19.639 1.00   11.28  ? 214  PHE A CE1 1 
ATOM   1028 C  CE2 . PHE A 1 125 ? 1.775   -10.808 -20.441 1.00   10.26  ? 214  PHE A CE2 1 
ATOM   1029 C  CZ  . PHE A 1 125 ? 1.362   -9.868  -19.519 1.00   11.12  ? 214  PHE A CZ  1 
ATOM   1030 N  N   . SER A 1 126 ? -1.504  -7.578  -23.136 1.00   8.92   ? 215  SER A N   1 
ATOM   1031 C  CA  . SER A 1 126 ? -0.866  -6.322  -23.533 1.00   9.31   ? 215  SER A CA  1 
ATOM   1032 C  C   . SER A 1 126 ? -0.158  -5.613  -22.378 1.00   9.83   ? 215  SER A C   1 
ATOM   1033 O  O   . SER A 1 126 ? -0.503  -5.794  -21.198 1.00   10.00  ? 215  SER A O   1 
ATOM   1034 C  CB  . SER A 1 126 ? -1.902  -5.350  -24.112 1.00   9.71   ? 215  SER A CB  1 
ATOM   1035 O  OG  . SER A 1 126 ? -2.591  -5.907  -25.223 1.00   10.61  ? 215  SER A OG  1 
ATOM   1036 N  N   . GLY A 1 127 ? 0.802   -4.761  -22.730 1.00   9.34   ? 216  GLY A N   1 
ATOM   1037 C  CA  . GLY A 1 127 ? 1.549   -3.997  -21.737 1.00   10.04  ? 216  GLY A CA  1 
ATOM   1038 C  C   . GLY A 1 127 ? 2.247   -2.822  -22.383 1.00   10.76  ? 216  GLY A C   1 
ATOM   1039 O  O   . GLY A 1 127 ? 2.562   -2.849  -23.577 1.00   10.86  ? 216  GLY A O   1 
ATOM   1040 N  N   . PHE A 1 128 ? 2.468   -1.772  -21.608 1.00   10.82  ? 217  PHE A N   1 
ATOM   1041 C  CA  . PHE A 1 128 ? 3.146   -0.594  -22.137 1.00   10.49  ? 217  PHE A CA  1 
ATOM   1042 C  C   . PHE A 1 128 ? 3.710   0.272   -21.021 1.00   10.98  ? 217  PHE A C   1 
ATOM   1043 O  O   . PHE A 1 128 ? 3.165   0.316   -19.917 1.00   9.40   ? 217  PHE A O   1 
ATOM   1044 C  CB  . PHE A 1 128 ? 2.230   0.211   -23.080 1.00   9.97   ? 217  PHE A CB  1 
ATOM   1045 C  CG  . PHE A 1 128 ? 0.913   0.654   -22.462 1.00   10.23  ? 217  PHE A CG  1 
ATOM   1046 C  CD1 . PHE A 1 128 ? 0.840   1.806   -21.686 1.00   10.84  ? 217  PHE A CD1 1 
ATOM   1047 C  CD2 . PHE A 1 128 ? -0.254  -0.065  -22.690 1.00   10.43  ? 217  PHE A CD2 1 
ATOM   1048 C  CE1 . PHE A 1 128 ? -0.362  2.219   -21.132 1.00   11.92  ? 217  PHE A CE1 1 
ATOM   1049 C  CE2 . PHE A 1 128 ? -1.469  0.341   -22.147 1.00   11.49  ? 217  PHE A CE2 1 
ATOM   1050 C  CZ  . PHE A 1 128 ? -1.527  1.488   -21.370 1.00   12.61  ? 217  PHE A CZ  1 
ATOM   1051 N  N   . LEU A 1 129 ? 4.817   0.948   -21.314 1.00   11.15  ? 218  LEU A N   1 
ATOM   1052 C  CA  . LEU A 1 129 ? 5.393   1.892   -20.369 1.00   11.30  ? 218  LEU A CA  1 
ATOM   1053 C  C   . LEU A 1 129 ? 4.489   3.111   -20.271 1.00   11.29  ? 218  LEU A C   1 
ATOM   1054 O  O   . LEU A 1 129 ? 4.017   3.616   -21.283 1.00   11.26  ? 218  LEU A O   1 
ATOM   1055 C  CB  . LEU A 1 129 ? 6.812   2.286   -20.801 1.00   11.38  ? 218  LEU A CB  1 
ATOM   1056 C  CG  . LEU A 1 129 ? 7.553   3.318   -19.952 1.00   11.86  ? 218  LEU A CG  1 
ATOM   1057 C  CD1 . LEU A 1 129 ? 7.850   2.799   -18.543 1.00   10.57  ? 218  LEU A CD1 1 
ATOM   1058 C  CD2 . LEU A 1 129 ? 8.842   3.758   -20.652 1.00   12.73  ? 218  LEU A CD2 1 
ATOM   1059 N  N   . ILE A 1 130 ? 4.219   3.558   -19.049 1.00   11.31  ? 219  ILE A N   1 
ATOM   1060 C  CA  . ILE A 1 130 ? 3.449   4.774   -18.829 1.00   12.62  ? 219  ILE A CA  1 
ATOM   1061 C  C   . ILE A 1 130 ? 4.426   5.936   -18.713 1.00   14.20  ? 219  ILE A C   1 
ATOM   1062 O  O   . ILE A 1 130 ? 4.301   6.935   -19.419 1.00   14.29  ? 219  ILE A O   1 
ATOM   1063 C  CB  . ILE A 1 130 ? 2.581   4.701   -17.533 1.00   12.28  ? 219  ILE A CB  1 
ATOM   1064 C  CG1 . ILE A 1 130 ? 1.680   3.459   -17.543 1.00   11.76  ? 219  ILE A CG1 1 
ATOM   1065 C  CG2 . ILE A 1 130 ? 1.743   5.975   -17.369 1.00   12.54  ? 219  ILE A CG2 1 
ATOM   1066 C  CD1 . ILE A 1 130 ? 0.862   3.272   -16.260 1.00   10.87  ? 219  ILE A CD1 1 
ATOM   1067 N  N   . PHE A 1 131 ? 5.395   5.799   -17.810 1.00   15.84  ? 220  PHE A N   1 
ATOM   1068 C  CA  . PHE A 1 131 ? 6.514   6.731   -17.735 1.00   18.27  ? 220  PHE A CA  1 
ATOM   1069 C  C   . PHE A 1 131 ? 7.726   6.118   -17.024 1.00   19.33  ? 220  PHE A C   1 
ATOM   1070 O  O   . PHE A 1 131 ? 7.572   5.368   -16.055 1.00   19.17  ? 220  PHE A O   1 
ATOM   1071 C  CB  . PHE A 1 131 ? 6.092   8.064   -17.093 1.00   19.16  ? 220  PHE A CB  1 
ATOM   1072 C  CG  . PHE A 1 131 ? 5.693   7.957   -15.652 1.00   19.53  ? 220  PHE A CG  1 
ATOM   1073 C  CD1 . PHE A 1 131 ? 6.623   8.175   -14.646 1.00   20.99  ? 220  PHE A CD1 1 
ATOM   1074 C  CD2 . PHE A 1 131 ? 4.391   7.662   -15.303 1.00   21.05  ? 220  PHE A CD2 1 
ATOM   1075 C  CE1 . PHE A 1 131 ? 6.258   8.099   -13.307 1.00   21.63  ? 220  PHE A CE1 1 
ATOM   1076 C  CE2 . PHE A 1 131 ? 4.016   7.570   -13.976 1.00   21.76  ? 220  PHE A CE2 1 
ATOM   1077 C  CZ  . PHE A 1 131 ? 4.947   7.790   -12.974 1.00   21.59  ? 220  PHE A CZ  1 
ATOM   1078 N  N   . PRO A 1 132 ? 8.937   6.429   -17.515 1.00   20.42  ? 221  PRO A N   1 
ATOM   1079 C  CA  . PRO A 1 132 ? 10.158  5.922   -16.888 1.00   21.65  ? 221  PRO A CA  1 
ATOM   1080 C  C   . PRO A 1 132 ? 10.459  6.603   -15.556 1.00   23.03  ? 221  PRO A C   1 
ATOM   1081 O  O   . PRO A 1 132 ? 10.048  7.740   -15.327 1.00   24.02  ? 221  PRO A O   1 
ATOM   1082 C  CB  . PRO A 1 132 ? 11.249  6.222   -17.926 1.00   21.30  ? 221  PRO A CB  1 
ATOM   1083 C  CG  . PRO A 1 132 ? 10.730  7.357   -18.715 1.00   21.66  ? 221  PRO A CG  1 
ATOM   1084 C  CD  . PRO A 1 132 ? 9.219   7.255   -18.704 1.00   20.69  ? 221  PRO A CD  1 
ATOM   1085 N  N   . SER A 1 133 ? 11.181  5.905   -14.690 1.00   24.27  ? 222  SER A N   1 
ATOM   1086 C  CA  . SER A 1 133 ? 11.436  6.382   -13.339 1.00   25.38  ? 222  SER A CA  1 
ATOM   1087 C  C   . SER A 1 133 ? 12.869  6.895   -13.178 1.00   26.45  ? 222  SER A C   1 
ATOM   1088 O  O   . SER A 1 133 ? 13.367  7.674   -13.998 1.00   27.68  ? 222  SER A O   1 
ATOM   1089 C  CB  . SER A 1 133 ? 11.179  5.253   -12.347 1.00   25.68  ? 222  SER A CB  1 
ATOM   1090 O  OG  . SER A 1 133 ? 12.045  4.155   -12.605 1.00   26.03  ? 222  SER A OG  1 
ATOM   1091 N  N   . ALA B 2 1   ? 2.134   15.747  -23.745 1.00   56.82  ? 91   ALA B N   1 
ATOM   1092 C  CA  . ALA B 2 1   ? 3.464   16.345  -24.067 1.00   57.10  ? 91   ALA B CA  1 
ATOM   1093 C  C   . ALA B 2 1   ? 3.356   17.397  -25.173 1.00   57.11  ? 91   ALA B C   1 
ATOM   1094 O  O   . ALA B 2 1   ? 3.344   18.598  -24.898 1.00   56.92  ? 91   ALA B O   1 
ATOM   1095 C  CB  . ALA B 2 1   ? 4.459   15.252  -24.458 1.00   57.13  ? 91   ALA B CB  1 
ATOM   1096 N  N   . THR B 2 2   ? 3.290   16.935  -26.420 1.00   57.37  ? 92   THR B N   1 
ATOM   1097 C  CA  . THR B 2 2   ? 3.088   17.817  -27.569 1.00   57.61  ? 92   THR B CA  1 
ATOM   1098 C  C   . THR B 2 2   ? 1.996   17.267  -28.488 1.00   57.68  ? 92   THR B C   1 
ATOM   1099 O  O   . THR B 2 2   ? 0.947   17.891  -28.660 1.00   57.88  ? 92   THR B O   1 
ATOM   1100 C  CB  . THR B 2 2   ? 4.394   18.035  -28.374 1.00   57.71  ? 92   THR B CB  1 
ATOM   1101 O  OG1 . THR B 2 2   ? 5.289   18.860  -27.620 1.00   58.20  ? 92   THR B OG1 1 
ATOM   1102 C  CG2 . THR B 2 2   ? 4.105   18.715  -29.709 1.00   57.56  ? 92   THR B CG2 1 
ATOM   1103 N  N   . GLN B 2 3   ? 2.245   16.097  -29.070 1.00   57.66  ? 93   GLN B N   1 
ATOM   1104 C  CA  . GLN B 2 3   ? 1.307   15.200  -30.128 0.0000 20.00  ? 93   GLN B CA  1 
ATOM   1105 C  C   . GLN B 2 3   ? 0.140   14.577  -29.372 0.0000 20.00  ? 93   GLN B C   1 
ATOM   1106 O  O   . GLN B 2 3   ? 0.730   14.046  -28.939 1.00   45.85  ? 93   GLN B O   1 
ATOM   1107 C  CB  . GLN B 2 3   ? 2.055   14.127  -30.921 0.0000 20.00  ? 93   GLN B CB  1 
ATOM   1108 C  CG  . GLN B 2 3   ? 3.283   14.638  -31.655 0.0000 20.00  ? 93   GLN B CG  1 
ATOM   1109 C  CD  . GLN B 2 3   ? 4.034   13.536  -32.375 0.0000 20.00  ? 93   GLN B CD  1 
ATOM   1110 O  OE1 . GLN B 2 3   ? 3.625   12.376  -32.344 0.0000 20.00  ? 93   GLN B OE1 1 
ATOM   1111 N  NE2 . GLN B 2 3   ? 5.135   13.897  -33.028 0.0000 20.00  ? 93   GLN B NE2 1 
ATOM   1112 N  N   . LYS B 2 4   ? -0.827  15.053  -28.319 1.00   19.19  ? 94   LYS B N   1 
ATOM   1113 C  CA  . LYS B 2 4   ? -1.971  14.845  -27.439 1.00   18.82  ? 94   LYS B CA  1 
ATOM   1114 C  C   . LYS B 2 4   ? -3.133  14.257  -28.230 1.00   18.34  ? 94   LYS B C   1 
ATOM   1115 O  O   . LYS B 2 4   ? -4.032  14.978  -28.675 1.00   18.13  ? 94   LYS B O   1 
ATOM   1116 C  CB  . LYS B 2 4   ? -2.387  16.162  -26.778 1.00   19.72  ? 94   LYS B CB  1 
ATOM   1117 C  CG  . LYS B 2 4   ? -1.241  16.877  -26.058 1.00   20.72  ? 94   LYS B CG  1 
ATOM   1118 C  CD  . LYS B 2 4   ? -1.755  17.950  -25.100 1.00   21.34  ? 94   LYS B CD  1 
ATOM   1119 C  CE  . LYS B 2 4   ? -0.600  18.637  -24.389 1.00   21.65  ? 94   LYS B CE  1 
ATOM   1120 N  NZ  . LYS B 2 4   ? -1.072  19.580  -23.349 1.00   22.21  ? 94   LYS B NZ  1 
ATOM   1121 N  N   . ILE B 2 5   ? -3.106  12.941  -28.416 1.00   16.88  ? 95   ILE B N   1 
ATOM   1122 C  CA  . ILE B 2 5   ? -4.137  12.277  -29.197 1.00   16.46  ? 95   ILE B CA  1 
ATOM   1123 C  C   . ILE B 2 5   ? -4.842  11.221  -28.367 1.00   15.52  ? 95   ILE B C   1 
ATOM   1124 O  O   . ILE B 2 5   ? -4.246  10.220  -27.990 1.00   14.81  ? 95   ILE B O   1 
ATOM   1125 C  CB  . ILE B 2 5   ? -3.553  11.640  -30.469 1.00   16.95  ? 95   ILE B CB  1 
ATOM   1126 C  CG1 . ILE B 2 5   ? -2.681  12.668  -31.206 1.00   17.57  ? 95   ILE B CG1 1 
ATOM   1127 C  CG2 . ILE B 2 5   ? -4.676  11.129  -31.354 1.00   17.06  ? 95   ILE B CG2 1 
ATOM   1128 C  CD1 . ILE B 2 5   ? -1.910  12.106  -32.359 1.00   18.87  ? 95   ILE B CD1 1 
ATOM   1129 N  N   . ALA B 2 6   ? -6.117  11.462  -28.083 1.00   14.49  ? 96   ALA B N   1 
ATOM   1130 C  CA  . ALA B 2 6   ? -6.895  10.561  -27.253 1.00   13.59  ? 96   ALA B CA  1 
ATOM   1131 C  C   . ALA B 2 6   ? -8.367  10.770  -27.527 1.00   12.94  ? 96   ALA B C   1 
ATOM   1132 O  O   . ALA B 2 6   ? -8.819  11.904  -27.651 1.00   13.75  ? 96   ALA B O   1 
ATOM   1133 C  CB  . ALA B 2 6   ? -6.591  10.811  -25.775 1.00   13.11  ? 96   ALA B CB  1 
ATOM   1134 N  N   . PHE B 2 7   ? -9.112  9.677   -27.629 1.00   12.07  ? 97   PHE B N   1 
ATOM   1135 C  CA  . PHE B 2 7   ? -10.553 9.755   -27.816 1.00   11.26  ? 97   PHE B CA  1 
ATOM   1136 C  C   . PHE B 2 7   ? -11.287 8.721   -26.965 1.00   11.29  ? 97   PHE B C   1 
ATOM   1137 O  O   . PHE B 2 7   ? -10.773 7.635   -26.699 1.00   9.79   ? 97   PHE B O   1 
ATOM   1138 C  CB  . PHE B 2 7   ? -10.924 9.577   -29.296 1.00   11.11  ? 97   PHE B CB  1 
ATOM   1139 C  CG  . PHE B 2 7   ? -10.825 8.156   -29.774 1.00   10.95  ? 97   PHE B CG  1 
ATOM   1140 C  CD1 . PHE B 2 7   ? -11.929 7.314   -29.723 1.00   10.52  ? 97   PHE B CD1 1 
ATOM   1141 C  CD2 . PHE B 2 7   ? -9.622  7.657   -30.248 1.00   10.03  ? 97   PHE B CD2 1 
ATOM   1142 C  CE1 . PHE B 2 7   ? -11.837 5.999   -30.152 1.00   10.72  ? 97   PHE B CE1 1 
ATOM   1143 C  CE2 . PHE B 2 7   ? -9.512  6.346   -30.681 1.00   10.40  ? 97   PHE B CE2 1 
ATOM   1144 C  CZ  . PHE B 2 7   ? -10.626 5.509   -30.637 1.00   10.75  ? 97   PHE B CZ  1 
ATOM   1145 N  N   . SER B 2 8   ? -12.491 9.091   -26.536 1.00   11.00  ? 98   SER B N   1 
ATOM   1146 C  CA  . SER B 2 8   ? -13.403 8.202   -25.845 1.00   11.30  ? 98   SER B CA  1 
ATOM   1147 C  C   . SER B 2 8   ? -14.791 8.604   -26.321 1.00   11.39  ? 98   SER B C   1 
ATOM   1148 O  O   . SER B 2 8   ? -15.159 9.768   -26.230 1.00   10.47  ? 98   SER B O   1 
ATOM   1149 C  CB  . SER B 2 8   ? -13.313 8.370   -24.313 1.00   11.60  ? 98   SER B CB  1 
ATOM   1150 O  OG  . SER B 2 8   ? -12.203 7.669   -23.774 1.00   12.26  ? 98   SER B OG  1 
ATOM   1151 N  N   . ALA B 2 9   ? -15.542 7.636   -26.831 1.00   11.25  ? 99   ALA B N   1 
ATOM   1152 C  CA  . ALA B 2 9   ? -16.834 7.896   -27.425 1.00   12.73  ? 99   ALA B CA  1 
ATOM   1153 C  C   . ALA B 2 9   ? -17.808 6.786   -27.064 1.00   13.23  ? 99   ALA B C   1 
ATOM   1154 O  O   . ALA B 2 9   ? -17.472 5.616   -27.178 1.00   13.38  ? 99   ALA B O   1 
ATOM   1155 C  CB  . ALA B 2 9   ? -16.692 8.011   -28.948 1.00   12.88  ? 99   ALA B CB  1 
ATOM   1156 N  N   . THR B 2 10  ? -19.014 7.150   -26.628 1.00   14.00  ? 100  THR B N   1 
ATOM   1157 C  CA  . THR B 2 10  ? -20.038 6.155   -26.290 1.00   15.06  ? 100  THR B CA  1 
ATOM   1158 C  C   . THR B 2 10  ? -21.022 5.927   -27.433 1.00   16.31  ? 100  THR B C   1 
ATOM   1159 O  O   . THR B 2 10  ? -21.148 6.755   -28.330 1.00   15.66  ? 100  THR B O   1 
ATOM   1160 C  CB  . THR B 2 10  ? -20.861 6.575   -25.060 1.00   15.66  ? 100  THR B CB  1 
ATOM   1161 O  OG1 . THR B 2 10  ? -21.458 7.853   -25.306 1.00   16.10  ? 100  THR B OG1 1 
ATOM   1162 C  CG2 . THR B 2 10  ? -19.984 6.652   -23.814 1.00   15.11  ? 100  THR B CG2 1 
ATOM   1163 N  N   . ARG B 2 11  ? -21.738 4.808   -27.380 1.00   17.93  ? 101  ARG B N   1 
ATOM   1164 C  CA  . ARG B 2 11  ? -22.775 4.523   -28.369 1.00   19.70  ? 101  ARG B CA  1 
ATOM   1165 C  C   . ARG B 2 11  ? -24.163 4.756   -27.775 1.00   21.07  ? 101  ARG B C   1 
ATOM   1166 O  O   . ARG B 2 11  ? -24.510 4.178   -26.751 1.00   20.79  ? 101  ARG B O   1 
ATOM   1167 C  CB  . ARG B 2 11  ? -22.639 3.091   -28.906 1.00   19.53  ? 101  ARG B CB  1 
ATOM   1168 C  CG  . ARG B 2 11  ? -23.813 2.625   -29.760 1.00   19.07  ? 101  ARG B CG  1 
ATOM   1169 C  CD  . ARG B 2 11  ? -23.432 1.404   -30.567 1.00   20.31  ? 101  ARG B CD  1 
ATOM   1170 N  NE  . ARG B 2 11  ? -24.544 0.879   -31.359 1.00   20.25  ? 101  ARG B NE  1 
ATOM   1171 C  CZ  . ARG B 2 11  ? -24.726 1.125   -32.650 1.00   19.78  ? 101  ARG B CZ  1 
ATOM   1172 N  NH1 . ARG B 2 11  ? -23.878 1.898   -33.311 1.00   20.10  ? 101  ARG B NH1 1 
ATOM   1173 N  NH2 . ARG B 2 11  ? -25.763 0.599   -33.282 1.00   20.52  ? 101  ARG B NH2 1 
ATOM   1174 N  N   . THR B 2 12  ? -24.951 5.616   -28.412 1.00   23.02  ? 102  THR B N   1 
ATOM   1175 C  CA  . THR B 2 12  ? -26.292 5.919   -27.912 1.00   25.23  ? 102  THR B CA  1 
ATOM   1176 C  C   . THR B 2 12  ? -27.406 5.442   -28.866 1.00   27.05  ? 102  THR B C   1 
ATOM   1177 O  O   . THR B 2 12  ? -28.588 5.595   -28.567 1.00   27.14  ? 102  THR B O   1 
ATOM   1178 C  CB  . THR B 2 12  ? -26.459 7.429   -27.586 1.00   25.06  ? 102  THR B CB  1 
ATOM   1179 O  OG1 . THR B 2 12  ? -26.322 8.206   -28.778 1.00   25.60  ? 102  THR B OG1 1 
ATOM   1180 C  CG2 . THR B 2 12  ? -25.411 7.893   -26.587 1.00   25.27  ? 102  THR B CG2 1 
ATOM   1181 N  N   . ILE B 2 13  ? -27.019 4.842   -29.993 1.00   28.70  ? 103  ILE B N   1 
ATOM   1182 C  CA  . ILE B 2 13  ? -27.970 4.361   -31.003 1.00   30.56  ? 103  ILE B CA  1 
ATOM   1183 C  C   . ILE B 2 13  ? -28.475 2.950   -30.709 1.00   31.49  ? 103  ILE B C   1 
ATOM   1184 O  O   . ILE B 2 13  ? -27.685 2.007   -30.624 1.00   31.72  ? 103  ILE B O   1 
ATOM   1185 C  CB  . ILE B 2 13  ? -27.336 4.344   -32.422 1.00   30.80  ? 103  ILE B CB  1 
ATOM   1186 C  CG1 . ILE B 2 13  ? -26.731 5.706   -32.775 1.00   30.74  ? 103  ILE B CG1 1 
ATOM   1187 C  CG2 . ILE B 2 13  ? -28.355 3.892   -33.472 1.00   31.72  ? 103  ILE B CG2 1 
ATOM   1188 C  CD1 . ILE B 2 13  ? -27.568 6.893   -32.358 1.00   31.50  ? 103  ILE B CD1 1 
ATOM   1189 N  N   . ASN B 2 14  ? -29.793 2.806   -30.578 1.00   32.96  ? 104  ASN B N   1 
ATOM   1190 C  CA  . ASN B 2 14  ? -30.408 1.508   -30.276 1.00   34.12  ? 104  ASN B CA  1 
ATOM   1191 C  C   . ASN B 2 14  ? -30.942 0.763   -31.502 1.00   34.52  ? 104  ASN B C   1 
ATOM   1192 O  O   . ASN B 2 14  ? -31.921 0.015   -31.409 1.00   35.00  ? 104  ASN B O   1 
ATOM   1193 C  CB  . ASN B 2 14  ? -31.520 1.664   -29.234 1.00   34.64  ? 104  ASN B CB  1 
ATOM   1194 C  CG  . ASN B 2 14  ? -31.012 1.512   -27.813 1.00   35.44  ? 104  ASN B CG  1 
ATOM   1195 O  OD1 . ASN B 2 14  ? -29.835 1.745   -27.532 1.00   35.02  ? 104  ASN B OD1 1 
ATOM   1196 N  ND2 . ASN B 2 14  ? -31.901 1.107   -26.907 1.00   36.00  ? 104  ASN B ND2 1 
ATOM   1197 N  N   . VAL B 2 15  ? -30.289 0.968   -32.642 1.00   34.23  ? 105  VAL B N   1 
ATOM   1198 C  CA  . VAL B 2 15  ? -30.653 0.293   -33.879 1.00   33.76  ? 105  VAL B CA  1 
ATOM   1199 C  C   . VAL B 2 15  ? -29.749 -0.920  -34.086 1.00   33.36  ? 105  VAL B C   1 
ATOM   1200 O  O   . VAL B 2 15  ? -28.529 -0.800  -34.028 1.00   32.96  ? 105  VAL B O   1 
ATOM   1201 C  CB  . VAL B 2 15  ? -30.549 1.250   -35.079 1.00   33.95  ? 105  VAL B CB  1 
ATOM   1202 C  CG1 . VAL B 2 15  ? -30.630 0.486   -36.389 1.00   34.47  ? 105  VAL B CG1 1 
ATOM   1203 C  CG2 . VAL B 2 15  ? -31.642 2.317   -34.998 1.00   34.56  ? 105  VAL B CG2 1 
ATOM   1204 N  N   . PRO B 2 16  ? -30.355 -2.097  -34.314 1.00   33.08  ? 106  PRO B N   1 
ATOM   1205 C  CA  . PRO B 2 16  ? -29.632 -3.362  -34.427 1.00   32.81  ? 106  PRO B CA  1 
ATOM   1206 C  C   . PRO B 2 16  ? -28.563 -3.369  -35.525 1.00   32.12  ? 106  PRO B C   1 
ATOM   1207 O  O   . PRO B 2 16  ? -28.798 -2.898  -36.641 1.00   31.58  ? 106  PRO B O   1 
ATOM   1208 C  CB  . PRO B 2 16  ? -30.741 -4.369  -34.752 1.00   33.29  ? 106  PRO B CB  1 
ATOM   1209 C  CG  . PRO B 2 16  ? -31.987 -3.746  -34.210 1.00   33.26  ? 106  PRO B CG  1 
ATOM   1210 C  CD  . PRO B 2 16  ? -31.809 -2.280  -34.454 1.00   33.19  ? 106  PRO B CD  1 
ATOM   1211 N  N   . LEU B 2 17  ? -27.395 -3.909  -35.195 1.00   31.20  ? 107  LEU B N   1 
ATOM   1212 C  CA  . LEU B 2 17  ? -26.281 -3.967  -36.129 1.00   30.33  ? 107  LEU B CA  1 
ATOM   1213 C  C   . LEU B 2 17  ? -26.420 -5.155  -37.075 1.00   29.86  ? 107  LEU B C   1 
ATOM   1214 O  O   . LEU B 2 17  ? -26.961 -6.199  -36.705 1.00   29.14  ? 107  LEU B O   1 
ATOM   1215 C  CB  . LEU B 2 17  ? -24.959 -4.069  -35.361 1.00   30.31  ? 107  LEU B CB  1 
ATOM   1216 C  CG  . LEU B 2 17  ? -24.502 -2.844  -34.563 1.00   30.37  ? 107  LEU B CG  1 
ATOM   1217 C  CD1 . LEU B 2 17  ? -23.526 -3.229  -33.453 1.00   29.91  ? 107  LEU B CD1 1 
ATOM   1218 C  CD2 . LEU B 2 17  ? -23.893 -1.792  -35.488 1.00   30.24  ? 107  LEU B CD2 1 
ATOM   1219 N  N   . ARG B 2 18  ? -25.936 -4.982  -38.302 1.00   29.37  ? 108  ARG B N   1 
ATOM   1220 C  CA  . ARG B 2 18  ? -25.861 -6.077  -39.262 1.00   29.05  ? 108  ARG B CA  1 
ATOM   1221 C  C   . ARG B 2 18  ? -24.408 -6.518  -39.380 1.00   28.67  ? 108  ARG B C   1 
ATOM   1222 O  O   . ARG B 2 18  ? -23.500 -5.753  -39.058 1.00   28.15  ? 108  ARG B O   1 
ATOM   1223 C  CB  . ARG B 2 18  ? -26.404 -5.639  -40.622 1.00   28.96  ? 108  ARG B CB  1 
ATOM   1224 N  N   . ARG B 2 19  ? -24.191 -7.749  -39.834 1.00   28.78  ? 109  ARG B N   1 
ATOM   1225 C  CA  . ARG B 2 19  ? -22.840 -8.288  -39.979 1.00   28.80  ? 109  ARG B CA  1 
ATOM   1226 C  C   . ARG B 2 19  ? -22.005 -7.385  -40.870 1.00   28.84  ? 109  ARG B C   1 
ATOM   1227 O  O   . ARG B 2 19  ? -22.496 -6.878  -41.881 1.00   29.52  ? 109  ARG B O   1 
ATOM   1228 C  CB  . ARG B 2 19  ? -22.878 -9.701  -40.565 1.00   28.82  ? 109  ARG B CB  1 
ATOM   1229 C  CG  . ARG B 2 19  ? -22.473 -10.305 -40.276 0.0000 66.98  ? 109  ARG B CG  1 
ATOM   1230 C  CD  . ARG B 2 19  ? -22.786 -11.631 -40.918 0.0000 78.91  ? 109  ARG B CD  1 
ATOM   1231 N  NE  . ARG B 2 19  ? -21.616 -12.489 -41.070 0.0000 88.46  ? 109  ARG B NE  1 
ATOM   1232 C  CZ  . ARG B 2 19  ? -21.644 -13.704 -41.613 0.0000 97.12  ? 109  ARG B CZ  1 
ATOM   1233 N  NH1 . ARG B 2 19  ? -22.784 -14.219 -42.068 0.0000 100.24 ? 109  ARG B NH1 1 
ATOM   1234 N  NH2 . ARG B 2 19  ? -20.526 -14.412 -41.707 0.0000 100.03 ? 109  ARG B NH2 1 
ATOM   1235 N  N   . ASP B 2 20  ? -20.751 -7.171  -40.482 1.00   28.24  ? 110  ASP B N   1 
ATOM   1236 C  CA  . ASP B 2 20  ? -19.811 -6.385  -41.280 1.00   27.28  ? 110  ASP B CA  1 
ATOM   1237 C  C   . ASP B 2 20  ? -20.037 -4.874  -41.198 1.00   26.33  ? 110  ASP B C   1 
ATOM   1238 O  O   . ASP B 2 20  ? -19.297 -4.095  -41.801 1.00   25.77  ? 110  ASP B O   1 
ATOM   1239 C  CB  . ASP B 2 20  ? -19.832 -6.837  -42.738 1.00   27.99  ? 110  ASP B CB  1 
ATOM   1240 C  CG  . ASP B 2 20  ? -19.424 -8.282  -42.904 1.00   28.93  ? 110  ASP B CG  1 
ATOM   1241 O  OD1 . ASP B 2 20  ? -18.875 -8.867  -41.946 1.00   30.08  ? 110  ASP B OD1 1 
ATOM   1242 O  OD2 . ASP B 2 20  ? -19.644 -8.833  -43.999 1.00   29.03  ? 110  ASP B OD2 1 
ATOM   1243 N  N   . GLN B 2 21  ? -21.049 -4.461  -40.449 1.00   25.25  ? 111  GLN B N   1 
ATOM   1244 C  CA  . GLN B 2 21  ? -21.310 -3.042  -40.258 1.00   24.87  ? 111  GLN B CA  1 
ATOM   1245 C  C   . GLN B 2 21  ? -20.310 -2.415  -39.285 1.00   23.67  ? 111  GLN B C   1 
ATOM   1246 O  O   . GLN B 2 21  ? -20.004 -2.987  -38.243 1.00   23.28  ? 111  GLN B O   1 
ATOM   1247 C  CB  . GLN B 2 21  ? -22.736 -2.838  -39.743 1.00   25.64  ? 111  GLN B CB  1 
ATOM   1248 C  CG  . GLN B 2 21  ? -23.150 -1.385  -39.583 1.00   27.06  ? 111  GLN B CG  1 
ATOM   1249 C  CD  . GLN B 2 21  ? -24.577 -1.244  -39.092 1.00   28.05  ? 111  GLN B CD  1 
ATOM   1250 O  OE1 . GLN B 2 21  ? -25.264 -2.237  -38.836 1.00   29.21  ? 111  GLN B OE1 1 
ATOM   1251 N  NE2 . GLN B 2 21  ? -25.032 -0.006  -38.958 1.00   29.01  ? 111  GLN B NE2 1 
ATOM   1252 N  N   . THR B 2 22  ? -19.815 -1.234  -39.628 1.00   22.40  ? 112  THR B N   1 
ATOM   1253 C  CA  . THR B 2 22  ? -18.959 -0.475  -38.726 1.00   21.73  ? 112  THR B CA  1 
ATOM   1254 C  C   . THR B 2 22  ? -19.758 -0.005  -37.506 1.00   21.07  ? 112  THR B C   1 
ATOM   1255 O  O   . THR B 2 22  ? -20.808 0.619   -37.655 1.00   21.35  ? 112  THR B O   1 
ATOM   1256 C  CB  . THR B 2 22  ? -18.341 0.737   -39.445 1.00   21.68  ? 112  THR B CB  1 
ATOM   1257 O  OG1 . THR B 2 22  ? -17.569 0.286   -40.567 1.00   22.05  ? 112  THR B OG1 1 
ATOM   1258 C  CG2 . THR B 2 22  ? -17.443 1.529   -38.505 1.00   21.84  ? 112  THR B CG2 1 
ATOM   1259 N  N   . ILE B 2 23  ? -19.268 -0.306  -36.305 1.00   19.63  ? 113  ILE B N   1 
ATOM   1260 C  CA  . ILE B 2 23  ? -19.966 0.105   -35.084 1.00   18.50  ? 113  ILE B CA  1 
ATOM   1261 C  C   . ILE B 2 23  ? -19.671 1.563   -34.736 1.00   17.98  ? 113  ILE B C   1 
ATOM   1262 O  O   . ILE B 2 23  ? -18.532 1.941   -34.439 1.00   16.99  ? 113  ILE B O   1 
ATOM   1263 C  CB  . ILE B 2 23  ? -19.632 -0.800  -33.878 1.00   18.46  ? 113  ILE B CB  1 
ATOM   1264 C  CG1 . ILE B 2 23  ? -19.843 -2.274  -34.252 1.00   18.10  ? 113  ILE B CG1 1 
ATOM   1265 C  CG2 . ILE B 2 23  ? -20.498 -0.409  -32.664 1.00   17.48  ? 113  ILE B CG2 1 
ATOM   1266 C  CD1 . ILE B 2 23  ? -19.404 -3.278  -33.195 1.00   17.39  ? 113  ILE B CD1 1 
ATOM   1267 N  N   . ARG B 2 24  ? -20.714 2.377   -34.785 1.00   17.59  ? 114  ARG B N   1 
ATOM   1268 C  CA  . ARG B 2 24  ? -20.576 3.793   -34.542 1.00   18.52  ? 114  ARG B CA  1 
ATOM   1269 C  C   . ARG B 2 24  ? -20.722 4.109   -33.058 1.00   17.98  ? 114  ARG B C   1 
ATOM   1270 O  O   . ARG B 2 24  ? -21.656 3.657   -32.406 1.00   18.87  ? 114  ARG B O   1 
ATOM   1271 C  CB  . ARG B 2 24  ? -21.616 4.574   -35.352 1.00   18.69  ? 114  ARG B CB  1 
ATOM   1272 C  CG  . ARG B 2 24  ? -21.442 6.079   -35.280 1.00   19.76  ? 114  ARG B CG  1 
ATOM   1273 C  CD  . ARG B 2 24  ? -22.531 6.810   -36.058 1.00   21.22  ? 114  ARG B CD  1 
ATOM   1274 N  NE  . ARG B 2 24  ? -22.698 8.183   -35.589 1.00   21.75  ? 114  ARG B NE  1 
ATOM   1275 C  CZ  . ARG B 2 24  ? -23.720 8.965   -35.919 1.00   22.81  ? 114  ARG B CZ  1 
ATOM   1276 N  NH1 . ARG B 2 24  ? -24.678 8.509   -36.717 1.00   22.58  ? 114  ARG B NH1 1 
ATOM   1277 N  NH2 . ARG B 2 24  ? -23.793 10.197  -35.439 1.00   23.47  ? 114  ARG B NH2 1 
ATOM   1278 N  N   . PHE B 2 25  ? -19.779 4.882   -32.538 1.00   17.91  ? 115  PHE B N   1 
ATOM   1279 C  CA  . PHE B 2 25  ? -19.885 5.445   -31.203 1.00   17.23  ? 115  PHE B CA  1 
ATOM   1280 C  C   . PHE B 2 25  ? -20.073 6.953   -31.370 1.00   17.05  ? 115  PHE B C   1 
ATOM   1281 O  O   . PHE B 2 25  ? -19.123 7.706   -31.580 1.00   16.42  ? 115  PHE B O   1 
ATOM   1282 C  CB  . PHE B 2 25  ? -18.647 5.081   -30.368 1.00   17.07  ? 115  PHE B CB  1 
ATOM   1283 C  CG  . PHE B 2 25  ? -18.473 3.595   -30.175 1.00   16.92  ? 115  PHE B CG  1 
ATOM   1284 C  CD1 . PHE B 2 25  ? -17.983 2.800   -31.203 1.00   16.98  ? 115  PHE B CD1 1 
ATOM   1285 C  CD2 . PHE B 2 25  ? -18.813 2.990   -28.972 1.00   16.63  ? 115  PHE B CD2 1 
ATOM   1286 C  CE1 . PHE B 2 25  ? -17.829 1.432   -31.037 1.00   15.47  ? 115  PHE B CE1 1 
ATOM   1287 C  CE2 . PHE B 2 25  ? -18.659 1.626   -28.801 1.00   16.25  ? 115  PHE B CE2 1 
ATOM   1288 C  CZ  . PHE B 2 25  ? -18.167 0.847   -29.842 1.00   16.05  ? 115  PHE B CZ  1 
ATOM   1289 N  N   . ASP B 2 26  ? -21.327 7.379   -31.297 1.00   17.58  ? 116  ASP B N   1 
ATOM   1290 C  CA  . ASP B 2 26  ? -21.723 8.704   -31.774 1.00   18.05  ? 116  ASP B CA  1 
ATOM   1291 C  C   . ASP B 2 26  ? -21.486 9.841   -30.782 1.00   18.14  ? 116  ASP B C   1 
ATOM   1292 O  O   . ASP B 2 26  ? -21.411 11.004  -31.176 1.00   17.42  ? 116  ASP B O   1 
ATOM   1293 C  CB  . ASP B 2 26  ? -23.200 8.676   -32.170 1.00   18.78  ? 116  ASP B CB  1 
ATOM   1294 C  CG  . ASP B 2 26  ? -24.076 8.102   -31.074 1.00   18.57  ? 116  ASP B CG  1 
ATOM   1295 O  OD1 . ASP B 2 26  ? -23.964 6.893   -30.784 1.00   18.81  ? 116  ASP B OD1 1 
ATOM   1296 O  OD2 . ASP B 2 26  ? -24.872 8.863   -30.495 1.00   19.79  ? 116  ASP B OD2 1 
ATOM   1297 N  N   . HIS B 2 27  ? -21.366 9.511   -29.497 1.00   18.22  ? 117  HIS B N   1 
ATOM   1298 C  CA  . HIS B 2 27  ? -21.243 10.536  -28.462 1.00   18.68  ? 117  HIS B CA  1 
ATOM   1299 C  C   . HIS B 2 27  ? -19.822 10.648  -27.923 1.00   18.66  ? 117  HIS B C   1 
ATOM   1300 O  O   . HIS B 2 27  ? -19.392 9.819   -27.119 1.00   18.60  ? 117  HIS B O   1 
ATOM   1301 C  CB  . HIS B 2 27  ? -22.204 10.223  -27.316 1.00   19.24  ? 117  HIS B CB  1 
ATOM   1302 C  CG  . HIS B 2 27  ? -22.118 11.186  -26.173 1.00   21.01  ? 117  HIS B CG  1 
ATOM   1303 N  ND1 . HIS B 2 27  ? -21.348 10.946  -25.055 1.00   21.97  ? 117  HIS B ND1 1 
ATOM   1304 C  CD2 . HIS B 2 27  ? -22.713 12.385  -25.971 1.00   21.60  ? 117  HIS B CD2 1 
ATOM   1305 C  CE1 . HIS B 2 27  ? -21.475 11.955  -24.212 1.00   22.14  ? 117  HIS B CE1 1 
ATOM   1306 N  NE2 . HIS B 2 27  ? -22.301 12.840  -24.742 1.00   22.20  ? 117  HIS B NE2 1 
ATOM   1307 N  N   . VAL B 2 28  ? -19.092 11.677  -28.343 1.00   18.43  ? 118  VAL B N   1 
ATOM   1308 C  CA  . VAL B 2 28  ? -17.733 11.827  -27.856 1.00   18.35  ? 118  VAL B CA  1 
ATOM   1309 C  C   . VAL B 2 28  ? -17.683 12.431  -26.455 1.00   17.68  ? 118  VAL B C   1 
ATOM   1310 O  O   . VAL B 2 28  ? -18.303 13.459  -26.170 1.00   17.66  ? 118  VAL B O   1 
ATOM   1311 C  CB  . VAL B 2 28  ? -16.771 12.539  -28.869 1.00   18.97  ? 118  VAL B CB  1 
ATOM   1312 C  CG1 . VAL B 2 28  ? -17.499 12.965  -30.139 1.00   20.71  ? 118  VAL B CG1 1 
ATOM   1313 C  CG2 . VAL B 2 28  ? -16.008 13.681  -28.218 1.00   18.54  ? 118  VAL B CG2 1 
ATOM   1314 N  N   . ILE B 2 29  ? -16.974 11.742  -25.570 1.00   16.62  ? 119  ILE B N   1 
ATOM   1315 C  CA  . ILE B 2 29  ? -16.663 12.284  -24.257 1.00   15.45  ? 119  ILE B CA  1 
ATOM   1316 C  C   . ILE B 2 29  ? -15.341 13.048  -24.398 1.00   14.93  ? 119  ILE B C   1 
ATOM   1317 O  O   . ILE B 2 29  ? -15.190 14.155  -23.882 1.00   13.94  ? 119  ILE B O   1 
ATOM   1318 C  CB  . ILE B 2 29  ? -16.574 11.160  -23.202 1.00   15.52  ? 119  ILE B CB  1 
ATOM   1319 C  CG1 . ILE B 2 29  ? -17.936 10.447  -23.077 1.00   14.48  ? 119  ILE B CG1 1 
ATOM   1320 C  CG2 . ILE B 2 29  ? -16.094 11.707  -21.857 1.00   15.50  ? 119  ILE B CG2 1 
ATOM   1321 C  CD1 . ILE B 2 29  ? -17.984 9.333   -22.039 1.00   14.11  ? 119  ILE B CD1 1 
ATOM   1322 N  N   . THR B 2 30  ? -14.401 12.445  -25.123 1.00   14.10  ? 120  THR B N   1 
ATOM   1323 C  CA  . THR B 2 30  ? -13.091 13.042  -25.368 1.00   13.92  ? 120  THR B CA  1 
ATOM   1324 C  C   . THR B 2 30  ? -12.671 12.788  -26.813 1.00   13.97  ? 120  THR B C   1 
ATOM   1325 O  O   . THR B 2 30  ? -12.951 11.727  -27.359 1.00   13.87  ? 120  THR B O   1 
ATOM   1326 C  CB  . THR B 2 30  ? -12.021 12.480  -24.397 1.00   13.73  ? 120  THR B CB  1 
ATOM   1327 O  OG1 . THR B 2 30  ? -12.420 12.733  -23.039 1.00   12.71  ? 120  THR B OG1 1 
ATOM   1328 C  CG2 . THR B 2 30  ? -10.668 13.145  -24.635 1.00   13.05  ? 120  THR B CG2 1 
ATOM   1329 N  N   . ASN B 2 31  ? -12.008 13.761  -27.434 1.00   14.56  ? 121  ASN B N   1 
ATOM   1330 C  CA  . ASN B 2 31  ? -11.533 13.608  -28.819 1.00   15.43  ? 121  ASN B CA  1 
ATOM   1331 C  C   . ASN B 2 31  ? -10.407 14.600  -29.133 1.00   15.88  ? 121  ASN B C   1 
ATOM   1332 O  O   . ASN B 2 31  ? -10.501 15.400  -30.075 1.00   17.36  ? 121  ASN B O   1 
ATOM   1333 C  CB  . ASN B 2 31  ? -12.707 13.777  -29.801 1.00   15.17  ? 121  ASN B CB  1 
ATOM   1334 C  CG  . ASN B 2 31  ? -12.368 13.348  -31.235 1.00   15.65  ? 121  ASN B CG  1 
ATOM   1335 O  OD1 . ASN B 2 31  ? -11.323 12.751  -31.504 1.00   14.83  ? 121  ASN B OD1 1 
ATOM   1336 N  ND2 . ASN B 2 31  ? -13.274 13.651  -32.161 1.00   15.25  ? 121  ASN B ND2 1 
ATOM   1337 N  N   . MET B 2 32  ? -9.341  14.545  -28.340 1.00   15.70  ? 122  MET B N   1 
ATOM   1338 C  CA  . MET B 2 32  ? -8.191  15.432  -28.526 1.00   16.33  ? 122  MET B CA  1 
ATOM   1339 C  C   . MET B 2 32  ? -7.441  15.159  -29.838 1.00   16.61  ? 122  MET B C   1 
ATOM   1340 O  O   . MET B 2 32  ? -7.058  14.021  -30.120 1.00   15.90  ? 122  MET B O   1 
ATOM   1341 C  CB  . MET B 2 32  ? -7.243  15.332  -27.330 1.00   15.51  ? 122  MET B CB  1 
ATOM   1342 C  CG  . MET B 2 32  ? -7.885  15.760  -26.002 1.00   17.31  ? 122  MET B CG  1 
ATOM   1343 S  SD  . MET B 2 32  ? -6.730  15.627  -24.622 1.00   18.50  ? 122  MET B SD  1 
ATOM   1344 C  CE  . MET B 2 32  ? -5.520  16.881  -25.051 1.00   16.75  ? 122  MET B CE  1 
ATOM   1345 N  N   . ASN B 2 33  ? -7.239  16.220  -30.620 1.00   17.90  ? 123  ASN B N   1 
ATOM   1346 C  CA  . ASN B 2 33  ? -6.639  16.153  -31.965 1.00   19.14  ? 123  ASN B CA  1 
ATOM   1347 C  C   . ASN B 2 33  ? -7.653  15.751  -33.045 1.00   19.07  ? 123  ASN B C   1 
ATOM   1348 O  O   . ASN B 2 33  ? -7.336  15.725  -34.234 1.00   19.23  ? 123  ASN B O   1 
ATOM   1349 C  CB  . ASN B 2 33  ? -5.400  15.242  -31.986 1.00   19.74  ? 123  ASN B CB  1 
ATOM   1350 C  CG  . ASN B 2 33  ? -4.338  15.703  -32.979 1.00   22.13  ? 123  ASN B CG  1 
ATOM   1351 O  OD1 . ASN B 2 33  ? -3.830  14.905  -33.772 1.00   22.42  ? 123  ASN B OD1 1 
ATOM   1352 N  ND2 . ASN B 2 33  ? -3.988  16.992  -32.931 1.00   22.38  ? 123  ASN B ND2 1 
ATOM   1353 N  N   . ASN B 2 34  ? -8.870  15.429  -32.617 1.00   20.04  ? 124  ASN B N   1 
ATOM   1354 C  CA  . ASN B 2 34  ? -9.975  15.126  -33.529 1.00   20.17  ? 124  ASN B CA  1 
ATOM   1355 C  C   . ASN B 2 34  ? -9.579  14.138  -34.616 1.00   20.02  ? 124  ASN B C   1 
ATOM   1356 O  O   . ASN B 2 34  ? -9.786  14.393  -35.802 1.00   19.28  ? 124  ASN B O   1 
ATOM   1357 C  CB  A ASN B 2 34  ? -10.490 16.413  -34.174 0.50   20.69  ? 124  ASN B CB  1 
ATOM   1358 C  CB  B ASN B 2 34  ? -10.551 16.411  -34.145 0.50   20.70  ? 124  ASN B CB  1 
ATOM   1359 C  CG  A ASN B 2 34  ? -10.886 17.455  -33.153 0.50   20.76  ? 124  ASN B CG  1 
ATOM   1360 C  CG  B ASN B 2 34  ? -11.748 16.148  -35.062 0.50   20.98  ? 124  ASN B CG  1 
ATOM   1361 O  OD1 A ASN B 2 34  ? -11.921 17.337  -32.499 0.50   21.43  ? 124  ASN B OD1 1 
ATOM   1362 O  OD1 B ASN B 2 34  ? -12.623 15.333  -34.756 0.50   20.88  ? 124  ASN B OD1 1 
ATOM   1363 N  ND2 A ASN B 2 34  ? -10.064 18.490  -33.016 0.50   20.65  ? 124  ASN B ND2 1 
ATOM   1364 N  ND2 B ASN B 2 34  ? -11.785 16.845  -36.193 0.50   20.84  ? 124  ASN B ND2 1 
ATOM   1365 N  N   . ASN B 2 35  ? -9.001  13.013  -34.198 1.00   19.11  ? 125  ASN B N   1 
ATOM   1366 C  CA  . ASN B 2 35  ? -8.634  11.945  -35.114 1.00   18.80  ? 125  ASN B CA  1 
ATOM   1367 C  C   . ASN B 2 35  ? -9.673  10.821  -35.082 1.00   18.13  ? 125  ASN B C   1 
ATOM   1368 O  O   . ASN B 2 35  ? -9.594  9.850   -35.835 1.00   16.82  ? 125  ASN B O   1 
ATOM   1369 C  CB  . ASN B 2 35  ? -7.229  11.430  -34.796 1.00   19.50  ? 125  ASN B CB  1 
ATOM   1370 C  CG  . ASN B 2 35  ? -6.147  12.404  -35.219 1.00   20.51  ? 125  ASN B CG  1 
ATOM   1371 O  OD1 . ASN B 2 35  ? -6.266  13.068  -36.249 1.00   22.87  ? 125  ASN B OD1 1 
ATOM   1372 N  ND2 . ASN B 2 35  ? -5.088  12.491  -34.436 1.00   20.25  ? 125  ASN B ND2 1 
ATOM   1373 N  N   . TYR B 2 36  ? -10.659 10.984  -34.209 1.00   17.72  ? 126  TYR B N   1 
ATOM   1374 C  CA  . TYR B 2 36  ? -11.811 10.110  -34.191 1.00   17.60  ? 126  TYR B CA  1 
ATOM   1375 C  C   . TYR B 2 36  ? -13.026 10.787  -34.820 1.00   18.47  ? 126  TYR B C   1 
ATOM   1376 O  O   . TYR B 2 36  ? -13.320 11.961  -34.544 1.00   17.75  ? 126  TYR B O   1 
ATOM   1377 C  CB  . TYR B 2 36  ? -12.133 9.658   -32.769 1.00   17.70  ? 126  TYR B CB  1 
ATOM   1378 C  CG  . TYR B 2 36  ? -13.355 8.793   -32.711 1.00   17.27  ? 126  TYR B CG  1 
ATOM   1379 C  CD1 . TYR B 2 36  ? -13.301 7.458   -33.088 1.00   17.20  ? 126  TYR B CD1 1 
ATOM   1380 C  CD2 . TYR B 2 36  ? -14.579 9.318   -32.310 1.00   18.03  ? 126  TYR B CD2 1 
ATOM   1381 C  CE1 . TYR B 2 36  ? -14.437 6.660   -33.052 1.00   18.13  ? 126  TYR B CE1 1 
ATOM   1382 C  CE2 . TYR B 2 36  ? -15.721 8.531   -32.283 1.00   18.46  ? 126  TYR B CE2 1 
ATOM   1383 C  CZ  . TYR B 2 36  ? -15.644 7.207   -32.654 1.00   18.20  ? 126  TYR B CZ  1 
ATOM   1384 O  OH  . TYR B 2 36  ? -16.782 6.423   -32.618 1.00   20.13  ? 126  TYR B OH  1 
ATOM   1385 N  N   . GLU B 2 37  ? -13.737 10.033  -35.658 1.00   19.10  ? 127  GLU B N   1 
ATOM   1386 C  CA  . GLU B 2 37  ? -14.925 10.540  -36.341 1.00   19.41  ? 127  GLU B CA  1 
ATOM   1387 C  C   . GLU B 2 37  ? -16.188 9.850   -35.825 1.00   19.53  ? 127  GLU B C   1 
ATOM   1388 O  O   . GLU B 2 37  ? -16.437 8.681   -36.133 1.00   19.02  ? 127  GLU B O   1 
ATOM   1389 C  CB  . GLU B 2 37  ? -14.801 10.355  -37.857 1.00   19.86  ? 127  GLU B CB  1 
ATOM   1390 C  CG  . GLU B 2 37  ? -16.024 10.842  -38.627 1.00   21.77  ? 127  GLU B CG  1 
ATOM   1391 C  CD  . GLU B 2 37  ? -16.339 12.293  -38.327 1.00   22.11  ? 127  GLU B CD  1 
ATOM   1392 O  OE1 . GLU B 2 37  ? -15.490 13.144  -38.634 1.00   24.31  ? 127  GLU B OE1 1 
ATOM   1393 O  OE2 . GLU B 2 37  ? -17.418 12.587  -37.780 1.00   23.08  ? 127  GLU B OE2 1 
ATOM   1394 N  N   . PRO B 2 38  ? -16.990 10.583  -35.040 1.00   19.80  ? 128  PRO B N   1 
ATOM   1395 C  CA  . PRO B 2 38  ? -18.213 10.093  -34.405 1.00   20.24  ? 128  PRO B CA  1 
ATOM   1396 C  C   . PRO B 2 38  ? -19.279 9.754   -35.437 1.00   20.69  ? 128  PRO B C   1 
ATOM   1397 O  O   . PRO B 2 38  ? -20.050 8.810   -35.252 1.00   20.84  ? 128  PRO B O   1 
ATOM   1398 C  CB  . PRO B 2 38  ? -18.682 11.278  -33.552 1.00   19.91  ? 128  PRO B CB  1 
ATOM   1399 C  CG  . PRO B 2 38  ? -17.550 12.261  -33.541 1.00   19.97  ? 128  PRO B CG  1 
ATOM   1400 C  CD  . PRO B 2 38  ? -16.727 12.003  -34.747 1.00   19.72  ? 128  PRO B CD  1 
ATOM   1401 N  N   . ARG B 2 39  ? -19.314 10.523  -36.520 1.00   21.38  ? 129  ARG B N   1 
ATOM   1402 C  CA  . ARG B 2 39  ? -20.144 10.022  -37.768 0.0000 24.91  ? 129  ARG B CA  1 
ATOM   1403 C  C   . ARG B 2 39  ? -19.997 8.518   -38.449 1.00   24.17  ? 129  ARG B C   1 
ATOM   1404 O  O   . ARG B 2 39  ? -20.903 7.995   -39.089 1.00   23.78  ? 129  ARG B O   1 
ATOM   1405 C  CB  . ARG B 2 39  ? -20.025 11.081  -38.865 0.0000 25.14  ? 129  ARG B CB  1 
ATOM   1406 C  CG  . ARG B 2 39  ? -20.347 12.517  -38.433 0.0000 27.15  ? 129  ARG B CG  1 
ATOM   1407 C  CD  . ARG B 2 39  ? -20.256 13.473  -39.632 0.0000 27.71  ? 129  ARG B CD  1 
ATOM   1408 N  NE  . ARG B 2 39  ? -20.892 14.766  -39.379 0.0000 31.51  ? 129  ARG B NE  1 
ATOM   1409 C  CZ  . ARG B 2 39  ? -21.241 15.634  -40.329 0.0000 32.57  ? 129  ARG B CZ  1 
ATOM   1410 N  NH1 . ARG B 2 39  ? -21.025 15.351  -41.608 0.0000 33.36  ? 129  ARG B NH1 1 
ATOM   1411 N  NH2 . ARG B 2 39  ? -21.811 16.786  -40.003 0.0000 32.82  ? 129  ARG B NH2 1 
ATOM   1412 N  N   . SER B 2 40  ? -18.787 7.980   -38.361 1.00   23.94  ? 130  SER B N   1 
ATOM   1413 C  CA  . SER B 2 40  ? -18.527 6.635   -38.860 1.00   23.81  ? 130  SER B CA  1 
ATOM   1414 C  C   . SER B 2 40  ? -18.188 5.657   -37.741 1.00   23.63  ? 130  SER B C   1 
ATOM   1415 O  O   . SER B 2 40  ? -18.549 4.480   -37.820 1.00   24.34  ? 130  SER B O   1 
ATOM   1416 C  CB  . SER B 2 40  ? -17.413 6.645   -39.908 1.00   23.61  ? 130  SER B CB  1 
ATOM   1417 O  OG  . SER B 2 40  ? -16.220 7.205   -39.391 1.00   23.74  ? 130  SER B OG  1 
ATOM   1418 N  N   . GLY B 2 41  ? -17.507 6.148   -36.702 1.00   22.25  ? 131  GLY B N   1 
ATOM   1419 C  CA  . GLY B 2 41  ? -17.016 5.295   -35.631 1.00   19.91  ? 131  GLY B CA  1 
ATOM   1420 C  C   . GLY B 2 41  ? -15.569 4.865   -35.837 1.00   19.46  ? 131  GLY B C   1 
ATOM   1421 O  O   . GLY B 2 41  ? -15.035 4.056   -35.075 1.00   18.81  ? 131  GLY B O   1 
ATOM   1422 N  N   . LYS B 2 42  ? -14.922 5.419   -36.859 1.00   18.10  ? 132  LYS B N   1 
ATOM   1423 C  CA  . LYS B 2 42  ? -13.535 5.068   -37.154 1.00   17.38  ? 132  LYS B CA  1 
ATOM   1424 C  C   . LYS B 2 42  ? -12.527 6.063   -36.595 1.00   16.77  ? 132  LYS B C   1 
ATOM   1425 O  O   . LYS B 2 42  ? -12.763 7.275   -36.584 1.00   16.23  ? 132  LYS B O   1 
ATOM   1426 C  CB  . LYS B 2 42  ? -13.332 4.953   -38.671 1.00   17.61  ? 132  LYS B CB  1 
ATOM   1427 C  CG  . LYS B 2 42  ? -14.141 3.857   -39.320 1.00   17.54  ? 132  LYS B CG  1 
ATOM   1428 C  CD  . LYS B 2 42  ? -13.950 3.844   -40.828 1.00   20.42  ? 132  LYS B CD  1 
ATOM   1429 C  CE  . LYS B 2 42  ? -14.696 2.685   -41.461 1.00   19.96  ? 132  LYS B CE  1 
ATOM   1430 N  NZ  . LYS B 2 42  ? -14.278 2.480   -42.876 1.00   23.00  ? 132  LYS B NZ  1 
ATOM   1431 N  N   . PHE B 2 43  ? -11.393 5.542   -36.139 1.00   16.28  ? 133  PHE B N   1 
ATOM   1432 C  CA  . PHE B 2 43  ? -10.249 6.379   -35.829 1.00   17.04  ? 133  PHE B CA  1 
ATOM   1433 C  C   . PHE B 2 43  ? -9.369  6.382   -37.075 1.00   17.06  ? 133  PHE B C   1 
ATOM   1434 O  O   . PHE B 2 43  ? -9.257  5.375   -37.757 1.00   16.89  ? 133  PHE B O   1 
ATOM   1435 C  CB  . PHE B 2 43  ? -9.489  5.831   -34.610 1.00   17.04  ? 133  PHE B CB  1 
ATOM   1436 C  CG  . PHE B 2 43  ? -8.163  6.500   -34.361 1.00   17.55  ? 133  PHE B CG  1 
ATOM   1437 C  CD1 . PHE B 2 43  ? -8.097  7.709   -33.680 1.00   17.46  ? 133  PHE B CD1 1 
ATOM   1438 C  CD2 . PHE B 2 43  ? -6.979  5.913   -34.802 1.00   17.05  ? 133  PHE B CD2 1 
ATOM   1439 C  CE1 . PHE B 2 43  ? -6.877  8.327   -33.442 1.00   18.00  ? 133  PHE B CE1 1 
ATOM   1440 C  CE2 . PHE B 2 43  ? -5.755  6.525   -34.576 1.00   17.01  ? 133  PHE B CE2 1 
ATOM   1441 C  CZ  . PHE B 2 43  ? -5.706  7.741   -33.893 1.00   17.89  ? 133  PHE B CZ  1 
ATOM   1442 N  N   . THR B 2 44  ? -8.763  7.514   -37.393 1.00   18.19  ? 134  THR B N   1 
ATOM   1443 C  CA  . THR B 2 44  ? -7.858  7.563   -38.533 1.00   18.59  ? 134  THR B CA  1 
ATOM   1444 C  C   . THR B 2 44  ? -6.567  8.218   -38.086 1.00   18.85  ? 134  THR B C   1 
ATOM   1445 O  O   . THR B 2 44  ? -6.567  9.359   -37.618 1.00   18.58  ? 134  THR B O   1 
ATOM   1446 C  CB  . THR B 2 44  ? -8.468  8.320   -39.729 1.00   19.08  ? 134  THR B CB  1 
ATOM   1447 O  OG1 . THR B 2 44  ? -9.690  7.685   -40.131 1.00   19.91  ? 134  THR B OG1 1 
ATOM   1448 C  CG2 . THR B 2 44  ? -7.499  8.333   -40.911 1.00   19.44  ? 134  THR B CG2 1 
ATOM   1449 N  N   . CYS B 2 45  ? -5.468  7.485   -38.225 1.00   19.15  ? 135  CYS B N   1 
ATOM   1450 C  CA  . CYS B 2 45  ? -4.170  7.939   -37.734 1.00   19.99  ? 135  CYS B CA  1 
ATOM   1451 C  C   . CYS B 2 45  ? -3.586  9.098   -38.542 1.00   20.52  ? 135  CYS B C   1 
ATOM   1452 O  O   . CYS B 2 45  ? -3.496  9.032   -39.770 1.00   20.06  ? 135  CYS B O   1 
ATOM   1453 C  CB  . CYS B 2 45  ? -3.188  6.761   -37.699 1.00   19.76  ? 135  CYS B CB  1 
ATOM   1454 S  SG  . CYS B 2 45  ? -1.473  7.200   -37.326 1.00   20.38  ? 135  CYS B SG  1 
ATOM   1455 N  N   . LYS B 2 46  ? -3.203  10.157  -37.833 1.00   21.40  ? 136  LYS B N   1 
ATOM   1456 C  CA  . LYS B 2 46  ? -2.476  11.288  -38.401 1.00   22.41  ? 136  LYS B CA  1 
ATOM   1457 C  C   . LYS B 2 46  ? -0.997  11.124  -38.111 1.00   22.66  ? 136  LYS B C   1 
ATOM   1458 O  O   . LYS B 2 46  ? -0.156  11.194  -39.000 1.00   23.93  ? 136  LYS B O   1 
ATOM   1459 C  CB  . LYS B 2 46  ? -2.905  12.581  -37.719 1.00   23.13  ? 136  LYS B CB  1 
ATOM   1460 C  CG  . LYS B 2 46  ? -3.841  13.478  -38.488 1.00   24.11  ? 136  LYS B CG  1 
ATOM   1461 C  CD  . LYS B 2 46  ? -3.825  14.856  -37.825 1.00   25.47  ? 136  LYS B CD  1 
ATOM   1462 C  CE  . LYS B 2 46  ? -5.199  15.521  -37.820 1.00   25.34  ? 136  LYS B CE  1 
ATOM   1463 N  NZ  . LYS B 2 46  ? -5.346  16.414  -36.631 1.00   25.51  ? 136  LYS B NZ  1 
ATOM   1464 N  N   . VAL B 2 47  ? -0.693  10.923  -36.837 1.00   22.10  ? 137  VAL B N   1 
ATOM   1465 C  CA  . VAL B 2 47  ? 0.676   10.815  -36.367 1.00   21.78  ? 137  VAL B CA  1 
ATOM   1466 C  C   . VAL B 2 47  ? 1.021   9.349   -36.185 1.00   21.17  ? 137  VAL B C   1 
ATOM   1467 O  O   . VAL B 2 47  ? 0.383   8.660   -35.386 1.00   20.97  ? 137  VAL B O   1 
ATOM   1468 C  CB  . VAL B 2 47  ? 0.845   11.543  -35.027 1.00   21.79  ? 137  VAL B CB  1 
ATOM   1469 C  CG1 . VAL B 2 47  ? 2.275   11.401  -34.513 1.00   23.04  ? 137  VAL B CG1 1 
ATOM   1470 C  CG2 . VAL B 2 47  ? 0.455   13.015  -35.172 1.00   21.93  ? 137  VAL B CG2 1 
ATOM   1471 N  N   . PRO B 2 48  ? 2.025   8.859   -36.933 1.00   20.55  ? 138  PRO B N   1 
ATOM   1472 C  CA  . PRO B 2 48  ? 2.417   7.458   -36.830 1.00   19.81  ? 138  PRO B CA  1 
ATOM   1473 C  C   . PRO B 2 48  ? 2.973   7.139   -35.454 1.00   18.79  ? 138  PRO B C   1 
ATOM   1474 O  O   . PRO B 2 48  ? 3.651   7.967   -34.850 1.00   19.10  ? 138  PRO B O   1 
ATOM   1475 C  CB  . PRO B 2 48  ? 3.524   7.332   -37.871 1.00   19.60  ? 138  PRO B CB  1 
ATOM   1476 C  CG  . PRO B 2 48  ? 4.079   8.714   -37.976 1.00   20.79  ? 138  PRO B CG  1 
ATOM   1477 C  CD  . PRO B 2 48  ? 2.857   9.578   -37.908 1.00   20.70  ? 138  PRO B CD  1 
ATOM   1478 N  N   . GLY B 2 49  ? 2.697   5.939   -34.964 1.00   18.26  ? 139  GLY B N   1 
ATOM   1479 C  CA  . GLY B 2 49  ? 3.233   5.533   -33.679 1.00   16.75  ? 139  GLY B CA  1 
ATOM   1480 C  C   . GLY B 2 49  ? 2.432   4.435   -33.017 1.00   15.99  ? 139  GLY B C   1 
ATOM   1481 O  O   . GLY B 2 49  ? 1.587   3.789   -33.644 1.00   14.92  ? 139  GLY B O   1 
ATOM   1482 N  N   . LEU B 2 50  ? 2.728   4.222   -31.739 1.00   15.37  ? 140  LEU B N   1 
ATOM   1483 C  CA  . LEU B 2 50  ? 2.048   3.229   -30.930 1.00   15.04  ? 140  LEU B CA  1 
ATOM   1484 C  C   . LEU B 2 50  ? 0.797   3.807   -30.292 1.00   14.31  ? 140  LEU B C   1 
ATOM   1485 O  O   . LEU B 2 50  ? 0.840   4.864   -29.665 1.00   14.60  ? 140  LEU B O   1 
ATOM   1486 C  CB  . LEU B 2 50  ? 2.993   2.733   -29.837 1.00   15.15  ? 140  LEU B CB  1 
ATOM   1487 C  CG  . LEU B 2 50  ? 4.143   1.870   -30.349 1.00   15.94  ? 140  LEU B CG  1 
ATOM   1488 C  CD1 . LEU B 2 50  ? 5.286   1.924   -29.369 1.00   16.61  ? 140  LEU B CD1 1 
ATOM   1489 C  CD2 . LEU B 2 50  ? 3.680   0.421   -30.581 1.00   15.14  ? 140  LEU B CD2 1 
ATOM   1490 N  N   . TYR B 2 51  ? -0.315  3.101   -30.455 1.00   14.74  ? 141  TYR B N   1 
ATOM   1491 C  CA  . TYR B 2 51  ? -1.583  3.470   -29.839 1.00   14.27  ? 141  TYR B CA  1 
ATOM   1492 C  C   . TYR B 2 51  ? -2.083  2.294   -29.012 1.00   14.86  ? 141  TYR B C   1 
ATOM   1493 O  O   . TYR B 2 51  ? -1.708  1.148   -29.271 1.00   15.63  ? 141  TYR B O   1 
ATOM   1494 C  CB  . TYR B 2 51  ? -2.619  3.824   -30.912 1.00   14.68  ? 141  TYR B CB  1 
ATOM   1495 C  CG  . TYR B 2 51  ? -2.323  5.119   -31.638 1.00   14.83  ? 141  TYR B CG  1 
ATOM   1496 C  CD1 . TYR B 2 51  ? -1.333  5.181   -32.614 1.00   15.24  ? 141  TYR B CD1 1 
ATOM   1497 C  CD2 . TYR B 2 51  ? -3.020  6.284   -31.335 1.00   14.91  ? 141  TYR B CD2 1 
ATOM   1498 C  CE1 . TYR B 2 51  ? -1.046  6.366   -33.272 1.00   15.94  ? 141  TYR B CE1 1 
ATOM   1499 C  CE2 . TYR B 2 51  ? -2.740  7.472   -31.982 1.00   15.91  ? 141  TYR B CE2 1 
ATOM   1500 C  CZ  . TYR B 2 51  ? -1.755  7.503   -32.953 1.00   16.50  ? 141  TYR B CZ  1 
ATOM   1501 O  OH  . TYR B 2 51  ? -1.475  8.680   -33.596 1.00   18.00  ? 141  TYR B OH  1 
ATOM   1502 N  N   . TYR B 2 52  ? -2.907  2.576   -28.008 1.00   13.75  ? 142  TYR B N   1 
ATOM   1503 C  CA  . TYR B 2 52  ? -3.639  1.532   -27.313 1.00   13.16  ? 142  TYR B CA  1 
ATOM   1504 C  C   . TYR B 2 52  ? -5.114  1.793   -27.552 1.00   12.86  ? 142  TYR B C   1 
ATOM   1505 O  O   . TYR B 2 52  ? -5.583  2.923   -27.398 1.00   12.67  ? 142  TYR B O   1 
ATOM   1506 C  CB  . TYR B 2 52  ? -3.329  1.523   -25.814 1.00   13.47  ? 142  TYR B CB  1 
ATOM   1507 C  CG  . TYR B 2 52  ? -4.143  0.521   -24.996 1.00   13.85  ? 142  TYR B CG  1 
ATOM   1508 C  CD1 . TYR B 2 52  ? -4.021  -0.848  -25.208 1.00   13.09  ? 142  TYR B CD1 1 
ATOM   1509 C  CD2 . TYR B 2 52  ? -5.017  0.950   -23.998 1.00   14.70  ? 142  TYR B CD2 1 
ATOM   1510 C  CE1 . TYR B 2 52  ? -4.752  -1.761  -24.456 1.00   13.67  ? 142  TYR B CE1 1 
ATOM   1511 C  CE2 . TYR B 2 52  ? -5.757  0.042   -23.239 1.00   13.83  ? 142  TYR B CE2 1 
ATOM   1512 C  CZ  . TYR B 2 52  ? -5.613  -1.309  -23.471 1.00   14.30  ? 142  TYR B CZ  1 
ATOM   1513 O  OH  . TYR B 2 52  ? -6.345  -2.215  -22.737 1.00   14.34  ? 142  TYR B OH  1 
ATOM   1514 N  N   . PHE B 2 53  ? -5.832  0.750   -27.956 1.00   12.20  ? 143  PHE B N   1 
ATOM   1515 C  CA  . PHE B 2 53  ? -7.253  0.844   -28.229 1.00   12.00  ? 143  PHE B CA  1 
ATOM   1516 C  C   . PHE B 2 53  ? -7.989  -0.059  -27.266 1.00   13.03  ? 143  PHE B C   1 
ATOM   1517 O  O   . PHE B 2 53  ? -7.543  -1.175  -26.993 1.00   12.88  ? 143  PHE B O   1 
ATOM   1518 C  CB  . PHE B 2 53  ? -7.553  0.404   -29.665 1.00   11.98  ? 143  PHE B CB  1 
ATOM   1519 C  CG  . PHE B 2 53  ? -6.994  1.333   -30.704 1.00   12.57  ? 143  PHE B CG  1 
ATOM   1520 C  CD1 . PHE B 2 53  ? -5.756  1.088   -31.275 1.00   12.16  ? 143  PHE B CD1 1 
ATOM   1521 C  CD2 . PHE B 2 53  ? -7.690  2.477   -31.077 1.00   12.57  ? 143  PHE B CD2 1 
ATOM   1522 C  CE1 . PHE B 2 53  ? -5.237  1.954   -32.215 1.00   12.30  ? 143  PHE B CE1 1 
ATOM   1523 C  CE2 . PHE B 2 53  ? -7.174  3.348   -32.022 1.00   12.35  ? 143  PHE B CE2 1 
ATOM   1524 C  CZ  . PHE B 2 53  ? -5.945  3.089   -32.585 1.00   11.63  ? 143  PHE B CZ  1 
ATOM   1525 N  N   . THR B 2 54  ? -9.122  0.412   -26.756 1.00   13.06  ? 144  THR B N   1 
ATOM   1526 C  CA  . THR B 2 54  ? -9.894  -0.399  -25.848 1.00   13.42  ? 144  THR B CA  1 
ATOM   1527 C  C   . THR B 2 54  ? -11.389 -0.100  -25.920 1.00   13.07  ? 144  THR B C   1 
ATOM   1528 O  O   . THR B 2 54  ? -11.801 1.007   -26.252 1.00   12.92  ? 144  THR B O   1 
ATOM   1529 C  CB  . THR B 2 54  ? -9.381  -0.243  -24.384 1.00   13.84  ? 144  THR B CB  1 
ATOM   1530 O  OG1 . THR B 2 54  ? -10.275 -0.920  -23.504 1.00   16.24  ? 144  THR B OG1 1 
ATOM   1531 C  CG2 . THR B 2 54  ? -9.301  1.218   -23.977 1.00   13.29  ? 144  THR B CG2 1 
ATOM   1532 N  N   . TYR B 2 55  ? -12.203 -1.093  -25.597 1.00   12.59  ? 145  TYR B N   1 
ATOM   1533 C  CA  . TYR B 2 55  ? -13.637 -0.868  -25.536 1.00   12.51  ? 145  TYR B CA  1 
ATOM   1534 C  C   . TYR B 2 55  ? -14.251 -1.642  -24.391 1.00   12.15  ? 145  TYR B C   1 
ATOM   1535 O  O   . TYR B 2 55  ? -13.670 -2.615  -23.902 1.00   12.63  ? 145  TYR B O   1 
ATOM   1536 C  CB  . TYR B 2 55  ? -14.322 -1.250  -26.856 1.00   12.18  ? 145  TYR B CB  1 
ATOM   1537 C  CG  . TYR B 2 55  ? -14.490 -2.735  -27.048 1.00   13.69  ? 145  TYR B CG  1 
ATOM   1538 C  CD1 . TYR B 2 55  ? -15.673 -3.368  -26.701 1.00   14.55  ? 145  TYR B CD1 1 
ATOM   1539 C  CD2 . TYR B 2 55  ? -13.466 -3.505  -27.586 1.00   14.40  ? 145  TYR B CD2 1 
ATOM   1540 C  CE1 . TYR B 2 55  ? -15.831 -4.740  -26.870 1.00   15.83  ? 145  TYR B CE1 1 
ATOM   1541 C  CE2 . TYR B 2 55  ? -13.612 -4.870  -27.762 1.00   15.59  ? 145  TYR B CE2 1 
ATOM   1542 C  CZ  . TYR B 2 55  ? -14.800 -5.481  -27.396 1.00   16.45  ? 145  TYR B CZ  1 
ATOM   1543 O  OH  . TYR B 2 55  ? -14.963 -6.832  -27.578 1.00   17.71  ? 145  TYR B OH  1 
ATOM   1544 N  N   . HIS B 2 56  ? -15.424 -1.191  -23.968 1.00   11.14  ? 146  HIS B N   1 
ATOM   1545 C  CA  . HIS B 2 56  ? -16.245 -1.928  -23.020 1.00   11.27  ? 146  HIS B CA  1 
ATOM   1546 C  C   . HIS B 2 56  ? -17.647 -1.899  -23.578 1.00   11.65  ? 146  HIS B C   1 
ATOM   1547 O  O   . HIS B 2 56  ? -18.167 -0.828  -23.880 1.00   12.01  ? 146  HIS B O   1 
ATOM   1548 C  CB  . HIS B 2 56  ? -16.228 -1.266  -21.642 1.00   10.78  ? 146  HIS B CB  1 
ATOM   1549 C  CG  . HIS B 2 56  ? -14.857 -1.079  -21.082 1.00   9.85   ? 146  HIS B CG  1 
ATOM   1550 N  ND1 . HIS B 2 56  ? -14.230 -2.041  -20.323 1.00   8.93   ? 146  HIS B ND1 1 
ATOM   1551 C  CD2 . HIS B 2 56  ? -13.988 -0.045  -21.173 1.00   10.73  ? 146  HIS B CD2 1 
ATOM   1552 C  CE1 . HIS B 2 56  ? -13.035 -1.608  -19.964 1.00   9.78   ? 146  HIS B CE1 1 
ATOM   1553 N  NE2 . HIS B 2 56  ? -12.864 -0.397  -20.463 1.00   10.74  ? 146  HIS B NE2 1 
ATOM   1554 N  N   . ALA B 2 57  ? -18.272 -3.059  -23.726 1.00   11.69  ? 147  ALA B N   1 
ATOM   1555 C  CA  . ALA B 2 57  ? -19.585 -3.072  -24.348 1.00   11.71  ? 147  ALA B CA  1 
ATOM   1556 C  C   . ALA B 2 57  ? -20.590 -3.790  -23.466 1.00   12.09  ? 147  ALA B C   1 
ATOM   1557 O  O   . ALA B 2 57  ? -20.312 -4.870  -22.957 1.00   11.29  ? 147  ALA B O   1 
ATOM   1558 C  CB  . ALA B 2 57  ? -19.512 -3.701  -25.717 1.00   12.48  ? 147  ALA B CB  1 
ATOM   1559 N  N   . SER B 2 58  ? -21.742 -3.153  -23.256 1.00   12.67  ? 148  SER B N   1 
ATOM   1560 C  CA  . SER B 2 58  ? -22.836 -3.764  -22.527 1.00   13.11  ? 148  SER B CA  1 
ATOM   1561 C  C   . SER B 2 58  ? -23.659 -4.539  -23.538 1.00   13.96  ? 148  SER B C   1 
ATOM   1562 O  O   . SER B 2 58  ? -23.724 -4.153  -24.702 1.00   14.17  ? 148  SER B O   1 
ATOM   1563 C  CB  . SER B 2 58  ? -23.697 -2.697  -21.842 1.00   13.04  ? 148  SER B CB  1 
ATOM   1564 O  OG  . SER B 2 58  ? -22.940 -1.966  -20.886 1.00   14.14  ? 148  SER B OG  1 
ATOM   1565 N  N   . SER B 2 59  ? -24.285 -5.624  -23.093 1.00   13.89  ? 149  SER B N   1 
ATOM   1566 C  CA  . SER B 2 59  ? -25.003 -6.512  -23.992 1.00   15.06  ? 149  SER B CA  1 
ATOM   1567 C  C   . SER B 2 59  ? -26.020 -7.297  -23.197 1.00   16.15  ? 149  SER B C   1 
ATOM   1568 O  O   . SER B 2 59  ? -25.889 -7.442  -21.979 1.00   17.44  ? 149  SER B O   1 
ATOM   1569 C  CB  . SER B 2 59  ? -24.034 -7.495  -24.654 1.00   14.46  ? 149  SER B CB  1 
ATOM   1570 O  OG  . SER B 2 59  ? -24.363 -8.579  -24.828 0.0000 24.79  ? 149  SER B OG  1 
ATOM   1571 N  N   . ARG B 2 60  ? -27.032 -7.817  -23.876 1.00   17.25  ? 150  ARG B N   1 
ATOM   1572 C  CA  . ARG B 2 60  ? -28.046 -8.628  -23.207 1.00   18.09  ? 150  ARG B CA  1 
ATOM   1573 C  C   . ARG B 2 60  ? -28.152 -9.979  -23.897 1.00   18.96  ? 150  ARG B C   1 
ATOM   1574 O  O   . ARG B 2 60  ? -29.127 -10.708 -23.721 1.00   19.31  ? 150  ARG B O   1 
ATOM   1575 C  CB  . ARG B 2 60  ? -29.400 -7.915  -23.208 1.00   18.29  ? 150  ARG B CB  1 
ATOM   1576 C  CG  . ARG B 2 60  ? -30.585 -8.163  -22.848 0.0000 43.21  ? 150  ARG B CG  1 
ATOM   1577 C  CD  . ARG B 2 60  ? -31.866 -7.839  -23.609 0.0000 50.57  ? 150  ARG B CD  1 
ATOM   1578 N  NE  . ARG B 2 60  ? -31.836 -6.482  -24.160 0.0000 54.76  ? 150  ARG B NE  1 
ATOM   1579 C  CZ  . ARG B 2 60  ? -32.658 -6.023  -25.101 0.0000 56.95  ? 150  ARG B CZ  1 
ATOM   1580 N  NH1 . ARG B 2 60  ? -33.598 -6.807  -25.620 0.0000 56.91  ? 150  ARG B NH1 1 
ATOM   1581 N  NH2 . ARG B 2 60  ? -32.537 -4.768  -25.524 0.0000 57.55  ? 150  ARG B NH2 1 
ATOM   1582 N  N   . GLY B 2 61  ? -27.142 -10.304 -24.695 1.00   18.95  ? 151  GLY B N   1 
ATOM   1583 C  CA  . GLY B 2 61  ? -27.085 -11.593 -25.369 1.00   19.16  ? 151  GLY B CA  1 
ATOM   1584 C  C   . GLY B 2 61  ? -25.711 -11.793 -25.961 1.00   18.77  ? 151  GLY B C   1 
ATOM   1585 O  O   . GLY B 2 61  ? -24.759 -11.147 -25.542 1.00   18.53  ? 151  GLY B O   1 
ATOM   1586 N  N   . ASN B 2 62  ? -25.612 -12.665 -26.956 1.00   18.49  ? 152  ASN B N   1 
ATOM   1587 C  CA  . ASN B 2 62  ? -24.317 -13.001 -27.534 1.00   18.58  ? 152  ASN B CA  1 
ATOM   1588 C  C   . ASN B 2 62  ? -23.713 -11.870 -28.377 1.00   18.36  ? 152  ASN B C   1 
ATOM   1589 O  O   . ASN B 2 62  ? -24.371 -11.302 -29.256 1.00   17.74  ? 152  ASN B O   1 
ATOM   1590 C  CB  . ASN B 2 62  ? -24.405 -14.316 -28.321 1.00   18.81  ? 152  ASN B CB  1 
ATOM   1591 C  CG  . ASN B 2 62  ? -24.832 -15.485 -27.450 1.00   19.52  ? 152  ASN B CG  1 
ATOM   1592 O  OD1 . ASN B 2 62  ? -24.653 -15.469 -26.234 1.00   19.86  ? 152  ASN B OD1 1 
ATOM   1593 N  ND2 . ASN B 2 62  ? -25.407 -16.507 -28.070 1.00   21.05  ? 152  ASN B ND2 1 
ATOM   1594 N  N   . LEU B 2 63  ? -22.450 -11.550 -28.097 1.00   17.35  ? 153  LEU B N   1 
ATOM   1595 C  CA  . LEU B 2 63  ? -21.753 -10.471 -28.797 1.00   16.32  ? 153  LEU B CA  1 
ATOM   1596 C  C   . LEU B 2 63  ? -20.376 -10.924 -29.286 1.00   16.33  ? 153  LEU B C   1 
ATOM   1597 O  O   . LEU B 2 63  ? -19.571 -11.441 -28.499 1.00   15.55  ? 153  LEU B O   1 
ATOM   1598 C  CB  . LEU B 2 63  ? -21.613 -9.250  -27.876 1.00   15.93  ? 153  LEU B CB  1 
ATOM   1599 C  CG  . LEU B 2 63  ? -20.972 -7.947  -28.384 1.00   15.68  ? 153  LEU B CG  1 
ATOM   1600 C  CD1 . LEU B 2 63  ? -21.633 -7.445  -29.664 1.00   14.65  ? 153  LEU B CD1 1 
ATOM   1601 C  CD2 . LEU B 2 63  ? -21.010 -6.860  -27.304 1.00   14.80  ? 153  LEU B CD2 1 
ATOM   1602 N  N   . CYS B 2 64  ? -20.123 -10.748 -30.585 1.00   15.97  ? 154  CYS B N   1 
ATOM   1603 C  CA  . CYS B 2 64  ? -18.777 -10.871 -31.143 1.00   16.49  ? 154  CYS B CA  1 
ATOM   1604 C  C   . CYS B 2 64  ? -18.449 -9.609  -31.934 1.00   16.57  ? 154  CYS B C   1 
ATOM   1605 O  O   . CYS B 2 64  ? -19.277 -9.120  -32.719 1.00   15.87  ? 154  CYS B O   1 
ATOM   1606 C  CB  . CYS B 2 64  ? -18.627 -12.100 -32.049 1.00   17.06  ? 154  CYS B CB  1 
ATOM   1607 S  SG  . CYS B 2 64  ? -18.805 -13.729 -31.256 1.00   18.24  ? 154  CYS B SG  1 
ATOM   1608 N  N   . VAL B 2 65  ? -17.248 -9.081  -31.720 1.00   16.00  ? 155  VAL B N   1 
ATOM   1609 C  CA  . VAL B 2 65  ? -16.801 -7.888  -32.441 1.00   16.42  ? 155  VAL B CA  1 
ATOM   1610 C  C   . VAL B 2 65  ? -15.409 -8.086  -33.051 1.00   16.28  ? 155  VAL B C   1 
ATOM   1611 O  O   . VAL B 2 65  ? -14.526 -8.689  -32.435 1.00   15.84  ? 155  VAL B O   1 
ATOM   1612 C  CB  . VAL B 2 65  ? -16.793 -6.653  -31.519 1.00   17.24  ? 155  VAL B CB  1 
ATOM   1613 C  CG1 . VAL B 2 65  ? -15.672 -6.758  -30.513 1.00   17.11  ? 155  VAL B CG1 1 
ATOM   1614 C  CG2 . VAL B 2 65  ? -16.649 -5.388  -32.325 1.00   18.20  ? 155  VAL B CG2 1 
ATOM   1615 N  N   . ASN B 2 66  ? -15.228 -7.584  -34.269 1.00   15.64  ? 156  ASN B N   1 
ATOM   1616 C  CA  . ASN B 2 66  ? -13.927 -7.595  -34.930 1.00   15.78  ? 156  ASN B CA  1 
ATOM   1617 C  C   . ASN B 2 66  ? -13.223 -6.259  -34.761 1.00   14.83  ? 156  ASN B C   1 
ATOM   1618 O  O   . ASN B 2 66  ? -13.798 -5.213  -35.055 1.00   14.67  ? 156  ASN B O   1 
ATOM   1619 C  CB  . ASN B 2 66  ? -14.090 -7.855  -36.434 1.00   15.90  ? 156  ASN B CB  1 
ATOM   1620 C  CG  . ASN B 2 66  ? -14.694 -9.210  -36.736 1.00   17.76  ? 156  ASN B CG  1 
ATOM   1621 O  OD1 . ASN B 2 66  ? -14.543 -10.162 -35.966 1.00   17.56  ? 156  ASN B OD1 1 
ATOM   1622 N  ND2 . ASN B 2 66  ? -15.370 -9.310  -37.879 1.00   17.81  ? 156  ASN B ND2 1 
ATOM   1623 N  N   . LEU B 2 67  ? -11.986 -6.295  -34.288 1.00   14.76  ? 157  LEU B N   1 
ATOM   1624 C  CA  . LEU B 2 67  ? -11.143 -5.110  -34.254 1.00   14.80  ? 157  LEU B CA  1 
ATOM   1625 C  C   . LEU B 2 67  ? -10.448 -5.027  -35.600 1.00   15.07  ? 157  LEU B C   1 
ATOM   1626 O  O   . LEU B 2 67  ? -9.655  -5.904  -35.949 1.00   15.01  ? 157  LEU B O   1 
ATOM   1627 C  CB  . LEU B 2 67  ? -10.092 -5.217  -33.155 1.00   14.41  ? 157  LEU B CB  1 
ATOM   1628 C  CG  . LEU B 2 67  ? -9.116  -4.037  -33.102 1.00   15.08  ? 157  LEU B CG  1 
ATOM   1629 C  CD1 . LEU B 2 67  ? -9.829  -2.748  -32.735 1.00   14.60  ? 157  LEU B CD1 1 
ATOM   1630 C  CD2 . LEU B 2 67  ? -7.971  -4.314  -32.128 1.00   14.86  ? 157  LEU B CD2 1 
ATOM   1631 N  N   . MET B 2 68  ? -10.749 -3.972  -36.347 1.00   15.23  ? 158  MET B N   1 
ATOM   1632 C  CA  . MET B 2 68  ? -10.309 -3.860  -37.729 1.00   15.46  ? 158  MET B CA  1 
ATOM   1633 C  C   . MET B 2 68  ? -9.219  -2.818  -37.861 1.00   15.86  ? 158  MET B C   1 
ATOM   1634 O  O   . MET B 2 68  ? -9.250  -1.795  -37.186 1.00   14.89  ? 158  MET B O   1 
ATOM   1635 C  CB  . MET B 2 68  ? -11.483 -3.448  -38.620 1.00   15.15  ? 158  MET B CB  1 
ATOM   1636 C  CG  . MET B 2 68  ? -12.714 -4.300  -38.474 1.00   15.34  ? 158  MET B CG  1 
ATOM   1637 S  SD  . MET B 2 68  ? -12.471 -5.932  -39.163 1.00   16.31  ? 158  MET B SD  1 
ATOM   1638 C  CE  . MET B 2 68  ? -12.613 -5.625  -40.937 1.00   14.97  ? 158  MET B CE  1 
ATOM   1639 N  N   A ARG B 2 69  ? -8.256  -3.087  -38.738 0.50   16.55  ? 159  ARG B N   1 
ATOM   1640 N  N   B ARG B 2 69  ? -8.258  -3.080  -38.743 0.50   16.42  ? 159  ARG B N   1 
ATOM   1641 C  CA  A ARG B 2 69  ? -7.179  -2.141  -39.020 0.50   17.14  ? 159  ARG B CA  1 
ATOM   1642 C  CA  B ARG B 2 69  ? -7.182  -2.129  -39.015 0.50   16.90  ? 159  ARG B CA  1 
ATOM   1643 C  C   A ARG B 2 69  ? -6.902  -2.091  -40.518 0.50   17.64  ? 159  ARG B C   1 
ATOM   1644 C  C   B ARG B 2 69  ? -6.886  -2.090  -40.510 0.50   17.51  ? 159  ARG B C   1 
ATOM   1645 O  O   A ARG B 2 69  ? -6.891  -3.124  -41.186 0.50   17.82  ? 159  ARG B O   1 
ATOM   1646 O  O   B ARG B 2 69  ? -6.846  -3.129  -41.166 0.50   17.71  ? 159  ARG B O   1 
ATOM   1647 C  CB  A ARG B 2 69  ? -5.901  -2.523  -38.263 0.50   17.02  ? 159  ARG B CB  1 
ATOM   1648 C  CB  B ARG B 2 69  ? -5.914  -2.507  -38.240 0.50   16.59  ? 159  ARG B CB  1 
ATOM   1649 C  CG  A ARG B 2 69  ? -4.651  -1.766  -38.726 0.50   16.89  ? 159  ARG B CG  1 
ATOM   1650 C  CG  B ARG B 2 69  ? -4.722  -1.569  -38.472 0.50   15.91  ? 159  ARG B CG  1 
ATOM   1651 C  CD  A ARG B 2 69  ? -3.423  -2.066  -37.873 0.50   16.32  ? 159  ARG B CD  1 
ATOM   1652 C  CD  B ARG B 2 69  ? -3.400  -2.236  -38.099 0.50   15.07  ? 159  ARG B CD  1 
ATOM   1653 N  NE  A ARG B 2 69  ? -3.085  -3.487  -37.826 0.50   15.17  ? 159  ARG B NE  1 
ATOM   1654 N  NE  B ARG B 2 69  ? -2.244  -1.492  -38.596 0.50   14.13  ? 159  ARG B NE  1 
ATOM   1655 C  CZ  A ARG B 2 69  ? -2.070  -3.990  -37.121 0.50   14.99  ? 159  ARG B CZ  1 
ATOM   1656 C  CZ  B ARG B 2 69  ? -0.985  -1.736  -38.241 0.50   13.29  ? 159  ARG B CZ  1 
ATOM   1657 N  NH1 A ARG B 2 69  ? -1.290  -3.186  -36.408 0.50   15.34  ? 159  ARG B NH1 1 
ATOM   1658 N  NH1 B ARG B 2 69  ? -0.713  -2.700  -37.379 0.50   13.43  ? 159  ARG B NH1 1 
ATOM   1659 N  NH2 A ARG B 2 69  ? -1.832  -5.293  -37.125 0.50   12.26  ? 159  ARG B NH2 1 
ATOM   1660 N  NH2 B ARG B 2 69  ? 0.005   -1.010  -38.746 0.50   13.35  ? 159  ARG B NH2 1 
ATOM   1661 N  N   . GLY B 2 70  ? -6.684  -0.891  -41.044 1.00   18.22  ? 160  GLY B N   1 
ATOM   1662 C  CA  . GLY B 2 70  ? -6.323  -0.738  -42.449 1.00   19.80  ? 160  GLY B CA  1 
ATOM   1663 C  C   . GLY B 2 70  ? -6.608  0.632   -43.018 1.00   21.51  ? 160  GLY B C   1 
ATOM   1664 O  O   . GLY B 2 70  ? -7.119  1.519   -42.329 1.00   20.93  ? 160  GLY B O   1 
ATOM   1665 N  N   . ARG B 2 71  ? -6.286  0.800   -44.294 1.00   22.56  ? 161  ARG B N   1 
ATOM   1666 C  CA  . ARG B 2 71  ? -6.528  2.059   -44.972 1.00   23.55  ? 161  ARG B CA  1 
ATOM   1667 C  C   . ARG B 2 71  ? -7.913  2.044   -45.633 1.00   24.02  ? 161  ARG B C   1 
ATOM   1668 O  O   . ARG B 2 71  ? -8.930  2.091   -44.937 1.00   24.37  ? 161  ARG B O   1 
ATOM   1669 C  CB  . ARG B 2 71  ? -5.378  2.362   -45.941 1.00   23.73  ? 161  ARG B CB  1 
ATOM   1670 C  CG  . ARG B 2 71  ? -4.082  2.680   -45.201 1.00   25.31  ? 161  ARG B CG  1 
ATOM   1671 C  CD  . ARG B 2 71  ? -2.836  2.269   -45.977 1.00   27.09  ? 161  ARG B CD  1 
ATOM   1672 N  NE  . ARG B 2 71  ? -1.636  2.277   -45.137 1.00   27.80  ? 161  ARG B NE  1 
ATOM   1673 C  CZ  . ARG B 2 71  ? -0.704  3.228   -45.148 1.00   29.00  ? 161  ARG B CZ  1 
ATOM   1674 N  NH1 . ARG B 2 71  ? -0.806  4.277   -45.957 1.00   29.63  ? 161  ARG B NH1 1 
ATOM   1675 N  NH2 . ARG B 2 71  ? 0.343   3.128   -44.348 1.00   29.19  ? 161  ARG B NH2 1 
ATOM   1676 N  N   A GLU B 2 72  ? -7.965  1.969   -46.959 0.50   24.31  ? 162  GLU B N   1 
ATOM   1677 N  N   B GLU B 2 72  ? -7.943  1.960   -46.958 0.50   23.88  ? 162  GLU B N   1 
ATOM   1678 C  CA  A GLU B 2 72  ? -9.253  1.952   -47.652 0.50   24.66  ? 162  GLU B CA  1 
ATOM   1679 C  CA  B GLU B 2 72  ? -9.197  1.924   -47.698 0.50   23.85  ? 162  GLU B CA  1 
ATOM   1680 C  C   A GLU B 2 72  ? -9.922  0.579   -47.543 0.50   24.82  ? 162  GLU B C   1 
ATOM   1681 C  C   B GLU B 2 72  ? -9.899  0.599   -47.448 0.50   24.36  ? 162  GLU B C   1 
ATOM   1682 O  O   A GLU B 2 72  ? -11.153 0.478   -47.552 0.50   25.05  ? 162  GLU B O   1 
ATOM   1683 O  O   B GLU B 2 72  ? -11.120 0.546   -47.273 0.50   24.62  ? 162  GLU B O   1 
ATOM   1684 C  CB  A GLU B 2 72  ? -9.103  2.381   -49.114 0.50   24.93  ? 162  GLU B CB  1 
ATOM   1685 C  CB  B GLU B 2 72  ? -8.933  2.093   -49.192 0.50   23.59  ? 162  GLU B CB  1 
ATOM   1686 C  CG  A GLU B 2 72  ? -8.530  3.787   -49.310 0.50   25.82  ? 162  GLU B CG  1 
ATOM   1687 C  CG  B GLU B 2 72  ? -7.721  2.951   -49.514 0.50   22.68  ? 162  GLU B CG  1 
ATOM   1688 C  CD  A GLU B 2 72  ? -9.596  4.872   -49.395 0.50   26.59  ? 162  GLU B CD  1 
ATOM   1689 C  CD  B GLU B 2 72  ? -6.409  2.215   -49.329 0.50   21.76  ? 162  GLU B CD  1 
ATOM   1690 O  OE1 A GLU B 2 72  ? -9.743  5.468   -50.485 0.50   26.58  ? 162  GLU B OE1 1 
ATOM   1691 O  OE1 B GLU B 2 72  ? -6.385  0.972   -49.452 0.50   21.65  ? 162  GLU B OE1 1 
ATOM   1692 O  OE2 A GLU B 2 72  ? -10.282 5.134   -48.379 0.50   26.74  ? 162  GLU B OE2 1 
ATOM   1693 O  OE2 B GLU B 2 72  ? -5.394  2.886   -49.062 0.50   21.88  ? 162  GLU B OE2 1 
ATOM   1694 N  N   . ARG B 2 73  ? -9.111  -0.471  -47.436 1.00   24.33  ? 163  ARG B N   1 
ATOM   1695 C  CA  . ARG B 2 73  ? -9.621  -1.812  -47.175 1.00   24.61  ? 163  ARG B CA  1 
ATOM   1696 C  C   . ARG B 2 73  ? -9.011  -2.295  -45.867 1.00   24.49  ? 163  ARG B C   1 
ATOM   1697 O  O   . ARG B 2 73  ? -7.792  -2.260  -45.699 1.00   25.37  ? 163  ARG B O   1 
ATOM   1698 C  CB  . ARG B 2 73  ? -9.262  -2.767  -48.316 1.00   24.29  ? 163  ARG B CB  1 
ATOM   1699 C  CG  . ARG B 2 73  ? -8.719  -2.390  -49.740 0.0000 20.00  ? 163  ARG B CG  1 
ATOM   1700 C  CD  . ARG B 2 73  ? -10.191 -2.637  -50.022 0.0000 20.00  ? 163  ARG B CD  1 
ATOM   1701 N  NE  . ARG B 2 73  ? -10.534 -2.375  -51.417 0.0000 20.00  ? 163  ARG B NE  1 
ATOM   1702 C  CZ  . ARG B 2 73  ? -10.839 -1.174  -51.898 0.0000 20.00  ? 163  ARG B CZ  1 
ATOM   1703 N  NH1 . ARG B 2 73  ? -10.847 -0.120  -51.094 0.0000 20.00  ? 163  ARG B NH1 1 
ATOM   1704 N  NH2 . ARG B 2 73  ? -11.138 -1.033  -53.182 0.0000 20.00  ? 163  ARG B NH2 1 
ATOM   1705 N  N   . ALA B 2 74  ? -9.855  -2.738  -44.943 1.00   23.95  ? 164  ALA B N   1 
ATOM   1706 C  CA  . ALA B 2 74  ? -9.409  -3.071  -43.590 1.00   23.27  ? 164  ALA B CA  1 
ATOM   1707 C  C   . ALA B 2 74  ? -9.370  -4.569  -43.369 1.00   22.64  ? 164  ALA B C   1 
ATOM   1708 O  O   . ALA B 2 74  ? -10.135 -5.311  -43.973 1.00   22.97  ? 164  ALA B O   1 
ATOM   1709 C  CB  . ALA B 2 74  ? -10.310 -2.413  -42.557 1.00   23.11  ? 164  ALA B CB  1 
ATOM   1710 N  N   . GLN B 2 75  ? -8.465  -5.002  -42.497 1.00   21.77  ? 165  GLN B N   1 
ATOM   1711 C  CA  . GLN B 2 75  ? -8.319  -6.402  -42.145 1.00   20.54  ? 165  GLN B CA  1 
ATOM   1712 C  C   . GLN B 2 75  ? -8.563  -6.536  -40.660 1.00   20.16  ? 165  GLN B C   1 
ATOM   1713 O  O   . GLN B 2 75  ? -8.254  -5.621  -39.894 1.00   19.48  ? 165  GLN B O   1 
ATOM   1714 C  CB  . GLN B 2 75  ? -6.902  -6.882  -42.458 1.00   21.25  ? 165  GLN B CB  1 
ATOM   1715 C  CG  . GLN B 2 75  ? -6.767  -6.449  -44.046 0.0000 20.00  ? 165  GLN B CG  1 
ATOM   1716 C  CD  . GLN B 2 75  ? -5.345  -6.862  -44.373 0.0000 20.00  ? 165  GLN B CD  1 
ATOM   1717 O  OE1 . GLN B 2 75  ? -4.434  -6.682  -43.566 0.0000 20.00  ? 165  GLN B OE1 1 
ATOM   1718 N  NE2 . GLN B 2 75  ? -5.152  -7.422  -45.563 0.0000 20.00  ? 165  GLN B NE2 1 
ATOM   1719 N  N   . LYS B 2 76  ? -9.103  -7.673  -40.246 1.00   19.54  ? 166  LYS B N   1 
ATOM   1720 C  CA  . LYS B 2 76  ? -9.388  -7.872  -38.834 1.00   19.85  ? 166  LYS B CA  1 
ATOM   1721 C  C   . LYS B 2 76  ? -8.131  -8.287  -38.077 1.00   19.44  ? 166  LYS B C   1 
ATOM   1722 O  O   . LYS B 2 76  ? -7.390  -9.185  -38.502 1.00   19.13  ? 166  LYS B O   1 
ATOM   1723 C  CB  . LYS B 2 76  ? -10.549 -8.853  -38.627 1.00   20.47  ? 166  LYS B CB  1 
ATOM   1724 C  CG  . LYS B 2 76  ? -10.177 -10.258 -38.248 1.00   23.11  ? 166  LYS B CG  1 
ATOM   1725 C  CD  . LYS B 2 76  ? -11.410 -11.160 -38.283 1.00   24.00  ? 166  LYS B CD  1 
ATOM   1726 C  CE  . LYS B 2 76  ? -11.089 -12.566 -37.812 1.00   25.45  ? 166  LYS B CE  1 
ATOM   1727 N  NZ  . LYS B 2 76  ? -10.625 -12.605 -36.390 1.00   26.75  ? 166  LYS B NZ  1 
ATOM   1728 N  N   . VAL B 2 77  ? -7.873  -7.601  -36.969 1.00   18.34  ? 167  VAL B N   1 
ATOM   1729 C  CA  . VAL B 2 77  ? -6.730  -7.929  -36.145 1.00   17.57  ? 167  VAL B CA  1 
ATOM   1730 C  C   . VAL B 2 77  ? -7.106  -9.078  -35.221 1.00   17.03  ? 167  VAL B C   1 
ATOM   1731 O  O   . VAL B 2 77  ? -6.378  -10.067 -35.107 1.00   16.37  ? 167  VAL B O   1 
ATOM   1732 C  CB  . VAL B 2 77  ? -6.271  -6.721  -35.327 1.00   17.94  ? 167  VAL B CB  1 
ATOM   1733 C  CG1 . VAL B 2 77  ? -4.877  -6.963  -34.758 1.00   17.82  ? 167  VAL B CG1 1 
ATOM   1734 C  CG2 . VAL B 2 77  ? -6.282  -5.474  -36.201 1.00   18.77  ? 167  VAL B CG2 1 
ATOM   1735 N  N   . VAL B 2 78  ? -8.259  -8.942  -34.568 1.00   16.82  ? 168  VAL B N   1 
ATOM   1736 C  CA  . VAL B 2 78  ? -8.755  -9.964  -33.658 1.00   15.99  ? 168  VAL B CA  1 
ATOM   1737 C  C   . VAL B 2 78  ? -10.273 -9.925  -33.583 1.00   16.02  ? 168  VAL B C   1 
ATOM   1738 O  O   . VAL B 2 78  ? -10.896 -8.935  -33.946 1.00   14.74  ? 168  VAL B O   1 
ATOM   1739 C  CB  . VAL B 2 78  ? -8.196  -9.782  -32.215 1.00   15.96  ? 168  VAL B CB  1 
ATOM   1740 C  CG1 . VAL B 2 78  ? -6.697  -10.084 -32.164 1.00   15.46  ? 168  VAL B CG1 1 
ATOM   1741 C  CG2 . VAL B 2 78  ? -8.494  -8.385  -31.698 1.00   14.22  ? 168  VAL B CG2 1 
ATOM   1742 N  N   . THR B 2 79  ? -10.853 -11.024 -33.110 1.00   15.96  ? 169  THR B N   1 
ATOM   1743 C  CA  . THR B 2 79  ? -12.273 -11.098 -32.831 1.00   15.98  ? 169  THR B CA  1 
ATOM   1744 C  C   . THR B 2 79  ? -12.431 -11.400 -31.343 1.00   15.42  ? 169  THR B C   1 
ATOM   1745 O  O   . THR B 2 79  ? -11.783 -12.305 -30.831 1.00   15.42  ? 169  THR B O   1 
ATOM   1746 C  CB  . THR B 2 79  ? -12.930 -12.224 -33.655 1.00   16.50  ? 169  THR B CB  1 
ATOM   1747 O  OG1 . THR B 2 79  ? -12.884 -11.886 -35.048 1.00   17.37  ? 169  THR B OG1 1 
ATOM   1748 C  CG2 . THR B 2 79  ? -14.371 -12.447 -33.227 1.00   15.89  ? 169  THR B CG2 1 
ATOM   1749 N  N   . PHE B 2 80  ? -13.258 -10.618 -30.653 1.00   15.14  ? 170  PHE B N   1 
ATOM   1750 C  CA  . PHE B 2 80  ? -13.595 -10.872 -29.247 1.00   15.66  ? 170  PHE B CA  1 
ATOM   1751 C  C   . PHE B 2 80  ? -15.045 -11.329 -29.160 1.00   15.44  ? 170  PHE B C   1 
ATOM   1752 O  O   . PHE B 2 80  ? -15.929 -10.657 -29.678 1.00   14.12  ? 170  PHE B O   1 
ATOM   1753 C  CB  . PHE B 2 80  ? -13.460 -9.598  -28.405 1.00   16.05  ? 170  PHE B CB  1 
ATOM   1754 C  CG  . PHE B 2 80  ? -12.053 -9.072  -28.286 1.00   17.34  ? 170  PHE B CG  1 
ATOM   1755 C  CD1 . PHE B 2 80  ? -11.129 -9.698  -27.462 1.00   19.03  ? 170  PHE B CD1 1 
ATOM   1756 C  CD2 . PHE B 2 80  ? -11.669 -7.924  -28.965 1.00   17.67  ? 170  PHE B CD2 1 
ATOM   1757 C  CE1 . PHE B 2 80  ? -9.836  -9.199  -27.332 1.00   18.83  ? 170  PHE B CE1 1 
ATOM   1758 C  CE2 . PHE B 2 80  ? -10.380 -7.418  -28.844 1.00   18.68  ? 170  PHE B CE2 1 
ATOM   1759 C  CZ  . PHE B 2 80  ? -9.463  -8.060  -28.027 1.00   18.89  ? 170  PHE B CZ  1 
ATOM   1760 N  N   . CYS B 2 81  ? -15.284 -12.468 -28.516 1.00   15.69  ? 171  CYS B N   1 
ATOM   1761 C  CA  . CYS B 2 81  ? -16.636 -12.948 -28.288 1.00   15.86  ? 171  CYS B CA  1 
ATOM   1762 C  C   . CYS B 2 81  ? -16.905 -13.072 -26.793 1.00   15.49  ? 171  CYS B C   1 
ATOM   1763 O  O   . CYS B 2 81  ? -16.066 -13.575 -26.042 1.00   14.47  ? 171  CYS B O   1 
ATOM   1764 C  CB  . CYS B 2 81  ? -16.863 -14.306 -28.956 1.00   16.74  ? 171  CYS B CB  1 
ATOM   1765 S  SG  . CYS B 2 81  ? -16.895 -14.290 -30.765 1.00   18.39  ? 171  CYS B SG  1 
ATOM   1766 N  N   . ASP B 2 82  ? -18.079 -12.608 -26.378 1.00   15.50  ? 172  ASP B N   1 
ATOM   1767 C  CA  . ASP B 2 82  ? -18.559 -12.782 -25.013 1.00   16.43  ? 172  ASP B CA  1 
ATOM   1768 C  C   . ASP B 2 82  ? -20.056 -13.093 -25.065 1.00   17.18  ? 172  ASP B C   1 
ATOM   1769 O  O   . ASP B 2 82  ? -20.850 -12.292 -25.552 1.00   17.39  ? 172  ASP B O   1 
ATOM   1770 C  CB  . ASP B 2 82  ? -18.300 -11.524 -24.186 1.00   15.78  ? 172  ASP B CB  1 
ATOM   1771 C  CG  . ASP B 2 82  ? -18.178 -11.818 -22.698 1.00   15.52  ? 172  ASP B CG  1 
ATOM   1772 O  OD1 . ASP B 2 82  ? -17.437 -11.092 -22.002 1.00   13.79  ? 172  ASP B OD1 1 
ATOM   1773 O  OD2 . ASP B 2 82  ? -18.813 -12.787 -22.228 1.00   14.34  ? 172  ASP B OD2 1 
ATOM   1774 N  N   . TYR B 2 83  ? -20.427 -14.271 -24.583 1.00   18.19  ? 173  TYR B N   1 
ATOM   1775 C  CA  . TYR B 2 83  ? -21.790 -14.754 -24.712 1.00   19.18  ? 173  TYR B CA  1 
ATOM   1776 C  C   . TYR B 2 83  ? -22.562 -14.536 -23.420 1.00   19.53  ? 173  TYR B C   1 
ATOM   1777 O  O   . TYR B 2 83  ? -21.977 -14.455 -22.340 1.00   19.76  ? 173  TYR B O   1 
ATOM   1778 C  CB  . TYR B 2 83  ? -21.788 -16.237 -25.088 1.00   19.97  ? 173  TYR B CB  1 
ATOM   1779 C  CG  . TYR B 2 83  ? -21.507 -16.496 -26.552 1.00   20.76  ? 173  TYR B CG  1 
ATOM   1780 C  CD1 . TYR B 2 83  ? -20.930 -15.516 -27.358 1.00   20.95  ? 173  TYR B CD1 1 
ATOM   1781 C  CD2 . TYR B 2 83  ? -21.790 -17.725 -27.123 1.00   21.69  ? 173  TYR B CD2 1 
ATOM   1782 C  CE1 . TYR B 2 83  ? -20.660 -15.753 -28.692 1.00   21.33  ? 173  TYR B CE1 1 
ATOM   1783 C  CE2 . TYR B 2 83  ? -21.519 -17.970 -28.466 1.00   22.17  ? 173  TYR B CE2 1 
ATOM   1784 C  CZ  . TYR B 2 83  ? -20.954 -16.980 -29.239 1.00   21.12  ? 173  TYR B CZ  1 
ATOM   1785 O  OH  . TYR B 2 83  ? -20.687 -17.220 -30.569 1.00   22.72  ? 173  TYR B OH  1 
ATOM   1786 N  N   . ALA B 2 84  ? -23.876 -14.418 -23.541 1.00   19.35  ? 174  ALA B N   1 
ATOM   1787 C  CA  . ALA B 2 84  ? -24.723 -14.247 -22.373 1.00   19.65  ? 174  ALA B CA  1 
ATOM   1788 C  C   . ALA B 2 84  ? -26.071 -14.883 -22.657 1.00   19.81  ? 174  ALA B C   1 
ATOM   1789 O  O   . ALA B 2 84  ? -26.808 -14.442 -23.542 1.00   20.29  ? 174  ALA B O   1 
ATOM   1790 C  CB  . ALA B 2 84  ? -24.878 -12.779 -22.038 1.00   19.17  ? 174  ALA B CB  1 
ATOM   1791 N  N   . TYR B 2 85  ? -26.377 -15.939 -21.917 1.00   20.17  ? 175  TYR B N   1 
ATOM   1792 C  CA  . TYR B 2 85  ? -27.928 -16.504 -22.116 0.0000 29.46  ? 175  TYR B CA  1 
ATOM   1793 C  C   . TYR B 2 85  ? -29.250 -15.463 -21.792 1.00   32.28  ? 175  TYR B C   1 
ATOM   1794 O  O   . TYR B 2 85  ? -28.860 -16.002 -20.758 1.00   32.82  ? 175  TYR B O   1 
ATOM   1795 C  CB  . TYR B 2 85  ? -27.954 -18.018 -21.899 0.0000 31.28  ? 175  TYR B CB  1 
ATOM   1796 C  CG  . TYR B 2 85  ? -29.186 -18.709 -22.453 0.0000 32.69  ? 175  TYR B CG  1 
ATOM   1797 C  CD1 . TYR B 2 85  ? -29.359 -18.861 -23.827 0.0000 33.59  ? 175  TYR B CD1 1 
ATOM   1798 C  CD2 . TYR B 2 85  ? -30.166 -19.227 -21.606 0.0000 33.65  ? 175  TYR B CD2 1 
ATOM   1799 C  CE1 . TYR B 2 85  ? -30.478 -19.498 -24.347 0.0000 33.77  ? 175  TYR B CE1 1 
ATOM   1800 C  CE2 . TYR B 2 85  ? -31.297 -19.874 -22.119 0.0000 33.58  ? 175  TYR B CE2 1 
ATOM   1801 C  CZ  . TYR B 2 85  ? -31.443 -20.004 -23.493 0.0000 33.50  ? 175  TYR B CZ  1 
ATOM   1802 O  OH  . TYR B 2 85  ? -32.549 -20.639 -24.026 0.0000 33.43  ? 175  TYR B OH  1 
ATOM   1803 N  N   . ASN B 2 86  ? -30.011 -14.375 -21.794 1.00   31.97  ? 176  ASN B N   1 
ATOM   1804 C  CA  . ASN B 2 86  ? -30.953 -14.107 -20.722 1.00   31.69  ? 176  ASN B CA  1 
ATOM   1805 C  C   . ASN B 2 86  ? -30.283 -13.491 -19.495 1.00   30.65  ? 176  ASN B C   1 
ATOM   1806 O  O   . ASN B 2 86  ? -30.548 -13.898 -18.355 1.00   30.46  ? 176  ASN B O   1 
ATOM   1807 C  CB  . ASN B 2 86  ? -31.687 -15.387 -20.322 1.00   32.78  ? 176  ASN B CB  1 
ATOM   1808 C  CG  . ASN B 2 86  ? -32.963 -15.106 -19.570 1.00   33.77  ? 176  ASN B CG  1 
ATOM   1809 O  OD1 . ASN B 2 86  ? -33.855 -14.420 -20.078 1.00   35.30  ? 176  ASN B OD1 1 
ATOM   1810 N  ND2 . ASN B 2 86  ? -33.062 -15.631 -18.352 1.00   34.63  ? 176  ASN B ND2 1 
ATOM   1811 N  N   . THR B 2 87  ? -29.426 -12.502 -19.739 1.00   28.90  ? 177  THR B N   1 
ATOM   1812 C  CA  . THR B 2 87  ? -28.700 -11.825 -18.670 1.00   27.38  ? 177  THR B CA  1 
ATOM   1813 C  C   . THR B 2 87  ? -27.841 -10.688 -19.240 1.00   25.65  ? 177  THR B C   1 
ATOM   1814 O  O   . THR B 2 87  ? -27.368 -10.776 -20.371 1.00   26.39  ? 177  THR B O   1 
ATOM   1815 C  CB  . THR B 2 87  ? -27.819 -12.813 -17.878 1.00   27.60  ? 177  THR B CB  1 
ATOM   1816 O  OG1 . THR B 2 87  ? -27.227 -12.144 -16.760 1.00   28.56  ? 177  THR B OG1 1 
ATOM   1817 C  CG2 . THR B 2 87  ? -26.715 -13.403 -18.765 1.00   28.46  ? 177  THR B CG2 1 
ATOM   1818 N  N   . PHE B 2 88  ? -27.651 -9.624  -18.461 1.00   22.63  ? 178  PHE B N   1 
ATOM   1819 C  CA  . PHE B 2 88  ? -26.851 -8.486  -18.904 1.00   19.96  ? 178  PHE B CA  1 
ATOM   1820 C  C   . PHE B 2 88  ? -25.378 -8.698  -18.583 1.00   17.91  ? 178  PHE B C   1 
ATOM   1821 O  O   . PHE B 2 88  ? -25.019 -9.164  -17.495 1.00   15.99  ? 178  PHE B O   1 
ATOM   1822 C  CB  . PHE B 2 88  ? -27.329 -7.184  -18.251 1.00   20.42  ? 178  PHE B CB  1 
ATOM   1823 C  CG  . PHE B 2 88  ? -28.704 -6.749  -18.687 1.00   21.07  ? 178  PHE B CG  1 
ATOM   1824 C  CD1 . PHE B 2 88  ? -29.802 -7.587  -18.520 1.00   21.36  ? 178  PHE B CD1 1 
ATOM   1825 C  CD2 . PHE B 2 88  ? -28.905 -5.493  -19.236 1.00   21.19  ? 178  PHE B CD2 1 
ATOM   1826 C  CE1 . PHE B 2 88  ? -31.064 -7.188  -18.920 1.00   21.42  ? 178  PHE B CE1 1 
ATOM   1827 C  CE2 . PHE B 2 88  ? -30.168 -5.086  -19.630 1.00   20.83  ? 178  PHE B CE2 1 
ATOM   1828 C  CZ  . PHE B 2 88  ? -31.246 -5.932  -19.471 1.00   21.00  ? 178  PHE B CZ  1 
ATOM   1829 N  N   . GLN B 2 89  ? -24.527 -8.346  -19.540 1.00   15.54  ? 179  GLN B N   1 
ATOM   1830 C  CA  . GLN B 2 89  ? -23.096 -8.483  -19.364 1.00   14.09  ? 179  GLN B CA  1 
ATOM   1831 C  C   . GLN B 2 89  ? -22.376 -7.194  -19.770 1.00   13.14  ? 179  GLN B C   1 
ATOM   1832 O  O   . GLN B 2 89  ? -22.926 -6.335  -20.457 1.00   12.70  ? 179  GLN B O   1 
ATOM   1833 C  CB  . GLN B 2 89  ? -22.567 -9.680  -20.165 1.00   13.87  ? 179  GLN B CB  1 
ATOM   1834 C  CG  . GLN B 2 89  ? -22.798 -9.557  -21.674 1.00   13.01  ? 179  GLN B CG  1 
ATOM   1835 C  CD  . GLN B 2 89  ? -21.933 -10.475 -22.491 1.00   12.87  ? 179  GLN B CD  1 
ATOM   1836 O  OE1 . GLN B 2 89  ? -21.103 -11.212 -21.951 1.00   13.32  ? 179  GLN B OE1 1 
ATOM   1837 N  NE2 . GLN B 2 89  ? -22.119 -10.445 -23.815 1.00   13.41  ? 179  GLN B NE2 1 
ATOM   1838 N  N   . VAL B 2 90  ? -21.150 -7.051  -19.304 1.00   12.38  ? 180  VAL B N   1 
ATOM   1839 C  CA  . VAL B 2 90  ? -20.259 -6.048  -19.859 1.00   11.65  ? 180  VAL B CA  1 
ATOM   1840 C  C   . VAL B 2 90  ? -19.006 -6.809  -20.216 1.00   11.51  ? 180  VAL B C   1 
ATOM   1841 O  O   . VAL B 2 90  ? -18.455 -7.542  -19.385 1.00   9.85   ? 180  VAL B O   1 
ATOM   1842 C  CB  . VAL B 2 90  ? -19.962 -4.886  -18.881 1.00   11.53  ? 180  VAL B CB  1 
ATOM   1843 C  CG1 . VAL B 2 90  ? -19.380 -5.406  -17.570 1.00   12.05  ? 180  VAL B CG1 1 
ATOM   1844 C  CG2 . VAL B 2 90  ? -19.039 -3.871  -19.520 1.00   10.58  ? 180  VAL B CG2 1 
ATOM   1845 N  N   . THR B 2 91  ? -18.596 -6.683  -21.474 1.00   11.77  ? 181  THR B N   1 
ATOM   1846 C  CA  . THR B 2 91  ? -17.373 -7.312  -21.927 1.00   12.65  ? 181  THR B CA  1 
ATOM   1847 C  C   . THR B 2 91  ? -16.351 -6.279  -22.396 1.00   13.25  ? 181  THR B C   1 
ATOM   1848 O  O   . THR B 2 91  ? -16.659 -5.086  -22.530 1.00   12.79  ? 181  THR B O   1 
ATOM   1849 C  CB  . THR B 2 91  ? -17.633 -8.284  -23.069 1.00   13.12  ? 181  THR B CB  1 
ATOM   1850 O  OG1 . THR B 2 91  ? -16.439 -9.027  -23.330 1.00   12.77  ? 181  THR B OG1 1 
ATOM   1851 C  CG2 . THR B 2 91  ? -18.061 -7.540  -24.322 1.00   12.74  ? 181  THR B CG2 1 
ATOM   1852 N  N   . THR B 2 92  ? -15.133 -6.740  -22.660 1.00   13.10  ? 182  THR B N   1 
ATOM   1853 C  CA  . THR B 2 92  ? -14.079 -5.803  -23.007 1.00   12.97  ? 182  THR B CA  1 
ATOM   1854 C  C   . THR B 2 92  ? -12.999 -6.437  -23.871 1.00   12.91  ? 182  THR B C   1 
ATOM   1855 O  O   . THR B 2 92  ? -12.871 -7.667  -23.950 1.00   12.92  ? 182  THR B O   1 
ATOM   1856 C  CB  . THR B 2 92  ? -13.458 -5.141  -21.731 1.00   12.60  ? 182  THR B CB  1 
ATOM   1857 O  OG1 . THR B 2 92  ? -12.568 -4.074  -22.110 1.00   12.18  ? 182  THR B OG1 1 
ATOM   1858 C  CG2 . THR B 2 92  ? -12.709 -6.161  -20.904 1.00   11.49  ? 182  THR B CG2 1 
ATOM   1859 N  N   . GLY B 2 93  ? -12.234 -5.578  -24.531 1.00   12.62  ? 183  GLY B N   1 
ATOM   1860 C  CA  . GLY B 2 93  ? -11.084 -5.999  -25.307 1.00   11.32  ? 183  GLY B CA  1 
ATOM   1861 C  C   . GLY B 2 93  ? -10.172 -4.801  -25.426 1.00   11.41  ? 183  GLY B C   1 
ATOM   1862 O  O   . GLY B 2 93  ? -10.614 -3.674  -25.257 1.00   11.46  ? 183  GLY B O   1 
ATOM   1863 N  N   . GLY B 2 94  ? -8.892  -5.051  -25.688 1.00   11.42  ? 184  GLY B N   1 
ATOM   1864 C  CA  . GLY B 2 94  ? -7.920  -3.996  -25.928 1.00   10.53  ? 184  GLY B CA  1 
ATOM   1865 C  C   . GLY B 2 94  ? -6.825  -4.521  -26.847 1.00   10.53  ? 184  GLY B C   1 
ATOM   1866 O  O   . GLY B 2 94  ? -6.732  -5.728  -27.081 1.00   9.60   ? 184  GLY B O   1 
ATOM   1867 N  N   . MET B 2 95  ? -5.994  -3.615  -27.347 1.00   9.98   ? 185  MET B N   1 
ATOM   1868 C  CA  . MET B 2 95  ? -4.928  -3.966  -28.262 1.00   10.29  ? 185  MET B CA  1 
ATOM   1869 C  C   . MET B 2 95  ? -3.967  -2.805  -28.422 1.00   10.52  ? 185  MET B C   1 
ATOM   1870 O  O   . MET B 2 95  ? -4.394  -1.670  -28.621 1.00   11.38  ? 185  MET B O   1 
ATOM   1871 C  CB  . MET B 2 95  ? -5.499  -4.336  -29.646 1.00   10.87  ? 185  MET B CB  1 
ATOM   1872 C  CG  . MET B 2 95  ? -4.445  -4.898  -30.614 1.00   10.67  ? 185  MET B CG  1 
ATOM   1873 S  SD  . MET B 2 95  ? -3.793  -6.498  -30.081 1.00   12.40  ? 185  MET B SD  1 
ATOM   1874 C  CE  . MET B 2 95  ? -5.273  -7.493  -30.101 1.00   12.69  ? 185  MET B CE  1 
ATOM   1875 N  N   . VAL B 2 96  ? -2.672  -3.099  -28.359 1.00   10.05  ? 186  VAL B N   1 
ATOM   1876 C  CA  . VAL B 2 96  ? -1.654  -2.132  -28.722 1.00   11.28  ? 186  VAL B CA  1 
ATOM   1877 C  C   . VAL B 2 96  ? -1.323  -2.325  -30.202 1.00   12.35  ? 186  VAL B C   1 
ATOM   1878 O  O   . VAL B 2 96  ? -1.095  -3.449  -30.659 1.00   12.77  ? 186  VAL B O   1 
ATOM   1879 C  CB  . VAL B 2 96  ? -0.374  -2.293  -27.863 1.00   11.34  ? 186  VAL B CB  1 
ATOM   1880 C  CG1 . VAL B 2 96  ? 0.742   -1.373  -28.363 1.00   10.19  ? 186  VAL B CG1 1 
ATOM   1881 C  CG2 . VAL B 2 96  ? -0.682  -2.017  -26.381 1.00   10.50  ? 186  VAL B CG2 1 
ATOM   1882 N  N   . LEU B 2 97  ? -1.315  -1.229  -30.949 1.00   13.04  ? 187  LEU B N   1 
ATOM   1883 C  CA  . LEU B 2 97  ? -1.040  -1.283  -32.384 1.00   13.58  ? 187  LEU B CA  1 
ATOM   1884 C  C   . LEU B 2 97  ? -0.054  -0.199  -32.754 1.00   14.74  ? 187  LEU B C   1 
ATOM   1885 O  O   . LEU B 2 97  ? -0.152  0.931   -32.268 1.00   14.45  ? 187  LEU B O   1 
ATOM   1886 C  CB  . LEU B 2 97  ? -2.339  -1.100  -33.183 1.00   12.89  ? 187  LEU B CB  1 
ATOM   1887 C  CG  . LEU B 2 97  ? -3.411  -2.190  -33.003 1.00   11.78  ? 187  LEU B CG  1 
ATOM   1888 C  CD1 . LEU B 2 97  ? -4.770  -1.745  -33.560 1.00   9.95   ? 187  LEU B CD1 1 
ATOM   1889 C  CD2 . LEU B 2 97  ? -2.952  -3.508  -33.625 1.00   9.50   ? 187  LEU B CD2 1 
ATOM   1890 N  N   . LYS B 2 98  ? 0.896   -0.534  -33.620 1.00   16.30  ? 188  LYS B N   1 
ATOM   1891 C  CA  . LYS B 2 98  ? 1.752   0.489   -34.199 1.00   17.88  ? 188  LYS B CA  1 
ATOM   1892 C  C   . LYS B 2 98  ? 1.227   0.871   -35.571 1.00   18.42  ? 188  LYS B C   1 
ATOM   1893 O  O   . LYS B 2 98  ? 1.266   0.067   -36.503 1.00   18.99  ? 188  LYS B O   1 
ATOM   1894 C  CB  . LYS B 2 98  ? 3.211   0.039   -34.294 1.00   18.75  ? 188  LYS B CB  1 
ATOM   1895 C  CG  . LYS B 2 98  ? 4.099   1.107   -34.900 1.00   20.75  ? 188  LYS B CG  1 
ATOM   1896 C  CD  . LYS B 2 98  ? 5.487   1.106   -34.294 1.00   23.96  ? 188  LYS B CD  1 
ATOM   1897 C  CE  . LYS B 2 98  ? 6.100   2.501   -34.403 1.00   25.15  ? 188  LYS B CE  1 
ATOM   1898 N  NZ  . LYS B 2 98  ? 7.541   2.524   -34.052 1.00   27.25  ? 188  LYS B NZ  1 
ATOM   1899 N  N   . LEU B 2 99  ? 0.770   2.115   -35.682 1.00   18.37  ? 189  LEU B N   1 
ATOM   1900 C  CA  . LEU B 2 99  ? 0.014   2.592   -36.829 1.00   18.12  ? 189  LEU B CA  1 
ATOM   1901 C  C   . LEU B 2 99  ? 0.794   3.560   -37.712 1.00   18.52  ? 189  LEU B C   1 
ATOM   1902 O  O   . LEU B 2 99  ? 1.567   4.384   -37.219 1.00   17.37  ? 189  LEU B O   1 
ATOM   1903 C  CB  . LEU B 2 99  ? -1.230  3.330   -36.328 1.00   18.70  ? 189  LEU B CB  1 
ATOM   1904 C  CG  . LEU B 2 99  ? -2.630  2.717   -36.398 1.00   19.15  ? 189  LEU B CG  1 
ATOM   1905 C  CD1 . LEU B 2 99  ? -2.647  1.215   -36.174 1.00   18.94  ? 189  LEU B CD1 1 
ATOM   1906 C  CD2 . LEU B 2 99  ? -3.555  3.438   -35.429 1.00   18.03  ? 189  LEU B CD2 1 
ATOM   1907 N  N   A GLU B 2 100 ? 0.577   3.443   -39.021 0.50   19.12  ? 190  GLU B N   1 
ATOM   1908 N  N   B GLU B 2 100 ? 0.576   3.460   -39.020 0.50   18.52  ? 190  GLU B N   1 
ATOM   1909 C  CA  A GLU B 2 100 ? 1.065   4.410   -40.003 0.50   19.90  ? 190  GLU B CA  1 
ATOM   1910 C  CA  B GLU B 2 100 ? 1.094   4.445   -39.961 0.50   18.78  ? 190  GLU B CA  1 
ATOM   1911 C  C   A GLU B 2 100 ? 0.000   5.481   -40.235 0.50   20.05  ? 190  GLU B C   1 
ATOM   1912 C  C   B GLU B 2 100 ? 0.009   5.476   -40.248 0.50   19.38  ? 190  GLU B C   1 
ATOM   1913 O  O   A GLU B 2 100 ? -1.186  5.250   -39.995 0.50   19.43  ? 190  GLU B O   1 
ATOM   1914 O  O   B GLU B 2 100 ? -1.180  5.214   -40.056 0.50   18.76  ? 190  GLU B O   1 
ATOM   1915 C  CB  A GLU B 2 100 ? 1.358   3.714   -41.338 0.50   20.36  ? 190  GLU B CB  1 
ATOM   1916 C  CB  B GLU B 2 100 ? 1.514   3.772   -41.269 0.50   18.53  ? 190  GLU B CB  1 
ATOM   1917 C  CG  A GLU B 2 100 ? 2.413   2.616   -41.282 0.50   21.43  ? 190  GLU B CG  1 
ATOM   1918 C  CG  B GLU B 2 100 ? 1.993   2.337   -41.121 0.50   17.47  ? 190  GLU B CG  1 
ATOM   1919 C  CD  A GLU B 2 100 ? 2.698   2.005   -42.652 0.50   22.08  ? 190  GLU B CD  1 
ATOM   1920 C  CD  B GLU B 2 100 ? 3.314   2.213   -40.380 0.50   16.25  ? 190  GLU B CD  1 
ATOM   1921 O  OE1 A GLU B 2 100 ? 1.746   1.783   -43.434 0.50   22.85  ? 190  GLU B OE1 1 
ATOM   1922 O  OE1 B GLU B 2 100 ? 3.909   3.244   -40.015 0.50   16.09  ? 190  GLU B OE1 1 
ATOM   1923 O  OE2 A GLU B 2 100 ? 3.879   1.740   -42.951 0.50   22.34  ? 190  GLU B OE2 1 
ATOM   1924 O  OE2 B GLU B 2 100 ? 3.759   1.073   -40.164 0.50   15.97  ? 190  GLU B OE2 1 
ATOM   1925 N  N   . GLN B 2 101 ? 0.424   6.649   -40.712 1.00   20.18  ? 191  GLN B N   1 
ATOM   1926 C  CA  . GLN B 2 101 ? -0.512  7.719   -41.057 1.00   21.32  ? 191  GLN B CA  1 
ATOM   1927 C  C   . GLN B 2 101 ? -1.460  7.241   -42.148 1.00   21.41  ? 191  GLN B C   1 
ATOM   1928 O  O   . GLN B 2 101 ? -1.041  6.560   -43.082 1.00   21.83  ? 191  GLN B O   1 
ATOM   1929 C  CB  . GLN B 2 101 ? 0.249   8.967   -41.519 1.00   22.09  ? 191  GLN B CB  1 
ATOM   1930 C  CG  . GLN B 2 101 ? -0.626  10.039  -42.171 1.00   23.97  ? 191  GLN B CG  1 
ATOM   1931 C  CD  . GLN B 2 101 ? 0.198   11.108  -42.859 1.00   24.52  ? 191  GLN B CD  1 
ATOM   1932 O  OE1 . GLN B 2 101 ? 1.083   11.703  -42.252 1.00   25.75  ? 191  GLN B OE1 1 
ATOM   1933 N  NE2 . GLN B 2 101 ? -0.078  11.347  -44.138 1.00   25.72  ? 191  GLN B NE2 1 
ATOM   1934 N  N   . GLY B 2 102 ? -2.738  7.588   -42.024 1.00   21.01  ? 192  GLY B N   1 
ATOM   1935 C  CA  . GLY B 2 102 ? -3.751  7.132   -42.973 1.00   20.47  ? 192  GLY B CA  1 
ATOM   1936 C  C   . GLY B 2 102 ? -4.432  5.837   -42.557 1.00   19.99  ? 192  GLY B C   1 
ATOM   1937 O  O   . GLY B 2 102 ? -5.497  5.491   -43.062 1.00   20.53  ? 192  GLY B O   1 
ATOM   1938 N  N   . GLU B 2 103 ? -3.820  5.101   -41.637 1.00   19.67  ? 193  GLU B N   1 
ATOM   1939 C  CA  . GLU B 2 103 ? -4.437  3.870   -41.162 1.00   18.23  ? 193  GLU B CA  1 
ATOM   1940 C  C   . GLU B 2 103 ? -5.657  4.162   -40.290 1.00   17.13  ? 193  GLU B C   1 
ATOM   1941 O  O   . GLU B 2 103 ? -5.612  5.041   -39.421 1.00   15.98  ? 193  GLU B O   1 
ATOM   1942 C  CB  . GLU B 2 103 ? -3.432  3.008   -40.405 1.00   18.83  ? 193  GLU B CB  1 
ATOM   1943 C  CG  . GLU B 2 103 ? -2.488  2.232   -41.292 1.00   20.15  ? 193  GLU B CG  1 
ATOM   1944 C  CD  . GLU B 2 103 ? -1.863  1.061   -40.569 1.00   22.05  ? 193  GLU B CD  1 
ATOM   1945 O  OE1 . GLU B 2 103 ? -2.335  -0.083  -40.760 1.00   23.64  ? 193  GLU B OE1 1 
ATOM   1946 O  OE2 . GLU B 2 103 ? -0.913  1.281   -39.794 1.00   21.86  ? 193  GLU B OE2 1 
ATOM   1947 N  N   A ASN B 2 104 ? -6.738  3.425   -40.522 0.50   16.37  ? 194  ASN B N   1 
ATOM   1948 N  N   B ASN B 2 104 ? -6.743  3.434   -40.558 0.50   15.90  ? 194  ASN B N   1 
ATOM   1949 C  CA  A ASN B 2 104 ? -7.931  3.551   -39.697 0.50   16.10  ? 194  ASN B CA  1 
ATOM   1950 C  CA  B ASN B 2 104 ? -7.969  3.486   -39.762 0.50   15.21  ? 194  ASN B CA  1 
ATOM   1951 C  C   A ASN B 2 104 ? -8.164  2.330   -38.816 0.50   15.32  ? 194  ASN B C   1 
ATOM   1952 C  C   B ASN B 2 104 ? -8.008  2.357   -38.733 0.50   14.76  ? 194  ASN B C   1 
ATOM   1953 O  O   A ASN B 2 104 ? -7.799  1.212   -39.170 0.50   14.90  ? 194  ASN B O   1 
ATOM   1954 O  O   B ASN B 2 104 ? -7.361  1.326   -38.913 0.50   14.15  ? 194  ASN B O   1 
ATOM   1955 C  CB  A ASN B 2 104 ? -9.165  3.858   -40.544 0.50   16.32  ? 194  ASN B CB  1 
ATOM   1956 C  CB  B ASN B 2 104 ? -9.215  3.383   -40.652 0.50   14.90  ? 194  ASN B CB  1 
ATOM   1957 C  CG  A ASN B 2 104 ? -9.329  2.902   -41.692 0.50   17.64  ? 194  ASN B CG  1 
ATOM   1958 C  CG  B ASN B 2 104 ? -9.626  4.717   -41.262 0.50   14.80  ? 194  ASN B CG  1 
ATOM   1959 O  OD1 A ASN B 2 104 ? -9.568  1.707   -41.491 0.50   18.43  ? 194  ASN B OD1 1 
ATOM   1960 O  OD1 B ASN B 2 104 ? -8.839  5.380   -41.929 0.50   15.70  ? 194  ASN B OD1 1 
ATOM   1961 N  ND2 A ASN B 2 104 ? -9.195  3.416   -42.912 0.50   16.73  ? 194  ASN B ND2 1 
ATOM   1962 N  ND2 B ASN B 2 104 ? -10.873 5.103   -41.045 0.50   15.37  ? 194  ASN B ND2 1 
ATOM   1963 N  N   . VAL B 2 105 ? -8.760  2.568   -37.652 1.00   14.09  ? 195  VAL B N   1 
ATOM   1964 C  CA  . VAL B 2 105 ? -9.046  1.515   -36.691 1.00   13.06  ? 195  VAL B CA  1 
ATOM   1965 C  C   . VAL B 2 105 ? -10.481 1.723   -36.197 1.00   12.37  ? 195  VAL B C   1 
ATOM   1966 O  O   . VAL B 2 105 ? -10.897 2.851   -35.930 1.00   12.19  ? 195  VAL B O   1 
ATOM   1967 C  CB  . VAL B 2 105 ? -8.085  1.552   -35.476 1.00   13.31  ? 195  VAL B CB  1 
ATOM   1968 C  CG1 . VAL B 2 105 ? -8.587  0.622   -34.389 1.00   13.01  ? 195  VAL B CG1 1 
ATOM   1969 C  CG2 . VAL B 2 105 ? -6.673  1.174   -35.881 1.00   12.19  ? 195  VAL B CG2 1 
ATOM   1970 N  N   . PHE B 2 106 ? -11.236 0.637   -36.101 1.00   11.57  ? 196  PHE B N   1 
ATOM   1971 C  CA  . PHE B 2 106 ? -12.637 0.714   -35.747 1.00   11.40  ? 196  PHE B CA  1 
ATOM   1972 C  C   . PHE B 2 106 ? -13.134 -0.654  -35.347 1.00   11.01  ? 196  PHE B C   1 
ATOM   1973 O  O   . PHE B 2 106 ? -12.447 -1.639  -35.550 1.00   11.41  ? 196  PHE B O   1 
ATOM   1974 C  CB  . PHE B 2 106 ? -13.459 1.260   -36.911 1.00   11.31  ? 196  PHE B CB  1 
ATOM   1975 C  CG  . PHE B 2 106 ? -13.297 0.491   -38.218 1.00   11.02  ? 196  PHE B CG  1 
ATOM   1976 C  CD1 . PHE B 2 106 ? -14.170 -0.536  -38.547 1.00   11.93  ? 196  PHE B CD1 1 
ATOM   1977 C  CD2 . PHE B 2 106 ? -12.307 0.839   -39.129 1.00   10.72  ? 196  PHE B CD2 1 
ATOM   1978 C  CE1 . PHE B 2 106 ? -14.051 -1.226  -39.769 1.00   12.11  ? 196  PHE B CE1 1 
ATOM   1979 C  CE2 . PHE B 2 106 ? -12.178 0.166   -40.346 1.00   11.24  ? 196  PHE B CE2 1 
ATOM   1980 C  CZ  . PHE B 2 106 ? -13.054 -0.873  -40.666 1.00   11.24  ? 196  PHE B CZ  1 
ATOM   1981 N  N   . LEU B 2 107 ? -14.321 -0.709  -34.761 1.00   11.09  ? 197  LEU B N   1 
ATOM   1982 C  CA  . LEU B 2 107 ? -14.924 -1.973  -34.380 1.00   12.42  ? 197  LEU B CA  1 
ATOM   1983 C  C   . LEU B 2 107 ? -16.004 -2.333  -35.397 1.00   13.43  ? 197  LEU B C   1 
ATOM   1984 O  O   . LEU B 2 107 ? -16.715 -1.449  -35.891 1.00   13.45  ? 197  LEU B O   1 
ATOM   1985 C  CB  . LEU B 2 107 ? -15.525 -1.873  -32.970 1.00   12.27  ? 197  LEU B CB  1 
ATOM   1986 C  CG  . LEU B 2 107 ? -14.521 -1.575  -31.849 1.00   12.47  ? 197  LEU B CG  1 
ATOM   1987 C  CD1 . LEU B 2 107 ? -15.223 -1.373  -30.504 1.00   12.28  ? 197  LEU B CD1 1 
ATOM   1988 C  CD2 . LEU B 2 107 ? -13.463 -2.694  -31.746 1.00   12.21  ? 197  LEU B CD2 1 
ATOM   1989 N  N   . GLN B 2 108 ? -16.117 -3.625  -35.702 1.00   14.15  ? 198  GLN B N   1 
ATOM   1990 C  CA  . GLN B 2 108 ? -17.058 -4.123  -36.706 1.00   15.23  ? 198  GLN B CA  1 
ATOM   1991 C  C   . GLN B 2 108 ? -17.941 -5.258  -36.174 1.00   15.33  ? 198  GLN B C   1 
ATOM   1992 O  O   . GLN B 2 108 ? -17.443 -6.225  -35.598 1.00   15.25  ? 198  GLN B O   1 
ATOM   1993 C  CB  . GLN B 2 108 ? -16.300 -4.594  -37.955 1.00   15.55  ? 198  GLN B CB  1 
ATOM   1994 C  CG  . GLN B 2 108 ? -17.091 -5.555  -38.822 1.00   17.68  ? 198  GLN B CG  1 
ATOM   1995 C  CD  . GLN B 2 108 ? -16.330 -5.993  -40.047 1.00   19.02  ? 198  GLN B CD  1 
ATOM   1996 O  OE1 . GLN B 2 108 ? -15.812 -7.103  -40.095 1.00   19.98  ? 198  GLN B OE1 1 
ATOM   1997 N  NE2 . GLN B 2 108 ? -16.237 -5.116  -41.034 1.00   19.78  ? 198  GLN B NE2 1 
ATOM   1998 N  N   . ALA B 2 109 ? -19.252 -5.139  -36.390 1.00   15.47  ? 199  ALA B N   1 
ATOM   1999 C  CA  . ALA B 2 109 ? -20.218 -6.143  -35.927 1.00   16.09  ? 199  ALA B CA  1 
ATOM   2000 C  C   . ALA B 2 109 ? -20.169 -7.461  -36.693 1.00   16.80  ? 199  ALA B C   1 
ATOM   2001 O  O   . ALA B 2 109 ? -19.758 -7.510  -37.848 1.00   16.31  ? 199  ALA B O   1 
ATOM   2002 C  CB  . ALA B 2 109 ? -21.646 -5.568  -35.965 1.00   16.57  ? 199  ALA B CB  1 
ATOM   2003 N  N   . THR B 2 110 ? -20.606 -8.530  -36.032 1.00   18.16  ? 200  THR B N   1 
ATOM   2004 C  CA  . THR B 2 110 ? -20.736 -9.841  -36.661 1.00   19.26  ? 200  THR B CA  1 
ATOM   2005 C  C   . THR B 2 110 ? -22.204 -10.256 -36.675 1.00   19.66  ? 200  THR B C   1 
ATOM   2006 O  O   . THR B 2 110 ? -23.073 -9.491  -36.261 1.00   20.33  ? 200  THR B O   1 
ATOM   2007 C  CB  . THR B 2 110 ? -19.907 -10.924 -35.929 1.00   19.28  ? 200  THR B CB  1 
ATOM   2008 O  OG1 . THR B 2 110 ? -20.404 -11.093 -34.599 1.00   20.07  ? 200  THR B OG1 1 
ATOM   2009 C  CG2 . THR B 2 110 ? -18.440 -10.527 -35.863 1.00   19.33  ? 200  THR B CG2 1 
ATOM   2010 N  N   . ASP B 2 111 ? -22.476 -11.467 -37.147 1.00   20.24  ? 201  ASP B N   1 
ATOM   2011 C  CA  . ASP B 2 111 ? -23.723 -12.288 -36.615 0.0000 26.94  ? 201  ASP B CA  1 
ATOM   2012 C  C   . ASP B 2 111 ? -24.576 -12.011 -35.149 1.00   24.42  ? 201  ASP B C   1 
ATOM   2013 O  O   . ASP B 2 111 ? -25.718 -11.849 -34.713 1.00   23.34  ? 201  ASP B O   1 
ATOM   2014 C  CB  . ASP B 2 111 ? -23.589 -13.793 -36.887 0.0000 28.85  ? 201  ASP B CB  1 
ATOM   2015 C  CG  . ASP B 2 111 ? -24.931 -14.508 -36.892 0.0000 31.80  ? 201  ASP B CG  1 
ATOM   2016 O  OD1 . ASP B 2 111 ? -25.873 -13.962 -37.518 0.0000 33.37  ? 201  ASP B OD1 1 
ATOM   2017 O  OD2 . ASP B 2 111 ? -25.044 -15.609 -36.286 0.0000 32.45  ? 201  ASP B OD2 1 
ATOM   2018 N  N   . LYS B 2 112 ? -23.514 -12.185 -34.363 1.00   24.88  ? 202  LYS B N   1 
ATOM   2019 C  CA  . LYS B 2 112 ? -23.582 -12.010 -32.906 1.00   24.92  ? 202  LYS B CA  1 
ATOM   2020 C  C   . LYS B 2 112 ? -23.515 -10.523 -32.529 1.00   25.29  ? 202  LYS B C   1 
ATOM   2021 O  O   . LYS B 2 112 ? -22.431 -9.976  -32.268 1.00   24.07  ? 202  LYS B O   1 
ATOM   2022 C  CB  . LYS B 2 112 ? -22.448 -12.785 -32.229 1.00   25.33  ? 202  LYS B CB  1 
ATOM   2023 C  CG  . LYS B 2 112 ? -22.721 -14.270 -32.021 1.00   26.52  ? 202  LYS B CG  1 
ATOM   2024 C  CD  . LYS B 2 112 ? -22.677 -15.066 -33.310 1.00   27.87  ? 202  LYS B CD  1 
ATOM   2025 C  CE  . LYS B 2 112 ? -22.937 -16.553 -33.045 1.00   29.05  ? 202  LYS B CE  1 
ATOM   2026 N  NZ  . LYS B 2 112 ? -24.281 -16.812 -32.428 1.00   29.90  ? 202  LYS B NZ  1 
ATOM   2027 N  N   . ASN B 2 113 ? -24.682 -9.883  -32.489 1.00   25.20  ? 203  ASN B N   1 
ATOM   2028 C  CA  . ASN B 2 113 ? -24.758 -8.424  -32.494 1.00   25.74  ? 203  ASN B CA  1 
ATOM   2029 C  C   . ASN B 2 113 ? -25.475 -7.795  -31.305 1.00   25.96  ? 203  ASN B C   1 
ATOM   2030 O  O   . ASN B 2 113 ? -25.875 -6.629  -31.371 1.00   26.02  ? 203  ASN B O   1 
ATOM   2031 C  CB  . ASN B 2 113 ? -25.418 -7.939  -33.798 1.00   26.35  ? 203  ASN B CB  1 
ATOM   2032 C  CG  . ASN B 2 113 ? -26.903 -8.296  -33.877 1.00   27.19  ? 203  ASN B CG  1 
ATOM   2033 O  OD1 . ASN B 2 113 ? -27.367 -9.228  -33.214 1.00   28.78  ? 203  ASN B OD1 1 
ATOM   2034 N  ND2 . ASN B 2 113 ? -27.654 -7.546  -34.679 1.00   26.45  ? 203  ASN B ND2 1 
ATOM   2035 N  N   . SER B 2 114 ? -25.645 -8.546  -30.222 1.00   25.60  ? 204  SER B N   1 
ATOM   2036 C  CA  . SER B 2 114 ? -26.326 -8.000  -29.048 1.00   25.77  ? 204  SER B CA  1 
ATOM   2037 C  C   . SER B 2 114 ? -25.456 -6.958  -28.347 1.00   25.45  ? 204  SER B C   1 
ATOM   2038 O  O   . SER B 2 114 ? -24.527 -7.301  -27.622 1.00   25.02  ? 204  SER B O   1 
ATOM   2039 C  CB  . SER B 2 114 ? -26.720 -9.112  -28.075 1.00   25.96  ? 204  SER B CB  1 
ATOM   2040 O  OG  . SER B 2 114 ? -27.472 -8.592  -26.985 1.00   26.72  ? 204  SER B OG  1 
ATOM   2041 N  N   . LEU B 2 115 ? -25.757 -5.686  -28.586 1.00   25.49  ? 205  LEU B N   1 
ATOM   2042 C  CA  . LEU B 2 115 ? -25.025 -4.587  -27.969 1.00   25.88  ? 205  LEU B CA  1 
ATOM   2043 C  C   . LEU B 2 115 ? -25.969 -3.461  -27.570 1.00   25.92  ? 205  LEU B C   1 
ATOM   2044 O  O   . LEU B 2 115 ? -26.774 -2.994  -28.373 1.00   25.38  ? 205  LEU B O   1 
ATOM   2045 C  CB  . LEU B 2 115 ? -23.925 -4.056  -28.899 1.00   25.92  ? 205  LEU B CB  1 
ATOM   2046 C  CG  . LEU B 2 115 ? -22.923 -3.085  -28.251 1.00   26.29  ? 205  LEU B CG  1 
ATOM   2047 C  CD1 . LEU B 2 115 ? -21.517 -3.245  -28.811 1.00   26.48  ? 205  LEU B CD1 1 
ATOM   2048 C  CD2 . LEU B 2 115 ? -23.385 -1.648  -28.402 1.00   26.77  ? 205  LEU B CD2 1 
ATOM   2049 N  N   . LEU B 2 116 ? -25.857 -3.034  -26.319 1.00   26.24  ? 206  LEU B N   1 
ATOM   2050 C  CA  . LEU B 2 116 ? -26.649 -1.930  -25.804 1.00   26.95  ? 206  LEU B CA  1 
ATOM   2051 C  C   . LEU B 2 116 ? -25.819 -0.655  -25.735 1.00   27.39  ? 206  LEU B C   1 
ATOM   2052 O  O   . LEU B 2 116 ? -24.606 -0.692  -25.522 1.00   27.38  ? 206  LEU B O   1 
ATOM   2053 C  CB  . LEU B 2 116 ? -27.195 -2.262  -24.412 1.00   27.47  ? 206  LEU B CB  1 
ATOM   2054 C  CG  . LEU B 2 116 ? -28.227 -3.387  -24.343 1.00   28.36  ? 206  LEU B CG  1 
ATOM   2055 C  CD1 . LEU B 2 116 ? -28.286 -3.976  -22.935 1.00   28.93  ? 206  LEU B CD1 1 
ATOM   2056 C  CD2 . LEU B 2 116 ? -29.589 -2.879  -24.784 1.00   28.13  ? 206  LEU B CD2 1 
ATOM   2057 N  N   . GLY B 2 117 ? -26.489 0.471   -25.935 1.00   27.76  ? 207  GLY B N   1 
ATOM   2058 C  CA  . GLY B 2 117 ? -25.887 1.774   -25.740 1.00   28.57  ? 207  GLY B CA  1 
ATOM   2059 C  C   . GLY B 2 117 ? -26.925 2.699   -25.142 1.00   29.05  ? 207  GLY B C   1 
ATOM   2060 O  O   . GLY B 2 117 ? -27.780 3.220   -25.850 1.00   28.70  ? 207  GLY B O   1 
ATOM   2061 N  N   . MET B 2 118 ? -26.868 2.887   -23.829 1.00   30.07  ? 208  MET B N   1 
ATOM   2062 C  CA  . MET B 2 118 ? -27.857 3.722   -23.167 1.00   31.37  ? 208  MET B CA  1 
ATOM   2063 C  C   . MET B 2 118 ? -27.509 4.095   -21.738 1.00   31.22  ? 208  MET B C   1 
ATOM   2064 O  O   . MET B 2 118 ? -26.492 3.675   -21.194 1.00   31.17  ? 208  MET B O   1 
ATOM   2065 C  CB  . MET B 2 118 ? -29.225 3.045   -23.188 1.00   32.66  ? 208  MET B CB  1 
ATOM   2066 C  CG  . MET B 2 118 ? -29.252 1.654   -22.577 1.00   33.49  ? 208  MET B CG  1 
ATOM   2067 S  SD  . MET B 2 118 ? -30.837 0.887   -22.945 1.00   36.83  ? 208  MET B SD  1 
ATOM   2068 C  CE  . MET B 2 118 ? -31.303 1.842   -24.383 1.00   33.91  ? 208  MET B CE  1 
ATOM   2069 N  N   . GLU B 2 119 ? -28.388 4.897   -21.150 1.00   31.07  ? 209  GLU B N   1 
ATOM   2070 C  CA  . GLU B 2 119 ? -28.252 5.381   -19.790 1.00   30.85  ? 209  GLU B CA  1 
ATOM   2071 C  C   . GLU B 2 119 ? -28.357 4.194   -18.841 1.00   29.24  ? 209  GLU B C   1 
ATOM   2072 O  O   . GLU B 2 119 ? -29.399 3.533   -18.779 1.00   30.06  ? 209  GLU B O   1 
ATOM   2073 C  CB  . GLU B 2 119 ? -29.370 6.391   -19.506 1.00   31.66  ? 209  GLU B CB  1 
ATOM   2074 C  CG  . GLU B 2 119 ? -29.291 7.094   -18.164 1.00   34.09  ? 209  GLU B CG  1 
ATOM   2075 C  CD  . GLU B 2 119 ? -28.404 8.320   -18.196 1.00   35.36  ? 209  GLU B CD  1 
ATOM   2076 O  OE1 . GLU B 2 119 ? -27.786 8.574   -19.253 1.00   36.25  ? 209  GLU B OE1 1 
ATOM   2077 O  OE2 . GLU B 2 119 ? -28.328 9.030   -17.162 1.00   36.06  ? 209  GLU B OE2 1 
ATOM   2078 N  N   . GLY B 2 120 ? -27.274 3.915   -18.122 1.00   27.12  ? 210  GLY B N   1 
ATOM   2079 C  CA  . GLY B 2 120 ? -27.269 2.830   -17.138 1.00   23.70  ? 210  GLY B CA  1 
ATOM   2080 C  C   . GLY B 2 120 ? -26.597 1.564   -17.633 1.00   20.81  ? 210  GLY B C   1 
ATOM   2081 O  O   . GLY B 2 120 ? -26.375 0.628   -16.867 1.00   19.96  ? 210  GLY B O   1 
ATOM   2082 N  N   . ALA B 2 121 ? -26.281 1.532   -18.923 1.00   18.38  ? 211  ALA B N   1 
ATOM   2083 C  CA  . ALA B 2 121 ? -25.534 0.432   -19.498 1.00   16.55  ? 211  ALA B CA  1 
ATOM   2084 C  C   . ALA B 2 121 ? -24.879 0.897   -20.790 1.00   15.80  ? 211  ALA B C   1 
ATOM   2085 O  O   . ALA B 2 121 ? -25.372 0.626   -21.879 1.00   15.73  ? 211  ALA B O   1 
ATOM   2086 C  CB  . ALA B 2 121 ? -26.444 -0.785  -19.749 1.00   16.80  ? 211  ALA B CB  1 
ATOM   2087 N  N   . ASN B 2 122 ? -23.758 1.595   -20.647 1.00   15.17  ? 212  ASN B N   1 
ATOM   2088 C  CA  . ASN B 2 122 ? -23.083 2.223   -21.759 1.00   14.02  ? 212  ASN B CA  1 
ATOM   2089 C  C   . ASN B 2 122 ? -22.207 1.247   -22.532 1.00   12.84  ? 212  ASN B C   1 
ATOM   2090 O  O   . ASN B 2 122 ? -21.880 0.168   -22.045 1.00   12.77  ? 212  ASN B O   1 
ATOM   2091 C  CB  . ASN B 2 122 ? -22.203 3.384   -21.274 1.00   14.72  ? 212  ASN B CB  1 
ATOM   2092 C  CG  . ASN B 2 122 ? -22.911 4.316   -20.309 1.00   15.54  ? 212  ASN B CG  1 
ATOM   2093 O  OD1 . ASN B 2 122 ? -22.276 4.879   -19.436 1.00   16.37  ? 212  ASN B OD1 1 
ATOM   2094 N  ND2 . ASN B 2 122 ? -24.221 4.490   -20.466 1.00   17.28  ? 212  ASN B ND2 1 
ATOM   2095 N  N   . SER B 2 123 ? -21.839 1.641   -23.747 1.00   11.50  ? 213  SER B N   1 
ATOM   2096 C  CA  . SER B 2 123 ? -20.796 0.966   -24.499 1.00   9.79   ? 213  SER B CA  1 
ATOM   2097 C  C   . SER B 2 123 ? -19.842 2.053   -24.990 1.00   9.68   ? 213  SER B C   1 
ATOM   2098 O  O   . SER B 2 123 ? -20.280 3.108   -25.459 1.00   9.55   ? 213  SER B O   1 
ATOM   2099 C  CB  . SER B 2 123 ? -21.384 0.183   -25.670 1.00   9.58   ? 213  SER B CB  1 
ATOM   2100 O  OG  . SER B 2 123 ? -22.181 -0.890  -25.212 1.00   10.93  ? 213  SER B OG  1 
ATOM   2101 N  N   . ILE B 2 124 ? -18.541 1.801   -24.896 1.00   9.38   ? 214  ILE B N   1 
ATOM   2102 C  CA  . ILE B 2 124 ? -17.565 2.860   -25.117 1.00   8.87   ? 214  ILE B CA  1 
ATOM   2103 C  C   . ILE B 2 124 ? -16.354 2.354   -25.872 1.00   9.29   ? 214  ILE B C   1 
ATOM   2104 O  O   . ILE B 2 124 ? -15.945 1.205   -25.711 1.00   9.64   ? 214  ILE B O   1 
ATOM   2105 C  CB  . ILE B 2 124 ? -17.121 3.481   -23.769 1.00   8.98   ? 214  ILE B CB  1 
ATOM   2106 C  CG1 . ILE B 2 124 ? -16.240 4.719   -23.989 1.00   9.08   ? 214  ILE B CG1 1 
ATOM   2107 C  CG2 . ILE B 2 124 ? -16.415 2.441   -22.896 1.00   8.26   ? 214  ILE B CG2 1 
ATOM   2108 C  CD1 . ILE B 2 124 ? -15.919 5.465   -22.703 1.00   8.56   ? 214  ILE B CD1 1 
ATOM   2109 N  N   . PHE B 2 125 ? -15.774 3.237   -26.676 1.00   9.93   ? 215  PHE B N   1 
ATOM   2110 C  CA  . PHE B 2 125 ? -14.624 2.929   -27.525 1.00   9.37   ? 215  PHE B CA  1 
ATOM   2111 C  C   . PHE B 2 125 ? -13.601 4.033   -27.300 1.00   8.97   ? 215  PHE B C   1 
ATOM   2112 O  O   . PHE B 2 125 ? -13.923 5.214   -27.442 1.00   9.09   ? 215  PHE B O   1 
ATOM   2113 C  CB  . PHE B 2 125 ? -15.093 2.880   -28.992 1.00   9.78   ? 215  PHE B CB  1 
ATOM   2114 C  CG  . PHE B 2 125 ? -14.002 2.589   -29.993 1.00   9.73   ? 215  PHE B CG  1 
ATOM   2115 C  CD1 . PHE B 2 125 ? -12.941 1.755   -29.682 1.00   9.79   ? 215  PHE B CD1 1 
ATOM   2116 C  CD2 . PHE B 2 125 ? -14.079 3.119   -31.272 1.00   10.97  ? 215  PHE B CD2 1 
ATOM   2117 C  CE1 . PHE B 2 125 ? -11.948 1.480   -30.616 1.00   11.55  ? 215  PHE B CE1 1 
ATOM   2118 C  CE2 . PHE B 2 125 ? -13.102 2.858   -32.209 1.00   10.54  ? 215  PHE B CE2 1 
ATOM   2119 C  CZ  . PHE B 2 125 ? -12.023 2.043   -31.882 1.00   10.41  ? 215  PHE B CZ  1 
ATOM   2120 N  N   . SER B 2 126 ? -12.384 3.651   -26.903 1.00   8.69   ? 216  SER B N   1 
ATOM   2121 C  CA  . SER B 2 126 ? -11.322 4.611   -26.631 1.00   8.33   ? 216  SER B CA  1 
ATOM   2122 C  C   . SER B 2 126 ? -10.004 4.199   -27.268 1.00   8.53   ? 216  SER B C   1 
ATOM   2123 O  O   . SER B 2 126 ? -9.783  3.036   -27.570 1.00   7.64   ? 216  SER B O   1 
ATOM   2124 C  CB  . SER B 2 126 ? -11.090 4.766   -25.119 1.00   9.34   ? 216  SER B CB  1 
ATOM   2125 O  OG  . SER B 2 126 ? -12.307 4.915   -24.411 1.00   8.28   ? 216  SER B OG  1 
ATOM   2126 N  N   . GLY B 2 127 ? -9.122  5.174   -27.446 1.00   7.96   ? 217  GLY B N   1 
ATOM   2127 C  CA  . GLY B 2 127 ? -7.786  4.914   -27.933 1.00   8.44   ? 217  GLY B CA  1 
ATOM   2128 C  C   . GLY B 2 127 ? -6.921  6.116   -27.625 1.00   8.57   ? 217  GLY B C   1 
ATOM   2129 O  O   . GLY B 2 127 ? -7.424  7.230   -27.515 1.00   9.55   ? 217  GLY B O   1 
ATOM   2130 N  N   . PHE B 2 128 ? -5.621  5.903   -27.477 1.00   9.05   ? 218  PHE B N   1 
ATOM   2131 C  CA  . PHE B 2 128 ? -4.712  7.020   -27.243 1.00   10.01  ? 218  PHE B CA  1 
ATOM   2132 C  C   . PHE B 2 128 ? -3.313  6.726   -27.740 1.00   11.54  ? 218  PHE B C   1 
ATOM   2133 O  O   . PHE B 2 128 ? -2.909  5.566   -27.834 1.00   10.91  ? 218  PHE B O   1 
ATOM   2134 C  CB  . PHE B 2 128 ? -4.667  7.413   -25.758 1.00   10.39  ? 218  PHE B CB  1 
ATOM   2135 C  CG  . PHE B 2 128 ? -4.396  6.265   -24.822 1.00   9.37   ? 218  PHE B CG  1 
ATOM   2136 C  CD1 . PHE B 2 128 ? -3.094  5.908   -24.499 1.00   9.42   ? 218  PHE B CD1 1 
ATOM   2137 C  CD2 . PHE B 2 128 ? -5.447  5.560   -24.244 1.00   9.50   ? 218  PHE B CD2 1 
ATOM   2138 C  CE1 . PHE B 2 128 ? -2.840  4.855   -23.603 1.00   10.26  ? 218  PHE B CE1 1 
ATOM   2139 C  CE2 . PHE B 2 128 ? -5.211  4.510   -23.359 1.00   9.75   ? 218  PHE B CE2 1 
ATOM   2140 C  CZ  . PHE B 2 128 ? -3.901  4.159   -23.030 1.00   9.47   ? 218  PHE B CZ  1 
ATOM   2141 N  N   . LEU B 2 129 ? -2.574  7.787   -28.051 1.00   12.98  ? 219  LEU B N   1 
ATOM   2142 C  CA  . LEU B 2 129 ? -1.185  7.641   -28.471 1.00   14.68  ? 219  LEU B CA  1 
ATOM   2143 C  C   . LEU B 2 129 ? -0.310  7.336   -27.250 1.00   15.70  ? 219  LEU B C   1 
ATOM   2144 O  O   . LEU B 2 129 ? -0.406  8.017   -26.227 1.00   16.32  ? 219  LEU B O   1 
ATOM   2145 C  CB  . LEU B 2 129 ? -0.722  8.906   -29.211 1.00   14.31  ? 219  LEU B CB  1 
ATOM   2146 C  CG  . LEU B 2 129 ? 0.720   9.052   -29.722 1.00   15.04  ? 219  LEU B CG  1 
ATOM   2147 C  CD1 . LEU B 2 129 ? 1.065   8.007   -30.786 1.00   13.52  ? 219  LEU B CD1 1 
ATOM   2148 C  CD2 . LEU B 2 129 ? 0.950   10.472  -30.268 1.00   15.53  ? 219  LEU B CD2 1 
ATOM   2149 N  N   . LEU B 2 130 ? 0.499   6.282   -27.351 1.00   16.67  ? 220  LEU B N   1 
ATOM   2150 C  CA  . LEU B 2 130 ? 1.502   5.950   -26.340 1.00   18.28  ? 220  LEU B CA  1 
ATOM   2151 C  C   . LEU B 2 130 ? 2.810   6.676   -26.635 1.00   20.02  ? 220  LEU B C   1 
ATOM   2152 O  O   . LEU B 2 130 ? 3.351   7.383   -25.781 1.00   19.88  ? 220  LEU B O   1 
ATOM   2153 C  CB  . LEU B 2 130 ? 1.760   4.439   -26.309 1.00   18.31  ? 220  LEU B CB  1 
ATOM   2154 C  CG  . LEU B 2 130 ? 0.558   3.520   -26.043 1.00   18.31  ? 220  LEU B CG  1 
ATOM   2155 C  CD1 . LEU B 2 130 ? 0.871   2.060   -26.362 1.00   18.60  ? 220  LEU B CD1 1 
ATOM   2156 C  CD2 . LEU B 2 130 ? 0.086   3.661   -24.611 1.00   18.21  ? 220  LEU B CD2 1 
ATOM   2157 N  N   . PHE B 2 131 ? 3.306   6.491   -27.859 1.00   21.53  ? 221  PHE B N   1 
ATOM   2158 C  CA  . PHE B 2 131 ? 4.588   7.028   -28.284 1.00   23.77  ? 221  PHE B CA  1 
ATOM   2159 C  C   . PHE B 2 131 ? 4.548   7.356   -29.773 1.00   24.66  ? 221  PHE B C   1 
ATOM   2160 O  O   . PHE B 2 131 ? 4.237   6.492   -30.591 1.00   23.02  ? 221  PHE B O   1 
ATOM   2161 C  CB  . PHE B 2 131 ? 5.720   6.013   -28.048 1.00   24.54  ? 221  PHE B CB  1 
ATOM   2162 C  CG  . PHE B 2 131 ? 5.697   5.363   -26.695 1.00   26.13  ? 221  PHE B CG  1 
ATOM   2163 C  CD1 . PHE B 2 131 ? 5.319   4.032   -26.559 1.00   26.20  ? 221  PHE B CD1 1 
ATOM   2164 C  CD2 . PHE B 2 131 ? 6.052   6.078   -25.558 1.00   26.87  ? 221  PHE B CD2 1 
ATOM   2165 C  CE1 . PHE B 2 131 ? 5.294   3.422   -25.313 1.00   26.63  ? 221  PHE B CE1 1 
ATOM   2166 C  CE2 . PHE B 2 131 ? 6.026   5.474   -24.304 1.00   27.68  ? 221  PHE B CE2 1 
ATOM   2167 C  CZ  . PHE B 2 131 ? 5.645   4.138   -24.185 1.00   26.60  ? 221  PHE B CZ  1 
ATOM   2168 N  N   . PRO B 2 132 ? 4.872   8.608   -30.121 1.00   26.48  ? 222  PRO B N   1 
ATOM   2169 C  CA  . PRO B 2 132 ? 5.021   9.071   -31.505 1.00   28.23  ? 222  PRO B CA  1 
ATOM   2170 C  C   . PRO B 2 132 ? 6.188   8.378   -32.202 1.00   30.33  ? 222  PRO B C   1 
ATOM   2171 O  O   . PRO B 2 132 ? 7.160   8.005   -31.545 1.00   30.41  ? 222  PRO B O   1 
ATOM   2172 C  CB  . PRO B 2 132 ? 5.340   10.561  -31.350 1.00   27.72  ? 222  PRO B CB  1 
ATOM   2173 C  CG  . PRO B 2 132 ? 4.901   10.923  -29.971 1.00   27.76  ? 222  PRO B CG  1 
ATOM   2174 C  CD  . PRO B 2 132 ? 5.103   9.687   -29.147 1.00   26.85  ? 222  PRO B CD  1 
ATOM   2175 N  N   . ASP B 2 133 ? 6.082   8.205   -33.518 1.00   32.34  ? 223  ASP B N   1 
ATOM   2176 C  CA  . ASP B 2 133 ? 7.174   7.651   -34.319 1.00   34.40  ? 223  ASP B CA  1 
ATOM   2177 C  C   . ASP B 2 133 ? 8.332   8.627   -34.466 1.00   35.20  ? 223  ASP B C   1 
ATOM   2178 O  O   . ASP B 2 133 ? 8.138   9.848   -34.497 1.00   35.14  ? 223  ASP B O   1 
ATOM   2179 C  CB  . ASP B 2 133 ? 6.680   7.254   -35.708 1.00   35.26  ? 223  ASP B CB  1 
ATOM   2180 C  CG  . ASP B 2 133 ? 6.793   5.769   -35.962 1.00   36.79  ? 223  ASP B CG  1 
ATOM   2181 O  OD1 . ASP B 2 133 ? 7.510   5.083   -35.199 1.00   38.12  ? 223  ASP B OD1 1 
ATOM   2182 O  OD2 . ASP B 2 133 ? 6.177   5.290   -36.940 1.00   38.40  ? 223  ASP B OD2 1 
ATOM   2183 N  N   . MET B 2 134 ? 9.488   8.202   -34.563 1.00   35.95  ? 224  MET B N   1 
ATOM   2184 N  N   . LYS C 3 1   ? 10.854  13.531  -13.229 1.00   41.64  ? 87   LYS C N   1 
ATOM   2185 C  CA  . LYS C 3 1   ? 10.380  14.050  -11.575 0.0000 20.00  ? 87   LYS C CA  1 
ATOM   2186 C  C   . LYS C 3 1   ? 8.778   13.559  -11.375 1.00   24.63  ? 87   LYS C C   1 
ATOM   2187 O  O   . LYS C 3 1   ? 7.758   13.622  -12.069 1.00   24.51  ? 87   LYS C O   1 
ATOM   2188 C  CB  . LYS C 3 1   ? 10.655  15.536  -11.340 0.0000 20.00  ? 87   LYS C CB  1 
ATOM   2189 C  CG  . LYS C 3 1   ? 12.045  15.985  -11.764 0.0000 20.00  ? 87   LYS C CG  1 
ATOM   2190 C  CD  . LYS C 3 1   ? 12.226  17.481  -11.569 0.0000 20.00  ? 87   LYS C CD  1 
ATOM   2191 C  CE  . LYS C 3 1   ? 13.618  17.928  -11.981 0.0000 20.00  ? 87   LYS C CE  1 
ATOM   2192 N  NZ  . LYS C 3 1   ? 13.808  19.394  -11.798 0.0000 20.00  ? 87   LYS C NZ  1 
ATOM   2193 N  N   . GLN C 3 2   ? 8.857   12.850  -10.249 1.00   24.36  ? 88   GLN C N   1 
ATOM   2194 C  CA  . GLN C 3 2   ? 7.754   12.016  -9.777  1.00   24.15  ? 88   GLN C CA  1 
ATOM   2195 C  C   . GLN C 3 2   ? 6.485   12.835  -9.570  1.00   24.12  ? 88   GLN C C   1 
ATOM   2196 O  O   . GLN C 3 2   ? 5.386   12.400  -9.919  1.00   23.24  ? 88   GLN C O   1 
ATOM   2197 C  CB  . GLN C 3 2   ? 8.139   11.316  -8.476  1.00   24.84  ? 88   GLN C CB  1 
ATOM   2198 C  CG  . GLN C 3 2   ? 6.960   10.673  -7.747  1.00   25.35  ? 88   GLN C CG  1 
ATOM   2199 C  CD  . GLN C 3 2   ? 7.352   10.098  -6.398  1.00   25.02  ? 88   GLN C CD  1 
ATOM   2200 O  OE1 . GLN C 3 2   ? 7.986   9.046   -6.315  1.00   24.45  ? 88   GLN C OE1 1 
ATOM   2201 N  NE2 . GLN C 3 2   ? 6.966   10.785  -5.335  1.00   25.44  ? 88   GLN C NE2 1 
ATOM   2202 N  N   . LYS C 3 3   ? 6.640   14.030  -9.009  1.00   24.01  ? 89   LYS C N   1 
ATOM   2203 C  CA  . LYS C 3 3   ? 5.491   14.894  -8.749  1.00   24.02  ? 89   LYS C CA  1 
ATOM   2204 C  C   . LYS C 3 3   ? 4.960   15.599  -9.994  1.00   22.53  ? 89   LYS C C   1 
ATOM   2205 O  O   . LYS C 3 3   ? 3.978   16.326  -9.922  1.00   23.78  ? 89   LYS C O   1 
ATOM   2206 C  CB  . LYS C 3 3   ? 5.817   15.906  -7.650  1.00   25.00  ? 89   LYS C CB  1 
ATOM   2207 C  CG  . LYS C 3 3   ? 7.123   16.655  -7.858  1.00   27.12  ? 89   LYS C CG  1 
ATOM   2208 C  CD  . LYS C 3 3   ? 7.558   17.349  -6.571  1.00   28.78  ? 89   LYS C CD  1 
ATOM   2209 C  CE  . LYS C 3 3   ? 9.047   17.681  -6.584  1.00   30.47  ? 89   LYS C CE  1 
ATOM   2210 N  NZ  . LYS C 3 3   ? 9.919   16.563  -6.097  1.00   31.36  ? 89   LYS C NZ  1 
ATOM   2211 N  N   . PHE C 3 4   ? 5.608   15.390  -11.131 1.00   21.65  ? 90   PHE C N   1 
ATOM   2212 C  CA  . PHE C 3 4   ? 5.104   15.904  -12.407 1.00   20.42  ? 90   PHE C CA  1 
ATOM   2213 C  C   . PHE C 3 4   ? 4.354   14.816  -13.193 1.00   19.20  ? 90   PHE C C   1 
ATOM   2214 O  O   . PHE C 3 4   ? 3.931   15.020  -14.332 1.00   19.50  ? 90   PHE C O   1 
ATOM   2215 C  CB  . PHE C 3 4   ? 6.252   16.511  -13.226 1.00   21.28  ? 90   PHE C CB  1 
ATOM   2216 C  CG  . PHE C 3 4   ? 6.617   17.914  -12.796 1.00   21.13  ? 90   PHE C CG  1 
ATOM   2217 C  CD1 . PHE C 3 4   ? 6.269   19.007  -13.576 1.00   21.04  ? 90   PHE C CD1 1 
ATOM   2218 C  CD2 . PHE C 3 4   ? 7.270   18.138  -11.595 1.00   22.18  ? 90   PHE C CD2 1 
ATOM   2219 C  CE1 . PHE C 3 4   ? 6.581   20.288  -13.174 1.00   21.02  ? 90   PHE C CE1 1 
ATOM   2220 C  CE2 . PHE C 3 4   ? 7.586   19.428  -11.187 1.00   21.03  ? 90   PHE C CE2 1 
ATOM   2221 C  CZ  . PHE C 3 4   ? 7.237   20.499  -11.980 1.00   20.98  ? 90   PHE C CZ  1 
ATOM   2222 N  N   . GLN C 3 5   ? 4.179   13.662  -12.564 1.00   17.38  ? 91   GLN C N   1 
ATOM   2223 C  CA  . GLN C 3 5   ? 3.424   12.564  -13.164 1.00   16.32  ? 91   GLN C CA  1 
ATOM   2224 C  C   . GLN C 3 5   ? 2.224   12.209  -12.283 1.00   14.85  ? 91   GLN C C   1 
ATOM   2225 O  O   . GLN C 3 5   ? 2.051   12.779  -11.209 1.00   14.00  ? 91   GLN C O   1 
ATOM   2226 C  CB  . GLN C 3 5   ? 4.330   11.342  -13.346 1.00   16.82  ? 91   GLN C CB  1 
ATOM   2227 C  CG  . GLN C 3 5   ? 5.542   11.577  -14.257 1.00   18.04  ? 91   GLN C CG  1 
ATOM   2228 C  CD  . GLN C 3 5   ? 5.163   11.697  -15.733 1.00   19.70  ? 91   GLN C CD  1 
ATOM   2229 O  OE1 . GLN C 3 5   ? 4.145   11.163  -16.166 1.00   21.63  ? 91   GLN C OE1 1 
ATOM   2230 N  NE2 . GLN C 3 5   ? 5.989   12.398  -16.510 1.00   19.81  ? 91   GLN C NE2 1 
ATOM   2231 N  N   . SER C 3 6   ? 1.403   11.264  -12.734 1.00   13.46  ? 92   SER C N   1 
ATOM   2232 C  CA  . SER C 3 6   ? 0.285   10.782  -11.922 1.00   12.88  ? 92   SER C CA  1 
ATOM   2233 C  C   . SER C 3 6   ? -0.135  9.363   -12.304 1.00   11.74  ? 92   SER C C   1 
ATOM   2234 O  O   . SER C 3 6   ? -0.408  9.075   -13.467 1.00   10.86  ? 92   SER C O   1 
ATOM   2235 C  CB  . SER C 3 6   ? -0.922  11.728  -12.008 1.00   13.10  ? 92   SER C CB  1 
ATOM   2236 O  OG  . SER C 3 6   ? -2.043  11.149  -11.349 1.00   12.92  ? 92   SER C OG  1 
ATOM   2237 N  N   . VAL C 3 7   ? -0.187  8.485   -11.309 1.00   10.84  ? 93   VAL C N   1 
ATOM   2238 C  CA  . VAL C 3 7   ? -0.499  7.078   -11.542 1.00   10.43  ? 93   VAL C CA  1 
ATOM   2239 C  C   . VAL C 3 7   ? -0.947  6.431   -10.238 1.00   9.37   ? 93   VAL C C   1 
ATOM   2240 O  O   . VAL C 3 7   ? -0.434  6.755   -9.166  1.00   7.74   ? 93   VAL C O   1 
ATOM   2241 C  CB  . VAL C 3 7   ? 0.743   6.321   -12.050 1.00   11.34  ? 93   VAL C CB  1 
ATOM   2242 C  CG1 . VAL C 3 7   ? 1.603   5.861   -10.870 1.00   12.83  ? 93   VAL C CG1 1 
ATOM   2243 C  CG2 . VAL C 3 7   ? 0.343   5.148   -12.895 1.00   12.06  ? 93   VAL C CG2 1 
ATOM   2244 N  N   . PHE C 3 8   ? -1.918  5.527   -10.320 1.00   8.15   ? 94   PHE C N   1 
ATOM   2245 C  CA  . PHE C 3 8   ? -2.268  4.736   -9.153  1.00   6.42   ? 94   PHE C CA  1 
ATOM   2246 C  C   . PHE C 3 8   ? -2.930  3.436   -9.583  1.00   5.81   ? 94   PHE C C   1 
ATOM   2247 O  O   . PHE C 3 8   ? -3.467  3.342   -10.676 1.00   5.40   ? 94   PHE C O   1 
ATOM   2248 C  CB  . PHE C 3 8   ? -3.183  5.524   -8.214  1.00   5.86   ? 94   PHE C CB  1 
ATOM   2249 C  CG  . PHE C 3 8   ? -4.562  5.750   -8.763  1.00   4.73   ? 94   PHE C CG  1 
ATOM   2250 C  CD1 . PHE C 3 8   ? -5.559  4.801   -8.587  1.00   4.91   ? 94   PHE C CD1 1 
ATOM   2251 C  CD2 . PHE C 3 8   ? -4.854  6.891   -9.487  1.00   5.50   ? 94   PHE C CD2 1 
ATOM   2252 C  CE1 . PHE C 3 8   ? -6.826  5.002   -9.105  1.00   5.10   ? 94   PHE C CE1 1 
ATOM   2253 C  CE2 . PHE C 3 8   ? -6.118  7.091   -10.001 1.00   5.16   ? 94   PHE C CE2 1 
ATOM   2254 C  CZ  . PHE C 3 8   ? -7.102  6.144   -9.809  1.00   4.49   ? 94   PHE C CZ  1 
ATOM   2255 N  N   . THR C 3 9   ? -2.819  2.426   -8.725  1.00   5.58   ? 95   THR C N   1 
ATOM   2256 C  CA  . THR C 3 9   ? -3.628  1.218   -8.779  1.00   3.65   ? 95   THR C CA  1 
ATOM   2257 C  C   . THR C 3 9   ? -3.960  0.898   -7.337  1.00   3.40   ? 95   THR C C   1 
ATOM   2258 O  O   . THR C 3 9   ? -3.069  0.684   -6.517  1.00   2.49   ? 95   THR C O   1 
ATOM   2259 C  CB  . THR C 3 9   ? -2.897  0.031   -9.401  1.00   3.69   ? 95   THR C CB  1 
ATOM   2260 O  OG1 . THR C 3 9   ? -2.754  0.247   -10.805 1.00   6.52   ? 95   THR C OG1 1 
ATOM   2261 C  CG2 . THR C 3 9   ? -3.704  -1.246  -9.211  1.00   5.27   ? 95   THR C CG2 1 
ATOM   2262 N  N   . VAL C 3 10  ? -5.246  0.938   -7.025  1.00   3.69   ? 96   VAL C N   1 
ATOM   2263 C  CA  . VAL C 3 10  ? -5.723  0.638   -5.693  1.00   5.06   ? 96   VAL C CA  1 
ATOM   2264 C  C   . VAL C 3 10  ? -6.640  -0.572  -5.803  1.00   6.74   ? 96   VAL C C   1 
ATOM   2265 O  O   . VAL C 3 10  ? -7.142  -0.907  -6.899  1.00   5.78   ? 96   VAL C O   1 
ATOM   2266 C  CB  . VAL C 3 10  ? -6.486  1.844   -5.082  1.00   4.13   ? 96   VAL C CB  1 
ATOM   2267 C  CG1 . VAL C 3 10  ? -5.513  2.969   -4.763  1.00   3.58   ? 96   VAL C CG1 1 
ATOM   2268 C  CG2 . VAL C 3 10  ? -7.562  2.335   -6.057  1.00   3.17   ? 96   VAL C CG2 1 
ATOM   2269 N  N   . THR C 3 11  ? -6.868  -1.232  -4.673  1.00   8.25   ? 97   THR C N   1 
ATOM   2270 C  CA  . THR C 3 11  ? -7.691  -2.423  -4.683  1.00   9.60   ? 97   THR C CA  1 
ATOM   2271 C  C   . THR C 3 11  ? -8.610  -2.423  -3.487  1.00   10.41  ? 97   THR C C   1 
ATOM   2272 O  O   . THR C 3 11  ? -8.378  -1.714  -2.507  1.00   9.86   ? 97   THR C O   1 
ATOM   2273 C  CB  . THR C 3 11  ? -6.848  -3.712  -4.646  1.00   10.40  ? 97   THR C CB  1 
ATOM   2274 O  OG1 . THR C 3 11  ? -7.723  -4.855  -4.624  1.00   13.84  ? 97   THR C OG1 1 
ATOM   2275 C  CG2 . THR C 3 11  ? -6.008  -3.744  -3.422  1.00   10.53  ? 97   THR C CG2 1 
ATOM   2276 N  N   . ARG C 3 12  ? -9.649  -3.236  -3.568  1.00   11.28  ? 98   ARG C N   1 
ATOM   2277 C  CA  . ARG C 3 12  ? -10.609 -3.291  -2.494  1.00   13.84  ? 98   ARG C CA  1 
ATOM   2278 C  C   . ARG C 3 12  ? -10.389 -4.561  -1.705  1.00   15.34  ? 98   ARG C C   1 
ATOM   2279 O  O   . ARG C 3 12  ? -10.769 -5.651  -2.146  1.00   16.58  ? 98   ARG C O   1 
ATOM   2280 C  CB  . ARG C 3 12  ? -12.035 -3.225  -3.033  1.00   13.06  ? 98   ARG C CB  1 
ATOM   2281 C  CG  . ARG C 3 12  ? -13.041 -2.825  -1.957  1.00   15.29  ? 98   ARG C CG  1 
ATOM   2282 C  CD  . ARG C 3 12  ? -14.313 -2.214  -2.529  1.00   15.72  ? 98   ARG C CD  1 
ATOM   2283 N  NE  . ARG C 3 12  ? -15.252 -1.941  -1.444  1.00   16.97  ? 98   ARG C NE  1 
ATOM   2284 C  CZ  . ARG C 3 12  ? -15.960 -2.884  -0.839  1.00   16.21  ? 98   ARG C CZ  1 
ATOM   2285 N  NH1 . ARG C 3 12  ? -15.842 -4.146  -1.227  1.00   17.71  ? 98   ARG C NH1 1 
ATOM   2286 N  NH2 . ARG C 3 12  ? -16.785 -2.567  0.150   1.00   18.14  ? 98   ARG C NH2 1 
ATOM   2287 N  N   . GLN C 3 13  ? -9.765  -4.428  -0.541  1.00   17.07  ? 99   GLN C N   1 
ATOM   2288 C  CA  . GLN C 3 13  ? -9.487  -5.602  0.273   1.00   18.91  ? 99   GLN C CA  1 
ATOM   2289 C  C   . GLN C 3 13  ? -10.416 -5.695  1.463   1.00   19.51  ? 99   GLN C C   1 
ATOM   2290 O  O   . GLN C 3 13  ? -10.142 -5.164  2.551   1.00   19.49  ? 99   GLN C O   1 
ATOM   2291 C  CB  . GLN C 3 13  ? -8.025  -5.670  0.711   1.00   19.28  ? 99   GLN C CB  1 
ATOM   2292 C  CG  . GLN C 3 13  ? -7.654  -7.040  1.273   1.00   21.56  ? 99   GLN C CG  1 
ATOM   2293 C  CD  . GLN C 3 13  ? -6.164  -7.228  1.383   1.00   22.18  ? 99   GLN C CD  1 
ATOM   2294 O  OE1 . GLN C 3 13  ? -5.407  -6.259  1.336   1.00   23.83  ? 99   GLN C OE1 1 
ATOM   2295 N  NE2 . GLN C 3 13  ? -5.727  -8.475  1.522   1.00   22.27  ? 99   GLN C NE2 1 
ATOM   2296 N  N   . THR C 3 14  ? -11.536 -6.358  1.222   1.00   19.83  ? 100  THR C N   1 
ATOM   2297 C  CA  . THR C 3 14  ? -12.525 -6.627  2.242   1.00   21.16  ? 100  THR C CA  1 
ATOM   2298 C  C   . THR C 3 14  ? -13.531 -7.615  1.674   1.00   21.81  ? 100  THR C C   1 
ATOM   2299 O  O   . THR C 3 14  ? -13.730 -7.686  0.454   1.00   21.81  ? 100  THR C O   1 
ATOM   2300 C  CB  . THR C 3 14  ? -13.250 -5.355  2.706   1.00   21.30  ? 100  THR C CB  1 
ATOM   2301 O  OG1 . THR C 3 14  ? -14.294 -5.718  3.618   1.00   22.03  ? 100  THR C OG1 1 
ATOM   2302 C  CG2 . THR C 3 14  ? -13.853 -4.601  1.530   1.00   21.39  ? 100  THR C CG2 1 
ATOM   2303 N  N   . HIS C 3 15  ? -14.152 -8.383  2.555   1.00   21.98  ? 101  HIS C N   1 
ATOM   2304 C  CA  . HIS C 3 15  ? -15.118 -9.378  2.130   1.00   22.83  ? 101  HIS C CA  1 
ATOM   2305 C  C   . HIS C 3 15  ? -16.523 -8.770  2.038   1.00   22.24  ? 101  HIS C C   1 
ATOM   2306 O  O   . HIS C 3 15  ? -17.355 -9.253  1.276   1.00   23.05  ? 101  HIS C O   1 
ATOM   2307 C  CB  . HIS C 3 15  ? -15.074 -10.593 3.066   1.00   23.13  ? 101  HIS C CB  1 
ATOM   2308 C  CG  . HIS C 3 15  ? -15.890 -11.759 2.594   1.00   24.66  ? 101  HIS C CG  1 
ATOM   2309 N  ND1 . HIS C 3 15  ? -15.746 -12.314 1.339   1.00   25.44  ? 101  HIS C ND1 1 
ATOM   2310 C  CD2 . HIS C 3 15  ? -16.844 -12.489 3.221   1.00   25.42  ? 101  HIS C CD2 1 
ATOM   2311 C  CE1 . HIS C 3 15  ? -16.588 -13.324 1.207   1.00   25.95  ? 101  HIS C CE1 1 
ATOM   2312 N  NE2 . HIS C 3 15  ? -17.264 -13.453 2.336   1.00   26.16  ? 101  HIS C NE2 1 
ATOM   2313 N  N   . GLN C 3 16  ? -16.772 -7.698  2.788   1.00   21.73  ? 102  GLN C N   1 
ATOM   2314 C  CA  . GLN C 3 16  ? -18.079 -7.027  2.765   1.00   20.92  ? 102  GLN C CA  1 
ATOM   2315 C  C   . GLN C 3 16  ? -18.187 -6.043  1.596   1.00   19.71  ? 102  GLN C C   1 
ATOM   2316 O  O   . GLN C 3 16  ? -17.288 -5.221  1.391   1.00   19.45  ? 102  GLN C O   1 
ATOM   2317 C  CB  . GLN C 3 16  ? -18.340 -6.292  4.081   1.00   22.07  ? 102  GLN C CB  1 
ATOM   2318 C  CG  . GLN C 3 16  ? -18.159 -7.136  5.345   1.00   24.45  ? 102  GLN C CG  1 
ATOM   2319 C  CD  . GLN C 3 16  ? -18.393 -6.338  6.630   1.00   26.96  ? 102  GLN C CD  1 
ATOM   2320 O  OE1 . GLN C 3 16  ? -17.451 -6.037  7.384   1.00   28.17  ? 102  GLN C OE1 1 
ATOM   2321 N  NE2 . GLN C 3 16  ? -19.657 -5.993  6.886   1.00   28.84  ? 102  GLN C NE2 1 
ATOM   2322 N  N   . PRO C 3 17  ? -19.299 -6.105  0.837   1.00   18.44  ? 103  PRO C N   1 
ATOM   2323 C  CA  . PRO C 3 17  ? -19.441 -5.259  -0.349  1.00   17.92  ? 103  PRO C CA  1 
ATOM   2324 C  C   . PRO C 3 17  ? -19.829 -3.825  0.025   1.00   17.12  ? 103  PRO C C   1 
ATOM   2325 O  O   . PRO C 3 17  ? -20.135 -3.552  1.192   1.00   17.21  ? 103  PRO C O   1 
ATOM   2326 C  CB  . PRO C 3 17  ? -20.565 -5.941  -1.128  1.00   17.56  ? 103  PRO C CB  1 
ATOM   2327 C  CG  . PRO C 3 17  ? -21.399 -6.607  -0.086  1.00   18.06  ? 103  PRO C CG  1 
ATOM   2328 C  CD  . PRO C 3 17  ? -20.483 -6.955  1.059   1.00   18.24  ? 103  PRO C CD  1 
ATOM   2329 N  N   . PRO C 3 18  ? -19.817 -2.909  -0.953  1.00   15.90  ? 104  PRO C N   1 
ATOM   2330 C  CA  . PRO C 3 18  ? -20.186 -1.533  -0.638  1.00   15.21  ? 104  PRO C CA  1 
ATOM   2331 C  C   . PRO C 3 18  ? -21.660 -1.444  -0.271  1.00   14.64  ? 104  PRO C C   1 
ATOM   2332 O  O   . PRO C 3 18  ? -22.432 -2.342  -0.608  1.00   13.47  ? 104  PRO C O   1 
ATOM   2333 C  CB  . PRO C 3 18  ? -19.954 -0.782  -1.959  1.00   14.99  ? 104  PRO C CB  1 
ATOM   2334 C  CG  . PRO C 3 18  ? -19.261 -1.719  -2.868  1.00   14.67  ? 104  PRO C CG  1 
ATOM   2335 C  CD  . PRO C 3 18  ? -19.496 -3.098  -2.381  1.00   15.96  ? 104  PRO C CD  1 
ATOM   2336 N  N   . ALA C 3 19  ? -22.041 -0.375  0.422   1.00   14.19  ? 105  ALA C N   1 
ATOM   2337 C  CA  . ALA C 3 19  ? -23.456 -0.105  0.677   1.00   13.82  ? 105  ALA C CA  1 
ATOM   2338 C  C   . ALA C 3 19  ? -24.143 0.273   -0.638  1.00   13.88  ? 105  ALA C C   1 
ATOM   2339 O  O   . ALA C 3 19  ? -23.491 0.775   -1.559  1.00   13.65  ? 105  ALA C O   1 
ATOM   2340 C  CB  . ALA C 3 19  ? -23.594 1.010   1.695   1.00   14.46  ? 105  ALA C CB  1 
ATOM   2341 N  N   . PRO C 3 20  ? -25.459 0.022   -0.748  1.00   14.12  ? 106  PRO C N   1 
ATOM   2342 C  CA  . PRO C 3 20  ? -26.141 0.400   -1.997  1.00   13.54  ? 106  PRO C CA  1 
ATOM   2343 C  C   . PRO C 3 20  ? -26.037 1.893   -2.270  1.00   12.61  ? 106  PRO C C   1 
ATOM   2344 O  O   . PRO C 3 20  ? -25.989 2.689   -1.333  1.00   12.28  ? 106  PRO C O   1 
ATOM   2345 C  CB  . PRO C 3 20  ? -27.596 0.002   -1.750  1.00   14.12  ? 106  PRO C CB  1 
ATOM   2346 C  CG  . PRO C 3 20  ? -27.543 -0.990  -0.597  1.00   14.15  ? 106  PRO C CG  1 
ATOM   2347 C  CD  . PRO C 3 20  ? -26.364 -0.612  0.227   1.00   14.37  ? 106  PRO C CD  1 
ATOM   2348 N  N   . ASN C 3 21  ? -25.966 2.263   -3.548  1.00   11.92  ? 107  ASN C N   1 
ATOM   2349 C  CA  . ASN C 3 21  ? -25.957 3.664   -3.938  1.00   12.10  ? 107  ASN C CA  1 
ATOM   2350 C  C   . ASN C 3 21  ? -24.906 4.490   -3.203  1.00   12.10  ? 107  ASN C C   1 
ATOM   2351 O  O   . ASN C 3 21  ? -25.202 5.558   -2.648  1.00   11.50  ? 107  ASN C O   1 
ATOM   2352 C  CB  . ASN C 3 21  ? -27.344 4.265   -3.714  1.00   11.91  ? 107  ASN C CB  1 
ATOM   2353 C  CG  . ASN C 3 21  ? -28.396 3.592   -4.549  1.00   13.28  ? 107  ASN C CG  1 
ATOM   2354 O  OD1 . ASN C 3 21  ? -28.345 3.634   -5.781  1.00   13.32  ? 107  ASN C OD1 1 
ATOM   2355 N  ND2 . ASN C 3 21  ? -29.356 2.954   -3.889  1.00   12.58  ? 107  ASN C ND2 1 
ATOM   2356 N  N   . SER C 3 22  ? -23.680 3.989   -3.176  1.00   12.14  ? 108  SER C N   1 
ATOM   2357 C  CA  . SER C 3 22  ? -22.626 4.694   -2.460  1.00   12.60  ? 108  SER C CA  1 
ATOM   2358 C  C   . SER C 3 22  ? -21.337 4.714   -3.264  1.00   13.23  ? 108  SER C C   1 
ATOM   2359 O  O   . SER C 3 22  ? -21.147 3.907   -4.178  1.00   13.03  ? 108  SER C O   1 
ATOM   2360 C  CB  . SER C 3 22  ? -22.371 4.051   -1.097  1.00   13.11  ? 108  SER C CB  1 
ATOM   2361 O  OG  . SER C 3 22  ? -21.659 2.828   -1.239  1.00   13.09  ? 108  SER C OG  1 
ATOM   2362 N  N   . LEU C 3 23  ? -20.461 5.647   -2.910  1.00   12.54  ? 109  LEU C N   1 
ATOM   2363 C  CA  . LEU C 3 23  ? -19.104 5.668   -3.419  1.00   13.28  ? 109  LEU C CA  1 
ATOM   2364 C  C   . LEU C 3 23  ? -18.344 4.401   -3.007  1.00   12.95  ? 109  LEU C C   1 
ATOM   2365 O  O   . LEU C 3 23  ? -18.455 3.937   -1.876  1.00   12.46  ? 109  LEU C O   1 
ATOM   2366 C  CB  . LEU C 3 23  ? -18.395 6.927   -2.908  1.00   13.13  ? 109  LEU C CB  1 
ATOM   2367 C  CG  . LEU C 3 23  ? -16.924 7.139   -3.249  1.00   14.62  ? 109  LEU C CG  1 
ATOM   2368 C  CD1 . LEU C 3 23  ? -16.605 8.635   -3.242  1.00   15.52  ? 109  LEU C CD1 1 
ATOM   2369 C  CD2 . LEU C 3 23  ? -16.033 6.399   -2.276  1.00   14.28  ? 109  LEU C CD2 1 
ATOM   2370 N  N   . ILE C 3 24  ? -17.573 3.844   -3.936  1.00   13.36  ? 110  ILE C N   1 
ATOM   2371 C  CA  . ILE C 3 24  ? -16.797 2.639   -3.667  1.00   13.22  ? 110  ILE C CA  1 
ATOM   2372 C  C   . ILE C 3 24  ? -15.396 2.987   -3.197  1.00   13.04  ? 110  ILE C C   1 
ATOM   2373 O  O   . ILE C 3 24  ? -14.596 3.512   -3.969  1.00   12.30  ? 110  ILE C O   1 
ATOM   2374 C  CB  . ILE C 3 24  ? -16.600 1.787   -4.935  1.00   13.27  ? 110  ILE C CB  1 
ATOM   2375 C  CG1 . ILE C 3 24  ? -17.938 1.431   -5.582  1.00   12.93  ? 110  ILE C CG1 1 
ATOM   2376 C  CG2 . ILE C 3 24  ? -15.778 0.552   -4.603  1.00   12.54  ? 110  ILE C CG2 1 
ATOM   2377 C  CD1 . ILE C 3 24  ? -17.769 0.812   -6.948  1.00   14.32  ? 110  ILE C CD1 1 
ATOM   2378 N  N   . ARG C 3 25  ? -15.080 2.660   -1.952  1.00   13.15  ? 111  ARG C N   1 
ATOM   2379 C  CA  . ARG C 3 25  ? -13.734 2.906   -1.453  1.00   14.15  ? 111  ARG C CA  1 
ATOM   2380 C  C   . ARG C 3 25  ? -12.789 1.749   -1.739  1.00   13.26  ? 111  ARG C C   1 
ATOM   2381 O  O   . ARG C 3 25  ? -13.069 0.598   -1.397  1.00   13.06  ? 111  ARG C O   1 
ATOM   2382 C  CB  . ARG C 3 25  ? -13.742 3.193   0.049   1.00   15.28  ? 111  ARG C CB  1 
ATOM   2383 C  CG  . ARG C 3 25  ? -12.415 3.740   0.547   1.00   19.38  ? 111  ARG C CG  1 
ATOM   2384 C  CD  . ARG C 3 25  ? -12.589 4.462   1.872   1.00   22.40  ? 111  ARG C CD  1 
ATOM   2385 N  NE  . ARG C 3 25  ? -11.381 4.382   2.690   1.00   24.93  ? 111  ARG C NE  1 
ATOM   2386 C  CZ  . ARG C 3 25  ? -10.984 3.288   3.335   1.00   25.52  ? 111  ARG C CZ  1 
ATOM   2387 N  NH1 . ARG C 3 25  ? -11.692 2.163   3.246   1.00   25.97  ? 111  ARG C NH1 1 
ATOM   2388 N  NH2 . ARG C 3 25  ? -9.874  3.317   4.060   1.00   24.77  ? 111  ARG C NH2 1 
ATOM   2389 N  N   . PHE C 3 26  ? -11.666 2.056   -2.371  1.00   12.36  ? 112  PHE C N   1 
ATOM   2390 C  CA  . PHE C 3 26  ? -10.583 1.086   -2.465  1.00   11.36  ? 112  PHE C CA  1 
ATOM   2391 C  C   . PHE C 3 26  ? -9.585  1.426   -1.343  1.00   10.97  ? 112  PHE C C   1 
ATOM   2392 O  O   . PHE C 3 26  ? -8.988  2.514   -1.335  1.00   10.18  ? 112  PHE C O   1 
ATOM   2393 C  CB  . PHE C 3 26  ? -9.957  1.105   -3.871  1.00   10.79  ? 112  PHE C CB  1 
ATOM   2394 C  CG  . PHE C 3 26  ? -10.928 0.712   -4.964  1.00   10.86  ? 112  PHE C CG  1 
ATOM   2395 C  CD1 . PHE C 3 26  ? -11.951 1.576   -5.350  1.00   9.80   ? 112  PHE C CD1 1 
ATOM   2396 C  CD2 . PHE C 3 26  ? -10.845 -0.531  -5.574  1.00   9.83   ? 112  PHE C CD2 1 
ATOM   2397 C  CE1 . PHE C 3 26  ? -12.865 1.208   -6.334  1.00   9.64   ? 112  PHE C CE1 1 
ATOM   2398 C  CE2 . PHE C 3 26  ? -11.750 -0.906  -6.556  1.00   8.75   ? 112  PHE C CE2 1 
ATOM   2399 C  CZ  . PHE C 3 26  ? -12.762 -0.028  -6.940  1.00   10.11  ? 112  PHE C CZ  1 
ATOM   2400 N  N   . ASN C 3 27  ? -9.441  0.507   -0.386  1.00   9.86   ? 113  ASN C N   1 
ATOM   2401 C  CA  . ASN C 3 27  ? -8.686  0.765   0.845   1.00   9.65   ? 113  ASN C CA  1 
ATOM   2402 C  C   . ASN C 3 27  ? -7.192  0.410   0.797   1.00   9.91   ? 113  ASN C C   1 
ATOM   2403 O  O   . ASN C 3 27  ? -6.425  0.870   1.640   1.00   11.12  ? 113  ASN C O   1 
ATOM   2404 C  CB  . ASN C 3 27  ? -9.349  0.071   2.060   1.00   9.14   ? 113  ASN C CB  1 
ATOM   2405 C  CG  . ASN C 3 27  ? -9.457  -1.435  1.892   1.00   9.82   ? 113  ASN C CG  1 
ATOM   2406 O  OD1 . ASN C 3 27  ? -9.776  -1.929  0.807   1.00   9.71   ? 113  ASN C OD1 1 
ATOM   2407 N  ND2 . ASN C 3 27  ? -9.186  -2.173  2.964   1.00   8.04   ? 113  ASN C ND2 1 
ATOM   2408 N  N   . ALA C 3 28  ? -6.787  -0.396  -0.179  1.00   9.80   ? 114  ALA C N   1 
ATOM   2409 C  CA  . ALA C 3 28  ? -5.412  -0.866  -0.297  1.00   9.64   ? 114  ALA C CA  1 
ATOM   2410 C  C   . ALA C 3 28  ? -4.730  -0.355  -1.576  1.00   11.31  ? 114  ALA C C   1 
ATOM   2411 O  O   . ALA C 3 28  ? -5.352  -0.275  -2.645  1.00   12.32  ? 114  ALA C O   1 
ATOM   2412 C  CB  . ALA C 3 28  ? -5.386  -2.388  -0.263  1.00   9.41   ? 114  ALA C CB  1 
ATOM   2413 N  N   . VAL C 3 29  ? -3.450  -0.020  -1.455  1.00   11.02  ? 115  VAL C N   1 
ATOM   2414 C  CA  . VAL C 3 29  ? -2.671  0.542   -2.546  1.00   11.25  ? 115  VAL C CA  1 
ATOM   2415 C  C   . VAL C 3 29  ? -1.698  -0.493  -3.116  1.00   10.61  ? 115  VAL C C   1 
ATOM   2416 O  O   . VAL C 3 29  ? -0.994  -1.190  -2.369  1.00   10.70  ? 115  VAL C O   1 
ATOM   2417 C  CB  . VAL C 3 29  ? -1.868  1.795   -2.066  1.00   11.26  ? 115  VAL C CB  1 
ATOM   2418 C  CG1 . VAL C 3 29  ? -0.903  2.286   -3.141  1.00   12.27  ? 115  VAL C CG1 1 
ATOM   2419 C  CG2 . VAL C 3 29  ? -2.802  2.905   -1.673  1.00   12.80  ? 115  VAL C CG2 1 
ATOM   2420 N  N   . LEU C 3 30  ? -1.681  -0.602  -4.436  1.00   9.57   ? 116  LEU C N   1 
ATOM   2421 C  CA  . LEU C 3 30  ? -0.612  -1.316  -5.127  1.00   9.78   ? 116  LEU C CA  1 
ATOM   2422 C  C   . LEU C 3 30  ? 0.504   -0.332  -5.501  1.00   9.85   ? 116  LEU C C   1 
ATOM   2423 O  O   . LEU C 3 30  ? 1.695   -0.624  -5.347  1.00   9.00   ? 116  LEU C O   1 
ATOM   2424 C  CB  . LEU C 3 30  ? -1.148  -2.016  -6.378  1.00   10.52  ? 116  LEU C CB  1 
ATOM   2425 C  CG  . LEU C 3 30  ? -2.059  -3.230  -6.191  1.00   10.06  ? 116  LEU C CG  1 
ATOM   2426 C  CD1 . LEU C 3 30  ? -2.283  -3.920  -7.540  1.00   11.34  ? 116  LEU C CD1 1 
ATOM   2427 C  CD2 . LEU C 3 30  ? -1.436  -4.190  -5.227  1.00   10.21  ? 116  LEU C CD2 1 
ATOM   2428 N  N   . THR C 3 31  ? 0.102   0.831   -6.000  1.00   9.51   ? 117  THR C N   1 
ATOM   2429 C  CA  . THR C 3 31  ? 1.015   1.945   -6.252  1.00   10.38  ? 117  THR C CA  1 
ATOM   2430 C  C   . THR C 3 31  ? 0.208   3.233   -6.233  1.00   10.00  ? 117  THR C C   1 
ATOM   2431 O  O   . THR C 3 31  ? -0.935  3.252   -6.678  1.00   9.30   ? 117  THR C O   1 
ATOM   2432 C  CB  . THR C 3 31  ? 1.798   1.818   -7.598  1.00   11.25  ? 117  THR C CB  1 
ATOM   2433 O  OG1 . THR C 3 31  ? 2.669   2.953   -7.760  1.00   13.00  ? 117  THR C OG1 1 
ATOM   2434 C  CG2 . THR C 3 31  ? 0.853   1.749   -8.790  1.00   11.34  ? 117  THR C CG2 1 
ATOM   2435 N  N   . ASN C 3 32  ? 0.794   4.301   -5.696  1.00   10.22  ? 118  ASN C N   1 
ATOM   2436 C  CA  . ASN C 3 32  ? 0.092   5.578   -5.566  1.00   10.85  ? 118  ASN C CA  1 
ATOM   2437 C  C   . ASN C 3 32  ? 1.098   6.645   -5.147  1.00   11.37  ? 118  ASN C C   1 
ATOM   2438 O  O   . ASN C 3 32  ? 0.885   7.331   -4.159  1.00   10.87  ? 118  ASN C O   1 
ATOM   2439 C  CB  . ASN C 3 32  ? -1.032  5.442   -4.521  1.00   10.02  ? 118  ASN C CB  1 
ATOM   2440 C  CG  . ASN C 3 32  ? -1.962  6.661   -4.445  1.00   9.73   ? 118  ASN C CG  1 
ATOM   2441 O  OD1 . ASN C 3 32  ? -2.212  7.356   -5.433  1.00   7.79   ? 118  ASN C OD1 1 
ATOM   2442 N  ND2 . ASN C 3 32  ? -2.505  6.898   -3.253  1.00   8.77   ? 118  ASN C ND2 1 
ATOM   2443 N  N   . PRO C 3 33  ? 2.183   6.808   -5.927  1.00   12.39  ? 119  PRO C N   1 
ATOM   2444 C  CA  . PRO C 3 33  ? 3.346   7.583   -5.468  1.00   13.09  ? 119  PRO C CA  1 
ATOM   2445 C  C   . PRO C 3 33  ? 3.058   9.051   -5.228  1.00   13.51  ? 119  PRO C C   1 
ATOM   2446 O  O   . PRO C 3 33  ? 3.674   9.661   -4.342  1.00   14.79  ? 119  PRO C O   1 
ATOM   2447 C  CB  . PRO C 3 33  ? 4.368   7.407   -6.591  1.00   13.47  ? 119  PRO C CB  1 
ATOM   2448 C  CG  . PRO C 3 33  ? 3.583   6.994   -7.786  1.00   12.65  ? 119  PRO C CG  1 
ATOM   2449 C  CD  . PRO C 3 33  ? 2.375   6.270   -7.285  1.00   12.76  ? 119  PRO C CD  1 
ATOM   2450 N  N   . GLN C 3 34  ? 2.128   9.621   -5.984  1.00   13.13  ? 120  GLN C N   1 
ATOM   2451 C  CA  . GLN C 3 34  ? 1.791   11.029  -5.791  1.00   12.62  ? 120  GLN C CA  1 
ATOM   2452 C  C   . GLN C 3 34  ? 0.654   11.242  -4.794  1.00   11.91  ? 120  GLN C C   1 
ATOM   2453 O  O   . GLN C 3 34  ? 0.353   12.376  -4.446  1.00   11.18  ? 120  GLN C O   1 
ATOM   2454 C  CB  . GLN C 3 34  ? 1.486   11.719  -7.126  1.00   13.24  ? 120  GLN C CB  1 
ATOM   2455 C  CG  . GLN C 3 34  ? 2.630   11.674  -8.132  1.00   12.56  ? 120  GLN C CG  1 
ATOM   2456 C  CD  . GLN C 3 34  ? 2.619   10.418  -8.965  1.00   12.84  ? 120  GLN C CD  1 
ATOM   2457 O  OE1 . GLN C 3 34  ? 1.702   9.610   -8.861  1.00   13.65  ? 120  GLN C OE1 1 
ATOM   2458 N  NE2 . GLN C 3 34  ? 3.634   10.247  -9.808  1.00   12.58  ? 120  GLN C NE2 1 
ATOM   2459 N  N   . GLY C 3 35  ? 0.036   10.155  -4.330  1.00   11.63  ? 121  GLY C N   1 
ATOM   2460 C  CA  . GLY C 3 35  ? -1.052  10.240  -3.346  1.00   11.25  ? 121  GLY C CA  1 
ATOM   2461 C  C   . GLY C 3 35  ? -2.341  10.791  -3.943  1.00   11.23  ? 121  GLY C C   1 
ATOM   2462 O  O   . GLY C 3 35  ? -3.224  11.269  -3.230  1.00   10.78  ? 121  GLY C O   1 
ATOM   2463 N  N   . ASP C 3 36  ? -2.438  10.718  -5.264  1.00   10.30  ? 122  ASP C N   1 
ATOM   2464 C  CA  . ASP C 3 36  ? -3.571  11.279  -5.989  1.00   10.62  ? 122  ASP C CA  1 
ATOM   2465 C  C   . ASP C 3 36  ? -4.874  10.546  -5.716  1.00   9.56   ? 122  ASP C C   1 
ATOM   2466 O  O   . ASP C 3 36  ? -5.937  11.152  -5.737  1.00   9.29   ? 122  ASP C O   1 
ATOM   2467 C  CB  . ASP C 3 36  ? -3.271  11.329  -7.485  1.00   10.52  ? 122  ASP C CB  1 
ATOM   2468 C  CG  . ASP C 3 36  ? -2.253  12.395  -7.823  1.00   12.19  ? 122  ASP C CG  1 
ATOM   2469 O  OD1 . ASP C 3 36  ? -1.994  13.255  -6.946  1.00   12.39  ? 122  ASP C OD1 1 
ATOM   2470 O  OD2 . ASP C 3 36  ? -1.716  12.380  -8.952  1.00   11.57  ? 122  ASP C OD2 1 
ATOM   2471 N  N   . TYR C 3 37  ? -4.792  9.247   -5.469  1.00   9.15   ? 123  TYR C N   1 
ATOM   2472 C  CA  . TYR C 3 37  ? -5.939  8.538   -4.906  1.00   9.43   ? 123  TYR C CA  1 
ATOM   2473 C  C   . TYR C 3 37  ? -5.864  8.543   -3.378  1.00   9.39   ? 123  TYR C C   1 
ATOM   2474 O  O   . TYR C 3 37  ? -4.824  8.240   -2.782  1.00   9.16   ? 123  TYR C O   1 
ATOM   2475 C  CB  . TYR C 3 37  ? -6.030  7.100   -5.417  1.00   9.15   ? 123  TYR C CB  1 
ATOM   2476 C  CG  . TYR C 3 37  ? -7.339  6.433   -5.027  1.00   8.24   ? 123  TYR C CG  1 
ATOM   2477 C  CD1 . TYR C 3 37  ? -8.420  6.434   -5.888  1.00   8.09   ? 123  TYR C CD1 1 
ATOM   2478 C  CD2 . TYR C 3 37  ? -7.490  5.814   -3.787  1.00   8.38   ? 123  TYR C CD2 1 
ATOM   2479 C  CE1 . TYR C 3 37  ? -9.621  5.828   -5.539  1.00   8.26   ? 123  TYR C CE1 1 
ATOM   2480 C  CE2 . TYR C 3 37  ? -8.698  5.205   -3.423  1.00   7.69   ? 123  TYR C CE2 1 
ATOM   2481 C  CZ  . TYR C 3 37  ? -9.750  5.221   -4.297  1.00   7.77   ? 123  TYR C CZ  1 
ATOM   2482 O  OH  . TYR C 3 37  ? -10.944 4.616   -3.955  1.00   9.47   ? 123  TYR C OH  1 
ATOM   2483 N  N   . ASP C 3 38  ? -6.973  8.895   -2.747  1.00   10.28  ? 124  ASP C N   1 
ATOM   2484 C  CA  . ASP C 3 38  ? -7.019  8.985   -1.291  1.00   11.88  ? 124  ASP C CA  1 
ATOM   2485 C  C   . ASP C 3 38  ? -7.858  7.850   -0.731  1.00   11.42  ? 124  ASP C C   1 
ATOM   2486 O  O   . ASP C 3 38  ? -9.075  7.834   -0.883  1.00   10.87  ? 124  ASP C O   1 
ATOM   2487 C  CB  . ASP C 3 38  ? -7.598  10.335  -0.867  1.00   12.98  ? 124  ASP C CB  1 
ATOM   2488 C  CG  . ASP C 3 38  ? -7.431  10.615  0.622   1.00   14.35  ? 124  ASP C CG  1 
ATOM   2489 O  OD1 . ASP C 3 38  ? -7.486  9.681   1.447   1.00   14.58  ? 124  ASP C OD1 1 
ATOM   2490 O  OD2 . ASP C 3 38  ? -7.262  11.795  0.963   1.00   16.31  ? 124  ASP C OD2 1 
ATOM   2491 N  N   . THR C 3 39  ? -7.205  6.908   -0.065  1.00   11.79  ? 125  THR C N   1 
ATOM   2492 C  CA  . THR C 3 39  ? -7.903  5.734   0.451   1.00   12.93  ? 125  THR C CA  1 
ATOM   2493 C  C   . THR C 3 39  ? -8.873  6.029   1.594   1.00   13.26  ? 125  THR C C   1 
ATOM   2494 O  O   . THR C 3 39  ? -9.730  5.203   1.895   1.00   13.73  ? 125  THR C O   1 
ATOM   2495 C  CB  . THR C 3 39  ? -6.923  4.653   0.920   1.00   13.13  ? 125  THR C CB  1 
ATOM   2496 O  OG1 . THR C 3 39  ? -6.168  5.150   2.026   1.00   12.93  ? 125  THR C OG1 1 
ATOM   2497 C  CG2 . THR C 3 39  ? -5.986  4.253   -0.210  1.00   13.18  ? 125  THR C CG2 1 
ATOM   2498 N  N   . SER C 3 40  ? -8.752  7.192   2.226   1.00   13.21  ? 126  SER C N   1 
ATOM   2499 C  CA  . SER C 3 40  ? -9.659  7.526   3.327   1.00   13.17  ? 126  SER C CA  1 
ATOM   2500 C  C   . SER C 3 40  ? -10.984 8.154   2.846   1.00   13.27  ? 126  SER C C   1 
ATOM   2501 O  O   . SER C 3 40  ? -12.006 8.049   3.517   1.00   13.13  ? 126  SER C O   1 
ATOM   2502 C  CB  . SER C 3 40  ? -8.964  8.406   4.374   1.00   13.23  ? 126  SER C CB  1 
ATOM   2503 O  OG  A SER C 3 40  ? -7.862  7.717   4.955   0.50   12.65  ? 126  SER C OG  1 
ATOM   2504 O  OG  B SER C 3 40  ? -8.867  9.754   3.944   0.50   12.73  ? 126  SER C OG  1 
ATOM   2505 N  N   . THR C 3 41  ? -10.962 8.797   1.684   1.00   12.39  ? 127  THR C N   1 
ATOM   2506 C  CA  . THR C 3 41  ? -12.182 9.362   1.118   1.00   12.02  ? 127  THR C CA  1 
ATOM   2507 C  C   . THR C 3 41  ? -12.722 8.528   -0.052  1.00   11.68  ? 127  THR C C   1 
ATOM   2508 O  O   . THR C 3 41  ? -13.912 8.598   -0.385  1.00   11.25  ? 127  THR C O   1 
ATOM   2509 C  CB  . THR C 3 41  ? -11.946 10.790  0.611   1.00   12.18  ? 127  THR C CB  1 
ATOM   2510 O  OG1 . THR C 3 41  ? -10.999 10.747  -0.463  1.00   10.57  ? 127  THR C OG1 1 
ATOM   2511 C  CG2 . THR C 3 41  ? -11.416 11.683  1.734   1.00   10.86  ? 127  THR C CG2 1 
ATOM   2512 N  N   . GLY C 3 42  ? -11.847 7.756   -0.689  1.00   10.68  ? 128  GLY C N   1 
ATOM   2513 C  CA  . GLY C 3 42  ? -12.254 6.960   -1.848  1.00   10.17  ? 128  GLY C CA  1 
ATOM   2514 C  C   . GLY C 3 42  ? -12.192 7.759   -3.142  1.00   10.49  ? 128  GLY C C   1 
ATOM   2515 O  O   . GLY C 3 42  ? -12.698 7.317   -4.177  1.00   11.17  ? 128  GLY C O   1 
ATOM   2516 N  N   . LYS C 3 43  ? -11.560 8.929   -3.093  1.00   9.54   ? 129  LYS C N   1 
ATOM   2517 C  CA  . LYS C 3 43  ? -11.553 9.838   -4.243  1.00   10.59  ? 129  LYS C CA  1 
ATOM   2518 C  C   . LYS C 3 43  ? -10.148 10.087  -4.801  1.00   10.70  ? 129  LYS C C   1 
ATOM   2519 O  O   . LYS C 3 43  ? -9.182  10.230  -4.049  1.00   10.60  ? 129  LYS C O   1 
ATOM   2520 C  CB  . LYS C 3 43  ? -12.192 11.190  -3.881  1.00   10.74  ? 129  LYS C CB  1 
ATOM   2521 C  CG  . LYS C 3 43  ? -13.640 11.134  -3.442  1.00   10.47  ? 129  LYS C CG  1 
ATOM   2522 C  CD  . LYS C 3 43  ? -14.270 12.534  -3.452  1.00   12.98  ? 129  LYS C CD  1 
ATOM   2523 C  CE  . LYS C 3 43  ? -15.771 12.491  -3.131  1.00   13.93  ? 129  LYS C CE  1 
ATOM   2524 N  NZ  . LYS C 3 43  ? -16.404 13.847  -3.187  1.00   15.27  ? 129  LYS C NZ  1 
ATOM   2525 N  N   . PHE C 3 44  ? -10.055 10.134  -6.126  1.00   11.00  ? 130  PHE C N   1 
ATOM   2526 C  CA  . PHE C 3 44  ? -8.881  10.660  -6.809  1.00   10.13  ? 130  PHE C CA  1 
ATOM   2527 C  C   . PHE C 3 44  ? -9.049  12.171  -6.908  1.00   10.31  ? 130  PHE C C   1 
ATOM   2528 O  O   . PHE C 3 44  ? -10.135 12.644  -7.233  1.00   9.74   ? 130  PHE C O   1 
ATOM   2529 C  CB  . PHE C 3 44  ? -8.786  10.072  -8.213  1.00   9.90   ? 130  PHE C CB  1 
ATOM   2530 C  CG  . PHE C 3 44  ? -7.889  10.849  -9.143  1.00   10.21  ? 130  PHE C CG  1 
ATOM   2531 C  CD1 . PHE C 3 44  ? -6.564  10.472  -9.329  1.00   11.01  ? 130  PHE C CD1 1 
ATOM   2532 C  CD2 . PHE C 3 44  ? -8.368  11.955  -9.837  1.00   10.58  ? 130  PHE C CD2 1 
ATOM   2533 C  CE1 . PHE C 3 44  ? -5.734  11.188  -10.187 1.00   10.40  ? 130  PHE C CE1 1 
ATOM   2534 C  CE2 . PHE C 3 44  ? -7.549  12.665  -10.692 1.00   9.15   ? 130  PHE C CE2 1 
ATOM   2535 C  CZ  . PHE C 3 44  ? -6.230  12.284  -10.857 1.00   10.14  ? 130  PHE C CZ  1 
ATOM   2536 N  N   . THR C 3 45  ? -7.997  12.928  -6.613  1.00   9.89   ? 131  THR C N   1 
ATOM   2537 C  CA  . THR C 3 45  ? -8.031  14.377  -6.837  1.00   10.60  ? 131  THR C CA  1 
ATOM   2538 C  C   . THR C 3 45  ? -6.898  14.804  -7.777  1.00   11.00  ? 131  THR C C   1 
ATOM   2539 O  O   . THR C 3 45  ? -5.732  14.443  -7.577  1.00   9.71   ? 131  THR C O   1 
ATOM   2540 C  CB  . THR C 3 45  ? -7.971  15.180  -5.520  1.00   11.21  ? 131  THR C CB  1 
ATOM   2541 O  OG1 . THR C 3 45  ? -9.076  14.810  -4.692  1.00   11.70  ? 131  THR C OG1 1 
ATOM   2542 C  CG2 . THR C 3 45  ? -8.063  16.669  -5.789  1.00   11.98  ? 131  THR C CG2 1 
ATOM   2543 N  N   . CYS C 3 46  ? -7.249  15.557  -8.816  1.00   11.61  ? 132  CYS C N   1 
ATOM   2544 C  CA  . CYS C 3 46  ? -6.263  15.950  -9.810  1.00   11.83  ? 132  CYS C CA  1 
ATOM   2545 C  C   . CYS C 3 46  ? -5.241  16.947  -9.268  1.00   11.41  ? 132  CYS C C   1 
ATOM   2546 O  O   . CYS C 3 46  ? -5.611  18.035  -8.839  1.00   11.47  ? 132  CYS C O   1 
ATOM   2547 C  CB  . CYS C 3 46  ? -6.946  16.544  -11.033 1.00   12.07  ? 132  CYS C CB  1 
ATOM   2548 S  SG  . CYS C 3 46  ? -5.742  17.076  -12.246 1.00   13.92  ? 132  CYS C SG  1 
ATOM   2549 N  N   . LYS C 3 47  ? -3.965  16.556  -9.263  1.00   11.68  ? 133  LYS C N   1 
ATOM   2550 C  CA  . LYS C 3 47  ? -2.879  17.484  -8.944  1.00   11.47  ? 133  LYS C CA  1 
ATOM   2551 C  C   . LYS C 3 47  ? -2.280  18.068  -10.218 1.00   11.89  ? 133  LYS C C   1 
ATOM   2552 O  O   . LYS C 3 47  ? -2.059  19.285  -10.315 1.00   11.38  ? 133  LYS C O   1 
ATOM   2553 C  CB  . LYS C 3 47  ? -1.781  16.812  -8.115  1.00   11.79  ? 133  LYS C CB  1 
ATOM   2554 C  CG  . LYS C 3 47  ? -2.146  16.564  -6.644  1.00   11.81  ? 133  LYS C CG  1 
ATOM   2555 C  CD  . LYS C 3 47  ? -0.927  16.066  -5.834  1.00   10.97  ? 133  LYS C CD  1 
ATOM   2556 C  CE  . LYS C 3 47  ? -1.317  15.616  -4.415  1.00   11.60  ? 133  LYS C CE  1 
ATOM   2557 N  NZ  . LYS C 3 47  ? -2.058  14.305  -4.402  1.00   9.72   ? 133  LYS C NZ  1 
ATOM   2558 N  N   . VAL C 3 48  ? -2.011  17.190  -11.183 1.00   11.56  ? 134  VAL C N   1 
ATOM   2559 C  CA  . VAL C 3 48  ? -1.429  17.593  -12.459 1.00   11.55  ? 134  VAL C CA  1 
ATOM   2560 C  C   . VAL C 3 48  ? -2.475  17.599  -13.562 1.00   11.38  ? 134  VAL C C   1 
ATOM   2561 O  O   . VAL C 3 48  ? -2.980  16.545  -13.958 1.00   11.84  ? 134  VAL C O   1 
ATOM   2562 C  CB  . VAL C 3 48  ? -0.289  16.651  -12.898 1.00   11.55  ? 134  VAL C CB  1 
ATOM   2563 C  CG1 . VAL C 3 48  ? 0.337   17.163  -14.174 1.00   11.70  ? 134  VAL C CG1 1 
ATOM   2564 C  CG2 . VAL C 3 48  ? 0.758   16.532  -11.805 1.00   13.12  ? 134  VAL C CG2 1 
ATOM   2565 N  N   . PRO C 3 49  ? -2.779  18.784  -14.095 1.00   11.69  ? 135  PRO C N   1 
ATOM   2566 C  CA  . PRO C 3 49  ? -3.824  18.898  -15.105 1.00   11.57  ? 135  PRO C CA  1 
ATOM   2567 C  C   . PRO C 3 49  ? -3.410  18.202  -16.396 1.00   11.96  ? 135  PRO C C   1 
ATOM   2568 O  O   . PRO C 3 49  ? -2.217  18.106  -16.686 1.00   12.39  ? 135  PRO C O   1 
ATOM   2569 C  CB  . PRO C 3 49  ? -3.939  20.406  -15.318 1.00   11.40  ? 135  PRO C CB  1 
ATOM   2570 C  CG  . PRO C 3 49  ? -2.604  20.947  -14.926 1.00   11.54  ? 135  PRO C CG  1 
ATOM   2571 C  CD  . PRO C 3 49  ? -2.121  20.074  -13.810 1.00   11.36  ? 135  PRO C CD  1 
ATOM   2572 N  N   . GLY C 3 50  ? -4.385  17.704  -17.154 1.00   11.90  ? 136  GLY C N   1 
ATOM   2573 C  CA  . GLY C 3 50  ? -4.097  17.026  -18.418 1.00   12.03  ? 136  GLY C CA  1 
ATOM   2574 C  C   . GLY C 3 50  ? -5.013  15.842  -18.684 1.00   12.13  ? 136  GLY C C   1 
ATOM   2575 O  O   . GLY C 3 50  ? -6.074  15.713  -18.074 1.00   11.99  ? 136  GLY C O   1 
ATOM   2576 N  N   . LEU C 3 51  ? -4.602  14.977  -19.604 1.00   12.09  ? 137  LEU C N   1 
ATOM   2577 C  CA  . LEU C 3 51  ? -5.433  13.853  -20.035 1.00   11.57  ? 137  LEU C CA  1 
ATOM   2578 C  C   . LEU C 3 51  ? -5.111  12.569  -19.266 1.00   10.92  ? 137  LEU C C   1 
ATOM   2579 O  O   . LEU C 3 51  ? -3.958  12.125  -19.237 1.00   10.53  ? 137  LEU C O   1 
ATOM   2580 C  CB  . LEU C 3 51  ? -5.296  13.595  -21.544 1.00   11.86  ? 137  LEU C CB  1 
ATOM   2581 C  CG  . LEU C 3 51  ? -6.297  12.481  -21.905 1.00   12.69  ? 137  LEU C CG  1 
ATOM   2582 C  CD1 . LEU C 3 51  ? -7.570  13.041  -22.495 1.00   11.98  ? 137  LEU C CD1 1 
ATOM   2583 C  CD2 . LEU C 3 51  ? -5.722  11.400  -22.784 1.00   13.84  ? 137  LEU C CD2 1 
ATOM   2584 N  N   . TYR C 3 52  ? -6.142  11.983  -18.661 1.00   10.05  ? 138  TYR C N   1 
ATOM   2585 C  CA  . TYR C 3 52  ? -5.999  10.793  -17.837 1.00   9.90   ? 138  TYR C CA  1 
ATOM   2586 C  C   . TYR C 3 52  ? -6.762  9.621   -18.426 1.00   10.56  ? 138  TYR C C   1 
ATOM   2587 O  O   . TYR C 3 52  ? -7.784  9.801   -19.086 1.00   10.12  ? 138  TYR C O   1 
ATOM   2588 C  CB  . TYR C 3 52  ? -6.546  11.037  -16.421 1.00   9.68   ? 138  TYR C CB  1 
ATOM   2589 C  CG  . TYR C 3 52  ? -5.647  11.865  -15.541 1.00   9.09   ? 138  TYR C CG  1 
ATOM   2590 C  CD1 . TYR C 3 52  ? -5.613  13.246  -15.659 1.00   9.32   ? 138  TYR C CD1 1 
ATOM   2591 C  CD2 . TYR C 3 52  ? -4.832  11.261  -14.591 1.00   8.82   ? 138  TYR C CD2 1 
ATOM   2592 C  CE1 . TYR C 3 52  ? -4.775  14.011  -14.870 1.00   8.15   ? 138  TYR C CE1 1 
ATOM   2593 C  CE2 . TYR C 3 52  ? -3.997  12.005  -13.797 1.00   9.26   ? 138  TYR C CE2 1 
ATOM   2594 C  CZ  . TYR C 3 52  ? -3.969  13.384  -13.941 1.00   9.99   ? 138  TYR C CZ  1 
ATOM   2595 O  OH  . TYR C 3 52  ? -3.141  14.134  -13.138 1.00   8.94   ? 138  TYR C OH  1 
ATOM   2596 N  N   . TYR C 3 53  ? -6.265  8.418   -18.157 1.00   10.25  ? 139  TYR C N   1 
ATOM   2597 C  CA  . TYR C 3 53  ? -7.012  7.208   -18.423 1.00   9.79   ? 139  TYR C CA  1 
ATOM   2598 C  C   . TYR C 3 53  ? -7.386  6.610   -17.076 1.00   9.69   ? 139  TYR C C   1 
ATOM   2599 O  O   . TYR C 3 53  ? -6.536  6.514   -16.181 1.00   9.54   ? 139  TYR C O   1 
ATOM   2600 C  CB  . TYR C 3 53  ? -6.158  6.234   -19.218 1.00   9.55   ? 139  TYR C CB  1 
ATOM   2601 C  CG  . TYR C 3 53  ? -6.859  4.951   -19.580 1.00   9.44   ? 139  TYR C CG  1 
ATOM   2602 C  CD1 . TYR C 3 53  ? -8.099  4.956   -20.213 1.00   8.17   ? 139  TYR C CD1 1 
ATOM   2603 C  CD2 . TYR C 3 53  ? -6.262  3.731   -19.315 1.00   9.32   ? 139  TYR C CD2 1 
ATOM   2604 C  CE1 . TYR C 3 53  ? -8.725  3.776   -20.548 1.00   9.34   ? 139  TYR C CE1 1 
ATOM   2605 C  CE2 . TYR C 3 53  ? -6.871  2.562   -19.648 1.00   9.79   ? 139  TYR C CE2 1 
ATOM   2606 C  CZ  . TYR C 3 53  ? -8.101  2.582   -20.259 1.00   9.18   ? 139  TYR C CZ  1 
ATOM   2607 O  OH  . TYR C 3 53  ? -8.683  1.376   -20.572 1.00   10.08  ? 139  TYR C OH  1 
ATOM   2608 N  N   . PHE C 3 54  ? -8.668  6.271   -16.924 1.00   9.47   ? 140  PHE C N   1 
ATOM   2609 C  CA  . PHE C 3 54  ? -9.184  5.561   -15.758 1.00   8.78   ? 140  PHE C CA  1 
ATOM   2610 C  C   . PHE C 3 54  ? -9.802  4.252   -16.222 1.00   8.73   ? 140  PHE C C   1 
ATOM   2611 O  O   . PHE C 3 54  ? -10.507 4.214   -17.235 1.00   8.26   ? 140  PHE C O   1 
ATOM   2612 C  CB  . PHE C 3 54  ? -10.240 6.395   -15.006 1.00   9.40   ? 140  PHE C CB  1 
ATOM   2613 C  CG  . PHE C 3 54  ? -9.724  7.710   -14.490 1.00   9.55   ? 140  PHE C CG  1 
ATOM   2614 C  CD1 . PHE C 3 54  ? -9.925  8.879   -15.204 1.00   9.12   ? 140  PHE C CD1 1 
ATOM   2615 C  CD2 . PHE C 3 54  ? -9.039  7.780   -13.282 1.00   9.71   ? 140  PHE C CD2 1 
ATOM   2616 C  CE1 . PHE C 3 54  ? -9.456  10.087  -14.733 1.00   7.69   ? 140  PHE C CE1 1 
ATOM   2617 C  CE2 . PHE C 3 54  ? -8.567  8.990   -12.811 1.00   8.33   ? 140  PHE C CE2 1 
ATOM   2618 C  CZ  . PHE C 3 54  ? -8.773  10.143  -13.535 1.00   9.25   ? 140  PHE C CZ  1 
ATOM   2619 N  N   . VAL C 3 55  ? -9.530  3.181   -15.483 1.00   8.06   ? 141  VAL C N   1 
ATOM   2620 C  CA  . VAL C 3 55  ? -10.046 1.860   -15.813 1.00   7.76   ? 141  VAL C CA  1 
ATOM   2621 C  C   . VAL C 3 55  ? -10.163 1.030   -14.528 1.00   7.19   ? 141  VAL C C   1 
ATOM   2622 O  O   . VAL C 3 55  ? -9.377  1.203   -13.609 1.00   7.43   ? 141  VAL C O   1 
ATOM   2623 C  CB  . VAL C 3 55  ? -9.145  1.155   -16.857 1.00   8.11   ? 141  VAL C CB  1 
ATOM   2624 C  CG1 . VAL C 3 55  ? -7.755  0.845   -16.272 1.00   10.02  ? 141  VAL C CG1 1 
ATOM   2625 C  CG2 . VAL C 3 55  ? -9.809  -0.097  -17.397 1.00   8.64   ? 141  VAL C CG2 1 
ATOM   2626 N  N   . TYR C 3 56  ? -11.162 0.155   -14.459 1.00   7.10   ? 142  TYR C N   1 
ATOM   2627 C  CA  . TYR C 3 56  ? -11.346 -0.716  -13.295 1.00   6.24   ? 142  TYR C CA  1 
ATOM   2628 C  C   . TYR C 3 56  ? -11.734 -2.126  -13.731 1.00   5.52   ? 142  TYR C C   1 
ATOM   2629 O  O   . TYR C 3 56  ? -12.220 -2.323  -14.845 1.00   3.67   ? 142  TYR C O   1 
ATOM   2630 C  CB  . TYR C 3 56  ? -12.435 -0.148  -12.373 1.00   6.30   ? 142  TYR C CB  1 
ATOM   2631 C  CG  . TYR C 3 56  ? -13.810 -0.284  -12.956 1.00   6.66   ? 142  TYR C CG  1 
ATOM   2632 C  CD1 . TYR C 3 56  ? -14.566 -1.437  -12.749 1.00   5.99   ? 142  TYR C CD1 1 
ATOM   2633 C  CD2 . TYR C 3 56  ? -14.352 0.726   -13.743 1.00   8.00   ? 142  TYR C CD2 1 
ATOM   2634 C  CE1 . TYR C 3 56  ? -15.817 -1.579  -13.307 1.00   7.09   ? 142  TYR C CE1 1 
ATOM   2635 C  CE2 . TYR C 3 56  ? -15.615 0.591   -14.303 1.00   7.56   ? 142  TYR C CE2 1 
ATOM   2636 C  CZ  . TYR C 3 56  ? -16.338 -0.563  -14.086 1.00   7.09   ? 142  TYR C CZ  1 
ATOM   2637 O  OH  . TYR C 3 56  ? -17.600 -0.697  -14.642 1.00   8.31   ? 142  TYR C OH  1 
ATOM   2638 N  N   . HIS C 3 57  ? -11.534 -3.091  -12.836 1.00   4.54   ? 143  HIS C N   1 
ATOM   2639 C  CA  . HIS C 3 57  ? -11.950 -4.487  -13.042 1.00   4.59   ? 143  HIS C CA  1 
ATOM   2640 C  C   . HIS C 3 57  ? -12.432 -4.981  -11.695 1.00   5.15   ? 143  HIS C C   1 
ATOM   2641 O  O   . HIS C 3 57  ? -11.647 -5.116  -10.774 1.00   5.35   ? 143  HIS C O   1 
ATOM   2642 C  CB  . HIS C 3 57  ? -10.774 -5.353  -13.495 1.00   3.96   ? 143  HIS C CB  1 
ATOM   2643 C  CG  . HIS C 3 57  ? -10.222 -4.960  -14.829 1.00   4.42   ? 143  HIS C CG  1 
ATOM   2644 N  ND1 . HIS C 3 57  ? -10.711 -5.468  -16.013 1.00   3.77   ? 143  HIS C ND1 1 
ATOM   2645 C  CD2 . HIS C 3 57  ? -9.237  -4.096  -15.169 1.00   3.61   ? 143  HIS C CD2 1 
ATOM   2646 C  CE1 . HIS C 3 57  ? -10.049 -4.934  -17.025 1.00   3.41   ? 143  HIS C CE1 1 
ATOM   2647 N  NE2 . HIS C 3 57  ? -9.162  -4.087  -16.540 1.00   3.43   ? 143  HIS C NE2 1 
ATOM   2648 N  N   . ALA C 3 58  ? -13.723 -5.240  -11.586 1.00   5.17   ? 144  ALA C N   1 
ATOM   2649 C  CA  . ALA C 3 58  ? -14.327 -5.512  -10.293 1.00   6.04   ? 144  ALA C CA  1 
ATOM   2650 C  C   . ALA C 3 58  ? -14.972 -6.899  -10.296 1.00   5.79   ? 144  ALA C C   1 
ATOM   2651 O  O   . ALA C 3 58  ? -15.781 -7.215  -11.180 1.00   6.37   ? 144  ALA C O   1 
ATOM   2652 C  CB  . ALA C 3 58  ? -15.343 -4.450  -9.996  1.00   5.72   ? 144  ALA C CB  1 
ATOM   2653 N  N   . SER C 3 59  ? -14.601 -7.727  -9.323  1.00   5.55   ? 145  SER C N   1 
ATOM   2654 C  CA  . SER C 3 59  ? -15.145 -9.079  -9.228  1.00   6.51   ? 145  SER C CA  1 
ATOM   2655 C  C   . SER C 3 59  ? -16.464 -9.055  -8.473  1.00   7.84   ? 145  SER C C   1 
ATOM   2656 O  O   . SER C 3 59  ? -16.621 -8.300  -7.520  1.00   8.58   ? 145  SER C O   1 
ATOM   2657 C  CB  . SER C 3 59  ? -14.162 -10.004 -8.501  1.00   6.08   ? 145  SER C CB  1 
ATOM   2658 O  OG  . SER C 3 59  ? -12.986 -10.241 -9.265  1.00   6.80   ? 145  SER C OG  1 
ATOM   2659 N  N   . HIS C 3 60  ? -17.407 -9.902  -8.872  1.00   8.84   ? 146  HIS C N   1 
ATOM   2660 C  CA  . HIS C 3 60  ? -18.704 -9.935  -8.213  1.00   9.13   ? 146  HIS C CA  1 
ATOM   2661 C  C   . HIS C 3 60  ? -19.365 -11.293 -8.405  1.00   9.60   ? 146  HIS C C   1 
ATOM   2662 O  O   . HIS C 3 60  ? -19.084 -11.985 -9.381  1.00   9.56   ? 146  HIS C O   1 
ATOM   2663 C  CB  . HIS C 3 60  ? -19.604 -8.784  -8.710  1.00   9.07   ? 146  HIS C CB  1 
ATOM   2664 C  CG  . HIS C 3 60  ? -19.963 -8.865  -10.165 1.00   8.60   ? 146  HIS C CG  1 
ATOM   2665 N  ND1 . HIS C 3 60  ? -19.076 -8.549  -11.175 1.00   9.10   ? 146  HIS C ND1 1 
ATOM   2666 C  CD2 . HIS C 3 60  ? -21.117 -9.220  -10.780 1.00   7.89   ? 146  HIS C CD2 1 
ATOM   2667 C  CE1 . HIS C 3 60  ? -19.665 -8.710  -12.347 1.00   6.53   ? 146  HIS C CE1 1 
ATOM   2668 N  NE2 . HIS C 3 60  ? -20.903 -9.120  -12.135 1.00   8.99   ? 146  HIS C NE2 1 
ATOM   2669 N  N   . THR C 3 61  ? -20.218 -11.674 -7.457  1.00   10.33  ? 147  THR C N   1 
ATOM   2670 C  CA  . THR C 3 61  ? -20.960 -12.940 -7.514  1.00   11.51  ? 147  THR C CA  1 
ATOM   2671 C  C   . THR C 3 61  ? -22.477 -12.728 -7.407  1.00   12.10  ? 147  THR C C   1 
ATOM   2672 O  O   . THR C 3 61  ? -23.243 -13.689 -7.274  1.00   12.66  ? 147  THR C O   1 
ATOM   2673 C  CB  . THR C 3 61  ? -20.509 -13.929 -6.420  1.00   12.05  ? 147  THR C CB  1 
ATOM   2674 O  OG1 . THR C 3 61  ? -20.545 -13.280 -5.140  1.00   12.37  ? 147  THR C OG1 1 
ATOM   2675 C  CG2 . THR C 3 61  ? -19.092 -14.417 -6.697  1.00   12.66  ? 147  THR C CG2 1 
ATOM   2676 N  N   . ALA C 3 62  ? -22.894 -11.463 -7.467  1.00   12.11  ? 148  ALA C N   1 
ATOM   2677 C  CA  . ALA C 3 62  ? -24.294 -11.080 -7.621  1.00   11.59  ? 148  ALA C CA  1 
ATOM   2678 C  C   . ALA C 3 62  ? -24.282 -9.836  -8.503  1.00   11.60  ? 148  ALA C C   1 
ATOM   2679 O  O   . ALA C 3 62  ? -23.210 -9.379  -8.907  1.00   10.97  ? 148  ALA C O   1 
ATOM   2680 C  CB  . ALA C 3 62  ? -24.938 -10.778 -6.251  1.00   11.52  ? 148  ALA C CB  1 
ATOM   2681 N  N   . ASN C 3 63  ? -25.453 -9.269  -8.781  1.00   10.71  ? 149  ASN C N   1 
ATOM   2682 C  CA  . ASN C 3 63  ? -25.530 -8.111  -9.675  1.00   10.22  ? 149  ASN C CA  1 
ATOM   2683 C  C   . ASN C 3 63  ? -24.672 -6.903  -9.227  1.00   9.53   ? 149  ASN C C   1 
ATOM   2684 O  O   . ASN C 3 63  ? -24.644 -6.539  -8.044  1.00   6.99   ? 149  ASN C O   1 
ATOM   2685 C  CB  . ASN C 3 63  ? -26.990 -7.704  -9.904  1.00   10.78  ? 149  ASN C CB  1 
ATOM   2686 C  CG  . ASN C 3 63  ? -27.767 -8.728  -10.748 1.00   11.48  ? 149  ASN C CG  1 
ATOM   2687 O  OD1 . ASN C 3 63  ? -27.226 -9.757  -11.166 1.00   10.03  ? 149  ASN C OD1 1 
ATOM   2688 N  ND2 . ASN C 3 63  ? -29.044 -8.445  -10.987 1.00   9.62   ? 149  ASN C ND2 1 
ATOM   2689 N  N   . LEU C 3 64  ? -23.958 -6.305  -10.185 1.00   8.25   ? 150  LEU C N   1 
ATOM   2690 C  CA  . LEU C 3 64  ? -23.084 -5.153  -9.913  1.00   7.47   ? 150  LEU C CA  1 
ATOM   2691 C  C   . LEU C 3 64  ? -23.115 -4.154  -11.058 1.00   7.87   ? 150  LEU C C   1 
ATOM   2692 O  O   . LEU C 3 64  ? -22.846 -4.515  -12.215 1.00   6.29   ? 150  LEU C O   1 
ATOM   2693 C  CB  . LEU C 3 64  ? -21.620 -5.589  -9.710  1.00   7.27   ? 150  LEU C CB  1 
ATOM   2694 C  CG  . LEU C 3 64  ? -20.594 -4.440  -9.652  1.00   6.17   ? 150  LEU C CG  1 
ATOM   2695 C  CD1 . LEU C 3 64  ? -20.854 -3.597  -8.409  1.00   5.22   ? 150  LEU C CD1 1 
ATOM   2696 C  CD2 . LEU C 3 64  ? -19.134 -4.923  -9.665  1.00   5.48   ? 150  LEU C CD2 1 
ATOM   2697 N  N   . CYS C 3 65  ? -23.427 -2.903  -10.719 1.00   8.90   ? 151  CYS C N   1 
ATOM   2698 C  CA  . CYS C 3 65  ? -23.228 -1.765  -11.622 1.00   9.28   ? 151  CYS C CA  1 
ATOM   2699 C  C   . CYS C 3 65  ? -22.211 -0.814  -11.020 1.00   8.48   ? 151  CYS C C   1 
ATOM   2700 O  O   . CYS C 3 65  ? -22.332 -0.404  -9.861  1.00   8.63   ? 151  CYS C O   1 
ATOM   2701 C  CB  . CYS C 3 65  ? -24.527 -0.979  -11.856 1.00   9.55   ? 151  CYS C CB  1 
ATOM   2702 S  SG  . CYS C 3 65  ? -25.821 -1.865  -12.715 1.00   11.21  ? 151  CYS C SG  1 
ATOM   2703 N  N   . VAL C 3 66  ? -21.206 -0.469  -11.809 1.00   8.34   ? 152  VAL C N   1 
ATOM   2704 C  CA  . VAL C 3 66  ? -20.220 0.502   -11.397 1.00   7.70   ? 152  VAL C CA  1 
ATOM   2705 C  C   . VAL C 3 66  ? -20.407 1.775   -12.206 1.00   8.72   ? 152  VAL C C   1 
ATOM   2706 O  O   . VAL C 3 66  ? -20.536 1.748   -13.450 1.00   8.17   ? 152  VAL C O   1 
ATOM   2707 C  CB  . VAL C 3 66  ? -18.792 -0.034  -11.583 1.00   8.34   ? 152  VAL C CB  1 
ATOM   2708 C  CG1 . VAL C 3 66  ? -17.768 1.008   -11.138 1.00   7.25   ? 152  VAL C CG1 1 
ATOM   2709 C  CG2 . VAL C 3 66  ? -18.618 -1.328  -10.820 1.00   6.58   ? 152  VAL C CG2 1 
ATOM   2710 N  N   . LEU C 3 67  ? -20.459 2.885   -11.485 1.00   8.25   ? 153  LEU C N   1 
ATOM   2711 C  CA  . LEU C 3 67  ? -20.628 4.192   -12.082 1.00   8.72   ? 153  LEU C CA  1 
ATOM   2712 C  C   . LEU C 3 67  ? -19.340 4.969   -11.860 1.00   8.90   ? 153  LEU C C   1 
ATOM   2713 O  O   . LEU C 3 67  ? -18.811 4.992   -10.743 1.00   8.62   ? 153  LEU C O   1 
ATOM   2714 C  CB  . LEU C 3 67  ? -21.795 4.937   -11.421 1.00   8.78   ? 153  LEU C CB  1 
ATOM   2715 C  CG  . LEU C 3 67  ? -23.238 4.470   -11.604 1.00   10.31  ? 153  LEU C CG  1 
ATOM   2716 C  CD1 . LEU C 3 67  ? -23.454 3.026   -11.151 1.00   10.12  ? 153  LEU C CD1 1 
ATOM   2717 C  CD2 . LEU C 3 67  ? -24.150 5.403   -10.816 1.00   11.76  ? 153  LEU C CD2 1 
ATOM   2718 N  N   . LEU C 3 68  ? -18.817 5.585   -12.912 1.00   8.99   ? 154  LEU C N   1 
ATOM   2719 C  CA  . LEU C 3 68  ? -17.671 6.469   -12.735 1.00   9.58   ? 154  LEU C CA  1 
ATOM   2720 C  C   . LEU C 3 68  ? -18.143 7.925   -12.721 1.00   9.46   ? 154  LEU C C   1 
ATOM   2721 O  O   . LEU C 3 68  ? -18.884 8.356   -13.611 1.00   9.19   ? 154  LEU C O   1 
ATOM   2722 C  CB  . LEU C 3 68  ? -16.580 6.242   -13.803 1.00   9.89   ? 154  LEU C CB  1 
ATOM   2723 C  CG  . LEU C 3 68  ? -15.375 7.181   -13.617 1.00   10.08  ? 154  LEU C CG  1 
ATOM   2724 C  CD1 . LEU C 3 68  ? -14.044 6.514   -13.979 1.00   10.26  ? 154  LEU C CD1 1 
ATOM   2725 C  CD2 . LEU C 3 68  ? -15.555 8.488   -14.387 1.00   10.44  ? 154  LEU C CD2 1 
ATOM   2726 N  N   . TYR C 3 69  ? -17.703 8.660   -11.704 1.00   9.46   ? 155  TYR C N   1 
ATOM   2727 C  CA  . TYR C 3 69  ? -18.070 10.069  -11.505 1.00   10.20  ? 155  TYR C CA  1 
ATOM   2728 C  C   . TYR C 3 69  ? -16.885 11.013  -11.678 1.00   10.40  ? 155  TYR C C   1 
ATOM   2729 O  O   . TYR C 3 69  ? -15.777 10.735  -11.208 1.00   9.48   ? 155  TYR C O   1 
ATOM   2730 C  CB  . TYR C 3 69  ? -18.670 10.282  -10.098 1.00   10.37  ? 155  TYR C CB  1 
ATOM   2731 C  CG  . TYR C 3 69  ? -20.138 9.962   -10.011 1.00   10.69  ? 155  TYR C CG  1 
ATOM   2732 C  CD1 . TYR C 3 69  ? -20.566 8.664   -9.787  1.00   11.22  ? 155  TYR C CD1 1 
ATOM   2733 C  CD2 . TYR C 3 69  ? -21.100 10.954  -10.161 1.00   11.47  ? 155  TYR C CD2 1 
ATOM   2734 C  CE1 . TYR C 3 69  ? -21.904 8.353   -9.717  1.00   11.88  ? 155  TYR C CE1 1 
ATOM   2735 C  CE2 . TYR C 3 69  ? -22.459 10.655  -10.087 1.00   11.76  ? 155  TYR C CE2 1 
ATOM   2736 C  CZ  . TYR C 3 69  ? -22.850 9.346   -9.868  1.00   11.76  ? 155  TYR C CZ  1 
ATOM   2737 O  OH  . TYR C 3 69  ? -24.182 9.008   -9.804  1.00   12.10  ? 155  TYR C OH  1 
ATOM   2738 N  N   . ARG C 3 70  ? -17.140 12.144  -12.336 1.00   11.27  ? 156  ARG C N   1 
ATOM   2739 C  CA  . ARG C 3 70  ? -16.164 13.227  -12.451 1.00   11.53  ? 156  ARG C CA  1 
ATOM   2740 C  C   . ARG C 3 70  ? -16.787 14.530  -11.953 1.00   11.82  ? 156  ARG C C   1 
ATOM   2741 O  O   . ARG C 3 70  ? -17.768 15.014  -12.520 1.00   11.67  ? 156  ARG C O   1 
ATOM   2742 C  CB  . ARG C 3 70  ? -15.689 13.381  -13.903 1.00   12.30  ? 156  ARG C CB  1 
ATOM   2743 C  CG  . ARG C 3 70  ? -14.748 14.567  -14.148 1.00   13.06  ? 156  ARG C CG  1 
ATOM   2744 C  CD  . ARG C 3 70  ? -14.769 14.973  -15.623 1.00   14.41  ? 156  ARG C CD  1 
ATOM   2745 N  NE  . ARG C 3 70  ? -14.038 16.213  -15.863 1.00   14.15  ? 156  ARG C NE  1 
ATOM   2746 C  CZ  . ARG C 3 70  ? -13.722 16.675  -17.066 1.00   13.17  ? 156  ARG C CZ  1 
ATOM   2747 N  NH1 . ARG C 3 70  ? -14.085 16.000  -18.147 1.00   14.27  ? 156  ARG C NH1 1 
ATOM   2748 N  NH2 . ARG C 3 70  ? -13.053 17.814  -17.186 1.00   13.13  ? 156  ARG C NH2 1 
ATOM   2749 N  N   . SER C 3 71  ? -16.227 15.079  -10.876 1.00   12.40  ? 157  SER C N   1 
ATOM   2750 C  CA  . SER C 3 71  ? -16.693 16.339  -10.311 1.00   12.56  ? 157  SER C CA  1 
ATOM   2751 C  C   . SER C 3 71  ? -18.212 16.380  -10.169 1.00   13.37  ? 157  SER C C   1 
ATOM   2752 O  O   . SER C 3 71  ? -18.852 17.366  -10.556 1.00   13.38  ? 157  SER C O   1 
ATOM   2753 C  CB  . SER C 3 71  ? -16.220 17.524  -11.171 1.00   13.33  ? 157  SER C CB  1 
ATOM   2754 O  OG  . SER C 3 71  ? -14.822 17.484  -11.392 1.00   12.25  ? 157  SER C OG  1 
ATOM   2755 N  N   . GLY C 3 72  ? -18.788 15.302  -9.639  1.00   13.20  ? 158  GLY C N   1 
ATOM   2756 C  CA  . GLY C 3 72  ? -20.214 15.268  -9.332  1.00   12.39  ? 158  GLY C CA  1 
ATOM   2757 C  C   . GLY C 3 72  ? -21.114 14.737  -10.432 1.00   12.51  ? 158  GLY C C   1 
ATOM   2758 O  O   . GLY C 3 72  ? -22.284 14.470  -10.196 1.00   12.24  ? 158  GLY C O   1 
ATOM   2759 N  N   . VAL C 3 73  ? -20.574 14.584  -11.637 1.00   12.77  ? 159  VAL C N   1 
ATOM   2760 C  CA  . VAL C 3 73  ? -21.359 14.109  -12.770 1.00   12.61  ? 159  VAL C CA  1 
ATOM   2761 C  C   . VAL C 3 73  ? -21.005 12.667  -13.109 1.00   12.67  ? 159  VAL C C   1 
ATOM   2762 O  O   . VAL C 3 73  ? -19.832 12.323  -13.199 1.00   11.92  ? 159  VAL C O   1 
ATOM   2763 C  CB  . VAL C 3 73  ? -21.111 14.978  -14.030 1.00   13.22  ? 159  VAL C CB  1 
ATOM   2764 C  CG1 . VAL C 3 73  ? -21.811 14.371  -15.244 1.00   12.81  ? 159  VAL C CG1 1 
ATOM   2765 C  CG2 . VAL C 3 73  ? -21.583 16.424  -13.801 1.00   12.84  ? 159  VAL C CG2 1 
ATOM   2766 N  N   . LYS C 3 74  ? -22.023 11.831  -13.302 1.00   12.89  ? 160  LYS C N   1 
ATOM   2767 C  CA  . LYS C 3 74  ? -21.819 10.459  -13.746 1.00   13.57  ? 160  LYS C CA  1 
ATOM   2768 C  C   . LYS C 3 74  ? -21.410 10.416  -15.225 1.00   13.80  ? 160  LYS C C   1 
ATOM   2769 O  O   . LYS C 3 74  ? -22.154 10.849  -16.105 1.00   13.69  ? 160  LYS C O   1 
ATOM   2770 C  CB  . LYS C 3 74  ? -23.076 9.620   -13.504 1.00   14.29  ? 160  LYS C CB  1 
ATOM   2771 C  CG  . LYS C 3 74  ? -22.958 8.159   -13.931 1.00   14.31  ? 160  LYS C CG  1 
ATOM   2772 C  CD  . LYS C 3 74  ? -24.286 7.406   -13.728 1.00   15.59  ? 160  LYS C CD  1 
ATOM   2773 C  CE  . LYS C 3 74  ? -25.474 8.163   -14.316 1.00   15.55  ? 160  LYS C CE  1 
ATOM   2774 N  NZ  . LYS C 3 74  ? -26.743 7.398   -14.183 1.00   17.22  ? 160  LYS C NZ  1 
ATOM   2775 N  N   . VAL C 3 75  ? -20.215 9.897   -15.486 1.00   12.97  ? 161  VAL C N   1 
ATOM   2776 C  CA  . VAL C 3 75  ? -19.696 9.835   -16.842 1.00   12.27  ? 161  VAL C CA  1 
ATOM   2777 C  C   . VAL C 3 75  ? -20.106 8.536   -17.544 1.00   12.54  ? 161  VAL C C   1 
ATOM   2778 O  O   . VAL C 3 75  ? -20.688 8.570   -18.632 1.00   12.37  ? 161  VAL C O   1 
ATOM   2779 C  CB  . VAL C 3 75  ? -18.170 10.011  -16.866 1.00   12.14  ? 161  VAL C CB  1 
ATOM   2780 C  CG1 . VAL C 3 75  ? -17.644 9.893   -18.300 1.00   11.65  ? 161  VAL C CG1 1 
ATOM   2781 C  CG2 . VAL C 3 75  ? -17.793 11.369  -16.275 1.00   10.45  ? 161  VAL C CG2 1 
ATOM   2782 N  N   . VAL C 3 76  ? -19.801 7.394   -16.931 1.00   11.50  ? 162  VAL C N   1 
ATOM   2783 C  CA  . VAL C 3 76  ? -20.171 6.107   -17.519 1.00   11.84  ? 162  VAL C CA  1 
ATOM   2784 C  C   . VAL C 3 76  ? -20.685 5.104   -16.494 1.00   11.35  ? 162  VAL C C   1 
ATOM   2785 O  O   . VAL C 3 76  ? -20.241 5.100   -15.350 1.00   11.61  ? 162  VAL C O   1 
ATOM   2786 C  CB  . VAL C 3 76  ? -18.997 5.462   -18.286 1.00   11.78  ? 162  VAL C CB  1 
ATOM   2787 C  CG1 . VAL C 3 76  ? -18.833 6.093   -19.653 1.00   11.83  ? 162  VAL C CG1 1 
ATOM   2788 C  CG2 . VAL C 3 76  ? -17.702 5.562   -17.477 1.00   12.10  ? 162  VAL C CG2 1 
ATOM   2789 N  N   . THR C 3 77  ? -21.605 4.248   -16.930 1.00   11.16  ? 163  THR C N   1 
ATOM   2790 C  CA  . THR C 3 77  ? -22.105 3.129   -16.121 1.00   11.79  ? 163  THR C CA  1 
ATOM   2791 C  C   . THR C 3 77  ? -21.953 1.822   -16.893 1.00   11.31  ? 163  THR C C   1 
ATOM   2792 O  O   . THR C 3 77  ? -22.240 1.761   -18.099 1.00   10.31  ? 163  THR C O   1 
ATOM   2793 C  CB  . THR C 3 77  ? -23.612 3.278   -15.789 1.00   12.10  ? 163  THR C CB  1 
ATOM   2794 O  OG1 . THR C 3 77  ? -23.910 4.638   -15.470 1.00   12.44  ? 163  THR C OG1 1 
ATOM   2795 C  CG2 . THR C 3 77  ? -24.016 2.355   -14.619 1.00   12.17  ? 163  THR C CG2 1 
ATOM   2796 N  N   . PHE C 3 78  ? -21.505 0.784   -16.192 1.00   11.02  ? 164  PHE C N   1 
ATOM   2797 C  CA  . PHE C 3 78  ? -21.415 -0.558  -16.758 1.00   10.36  ? 164  PHE C CA  1 
ATOM   2798 C  C   . PHE C 3 78  ? -21.917 -1.580  -15.741 1.00   10.33  ? 164  PHE C C   1 
ATOM   2799 O  O   . PHE C 3 78  ? -21.529 -1.545  -14.566 1.00   9.79   ? 164  PHE C O   1 
ATOM   2800 C  CB  . PHE C 3 78  ? -19.973 -0.893  -17.163 1.00   9.58   ? 164  PHE C CB  1 
ATOM   2801 C  CG  . PHE C 3 78  ? -19.382 0.066   -18.151 1.00   9.22   ? 164  PHE C CG  1 
ATOM   2802 C  CD1 . PHE C 3 78  ? -18.584 1.111   -17.722 1.00   8.27   ? 164  PHE C CD1 1 
ATOM   2803 C  CD2 . PHE C 3 78  ? -19.630 -0.077  -19.511 1.00   10.33  ? 164  PHE C CD2 1 
ATOM   2804 C  CE1 . PHE C 3 78  ? -18.030 1.998   -18.630 1.00   9.84   ? 164  PHE C CE1 1 
ATOM   2805 C  CE2 . PHE C 3 78  ? -19.084 0.811   -20.431 1.00   9.91   ? 164  PHE C CE2 1 
ATOM   2806 C  CZ  . PHE C 3 78  ? -18.286 1.848   -19.988 1.00   9.24   ? 164  PHE C CZ  1 
ATOM   2807 N  N   . CYS C 3 79  ? -22.775 -2.488  -16.196 1.00   10.32  ? 165  CYS C N   1 
ATOM   2808 C  CA  . CYS C 3 79  ? -23.404 -3.449  -15.296 1.00   11.54  ? 165  CYS C CA  1 
ATOM   2809 C  C   . CYS C 3 79  ? -23.139 -4.885  -15.700 1.00   11.58  ? 165  CYS C C   1 
ATOM   2810 O  O   . CYS C 3 79  ? -23.077 -5.211  -16.889 1.00   11.15  ? 165  CYS C O   1 
ATOM   2811 C  CB  . CYS C 3 79  ? -24.916 -3.227  -15.232 1.00   11.04  ? 165  CYS C CB  1 
ATOM   2812 S  SG  . CYS C 3 79  ? -25.371 -1.601  -14.698 1.00   12.86  ? 165  CYS C SG  1 
ATOM   2813 N  N   . GLY C 3 80  ? -23.000 -5.735  -14.692 1.00   11.45  ? 166  GLY C N   1 
ATOM   2814 C  CA  . GLY C 3 80  ? -22.869 -7.170  -14.893 1.00   11.55  ? 166  GLY C CA  1 
ATOM   2815 C  C   . GLY C 3 80  ? -23.817 -7.949  -13.998 1.00   12.21  ? 166  GLY C C   1 
ATOM   2816 O  O   . GLY C 3 80  ? -23.923 -7.684  -12.796 1.00   11.46  ? 166  GLY C O   1 
ATOM   2817 N  N   . HIS C 3 81  ? -24.521 -8.904  -14.591 1.00   12.71  ? 167  HIS C N   1 
ATOM   2818 C  CA  . HIS C 3 81  ? -25.482 -9.705  -13.854 1.00   14.69  ? 167  HIS C CA  1 
ATOM   2819 C  C   . HIS C 3 81  ? -25.026 -11.147 -13.745 1.00   15.77  ? 167  HIS C C   1 
ATOM   2820 O  O   . HIS C 3 81  ? -24.642 -11.770 -14.738 1.00   15.90  ? 167  HIS C O   1 
ATOM   2821 C  CB  . HIS C 3 81  ? -26.859 -9.662  -14.525 1.00   14.24  ? 167  HIS C CB  1 
ATOM   2822 C  CG  . HIS C 3 81  ? -27.520 -8.323  -14.440 1.00   14.50  ? 167  HIS C CG  1 
ATOM   2823 N  ND1 . HIS C 3 81  ? -28.864 -8.140  -14.676 1.00   13.00  ? 167  HIS C ND1 1 
ATOM   2824 C  CD2 . HIS C 3 81  ? -27.020 -7.102  -14.135 1.00   13.02  ? 167  HIS C CD2 1 
ATOM   2825 C  CE1 . HIS C 3 81  ? -29.161 -6.861  -14.531 1.00   14.52  ? 167  HIS C CE1 1 
ATOM   2826 N  NE2 . HIS C 3 81  ? -28.061 -6.211  -14.200 1.00   13.36  ? 167  HIS C NE2 1 
ATOM   2827 N  N   . THR C 3 82  ? -25.087 -11.667 -12.527 1.00   16.63  ? 168  THR C N   1 
ATOM   2828 C  CA  . THR C 3 82  ? -24.751 -13.047 -12.274 1.00   18.72  ? 168  THR C CA  1 
ATOM   2829 C  C   . THR C 3 82  ? -25.432 -13.502 -10.995 1.00   19.40  ? 168  THR C C   1 
ATOM   2830 O  O   . THR C 3 82  ? -25.931 -12.690 -10.217 1.00   19.28  ? 168  THR C O   1 
ATOM   2831 C  CB  . THR C 3 82  ? -23.232 -13.236 -12.152 1.00   19.21  ? 168  THR C CB  1 
ATOM   2832 O  OG1 . THR C 3 82  ? -22.927 -14.635 -12.107 1.00   20.34  ? 168  THR C OG1 1 
ATOM   2833 C  CG2 . THR C 3 82  ? -22.700 -12.547 -10.893 1.00   20.04  ? 168  THR C CG2 1 
ATOM   2834 N  N   . SER C 3 83  ? -25.458 -14.811 -10.792 1.00   20.35  ? 169  SER C N   1 
ATOM   2835 C  CA  . SER C 3 83  ? -26.051 -15.395 -9.603  1.00   20.81  ? 169  SER C CA  1 
ATOM   2836 C  C   . SER C 3 83  ? -25.129 -16.510 -9.155  1.00   20.69  ? 169  SER C C   1 
ATOM   2837 O  O   . SER C 3 83  ? -24.981 -17.506 -9.850  1.00   20.90  ? 169  SER C O   1 
ATOM   2838 C  CB  . SER C 3 83  ? -27.459 -15.913 -9.920  1.00   21.44  ? 169  SER C CB  1 
ATOM   2839 O  OG  . SER C 3 83  ? -27.689 -17.229 -9.425  1.00   23.13  ? 169  SER C OG  1 
ATOM   2840 N  N   . LYS C 3 84  ? -24.475 -16.319 -8.011  1.00   21.04  ? 170  LYS C N   1 
ATOM   2841 C  CA  . LYS C 3 84  ? -23.566 -17.125 -7.360  0.0000 19.14  ? 170  LYS C CA  1 
ATOM   2842 C  C   . LYS C 3 84  ? -22.217 -17.558 -8.006  1.00   14.83  ? 170  LYS C C   1 
ATOM   2843 O  O   . LYS C 3 84  ? -21.370 -17.190 -7.192  1.00   15.06  ? 170  LYS C O   1 
ATOM   2844 C  CB  . LYS C 3 84  ? -24.208 -18.509 -7.228  0.0000 19.95  ? 170  LYS C CB  1 
ATOM   2845 C  CG  . LYS C 3 84  ? -25.487 -18.538 -6.391  0.0000 22.90  ? 170  LYS C CG  1 
ATOM   2846 C  CD  . LYS C 3 84  ? -26.286 -19.793 -6.713  0.0000 24.88  ? 170  LYS C CD  1 
ATOM   2847 C  CE  . LYS C 3 84  ? -26.673 -19.808 -8.192  0.0000 26.37  ? 170  LYS C CE  1 
ATOM   2848 N  NZ  . LYS C 3 84  ? -26.477 -21.151 -8.828  0.0000 27.30  ? 170  LYS C NZ  1 
ATOM   2849 N  N   . THR C 3 85  ? -22.066 -17.448 -9.323  1.00   13.10  ? 171  THR C N   1 
ATOM   2850 C  CA  . THR C 3 85  ? -20.776 -17.606 -9.951  1.00   12.82  ? 171  THR C CA  1 
ATOM   2851 C  C   . THR C 3 85  ? -20.122 -16.237 -10.155 1.00   12.73  ? 171  THR C C   1 
ATOM   2852 O  O   . THR C 3 85  ? -20.803 -15.203 -10.170 1.00   12.70  ? 171  THR C O   1 
ATOM   2853 C  CB  . THR C 3 85  ? -20.889 -18.351 -11.302 1.00   12.61  ? 171  THR C CB  1 
ATOM   2854 O  OG1 . THR C 3 85  ? -21.829 -17.677 -12.135 1.00   12.12  ? 171  THR C OG1 1 
ATOM   2855 C  CG2 . THR C 3 85  ? -21.355 -19.798 -11.092 1.00   13.07  ? 171  THR C CG2 1 
ATOM   2856 N  N   . ASN C 3 86  ? -18.803 -16.257 -10.325 1.00   11.12  ? 172  ASN C N   1 
ATOM   2857 C  CA  . ASN C 3 86  ? -17.970 -15.056 -10.344 1.00   10.52  ? 172  ASN C CA  1 
ATOM   2858 C  C   . ASN C 3 86  ? -17.717 -14.551 -11.762 1.00   10.62  ? 172  ASN C C   1 
ATOM   2859 O  O   . ASN C 3 86  ? -17.390 -15.335 -12.657 1.00   10.09  ? 172  ASN C O   1 
ATOM   2860 C  CB  . ASN C 3 86  ? -16.633 -15.375 -9.658  1.00   9.76   ? 172  ASN C CB  1 
ATOM   2861 C  CG  . ASN C 3 86  ? -15.806 -14.137 -9.344  1.00   8.77   ? 172  ASN C CG  1 
ATOM   2862 O  OD1 . ASN C 3 86  ? -15.785 -13.667 -8.212  1.00   7.29   ? 172  ASN C OD1 1 
ATOM   2863 N  ND2 . ASN C 3 86  ? -15.096 -13.629 -10.339 1.00   8.26   ? 172  ASN C ND2 1 
ATOM   2864 N  N   . GLN C 3 87  ? -17.882 -13.242 -11.958 1.00   10.49  ? 173  GLN C N   1 
ATOM   2865 C  CA  . GLN C 3 87  ? -17.479 -12.588 -13.197 1.00   10.88  ? 173  GLN C CA  1 
ATOM   2866 C  C   . GLN C 3 87  ? -16.763 -11.279 -12.899 1.00   10.12  ? 173  GLN C C   1 
ATOM   2867 O  O   . GLN C 3 87  ? -16.807 -10.780 -11.772 1.00   9.44   ? 173  GLN C O   1 
ATOM   2868 C  CB  . GLN C 3 87  ? -18.698 -12.306 -14.082 1.00   11.83  ? 173  GLN C CB  1 
ATOM   2869 C  CG  . GLN C 3 87  ? -19.450 -13.534 -14.497 1.00   15.51  ? 173  GLN C CG  1 
ATOM   2870 C  CD  . GLN C 3 87  ? -20.525 -13.232 -15.509 1.00   18.41  ? 173  GLN C CD  1 
ATOM   2871 O  OE1 . GLN C 3 87  ? -21.632 -12.827 -15.150 1.00   18.80  ? 173  GLN C OE1 1 
ATOM   2872 N  NE2 . GLN C 3 87  ? -20.204 -13.421 -16.795 1.00   19.35  ? 173  GLN C NE2 1 
ATOM   2873 N  N   . VAL C 3 88  ? -16.124 -10.713 -13.919 1.00   9.55   ? 174  VAL C N   1 
ATOM   2874 C  CA  . VAL C 3 88  ? -15.450 -9.412  -13.776 1.00   8.87   ? 174  VAL C CA  1 
ATOM   2875 C  C   . VAL C 3 88  ? -16.209 -8.305  -14.515 1.00   8.63   ? 174  VAL C C   1 
ATOM   2876 O  O   . VAL C 3 88  ? -16.440 -8.385  -15.722 1.00   9.03   ? 174  VAL C O   1 
ATOM   2877 C  CB  . VAL C 3 88  ? -13.971 -9.477  -14.265 1.00   8.70   ? 174  VAL C CB  1 
ATOM   2878 C  CG1 . VAL C 3 88  ? -13.304 -8.091  -14.228 1.00   7.96   ? 174  VAL C CG1 1 
ATOM   2879 C  CG2 . VAL C 3 88  ? -13.167 -10.471 -13.422 1.00   9.34   ? 174  VAL C CG2 1 
ATOM   2880 N  N   . ASN C 3 89  ? -16.596 -7.267  -13.788 1.00   9.08   ? 175  ASN C N   1 
ATOM   2881 C  CA  . ASN C 3 89  ? -17.189 -6.088  -14.408 1.00   9.00   ? 175  ASN C CA  1 
ATOM   2882 C  C   . ASN C 3 89  ? -16.097 -5.073  -14.697 1.00   9.09   ? 175  ASN C C   1 
ATOM   2883 O  O   . ASN C 3 89  ? -15.349 -4.689  -13.805 1.00   10.09  ? 175  ASN C O   1 
ATOM   2884 C  CB  . ASN C 3 89  ? -18.283 -5.490  -13.518 1.00   8.98   ? 175  ASN C CB  1 
ATOM   2885 C  CG  . ASN C 3 89  ? -18.829 -4.156  -14.044 1.00   9.96   ? 175  ASN C CG  1 
ATOM   2886 O  OD1 . ASN C 3 89  ? -18.118 -3.383  -14.687 1.00   10.33  ? 175  ASN C OD1 1 
ATOM   2887 N  ND2 . ASN C 3 89  ? -20.087 -3.872  -13.733 1.00   7.41   ? 175  ASN C ND2 1 
ATOM   2888 N  N   . SER C 3 90  ? -16.016 -4.636  -15.944 1.00   8.72   ? 176  SER C N   1 
ATOM   2889 C  CA  . SER C 3 90  ? -14.959 -3.741  -16.361 1.00   9.15   ? 176  SER C CA  1 
ATOM   2890 C  C   . SER C 3 90  ? -15.491 -2.468  -17.024 1.00   9.11   ? 176  SER C C   1 
ATOM   2891 O  O   . SER C 3 90  ? -16.582 -2.449  -17.597 1.00   8.83   ? 176  SER C O   1 
ATOM   2892 C  CB  . SER C 3 90  ? -13.994 -4.461  -17.310 1.00   9.50   ? 176  SER C CB  1 
ATOM   2893 O  OG  A SER C 3 90  ? -14.586 -4.675  -18.579 0.50   6.97   ? 176  SER C OG  1 
ATOM   2894 O  OG  B SER C 3 90  ? -12.870 -3.635  -17.588 0.50   11.53  ? 176  SER C OG  1 
ATOM   2895 N  N   . GLY C 3 91  ? -14.709 -1.399  -16.943 1.00   9.13   ? 177  GLY C N   1 
ATOM   2896 C  CA  . GLY C 3 91  ? -15.134 -0.117  -17.485 1.00   9.04   ? 177  GLY C CA  1 
ATOM   2897 C  C   . GLY C 3 91  ? -13.955 0.830   -17.514 1.00   9.53   ? 177  GLY C C   1 
ATOM   2898 O  O   . GLY C 3 91  ? -12.992 0.641   -16.781 1.00   9.29   ? 177  GLY C O   1 
ATOM   2899 N  N   . GLY C 3 92  ? -14.035 1.860   -18.348 1.00   9.26   ? 178  GLY C N   1 
ATOM   2900 C  CA  . GLY C 3 92  ? -12.904 2.767   -18.528 1.00   9.45   ? 178  GLY C CA  1 
ATOM   2901 C  C   . GLY C 3 92  ? -13.232 3.933   -19.433 1.00   8.81   ? 178  GLY C C   1 
ATOM   2902 O  O   . GLY C 3 92  ? -14.176 3.865   -20.209 1.00   8.40   ? 178  GLY C O   1 
ATOM   2903 N  N   . VAL C 3 93  ? -12.450 5.006   -19.325 1.00   8.75   ? 179  VAL C N   1 
ATOM   2904 C  CA  . VAL C 3 93  ? -12.719 6.233   -20.073 1.00   8.42   ? 179  VAL C CA  1 
ATOM   2905 C  C   . VAL C 3 93  ? -11.508 7.188   -19.995 1.00   8.76   ? 179  VAL C C   1 
ATOM   2906 O  O   . VAL C 3 93  ? -10.750 7.178   -19.007 1.00   8.23   ? 179  VAL C O   1 
ATOM   2907 C  CB  . VAL C 3 93  ? -14.025 6.908   -19.542 1.00   8.43   ? 179  VAL C CB  1 
ATOM   2908 C  CG1 . VAL C 3 93  ? -13.896 7.252   -18.059 1.00   6.86   ? 179  VAL C CG1 1 
ATOM   2909 C  CG2 . VAL C 3 93  ? -14.417 8.136   -20.363 1.00   8.70   ? 179  VAL C CG2 1 
ATOM   2910 N  N   . LEU C 3 94  ? -11.301 7.979   -21.046 1.00   8.79   ? 180  LEU C N   1 
ATOM   2911 C  CA  . LEU C 3 94  ? -10.275 9.037   -21.025 1.00   9.97   ? 180  LEU C CA  1 
ATOM   2912 C  C   . LEU C 3 94  ? -10.935 10.366  -20.700 1.00   9.91   ? 180  LEU C C   1 
ATOM   2913 O  O   . LEU C 3 94  ? -12.005 10.672  -21.226 1.00   9.45   ? 180  LEU C O   1 
ATOM   2914 C  CB  . LEU C 3 94  ? -9.554  9.148   -22.380 1.00   10.33  ? 180  LEU C CB  1 
ATOM   2915 C  CG  . LEU C 3 94  ? -8.745  7.924   -22.804 1.00   12.23  ? 180  LEU C CG  1 
ATOM   2916 C  CD1 . LEU C 3 94  ? -8.492  7.890   -24.318 1.00   11.09  ? 180  LEU C CD1 1 
ATOM   2917 C  CD2 . LEU C 3 94  ? -7.435  7.910   -22.042 1.00   11.79  ? 180  LEU C CD2 1 
ATOM   2918 N  N   . LEU C 3 95  ? -10.299 11.146  -19.827 1.00   10.41  ? 181  LEU C N   1 
ATOM   2919 C  CA  . LEU C 3 95  ? -10.837 12.441  -19.408 1.00   10.59  ? 181  LEU C CA  1 
ATOM   2920 C  C   . LEU C 3 95  ? -9.735  13.483  -19.281 1.00   10.62  ? 181  LEU C C   1 
ATOM   2921 O  O   . LEU C 3 95  ? -8.699  13.215  -18.680 1.00   10.45  ? 181  LEU C O   1 
ATOM   2922 C  CB  . LEU C 3 95  ? -11.564 12.309  -18.062 1.00   10.77  ? 181  LEU C CB  1 
ATOM   2923 C  CG  . LEU C 3 95  ? -12.713 11.301  -17.992 1.00   10.55  ? 181  LEU C CG  1 
ATOM   2924 C  CD1 . LEU C 3 95  ? -13.083 11.001  -16.532 1.00   11.23  ? 181  LEU C CD1 1 
ATOM   2925 C  CD2 . LEU C 3 95  ? -13.923 11.827  -18.750 1.00   10.34  ? 181  LEU C CD2 1 
ATOM   2926 N  N   . ARG C 3 96  ? -9.963  14.664  -19.853 1.00   11.22  ? 182  ARG C N   1 
ATOM   2927 C  CA  . ARG C 3 96  ? -9.059  15.816  -19.677 1.00   12.05  ? 182  ARG C CA  1 
ATOM   2928 C  C   . ARG C 3 96  ? -9.448  16.634  -18.435 1.00   11.98  ? 182  ARG C C   1 
ATOM   2929 O  O   . ARG C 3 96  ? -10.480 17.300  -18.432 1.00   12.40  ? 182  ARG C O   1 
ATOM   2930 C  CB  . ARG C 3 96  ? -9.071  16.711  -20.924 1.00   12.21  ? 182  ARG C CB  1 
ATOM   2931 C  CG  . ARG C 3 96  ? -7.971  17.754  -20.908 1.00   12.59  ? 182  ARG C CG  1 
ATOM   2932 C  CD  . ARG C 3 96  ? -8.077  18.767  -22.042 1.00   13.66  ? 182  ARG C CD  1 
ATOM   2933 N  NE  . ARG C 3 96  ? -6.748  19.289  -22.348 1.00   14.11  ? 182  ARG C NE  1 
ATOM   2934 C  CZ  . ARG C 3 96  ? -6.430  20.012  -23.421 1.00   15.85  ? 182  ARG C CZ  1 
ATOM   2935 N  NH1 . ARG C 3 96  ? -7.354  20.329  -24.316 1.00   13.61  ? 182  ARG C NH1 1 
ATOM   2936 N  NH2 . ARG C 3 96  ? -5.171  20.411  -23.599 1.00   14.99  ? 182  ARG C NH2 1 
ATOM   2937 N  N   . LEU C 3 97  ? -8.627  16.577  -17.388 1.00   12.64  ? 183  LEU C N   1 
ATOM   2938 C  CA  . LEU C 3 97  ? -8.987  17.140  -16.071 1.00   13.20  ? 183  LEU C CA  1 
ATOM   2939 C  C   . LEU C 3 97  ? -8.224  18.411  -15.692 1.00   14.12  ? 183  LEU C C   1 
ATOM   2940 O  O   . LEU C 3 97  ? -7.040  18.546  -16.006 1.00   14.79  ? 183  LEU C O   1 
ATOM   2941 C  CB  . LEU C 3 97  ? -8.735  16.105  -14.971 1.00   12.27  ? 183  LEU C CB  1 
ATOM   2942 C  CG  . LEU C 3 97  ? -9.502  14.780  -14.994 1.00   11.73  ? 183  LEU C CG  1 
ATOM   2943 C  CD1 . LEU C 3 97  ? -8.952  13.848  -13.927 1.00   11.48  ? 183  LEU C CD1 1 
ATOM   2944 C  CD2 . LEU C 3 97  ? -10.968 15.032  -14.767 1.00   11.69  ? 183  LEU C CD2 1 
ATOM   2945 N  N   . GLN C 3 98  ? -8.897  19.304  -14.966 1.00   14.91  ? 184  GLN C N   1 
ATOM   2946 C  CA  . GLN C 3 98  ? -8.274  20.493  -14.380 1.00   15.67  ? 184  GLN C CA  1 
ATOM   2947 C  C   . GLN C 3 98  ? -7.869  20.212  -12.923 1.00   15.42  ? 184  GLN C C   1 
ATOM   2948 O  O   . GLN C 3 98  ? -8.452  19.347  -12.266 1.00   14.40  ? 184  GLN C O   1 
ATOM   2949 C  CB  . GLN C 3 98  ? -9.242  21.695  -14.429 1.00   16.86  ? 184  GLN C CB  1 
ATOM   2950 C  CG  . GLN C 3 98  ? -9.862  22.012  -15.812 1.00   20.13  ? 184  GLN C CG  1 
ATOM   2951 C  CD  . GLN C 3 98  ? -11.355 21.640  -15.925 1.00   22.55  ? 184  GLN C CD  1 
ATOM   2952 O  OE1 . GLN C 3 98  ? -12.099 21.659  -14.938 1.00   24.31  ? 184  GLN C OE1 1 
ATOM   2953 N  NE2 . GLN C 3 98  ? -11.790 21.315  -17.136 1.00   23.44  ? 184  GLN C NE2 1 
ATOM   2954 N  N   . VAL C 3 99  ? -6.883  20.954  -12.419 1.00   15.28  ? 185  VAL C N   1 
ATOM   2955 C  CA  . VAL C 3 99  ? -6.441  20.837  -11.029 1.00   14.50  ? 185  VAL C CA  1 
ATOM   2956 C  C   . VAL C 3 99  ? -7.652  20.873  -10.087 1.00   14.61  ? 185  VAL C C   1 
ATOM   2957 O  O   . VAL C 3 99  ? -8.534  21.714  -10.252 1.00   15.16  ? 185  VAL C O   1 
ATOM   2958 C  CB  . VAL C 3 99  ? -5.450  21.978  -10.658 1.00   14.83  ? 185  VAL C CB  1 
ATOM   2959 C  CG1 . VAL C 3 99  ? -5.175  22.022  -9.136  1.00   14.15  ? 185  VAL C CG1 1 
ATOM   2960 C  CG2 . VAL C 3 99  ? -4.147  21.838  -11.434 1.00   15.02  ? 185  VAL C CG2 1 
ATOM   2961 N  N   . GLY C 3 100 ? -7.714  19.949  -9.127  1.00   14.04  ? 186  GLY C N   1 
ATOM   2962 C  CA  . GLY C 3 100 ? -8.777  19.972  -8.108  1.00   13.86  ? 186  GLY C CA  1 
ATOM   2963 C  C   . GLY C 3 100 ? -10.040 19.180  -8.436  1.00   13.82  ? 186  GLY C C   1 
ATOM   2964 O  O   . GLY C 3 100 ? -10.906 18.978  -7.573  1.00   13.50  ? 186  GLY C O   1 
ATOM   2965 N  N   . GLU C 3 101 ? -10.153 18.735  -9.684  1.00   13.57  ? 187  GLU C N   1 
ATOM   2966 C  CA  . GLU C 3 101 ? -11.243 17.850  -10.079 1.00   13.23  ? 187  GLU C CA  1 
ATOM   2967 C  C   . GLU C 3 101 ? -11.128 16.486  -9.401  1.00   12.94  ? 187  GLU C C   1 
ATOM   2968 O  O   . GLU C 3 101 ? -10.030 15.903  -9.293  1.00   11.08  ? 187  GLU C O   1 
ATOM   2969 C  CB  . GLU C 3 101 ? -11.272 17.649  -11.602 1.00   14.18  ? 187  GLU C CB  1 
ATOM   2970 C  CG  . GLU C 3 101 ? -11.626 18.883  -12.393 1.00   15.44  ? 187  GLU C CG  1 
ATOM   2971 C  CD  . GLU C 3 101 ? -12.308 18.549  -13.690 1.00   16.43  ? 187  GLU C CD  1 
ATOM   2972 O  OE1 . GLU C 3 101 ? -13.460 18.056  -13.634 1.00   18.27  ? 187  GLU C OE1 1 
ATOM   2973 O  OE2 . GLU C 3 101 ? -11.702 18.775  -14.761 1.00   15.86  ? 187  GLU C OE2 1 
ATOM   2974 N  N   . GLU C 3 102 ? -12.280 15.980  -8.967  1.00   12.12  ? 188  GLU C N   1 
ATOM   2975 C  CA  . GLU C 3 102 ? -12.367 14.699  -8.295  1.00   12.04  ? 188  GLU C CA  1 
ATOM   2976 C  C   . GLU C 3 102 ? -12.949 13.621  -9.210  1.00   11.21  ? 188  GLU C C   1 
ATOM   2977 O  O   . GLU C 3 102 ? -13.897 13.876  -9.950  1.00   11.37  ? 188  GLU C O   1 
ATOM   2978 C  CB  . GLU C 3 102 ? -13.243 14.837  -7.051  1.00   12.41  ? 188  GLU C CB  1 
ATOM   2979 C  CG  . GLU C 3 102 ? -12.717 15.861  -6.060  1.00   15.15  ? 188  GLU C CG  1 
ATOM   2980 C  CD  . GLU C 3 102 ? -13.612 16.015  -4.845  1.00   16.31  ? 188  GLU C CD  1 
ATOM   2981 O  OE1 . GLU C 3 102 ? -14.855 15.980  -5.004  1.00   16.89  ? 188  GLU C OE1 1 
ATOM   2982 O  OE2 . GLU C 3 102 ? -13.070 16.173  -3.732  1.00   17.28  ? 188  GLU C OE2 1 
ATOM   2983 N  N   . VAL C 3 103 ? -12.370 12.424  -9.142  1.00   10.08  ? 189  VAL C N   1 
ATOM   2984 C  CA  . VAL C 3 103 ? -12.885 11.261  -9.839  1.00   9.99   ? 189  VAL C CA  1 
ATOM   2985 C  C   . VAL C 3 103 ? -13.086 10.102  -8.862  1.00   9.98   ? 189  VAL C C   1 
ATOM   2986 O  O   . VAL C 3 103 ? -12.268 9.880   -7.972  1.00   9.47   ? 189  VAL C O   1 
ATOM   2987 C  CB  . VAL C 3 103 ? -11.938 10.820  -10.974 1.00   9.97   ? 189  VAL C CB  1 
ATOM   2988 C  CG1 . VAL C 3 103 ? -12.419 9.525   -11.579 1.00   10.17  ? 189  VAL C CG1 1 
ATOM   2989 C  CG2 . VAL C 3 103 ? -11.834 11.929  -12.032 1.00   8.92   ? 189  VAL C CG2 1 
ATOM   2990 N  N   . TRP C 3 104 ? -14.188 9.380   -9.019  1.00   9.12   ? 190  TRP C N   1 
ATOM   2991 C  CA  . TRP C 3 104 ? -14.432 8.236   -8.168  1.00   8.95   ? 190  TRP C CA  1 
ATOM   2992 C  C   . TRP C 3 104 ? -15.395 7.277   -8.811  1.00   8.37   ? 190  TRP C C   1 
ATOM   2993 O  O   . TRP C 3 104 ? -16.046 7.615   -9.795  1.00   8.13   ? 190  TRP C O   1 
ATOM   2994 C  CB  . TRP C 3 104 ? -14.978 8.684   -6.806  1.00   8.42   ? 190  TRP C CB  1 
ATOM   2995 C  CG  . TRP C 3 104 ? -16.353 9.327   -6.832  1.00   8.17   ? 190  TRP C CG  1 
ATOM   2996 C  CD1 . TRP C 3 104 ? -17.559 8.693   -6.695  1.00   9.39   ? 190  TRP C CD1 1 
ATOM   2997 C  CD2 . TRP C 3 104 ? -16.652 10.727  -6.949  1.00   7.48   ? 190  TRP C CD2 1 
ATOM   2998 N  NE1 . TRP C 3 104 ? -18.583 9.604   -6.732  1.00   8.32   ? 190  TRP C NE1 1 
ATOM   2999 C  CE2 . TRP C 3 104 ? -18.056 10.861  -6.883  1.00   8.71   ? 190  TRP C CE2 1 
ATOM   3000 C  CE3 . TRP C 3 104 ? -15.871 11.874  -7.117  1.00   8.40   ? 190  TRP C CE3 1 
ATOM   3001 C  CZ2 . TRP C 3 104 ? -18.702 12.103  -6.975  1.00   9.00   ? 190  TRP C CZ2 1 
ATOM   3002 C  CZ3 . TRP C 3 104 ? -16.511 13.112  -7.208  1.00   9.29   ? 190  TRP C CZ3 1 
ATOM   3003 C  CH2 . TRP C 3 104 ? -17.914 13.213  -7.132  1.00   9.39   ? 190  TRP C CH2 1 
ATOM   3004 N  N   . LEU C 3 105 ? -15.481 6.083   -8.228  1.00   7.71   ? 191  LEU C N   1 
ATOM   3005 C  CA  . LEU C 3 105 ? -16.427 5.061   -8.641  1.00   6.84   ? 191  LEU C CA  1 
ATOM   3006 C  C   . LEU C 3 105 ? -17.497 4.864   -7.562  1.00   6.88   ? 191  LEU C C   1 
ATOM   3007 O  O   . LEU C 3 105 ? -17.230 5.004   -6.362  1.00   5.68   ? 191  LEU C O   1 
ATOM   3008 C  CB  . LEU C 3 105 ? -15.700 3.729   -8.869  1.00   7.62   ? 191  LEU C CB  1 
ATOM   3009 C  CG  . LEU C 3 105 ? -14.548 3.605   -9.880  1.00   8.16   ? 191  LEU C CG  1 
ATOM   3010 C  CD1 . LEU C 3 105 ? -14.077 2.157   -9.991  1.00   8.31   ? 191  LEU C CD1 1 
ATOM   3011 C  CD2 . LEU C 3 105 ? -14.952 4.120   -11.250 1.00   6.43   ? 191  LEU C CD2 1 
ATOM   3012 N  N   . ALA C 3 106 ? -18.703 4.524   -8.002  1.00   6.88   ? 192  ALA C N   1 
ATOM   3013 C  CA  . ALA C 3 106 ? -19.837 4.312   -7.112  1.00   7.96   ? 192  ALA C CA  1 
ATOM   3014 C  C   . ALA C 3 106 ? -20.648 3.119   -7.610  1.00   8.81   ? 192  ALA C C   1 
ATOM   3015 O  O   . ALA C 3 106 ? -20.483 2.679   -8.762  1.00   8.02   ? 192  ALA C O   1 
ATOM   3016 C  CB  . ALA C 3 106 ? -20.714 5.563   -7.081  1.00   7.67   ? 192  ALA C CB  1 
ATOM   3017 N  N   . VAL C 3 107 ? -21.525 2.604   -6.756  1.00   9.07   ? 193  VAL C N   1 
ATOM   3018 C  CA  . VAL C 3 107 ? -22.493 1.595   -7.179  1.00   9.36   ? 193  VAL C CA  1 
ATOM   3019 C  C   . VAL C 3 107 ? -23.906 2.151   -7.058  1.00   10.10  ? 193  VAL C C   1 
ATOM   3020 O  O   . VAL C 3 107 ? -24.125 3.216   -6.472  1.00   9.86   ? 193  VAL C O   1 
ATOM   3021 C  CB  . VAL C 3 107 ? -22.392 0.286   -6.345  1.00   9.06   ? 193  VAL C CB  1 
ATOM   3022 C  CG1 . VAL C 3 107 ? -21.049 -0.372  -6.540  1.00   9.03   ? 193  VAL C CG1 1 
ATOM   3023 C  CG2 . VAL C 3 107 ? -22.622 0.574   -4.854  1.00   10.40  ? 193  VAL C CG2 1 
ATOM   3024 N  N   . ASN C 3 108 ? -24.874 1.431   -7.607  1.00   11.00  ? 194  ASN C N   1 
ATOM   3025 C  CA  . ASN C 3 108 ? -26.258 1.819   -7.431  1.00   11.69  ? 194  ASN C CA  1 
ATOM   3026 C  C   . ASN C 3 108 ? -26.988 0.813   -6.544  1.00   11.87  ? 194  ASN C C   1 
ATOM   3027 O  O   . ASN C 3 108 ? -26.508 0.497   -5.455  1.00   12.44  ? 194  ASN C O   1 
ATOM   3028 C  CB  . ASN C 3 108 ? -26.961 2.069   -8.783  1.00   11.89  ? 194  ASN C CB  1 
ATOM   3029 C  CG  . ASN C 3 108 ? -26.846 0.898   -9.739  1.00   10.62  ? 194  ASN C CG  1 
ATOM   3030 O  OD1 . ASN C 3 108 ? -26.674 -0.242  -9.331  1.00   11.17  ? 194  ASN C OD1 1 
ATOM   3031 N  ND2 . ASN C 3 108 ? -26.948 1.184   -11.029 1.00   11.81  ? 194  ASN C ND2 1 
ATOM   3032 N  N   . ASP C 3 109 ? -28.145 0.320   -6.973  1.00   11.78  ? 195  ASP C N   1 
ATOM   3033 C  CA  . ASP C 3 109 ? -28.850 -0.676  -6.154  1.00   12.67  ? 195  ASP C CA  1 
ATOM   3034 C  C   . ASP C 3 109 ? -28.246 -2.064  -6.379  1.00   12.64  ? 195  ASP C C   1 
ATOM   3035 O  O   . ASP C 3 109 ? -28.463 -2.980  -5.585  1.00   11.94  ? 195  ASP C O   1 
ATOM   3036 C  CB  . ASP C 3 109 ? -30.367 -0.672  -6.426  1.00   12.50  ? 195  ASP C CB  1 
ATOM   3037 C  CG  . ASP C 3 109 ? -31.053 0.621   -5.956  1.00   14.57  ? 195  ASP C CG  1 
ATOM   3038 O  OD1 . ASP C 3 109 ? -30.874 1.010   -4.778  1.00   15.13  ? 195  ASP C OD1 1 
ATOM   3039 O  OD2 . ASP C 3 109 ? -31.784 1.246   -6.759  1.00   15.48  ? 195  ASP C OD2 1 
ATOM   3040 N  N   . TYR C 3 110 ? -27.520 -2.215  -7.491  1.00   12.92  ? 196  TYR C N   1 
ATOM   3041 C  CA  . TYR C 3 110 ? -26.744 -3.422  -7.772  1.00   12.42  ? 196  TYR C CA  1 
ATOM   3042 C  C   . TYR C 3 110 ? -25.307 -3.136  -7.310  1.00   12.56  ? 196  TYR C C   1 
ATOM   3043 O  O   . TYR C 3 110 ? -24.557 -2.427  -7.987  1.00   11.48  ? 196  TYR C O   1 
ATOM   3044 C  CB  . TYR C 3 110 ? -26.778 -3.759  -9.272  1.00   12.45  ? 196  TYR C CB  1 
ATOM   3045 C  CG  . TYR C 3 110 ? -28.137 -4.208  -9.807  1.00   12.06  ? 196  TYR C CG  1 
ATOM   3046 C  CD1 . TYR C 3 110 ? -28.424 -4.152  -11.178 1.00   12.38  ? 196  TYR C CD1 1 
ATOM   3047 C  CD2 . TYR C 3 110 ? -29.127 -4.684  -8.950  1.00   12.62  ? 196  TYR C CD2 1 
ATOM   3048 C  CE1 . TYR C 3 110 ? -29.662 -4.568  -11.680 1.00   10.43  ? 196  TYR C CE1 1 
ATOM   3049 C  CE2 . TYR C 3 110 ? -30.362 -5.103  -9.433  1.00   11.66  ? 196  TYR C CE2 1 
ATOM   3050 C  CZ  . TYR C 3 110 ? -30.623 -5.037  -10.802 1.00   11.51  ? 196  TYR C CZ  1 
ATOM   3051 O  OH  . TYR C 3 110 ? -31.835 -5.454  -11.279 1.00   9.58   ? 196  TYR C OH  1 
ATOM   3052 N  N   . TYR C 3 111 ? -24.936 -3.681  -6.153  1.00   13.02  ? 197  TYR C N   1 
ATOM   3053 C  CA  . TYR C 3 111 ? -23.741 -3.223  -5.435  1.00   14.39  ? 197  TYR C CA  1 
ATOM   3054 C  C   . TYR C 3 111 ? -22.717 -4.311  -5.070  1.00   14.49  ? 197  TYR C C   1 
ATOM   3055 O  O   . TYR C 3 111 ? -21.718 -4.033  -4.399  1.00   13.99  ? 197  TYR C O   1 
ATOM   3056 C  CB  . TYR C 3 111 ? -24.180 -2.515  -4.151  1.00   15.29  ? 197  TYR C CB  1 
ATOM   3057 C  CG  . TYR C 3 111 ? -24.927 -3.412  -3.190  1.00   17.36  ? 197  TYR C CG  1 
ATOM   3058 C  CD1 . TYR C 3 111 ? -24.266 -4.039  -2.137  1.00   19.53  ? 197  TYR C CD1 1 
ATOM   3059 C  CD2 . TYR C 3 111 ? -26.292 -3.633  -3.331  1.00   18.22  ? 197  TYR C CD2 1 
ATOM   3060 C  CE1 . TYR C 3 111 ? -24.944 -4.862  -1.250  1.00   20.66  ? 197  TYR C CE1 1 
ATOM   3061 C  CE2 . TYR C 3 111 ? -26.981 -4.454  -2.453  1.00   19.96  ? 197  TYR C CE2 1 
ATOM   3062 C  CZ  . TYR C 3 111 ? -26.304 -5.065  -1.413  1.00   21.13  ? 197  TYR C CZ  1 
ATOM   3063 O  OH  . TYR C 3 111 ? -26.986 -5.880  -0.529  1.00   22.23  ? 197  TYR C OH  1 
ATOM   3064 N  N   . ASP C 3 112 ? -22.955 -5.542  -5.498  1.00   14.50  ? 198  ASP C N   1 
ATOM   3065 C  CA  . ASP C 3 112 ? -22.138 -6.655  -5.009  1.00   15.52  ? 198  ASP C CA  1 
ATOM   3066 C  C   . ASP C 3 112 ? -20.707 -6.565  -5.508  1.00   15.19  ? 198  ASP C C   1 
ATOM   3067 O  O   . ASP C 3 112 ? -20.482 -6.405  -6.700  1.00   15.57  ? 198  ASP C O   1 
ATOM   3068 C  CB  . ASP C 3 112 ? -22.753 -7.990  -5.417  1.00   15.31  ? 198  ASP C CB  1 
ATOM   3069 C  CG  . ASP C 3 112 ? -21.975 -9.174  -4.885  1.00   16.01  ? 198  ASP C CG  1 
ATOM   3070 O  OD1 . ASP C 3 112 ? -20.987 -9.581  -5.540  1.00   15.31  ? 198  ASP C OD1 1 
ATOM   3071 O  OD2 . ASP C 3 112 ? -22.365 -9.710  -3.823  1.00   13.88  ? 198  ASP C OD2 1 
ATOM   3072 N  N   . MET C 3 113 ? -19.742 -6.640  -4.592  1.00   15.78  ? 199  MET C N   1 
ATOM   3073 C  CA  . MET C 3 113 ? -18.328 -6.745  -4.982  1.00   15.55  ? 199  MET C CA  1 
ATOM   3074 C  C   . MET C 3 113 ? -17.640 -7.887  -4.255  1.00   15.68  ? 199  MET C C   1 
ATOM   3075 O  O   . MET C 3 113 ? -16.467 -7.802  -3.879  1.00   14.68  ? 199  MET C O   1 
ATOM   3076 C  CB  . MET C 3 113 ? -17.584 -5.435  -4.743  1.00   15.67  ? 199  MET C CB  1 
ATOM   3077 C  CG  . MET C 3 113 ? -17.981 -4.334  -5.703  1.00   15.52  ? 199  MET C CG  1 
ATOM   3078 S  SD  . MET C 3 113 ? -17.083 -2.816  -5.367  1.00   17.30  ? 199  MET C SD  1 
ATOM   3079 C  CE  . MET C 3 113 ? -15.614 -3.099  -6.341  1.00   15.73  ? 199  MET C CE  1 
ATOM   3080 N  N   . VAL C 3 114 ? -18.368 -8.977  -4.071  1.00   16.21  ? 200  VAL C N   1 
ATOM   3081 C  CA  . VAL C 3 114 ? -17.802 -10.105 -3.350  1.00   16.62  ? 200  VAL C CA  1 
ATOM   3082 C  C   . VAL C 3 114 ? -17.287 -11.156 -4.331  1.00   16.78  ? 200  VAL C C   1 
ATOM   3083 O  O   . VAL C 3 114 ? -18.044 -11.980 -4.838  1.00   16.61  ? 200  VAL C O   1 
ATOM   3084 C  CB  . VAL C 3 114 ? -18.802 -10.672 -2.329  1.00   16.75  ? 200  VAL C CB  1 
ATOM   3085 C  CG1 A VAL C 3 114 ? -18.180 -11.806 -1.522  0.50   15.89  ? 200  VAL C CG1 1 
ATOM   3086 C  CG1 B VAL C 3 114 ? -19.426 -9.530  -1.527  0.50   17.13  ? 200  VAL C CG1 1 
ATOM   3087 C  CG2 A VAL C 3 114 ? -19.315 -9.558  -1.418  0.50   16.89  ? 200  VAL C CG2 1 
ATOM   3088 C  CG2 B VAL C 3 114 ? -19.875 -11.473 -3.010  0.50   17.53  ? 200  VAL C CG2 1 
ATOM   3089 N  N   . GLY C 3 115 ? -15.989 -11.094 -4.615  1.00   16.72  ? 201  GLY C N   1 
ATOM   3090 C  CA  . GLY C 3 115 ? -15.358 -12.069 -5.503  1.00   16.99  ? 201  GLY C CA  1 
ATOM   3091 C  C   . GLY C 3 115 ? -15.054 -13.357 -4.763  1.00   16.92  ? 201  GLY C C   1 
ATOM   3092 O  O   . GLY C 3 115 ? -14.874 -13.360 -3.538  1.00   16.32  ? 201  GLY C O   1 
ATOM   3093 N  N   . ILE C 3 116 ? -15.019 -14.462 -5.493  1.00   17.39  ? 202  ILE C N   1 
ATOM   3094 C  CA  . ILE C 3 116 ? -14.600 -15.730 -4.897  1.00   18.04  ? 202  ILE C CA  1 
ATOM   3095 C  C   . ILE C 3 116 ? -13.140 -15.595 -4.493  1.00   18.50  ? 202  ILE C C   1 
ATOM   3096 O  O   . ILE C 3 116 ? -12.492 -14.587 -4.817  1.00   18.55  ? 202  ILE C O   1 
ATOM   3097 C  CB  . ILE C 3 116 ? -14.752 -16.911 -5.888  1.00   18.21  ? 202  ILE C CB  1 
ATOM   3098 C  CG1 . ILE C 3 116 ? -13.930 -16.646 -7.153  1.00   17.24  ? 202  ILE C CG1 1 
ATOM   3099 C  CG2 . ILE C 3 116 ? -16.228 -17.147 -6.209  1.00   18.47  ? 202  ILE C CG2 1 
ATOM   3100 C  CD1 . ILE C 3 116 ? -14.028 -17.719 -8.191  1.00   18.49  ? 202  ILE C CD1 1 
ATOM   3101 N  N   . GLN C 3 117 ? -12.626 -16.594 -3.777  1.00   18.53  ? 203  GLN C N   1 
ATOM   3102 C  CA  . GLN C 3 117 ? -11.203 -16.664 -3.492  1.00   19.00  ? 203  GLN C CA  1 
ATOM   3103 C  C   . GLN C 3 117 ? -10.411 -16.531 -4.790  1.00   18.21  ? 203  GLN C C   1 
ATOM   3104 O  O   . GLN C 3 117 ? -10.635 -17.275 -5.746  1.00   17.84  ? 203  GLN C O   1 
ATOM   3105 C  CB  . GLN C 3 117 ? -10.851 -17.987 -2.803  1.00   20.26  ? 203  GLN C CB  1 
ATOM   3106 C  CG  . GLN C 3 117 ? -11.042 -17.981 -1.288  1.00   22.22  ? 203  GLN C CG  1 
ATOM   3107 C  CD  . GLN C 3 117 ? -10.521 -19.258 -0.630  1.00   23.51  ? 203  GLN C CD  1 
ATOM   3108 O  OE1 . GLN C 3 117 ? -11.058 -20.347 -0.843  1.00   23.96  ? 203  GLN C OE1 1 
ATOM   3109 N  NE2 . GLN C 3 117 ? -9.471  -19.123 0.174   1.00   23.89  ? 203  GLN C NE2 1 
ATOM   3110 N  N   . GLY C 3 118 ? -9.496  -15.569 -4.818  1.00   17.02  ? 204  GLY C N   1 
ATOM   3111 C  CA  . GLY C 3 118 ? -8.595  -15.409 -5.946  1.00   16.09  ? 204  GLY C CA  1 
ATOM   3112 C  C   . GLY C 3 118 ? -9.147  -14.515 -7.033  1.00   15.33  ? 204  GLY C C   1 
ATOM   3113 O  O   . GLY C 3 118 ? -8.584  -14.445 -8.122  1.00   15.89  ? 204  GLY C O   1 
ATOM   3114 N  N   . SER C 3 119 ? -10.251 -13.828 -6.752  1.00   14.06  ? 205  SER C N   1 
ATOM   3115 C  CA  . SER C 3 119 ? -10.778 -12.858 -7.705  1.00   13.02  ? 205  SER C CA  1 
ATOM   3116 C  C   . SER C 3 119 ? -11.010 -11.513 -7.010  1.00   12.98  ? 205  SER C C   1 
ATOM   3117 O  O   . SER C 3 119 ? -11.854 -11.396 -6.123  1.00   12.63  ? 205  SER C O   1 
ATOM   3118 C  CB  . SER C 3 119 ? -12.056 -13.367 -8.365  1.00   12.08  ? 205  SER C CB  1 
ATOM   3119 O  OG  . SER C 3 119 ? -12.365 -12.599 -9.519  1.00   9.51   ? 205  SER C OG  1 
ATOM   3120 N  N   . ASP C 3 120 ? -10.271 -10.499 -7.451  1.00   12.76  ? 206  ASP C N   1 
ATOM   3121 C  CA  . ASP C 3 120 ? -10.182 -9.224  -6.748  1.00   12.06  ? 206  ASP C CA  1 
ATOM   3122 C  C   . ASP C 3 120 ? -10.813 -8.076  -7.539  1.00   10.93  ? 206  ASP C C   1 
ATOM   3123 O  O   . ASP C 3 120 ? -11.334 -8.278  -8.634  1.00   9.32   ? 206  ASP C O   1 
ATOM   3124 C  CB  . ASP C 3 120 ? -8.710  -8.912  -6.468  1.00   13.83  ? 206  ASP C CB  1 
ATOM   3125 C  CG  . ASP C 3 120 ? -8.029  -10.006 -5.663  1.00   16.65  ? 206  ASP C CG  1 
ATOM   3126 O  OD1 . ASP C 3 120 ? -7.004  -10.549 -6.131  1.00   17.97  ? 206  ASP C OD1 1 
ATOM   3127 O  OD2 . ASP C 3 120 ? -8.528  -10.335 -4.560  1.00   18.48  ? 206  ASP C OD2 1 
ATOM   3128 N  N   . SER C 3 121 ? -10.746 -6.873  -6.973  1.00   9.51   ? 207  SER C N   1 
ATOM   3129 C  CA  . SER C 3 121 ? -11.312 -5.681  -7.600  1.00   9.55   ? 207  SER C CA  1 
ATOM   3130 C  C   . SER C 3 121 ? -10.274 -4.574  -7.615  1.00   9.24   ? 207  SER C C   1 
ATOM   3131 O  O   . SER C 3 121 ? -9.678  -4.249  -6.577  1.00   8.27   ? 207  SER C O   1 
ATOM   3132 C  CB  . SER C 3 121 ? -12.571 -5.206  -6.865  1.00   9.21   ? 207  SER C CB  1 
ATOM   3133 O  OG  . SER C 3 121 ? -13.659 -6.079  -7.105  1.00   8.98   ? 207  SER C OG  1 
ATOM   3134 N  N   . VAL C 3 122 ? -10.049 -4.007  -8.798  1.00   8.51   ? 208  VAL C N   1 
ATOM   3135 C  CA  . VAL C 3 122 ? -8.985  -3.017  -8.976  1.00   8.33   ? 208  VAL C CA  1 
ATOM   3136 C  C   . VAL C 3 122 ? -9.504  -1.757  -9.686  1.00   8.25   ? 208  VAL C C   1 
ATOM   3137 O  O   . VAL C 3 122 ? -10.476 -1.818  -10.449 1.00   6.47   ? 208  VAL C O   1 
ATOM   3138 C  CB  . VAL C 3 122 ? -7.766  -3.634  -9.726  1.00   9.12   ? 208  VAL C CB  1 
ATOM   3139 C  CG1 A VAL C 3 122 ? -8.086  -3.897  -11.196 0.50   5.95   ? 208  VAL C CG1 1 
ATOM   3140 C  CG1 B VAL C 3 122 ? -6.775  -2.548  -10.146 0.50   9.58   ? 208  VAL C CG1 1 
ATOM   3141 C  CG2 A VAL C 3 122 ? -6.534  -2.742  -9.591  0.50   8.60   ? 208  VAL C CG2 1 
ATOM   3142 C  CG2 B VAL C 3 122 ? -7.086  -4.688  -8.859  0.50   9.69   ? 208  VAL C CG2 1 
ATOM   3143 N  N   . PHE C 3 123 ? -8.872  -0.617  -9.391  1.00   8.13   ? 209  PHE C N   1 
ATOM   3144 C  CA  . PHE C 3 123 ? -9.197  0.663   -10.016 1.00   7.74   ? 209  PHE C CA  1 
ATOM   3145 C  C   . PHE C 3 123 ? -7.873  1.349   -10.317 1.00   7.49   ? 209  PHE C C   1 
ATOM   3146 O  O   . PHE C 3 123 ? -7.078  1.560   -9.411  1.00   7.09   ? 209  PHE C O   1 
ATOM   3147 C  CB  . PHE C 3 123 ? -10.050 1.523   -9.068  1.00   8.59   ? 209  PHE C CB  1 
ATOM   3148 C  CG  . PHE C 3 123 ? -10.408 2.905   -9.614  1.00   9.02   ? 209  PHE C CG  1 
ATOM   3149 C  CD1 . PHE C 3 123 ? -10.552 3.129   -10.980 1.00   9.24   ? 209  PHE C CD1 1 
ATOM   3150 C  CD2 . PHE C 3 123 ? -10.629 3.968   -8.746  1.00   10.30  ? 209  PHE C CD2 1 
ATOM   3151 C  CE1 . PHE C 3 123 ? -10.890 4.379   -11.469 1.00   9.01   ? 209  PHE C CE1 1 
ATOM   3152 C  CE2 . PHE C 3 123 ? -10.970 5.222   -9.222  1.00   9.56   ? 209  PHE C CE2 1 
ATOM   3153 C  CZ  . PHE C 3 123 ? -11.094 5.431   -10.592 1.00   11.05  ? 209  PHE C CZ  1 
ATOM   3154 N  N   . SER C 3 124 ? -7.628  1.657   -11.588 1.00   6.47   ? 210  SER C N   1 
ATOM   3155 C  CA  . SER C 3 124 ? -6.401  2.347   -12.002 1.00   6.87   ? 210  SER C CA  1 
ATOM   3156 C  C   . SER C 3 124 ? -6.675  3.639   -12.774 1.00   7.07   ? 210  SER C C   1 
ATOM   3157 O  O   . SER C 3 124 ? -7.696  3.783   -13.465 1.00   5.52   ? 210  SER C O   1 
ATOM   3158 C  CB  . SER C 3 124 ? -5.519  1.438   -12.875 1.00   6.32   ? 210  SER C CB  1 
ATOM   3159 O  OG  . SER C 3 124 ? -5.190  0.249   -12.199 1.00   6.36   ? 210  SER C OG  1 
ATOM   3160 N  N   . GLY C 3 125 ? -5.736  4.570   -12.658 1.00   7.88   ? 211  GLY C N   1 
ATOM   3161 C  CA  . GLY C 3 125 ? -5.774  5.811   -13.412 1.00   8.76   ? 211  GLY C CA  1 
ATOM   3162 C  C   . GLY C 3 125 ? -4.371  6.336   -13.605 1.00   8.87   ? 211  GLY C C   1 
ATOM   3163 O  O   . GLY C 3 125 ? -3.535  6.216   -12.703 1.00   10.07  ? 211  GLY C O   1 
ATOM   3164 N  N   . PHE C 3 126 ? -4.083  6.875   -14.788 1.00   8.62   ? 212  PHE C N   1 
ATOM   3165 C  CA  . PHE C 3 126 ? -2.779  7.499   -15.036 1.00   8.93   ? 212  PHE C CA  1 
ATOM   3166 C  C   . PHE C 3 126 ? -2.809  8.677   -16.016 1.00   9.78   ? 212  PHE C C   1 
ATOM   3167 O  O   . PHE C 3 126 ? -3.642  8.732   -16.938 1.00   8.56   ? 212  PHE C O   1 
ATOM   3168 C  CB  . PHE C 3 126 ? -1.689  6.473   -15.440 1.00   8.81   ? 212  PHE C CB  1 
ATOM   3169 C  CG  . PHE C 3 126 ? -2.136  5.448   -16.450 1.00   10.42  ? 212  PHE C CG  1 
ATOM   3170 C  CD1 . PHE C 3 126 ? -2.023  5.697   -17.817 1.00   10.38  ? 212  PHE C CD1 1 
ATOM   3171 C  CD2 . PHE C 3 126 ? -2.639  4.221   -16.035 1.00   10.06  ? 212  PHE C CD2 1 
ATOM   3172 C  CE1 . PHE C 3 126 ? -2.431  4.749   -18.751 1.00   10.32  ? 212  PHE C CE1 1 
ATOM   3173 C  CE2 . PHE C 3 126 ? -3.040  3.276   -16.957 1.00   10.95  ? 212  PHE C CE2 1 
ATOM   3174 C  CZ  . PHE C 3 126 ? -2.940  3.539   -18.319 1.00   10.33  ? 212  PHE C CZ  1 
ATOM   3175 N  N   . LEU C 3 127 ? -1.881  9.610   -15.799 1.00   9.92   ? 213  LEU C N   1 
ATOM   3176 C  CA  . LEU C 3 127 ? -1.736  10.790  -16.637 1.00   11.00  ? 213  LEU C CA  1 
ATOM   3177 C  C   . LEU C 3 127 ? -0.989  10.436  -17.910 1.00   12.35  ? 213  LEU C C   1 
ATOM   3178 O  O   . LEU C 3 127 ? 0.141   9.940   -17.848 1.00   11.85  ? 213  LEU C O   1 
ATOM   3179 C  CB  . LEU C 3 127 ? -0.977  11.874  -15.884 1.00   10.20  ? 213  LEU C CB  1 
ATOM   3180 C  CG  . LEU C 3 127 ? -0.638  13.152  -16.653 1.00   10.85  ? 213  LEU C CG  1 
ATOM   3181 C  CD1 . LEU C 3 127 ? -1.905  13.901  -17.067 1.00   10.18  ? 213  LEU C CD1 1 
ATOM   3182 C  CD2 . LEU C 3 127 ? 0.273   14.029  -15.797 1.00   10.57  ? 213  LEU C CD2 1 
ATOM   3183 N  N   . LEU C 3 128 ? -1.623  10.690  -19.055 1.00   13.42  ? 214  LEU C N   1 
ATOM   3184 C  CA  . LEU C 3 128 ? -0.990  10.463  -20.348 1.00   15.25  ? 214  LEU C CA  1 
ATOM   3185 C  C   . LEU C 3 128 ? -0.366  11.736  -20.914 1.00   16.65  ? 214  LEU C C   1 
ATOM   3186 O  O   . LEU C 3 128 ? 0.821   11.735  -21.264 1.00   18.14  ? 214  LEU C O   1 
ATOM   3187 C  CB  . LEU C 3 128 ? -1.979  9.860   -21.353 1.00   15.13  ? 214  LEU C CB  1 
ATOM   3188 C  CG  . LEU C 3 128 ? -2.459  8.454   -20.985 1.00   15.61  ? 214  LEU C CG  1 
ATOM   3189 C  CD1 . LEU C 3 128 ? -3.700  8.099   -21.777 1.00   15.61  ? 214  LEU C CD1 1 
ATOM   3190 C  CD2 . LEU C 3 128 ? -1.352  7.427   -21.195 1.00   16.65  ? 214  LEU C CD2 1 
ATOM   3191 N  N   . PHE C 3 129 ? -1.156  12.809  -20.998 1.00   16.92  ? 215  PHE C N   1 
ATOM   3192 C  CA  . PHE C 3 129 ? -0.691  14.074  -21.573 1.00   17.30  ? 215  PHE C CA  1 
ATOM   3193 C  C   . PHE C 3 129 ? -0.894  15.237  -20.615 1.00   18.13  ? 215  PHE C C   1 
ATOM   3194 O  O   . PHE C 3 129 ? -2.017  15.699  -20.419 1.00   17.93  ? 215  PHE C O   1 
ATOM   3195 C  CB  . PHE C 3 129 ? -1.406  14.398  -22.895 1.00   16.71  ? 215  PHE C CB  1 
ATOM   3196 C  CG  . PHE C 3 129 ? -1.600  13.215  -23.792 1.00   16.99  ? 215  PHE C CG  1 
ATOM   3197 C  CD1 . PHE C 3 129 ? -0.523  12.439  -24.185 1.00   18.32  ? 215  PHE C CD1 1 
ATOM   3198 C  CD2 . PHE C 3 129 ? -2.858  12.889  -24.255 1.00   16.36  ? 215  PHE C CD2 1 
ATOM   3199 C  CE1 . PHE C 3 129 ? -0.703  11.351  -25.022 1.00   18.95  ? 215  PHE C CE1 1 
ATOM   3200 C  CE2 . PHE C 3 129 ? -3.045  11.815  -25.086 1.00   18.39  ? 215  PHE C CE2 1 
ATOM   3201 C  CZ  . PHE C 3 129 ? -1.967  11.034  -25.467 1.00   18.36  ? 215  PHE C CZ  1 
ATOM   3202 N  N   . PRO C 3 130 ? 0.198   15.718  -20.019 1.00   19.28  ? 216  PRO C N   1 
ATOM   3203 C  CA  . PRO C 3 130 ? 0.163   16.905  -19.185 1.00   20.50  ? 216  PRO C CA  1 
ATOM   3204 C  C   . PRO C 3 130 ? -0.151  18.172  -19.965 1.00   22.16  ? 216  PRO C C   1 
ATOM   3205 O  O   . PRO C 3 130 ? 0.216   18.299  -21.139 1.00   22.22  ? 216  PRO C O   1 
ATOM   3206 C  CB  . PRO C 3 130 ? 1.596   16.997  -18.651 1.00   20.44  ? 216  PRO C CB  1 
ATOM   3207 C  CG  . PRO C 3 130 ? 2.186   15.629  -18.844 1.00   20.64  ? 216  PRO C CG  1 
ATOM   3208 C  CD  . PRO C 3 130 ? 1.544   15.117  -20.079 1.00   20.19  ? 216  PRO C CD  1 
ATOM   3209 N  N   . ASP C 3 131 ? -0.847  19.099  -19.322 1.00   23.63  ? 217  ASP C N   1 
ATOM   3210 C  CA  . ASP C 3 131 ? -0.700  20.499  -19.693 1.00   25.65  ? 217  ASP C CA  1 
ATOM   3211 C  C   . ASP C 3 131 ? -0.516  21.343  -18.453 1.00   26.11  ? 217  ASP C C   1 
ATOM   3212 O  O   . ASP C 3 131 ? 0.358   21.016  -17.641 1.00   26.56  ? 217  ASP C O   1 
ATOM   3213 C  CB  . ASP C 3 131 ? -1.822  21.026  -20.601 1.00   26.45  ? 217  ASP C CB  1 
ATOM   3214 C  CG  . ASP C 3 131 ? -3.085  20.213  -20.511 1.00   26.54  ? 217  ASP C CG  1 
ATOM   3215 O  OD1 . ASP C 3 131 ? -3.730  20.229  -19.450 1.00   27.75  ? 217  ASP C OD1 1 
ATOM   3216 O  OD2 . ASP C 3 131 ? -3.444  19.573  -21.515 1.00   26.66  ? 217  ASP C OD2 1 
ATOM   3217 O  OXT . ASP C 3 131 ? -1.208  22.342  -18.247 1.00   26.65  ? 217  ASP C OXT 1 
ATOM   3218 N  N   . GLN D 1 1   ? -0.242  17.356  26.027  1.00   37.39  ? 90   GLN D N   1 
ATOM   3219 C  CA  . GLN D 1 1   ? -0.151  16.427  24.863  1.00   36.84  ? 90   GLN D CA  1 
ATOM   3220 C  C   . GLN D 1 1   ? -1.290  15.410  24.872  1.00   36.12  ? 90   GLN D C   1 
ATOM   3221 O  O   . GLN D 1 1   ? -1.756  14.997  25.940  1.00   36.18  ? 90   GLN D O   1 
ATOM   3222 C  CB  . GLN D 1 1   ? 1.199   15.700  24.863  1.00   37.20  ? 90   GLN D CB  1 
ATOM   3223 C  CG  . GLN D 1 1   ? 1.733   14.685  25.783  0.0000 20.00  ? 90   GLN D CG  1 
ATOM   3224 C  CD  . GLN D 1 1   ? 3.095   14.112  25.449  0.0000 20.00  ? 90   GLN D CD  1 
ATOM   3225 O  OE1 . GLN D 1 1   ? 4.078   14.844  25.339  0.0000 20.00  ? 90   GLN D OE1 1 
ATOM   3226 N  NE2 . GLN D 1 1   ? 3.157   12.795  25.289  0.0000 20.00  ? 90   GLN D NE2 1 
ATOM   3227 N  N   . PRO D 1 2   ? -1.743  15.002  23.676  1.00   34.91  ? 91   PRO D N   1 
ATOM   3228 C  CA  . PRO D 1 2   ? -2.789  13.982  23.572  1.00   33.59  ? 91   PRO D CA  1 
ATOM   3229 C  C   . PRO D 1 2   ? -2.287  12.608  24.018  1.00   31.96  ? 91   PRO D C   1 
ATOM   3230 O  O   . PRO D 1 2   ? -1.157  12.227  23.697  1.00   31.88  ? 91   PRO D O   1 
ATOM   3231 C  CB  . PRO D 1 2   ? -3.122  13.964  22.076  1.00   33.85  ? 91   PRO D CB  1 
ATOM   3232 C  CG  . PRO D 1 2   ? -1.911  14.535  21.389  1.00   34.68  ? 91   PRO D CG  1 
ATOM   3233 C  CD  . PRO D 1 2   ? -1.288  15.494  22.359  1.00   35.10  ? 91   PRO D CD  1 
ATOM   3234 N  N   . ARG D 1 3   ? -3.124  11.874  24.750  1.00   29.54  ? 92   ARG D N   1 
ATOM   3235 C  CA  . ARG D 1 3   ? -2.760  10.536  25.219  1.00   27.14  ? 92   ARG D CA  1 
ATOM   3236 C  C   . ARG D 1 3   ? -3.879  9.491   25.045  1.00   24.80  ? 92   ARG D C   1 
ATOM   3237 O  O   . ARG D 1 3   ? -4.134  8.700   25.954  1.00   24.51  ? 92   ARG D O   1 
ATOM   3238 C  CB  . ARG D 1 3   ? -2.329  10.594  26.686  1.00   26.89  ? 92   ARG D CB  1 
ATOM   3239 C  CG  . ARG D 1 3   ? -1.060  11.063  27.244  0.0000 20.00  ? 92   ARG D CG  1 
ATOM   3240 C  CD  . ARG D 1 3   ? -0.785  11.047  28.738  0.0000 20.00  ? 92   ARG D CD  1 
ATOM   3241 N  NE  . ARG D 1 3   ? -1.793  11.789  29.488  0.0000 20.00  ? 92   ARG D NE  1 
ATOM   3242 C  CZ  . ARG D 1 3   ? -1.842  11.852  30.815  0.0000 20.00  ? 92   ARG D CZ  1 
ATOM   3243 N  NH1 . ARG D 1 3   ? -0.938  11.212  31.544  0.0000 20.00  ? 92   ARG D NH1 1 
ATOM   3244 N  NH2 . ARG D 1 3   ? -2.798  12.555  31.411  0.0000 20.00  ? 92   ARG D NH2 1 
ATOM   3245 N  N   . PRO D 1 4   ? -4.539  9.476   23.872  1.00   22.27  ? 93   PRO D N   1 
ATOM   3246 C  CA  . PRO D 1 4   ? -5.690  8.599   23.676  1.00   20.73  ? 93   PRO D CA  1 
ATOM   3247 C  C   . PRO D 1 4   ? -5.290  7.131   23.569  1.00   18.97  ? 93   PRO D C   1 
ATOM   3248 O  O   . PRO D 1 4   ? -4.528  6.758   22.682  1.00   18.98  ? 93   PRO D O   1 
ATOM   3249 C  CB  . PRO D 1 4   ? -6.292  9.087   22.350  1.00   21.26  ? 93   PRO D CB  1 
ATOM   3250 C  CG  . PRO D 1 4   ? -5.580  10.371  22.034  1.00   21.63  ? 93   PRO D CG  1 
ATOM   3251 C  CD  . PRO D 1 4   ? -4.251  10.273  22.674  1.00   21.72  ? 93   PRO D CD  1 
ATOM   3252 N  N   . ALA D 1 5   ? -5.796  6.317   24.488  1.00   16.89  ? 94   ALA D N   1 
ATOM   3253 C  CA  . ALA D 1 5   ? -5.486  4.895   24.533  1.00   15.20  ? 94   ALA D CA  1 
ATOM   3254 C  C   . ALA D 1 5   ? -6.592  4.156   25.278  1.00   14.36  ? 94   ALA D C   1 
ATOM   3255 O  O   . ALA D 1 5   ? -7.093  4.635   26.302  1.00   14.41  ? 94   ALA D O   1 
ATOM   3256 C  CB  . ALA D 1 5   ? -4.148  4.670   25.219  1.00   14.66  ? 94   ALA D CB  1 
ATOM   3257 N  N   . PHE D 1 6   ? -6.975  2.985   24.788  1.00   12.78  ? 95   PHE D N   1 
ATOM   3258 C  CA  . PHE D 1 6   ? -8.012  2.220   25.480  1.00   12.04  ? 95   PHE D CA  1 
ATOM   3259 C  C   . PHE D 1 6   ? -7.799  0.722   25.357  1.00   10.81  ? 95   PHE D C   1 
ATOM   3260 O  O   . PHE D 1 6   ? -7.093  0.258   24.463  1.00   9.31   ? 95   PHE D O   1 
ATOM   3261 C  CB  . PHE D 1 6   ? -9.397  2.569   24.926  1.00   11.47  ? 95   PHE D CB  1 
ATOM   3262 C  CG  . PHE D 1 6   ? -9.729  1.844   23.662  1.00   10.84  ? 95   PHE D CG  1 
ATOM   3263 C  CD1 . PHE D 1 6   ? -10.464 0.665   23.692  1.00   10.68  ? 95   PHE D CD1 1 
ATOM   3264 C  CD2 . PHE D 1 6   ? -9.268  2.308   22.444  1.00   10.79  ? 95   PHE D CD2 1 
ATOM   3265 C  CE1 . PHE D 1 6   ? -10.743 -0.022  22.529  1.00   9.76   ? 95   PHE D CE1 1 
ATOM   3266 C  CE2 . PHE D 1 6   ? -9.556  1.620   21.267  1.00   9.87   ? 95   PHE D CE2 1 
ATOM   3267 C  CZ  . PHE D 1 6   ? -10.284 0.455   21.319  1.00   9.28   ? 95   PHE D CZ  1 
ATOM   3268 N  N   . SER D 1 7   ? -8.408  -0.015  26.285  1.00   10.38  ? 96   SER D N   1 
ATOM   3269 C  CA  . SER D 1 7   ? -8.635  -1.448  26.158  1.00   9.99   ? 96   SER D CA  1 
ATOM   3270 C  C   . SER D 1 7   ? -9.994  -1.757  26.774  1.00   11.06  ? 96   SER D C   1 
ATOM   3271 O  O   . SER D 1 7   ? -10.334 -1.242  27.844  1.00   11.52  ? 96   SER D O   1 
ATOM   3272 C  CB  . SER D 1 7   ? -7.573  -2.260  26.897  1.00   10.03  ? 96   SER D CB  1 
ATOM   3273 O  OG  . SER D 1 7   ? -6.371  -2.386  26.162  1.00   9.42   ? 96   SER D OG  1 
ATOM   3274 N  N   . ALA D 1 8   ? -10.764 -2.614  26.119  1.00   10.31  ? 97   ALA D N   1 
ATOM   3275 C  CA  . ALA D 1 8   ? -12.066 -2.986  26.640  1.00   11.59  ? 97   ALA D CA  1 
ATOM   3276 C  C   . ALA D 1 8   ? -12.271 -4.475  26.441  1.00   11.54  ? 97   ALA D C   1 
ATOM   3277 O  O   . ALA D 1 8   ? -11.754 -5.061  25.486  1.00   11.19  ? 97   ALA D O   1 
ATOM   3278 C  CB  . ALA D 1 8   ? -13.179 -2.183  25.948  1.00   10.24  ? 97   ALA D CB  1 
ATOM   3279 N  N   . ILE D 1 9   ? -13.019 -5.089  27.349  1.00   12.23  ? 98   ILE D N   1 
ATOM   3280 C  CA  . ILE D 1 9   ? -13.253 -6.522  27.279  1.00   12.83  ? 98   ILE D CA  1 
ATOM   3281 C  C   . ILE D 1 9   ? -14.740 -6.799  27.281  1.00   14.11  ? 98   ILE D C   1 
ATOM   3282 O  O   . ILE D 1 9   ? -15.539 -5.896  27.481  1.00   14.14  ? 98   ILE D O   1 
ATOM   3283 C  CB  . ILE D 1 9   ? -12.569 -7.263  28.437  1.00   13.11  ? 98   ILE D CB  1 
ATOM   3284 C  CG1 . ILE D 1 9   ? -13.307 -7.010  29.761  1.00   12.33  ? 98   ILE D CG1 1 
ATOM   3285 C  CG2 . ILE D 1 9   ? -11.096 -6.839  28.540  1.00   13.60  ? 98   ILE D CG2 1 
ATOM   3286 C  CD1 . ILE D 1 9   ? -12.666 -7.714  30.946  1.00   14.04  ? 98   ILE D CD1 1 
ATOM   3287 N  N   . ARG D 1 10  ? -15.109 -8.050  27.030  1.00   15.73  ? 99   ARG D N   1 
ATOM   3288 C  CA  . ARG D 1 10  ? -16.498 -8.470  27.090  1.00   17.13  ? 99   ARG D CA  1 
ATOM   3289 C  C   . ARG D 1 10  ? -16.829 -9.061  28.459  1.00   18.02  ? 99   ARG D C   1 
ATOM   3290 O  O   . ARG D 1 10  ? -16.008 -9.748  29.049  1.00   18.24  ? 99   ARG D O   1 
ATOM   3291 C  CB  . ARG D 1 10  ? -16.757 -9.535  26.023  1.00   17.20  ? 99   ARG D CB  1 
ATOM   3292 C  CG  . ARG D 1 10  ? -16.972 -8.990  24.616  1.00   17.46  ? 99   ARG D CG  1 
ATOM   3293 C  CD  . ARG D 1 10  ? -17.872 -9.916  23.833  1.00   17.89  ? 99   ARG D CD  1 
ATOM   3294 N  NE  . ARG D 1 10  ? -18.867 -9.140  23.111  1.00   20.30  ? 99   ARG D NE  1 
ATOM   3295 C  CZ  . ARG D 1 10  ? -20.003 -9.624  22.635  1.00   19.68  ? 99   ARG D CZ  1 
ATOM   3296 N  NH1 . ARG D 1 10  ? -20.312 -10.907 22.793  1.00   18.05  ? 99   ARG D NH1 1 
ATOM   3297 N  NH2 . ARG D 1 10  ? -20.831 -8.810  22.001  1.00   21.73  ? 99   ARG D NH2 1 
ATOM   3298 N  N   A ARG D 1 11  ? -18.034 -8.822  28.965  0.50   18.89  ? 100  ARG D N   1 
ATOM   3299 N  N   B ARG D 1 11  ? -18.029 -8.758  28.947  0.50   18.78  ? 100  ARG D N   1 
ATOM   3300 C  CA  A ARG D 1 11  ? -18.490 -9.548  30.158  0.50   20.02  ? 100  ARG D CA  1 
ATOM   3301 C  CA  B ARG D 1 11  ? -18.560 -9.337  30.177  0.50   19.84  ? 100  ARG D CA  1 
ATOM   3302 C  C   A ARG D 1 11  ? -19.994 -9.458  30.415  0.50   21.14  ? 100  ARG D C   1 
ATOM   3303 C  C   B ARG D 1 11  ? -20.071 -9.461  30.049  0.50   20.74  ? 100  ARG D C   1 
ATOM   3304 O  O   A ARG D 1 11  ? -20.571 -10.341 31.044  0.50   21.69  ? 100  ARG D O   1 
ATOM   3305 O  O   B ARG D 1 11  ? -20.602 -10.551 29.851  0.50   20.89  ? 100  ARG D O   1 
ATOM   3306 C  CB  A ARG D 1 11  ? -17.658 -9.196  31.407  0.50   19.75  ? 100  ARG D CB  1 
ATOM   3307 C  CB  B ARG D 1 11  ? -18.189 -8.487  31.396  0.50   19.60  ? 100  ARG D CB  1 
ATOM   3308 C  CG  A ARG D 1 11  ? -16.382 -10.059 31.527  0.50   19.09  ? 100  ARG D CG  1 
ATOM   3309 C  CG  B ARG D 1 11  ? -18.886 -8.912  32.686  0.50   20.03  ? 100  ARG D CG  1 
ATOM   3310 C  CD  A ARG D 1 11  ? -15.481 -9.680  32.694  0.50   18.69  ? 100  ARG D CD  1 
ATOM   3311 C  CD  B ARG D 1 11  ? -18.015 -8.674  33.912  0.50   21.12  ? 100  ARG D CD  1 
ATOM   3312 N  NE  A ARG D 1 11  ? -14.130 -10.235 32.545  0.50   17.46  ? 100  ARG D NE  1 
ATOM   3313 N  NE  B ARG D 1 11  ? -18.743 -8.936  35.153  0.50   21.99  ? 100  ARG D NE  1 
ATOM   3314 C  CZ  A ARG D 1 11  ? -13.213 -10.250 33.509  0.50   16.52  ? 100  ARG D CZ  1 
ATOM   3315 C  CZ  B ARG D 1 11  ? -18.170 -9.170  36.330  0.50   22.47  ? 100  ARG D CZ  1 
ATOM   3316 N  NH1 A ARG D 1 11  ? -13.497 -9.758  34.706  0.50   16.81  ? 100  ARG D NH1 1 
ATOM   3317 N  NH1 B ARG D 1 11  ? -16.849 -9.192  36.441  0.50   23.28  ? 100  ARG D NH1 1 
ATOM   3318 N  NH2 A ARG D 1 11  ? -12.013 -10.760 33.285  0.50   15.62  ? 100  ARG D NH2 1 
ATOM   3319 N  NH2 B ARG D 1 11  ? -18.921 -9.387  37.400  0.50   22.69  ? 100  ARG D NH2 1 
ATOM   3320 N  N   A ASN D 1 12  ? -20.623 -8.401  29.917  0.50   22.66  ? 101  ASN D N   1 
ATOM   3321 N  N   B ASN D 1 12  ? -20.763 -8.332  30.146  0.50   22.14  ? 101  ASN D N   1 
ATOM   3322 C  CA  A ASN D 1 12  ? -22.076 -8.293  29.943  0.50   24.03  ? 101  ASN D CA  1 
ATOM   3323 C  CA  B ASN D 1 12  ? -22.203 -8.312  29.949  0.50   23.54  ? 101  ASN D CA  1 
ATOM   3324 C  C   A ASN D 1 12  ? -22.553 -7.476  28.749  0.50   24.73  ? 101  ASN D C   1 
ATOM   3325 C  C   B ASN D 1 12  ? -22.569 -7.457  28.740  0.50   24.46  ? 101  ASN D C   1 
ATOM   3326 O  O   A ASN D 1 12  ? -23.289 -6.503  28.912  0.50   25.04  ? 101  ASN D O   1 
ATOM   3327 O  O   B ASN D 1 12  ? -23.237 -6.433  28.884  0.50   24.78  ? 101  ASN D O   1 
ATOM   3328 C  CB  A ASN D 1 12  ? -22.553 -7.656  31.253  0.50   24.33  ? 101  ASN D CB  1 
ATOM   3329 C  CB  B ASN D 1 12  ? -22.903 -7.780  31.206  0.50   23.52  ? 101  ASN D CB  1 
ATOM   3330 C  CG  A ASN D 1 12  ? -24.037 -7.880  31.511  0.50   25.01  ? 101  ASN D CG  1 
ATOM   3331 C  CG  B ASN D 1 12  ? -22.517 -8.545  32.464  0.50   23.96  ? 101  ASN D CG  1 
ATOM   3332 O  OD1 A ASN D 1 12  ? -24.639 -8.814  30.979  0.50   25.15  ? 101  ASN D OD1 1 
ATOM   3333 O  OD1 B ASN D 1 12  ? -22.584 -9.776  32.506  0.50   23.78  ? 101  ASN D OD1 1 
ATOM   3334 N  ND2 A ASN D 1 12  ? -24.633 -7.017  32.332  0.50   26.09  ? 101  ASN D ND2 1 
ATOM   3335 N  ND2 B ASN D 1 12  ? -22.116 -7.813  33.501  0.50   23.56  ? 101  ASN D ND2 1 
ATOM   3336 N  N   . PRO D 1 13  ? -22.127 -7.869  27.536  1.00   25.42  ? 102  PRO D N   1 
ATOM   3337 C  CA  . PRO D 1 13  ? -22.362 -7.036  26.357  1.00   26.09  ? 102  PRO D CA  1 
ATOM   3338 C  C   . PRO D 1 13  ? -23.803 -7.025  25.887  1.00   27.36  ? 102  PRO D C   1 
ATOM   3339 O  O   . PRO D 1 13  ? -24.472 -8.063  25.911  1.00   27.00  ? 102  PRO D O   1 
ATOM   3340 C  CB  . PRO D 1 13  ? -21.459 -7.665  25.289  1.00   26.28  ? 102  PRO D CB  1 
ATOM   3341 C  CG  . PRO D 1 13  ? -21.327 -9.089  25.697  1.00   26.16  ? 102  PRO D CG  1 
ATOM   3342 C  CD  . PRO D 1 13  ? -21.405 -9.111  27.204  1.00   25.19  ? 102  PRO D CD  1 
ATOM   3343 N  N   . PRO D 1 14  ? -24.291 -5.842  25.487  1.00   28.65  ? 103  PRO D N   1 
ATOM   3344 C  CA  . PRO D 1 14  ? -25.512 -5.789  24.696  1.00   29.41  ? 103  PRO D CA  1 
ATOM   3345 C  C   . PRO D 1 14  ? -25.275 -6.551  23.403  1.00   29.78  ? 103  PRO D C   1 
ATOM   3346 O  O   . PRO D 1 14  ? -24.204 -6.441  22.803  1.00   29.77  ? 103  PRO D O   1 
ATOM   3347 C  CB  . PRO D 1 14  ? -25.715 -4.294  24.419  1.00   29.51  ? 103  PRO D CB  1 
ATOM   3348 C  CG  . PRO D 1 14  ? -24.486 -3.600  24.888  1.00   29.57  ? 103  PRO D CG  1 
ATOM   3349 C  CD  . PRO D 1 14  ? -23.736 -4.512  25.794  1.00   28.98  ? 103  PRO D CD  1 
ATOM   3350 N  N   A MET D 1 15  ? -26.266 -7.329  22.985  0.50   30.30  ? 104  MET D N   1 
ATOM   3351 N  N   B MET D 1 15  ? -26.260 -7.339  22.986  0.50   29.92  ? 104  MET D N   1 
ATOM   3352 C  CA  A MET D 1 15  ? -26.130 -8.155  21.795  0.50   30.63  ? 104  MET D CA  1 
ATOM   3353 C  CA  B MET D 1 15  ? -26.113 -8.155  21.786  0.50   29.92  ? 104  MET D CA  1 
ATOM   3354 C  C   A MET D 1 15  ? -26.714 -7.445  20.587  0.50   30.19  ? 104  MET D C   1 
ATOM   3355 C  C   B MET D 1 15  ? -26.691 -7.444  20.575  0.50   29.77  ? 104  MET D C   1 
ATOM   3356 O  O   A MET D 1 15  ? -26.722 -6.214  20.523  0.50   30.77  ? 104  MET D O   1 
ATOM   3357 O  O   B MET D 1 15  ? -26.672 -6.213  20.497  0.50   30.37  ? 104  MET D O   1 
ATOM   3358 C  CB  A MET D 1 15  ? -26.810 -9.512  21.997  0.50   31.15  ? 104  MET D CB  1 
ATOM   3359 C  CB  B MET D 1 15  ? -26.770 -9.529  21.961  0.50   29.89  ? 104  MET D CB  1 
ATOM   3360 C  CG  A MET D 1 15  ? -26.302 -10.290 23.206  0.50   32.50  ? 104  MET D CG  1 
ATOM   3361 C  CG  B MET D 1 15  ? -28.285 -9.499  22.090  0.50   29.73  ? 104  MET D CG  1 
ATOM   3362 S  SD  A MET D 1 15  ? -24.570 -10.780 23.092  0.50   34.00  ? 104  MET D SD  1 
ATOM   3363 S  SD  B MET D 1 15  ? -29.047 -11.067 21.622  0.50   30.29  ? 104  MET D SD  1 
ATOM   3364 C  CE  A MET D 1 15  ? -24.613 -11.856 21.657  0.50   33.97  ? 104  MET D CE  1 
ATOM   3365 C  CE  B MET D 1 15  ? -28.598 -11.175 19.893  0.50   29.80  ? 104  MET D CE  1 
ATOM   3366 N  N   . GLY D 1 16  ? -27.190 -8.227  19.626  1.00   29.46  ? 105  GLY D N   1 
ATOM   3367 C  CA  . GLY D 1 16  ? -27.817 -7.684  18.435  1.00   28.52  ? 105  GLY D CA  1 
ATOM   3368 C  C   . GLY D 1 16  ? -26.885 -6.905  17.532  1.00   26.81  ? 105  GLY D C   1 
ATOM   3369 O  O   . GLY D 1 16  ? -25.971 -6.221  17.993  1.00   27.14  ? 105  GLY D O   1 
ATOM   3370 N  N   . GLY D 1 17  ? -27.134 -6.997  16.231  1.00   25.50  ? 106  GLY D N   1 
ATOM   3371 C  CA  . GLY D 1 17  ? -26.320 -6.293  15.267  1.00   22.37  ? 106  GLY D CA  1 
ATOM   3372 C  C   . GLY D 1 17  ? -24.966 -6.955  15.136  1.00   20.73  ? 106  GLY D C   1 
ATOM   3373 O  O   . GLY D 1 17  ? -24.642 -7.896  15.867  1.00   19.63  ? 106  GLY D O   1 
ATOM   3374 N  N   . ASN D 1 18  ? -24.168 -6.451  14.205  1.00   18.74  ? 107  ASN D N   1 
ATOM   3375 C  CA  . ASN D 1 18  ? -22.921 -7.102  13.859  1.00   18.42  ? 107  ASN D CA  1 
ATOM   3376 C  C   . ASN D 1 18  ? -21.701 -6.468  14.519  1.00   17.88  ? 107  ASN D C   1 
ATOM   3377 O  O   . ASN D 1 18  ? -20.605 -7.001  14.415  1.00   17.56  ? 107  ASN D O   1 
ATOM   3378 C  CB  . ASN D 1 18  ? -22.770 -7.164  12.336  1.00   17.96  ? 107  ASN D CB  1 
ATOM   3379 C  CG  . ASN D 1 18  ? -23.754 -8.126  11.707  1.00   18.22  ? 107  ASN D CG  1 
ATOM   3380 O  OD1 . ASN D 1 18  ? -24.092 -9.158  12.296  1.00   18.99  ? 107  ASN D OD1 1 
ATOM   3381 N  ND2 . ASN D 1 18  ? -24.238 -7.788  10.527  1.00   17.55  ? 107  ASN D ND2 1 
ATOM   3382 N  N   . VAL D 1 19  ? -21.913 -5.340  15.197  1.00   18.02  ? 108  VAL D N   1 
ATOM   3383 C  CA  . VAL D 1 19  ? -20.870 -4.691  15.997  1.00   18.18  ? 108  VAL D CA  1 
ATOM   3384 C  C   . VAL D 1 19  ? -20.706 -5.434  17.315  1.00   18.02  ? 108  VAL D C   1 
ATOM   3385 O  O   . VAL D 1 19  ? -21.686 -5.693  18.011  1.00   17.89  ? 108  VAL D O   1 
ATOM   3386 C  CB  . VAL D 1 19  ? -21.187 -3.200  16.268  1.00   18.19  ? 108  VAL D CB  1 
ATOM   3387 C  CG1 . VAL D 1 19  ? -20.177 -2.587  17.255  1.00   18.12  ? 108  VAL D CG1 1 
ATOM   3388 C  CG2 . VAL D 1 19  ? -21.192 -2.416  14.957  1.00   18.89  ? 108  VAL D CG2 1 
ATOM   3389 N  N   . VAL D 1 20  ? -19.470 -5.802  17.640  1.00   17.92  ? 109  VAL D N   1 
ATOM   3390 C  CA  . VAL D 1 20  ? -18.915 -6.326  18.721  0.0000 14.03  ? 109  VAL D CA  1 
ATOM   3391 C  C   . VAL D 1 20  ? -18.565 -5.316  19.823  1.00   12.48  ? 109  VAL D C   1 
ATOM   3392 O  O   . VAL D 1 20  ? -17.629 -4.520  19.879  1.00   12.05  ? 109  VAL D O   1 
ATOM   3393 C  CB  . VAL D 1 20  ? -17.667 -7.199  18.498  0.0000 14.24  ? 109  VAL D CB  1 
ATOM   3394 C  CG1 . VAL D 1 20  ? -17.310 -7.972  19.775  0.0000 13.74  ? 109  VAL D CG1 1 
ATOM   3395 C  CG2 . VAL D 1 20  ? -17.894 -8.155  17.336  0.0000 13.90  ? 109  VAL D CG2 1 
ATOM   3396 N  N   . ILE D 1 21  ? -19.535 -5.323  20.727  1.00   12.89  ? 110  ILE D N   1 
ATOM   3397 C  CA  . ILE D 1 21  ? -19.494 -4.392  21.846  1.00   13.07  ? 110  ILE D CA  1 
ATOM   3398 C  C   . ILE D 1 21  ? -18.673 -4.947  23.002  1.00   13.14  ? 110  ILE D C   1 
ATOM   3399 O  O   . ILE D 1 21  ? -19.034 -5.968  23.587  1.00   13.33  ? 110  ILE D O   1 
ATOM   3400 C  CB  . ILE D 1 21  ? -20.910 -4.033  22.330  1.00   13.41  ? 110  ILE D CB  1 
ATOM   3401 C  CG1 . ILE D 1 21  ? -21.678 -3.332  21.205  1.00   12.23  ? 110  ILE D CG1 1 
ATOM   3402 C  CG2 . ILE D 1 21  ? -20.841 -3.156  23.568  1.00   12.82  ? 110  ILE D CG2 1 
ATOM   3403 C  CD1 . ILE D 1 21  ? -23.118 -2.999  21.540  1.00   14.85  ? 110  ILE D CD1 1 
ATOM   3404 N  N   . PHE D 1 22  ? -17.558 -4.288  23.317  1.00   12.40  ? 111  PHE D N   1 
ATOM   3405 C  CA  . PHE D 1 22  ? -16.793 -4.639  24.506  1.00   12.57  ? 111  PHE D CA  1 
ATOM   3406 C  C   . PHE D 1 22  ? -17.227 -3.734  25.660  1.00   12.93  ? 111  PHE D C   1 
ATOM   3407 O  O   . PHE D 1 22  ? -16.800 -2.583  25.757  1.00   12.85  ? 111  PHE D O   1 
ATOM   3408 C  CB  . PHE D 1 22  ? -15.283 -4.532  24.245  1.00   11.88  ? 111  PHE D CB  1 
ATOM   3409 C  CG  . PHE D 1 22  ? -14.794 -5.420  23.131  1.00   11.06  ? 111  PHE D CG  1 
ATOM   3410 C  CD1 . PHE D 1 22  ? -15.007 -5.071  21.803  1.00   11.19  ? 111  PHE D CD1 1 
ATOM   3411 C  CD2 . PHE D 1 22  ? -14.119 -6.599  23.410  1.00   10.63  ? 111  PHE D CD2 1 
ATOM   3412 C  CE1 . PHE D 1 22  ? -14.559 -5.891  20.760  1.00   10.80  ? 111  PHE D CE1 1 
ATOM   3413 C  CE2 . PHE D 1 22  ? -13.667 -7.419  22.384  1.00   10.48  ? 111  PHE D CE2 1 
ATOM   3414 C  CZ  . PHE D 1 22  ? -13.889 -7.063  21.047  1.00   9.59   ? 111  PHE D CZ  1 
ATOM   3415 N  N   . ASP D 1 23  ? -18.070 -4.264  26.539  1.00   13.81  ? 112  ASP D N   1 
ATOM   3416 C  CA  . ASP D 1 23  ? -18.809 -3.422  27.495  1.00   14.73  ? 112  ASP D CA  1 
ATOM   3417 C  C   . ASP D 1 23  ? -18.028 -3.018  28.745  1.00   15.52  ? 112  ASP D C   1 
ATOM   3418 O  O   . ASP D 1 23  ? -18.389 -2.046  29.425  1.00   15.16  ? 112  ASP D O   1 
ATOM   3419 C  CB  . ASP D 1 23  ? -20.075 -4.142  27.928  1.00   15.85  ? 112  ASP D CB  1 
ATOM   3420 C  CG  . ASP D 1 23  ? -19.781 -5.493  28.518  1.00   17.43  ? 112  ASP D CG  1 
ATOM   3421 O  OD1 . ASP D 1 23  ? -19.450 -6.407  27.733  1.00   18.46  ? 112  ASP D OD1 1 
ATOM   3422 O  OD2 . ASP D 1 23  ? -19.853 -5.637  29.759  1.00   17.70  ? 112  ASP D OD2 1 
ATOM   3423 N  N   . THR D 1 24  ? -16.982 -3.773  29.068  1.00   15.07  ? 113  THR D N   1 
ATOM   3424 C  CA  . THR D 1 24  ? -16.222 -3.513  30.279  1.00   15.77  ? 113  THR D CA  1 
ATOM   3425 C  C   . THR D 1 24  ? -14.878 -2.859  29.962  1.00   16.12  ? 113  THR D C   1 
ATOM   3426 O  O   . THR D 1 24  ? -14.011 -3.464  29.326  1.00   16.07  ? 113  THR D O   1 
ATOM   3427 C  CB  . THR D 1 24  ? -16.042 -4.814  31.114  1.00   16.49  ? 113  THR D CB  1 
ATOM   3428 O  OG1 . THR D 1 24  ? -17.303 -5.183  31.687  1.00   15.16  ? 113  THR D OG1 1 
ATOM   3429 C  CG2 . THR D 1 24  ? -15.023 -4.621  32.229  1.00   15.02  ? 113  THR D CG2 1 
ATOM   3430 N  N   . VAL D 1 25  ? -14.723 -1.610  30.396  1.00   16.36  ? 114  VAL D N   1 
ATOM   3431 C  CA  . VAL D 1 25  ? -13.517 -0.835  30.113  1.00   16.56  ? 114  VAL D CA  1 
ATOM   3432 C  C   . VAL D 1 25  ? -12.389 -1.134  31.091  1.00   16.37  ? 114  VAL D C   1 
ATOM   3433 O  O   . VAL D 1 25  ? -12.589 -1.084  32.310  1.00   16.57  ? 114  VAL D O   1 
ATOM   3434 C  CB  . VAL D 1 25  ? -13.804 0.669   30.149  1.00   17.05  ? 114  VAL D CB  1 
ATOM   3435 C  CG1 . VAL D 1 25  ? -12.524 1.453   29.934  1.00   18.53  ? 114  VAL D CG1 1 
ATOM   3436 C  CG2 . VAL D 1 25  ? -14.828 1.036   29.096  1.00   18.25  ? 114  VAL D CG2 1 
ATOM   3437 N  N   . ILE D 1 26  ? -11.208 -1.444  30.555  1.00   15.73  ? 115  ILE D N   1 
ATOM   3438 C  CA  . ILE D 1 26  ? -10.008 -1.638  31.365  1.00   15.66  ? 115  ILE D CA  1 
ATOM   3439 C  C   . ILE D 1 26  ? -9.214  -0.331  31.452  1.00   15.95  ? 115  ILE D C   1 
ATOM   3440 O  O   . ILE D 1 26  ? -8.786  0.087   32.530  1.00   15.54  ? 115  ILE D O   1 
ATOM   3441 C  CB  . ILE D 1 26  ? -9.103  -2.751  30.794  1.00   15.67  ? 115  ILE D CB  1 
ATOM   3442 C  CG1 . ILE D 1 26  ? -9.857  -4.073  30.721  1.00   15.10  ? 115  ILE D CG1 1 
ATOM   3443 C  CG2 . ILE D 1 26  ? -7.842  -2.902  31.630  1.00   15.09  ? 115  ILE D CG2 1 
ATOM   3444 C  CD1 . ILE D 1 26  ? -10.443 -4.509  32.060  1.00   17.27  ? 115  ILE D CD1 1 
ATOM   3445 N  N   . THR D 1 27  ? -9.023  0.301   30.298  1.00   16.17  ? 116  THR D N   1 
ATOM   3446 C  CA  . THR D 1 27  ? -8.335  1.578   30.199  1.00   15.41  ? 116  THR D CA  1 
ATOM   3447 C  C   . THR D 1 27  ? -9.058  2.413   29.152  1.00   15.22  ? 116  THR D C   1 
ATOM   3448 O  O   . THR D 1 27  ? -9.626  1.868   28.212  1.00   14.08  ? 116  THR D O   1 
ATOM   3449 C  CB  . THR D 1 27  ? -6.855  1.386   29.801  1.00   15.37  ? 116  THR D CB  1 
ATOM   3450 O  OG1 . THR D 1 27  ? -6.195  0.583   30.790  1.00   15.16  ? 116  THR D OG1 1 
ATOM   3451 C  CG2 . THR D 1 27  ? -6.141  2.725   29.711  1.00   14.93  ? 116  THR D CG2 1 
ATOM   3452 N  N   . ASN D 1 28  ? -9.050  3.730   29.332  1.00   15.54  ? 117  ASN D N   1 
ATOM   3453 C  CA  . ASN D 1 28  ? -9.788  4.650   28.459  1.00   15.84  ? 117  ASN D CA  1 
ATOM   3454 C  C   . ASN D 1 28  ? -9.306  6.071   28.679  1.00   16.34  ? 117  ASN D C   1 
ATOM   3455 O  O   . ASN D 1 28  ? -10.078 6.938   29.104  1.00   16.47  ? 117  ASN D O   1 
ATOM   3456 C  CB  . ASN D 1 28  ? -11.289 4.579   28.752  1.00   15.08  ? 117  ASN D CB  1 
ATOM   3457 C  CG  . ASN D 1 28  ? -12.141 4.904   27.544  1.00   14.94  ? 117  ASN D CG  1 
ATOM   3458 O  OD1 . ASN D 1 28  ? -11.623 5.152   26.455  1.00   14.64  ? 117  ASN D OD1 1 
ATOM   3459 N  ND2 . ASN D 1 28  ? -13.461 4.892   27.726  1.00   14.27  ? 117  ASN D ND2 1 
ATOM   3460 N  N   . GLN D 1 29  ? -8.026  6.307   28.412  1.00   16.93  ? 118  GLN D N   1 
ATOM   3461 C  CA  . GLN D 1 29  ? -7.452  7.638   28.573  1.00   17.92  ? 118  GLN D CA  1 
ATOM   3462 C  C   . GLN D 1 29  ? -7.979  8.592   27.500  1.00   18.55  ? 118  GLN D C   1 
ATOM   3463 O  O   . GLN D 1 29  ? -7.902  8.297   26.304  1.00   18.63  ? 118  GLN D O   1 
ATOM   3464 C  CB  . GLN D 1 29  ? -5.926  7.586   28.556  1.00   18.33  ? 118  GLN D CB  1 
ATOM   3465 C  CG  . GLN D 1 29  ? -5.256  8.925   28.838  1.00   19.29  ? 118  GLN D CG  1 
ATOM   3466 C  CD  . GLN D 1 29  ? -5.483  9.410   30.260  1.00   21.49  ? 118  GLN D CD  1 
ATOM   3467 O  OE1 . GLN D 1 29  ? -5.569  8.613   31.197  1.00   21.95  ? 118  GLN D OE1 1 
ATOM   3468 N  NE2 . GLN D 1 29  ? -5.582  10.723  30.427  1.00   21.22  ? 118  GLN D NE2 1 
ATOM   3469 N  N   A GLU D 1 30  ? -8.494  9.737   27.948  0.62   18.66  ? 119  GLU D N   1 
ATOM   3470 N  N   B GLU D 1 30  ? -8.497  9.734   27.948  0.38   18.69  ? 119  GLU D N   1 
ATOM   3471 C  CA  A GLU D 1 30  ? -9.176  10.711  27.101  0.62   19.00  ? 119  GLU D CA  1 
ATOM   3472 C  CA  B GLU D 1 30  ? -9.177  10.704  27.092  0.38   19.00  ? 119  GLU D CA  1 
ATOM   3473 C  C   A GLU D 1 30  ? -10.604 10.267  26.792  0.62   18.79  ? 119  GLU D C   1 
ATOM   3474 C  C   B GLU D 1 30  ? -10.593 10.250  26.757  0.38   18.84  ? 119  GLU D C   1 
ATOM   3475 O  O   A GLU D 1 30  ? -11.359 10.987  26.146  0.62   19.55  ? 119  GLU D O   1 
ATOM   3476 O  O   B GLU D 1 30  ? -11.327 10.945  26.058  0.38   19.33  ? 119  GLU D O   1 
ATOM   3477 C  CB  A GLU D 1 30  ? -8.400  10.983  25.804  0.62   19.35  ? 119  GLU D CB  1 
ATOM   3478 C  CB  B GLU D 1 30  ? -8.385  10.986  25.810  0.38   19.29  ? 119  GLU D CB  1 
ATOM   3479 C  CG  A GLU D 1 30  ? -6.934  11.385  25.994  0.62   20.21  ? 119  GLU D CG  1 
ATOM   3480 C  CG  B GLU D 1 30  ? -7.050  11.678  26.038  0.38   20.07  ? 119  GLU D CG  1 
ATOM   3481 C  CD  A GLU D 1 30  ? -6.757  12.626  26.854  0.62   20.74  ? 119  GLU D CD  1 
ATOM   3482 C  CD  B GLU D 1 30  ? -6.633  12.546  24.868  0.38   20.41  ? 119  GLU D CD  1 
ATOM   3483 O  OE1 A GLU D 1 30  ? -7.655  13.496  26.867  0.62   21.43  ? 119  GLU D OE1 1 
ATOM   3484 O  OE1 B GLU D 1 30  ? -7.329  12.538  23.829  0.38   20.91  ? 119  GLU D OE1 1 
ATOM   3485 O  OE2 A GLU D 1 30  ? -5.707  12.735  27.517  0.62   21.50  ? 119  GLU D OE2 1 
ATOM   3486 O  OE2 B GLU D 1 30  ? -5.608  13.249  24.989  0.38   21.50  ? 119  GLU D OE2 1 
ATOM   3487 N  N   . GLU D 1 31  ? -10.972 9.080   27.261  1.00   18.82  ? 120  GLU D N   1 
ATOM   3488 C  CA  . GLU D 1 31  ? -12.307 8.527   27.021  1.00   18.66  ? 120  GLU D CA  1 
ATOM   3489 C  C   . GLU D 1 31  ? -12.747 8.464   25.548  1.00   17.70  ? 120  GLU D C   1 
ATOM   3490 O  O   . GLU D 1 31  ? -13.896 8.799   25.237  1.00   18.50  ? 120  GLU D O   1 
ATOM   3491 C  CB  . GLU D 1 31  ? -13.368 9.302   27.815  1.00   19.77  ? 120  GLU D CB  1 
ATOM   3492 C  CG  . GLU D 1 31  ? -13.332 9.101   29.318  1.00   21.44  ? 120  GLU D CG  1 
ATOM   3493 C  CD  . GLU D 1 31  ? -14.469 9.833   30.008  1.00   22.98  ? 120  GLU D CD  1 
ATOM   3494 O  OE1 . GLU D 1 31  ? -14.521 11.077  29.919  1.00   24.86  ? 120  GLU D OE1 1 
ATOM   3495 O  OE2 . GLU D 1 31  ? -15.316 9.167   30.636  1.00   24.51  ? 120  GLU D OE2 1 
ATOM   3496 N  N   . PRO D 1 32  ? -11.864 8.006   24.642  1.00   16.45  ? 121  PRO D N   1 
ATOM   3497 C  CA  . PRO D 1 32  ? -12.291 7.934   23.241  1.00   15.77  ? 121  PRO D CA  1 
ATOM   3498 C  C   . PRO D 1 32  ? -13.231 6.763   22.970  1.00   15.07  ? 121  PRO D C   1 
ATOM   3499 O  O   . PRO D 1 32  ? -13.961 6.787   21.979  1.00   15.62  ? 121  PRO D O   1 
ATOM   3500 C  CB  . PRO D 1 32  ? -10.977 7.707   22.489  1.00   15.76  ? 121  PRO D CB  1 
ATOM   3501 C  CG  . PRO D 1 32  ? -10.118 6.968   23.464  1.00   15.73  ? 121  PRO D CG  1 
ATOM   3502 C  CD  . PRO D 1 32  ? -10.484 7.516   24.826  1.00   16.20  ? 121  PRO D CD  1 
ATOM   3503 N  N   . TYR D 1 33  ? -13.208 5.742   23.826  1.00   13.89  ? 122  TYR D N   1 
ATOM   3504 C  CA  . TYR D 1 33  ? -13.997 4.532   23.561  1.00   13.59  ? 122  TYR D CA  1 
ATOM   3505 C  C   . TYR D 1 33  ? -15.338 4.516   24.300  1.00   14.44  ? 122  TYR D C   1 
ATOM   3506 O  O   . TYR D 1 33  ? -15.412 4.794   25.515  1.00   13.18  ? 122  TYR D O   1 
ATOM   3507 C  CB  . TYR D 1 33  ? -13.188 3.260   23.866  1.00   13.47  ? 122  TYR D CB  1 
ATOM   3508 C  CG  . TYR D 1 33  ? -13.991 1.977   23.713  1.00   12.86  ? 122  TYR D CG  1 
ATOM   3509 C  CD1 . TYR D 1 33  ? -14.205 1.407   22.461  1.00   11.27  ? 122  TYR D CD1 1 
ATOM   3510 C  CD2 . TYR D 1 33  ? -14.541 1.346   24.824  1.00   14.17  ? 122  TYR D CD2 1 
ATOM   3511 C  CE1 . TYR D 1 33  ? -14.936 0.247   22.322  1.00   12.08  ? 122  TYR D CE1 1 
ATOM   3512 C  CE2 . TYR D 1 33  ? -15.278 0.187   24.697  1.00   14.03  ? 122  TYR D CE2 1 
ATOM   3513 C  CZ  . TYR D 1 33  ? -15.471 -0.360  23.446  1.00   13.19  ? 122  TYR D CZ  1 
ATOM   3514 O  OH  . TYR D 1 33  ? -16.217 -1.512  23.333  1.00   13.32  ? 122  TYR D OH  1 
ATOM   3515 N  N   . GLN D 1 34  ? -16.391 4.182   23.559  1.00   14.82  ? 123  GLN D N   1 
ATOM   3516 C  CA  . GLN D 1 34  ? -17.746 4.139   24.099  1.00   16.51  ? 123  GLN D CA  1 
ATOM   3517 C  C   . GLN D 1 34  ? -18.192 2.708   24.350  1.00   16.28  ? 123  GLN D C   1 
ATOM   3518 O  O   . GLN D 1 34  ? -18.469 1.955   23.413  1.00   15.46  ? 123  GLN D O   1 
ATOM   3519 C  CB  . GLN D 1 34  ? -18.721 4.811   23.137  1.00   17.70  ? 123  GLN D CB  1 
ATOM   3520 C  CG  . GLN D 1 34  ? -18.462 6.288   22.914  1.00   21.95  ? 123  GLN D CG  1 
ATOM   3521 C  CD  . GLN D 1 34  ? -19.489 6.911   21.992  1.00   25.19  ? 123  GLN D CD  1 
ATOM   3522 O  OE1 . GLN D 1 34  ? -20.278 6.201   21.354  1.00   27.62  ? 123  GLN D OE1 1 
ATOM   3523 N  NE2 . GLN D 1 34  ? -19.492 8.245   21.913  1.00   26.54  ? 123  GLN D NE2 1 
ATOM   3524 N  N   . ASN D 1 35  ? -18.280 2.337   25.621  1.00   16.84  ? 124  ASN D N   1 
ATOM   3525 C  CA  . ASN D 1 35  ? -18.531 0.947   25.974  1.00   17.74  ? 124  ASN D CA  1 
ATOM   3526 C  C   . ASN D 1 35  ? -19.977 0.509   25.760  1.00   17.99  ? 124  ASN D C   1 
ATOM   3527 O  O   . ASN D 1 35  ? -20.290 -0.662  25.877  1.00   17.65  ? 124  ASN D O   1 
ATOM   3528 C  CB  . ASN D 1 35  ? -18.081 0.660   27.406  1.00   18.19  ? 124  ASN D CB  1 
ATOM   3529 C  CG  . ASN D 1 35  ? -19.036 1.212   28.435  1.00   18.78  ? 124  ASN D CG  1 
ATOM   3530 O  OD1 . ASN D 1 35  ? -19.109 2.417   28.649  1.00   18.41  ? 124  ASN D OD1 1 
ATOM   3531 N  ND2 . ASN D 1 35  ? -19.777 0.323   29.087  1.00   20.76  ? 124  ASN D ND2 1 
ATOM   3532 N  N   . HIS D 1 36  ? -20.856 1.449   25.427  1.00   19.29  ? 125  HIS D N   1 
ATOM   3533 C  CA  . HIS D 1 36  ? -22.253 1.104   25.180  1.00   20.12  ? 125  HIS D CA  1 
ATOM   3534 C  C   . HIS D 1 36  ? -22.485 0.668   23.729  1.00   19.80  ? 125  HIS D C   1 
ATOM   3535 O  O   . HIS D 1 36  ? -23.406 -0.103  23.443  1.00   19.63  ? 125  HIS D O   1 
ATOM   3536 C  CB  . HIS D 1 36  ? -23.173 2.278   25.554  1.00   21.36  ? 125  HIS D CB  1 
ATOM   3537 C  CG  . HIS D 1 36  ? -23.018 3.472   24.665  1.00   23.37  ? 125  HIS D CG  1 
ATOM   3538 N  ND1 . HIS D 1 36  ? -23.863 3.726   23.606  1.00   24.60  ? 125  HIS D ND1 1 
ATOM   3539 C  CD2 . HIS D 1 36  ? -22.108 4.474   24.668  1.00   24.58  ? 125  HIS D CD2 1 
ATOM   3540 C  CE1 . HIS D 1 36  ? -23.483 4.835   22.997  1.00   24.51  ? 125  HIS D CE1 1 
ATOM   3541 N  NE2 . HIS D 1 36  ? -22.418 5.307   23.620  1.00   24.62  ? 125  HIS D NE2 1 
ATOM   3542 N  N   . SER D 1 37  ? -21.632 1.142   22.824  1.00   18.99  ? 126  SER D N   1 
ATOM   3543 C  CA  . SER D 1 37  ? -21.815 0.920   21.391  1.00   18.45  ? 126  SER D CA  1 
ATOM   3544 C  C   . SER D 1 37  ? -20.635 0.175   20.774  1.00   17.80  ? 126  SER D C   1 
ATOM   3545 O  O   . SER D 1 37  ? -20.702 -0.262  19.618  1.00   16.57  ? 126  SER D O   1 
ATOM   3546 C  CB  . SER D 1 37  ? -21.967 2.258   20.669  1.00   19.04  ? 126  SER D CB  1 
ATOM   3547 O  OG  . SER D 1 37  ? -20.697 2.885   20.516  1.00   19.81  ? 126  SER D OG  1 
ATOM   3548 N  N   . GLY D 1 38  ? -19.549 0.061   21.534  1.00   16.47  ? 127  GLY D N   1 
ATOM   3549 C  CA  . GLY D 1 38  ? -18.337 -0.596  21.046  1.00   16.19  ? 127  GLY D CA  1 
ATOM   3550 C  C   . GLY D 1 38  ? -17.569 0.209   20.005  1.00   16.27  ? 127  GLY D C   1 
ATOM   3551 O  O   . GLY D 1 38  ? -16.776 -0.344  19.243  1.00   16.05  ? 127  GLY D O   1 
ATOM   3552 N  N   . ARG D 1 39  ? -17.783 1.518   19.984  1.00   15.90  ? 128  ARG D N   1 
ATOM   3553 C  CA  . ARG D 1 39  ? -17.139 2.372   18.990  1.00   16.15  ? 128  ARG D CA  1 
ATOM   3554 C  C   . ARG D 1 39  ? -16.112 3.310   19.601  1.00   15.91  ? 128  ARG D C   1 
ATOM   3555 O  O   . ARG D 1 39  ? -16.398 4.032   20.567  1.00   15.90  ? 128  ARG D O   1 
ATOM   3556 C  CB  . ARG D 1 39  ? -18.188 3.171   18.203  1.00   17.37  ? 128  ARG D CB  1 
ATOM   3557 C  CG  . ARG D 1 39  ? -18.939 2.328   17.185  1.00   18.63  ? 128  ARG D CG  1 
ATOM   3558 C  CD  . ARG D 1 39  ? -20.236 2.971   16.744  1.00   21.97  ? 128  ARG D CD  1 
ATOM   3559 N  NE  . ARG D 1 39  ? -21.015 2.047   15.917  1.00   23.57  ? 128  ARG D NE  1 
ATOM   3560 C  CZ  . ARG D 1 39  ? -21.170 2.166   14.603  1.00   23.60  ? 128  ARG D CZ  1 
ATOM   3561 N  NH1 . ARG D 1 39  ? -20.624 3.185   13.954  1.00   24.79  ? 128  ARG D NH1 1 
ATOM   3562 N  NH2 . ARG D 1 39  ? -21.882 1.271   13.937  1.00   24.16  ? 128  ARG D NH2 1 
ATOM   3563 N  N   . PHE D 1 40  ? -14.907 3.275   19.039  1.00   14.82  ? 129  PHE D N   1 
ATOM   3564 C  CA  . PHE D 1 40  ? -13.859 4.223   19.368  1.00   13.69  ? 129  PHE D CA  1 
ATOM   3565 C  C   . PHE D 1 40  ? -14.147 5.473   18.545  1.00   13.94  ? 129  PHE D C   1 
ATOM   3566 O  O   . PHE D 1 40  ? -14.549 5.372   17.386  1.00   13.79  ? 129  PHE D O   1 
ATOM   3567 C  CB  . PHE D 1 40  ? -12.482 3.632   19.010  1.00   12.98  ? 129  PHE D CB  1 
ATOM   3568 C  CG  . PHE D 1 40  ? -11.361 4.644   18.975  1.00   12.22  ? 129  PHE D CG  1 
ATOM   3569 C  CD1 . PHE D 1 40  ? -10.566 4.855   20.085  1.00   11.30  ? 129  PHE D CD1 1 
ATOM   3570 C  CD2 . PHE D 1 40  ? -11.091 5.367   17.817  1.00   13.16  ? 129  PHE D CD2 1 
ATOM   3571 C  CE1 . PHE D 1 40  ? -9.524  5.784   20.056  1.00   11.98  ? 129  PHE D CE1 1 
ATOM   3572 C  CE2 . PHE D 1 40  ? -10.054 6.300   17.781  1.00   12.44  ? 129  PHE D CE2 1 
ATOM   3573 C  CZ  . PHE D 1 40  ? -9.270  6.502   18.907  1.00   11.90  ? 129  PHE D CZ  1 
ATOM   3574 N  N   . VAL D 1 41  ? -13.970 6.644   19.148  1.00   13.83  ? 130  VAL D N   1 
ATOM   3575 C  CA  . VAL D 1 41  ? -14.147 7.907   18.432  1.00   14.38  ? 130  VAL D CA  1 
ATOM   3576 C  C   . VAL D 1 41  ? -12.849 8.710   18.476  1.00   14.16  ? 130  VAL D C   1 
ATOM   3577 O  O   . VAL D 1 41  ? -12.320 8.985   19.552  1.00   13.03  ? 130  VAL D O   1 
ATOM   3578 C  CB  . VAL D 1 41  ? -15.310 8.748   19.034  1.00   14.38  ? 130  VAL D CB  1 
ATOM   3579 C  CG1 . VAL D 1 41  ? -15.493 10.053  18.253  1.00   15.21  ? 130  VAL D CG1 1 
ATOM   3580 C  CG2 . VAL D 1 41  ? -16.599 7.943   19.023  1.00   14.13  ? 130  VAL D CG2 1 
ATOM   3581 N  N   . CYS D 1 42  ? -12.346 9.082   17.306  1.00   14.56  ? 131  CYS D N   1 
ATOM   3582 C  CA  . CYS D 1 42  ? -11.116 9.868   17.207  1.00   15.61  ? 131  CYS D CA  1 
ATOM   3583 C  C   . CYS D 1 42  ? -11.315 11.341  17.584  1.00   16.47  ? 131  CYS D C   1 
ATOM   3584 O  O   . CYS D 1 42  ? -12.180 12.025  17.034  1.00   16.19  ? 131  CYS D O   1 
ATOM   3585 C  CB  . CYS D 1 42  ? -10.531 9.762   15.788  1.00   15.48  ? 131  CYS D CB  1 
ATOM   3586 S  SG  . CYS D 1 42  ? -9.130  10.854  15.446  1.00   16.08  ? 131  CYS D SG  1 
ATOM   3587 N  N   . THR D 1 43  ? -10.503 11.827  18.519  1.00   17.20  ? 132  THR D N   1 
ATOM   3588 C  CA  . THR D 1 43  ? -10.502 13.248  18.852  1.00   17.86  ? 132  THR D CA  1 
ATOM   3589 C  C   . THR D 1 43  ? -9.259  13.902  18.284  1.00   17.85  ? 132  THR D C   1 
ATOM   3590 O  O   . THR D 1 43  ? -9.336  14.946  17.647  1.00   18.13  ? 132  THR D O   1 
ATOM   3591 C  CB  . THR D 1 43  ? -10.545 13.490  20.375  1.00   18.64  ? 132  THR D CB  1 
ATOM   3592 O  OG1 . THR D 1 43  ? -11.810 13.059  20.894  1.00   19.46  ? 132  THR D OG1 1 
ATOM   3593 C  CG2 . THR D 1 43  ? -10.371 14.973  20.676  1.00   18.96  ? 132  THR D CG2 1 
ATOM   3594 N  N   . VAL D 1 44  ? -8.111  13.276  18.517  1.00   17.85  ? 133  VAL D N   1 
ATOM   3595 C  CA  . VAL D 1 44  ? -6.841  13.763  17.988  1.00   17.63  ? 133  VAL D CA  1 
ATOM   3596 C  C   . VAL D 1 44  ? -6.523  13.054  16.662  1.00   17.43  ? 133  VAL D C   1 
ATOM   3597 O  O   . VAL D 1 44  ? -6.356  11.835  16.636  1.00   17.52  ? 133  VAL D O   1 
ATOM   3598 C  CB  . VAL D 1 44  ? -5.715  13.534  19.009  1.00   17.95  ? 133  VAL D CB  1 
ATOM   3599 C  CG1 . VAL D 1 44  ? -4.433  14.225  18.572  1.00   17.71  ? 133  VAL D CG1 1 
ATOM   3600 C  CG2 . VAL D 1 44  ? -6.153  14.037  20.386  1.00   18.03  ? 133  VAL D CG2 1 
ATOM   3601 N  N   . PRO D 1 45  ? -6.452  13.811  15.552  1.00   17.24  ? 134  PRO D N   1 
ATOM   3602 C  CA  . PRO D 1 45  ? -6.185  13.188  14.254  1.00   16.67  ? 134  PRO D CA  1 
ATOM   3603 C  C   . PRO D 1 45  ? -4.743  12.695  14.190  1.00   15.86  ? 134  PRO D C   1 
ATOM   3604 O  O   . PRO D 1 45  ? -3.857  13.318  14.772  1.00   15.93  ? 134  PRO D O   1 
ATOM   3605 C  CB  . PRO D 1 45  ? -6.398  14.330  13.253  1.00   16.66  ? 134  PRO D CB  1 
ATOM   3606 C  CG  . PRO D 1 45  ? -7.050  15.432  14.025  1.00   17.57  ? 134  PRO D CG  1 
ATOM   3607 C  CD  . PRO D 1 45  ? -6.597  15.268  15.436  1.00   17.26  ? 134  PRO D CD  1 
ATOM   3608 N  N   . GLY D 1 46  ? -4.514  11.580  13.504  1.00   13.95  ? 135  GLY D N   1 
ATOM   3609 C  CA  . GLY D 1 46  ? -3.182  10.987  13.471  1.00   13.48  ? 135  GLY D CA  1 
ATOM   3610 C  C   . GLY D 1 46  ? -3.202  9.498   13.196  1.00   12.60  ? 135  GLY D C   1 
ATOM   3611 O  O   . GLY D 1 46  ? -4.217  8.945   12.760  1.00   12.65  ? 135  GLY D O   1 
ATOM   3612 N  N   . TYR D 1 47  ? -2.075  8.850   13.460  1.00   11.61  ? 136  TYR D N   1 
ATOM   3613 C  CA  . TYR D 1 47  ? -1.912  7.429   13.192  1.00   10.82  ? 136  TYR D CA  1 
ATOM   3614 C  C   . TYR D 1 47  ? -2.120  6.640   14.474  1.00   9.65   ? 136  TYR D C   1 
ATOM   3615 O  O   . TYR D 1 47  ? -1.471  6.903   15.487  1.00   8.88   ? 136  TYR D O   1 
ATOM   3616 C  CB  . TYR D 1 47  ? -0.534  7.141   12.589  1.00   10.93  ? 136  TYR D CB  1 
ATOM   3617 C  CG  . TYR D 1 47  ? -0.373  7.690   11.180  1.00   11.42  ? 136  TYR D CG  1 
ATOM   3618 C  CD1 . TYR D 1 47  ? -0.015  9.014   10.967  1.00   12.20  ? 136  TYR D CD1 1 
ATOM   3619 C  CD2 . TYR D 1 47  ? -0.595  6.891   10.069  1.00   11.09  ? 136  TYR D CD2 1 
ATOM   3620 C  CE1 . TYR D 1 47  ? 0.121   9.530   9.682   1.00   11.83  ? 136  TYR D CE1 1 
ATOM   3621 C  CE2 . TYR D 1 47  ? -0.458  7.396   8.779   1.00   11.43  ? 136  TYR D CE2 1 
ATOM   3622 C  CZ  . TYR D 1 47  ? -0.094  8.714   8.599   1.00   12.44  ? 136  TYR D CZ  1 
ATOM   3623 O  OH  . TYR D 1 47  ? 0.047   9.233   7.324   1.00   13.80  ? 136  TYR D OH  1 
ATOM   3624 N  N   . TYR D 1 48  ? -3.024  5.670   14.391  1.00   8.61   ? 137  TYR D N   1 
ATOM   3625 C  CA  . TYR D 1 48  ? -3.498  4.873   15.511  1.00   9.12   ? 137  TYR D CA  1 
ATOM   3626 C  C   . TYR D 1 48  ? -3.230  3.404   15.247  1.00   9.16   ? 137  TYR D C   1 
ATOM   3627 O  O   . TYR D 1 48  ? -3.241  2.962   14.100  1.00   9.19   ? 137  TYR D O   1 
ATOM   3628 C  CB  . TYR D 1 48  ? -5.015  5.061   15.669  1.00   9.84   ? 137  TYR D CB  1 
ATOM   3629 C  CG  . TYR D 1 48  ? -5.378  6.362   16.334  1.00   10.27  ? 137  TYR D CG  1 
ATOM   3630 C  CD1 . TYR D 1 48  ? -5.459  7.533   15.597  1.00   11.26  ? 137  TYR D CD1 1 
ATOM   3631 C  CD2 . TYR D 1 48  ? -5.623  6.419   17.703  1.00   11.13  ? 137  TYR D CD2 1 
ATOM   3632 C  CE1 . TYR D 1 48  ? -5.775  8.723   16.199  1.00   12.62  ? 137  TYR D CE1 1 
ATOM   3633 C  CE2 . TYR D 1 48  ? -5.933  7.614   18.322  1.00   12.70  ? 137  TYR D CE2 1 
ATOM   3634 C  CZ  . TYR D 1 48  ? -6.013  8.761   17.558  1.00   12.22  ? 137  TYR D CZ  1 
ATOM   3635 O  OH  . TYR D 1 48  ? -6.329  9.960   18.141  1.00   13.59  ? 137  TYR D OH  1 
ATOM   3636 N  N   . TYR D 1 49  ? -2.982  2.639   16.299  1.00   8.54   ? 138  TYR D N   1 
ATOM   3637 C  CA  . TYR D 1 49  ? -2.905  1.194   16.130  1.00   8.28   ? 138  TYR D CA  1 
ATOM   3638 C  C   . TYR D 1 49  ? -4.085  0.558   16.819  1.00   8.32   ? 138  TYR D C   1 
ATOM   3639 O  O   . TYR D 1 49  ? -4.408  0.912   17.958  1.00   7.26   ? 138  TYR D O   1 
ATOM   3640 C  CB  . TYR D 1 49  ? -1.604  0.599   16.677  1.00   8.91   ? 138  TYR D CB  1 
ATOM   3641 C  CG  . TYR D 1 49  ? -1.461  -0.853  16.286  1.00   9.28   ? 138  TYR D CG  1 
ATOM   3642 C  CD1 . TYR D 1 49  ? -1.369  -1.207  14.943  1.00   9.45   ? 138  TYR D CD1 1 
ATOM   3643 C  CD2 . TYR D 1 49  ? -1.468  -1.873  17.242  1.00   7.73   ? 138  TYR D CD2 1 
ATOM   3644 C  CE1 . TYR D 1 49  ? -1.268  -2.523  14.551  1.00   8.21   ? 138  TYR D CE1 1 
ATOM   3645 C  CE2 . TYR D 1 49  ? -1.359  -3.197  16.859  1.00   8.70   ? 138  TYR D CE2 1 
ATOM   3646 C  CZ  . TYR D 1 49  ? -1.263  -3.509  15.496  1.00   8.98   ? 138  TYR D CZ  1 
ATOM   3647 O  OH  . TYR D 1 49  ? -1.159  -4.807  15.064  1.00   9.23   ? 138  TYR D OH  1 
ATOM   3648 N  N   . PHE D 1 50  ? -4.736  -0.370  16.123  1.00   7.56   ? 139  PHE D N   1 
ATOM   3649 C  CA  . PHE D 1 50  ? -5.888  -1.073  16.683  1.00   7.73   ? 139  PHE D CA  1 
ATOM   3650 C  C   . PHE D 1 50  ? -5.644  -2.564  16.626  1.00   7.58   ? 139  PHE D C   1 
ATOM   3651 O  O   . PHE D 1 50  ? -5.049  -3.068  15.674  1.00   6.23   ? 139  PHE D O   1 
ATOM   3652 C  CB  . PHE D 1 50  ? -7.178  -0.707  15.933  1.00   8.29   ? 139  PHE D CB  1 
ATOM   3653 C  CG  . PHE D 1 50  ? -7.611  0.725   16.140  1.00   8.63   ? 139  PHE D CG  1 
ATOM   3654 C  CD1 . PHE D 1 50  ? -7.354  1.689   15.182  1.00   7.61   ? 139  PHE D CD1 1 
ATOM   3655 C  CD2 . PHE D 1 50  ? -8.257  1.106   17.312  1.00   8.60   ? 139  PHE D CD2 1 
ATOM   3656 C  CE1 . PHE D 1 50  ? -7.739  2.999   15.375  1.00   8.03   ? 139  PHE D CE1 1 
ATOM   3657 C  CE2 . PHE D 1 50  ? -8.646  2.419   17.511  1.00   8.15   ? 139  PHE D CE2 1 
ATOM   3658 C  CZ  . PHE D 1 50  ? -8.390  3.367   16.540  1.00   7.98   ? 139  PHE D CZ  1 
ATOM   3659 N  N   . THR D 1 51  ? -6.101  -3.275  17.652  1.00   8.45   ? 140  THR D N   1 
ATOM   3660 C  CA  . THR D 1 51  ? -5.918  -4.712  17.690  1.00   9.19   ? 140  THR D CA  1 
ATOM   3661 C  C   . THR D 1 51  ? -6.969  -5.394  18.548  1.00   9.68   ? 140  THR D C   1 
ATOM   3662 O  O   . THR D 1 51  ? -7.508  -4.804  19.495  1.00   10.59  ? 140  THR D O   1 
ATOM   3663 C  CB  . THR D 1 51  ? -4.496  -5.076  18.192  1.00   9.50   ? 140  THR D CB  1 
ATOM   3664 O  OG1 . THR D 1 51  ? -4.218  -6.461  17.932  1.00   9.72   ? 140  THR D OG1 1 
ATOM   3665 C  CG2 . THR D 1 51  ? -4.371  -4.780  19.684  1.00   8.42   ? 140  THR D CG2 1 
ATOM   3666 N  N   . PHE D 1 52  ? -7.265  -6.643  18.213  1.00   9.64   ? 141  PHE D N   1 
ATOM   3667 C  CA  . PHE D 1 52  ? -8.192  -7.435  19.019  1.00   9.29   ? 141  PHE D CA  1 
ATOM   3668 C  C   . PHE D 1 52  ? -7.685  -8.858  19.209  1.00   8.85   ? 141  PHE D C   1 
ATOM   3669 O  O   . PHE D 1 52  ? -6.923  -9.371  18.397  1.00   8.79   ? 141  PHE D O   1 
ATOM   3670 C  CB  . PHE D 1 52  ? -9.611  -7.437  18.416  1.00   8.36   ? 141  PHE D CB  1 
ATOM   3671 C  CG  . PHE D 1 52  ? -9.694  -8.022  17.008  1.00   7.07   ? 141  PHE D CG  1 
ATOM   3672 C  CD1 . PHE D 1 52  ? -9.846  -9.385  16.812  1.00   6.68   ? 141  PHE D CD1 1 
ATOM   3673 C  CD2 . PHE D 1 52  ? -9.652  -7.203  15.902  1.00   6.17   ? 141  PHE D CD2 1 
ATOM   3674 C  CE1 . PHE D 1 52  ? -9.929  -9.927  15.509  1.00   8.28   ? 141  PHE D CE1 1 
ATOM   3675 C  CE2 . PHE D 1 52  ? -9.732  -7.732  14.595  1.00   7.22   ? 141  PHE D CE2 1 
ATOM   3676 C  CZ  . PHE D 1 52  ? -9.879  -9.090  14.407  1.00   6.32   ? 141  PHE D CZ  1 
ATOM   3677 N  N   . GLN D 1 53  ? -8.077  -9.458  20.327  1.00   9.88   ? 142  GLN D N   1 
ATOM   3678 C  CA  . GLN D 1 53  ? -7.892  -10.873 20.563  1.00   11.02  ? 142  GLN D CA  1 
ATOM   3679 C  C   . GLN D 1 53  ? -9.229  -11.368 21.109  1.00   11.51  ? 142  GLN D C   1 
ATOM   3680 O  O   . GLN D 1 53  ? -9.593  -11.072 22.252  1.00   10.98  ? 142  GLN D O   1 
ATOM   3681 C  CB  . GLN D 1 53  ? -6.761  -11.125 21.561  1.00   11.46  ? 142  GLN D CB  1 
ATOM   3682 C  CG  . GLN D 1 53  ? -5.417  -10.554 21.148  1.00   13.45  ? 142  GLN D CG  1 
ATOM   3683 C  CD  . GLN D 1 53  ? -5.228  -9.125  21.601  1.00   15.32  ? 142  GLN D CD  1 
ATOM   3684 O  OE1 . GLN D 1 53  ? -5.632  -8.761  22.706  1.00   16.50  ? 142  GLN D OE1 1 
ATOM   3685 N  NE2 . GLN D 1 53  ? -4.599  -8.311  20.764  1.00   14.46  ? 142  GLN D NE2 1 
ATOM   3686 N  N   . VAL D 1 54  ? -9.966  -12.094 20.276  1.00   12.00  ? 143  VAL D N   1 
ATOM   3687 C  CA  . VAL D 1 54  ? -11.328 -12.489 20.610  1.00   13.00  ? 143  VAL D CA  1 
ATOM   3688 C  C   . VAL D 1 54  ? -11.442 -14.004 20.741  1.00   13.56  ? 143  VAL D C   1 
ATOM   3689 O  O   . VAL D 1 54  ? -10.903 -14.754 19.927  1.00   13.75  ? 143  VAL D O   1 
ATOM   3690 C  CB  . VAL D 1 54  ? -12.355 -11.955 19.576  1.00   12.35  ? 143  VAL D CB  1 
ATOM   3691 C  CG1 . VAL D 1 54  ? -13.749 -12.472 19.888  1.00   11.82  ? 143  VAL D CG1 1 
ATOM   3692 C  CG2 . VAL D 1 54  ? -12.348 -10.424 19.549  1.00   11.89  ? 143  VAL D CG2 1 
ATOM   3693 N  N   . LEU D 1 55  ? -12.160 -14.436 21.772  1.00   13.73  ? 144  LEU D N   1 
ATOM   3694 C  CA  . LEU D 1 55  ? -12.269 -15.848 22.116  1.00   14.34  ? 144  LEU D CA  1 
ATOM   3695 C  C   . LEU D 1 55  ? -13.510 -16.470 21.478  1.00   14.30  ? 144  LEU D C   1 
ATOM   3696 O  O   . LEU D 1 55  ? -14.620 -15.931 21.588  1.00   13.22  ? 144  LEU D O   1 
ATOM   3697 C  CB  . LEU D 1 55  ? -12.338 -15.993 23.636  1.00   14.70  ? 144  LEU D CB  1 
ATOM   3698 C  CG  . LEU D 1 55  ? -12.177 -17.378 24.254  1.00   15.85  ? 144  LEU D CG  1 
ATOM   3699 C  CD1 . LEU D 1 55  ? -10.814 -17.975 23.933  1.00   15.60  ? 144  LEU D CD1 1 
ATOM   3700 C  CD2 . LEU D 1 55  ? -12.381 -17.284 25.761  1.00   15.74  ? 144  LEU D CD2 1 
ATOM   3701 N  N   . SER D 1 56  ? -13.316 -17.607 20.817  1.00   14.08  ? 145  SER D N   1 
ATOM   3702 C  CA  . SER D 1 56  ? -14.417 -18.316 20.164  1.00   14.60  ? 145  SER D CA  1 
ATOM   3703 C  C   . SER D 1 56  ? -14.289 -19.807 20.430  1.00   14.51  ? 145  SER D C   1 
ATOM   3704 O  O   . SER D 1 56  ? -13.232 -20.278 20.843  1.00   14.32  ? 145  SER D O   1 
ATOM   3705 C  CB  . SER D 1 56  ? -14.402 -18.050 18.649  1.00   15.07  ? 145  SER D CB  1 
ATOM   3706 O  OG  . SER D 1 56  ? -15.457 -18.728 17.986  1.00   15.39  ? 145  SER D OG  1 
ATOM   3707 N  N   . GLN D 1 57  ? -15.364 -20.549 20.199  1.00   14.34  ? 146  GLN D N   1 
ATOM   3708 C  CA  . GLN D 1 57  ? -15.308 -22.006 20.324  1.00   15.04  ? 146  GLN D CA  1 
ATOM   3709 C  C   . GLN D 1 57  ? -15.737 -22.709 19.033  1.00   14.46  ? 146  GLN D C   1 
ATOM   3710 O  O   . GLN D 1 57  ? -15.539 -23.913 18.881  1.00   13.73  ? 146  GLN D O   1 
ATOM   3711 C  CB  . GLN D 1 57  ? -16.174 -22.484 21.494  1.00   14.52  ? 146  GLN D CB  1 
ATOM   3712 C  CG  . GLN D 1 57  ? -15.606 -22.151 22.849  1.00   16.56  ? 146  GLN D CG  1 
ATOM   3713 C  CD  . GLN D 1 57  ? -16.621 -22.305 23.957  1.00   18.36  ? 146  GLN D CD  1 
ATOM   3714 O  OE1 . GLN D 1 57  ? -17.763 -21.861 23.832  1.00   19.77  ? 146  GLN D OE1 1 
ATOM   3715 N  NE2 . GLN D 1 57  ? -16.209 -22.926 25.062  1.00   19.93  ? 146  GLN D NE2 1 
ATOM   3716 N  N   . TRP D 1 58  ? -16.312 -21.953 18.108  1.00   15.00  ? 147  TRP D N   1 
ATOM   3717 C  CA  . TRP D 1 58  ? -16.857 -22.530 16.874  1.00   15.79  ? 147  TRP D CA  1 
ATOM   3718 C  C   . TRP D 1 58  ? -16.272 -21.855 15.641  1.00   15.45  ? 147  TRP D C   1 
ATOM   3719 O  O   . TRP D 1 58  ? -15.137 -22.136 15.279  1.00   16.15  ? 147  TRP D O   1 
ATOM   3720 C  CB  . TRP D 1 58  ? -18.393 -22.512 16.904  1.00   16.61  ? 147  TRP D CB  1 
ATOM   3721 C  CG  . TRP D 1 58  ? -18.897 -23.240 18.120  1.00   18.19  ? 147  TRP D CG  1 
ATOM   3722 C  CD1 . TRP D 1 58  ? -19.364 -22.684 19.278  1.00   18.96  ? 147  TRP D CD1 1 
ATOM   3723 C  CD2 . TRP D 1 58  ? -18.908 -24.658 18.325  1.00   19.05  ? 147  TRP D CD2 1 
ATOM   3724 N  NE1 . TRP D 1 58  ? -19.685 -23.670 20.180  1.00   18.78  ? 147  TRP D NE1 1 
ATOM   3725 C  CE2 . TRP D 1 58  ? -19.420 -24.890 19.619  1.00   19.68  ? 147  TRP D CE2 1 
ATOM   3726 C  CE3 . TRP D 1 58  ? -18.555 -25.755 17.532  1.00   20.27  ? 147  TRP D CE3 1 
ATOM   3727 C  CZ2 . TRP D 1 58  ? -19.584 -26.176 20.143  1.00   20.90  ? 147  TRP D CZ2 1 
ATOM   3728 C  CZ3 . TRP D 1 58  ? -18.716 -27.040 18.056  1.00   20.38  ? 147  TRP D CZ3 1 
ATOM   3729 C  CH2 . TRP D 1 58  ? -19.222 -27.235 19.351  1.00   20.68  ? 147  TRP D CH2 1 
ATOM   3730 N  N   . GLU D 1 59  ? -17.023 -20.966 15.005  1.00   15.29  ? 148  GLU D N   1 
ATOM   3731 C  CA  . GLU D 1 59  ? -16.487 -20.207 13.876  1.00   15.32  ? 148  GLU D CA  1 
ATOM   3732 C  C   . GLU D 1 59  ? -16.661 -18.719 14.086  1.00   14.47  ? 148  GLU D C   1 
ATOM   3733 O  O   . GLU D 1 59  ? -17.738 -18.255 14.450  1.00   14.60  ? 148  GLU D O   1 
ATOM   3734 C  CB  . GLU D 1 59  ? -17.183 -20.584 12.576  1.00   16.03  ? 148  GLU D CB  1 
ATOM   3735 C  CG  . GLU D 1 59  ? -17.056 -22.038 12.181  1.00   17.71  ? 148  GLU D CG  1 
ATOM   3736 C  CD  . GLU D 1 59  ? -17.630 -22.270 10.807  1.00   19.00  ? 148  GLU D CD  1 
ATOM   3737 O  OE1 . GLU D 1 59  ? -16.877 -22.699 9.914   1.00   19.48  ? 148  GLU D OE1 1 
ATOM   3738 O  OE2 . GLU D 1 59  ? -18.827 -21.980 10.618  1.00   19.12  ? 148  GLU D OE2 1 
ATOM   3739 N  N   A ILE D 1 60  ? -15.595 -17.964 13.848  0.50   13.66  ? 149  ILE D N   1 
ATOM   3740 N  N   B ILE D 1 60  ? -15.597 -17.968 13.834  0.50   13.72  ? 149  ILE D N   1 
ATOM   3741 C  CA  A ILE D 1 60  ? -15.643 -16.519 14.006  0.50   13.13  ? 149  ILE D CA  1 
ATOM   3742 C  CA  B ILE D 1 60  ? -15.644 -16.527 13.993  0.50   13.23  ? 149  ILE D CA  1 
ATOM   3743 C  C   A ILE D 1 60  ? -14.822 -15.828 12.921  0.50   13.27  ? 149  ILE D C   1 
ATOM   3744 C  C   B ILE D 1 60  ? -14.825 -15.836 12.909  0.50   13.33  ? 149  ILE D C   1 
ATOM   3745 O  O   A ILE D 1 60  ? -13.694 -16.222 12.638  0.50   13.26  ? 149  ILE D O   1 
ATOM   3746 O  O   B ILE D 1 60  ? -13.701 -16.235 12.616  0.50   13.32  ? 149  ILE D O   1 
ATOM   3747 C  CB  A ILE D 1 60  ? -15.132 -16.086 15.403  0.50   12.67  ? 149  ILE D CB  1 
ATOM   3748 C  CB  B ILE D 1 60  ? -15.126 -16.105 15.383  0.50   12.84  ? 149  ILE D CB  1 
ATOM   3749 C  CG1 A ILE D 1 60  ? -15.234 -14.565 15.574  0.50   11.45  ? 149  ILE D CG1 1 
ATOM   3750 C  CG1 B ILE D 1 60  ? -15.255 -14.591 15.562  0.50   11.75  ? 149  ILE D CG1 1 
ATOM   3751 C  CG2 A ILE D 1 60  ? -13.693 -16.568 15.624  0.50   11.69  ? 149  ILE D CG2 1 
ATOM   3752 C  CG2 B ILE D 1 60  ? -13.677 -16.574 15.586  0.50   11.83  ? 149  ILE D CG2 1 
ATOM   3753 C  CD1 A ILE D 1 60  ? -16.639 -14.016 15.422  0.50   10.45  ? 149  ILE D CD1 1 
ATOM   3754 C  CD1 B ILE D 1 60  ? -14.867 -14.116 16.928  0.50   11.05  ? 149  ILE D CD1 1 
ATOM   3755 N  N   . CYS D 1 61  ? -15.412 -14.812 12.305  1.00   13.77  ? 150  CYS D N   1 
ATOM   3756 C  CA  . CYS D 1 61  ? -14.715 -13.969 11.359  1.00   13.99  ? 150  CYS D CA  1 
ATOM   3757 C  C   . CYS D 1 61  ? -14.963 -12.534 11.808  1.00   14.03  ? 150  CYS D C   1 
ATOM   3758 O  O   . CYS D 1 61  ? -16.117 -12.117 11.946  1.00   13.93  ? 150  CYS D O   1 
ATOM   3759 C  CB  . CYS D 1 61  ? -15.255 -14.187 9.948   1.00   15.18  ? 150  CYS D CB  1 
ATOM   3760 S  SG  . CYS D 1 61  ? -14.572 -15.635 9.132   1.00   17.04  ? 150  CYS D SG  1 
ATOM   3761 N  N   . LEU D 1 62  ? -13.878 -11.802 12.063  1.00   13.34  ? 151  LEU D N   1 
ATOM   3762 C  CA  . LEU D 1 62  ? -13.944 -10.438 12.582  1.00   12.34  ? 151  LEU D CA  1 
ATOM   3763 C  C   . LEU D 1 62  ? -13.220 -9.443  11.691  1.00   12.44  ? 151  LEU D C   1 
ATOM   3764 O  O   . LEU D 1 62  ? -12.210 -9.765  11.058  1.00   11.27  ? 151  LEU D O   1 
ATOM   3765 C  CB  . LEU D 1 62  ? -13.317 -10.359 13.978  1.00   12.34  ? 151  LEU D CB  1 
ATOM   3766 C  CG  . LEU D 1 62  ? -14.018 -11.060 15.141  1.00   12.88  ? 151  LEU D CG  1 
ATOM   3767 C  CD1 . LEU D 1 62  ? -13.317 -10.724 16.438  1.00   12.13  ? 151  LEU D CD1 1 
ATOM   3768 C  CD2 . LEU D 1 62  ? -15.482 -10.664 15.216  1.00   12.98  ? 151  LEU D CD2 1 
ATOM   3769 N  N   . SER D 1 63  ? -13.718 -8.212  11.678  1.00   13.08  ? 152  SER D N   1 
ATOM   3770 C  CA  . SER D 1 63  ? -13.087 -7.163  10.898  1.00   13.92  ? 152  SER D CA  1 
ATOM   3771 C  C   . SER D 1 63  ? -13.032 -5.845  11.665  1.00   13.78  ? 152  SER D C   1 
ATOM   3772 O  O   . SER D 1 63  ? -13.972 -5.490  12.372  1.00   12.86  ? 152  SER D O   1 
ATOM   3773 C  CB  . SER D 1 63  ? -13.830 -6.978  9.583   1.00   13.95  ? 152  SER D CB  1 
ATOM   3774 O  OG  . SER D 1 63  ? -13.218 -5.962  8.817   1.00   17.76  ? 152  SER D OG  1 
ATOM   3775 N  N   . ILE D 1 64  ? -11.914 -5.137  11.546  1.00   14.30  ? 153  ILE D N   1 
ATOM   3776 C  CA  . ILE D 1 64  ? -11.819 -3.796  12.107  1.00   15.04  ? 153  ILE D CA  1 
ATOM   3777 C  C   . ILE D 1 64  ? -12.355 -2.824  11.059  1.00   15.09  ? 153  ILE D C   1 
ATOM   3778 O  O   . ILE D 1 64  ? -11.794 -2.702  9.971   1.00   15.78  ? 153  ILE D O   1 
ATOM   3779 C  CB  . ILE D 1 64  ? -10.375 -3.429  12.513  1.00   15.60  ? 153  ILE D CB  1 
ATOM   3780 C  CG1 . ILE D 1 64  ? -9.955  -4.212  13.762  1.00   15.57  ? 153  ILE D CG1 1 
ATOM   3781 C  CG2 . ILE D 1 64  ? -10.254 -1.931  12.796  1.00   14.94  ? 153  ILE D CG2 1 
ATOM   3782 C  CD1 . ILE D 1 64  ? -8.470  -4.196  14.014  1.00   16.12  ? 153  ILE D CD1 1 
ATOM   3783 N  N   . VAL D 1 65  ? -13.469 -2.174  11.384  1.00   15.67  ? 154  VAL D N   1 
ATOM   3784 C  CA  . VAL D 1 65  ? -14.137 -1.253  10.475  1.00   15.83  ? 154  VAL D CA  1 
ATOM   3785 C  C   . VAL D 1 65  ? -14.000 0.182   10.975  1.00   16.16  ? 154  VAL D C   1 
ATOM   3786 O  O   . VAL D 1 65  ? -13.896 0.428   12.177  1.00   16.00  ? 154  VAL D O   1 
ATOM   3787 C  CB  . VAL D 1 65  ? -15.648 -1.568  10.361  1.00   16.71  ? 154  VAL D CB  1 
ATOM   3788 C  CG1 . VAL D 1 65  ? -16.295 -0.719  9.260   1.00   16.90  ? 154  VAL D CG1 1 
ATOM   3789 C  CG2 . VAL D 1 65  ? -15.879 -3.056  10.081  1.00   16.86  ? 154  VAL D CG2 1 
ATOM   3790 N  N   . SER D 1 66  ? -14.007 1.137   10.055  1.00   15.73  ? 155  SER D N   1 
ATOM   3791 C  CA  . SER D 1 66  ? -14.041 2.533   10.460  1.00   15.66  ? 155  SER D CA  1 
ATOM   3792 C  C   . SER D 1 66  ? -15.135 3.276   9.713   1.00   15.77  ? 155  SER D C   1 
ATOM   3793 O  O   . SER D 1 66  ? -15.782 2.724   8.816   1.00   15.48  ? 155  SER D O   1 
ATOM   3794 C  CB  . SER D 1 66  ? -12.677 3.209   10.273  1.00   15.34  ? 155  SER D CB  1 
ATOM   3795 O  OG  . SER D 1 66  ? -12.367 3.420   8.907   1.00   16.07  ? 155  SER D OG  1 
ATOM   3796 N  N   . SER D 1 67  ? -15.353 4.521   10.107  1.00   16.30  ? 156  SER D N   1 
ATOM   3797 C  CA  . SER D 1 67  ? -16.229 5.411   9.367   1.00   16.89  ? 156  SER D CA  1 
ATOM   3798 C  C   . SER D 1 67  ? -15.657 6.828   9.314   1.00   17.34  ? 156  SER D C   1 
ATOM   3799 O  O   . SER D 1 67  ? -14.937 7.259   10.221  1.00   16.90  ? 156  SER D O   1 
ATOM   3800 C  CB  . SER D 1 67  ? -17.640 5.418   9.964   1.00   16.67  ? 156  SER D CB  1 
ATOM   3801 O  OG  . SER D 1 67  ? -17.684 6.157   11.170  1.00   17.20  ? 156  SER D OG  1 
ATOM   3802 N  N   . SER D 1 68  ? -15.947 7.526   8.224   1.00   18.71  ? 157  SER D N   1 
ATOM   3803 C  CA  . SER D 1 68  ? -15.700 8.967   8.135   1.00   20.66  ? 157  SER D CA  1 
ATOM   3804 C  C   . SER D 1 68  ? -16.923 9.653   7.537   1.00   20.60  ? 157  SER D C   1 
ATOM   3805 O  O   . SER D 1 68  ? -17.418 9.242   6.485   1.00   20.67  ? 157  SER D O   1 
ATOM   3806 C  CB  . SER D 1 68  ? -14.454 9.281   7.309   1.00   21.22  ? 157  SER D CB  1 
ATOM   3807 O  OG  . SER D 1 68  ? -14.073 10.644  7.483   1.00   24.02  ? 157  SER D OG  1 
ATOM   3808 N  N   . ARG D 1 69  ? -17.414 10.681  8.229   1.00   21.35  ? 158  ARG D N   1 
ATOM   3809 C  CA  . ARG D 1 69  ? -18.625 11.399  7.833   1.00   21.40  ? 158  ARG D CA  1 
ATOM   3810 C  C   . ARG D 1 69  ? -19.845 10.480  7.806   1.00   21.38  ? 158  ARG D C   1 
ATOM   3811 O  O   . ARG D 1 69  ? -20.747 10.656  6.990   1.00   21.79  ? 158  ARG D O   1 
ATOM   3812 C  CB  . ARG D 1 69  ? -18.438 12.051  6.463   1.00   22.48  ? 158  ARG D CB  1 
ATOM   3813 C  CG  . ARG D 1 69  ? -17.140 12.849  6.313   1.00   23.38  ? 158  ARG D CG  1 
ATOM   3814 C  CD  . ARG D 1 69  ? -16.843 13.089  4.838   1.00   25.17  ? 158  ARG D CD  1 
ATOM   3815 N  NE  . ARG D 1 69  ? -15.656 13.914  4.616   1.00   24.41  ? 158  ARG D NE  1 
ATOM   3816 C  CZ  . ARG D 1 69  ? -15.626 15.229  4.810   1.00   24.58  ? 158  ARG D CZ  1 
ATOM   3817 N  NH1 . ARG D 1 69  ? -16.712 15.855  5.256   1.00   23.64  ? 158  ARG D NH1 1 
ATOM   3818 N  NH2 . ARG D 1 69  ? -14.515 15.915  4.572   1.00   23.07  ? 158  ARG D NH2 1 
ATOM   3819 N  N   . GLY D 1 70  ? -19.862 9.492   8.694   1.00   21.02  ? 159  GLY D N   1 
ATOM   3820 C  CA  . GLY D 1 70  ? -20.982 8.559   8.787   1.00   20.23  ? 159  GLY D CA  1 
ATOM   3821 C  C   . GLY D 1 70  ? -20.944 7.427   7.771   1.00   19.35  ? 159  GLY D C   1 
ATOM   3822 O  O   . GLY D 1 70  ? -21.797 6.540   7.794   1.00   19.66  ? 159  GLY D O   1 
ATOM   3823 N  N   . GLN D 1 71  ? -19.957 7.453   6.877   1.00   20.00  ? 160  GLN D N   1 
ATOM   3824 C  CA  . GLN D 1 71  ? -19.844 6.455   5.821   1.00   20.00  ? 160  GLN D CA  1 
ATOM   3825 C  C   . GLN D 1 71  ? -18.928 5.310   6.238   1.00   20.00  ? 160  GLN D C   1 
ATOM   3826 O  O   . GLN D 1 71  ? -17.839 5.551   6.759   1.00   15.15  ? 160  GLN D O   1 
ATOM   3827 C  CB  . GLN D 1 71  ? -19.330 7.097   4.531   1.00   20.00  ? 160  GLN D CB  1 
ATOM   3828 C  CG  . GLN D 1 71  ? -20.262 8.145   3.944   1.00   20.00  ? 160  GLN D CG  1 
ATOM   3829 C  CD  . GLN D 1 71  ? -21.598 7.568   3.524   1.00   20.00  ? 160  GLN D CD  1 
ATOM   3830 O  OE1 . GLN D 1 71  ? -21.654 6.525   2.873   1.00   20.00  ? 160  GLN D OE1 1 
ATOM   3831 N  NE2 . GLN D 1 71  ? -22.681 8.245   3.896   1.00   20.00  ? 160  GLN D NE2 1 
ATOM   3832 N  N   . VAL D 1 72  ? -19.384 4.089   6.011   1.00   15.33  ? 161  VAL D N   1 
ATOM   3833 C  CA  . VAL D 1 72  ? -18.650 2.920   6.484   1.00   15.84  ? 161  VAL D CA  1 
ATOM   3834 C  C   . VAL D 1 72  ? -17.511 2.547   5.540   1.00   15.16  ? 161  VAL D C   1 
ATOM   3835 O  O   . VAL D 1 72  ? -17.689 2.481   4.319   1.00   14.52  ? 161  VAL D O   1 
ATOM   3836 C  CB  . VAL D 1 72  ? -19.573 1.694   6.701   1.00   16.33  ? 161  VAL D CB  1 
ATOM   3837 C  CG1 . VAL D 1 72  ? -18.779 0.528   7.248   1.00   16.61  ? 161  VAL D CG1 1 
ATOM   3838 C  CG2 . VAL D 1 72  ? -20.700 2.038   7.671   1.00   18.63  ? 161  VAL D CG2 1 
ATOM   3839 N  N   . ARG D 1 73  ? -16.342 2.319   6.125   1.00   14.73  ? 162  ARG D N   1 
ATOM   3840 C  CA  . ARG D 1 73  ? -15.150 1.941   5.377   1.00   15.22  ? 162  ARG D CA  1 
ATOM   3841 C  C   . ARG D 1 73  ? -14.759 0.531   5.787   1.00   15.81  ? 162  ARG D C   1 
ATOM   3842 O  O   . ARG D 1 73  ? -14.090 0.335   6.806   1.00   16.03  ? 162  ARG D O   1 
ATOM   3843 C  CB  . ARG D 1 73  ? -14.013 2.934   5.648   1.00   14.27  ? 162  ARG D CB  1 
ATOM   3844 C  CG  . ARG D 1 73  ? -14.432 4.377   5.420   1.00   13.88  ? 162  ARG D CG  1 
ATOM   3845 C  CD  . ARG D 1 73  ? -13.268 5.346   5.507   1.00   13.91  ? 162  ARG D CD  1 
ATOM   3846 N  NE  . ARG D 1 73  ? -12.748 5.503   6.866   1.00   12.20  ? 162  ARG D NE  1 
ATOM   3847 C  CZ  . ARG D 1 73  ? -11.972 6.514   7.248   1.00   13.91  ? 162  ARG D CZ  1 
ATOM   3848 N  NH1 . ARG D 1 73  ? -11.638 7.459   6.370   1.00   11.74  ? 162  ARG D NH1 1 
ATOM   3849 N  NH2 . ARG D 1 73  ? -11.536 6.589   8.507   1.00   12.82  ? 162  ARG D NH2 1 
ATOM   3850 N  N   . ARG D 1 74  ? -15.213 -0.449  5.007   1.00   16.59  ? 163  ARG D N   1 
ATOM   3851 C  CA  . ARG D 1 74  ? -14.947 -1.855  5.290   1.00   18.12  ? 163  ARG D CA  1 
ATOM   3852 C  C   . ARG D 1 74  ? -13.467 -2.149  5.059   1.00   18.11  ? 163  ARG D C   1 
ATOM   3853 O  O   . ARG D 1 74  ? -12.797 -1.426  4.325   1.00   18.24  ? 163  ARG D O   1 
ATOM   3854 C  CB  . ARG D 1 74  ? -15.801 -2.752  4.387   1.00   18.86  ? 163  ARG D CB  1 
ATOM   3855 C  CG  . ARG D 1 74  ? -17.283 -2.458  4.428   1.00   20.50  ? 163  ARG D CG  1 
ATOM   3856 C  CD  . ARG D 1 74  ? -17.902 -2.947  5.716   1.00   22.58  ? 163  ARG D CD  1 
ATOM   3857 N  NE  . ARG D 1 74  ? -19.312 -2.586  5.834   1.00   24.11  ? 163  ARG D NE  1 
ATOM   3858 C  CZ  . ARG D 1 74  ? -20.104 -3.008  6.814   1.00   24.26  ? 163  ARG D CZ  1 
ATOM   3859 N  NH1 . ARG D 1 74  ? -19.622 -3.814  7.748   1.00   24.91  ? 163  ARG D NH1 1 
ATOM   3860 N  NH2 . ARG D 1 74  ? -21.374 -2.629  6.860   1.00   25.21  ? 163  ARG D NH2 1 
ATOM   3861 N  N   . SER D 1 75  ? -12.964 -3.216  5.672   1.00   18.44  ? 164  SER D N   1 
ATOM   3862 C  CA  . SER D 1 75  ? -11.524 -3.484  5.676   1.00   18.53  ? 164  SER D CA  1 
ATOM   3863 C  C   . SER D 1 75  ? -11.180 -4.973  5.777   1.00   17.65  ? 164  SER D C   1 
ATOM   3864 O  O   . SER D 1 75  ? -11.986 -5.831  5.429   1.00   18.25  ? 164  SER D O   1 
ATOM   3865 C  CB  . SER D 1 75  ? -10.853 -2.707  6.815   1.00   18.89  ? 164  SER D CB  1 
ATOM   3866 O  OG  . SER D 1 75  ? -9.447  -2.614  6.626   1.00   20.84  ? 164  SER D OG  1 
ATOM   3867 N  N   . LEU D 1 76  ? -9.979  -5.267  6.262   1.00   17.14  ? 165  LEU D N   1 
ATOM   3868 C  CA  . LEU D 1 76  ? -9.473  -6.635  6.310   1.00   16.72  ? 165  LEU D CA  1 
ATOM   3869 C  C   . LEU D 1 76  ? -10.196 -7.445  7.380   1.00   16.34  ? 165  LEU D C   1 
ATOM   3870 O  O   . LEU D 1 76  ? -10.703 -6.897  8.363   1.00   16.69  ? 165  LEU D O   1 
ATOM   3871 C  CB  . LEU D 1 76  ? -7.963  -6.655  6.584   1.00   17.09  ? 165  LEU D CB  1 
ATOM   3872 C  CG  . LEU D 1 76  ? -6.949  -6.133  5.548   1.00   16.93  ? 165  LEU D CG  1 
ATOM   3873 C  CD1 A LEU D 1 76  ? -7.240  -4.692  5.172   0.50   16.13  ? 165  LEU D CD1 1 
ATOM   3874 C  CD1 B LEU D 1 76  ? -6.259  -7.253  4.807   0.50   17.37  ? 165  LEU D CD1 1 
ATOM   3875 C  CD2 A LEU D 1 76  ? -5.527  -6.287  6.060   0.50   15.85  ? 165  LEU D CD2 1 
ATOM   3876 C  CD2 B LEU D 1 76  ? -7.563  -5.121  4.576   0.50   16.11  ? 165  LEU D CD2 1 
ATOM   3877 N  N   . GLY D 1 77  ? -10.230 -8.753  7.185   1.00   14.87  ? 166  GLY D N   1 
ATOM   3878 C  CA  . GLY D 1 77  ? -10.882 -9.642  8.124   1.00   13.32  ? 166  GLY D CA  1 
ATOM   3879 C  C   . GLY D 1 77  ? -9.939  -10.689 8.684   1.00   12.67  ? 166  GLY D C   1 
ATOM   3880 O  O   . GLY D 1 77  ? -8.899  -11.010 8.090   1.00   11.43  ? 166  GLY D O   1 
ATOM   3881 N  N   . PHE D 1 78  ? -10.309 -11.215 9.844   1.00   11.61  ? 167  PHE D N   1 
ATOM   3882 C  CA  . PHE D 1 78  ? -9.541  -12.261 10.500  1.00   11.30  ? 167  PHE D CA  1 
ATOM   3883 C  C   . PHE D 1 78  ? -10.502 -13.302 11.055  1.00   11.14  ? 167  PHE D C   1 
ATOM   3884 O  O   . PHE D 1 78  ? -11.505 -12.956 11.707  1.00   10.68  ? 167  PHE D O   1 
ATOM   3885 C  CB  . PHE D 1 78  ? -8.654  -11.662 11.598  1.00   10.49  ? 167  PHE D CB  1 
ATOM   3886 C  CG  . PHE D 1 78  ? -7.731  -10.588 11.092  1.00   10.53  ? 167  PHE D CG  1 
ATOM   3887 C  CD1 . PHE D 1 78  ? -8.148  -9.259  11.043  1.00   10.53  ? 167  PHE D CD1 1 
ATOM   3888 C  CD2 . PHE D 1 78  ? -6.463  -10.905 10.630  1.00   10.29  ? 167  PHE D CD2 1 
ATOM   3889 C  CE1 . PHE D 1 78  ? -7.307  -8.263  10.549  1.00   10.21  ? 167  PHE D CE1 1 
ATOM   3890 C  CE2 . PHE D 1 78  ? -5.617  -9.906  10.139  1.00   11.23  ? 167  PHE D CE2 1 
ATOM   3891 C  CZ  . PHE D 1 78  ? -6.046  -8.588  10.099  1.00   9.94   ? 167  PHE D CZ  1 
ATOM   3892 N  N   . CYS D 1 79  ? -10.178 -14.570 10.802  1.00   11.51  ? 168  CYS D N   1 
ATOM   3893 C  CA  . CYS D 1 79  ? -11.076 -15.692 11.098  1.00   13.08  ? 168  CYS D CA  1 
ATOM   3894 C  C   . CYS D 1 79  ? -10.404 -16.848 11.820  1.00   12.87  ? 168  CYS D C   1 
ATOM   3895 O  O   . CYS D 1 79  ? -9.230  -17.144 11.581  1.00   13.80  ? 168  CYS D O   1 
ATOM   3896 C  CB  . CYS D 1 79  ? -11.673 -16.262 9.797   1.00   13.38  ? 168  CYS D CB  1 
ATOM   3897 S  SG  . CYS D 1 79  ? -12.621 -15.108 8.784   1.00   15.97  ? 168  CYS D SG  1 
ATOM   3898 N  N   . ASP D 1 80  ? -11.167 -17.521 12.680  1.00   12.90  ? 169  ASP D N   1 
ATOM   3899 C  CA  . ASP D 1 80  ? -10.811 -18.873 13.130  1.00   12.84  ? 169  ASP D CA  1 
ATOM   3900 C  C   . ASP D 1 80  ? -12.018 -19.785 12.927  1.00   12.77  ? 169  ASP D C   1 
ATOM   3901 O  O   . ASP D 1 80  ? -13.098 -19.503 13.454  1.00   11.12  ? 169  ASP D O   1 
ATOM   3902 C  CB  . ASP D 1 80  ? -10.358 -18.902 14.596  1.00   12.36  ? 169  ASP D CB  1 
ATOM   3903 C  CG  . ASP D 1 80  ? -9.785  -20.255 14.996  1.00   12.90  ? 169  ASP D CG  1 
ATOM   3904 O  OD1 . ASP D 1 80  ? -10.537 -21.255 15.030  1.00   13.82  ? 169  ASP D OD1 1 
ATOM   3905 O  OD2 . ASP D 1 80  ? -8.576  -20.333 15.251  1.00   11.73  ? 169  ASP D OD2 1 
ATOM   3906 N  N   . THR D 1 81  ? -11.833 -20.856 12.148  1.00   12.62  ? 170  THR D N   1 
ATOM   3907 C  CA  . THR D 1 81  ? -12.932 -21.759 11.790  1.00   13.06  ? 170  THR D CA  1 
ATOM   3908 C  C   . THR D 1 81  ? -12.679 -23.217 12.200  1.00   13.61  ? 170  THR D C   1 
ATOM   3909 O  O   . THR D 1 81  ? -13.291 -24.150 11.663  1.00   13.11  ? 170  THR D O   1 
ATOM   3910 C  CB  . THR D 1 81  ? -13.309 -21.656 10.290  1.00   12.89  ? 170  THR D CB  1 
ATOM   3911 O  OG1 . THR D 1 81  ? -12.204 -22.050 9.466   1.00   12.08  ? 170  THR D OG1 1 
ATOM   3912 C  CG2 . THR D 1 81  ? -13.703 -20.221 9.945   1.00   14.06  ? 170  THR D CG2 1 
ATOM   3913 N  N   . THR D 1 82  ? -11.788 -23.392 13.170  1.00   14.11  ? 171  THR D N   1 
ATOM   3914 C  CA  . THR D 1 82  ? -11.477 -24.696 13.736  1.00   16.15  ? 171  THR D CA  1 
ATOM   3915 C  C   . THR D 1 82  ? -12.755 -25.487 14.032  1.00   16.83  ? 171  THR D C   1 
ATOM   3916 O  O   . THR D 1 82  ? -12.859 -26.655 13.667  1.00   17.16  ? 171  THR D O   1 
ATOM   3917 C  CB  . THR D 1 82  ? -10.632 -24.549 15.025  1.00   16.69  ? 171  THR D CB  1 
ATOM   3918 O  OG1 . THR D 1 82  ? -9.504  -23.701 14.755  1.00   17.86  ? 171  THR D OG1 1 
ATOM   3919 C  CG2 . THR D 1 82  ? -10.144 -25.905 15.519  1.00   16.30  ? 171  THR D CG2 1 
ATOM   3920 N  N   . ASN D 1 83  ? -13.712 -24.844 14.702  1.00   16.96  ? 172  ASN D N   1 
ATOM   3921 C  CA  . ASN D 1 83  ? -15.077 -25.374 14.821  1.00   17.29  ? 172  ASN D CA  1 
ATOM   3922 C  C   . ASN D 1 83  ? -15.127 -26.699 15.576  1.00   17.38  ? 172  ASN D C   1 
ATOM   3923 O  O   . ASN D 1 83  ? -15.756 -27.656 15.119  1.00   16.94  ? 172  ASN D O   1 
ATOM   3924 C  CB  . ASN D 1 83  ? -15.683 -25.536 13.424  1.00   16.91  ? 172  ASN D CB  1 
ATOM   3925 C  CG  . ASN D 1 83  ? -17.199 -25.519 13.426  1.00   17.82  ? 172  ASN D CG  1 
ATOM   3926 O  OD1 . ASN D 1 83  ? -17.835 -26.308 12.721  1.00   19.29  ? 172  ASN D OD1 1 
ATOM   3927 N  ND2 . ASN D 1 83  ? -17.786 -24.619 14.204  1.00   15.70  ? 172  ASN D ND2 1 
ATOM   3928 N  N   . LYS D 1 84  ? -14.446 -26.747 16.719  1.00   16.91  ? 173  LYS D N   1 
ATOM   3929 C  CA  . LYS D 1 84  ? -14.309 -27.971 17.490  1.00   17.50  ? 173  LYS D CA  1 
ATOM   3930 C  C   . LYS D 1 84  ? -14.861 -27.804 18.905  1.00   17.79  ? 173  LYS D C   1 
ATOM   3931 O  O   . LYS D 1 84  ? -14.795 -28.726 19.716  1.00   17.76  ? 173  LYS D O   1 
ATOM   3932 C  CB  . LYS D 1 84  ? -12.833 -28.392 17.577  1.00   17.59  ? 173  LYS D CB  1 
ATOM   3933 C  CG  . LYS D 1 84  ? -12.243 -28.944 16.290  1.00   19.18  ? 173  LYS D CG  1 
ATOM   3934 C  CD  . LYS D 1 84  ? -12.829 -30.312 15.928  1.00   20.58  ? 173  LYS D CD  1 
ATOM   3935 C  CE  . LYS D 1 84  ? -12.482 -30.683 14.480  1.00   21.77  ? 173  LYS D CE  1 
ATOM   3936 N  NZ  . LYS D 1 84  ? -13.183 -31.905 13.996  1.00   22.32  ? 173  LYS D NZ  1 
ATOM   3937 N  N   . GLY D 1 85  ? -15.394 -26.628 19.204  1.00   17.49  ? 174  GLY D N   1 
ATOM   3938 C  CA  . GLY D 1 85  ? -15.928 -26.376 20.534  1.00   18.62  ? 174  GLY D CA  1 
ATOM   3939 C  C   . GLY D 1 85  ? -14.843 -26.221 21.582  1.00   19.25  ? 174  GLY D C   1 
ATOM   3940 O  O   . GLY D 1 85  ? -15.106 -26.343 22.771  1.00   19.95  ? 174  GLY D O   1 
ATOM   3941 N  N   . LEU D 1 86  ? -13.617 -25.972 21.135  1.00   19.68  ? 175  LEU D N   1 
ATOM   3942 C  CA  . LEU D 1 86  ? -12.512 -25.692 22.035  1.00   19.61  ? 175  LEU D CA  1 
ATOM   3943 C  C   . LEU D 1 86  ? -12.128 -24.234 21.834  1.00   18.76  ? 175  LEU D C   1 
ATOM   3944 O  O   . LEU D 1 86  ? -12.142 -23.740 20.705  1.00   17.98  ? 175  LEU D O   1 
ATOM   3945 C  CB  . LEU D 1 86  ? -11.296 -26.571 21.721  1.00   20.74  ? 175  LEU D CB  1 
ATOM   3946 C  CG  . LEU D 1 86  ? -11.363 -28.101 21.804  1.00   22.62  ? 175  LEU D CG  1 
ATOM   3947 C  CD1 . LEU D 1 86  ? -10.028 -28.664 21.364  1.00   22.54  ? 175  LEU D CD1 1 
ATOM   3948 C  CD2 . LEU D 1 86  ? -11.721 -28.603 23.200  1.00   22.15  ? 175  LEU D CD2 1 
ATOM   3949 N  N   . PHE D 1 87  ? -11.782 -23.560 22.926  1.00   17.84  ? 176  PHE D N   1 
ATOM   3950 C  CA  . PHE D 1 87  ? -11.289 -22.181 22.883  1.00   17.35  ? 176  PHE D CA  1 
ATOM   3951 C  C   . PHE D 1 87  ? -10.242 -21.944 21.788  1.00   16.74  ? 176  PHE D C   1 
ATOM   3952 O  O   . PHE D 1 87  ? -9.249  -22.666 21.708  1.00   17.95  ? 176  PHE D O   1 
ATOM   3953 C  CB  . PHE D 1 87  ? -10.636 -21.831 24.216  1.00   17.51  ? 176  PHE D CB  1 
ATOM   3954 C  CG  . PHE D 1 87  ? -11.593 -21.716 25.365  1.00   17.95  ? 176  PHE D CG  1 
ATOM   3955 C  CD1 . PHE D 1 87  ? -11.237 -22.190 26.621  1.00   18.56  ? 176  PHE D CD1 1 
ATOM   3956 C  CD2 . PHE D 1 87  ? -12.827 -21.111 25.208  1.00   17.88  ? 176  PHE D CD2 1 
ATOM   3957 C  CE1 . PHE D 1 87  ? -12.100 -22.071 27.696  1.00   19.16  ? 176  PHE D CE1 1 
ATOM   3958 C  CE2 . PHE D 1 87  ? -13.693 -20.987 26.285  1.00   19.35  ? 176  PHE D CE2 1 
ATOM   3959 C  CZ  . PHE D 1 87  ? -13.330 -21.462 27.526  1.00   18.75  ? 176  PHE D CZ  1 
ATOM   3960 N  N   . GLN D 1 88  ? -10.462 -20.932 20.954  1.00   15.85  ? 177  GLN D N   1 
ATOM   3961 C  CA  . GLN D 1 88  ? -9.439  -20.442 20.017  1.00   14.87  ? 177  GLN D CA  1 
ATOM   3962 C  C   . GLN D 1 88  ? -9.498  -18.934 20.052  1.00   14.22  ? 177  GLN D C   1 
ATOM   3963 O  O   . GLN D 1 88  ? -10.581 -18.368 20.176  1.00   14.50  ? 177  GLN D O   1 
ATOM   3964 C  CB  . GLN D 1 88  ? -9.706  -20.895 18.580  1.00   14.79  ? 177  GLN D CB  1 
ATOM   3965 C  CG  . GLN D 1 88  ? -10.214 -22.311 18.434  1.00   16.19  ? 177  GLN D CG  1 
ATOM   3966 C  CD  . GLN D 1 88  ? -9.131  -23.363 18.569  1.00   16.77  ? 177  GLN D CD  1 
ATOM   3967 O  OE1 . GLN D 1 88  ? -7.937  -23.060 18.539  1.00   15.85  ? 177  GLN D OE1 1 
ATOM   3968 N  NE2 . GLN D 1 88  ? -9.548  -24.621 18.694  1.00   17.76  ? 177  GLN D NE2 1 
ATOM   3969 N  N   . VAL D 1 89  ? -8.344  -18.287 19.948  1.00   13.49  ? 178  VAL D N   1 
ATOM   3970 C  CA  . VAL D 1 89  ? -8.279  -16.826 19.931  1.00   13.28  ? 178  VAL D CA  1 
ATOM   3971 C  C   . VAL D 1 89  ? -7.986  -16.326 18.531  1.00   13.45  ? 178  VAL D C   1 
ATOM   3972 O  O   . VAL D 1 89  ? -6.920  -16.594 17.976  1.00   13.40  ? 178  VAL D O   1 
ATOM   3973 C  CB  . VAL D 1 89  ? -7.215  -16.293 20.902  1.00   13.39  ? 178  VAL D CB  1 
ATOM   3974 C  CG1 . VAL D 1 89  ? -7.040  -14.778 20.750  1.00   13.51  ? 178  VAL D CG1 1 
ATOM   3975 C  CG2 . VAL D 1 89  ? -7.608  -16.628 22.334  1.00   12.94  ? 178  VAL D CG2 1 
ATOM   3976 N  N   . VAL D 1 90  ? -8.951  -15.617 17.954  1.00   12.59  ? 179  VAL D N   1 
ATOM   3977 C  CA  . VAL D 1 90  ? -8.749  -14.953 16.682  1.00   12.17  ? 179  VAL D CA  1 
ATOM   3978 C  C   . VAL D 1 90  ? -8.162  -13.571 16.977  1.00   11.71  ? 179  VAL D C   1 
ATOM   3979 O  O   . VAL D 1 90  ? -8.635  -12.858 17.868  1.00   12.30  ? 179  VAL D O   1 
ATOM   3980 C  CB  . VAL D 1 90  ? -10.080 -14.854 15.862  1.00   12.19  ? 179  VAL D CB  1 
ATOM   3981 C  CG1 . VAL D 1 90  ? -11.044 -13.830 16.467  1.00   12.01  ? 179  VAL D CG1 1 
ATOM   3982 C  CG2 . VAL D 1 90  ? -9.798  -14.535 14.390  1.00   12.33  ? 179  VAL D CG2 1 
ATOM   3983 N  N   . SER D 1 91  ? -7.114  -13.204 16.252  1.00   10.70  ? 180  SER D N   1 
ATOM   3984 C  CA  . SER D 1 91  ? -6.487  -11.905 16.442  1.00   9.24   ? 180  SER D CA  1 
ATOM   3985 C  C   . SER D 1 91  ? -6.304  -11.163 15.129  1.00   8.48   ? 180  SER D C   1 
ATOM   3986 O  O   . SER D 1 91  ? -6.385  -11.742 14.050  1.00   6.74   ? 180  SER D O   1 
ATOM   3987 C  CB  . SER D 1 91  ? -5.135  -12.048 17.151  1.00   9.70   ? 180  SER D CB  1 
ATOM   3988 O  OG  . SER D 1 91  ? -4.206  -12.755 16.345  1.00   10.91  ? 180  SER D OG  1 
ATOM   3989 N  N   . GLY D 1 92  ? -6.075  -9.859  15.235  1.00   8.80   ? 181  GLY D N   1 
ATOM   3990 C  CA  . GLY D 1 92  ? -5.791  -9.043  14.069  1.00   8.52   ? 181  GLY D CA  1 
ATOM   3991 C  C   . GLY D 1 92  ? -5.520  -7.641  14.547  1.00   9.03   ? 181  GLY D C   1 
ATOM   3992 O  O   . GLY D 1 92  ? -5.731  -7.328  15.714  1.00   9.46   ? 181  GLY D O   1 
ATOM   3993 N  N   . GLY D 1 93  ? -5.072  -6.785  13.644  1.00   9.48   ? 182  GLY D N   1 
ATOM   3994 C  CA  . GLY D 1 93  ? -4.738  -5.423  14.006  1.00   9.56   ? 182  GLY D CA  1 
ATOM   3995 C  C   . GLY D 1 93  ? -4.193  -4.680  12.814  1.00   10.25  ? 182  GLY D C   1 
ATOM   3996 O  O   . GLY D 1 93  ? -3.766  -5.293  11.829  1.00   10.52  ? 182  GLY D O   1 
ATOM   3997 N  N   . MET D 1 94  ? -4.214  -3.354  12.895  1.00   10.56  ? 183  MET D N   1 
ATOM   3998 C  CA  . MET D 1 94  ? -3.666  -2.520  11.839  1.00   11.43  ? 183  MET D CA  1 
ATOM   3999 C  C   . MET D 1 94  ? -3.470  -1.087  12.294  1.00   10.98  ? 183  MET D C   1 
ATOM   4000 O  O   . MET D 1 94  ? -4.083  -0.633  13.272  1.00   10.29  ? 183  MET D O   1 
ATOM   4001 C  CB  . MET D 1 94  ? -4.581  -2.534  10.616  1.00   12.05  ? 183  MET D CB  1 
ATOM   4002 C  CG  . MET D 1 94  ? -6.022  -2.142  10.907  1.00   14.62  ? 183  MET D CG  1 
ATOM   4003 S  SD  . MET D 1 94  ? -7.051  -2.232  9.418   1.00   15.89  ? 183  MET D SD  1 
ATOM   4004 C  CE  A MET D 1 94  ? -6.396  -0.860  8.492   0.50   13.76  ? 183  MET D CE  1 
ATOM   4005 C  CE  B MET D 1 94  ? -6.869  -3.970  9.027   0.50   14.70  ? 183  MET D CE  1 
ATOM   4006 N  N   . VAL D 1 95  ? -2.613  -0.376  11.573  1.00   10.68  ? 184  VAL D N   1 
ATOM   4007 C  CA  . VAL D 1 95  ? -2.510  1.070   11.720  1.00   10.69  ? 184  VAL D CA  1 
ATOM   4008 C  C   . VAL D 1 95  ? -3.571  1.761   10.869  1.00   11.45  ? 184  VAL D C   1 
ATOM   4009 O  O   . VAL D 1 95  ? -3.718  1.456   9.676   1.00   11.56  ? 184  VAL D O   1 
ATOM   4010 C  CB  . VAL D 1 95  ? -1.107  1.575   11.329  1.00   10.32  ? 184  VAL D CB  1 
ATOM   4011 C  CG1 . VAL D 1 95  ? -1.026  3.102   11.433  1.00   9.36   ? 184  VAL D CG1 1 
ATOM   4012 C  CG2 . VAL D 1 95  ? -0.039  0.918   12.221  1.00   10.16  ? 184  VAL D CG2 1 
ATOM   4013 N  N   . LEU D 1 96  ? -4.319  2.679   11.481  1.00   12.00  ? 185  LEU D N   1 
ATOM   4014 C  CA  . LEU D 1 96  ? -5.293  3.510   10.744  1.00   12.38  ? 185  LEU D CA  1 
ATOM   4015 C  C   . LEU D 1 96  ? -5.010  5.001   10.909  1.00   12.77  ? 185  LEU D C   1 
ATOM   4016 O  O   . LEU D 1 96  ? -4.866  5.489   12.034  1.00   12.44  ? 185  LEU D O   1 
ATOM   4017 C  CB  . LEU D 1 96  ? -6.730  3.241   11.214  1.00   12.11  ? 185  LEU D CB  1 
ATOM   4018 C  CG  . LEU D 1 96  ? -7.501  1.990   10.781  1.00   12.24  ? 185  LEU D CG  1 
ATOM   4019 C  CD1 . LEU D 1 96  ? -8.763  1.867   11.629  1.00   13.29  ? 185  LEU D CD1 1 
ATOM   4020 C  CD2 . LEU D 1 96  ? -7.855  2.048   9.290   1.00   12.59  ? 185  LEU D CD2 1 
ATOM   4021 N  N   . GLN D 1 97  ? -4.932  5.728   9.795   1.00   13.10  ? 186  GLN D N   1 
ATOM   4022 C  CA  . GLN D 1 97  ? -4.842  7.178   9.875   1.00   14.41  ? 186  GLN D CA  1 
ATOM   4023 C  C   . GLN D 1 97  ? -6.263  7.724   9.982   1.00   14.72  ? 186  GLN D C   1 
ATOM   4024 O  O   . GLN D 1 97  ? -7.095  7.494   9.099   1.00   15.14  ? 186  GLN D O   1 
ATOM   4025 C  CB  . GLN D 1 97  ? -4.125  7.772   8.662   1.00   15.43  ? 186  GLN D CB  1 
ATOM   4026 C  CG  . GLN D 1 97  ? -3.756  9.231   8.880   1.00   16.65  ? 186  GLN D CG  1 
ATOM   4027 C  CD  . GLN D 1 97  ? -3.200  9.912   7.653   1.00   18.85  ? 186  GLN D CD  1 
ATOM   4028 O  OE1 . GLN D 1 97  ? -2.637  11.005  7.749   1.00   20.93  ? 186  GLN D OE1 1 
ATOM   4029 N  NE2 . GLN D 1 97  ? -3.353  9.283   6.494   1.00   19.19  ? 186  GLN D NE2 1 
ATOM   4030 N  N   . LEU D 1 98  ? -6.554  8.411   11.081  1.00   14.32  ? 187  LEU D N   1 
ATOM   4031 C  CA  . LEU D 1 98  ? -7.913  8.859   11.340  1.00   13.55  ? 187  LEU D CA  1 
ATOM   4032 C  C   . LEU D 1 98  ? -8.011  10.382  11.358  1.00   14.13  ? 187  LEU D C   1 
ATOM   4033 O  O   . LEU D 1 98  ? -7.048  11.077  11.691  1.00   13.28  ? 187  LEU D O   1 
ATOM   4034 C  CB  . LEU D 1 98  ? -8.426  8.278   12.667  1.00   12.90  ? 187  LEU D CB  1 
ATOM   4035 C  CG  . LEU D 1 98  ? -8.511  6.744   12.766  1.00   13.05  ? 187  LEU D CG  1 
ATOM   4036 C  CD1 . LEU D 1 98  ? -8.963  6.291   14.157  1.00   11.55  ? 187  LEU D CD1 1 
ATOM   4037 C  CD2 . LEU D 1 98  ? -9.406  6.137   11.668  1.00   10.74  ? 187  LEU D CD2 1 
ATOM   4038 N  N   . GLN D 1 99  ? -9.185  10.890  10.995  1.00   14.36  ? 188  GLN D N   1 
ATOM   4039 C  CA  . GLN D 1 99  ? -9.483  12.309  11.138  1.00   14.84  ? 188  GLN D CA  1 
ATOM   4040 C  C   . GLN D 1 99  ? -10.436 12.498  12.315  1.00   14.39  ? 188  GLN D C   1 
ATOM   4041 O  O   . GLN D 1 99  ? -11.058 11.546  12.777  1.00   13.43  ? 188  GLN D O   1 
ATOM   4042 C  CB  . GLN D 1 99  ? -10.114 12.860  9.860   1.00   15.24  ? 188  GLN D CB  1 
ATOM   4043 C  CG  . GLN D 1 99  ? -9.344  12.537  8.599   1.00   17.89  ? 188  GLN D CG  1 
ATOM   4044 C  CD  . GLN D 1 99  ? -10.134 12.852  7.334   1.00   20.14  ? 188  GLN D CD  1 
ATOM   4045 O  OE1 . GLN D 1 99  ? -10.543 13.994  7.108   1.00   20.56  ? 188  GLN D OE1 1 
ATOM   4046 N  NE2 . GLN D 1 99  ? -10.347 11.832  6.498   1.00   21.37  ? 188  GLN D NE2 1 
ATOM   4047 N  N   . GLN D 1 100 ? -10.552 13.740  12.773  1.00   14.65  ? 189  GLN D N   1 
ATOM   4048 C  CA  . GLN D 1 100 ? -11.435 14.099  13.869  1.00   14.96  ? 189  GLN D CA  1 
ATOM   4049 C  C   . GLN D 1 100 ? -12.827 13.565  13.607  1.00   13.92  ? 189  GLN D C   1 
ATOM   4050 O  O   . GLN D 1 100 ? -13.350 13.707  12.511  1.00   12.50  ? 189  GLN D O   1 
ATOM   4051 C  CB  . GLN D 1 100 ? -11.484 15.620  13.993  1.00   16.05  ? 189  GLN D CB  1 
ATOM   4052 C  CG  . GLN D 1 100 ? -12.160 16.153  15.248  1.00   18.31  ? 189  GLN D CG  1 
ATOM   4053 C  CD  . GLN D 1 100 ? -12.557 17.608  15.082  1.00   19.91  ? 189  GLN D CD  1 
ATOM   4054 O  OE1 . GLN D 1 100 ? -12.973 18.034  13.990  1.00   20.20  ? 189  GLN D OE1 1 
ATOM   4055 N  NE2 . GLN D 1 100 ? -12.433 18.380  16.154  1.00   21.15  ? 189  GLN D NE2 1 
ATOM   4056 N  N   . GLY D 1 101 ? -13.424 12.942  14.614  1.00   14.12  ? 190  GLY D N   1 
ATOM   4057 C  CA  . GLY D 1 101 ? -14.773 12.392  14.464  1.00   13.76  ? 190  GLY D CA  1 
ATOM   4058 C  C   . GLY D 1 101 ? -14.878 11.008  13.836  1.00   13.43  ? 190  GLY D C   1 
ATOM   4059 O  O   . GLY D 1 101 ? -15.948 10.398  13.870  1.00   13.53  ? 190  GLY D O   1 
ATOM   4060 N  N   . ASP D 1 102 ? -13.793 10.499  13.250  1.00   12.92  ? 191  ASP D N   1 
ATOM   4061 C  CA  . ASP D 1 102 ? -13.819 9.129   12.720  1.00   12.08  ? 191  ASP D CA  1 
ATOM   4062 C  C   . ASP D 1 102 ? -14.080 8.137   13.849  1.00   11.04  ? 191  ASP D C   1 
ATOM   4063 O  O   . ASP D 1 102 ? -13.614 8.327   14.966  1.00   10.24  ? 191  ASP D O   1 
ATOM   4064 C  CB  . ASP D 1 102 ? -12.504 8.769   12.020  1.00   12.79  ? 191  ASP D CB  1 
ATOM   4065 C  CG  . ASP D 1 102 ? -12.336 9.471   10.685  1.00   13.29  ? 191  ASP D CG  1 
ATOM   4066 O  OD1 . ASP D 1 102 ? -11.272 9.285   10.057  1.00   14.35  ? 191  ASP D OD1 1 
ATOM   4067 O  OD2 . ASP D 1 102 ? -13.249 10.221  10.270  1.00   15.01  ? 191  ASP D OD2 1 
ATOM   4068 N  N   . GLN D 1 103 ? -14.825 7.082   13.540  1.00   10.72  ? 192  GLN D N   1 
ATOM   4069 C  CA  . GLN D 1 103 ? -15.150 6.042   14.502  1.00   11.20  ? 192  GLN D CA  1 
ATOM   4070 C  C   . GLN D 1 103 ? -14.594 4.714   14.030  1.00   10.44  ? 192  GLN D C   1 
ATOM   4071 O  O   . GLN D 1 103 ? -14.468 4.469   12.825  1.00   10.37  ? 192  GLN D O   1 
ATOM   4072 C  CB  . GLN D 1 103 ? -16.664 5.950   14.704  1.00   12.34  ? 192  GLN D CB  1 
ATOM   4073 C  CG  . GLN D 1 103 ? -17.276 7.247   15.203  1.00   14.47  ? 192  GLN D CG  1 
ATOM   4074 C  CD  . GLN D 1 103 ? -18.766 7.139   15.478  1.00   17.20  ? 192  GLN D CD  1 
ATOM   4075 O  OE1 . GLN D 1 103 ? -19.305 6.049   15.692  1.00   17.43  ? 192  GLN D OE1 1 
ATOM   4076 N  NE2 . GLN D 1 103 ? -19.443 8.282   15.463  1.00   18.18  ? 192  GLN D NE2 1 
ATOM   4077 N  N   . VAL D 1 104 ? -14.229 3.872   14.985  1.00   9.18   ? 193  VAL D N   1 
ATOM   4078 C  CA  . VAL D 1 104 ? -13.594 2.604   14.689  1.00   8.70   ? 193  VAL D CA  1 
ATOM   4079 C  C   . VAL D 1 104 ? -14.174 1.536   15.598  1.00   9.17   ? 193  VAL D C   1 
ATOM   4080 O  O   . VAL D 1 104 ? -14.292 1.735   16.811  1.00   10.15  ? 193  VAL D O   1 
ATOM   4081 C  CB  . VAL D 1 104 ? -12.070 2.679   14.889  1.00   8.52   ? 193  VAL D CB  1 
ATOM   4082 C  CG1 . VAL D 1 104 ? -11.410 1.324   14.601  1.00   8.04   ? 193  VAL D CG1 1 
ATOM   4083 C  CG2 . VAL D 1 104 ? -11.466 3.746   14.006  1.00   7.72   ? 193  VAL D CG2 1 
ATOM   4084 N  N   . TRP D 1 105 ? -14.547 0.408   15.014  1.00   9.60   ? 194  TRP D N   1 
ATOM   4085 C  CA  . TRP D 1 105 ? -15.136 -0.676  15.784  1.00   9.74   ? 194  TRP D CA  1 
ATOM   4086 C  C   . TRP D 1 105 ? -14.840 -2.052  15.187  1.00   9.47   ? 194  TRP D C   1 
ATOM   4087 O  O   . TRP D 1 105 ? -14.338 -2.187  14.059  1.00   9.14   ? 194  TRP D O   1 
ATOM   4088 C  CB  . TRP D 1 105 ? -16.660 -0.475  15.923  1.00   10.35  ? 194  TRP D CB  1 
ATOM   4089 C  CG  . TRP D 1 105 ? -17.402 -0.586  14.616  1.00   11.25  ? 194  TRP D CG  1 
ATOM   4090 C  CD1 . TRP D 1 105 ? -17.976 -1.704  14.082  1.00   11.94  ? 194  TRP D CD1 1 
ATOM   4091 C  CD2 . TRP D 1 105 ? -17.625 0.467   13.675  1.00   11.52  ? 194  TRP D CD2 1 
ATOM   4092 N  NE1 . TRP D 1 105 ? -18.551 -1.407  12.857  1.00   12.04  ? 194  TRP D NE1 1 
ATOM   4093 C  CE2 . TRP D 1 105 ? -18.345 -0.077  12.593  1.00   12.43  ? 194  TRP D CE2 1 
ATOM   4094 C  CE3 . TRP D 1 105 ? -17.278 1.816   13.639  1.00   12.64  ? 194  TRP D CE3 1 
ATOM   4095 C  CZ2 . TRP D 1 105 ? -18.728 0.688   11.494  1.00   12.70  ? 194  TRP D CZ2 1 
ATOM   4096 C  CZ3 . TRP D 1 105 ? -17.664 2.572   12.545  1.00   12.98  ? 194  TRP D CZ3 1 
ATOM   4097 C  CH2 . TRP D 1 105 ? -18.377 2.006   11.491  1.00   12.34  ? 194  TRP D CH2 1 
ATOM   4098 N  N   . VAL D 1 106 ? -15.178 -3.078  15.955  1.00   9.71   ? 195  VAL D N   1 
ATOM   4099 C  CA  . VAL D 1 106 ? -15.051 -4.447  15.501  1.00   10.30  ? 195  VAL D CA  1 
ATOM   4100 C  C   . VAL D 1 106 ? -16.412 -5.014  15.089  1.00   11.13  ? 195  VAL D C   1 
ATOM   4101 O  O   . VAL D 1 106 ? -17.395 -4.924  15.834  1.00   10.76  ? 195  VAL D O   1 
ATOM   4102 C  CB  . VAL D 1 106 ? -14.438 -5.342  16.604  1.00   10.25  ? 195  VAL D CB  1 
ATOM   4103 C  CG1 . VAL D 1 106 ? -14.374 -6.793  16.122  1.00   10.31  ? 195  VAL D CG1 1 
ATOM   4104 C  CG2 . VAL D 1 106 ? -13.058 -4.827  16.985  1.00   8.69   ? 195  VAL D CG2 1 
ATOM   4105 N  N   . GLU D 1 107 ? -16.465 -5.595  13.898  1.00   11.79  ? 196  GLU D N   1 
ATOM   4106 C  CA  . GLU D 1 107 ? -17.689 -6.206  13.415  1.00   13.64  ? 196  GLU D CA  1 
ATOM   4107 C  C   . GLU D 1 107 ? -17.483 -7.683  13.140  1.00   14.04  ? 196  GLU D C   1 
ATOM   4108 O  O   . GLU D 1 107 ? -16.413 -8.091  12.694  1.00   14.04  ? 196  GLU D O   1 
ATOM   4109 C  CB  . GLU D 1 107 ? -18.193 -5.503  12.157  1.00   15.07  ? 196  GLU D CB  1 
ATOM   4110 C  CG  . GLU D 1 107 ? -19.449 -4.710  12.402  1.00   17.72  ? 196  GLU D CG  1 
ATOM   4111 C  CD  . GLU D 1 107 ? -19.913 -3.964  11.188  1.00   18.40  ? 196  GLU D CD  1 
ATOM   4112 O  OE1 . GLU D 1 107 ? -20.291 -4.617  10.200  1.00   20.18  ? 196  GLU D OE1 1 
ATOM   4113 O  OE2 . GLU D 1 107 ? -19.913 -2.719  11.236  1.00   20.87  ? 196  GLU D OE2 1 
ATOM   4114 N  N   . LYS D 1 108 ? -18.505 -8.480  13.434  1.00   15.30  ? 197  LYS D N   1 
ATOM   4115 C  CA  . LYS D 1 108 ? -18.473 -9.896  13.129  1.00   16.11  ? 197  LYS D CA  1 
ATOM   4116 C  C   . LYS D 1 108 ? -19.221 -10.186 11.835  1.00   17.18  ? 197  LYS D C   1 
ATOM   4117 O  O   . LYS D 1 108 ? -20.094 -9.414  11.412  1.00   17.09  ? 197  LYS D O   1 
ATOM   4118 C  CB  . LYS D 1 108 ? -19.041 -10.724 14.289  1.00   16.19  ? 197  LYS D CB  1 
ATOM   4119 C  CG  . LYS D 1 108 ? -20.483 -10.426 14.621  1.00   16.82  ? 197  LYS D CG  1 
ATOM   4120 C  CD  . LYS D 1 108 ? -20.921 -11.142 15.888  1.00   17.66  ? 197  LYS D CD  1 
ATOM   4121 C  CE  . LYS D 1 108 ? -22.344 -10.771 16.251  1.00   18.40  ? 197  LYS D CE  1 
ATOM   4122 N  NZ  . LYS D 1 108 ? -23.257 -10.951 15.088  1.00   17.96  ? 197  LYS D NZ  1 
ATOM   4123 N  N   . ASP D 1 109 ? -18.853 -11.286 11.190  1.00   17.91  ? 198  ASP D N   1 
ATOM   4124 C  CA  . ASP D 1 109 ? -19.568 -11.734 10.012  1.00   18.97  ? 198  ASP D CA  1 
ATOM   4125 C  C   . ASP D 1 109 ? -20.867 -12.401 10.473  1.00   18.60  ? 198  ASP D C   1 
ATOM   4126 O  O   . ASP D 1 109 ? -20.846 -13.276 11.329  1.00   17.74  ? 198  ASP D O   1 
ATOM   4127 C  CB  . ASP D 1 109 ? -18.708 -12.705 9.203   1.00   19.76  ? 198  ASP D CB  1 
ATOM   4128 C  CG  . ASP D 1 109 ? -19.472 -13.350 8.059   1.00   20.73  ? 198  ASP D CG  1 
ATOM   4129 O  OD1 . ASP D 1 109 ? -20.443 -14.075 8.330   1.00   21.01  ? 198  ASP D OD1 1 
ATOM   4130 O  OD2 . ASP D 1 109 ? -19.105 -13.133 6.887   1.00   22.38  ? 198  ASP D OD2 1 
ATOM   4131 N  N   . PRO D 1 110 ? -22.007 -11.968 9.915   1.00   19.02  ? 199  PRO D N   1 
ATOM   4132 C  CA  . PRO D 1 110 ? -23.300 -12.494 10.353  1.00   19.25  ? 199  PRO D CA  1 
ATOM   4133 C  C   . PRO D 1 110 ? -23.389 -14.029 10.302  1.00   19.74  ? 199  PRO D C   1 
ATOM   4134 O  O   . PRO D 1 110 ? -24.142 -14.618 11.077  1.00   19.80  ? 199  PRO D O   1 
ATOM   4135 C  CB  . PRO D 1 110 ? -24.307 -11.849 9.386   1.00   18.78  ? 199  PRO D CB  1 
ATOM   4136 C  CG  . PRO D 1 110 ? -23.486 -11.221 8.286   1.00   19.01  ? 199  PRO D CG  1 
ATOM   4137 C  CD  . PRO D 1 110 ? -22.137 -10.946 8.858   1.00   19.01  ? 199  PRO D CD  1 
ATOM   4138 N  N   . LYS D 1 111 ? -22.624 -14.663 9.415   1.00   19.72  ? 200  LYS D N   1 
ATOM   4139 C  CA  . LYS D 1 111 ? -22.634 -16.123 9.297   1.00   21.15  ? 200  LYS D CA  1 
ATOM   4140 C  C   . LYS D 1 111 ? -21.594 -16.823 10.180  1.00   21.27  ? 200  LYS D C   1 
ATOM   4141 O  O   . LYS D 1 111 ? -21.523 -18.055 10.213  1.00   20.87  ? 200  LYS D O   1 
ATOM   4142 C  CB  . LYS D 1 111 ? -22.428 -16.553 7.839   1.00   21.62  ? 200  LYS D CB  1 
ATOM   4143 C  CG  . LYS D 1 111 ? -23.398 -15.920 6.848   1.00   23.41  ? 200  LYS D CG  1 
ATOM   4144 C  CD  . LYS D 1 111 ? -24.827 -15.913 7.378   1.00   25.04  ? 200  LYS D CD  1 
ATOM   4145 C  CE  . LYS D 1 111 ? -25.600 -14.719 6.816   1.00   26.97  ? 200  LYS D CE  1 
ATOM   4146 N  NZ  . LYS D 1 111 ? -27.025 -14.685 7.232   1.00   27.93  ? 200  LYS D NZ  1 
ATOM   4147 N  N   . LYS D 1 112 ? -20.775 -16.041 10.875  1.00   21.37  ? 201  LYS D N   1 
ATOM   4148 C  CA  . LYS D 1 112 ? -19.539 -16.657 11.522  0.0000 17.72  ? 201  LYS D CA  1 
ATOM   4149 C  C   . LYS D 1 112 ? -19.226 -15.644 12.607  1.00   13.10  ? 201  LYS D C   1 
ATOM   4150 O  O   . LYS D 1 112 ? -18.338 -14.788 12.605  1.00   10.83  ? 201  LYS D O   1 
ATOM   4151 C  CB  . LYS D 1 112 ? -18.247 -16.855 10.723  0.0000 17.88  ? 201  LYS D CB  1 
ATOM   4152 C  CG  . LYS D 1 112 ? -18.274 -18.007 9.712   0.0000 18.71  ? 201  LYS D CG  1 
ATOM   4153 C  CD  . LYS D 1 112 ? -17.147 -17.862 8.695   0.0000 19.16  ? 201  LYS D CD  1 
ATOM   4154 C  CE  . LYS D 1 112 ? -17.029 -19.090 7.821   0.0000 20.65  ? 201  LYS D CE  1 
ATOM   4155 N  NZ  . LYS D 1 112 ? -18.355 -19.488 7.260   0.0000 20.65  ? 201  LYS D NZ  1 
ATOM   4156 N  N   . GLY D 1 113 ? -19.979 -15.899 13.672  1.00   13.61  ? 202  GLY D N   1 
ATOM   4157 C  CA  . GLY D 1 113 ? -20.241 -14.876 14.669  1.00   14.54  ? 202  GLY D CA  1 
ATOM   4158 C  C   . GLY D 1 113 ? -20.127 -15.355 16.105  1.00   15.55  ? 202  GLY D C   1 
ATOM   4159 O  O   . GLY D 1 113 ? -20.431 -14.609 17.034  1.00   15.64  ? 202  GLY D O   1 
ATOM   4160 N  N   . HIS D 1 114 ? -19.686 -16.591 16.313  1.00   15.86  ? 203  HIS D N   1 
ATOM   4161 C  CA  . HIS D 1 114 ? -19.601 -17.087 17.687  1.00   16.19  ? 203  HIS D CA  1 
ATOM   4162 C  C   . HIS D 1 114 ? -18.484 -16.462 18.507  1.00   15.95  ? 203  HIS D C   1 
ATOM   4163 O  O   . HIS D 1 114 ? -17.295 -16.685 18.258  1.00   16.49  ? 203  HIS D O   1 
ATOM   4164 C  CB  . HIS D 1 114 ? -19.484 -18.609 17.767  1.00   16.79  ? 203  HIS D CB  1 
ATOM   4165 C  CG  . HIS D 1 114 ? -19.365 -19.115 19.177  1.00   18.14  ? 203  HIS D CG  1 
ATOM   4166 N  ND1 . HIS D 1 114 ? -18.149 -19.345 19.791  1.00   18.31  ? 203  HIS D ND1 1 
ATOM   4167 C  CD2 . HIS D 1 114 ? -20.311 -19.397 20.104  1.00   18.07  ? 203  HIS D CD2 1 
ATOM   4168 C  CE1 . HIS D 1 114 ? -18.352 -19.764 21.026  1.00   18.14  ? 203  HIS D CE1 1 
ATOM   4169 N  NE2 . HIS D 1 114 ? -19.655 -19.803 21.242  1.00   19.41  ? 203  HIS D NE2 1 
ATOM   4170 N  N   . ILE D 1 115 ? -18.878 -15.699 19.514  1.00   15.57  ? 204  ILE D N   1 
ATOM   4171 C  CA  . ILE D 1 115 ? -17.929 -15.162 20.470  1.00   15.15  ? 204  ILE D CA  1 
ATOM   4172 C  C   . ILE D 1 115 ? -18.256 -15.717 21.851  1.00   16.07  ? 204  ILE D C   1 
ATOM   4173 O  O   . ILE D 1 115 ? -19.382 -15.605 22.313  1.00   16.15  ? 204  ILE D O   1 
ATOM   4174 C  CB  . ILE D 1 115 ? -17.971 -13.629 20.494  1.00   14.69  ? 204  ILE D CB  1 
ATOM   4175 C  CG1 . ILE D 1 115 ? -17.580 -13.075 19.119  1.00   12.96  ? 204  ILE D CG1 1 
ATOM   4176 C  CG2 . ILE D 1 115 ? -17.076 -13.083 21.618  1.00   14.18  ? 204  ILE D CG2 1 
ATOM   4177 C  CD1 . ILE D 1 115 ? -17.778 -11.578 18.971  1.00   12.94  ? 204  ILE D CD1 1 
ATOM   4178 N  N   . TYR D 1 116 ? -17.268 -16.325 22.493  1.00   16.94  ? 205  TYR D N   1 
ATOM   4179 C  CA  . TYR D 1 116 ? -17.444 -16.923 23.807  1.00   17.80  ? 205  TYR D CA  1 
ATOM   4180 C  C   . TYR D 1 116 ? -18.127 -15.992 24.816  1.00   18.94  ? 205  TYR D C   1 
ATOM   4181 O  O   . TYR D 1 116 ? -17.812 -14.804 24.892  1.00   18.94  ? 205  TYR D O   1 
ATOM   4182 C  CB  . TYR D 1 116 ? -16.086 -17.381 24.340  1.00   17.52  ? 205  TYR D CB  1 
ATOM   4183 C  CG  . TYR D 1 116 ? -16.099 -17.878 25.767  1.00   18.46  ? 205  TYR D CG  1 
ATOM   4184 C  CD1 . TYR D 1 116 ? -16.507 -19.168 26.071  1.00   18.19  ? 205  TYR D CD1 1 
ATOM   4185 C  CD2 . TYR D 1 116 ? -15.681 -17.059 26.811  1.00   18.73  ? 205  TYR D CD2 1 
ATOM   4186 C  CE1 . TYR D 1 116 ? -16.514 -19.625 27.377  1.00   18.18  ? 205  TYR D CE1 1 
ATOM   4187 C  CE2 . TYR D 1 116 ? -15.685 -17.507 28.112  1.00   18.42  ? 205  TYR D CE2 1 
ATOM   4188 C  CZ  . TYR D 1 116 ? -16.103 -18.793 28.388  1.00   18.30  ? 205  TYR D CZ  1 
ATOM   4189 O  OH  . TYR D 1 116 ? -16.099 -19.239 29.686  1.00   19.57  ? 205  TYR D OH  1 
ATOM   4190 N  N   . GLN D 1 117 ? -19.076 -16.536 25.569  1.00   19.86  ? 206  GLN D N   1 
ATOM   4191 C  CA  . GLN D 1 117 ? -19.684 -15.824 26.693  1.00   21.42  ? 206  GLN D CA  1 
ATOM   4192 C  C   . GLN D 1 117 ? -19.486 -16.662 27.948  1.00   21.95  ? 206  GLN D C   1 
ATOM   4193 O  O   . GLN D 1 117 ? -19.939 -17.804 28.018  1.00   21.54  ? 206  GLN D O   1 
ATOM   4194 C  CB  . GLN D 1 117 ? -21.179 -15.577 26.454  1.00   22.71  ? 206  GLN D CB  1 
ATOM   4195 C  CG  . GLN D 1 117 ? -21.987 -15.295 27.737  1.00   25.06  ? 206  GLN D CG  1 
ATOM   4196 C  CD  . GLN D 1 117 ? -23.295 -14.542 27.486  1.00   26.75  ? 206  GLN D CD  1 
ATOM   4197 O  OE1 . GLN D 1 117 ? -23.577 -14.101 26.364  1.00   28.69  ? 206  GLN D OE1 1 
ATOM   4198 N  NE2 . GLN D 1 117 ? -24.099 -14.385 28.541  1.00   27.83  ? 206  GLN D NE2 1 
ATOM   4199 N  N   . GLY D 1 118 ? -18.788 -16.104 28.930  1.00   22.29  ? 207  GLY D N   1 
ATOM   4200 C  CA  . GLY D 1 118 ? -18.554 -16.804 30.184  1.00   23.28  ? 207  GLY D CA  1 
ATOM   4201 C  C   . GLY D 1 118 ? -17.454 -16.121 30.964  1.00   23.96  ? 207  GLY D C   1 
ATOM   4202 O  O   . GLY D 1 118 ? -16.915 -15.109 30.530  1.00   23.35  ? 207  GLY D O   1 
ATOM   4203 N  N   . SER D 1 119 ? -17.109 -16.669 32.119  1.00   24.59  ? 208  SER D N   1 
ATOM   4204 C  CA  . SER D 1 119 ? -16.109 -16.017 32.953  1.00   25.37  ? 208  SER D CA  1 
ATOM   4205 C  C   . SER D 1 119 ? -14.749 -16.725 32.972  1.00   25.08  ? 208  SER D C   1 
ATOM   4206 O  O   . SER D 1 119 ? -13.852 -16.313 33.703  1.00   25.56  ? 208  SER D O   1 
ATOM   4207 C  CB  . SER D 1 119 ? -16.651 -15.816 34.373  1.00   25.95  ? 208  SER D CB  1 
ATOM   4208 O  OG  . SER D 1 119 ? -17.051 -17.050 34.936  1.00   27.81  ? 208  SER D OG  1 
ATOM   4209 N  N   . GLU D 1 120 ? -14.580 -17.766 32.156  1.00   24.69  ? 209  GLU D N   1 
ATOM   4210 C  CA  . GLU D 1 120 ? -13.321 -18.522 32.163  1.00   24.28  ? 209  GLU D CA  1 
ATOM   4211 C  C   . GLU D 1 120 ? -12.178 -17.787 31.466  1.00   22.66  ? 209  GLU D C   1 
ATOM   4212 O  O   . GLU D 1 120 ? -11.016 -17.910 31.857  1.00   22.78  ? 209  GLU D O   1 
ATOM   4213 C  CB  . GLU D 1 120 ? -13.491 -19.899 31.519  1.00   25.24  ? 209  GLU D CB  1 
ATOM   4214 C  CG  . GLU D 1 120 ? -14.525 -20.791 32.179  1.00   28.08  ? 209  GLU D CG  1 
ATOM   4215 C  CD  . GLU D 1 120 ? -14.816 -22.019 31.348  1.00   29.97  ? 209  GLU D CD  1 
ATOM   4216 O  OE1 . GLU D 1 120 ? -13.848 -22.719 30.971  1.00   31.38  ? 209  GLU D OE1 1 
ATOM   4217 O  OE2 . GLU D 1 120 ? -16.007 -22.279 31.064  1.00   31.43  ? 209  GLU D OE2 1 
ATOM   4218 N  N   . ALA D 1 121 ? -12.503 -17.047 30.414  1.00   20.68  ? 210  ALA D N   1 
ATOM   4219 C  CA  . ALA D 1 121 ? -11.477 -16.365 29.645  1.00   18.43  ? 210  ALA D CA  1 
ATOM   4220 C  C   . ALA D 1 121 ? -12.034 -15.101 29.005  1.00   16.69  ? 210  ALA D C   1 
ATOM   4221 O  O   . ALA D 1 121 ? -13.246 -14.892 28.990  1.00   15.35  ? 210  ALA D O   1 
ATOM   4222 C  CB  . ALA D 1 121 ? -10.893 -17.302 28.600  1.00   18.34  ? 210  ALA D CB  1 
ATOM   4223 N  N   . ASP D 1 122 ? -11.145 -14.268 28.473  1.00   15.35  ? 211  ASP D N   1 
ATOM   4224 C  CA  . ASP D 1 122 ? -11.531 -12.934 28.014  1.00   15.32  ? 211  ASP D CA  1 
ATOM   4225 C  C   . ASP D 1 122 ? -11.328 -12.681 26.519  1.00   14.27  ? 211  ASP D C   1 
ATOM   4226 O  O   . ASP D 1 122 ? -10.528 -13.356 25.858  1.00   14.35  ? 211  ASP D O   1 
ATOM   4227 C  CB  . ASP D 1 122 ? -10.819 -11.853 28.846  1.00   15.54  ? 211  ASP D CB  1 
ATOM   4228 C  CG  . ASP D 1 122 ? -11.315 -11.806 30.292  1.00   16.87  ? 211  ASP D CG  1 
ATOM   4229 O  OD1 . ASP D 1 122 ? -12.485 -11.412 30.500  1.00   15.76  ? 211  ASP D OD1 1 
ATOM   4230 O  OD2 . ASP D 1 122 ? -10.542 -12.174 31.214  1.00   16.94  ? 211  ASP D OD2 1 
ATOM   4231 N  N   . SER D 1 123 ? -12.088 -11.716 26.000  1.00   13.06  ? 212  SER D N   1 
ATOM   4232 C  CA  . SER D 1 123 ? -11.863 -11.141 24.668  1.00   13.20  ? 212  SER D CA  1 
ATOM   4233 C  C   . SER D 1 123 ? -11.618 -9.643  24.845  1.00   13.04  ? 212  SER D C   1 
ATOM   4234 O  O   . SER D 1 123 ? -12.303 -8.992  25.641  1.00   13.16  ? 212  SER D O   1 
ATOM   4235 C  CB  . SER D 1 123 ? -13.077 -11.339 23.756  1.00   12.56  ? 212  SER D CB  1 
ATOM   4236 O  OG  . SER D 1 123 ? -13.376 -12.708 23.547  1.00   13.66  ? 212  SER D OG  1 
ATOM   4237 N  N   . VAL D 1 124 ? -10.658 -9.106  24.092  1.00   11.75  ? 213  VAL D N   1 
ATOM   4238 C  CA  . VAL D 1 124 ? -10.171 -7.744  24.281  1.00   10.83  ? 213  VAL D CA  1 
ATOM   4239 C  C   . VAL D 1 124 ? -10.099 -6.974  22.966  1.00   10.23  ? 213  VAL D C   1 
ATOM   4240 O  O   . VAL D 1 124 ? -9.682  -7.512  21.934  1.00   9.12   ? 213  VAL D O   1 
ATOM   4241 C  CB  . VAL D 1 124 ? -8.727  -7.727  24.867  1.00   10.55  ? 213  VAL D CB  1 
ATOM   4242 C  CG1 A VAL D 1 124 ? -8.354  -6.328  25.337  0.60   10.14  ? 213  VAL D CG1 1 
ATOM   4243 C  CG1 B VAL D 1 124 ? -7.734  -8.158  23.819  0.40   9.83   ? 213  VAL D CG1 1 
ATOM   4244 C  CG2 A VAL D 1 124 ? -8.568  -8.737  26.008  0.60   10.08  ? 213  VAL D CG2 1 
ATOM   4245 C  CG2 B VAL D 1 124 ? -8.379  -6.344  25.399  0.40   10.25  ? 213  VAL D CG2 1 
ATOM   4246 N  N   . PHE D 1 125 ? -10.468 -5.700  23.032  1.00   10.26  ? 214  PHE D N   1 
ATOM   4247 C  CA  . PHE D 1 125 ? -10.298 -4.763  21.920  1.00   11.02  ? 214  PHE D CA  1 
ATOM   4248 C  C   . PHE D 1 125 ? -9.467  -3.605  22.456  1.00   10.68  ? 214  PHE D C   1 
ATOM   4249 O  O   . PHE D 1 125 ? -9.838  -3.014  23.468  1.00   10.63  ? 214  PHE D O   1 
ATOM   4250 C  CB  . PHE D 1 125 ? -11.676 -4.249  21.504  1.00   10.89  ? 214  PHE D CB  1 
ATOM   4251 C  CG  . PHE D 1 125 ? -11.664 -3.243  20.385  1.00   11.40  ? 214  PHE D CG  1 
ATOM   4252 C  CD1 . PHE D 1 125 ? -10.666 -3.241  19.419  1.00   11.35  ? 214  PHE D CD1 1 
ATOM   4253 C  CD2 . PHE D 1 125 ? -12.704 -2.327  20.269  1.00   10.95  ? 214  PHE D CD2 1 
ATOM   4254 C  CE1 . PHE D 1 125 ? -10.695 -2.322  18.376  1.00   11.02  ? 214  PHE D CE1 1 
ATOM   4255 C  CE2 . PHE D 1 125 ? -12.740 -1.412  19.229  1.00   10.58  ? 214  PHE D CE2 1 
ATOM   4256 C  CZ  . PHE D 1 125 ? -11.738 -1.404  18.285  1.00   10.78  ? 214  PHE D CZ  1 
ATOM   4257 N  N   . SER D 1 126 ? -8.352  -3.292  21.794  1.00   10.37  ? 215  SER D N   1 
ATOM   4258 C  CA  . SER D 1 126 ? -7.440  -2.239  22.241  1.00   9.79   ? 215  SER D CA  1 
ATOM   4259 C  C   . SER D 1 126 ? -7.058  -1.297  21.104  1.00   10.25  ? 215  SER D C   1 
ATOM   4260 O  O   . SER D 1 126 ? -7.121  -1.660  19.926  1.00   10.12  ? 215  SER D O   1 
ATOM   4261 C  CB  . SER D 1 126 ? -6.151  -2.839  22.813  1.00   9.76   ? 215  SER D CB  1 
ATOM   4262 O  OG  . SER D 1 126 ? -6.372  -3.553  24.016  1.00   11.51  ? 215  SER D OG  1 
ATOM   4263 N  N   . GLY D 1 127 ? -6.613  -0.097  21.456  1.00   10.27  ? 216  GLY D N   1 
ATOM   4264 C  CA  . GLY D 1 127 ? -6.158  0.853   20.440  1.00   11.20  ? 216  GLY D CA  1 
ATOM   4265 C  C   . GLY D 1 127 ? -5.424  1.991   21.100  1.00   12.00  ? 216  GLY D C   1 
ATOM   4266 O  O   . GLY D 1 127 ? -5.682  2.295   22.266  1.00   11.23  ? 216  GLY D O   1 
ATOM   4267 N  N   . PHE D 1 128 ? -4.507  2.614   20.361  1.00   12.21  ? 217  PHE D N   1 
ATOM   4268 C  CA  . PHE D 1 128 ? -3.752  3.753   20.879  1.00   12.18  ? 217  PHE D CA  1 
ATOM   4269 C  C   . PHE D 1 128 ? -3.229  4.681   19.785  1.00   12.68  ? 217  PHE D C   1 
ATOM   4270 O  O   . PHE D 1 128 ? -3.002  4.258   18.661  1.00   11.91  ? 217  PHE D O   1 
ATOM   4271 C  CB  . PHE D 1 128 ? -2.603  3.286   21.776  1.00   11.66  ? 217  PHE D CB  1 
ATOM   4272 C  CG  . PHE D 1 128 ? -1.698  2.242   21.152  1.00   10.53  ? 217  PHE D CG  1 
ATOM   4273 C  CD1 . PHE D 1 128 ? -0.632  2.614   20.351  1.00   10.43  ? 217  PHE D CD1 1 
ATOM   4274 C  CD2 . PHE D 1 128 ? -1.888  0.890   21.418  1.00   10.66  ? 217  PHE D CD2 1 
ATOM   4275 C  CE1 . PHE D 1 128 ? 0.210   1.661   19.807  1.00   11.32  ? 217  PHE D CE1 1 
ATOM   4276 C  CE2 . PHE D 1 128 ? -1.048  -0.072  20.883  1.00   9.57   ? 217  PHE D CE2 1 
ATOM   4277 C  CZ  . PHE D 1 128 ? -0.001  0.305   20.079  1.00   11.27  ? 217  PHE D CZ  1 
ATOM   4278 N  N   . LEU D 1 129 ? -3.039  5.949   20.128  1.00   12.39  ? 218  LEU D N   1 
ATOM   4279 C  CA  . LEU D 1 129 ? -2.453  6.895   19.187  1.00   12.84  ? 218  LEU D CA  1 
ATOM   4280 C  C   . LEU D 1 129 ? -0.977  6.586   19.035  1.00   12.92  ? 218  LEU D C   1 
ATOM   4281 O  O   . LEU D 1 129 ? -0.279  6.398   20.027  1.00   12.93  ? 218  LEU D O   1 
ATOM   4282 C  CB  . LEU D 1 129 ? -2.669  8.337   19.661  1.00   12.84  ? 218  LEU D CB  1 
ATOM   4283 C  CG  . LEU D 1 129 ? -1.976  9.479   18.909  1.00   14.03  ? 218  LEU D CG  1 
ATOM   4284 C  CD1 . LEU D 1 129 ? -2.453  9.588   17.458  1.00   13.09  ? 218  LEU D CD1 1 
ATOM   4285 C  CD2 . LEU D 1 129 ? -2.168  10.811  19.658  1.00   13.05  ? 218  LEU D CD2 1 
ATOM   4286 N  N   . ILE D 1 130 ? -0.512  6.489   17.791  1.00   13.49  ? 219  ILE D N   1 
ATOM   4287 C  CA  . ILE D 1 130 ? 0.913   6.295   17.519  1.00   14.11  ? 219  ILE D CA  1 
ATOM   4288 C  C   . ILE D 1 130 ? 1.587   7.655   17.408  1.00   15.72  ? 219  ILE D C   1 
ATOM   4289 O  O   . ILE D 1 130 ? 2.535   7.949   18.133  1.00   15.60  ? 219  ILE D O   1 
ATOM   4290 C  CB  . ILE D 1 130 ? 1.165   5.537   16.200  1.00   13.90  ? 219  ILE D CB  1 
ATOM   4291 C  CG1 . ILE D 1 130 ? 0.622   4.109   16.270  1.00   13.21  ? 219  ILE D CG1 1 
ATOM   4292 C  CG2 . ILE D 1 130 ? 2.648   5.495   15.898  1.00   14.87  ? 219  ILE D CG2 1 
ATOM   4293 C  CD1 . ILE D 1 130 ? 0.604   3.393   14.926  1.00   12.86  ? 219  ILE D CD1 1 
ATOM   4294 N  N   . PHE D 1 131 ? 1.122   8.474   16.472  1.00   16.76  ? 220  PHE D N   1 
ATOM   4295 C  CA  . PHE D 1 131 ? 1.511   9.876   16.474  1.00   19.19  ? 220  PHE D CA  1 
ATOM   4296 C  C   . PHE D 1 131 ? 0.463   10.761  15.814  1.00   20.51  ? 220  PHE D C   1 
ATOM   4297 O  O   . PHE D 1 131 ? -0.220  10.335  14.879  1.00   20.28  ? 220  PHE D O   1 
ATOM   4298 C  CB  . PHE D 1 131 ? 2.915   10.078  15.883  1.00   19.26  ? 220  PHE D CB  1 
ATOM   4299 C  CG  . PHE D 1 131 ? 2.988   9.916   14.398  1.00   19.83  ? 220  PHE D CG  1 
ATOM   4300 C  CD1 . PHE D 1 131 ? 2.732   10.992  13.555  1.00   20.62  ? 220  PHE D CD1 1 
ATOM   4301 C  CD2 . PHE D 1 131 ? 3.341   8.703   13.842  1.00   20.47  ? 220  PHE D CD2 1 
ATOM   4302 C  CE1 . PHE D 1 131 ? 2.823   10.854  12.172  1.00   20.79  ? 220  PHE D CE1 1 
ATOM   4303 C  CE2 . PHE D 1 131 ? 3.416   8.552   12.465  1.00   20.75  ? 220  PHE D CE2 1 
ATOM   4304 C  CZ  . PHE D 1 131 ? 3.165   9.631   11.632  1.00   20.61  ? 220  PHE D CZ  1 
ATOM   4305 N  N   . PRO D 1 132 ? 0.316   11.995  16.319  1.00   22.02  ? 221  PRO D N   1 
ATOM   4306 C  CA  . PRO D 1 132 ? -0.701  12.907  15.809  1.00   23.21  ? 221  PRO D CA  1 
ATOM   4307 C  C   . PRO D 1 132 ? -0.242  13.536  14.504  1.00   24.19  ? 221  PRO D C   1 
ATOM   4308 O  O   . PRO D 1 132 ? 0.958   13.702  14.289  1.00   25.27  ? 221  PRO D O   1 
ATOM   4309 C  CB  . PRO D 1 132 ? -0.818  13.960  16.914  1.00   22.83  ? 221  PRO D CB  1 
ATOM   4310 C  CG  . PRO D 1 132 ? 0.497   13.949  17.599  1.00   22.95  ? 221  PRO D CG  1 
ATOM   4311 C  CD  . PRO D 1 132 ? 1.122   12.595  17.397  1.00   22.61  ? 221  PRO D CD  1 
ATOM   4312 N  N   . SER D 1 133 ? -1.182  13.861  13.626  1.00   25.04  ? 222  SER D N   1 
ATOM   4313 C  CA  . SER D 1 133 ? -0.824  14.510  12.369  1.00   26.13  ? 222  SER D CA  1 
ATOM   4314 C  C   . SER D 1 133 ? -1.373  15.937  12.334  1.00   26.94  ? 222  SER D C   1 
ATOM   4315 O  O   . SER D 1 133 ? -1.059  16.756  13.213  1.00   27.18  ? 222  SER D O   1 
ATOM   4316 C  CB  . SER D 1 133 ? -1.308  13.693  11.165  1.00   26.38  ? 222  SER D CB  1 
ATOM   4317 O  OG  . SER D 1 133 ? -2.726  13.671  11.090  1.00   27.84  ? 222  SER D OG  1 
ATOM   4318 N  N   . THR E 2 2   ? 13.704  12.035  25.779  1.00   53.94  ? 92   THR E N   1 
ATOM   4319 C  CA  . THR E 2 2   ? 13.731  11.563  27.195  1.00   53.93  ? 92   THR E CA  1 
ATOM   4320 C  C   . THR E 2 2   ? 12.792  10.372  27.378  1.00   53.96  ? 92   THR E C   1 
ATOM   4321 O  O   . THR E 2 2   ? 13.149  9.374   28.004  1.00   53.87  ? 92   THR E O   1 
ATOM   4322 C  CB  . THR E 2 2   ? 13.341  12.693  28.174  1.00   53.93  ? 92   THR E CB  1 
ATOM   4323 O  OG1 . THR E 2 2   ? 14.091  13.877  27.868  1.00   53.89  ? 92   THR E OG1 1 
ATOM   4324 C  CG2 . THR E 2 2   ? 13.615  12.281  29.615  1.00   53.96  ? 92   THR E CG2 1 
ATOM   4325 N  N   . GLN E 2 3   ? 11.591  10.483  26.820  1.00   54.13  ? 93   GLN E N   1 
ATOM   4326 C  CA  . GLN E 2 3   ? 11.487  8.175   28.699  0.0000 20.00  ? 93   GLN E CA  1 
ATOM   4327 C  C   . GLN E 2 3   ? 11.469  7.005   27.722  0.0000 20.00  ? 93   GLN E C   1 
ATOM   4328 O  O   . GLN E 2 3   ? 10.665  6.960   27.584  1.00   25.39  ? 93   GLN E O   1 
ATOM   4329 C  CB  . GLN E 2 3   ? 10.126  8.309   29.385  0.0000 20.00  ? 93   GLN E CB  1 
ATOM   4330 C  CG  . GLN E 2 3   ? 10.013  9.507   30.313  0.0000 20.00  ? 93   GLN E CG  1 
ATOM   4331 C  CD  . GLN E 2 3   ? 10.091  10.827  29.573  0.0000 20.00  ? 93   GLN E CD  1 
ATOM   4332 O  OE1 . GLN E 2 3   ? 9.462   10.999  28.529  0.0000 20.00  ? 93   GLN E OE1 1 
ATOM   4333 N  NE2 . GLN E 2 3   ? 10.864  11.765  30.113  0.0000 20.00  ? 93   GLN E NE2 1 
ATOM   4334 N  N   . LYS E 2 4   ? 12.248  6.479   27.220  1.00   16.78  ? 94   LYS E N   1 
ATOM   4335 C  CA  . LYS E 2 4   ? 12.302  5.374   26.270  1.00   16.94  ? 94   LYS E CA  1 
ATOM   4336 C  C   . LYS E 2 4   ? 12.283  4.062   27.037  1.00   16.54  ? 94   LYS E C   1 
ATOM   4337 O  O   . LYS E 2 4   ? 13.322  3.570   27.469  1.00   17.38  ? 94   LYS E O   1 
ATOM   4338 C  CB  . LYS E 2 4   ? 13.566  5.467   25.412  1.00   16.98  ? 94   LYS E CB  1 
ATOM   4339 C  CG  . LYS E 2 4   ? 13.755  6.818   24.731  1.00   16.92  ? 94   LYS E CG  1 
ATOM   4340 C  CD  . LYS E 2 4   ? 15.048  6.874   23.941  1.00   16.30  ? 94   LYS E CD  1 
ATOM   4341 C  CE  . LYS E 2 4   ? 15.282  8.272   23.386  1.00   17.76  ? 94   LYS E CE  1 
ATOM   4342 N  NZ  . LYS E 2 4   ? 15.958  8.245   22.052  1.00   17.45  ? 94   LYS E NZ  1 
ATOM   4343 N  N   . ILE E 2 5   ? 11.094  3.501   27.209  1.00   16.07  ? 95   ILE E N   1 
ATOM   4344 C  CA  . ILE E 2 5   ? 10.926  2.287   27.992  1.00   15.91  ? 95   ILE E CA  1 
ATOM   4345 C  C   . ILE E 2 5   ? 10.212  1.228   27.170  1.00   15.43  ? 95   ILE E C   1 
ATOM   4346 O  O   . ILE E 2 5   ? 9.058   1.403   26.795  1.00   15.51  ? 95   ILE E O   1 
ATOM   4347 C  CB  . ILE E 2 5   ? 10.104  2.556   29.270  1.00   16.25  ? 95   ILE E CB  1 
ATOM   4348 C  CG1 . ILE E 2 5   ? 10.708  3.718   30.062  1.00   16.87  ? 95   ILE E CG1 1 
ATOM   4349 C  CG2 . ILE E 2 5   ? 10.011  1.287   30.121  1.00   15.72  ? 95   ILE E CG2 1 
ATOM   4350 C  CD1 . ILE E 2 5   ? 9.782   4.254   31.142  1.00   16.63  ? 95   ILE E CD1 1 
ATOM   4351 N  N   . ALA E 2 6   ? 10.906  0.130   26.894  1.00   14.90  ? 96   ALA E N   1 
ATOM   4352 C  CA  . ALA E 2 6   ? 10.366  -0.948  26.082  1.00   14.05  ? 96   ALA E CA  1 
ATOM   4353 C  C   . ALA E 2 6   ? 11.145  -2.221  26.375  1.00   13.48  ? 96   ALA E C   1 
ATOM   4354 O  O   . ALA E 2 6   ? 12.347  -2.173  26.622  1.00   13.18  ? 96   ALA E O   1 
ATOM   4355 C  CB  . ALA E 2 6   ? 10.475  -0.605  24.594  1.00   14.08  ? 96   ALA E CB  1 
ATOM   4356 N  N   . PHE E 2 7   ? 10.463  -3.360  26.350  1.00   12.74  ? 97   PHE E N   1 
ATOM   4357 C  CA  . PHE E 2 7   ? 11.139  -4.626  26.556  1.00   12.01  ? 97   PHE E CA  1 
ATOM   4358 C  C   . PHE E 2 7   ? 10.499  -5.722  25.717  1.00   11.98  ? 97   PHE E C   1 
ATOM   4359 O  O   . PHE E 2 7   ? 9.298   -5.701  25.479  1.00   11.53  ? 97   PHE E O   1 
ATOM   4360 C  CB  . PHE E 2 7   ? 11.111  -5.018  28.038  1.00   12.28  ? 97   PHE E CB  1 
ATOM   4361 C  CG  . PHE E 2 7   ? 9.764   -5.508  28.508  1.00   11.71  ? 97   PHE E CG  1 
ATOM   4362 C  CD1 . PHE E 2 7   ? 9.418   -6.843  28.387  1.00   11.51  ? 97   PHE E CD1 1 
ATOM   4363 C  CD2 . PHE E 2 7   ? 8.846   -4.629  29.054  1.00   10.84  ? 97   PHE E CD2 1 
ATOM   4364 C  CE1 . PHE E 2 7   ? 8.178   -7.286  28.800  1.00   12.08  ? 97   PHE E CE1 1 
ATOM   4365 C  CE2 . PHE E 2 7   ? 7.607   -5.067  29.480  1.00   10.70  ? 97   PHE E CE2 1 
ATOM   4366 C  CZ  . PHE E 2 7   ? 7.271   -6.393  29.357  1.00   10.51  ? 97   PHE E CZ  1 
ATOM   4367 N  N   . SER E 2 8   ? 11.322  -6.670  25.273  1.00   11.65  ? 98   SER E N   1 
ATOM   4368 C  CA  . SER E 2 8   ? 10.856  -7.891  24.639  1.00   12.08  ? 98   SER E CA  1 
ATOM   4369 C  C   . SER E 2 8   ? 11.736  -8.996  25.178  1.00   11.69  ? 98   SER E C   1 
ATOM   4370 O  O   . SER E 2 8   ? 12.955  -8.897  25.118  1.00   11.66  ? 98   SER E O   1 
ATOM   4371 C  CB  . SER E 2 8   ? 11.013  -7.841  23.111  1.00   11.88  ? 98   SER E CB  1 
ATOM   4372 O  OG  . SER E 2 8   ? 10.049  -6.998  22.500  1.00   13.47  ? 98   SER E OG  1 
ATOM   4373 N  N   . ALA E 2 9   ? 11.125  -10.048 25.696  1.00   11.41  ? 99   ALA E N   1 
ATOM   4374 C  CA  . ALA E 2 9   ? 11.879  -11.152 26.254  1.00   12.16  ? 99   ALA E CA  1 
ATOM   4375 C  C   . ALA E 2 9   ? 11.249  -12.464 25.823  1.00   12.50  ? 99   ALA E C   1 
ATOM   4376 O  O   . ALA E 2 9   ? 10.034  -12.601 25.868  1.00   12.82  ? 99   ALA E O   1 
ATOM   4377 C  CB  . ALA E 2 9   ? 11.900  -11.042 27.793  1.00   12.21  ? 99   ALA E CB  1 
ATOM   4378 N  N   . THR E 2 10  ? 12.064  -13.428 25.397  1.00   13.45  ? 100  THR E N   1 
ATOM   4379 C  CA  . THR E 2 10  ? 11.540  -14.750 25.057  1.00   14.36  ? 100  THR E CA  1 
ATOM   4380 C  C   . THR E 2 10  ? 11.726  -15.746 26.203  1.00   15.75  ? 100  THR E C   1 
ATOM   4381 O  O   . THR E 2 10  ? 12.547  -15.536 27.093  1.00   15.80  ? 100  THR E O   1 
ATOM   4382 C  CB  . THR E 2 10  ? 12.162  -15.318 23.752  1.00   14.72  ? 100  THR E CB  1 
ATOM   4383 O  OG1 . THR E 2 10  ? 13.589  -15.351 23.859  1.00   15.13  ? 100  THR E OG1 1 
ATOM   4384 C  CG2 . THR E 2 10  ? 11.764  -14.465 22.540  1.00   14.31  ? 100  THR E CG2 1 
ATOM   4385 N  N   . ARG E 2 11  ? 10.953  -16.827 26.179  1.00   17.63  ? 101  ARG E N   1 
ATOM   4386 C  CA  . ARG E 2 11  ? 11.095  -17.900 27.160  1.00   20.08  ? 101  ARG E CA  1 
ATOM   4387 C  C   . ARG E 2 11  ? 11.851  -19.070 26.543  1.00   21.76  ? 101  ARG E C   1 
ATOM   4388 O  O   . ARG E 2 11  ? 11.439  -19.611 25.519  1.00   21.75  ? 101  ARG E O   1 
ATOM   4389 C  CB  . ARG E 2 11  ? 9.730   -18.366 27.658  1.00   20.19  ? 101  ARG E CB  1 
ATOM   4390 C  CG  . ARG E 2 11  ? 9.785   -19.533 28.627  1.00   20.77  ? 101  ARG E CG  1 
ATOM   4391 C  CD  . ARG E 2 11  ? 8.441   -19.705 29.325  1.00   21.02  ? 101  ARG E CD  1 
ATOM   4392 N  NE  . ARG E 2 11  ? 8.387   -20.888 30.180  1.00   21.62  ? 101  ARG E NE  1 
ATOM   4393 C  CZ  . ARG E 2 11  ? 8.708   -20.890 31.468  1.00   22.00  ? 101  ARG E CZ  1 
ATOM   4394 N  NH1 . ARG E 2 11  ? 9.118   -19.768 32.046  1.00   22.23  ? 101  ARG E NH1 1 
ATOM   4395 N  NH2 . ARG E 2 11  ? 8.620   -22.010 32.176  1.00   21.99  ? 101  ARG E NH2 1 
ATOM   4396 N  N   . THR E 2 12  ? 12.969  -19.439 27.161  1.00   23.35  ? 102  THR E N   1 
ATOM   4397 C  CA  . THR E 2 12  ? 13.814  -20.505 26.642  1.00   25.29  ? 102  THR E CA  1 
ATOM   4398 C  C   . THR E 2 12  ? 13.873  -21.647 27.652  1.00   26.44  ? 102  THR E C   1 
ATOM   4399 O  O   . THR E 2 12  ? 14.611  -22.616 27.473  1.00   26.09  ? 102  THR E O   1 
ATOM   4400 C  CB  . THR E 2 12  ? 15.246  -20.001 26.329  1.00   25.58  ? 102  THR E CB  1 
ATOM   4401 O  OG1 . THR E 2 12  ? 15.864  -19.523 27.531  1.00   26.05  ? 102  THR E OG1 1 
ATOM   4402 C  CG2 . THR E 2 12  ? 15.215  -18.872 25.300  1.00   25.28  ? 102  THR E CG2 1 
ATOM   4403 N  N   . ILE E 2 13  ? 13.074  -21.514 28.707  1.00   27.73  ? 103  ILE E N   1 
ATOM   4404 C  CA  . ILE E 2 13  ? 12.998  -22.489 29.784  1.00   28.75  ? 103  ILE E CA  1 
ATOM   4405 C  C   . ILE E 2 13  ? 12.082  -23.644 29.397  1.00   28.74  ? 103  ILE E C   1 
ATOM   4406 O  O   . ILE E 2 13  ? 10.875  -23.464 29.239  1.00   29.54  ? 103  ILE E O   1 
ATOM   4407 C  CB  . ILE E 2 13  ? 12.475  -21.828 31.088  1.00   29.08  ? 103  ILE E CB  1 
ATOM   4408 C  CG1 . ILE E 2 13  ? 13.429  -20.729 31.555  1.00   29.52  ? 103  ILE E CG1 1 
ATOM   4409 C  CG2 . ILE E 2 13  ? 12.296  -22.854 32.185  1.00   29.32  ? 103  ILE E CG2 1 
ATOM   4410 C  CD1 . ILE E 2 13  ? 14.843  -21.210 31.771  1.00   31.22  ? 103  ILE E CD1 1 
ATOM   4411 N  N   . ASN E 2 14  ? 12.660  -24.828 29.236  1.00   28.89  ? 104  ASN E N   1 
ATOM   4412 C  CA  . ASN E 2 14  ? 11.575  -25.817 29.059  0.0000 37.01  ? 104  ASN E CA  1 
ATOM   4413 C  C   . ASN E 2 14  ? 11.084  -27.021 30.462  1.00   38.02  ? 104  ASN E C   1 
ATOM   4414 O  O   . ASN E 2 14  ? 12.219  -27.487 30.344  1.00   38.59  ? 104  ASN E O   1 
ATOM   4415 C  CB  . ASN E 2 14  ? 12.125  -26.737 27.962  0.0000 37.86  ? 104  ASN E CB  1 
ATOM   4416 C  CG  . ASN E 2 14  ? 11.046  -27.595 27.321  0.0000 39.50  ? 104  ASN E CG  1 
ATOM   4417 O  OD1 . ASN E 2 14  ? 9.989   -27.829 27.912  0.0000 40.40  ? 104  ASN E OD1 1 
ATOM   4418 N  ND2 . ASN E 2 14  ? 11.306  -28.068 26.101  0.0000 40.60  ? 104  ASN E ND2 1 
ATOM   4419 N  N   . VAL E 2 15  ? 10.756  -26.162 31.420  1.00   37.59  ? 105  VAL E N   1 
ATOM   4420 C  CA  . VAL E 2 15  ? 10.303  -26.621 32.722  1.00   37.54  ? 105  VAL E CA  1 
ATOM   4421 C  C   . VAL E 2 15  ? 8.800   -26.434 32.841  1.00   37.26  ? 105  VAL E C   1 
ATOM   4422 O  O   . VAL E 2 15  ? 8.302   -25.325 32.673  1.00   37.41  ? 105  VAL E O   1 
ATOM   4423 C  CB  . VAL E 2 15  ? 11.003  -25.865 33.862  1.00   37.52  ? 105  VAL E CB  1 
ATOM   4424 C  CG1 . VAL E 2 15  ? 10.519  -26.372 35.209  1.00   38.07  ? 105  VAL E CG1 1 
ATOM   4425 C  CG2 . VAL E 2 15  ? 12.515  -26.010 33.744  1.00   38.15  ? 105  VAL E CG2 1 
ATOM   4426 N  N   . PRO E 2 16  ? 8.071   -27.527 33.119  1.00   37.06  ? 106  PRO E N   1 
ATOM   4427 C  CA  . PRO E 2 16  ? 6.619   -27.491 33.295  1.00   36.68  ? 106  PRO E CA  1 
ATOM   4428 C  C   . PRO E 2 16  ? 6.184   -26.473 34.347  1.00   36.23  ? 106  PRO E C   1 
ATOM   4429 O  O   . PRO E 2 16  ? 6.615   -26.548 35.498  1.00   35.92  ? 106  PRO E O   1 
ATOM   4430 C  CB  . PRO E 2 16  ? 6.292   -28.911 33.769  1.00   36.88  ? 106  PRO E CB  1 
ATOM   4431 C  CG  . PRO E 2 16  ? 7.375   -29.754 33.177  1.00   36.96  ? 106  PRO E CG  1 
ATOM   4432 C  CD  . PRO E 2 16  ? 8.609   -28.892 33.262  1.00   36.95  ? 106  PRO E CD  1 
ATOM   4433 N  N   . LEU E 2 17  ? 5.337   -25.529 33.945  1.00   35.27  ? 107  LEU E N   1 
ATOM   4434 C  CA  . LEU E 2 17  ? 4.833   -24.517 34.864  1.00   34.49  ? 107  LEU E CA  1 
ATOM   4435 C  C   . LEU E 2 17  ? 3.770   -25.096 35.786  1.00   34.27  ? 107  LEU E C   1 
ATOM   4436 O  O   . LEU E 2 17  ? 2.986   -25.952 35.380  1.00   34.59  ? 107  LEU E O   1 
ATOM   4437 C  CB  . LEU E 2 17  ? 4.257   -23.332 34.087  1.00   34.08  ? 107  LEU E CB  1 
ATOM   4438 C  CG  . LEU E 2 17  ? 5.264   -22.311 33.552  1.00   33.55  ? 107  LEU E CG  1 
ATOM   4439 C  CD1 . LEU E 2 17  ? 4.736   -21.632 32.298  1.00   33.24  ? 107  LEU E CD1 1 
ATOM   4440 C  CD2 . LEU E 2 17  ? 5.618   -21.291 34.630  1.00   32.84  ? 107  LEU E CD2 1 
ATOM   4441 N  N   . ARG E 2 18  ? 3.755   -24.630 37.029  1.00   33.81  ? 108  ARG E N   1 
ATOM   4442 C  CA  . ARG E 2 18  ? 2.711   -24.995 37.977  1.00   33.31  ? 108  ARG E CA  1 
ATOM   4443 C  C   . ARG E 2 18  ? 1.730   -23.836 38.082  1.00   32.98  ? 108  ARG E C   1 
ATOM   4444 O  O   . ARG E 2 18  ? 2.079   -22.702 37.769  1.00   32.89  ? 108  ARG E O   1 
ATOM   4445 C  CB  . ARG E 2 18  ? 3.319   -25.310 39.343  1.00   33.32  ? 108  ARG E CB  1 
ATOM   4446 N  N   . ARG E 2 19  ? 0.506   -24.122 38.515  1.00   32.86  ? 109  ARG E N   1 
ATOM   4447 C  CA  . ARG E 2 19  ? -0.519  -23.090 38.699  1.00   32.47  ? 109  ARG E CA  1 
ATOM   4448 C  C   . ARG E 2 19  ? -0.029  -21.946 39.591  1.00   32.02  ? 109  ARG E C   1 
ATOM   4449 O  O   . ARG E 2 19  ? 0.700   -22.169 40.559  1.00   32.35  ? 109  ARG E O   1 
ATOM   4450 C  CB  . ARG E 2 19  ? -1.799  -23.702 39.285  1.00   32.43  ? 109  ARG E CB  1 
ATOM   4451 C  CG  . ARG E 2 19  ? -2.599  -23.544 38.977  0.0000 66.98  ? 109  ARG E CG  1 
ATOM   4452 C  CD  . ARG E 2 19  ? -3.692  -24.363 39.614  0.0000 78.91  ? 109  ARG E CD  1 
ATOM   4453 N  NE  . ARG E 2 19  ? -4.947  -23.632 39.762  0.0000 88.46  ? 109  ARG E NE  1 
ATOM   4454 C  CZ  . ARG E 2 19  ? -6.051  -24.144 40.299  0.0000 97.12  ? 109  ARG E CZ  1 
ATOM   4455 N  NH1 . ARG E 2 19  ? -6.070  -25.396 40.752  0.0000 100.24 ? 109  ARG E NH1 1 
ATOM   4456 N  NH2 . ARG E 2 19  ? -7.148  -23.403 40.390  0.0000 100.03 ? 109  ARG E NH2 1 
ATOM   4457 N  N   . ASP E 2 20  ? -0.431  -20.725 39.248  1.00   31.19  ? 110  ASP E N   1 
ATOM   4458 C  CA  . ASP E 2 20  ? -0.123  -19.531 40.040  1.00   30.42  ? 110  ASP E CA  1 
ATOM   4459 C  C   . ASP E 2 20  ? 1.355   -19.109 39.991  1.00   29.03  ? 110  ASP E C   1 
ATOM   4460 O  O   . ASP E 2 20  ? 1.761   -18.153 40.651  1.00   28.21  ? 110  ASP E O   1 
ATOM   4461 C  CB  . ASP E 2 20  ? -0.599  -19.705 41.487  1.00   31.58  ? 110  ASP E CB  1 
ATOM   4462 C  CG  . ASP E 2 20  ? -2.106  -19.857 41.589  1.00   33.05  ? 110  ASP E CG  1 
ATOM   4463 O  OD1 . ASP E 2 20  ? -2.769  -20.017 40.539  1.00   34.31  ? 110  ASP E OD1 1 
ATOM   4464 O  OD2 . ASP E 2 20  ? -2.632  -19.813 42.721  1.00   34.22  ? 110  ASP E OD2 1 
ATOM   4465 N  N   . GLN E 2 21  ? 2.144   -19.817 39.190  1.00   27.58  ? 111  GLN E N   1 
ATOM   4466 C  CA  . GLN E 2 21  ? 3.562   -19.510 39.009  1.00   26.49  ? 111  GLN E CA  1 
ATOM   4467 C  C   . GLN E 2 21  ? 3.745   -18.377 37.997  1.00   25.06  ? 111  GLN E C   1 
ATOM   4468 O  O   . GLN E 2 21  ? 3.123   -18.386 36.929  1.00   24.89  ? 111  GLN E O   1 
ATOM   4469 C  CB  . GLN E 2 21  ? 4.288   -20.770 38.524  1.00   27.09  ? 111  GLN E CB  1 
ATOM   4470 C  CG  . GLN E 2 21  ? 5.809   -20.703 38.471  1.00   28.11  ? 111  GLN E CG  1 
ATOM   4471 C  CD  . GLN E 2 21  ? 6.429   -21.992 37.940  1.00   29.01  ? 111  GLN E CD  1 
ATOM   4472 O  OE1 . GLN E 2 21  ? 5.800   -23.057 37.951  1.00   29.95  ? 111  GLN E OE1 1 
ATOM   4473 N  NE2 . GLN E 2 21  ? 7.665   -21.898 37.462  1.00   29.87  ? 111  GLN E NE2 1 
ATOM   4474 N  N   . THR E 2 22  ? 4.591   -17.405 38.334  1.00   23.21  ? 112  THR E N   1 
ATOM   4475 C  CA  . THR E 2 22  ? 4.946   -16.342 37.397  1.00   21.72  ? 112  THR E CA  1 
ATOM   4476 C  C   . THR E 2 22  ? 5.712   -16.958 36.227  1.00   20.93  ? 112  THR E C   1 
ATOM   4477 O  O   . THR E 2 22  ? 6.606   -17.785 36.425  1.00   20.55  ? 112  THR E O   1 
ATOM   4478 C  CB  . THR E 2 22  ? 5.817   -15.251 38.067  1.00   21.94  ? 112  THR E CB  1 
ATOM   4479 O  OG1 . THR E 2 22  ? 5.203   -14.816 39.288  1.00   22.18  ? 112  THR E OG1 1 
ATOM   4480 C  CG2 . THR E 2 22  ? 6.008   -14.045 37.138  1.00   21.53  ? 112  THR E CG2 1 
ATOM   4481 N  N   . ILE E 2 23  ? 5.349   -16.573 35.009  1.00   19.46  ? 113  ILE E N   1 
ATOM   4482 C  CA  . ILE E 2 23  ? 6.006   -17.094 33.818  1.00   17.71  ? 113  ILE E CA  1 
ATOM   4483 C  C   . ILE E 2 23  ? 7.242   -16.268 33.485  1.00   17.63  ? 113  ILE E C   1 
ATOM   4484 O  O   . ILE E 2 23  ? 7.144   -15.100 33.112  1.00   16.97  ? 113  ILE E O   1 
ATOM   4485 C  CB  . ILE E 2 23  ? 5.046   -17.132 32.618  1.00   17.38  ? 113  ILE E CB  1 
ATOM   4486 C  CG1 . ILE E 2 23  ? 3.811   -17.970 32.969  1.00   17.56  ? 113  ILE E CG1 1 
ATOM   4487 C  CG2 . ILE E 2 23  ? 5.746   -17.699 31.388  1.00   17.19  ? 113  ILE E CG2 1 
ATOM   4488 C  CD1 . ILE E 2 23  ? 2.746   -17.999 31.889  1.00   16.41  ? 113  ILE E CD1 1 
ATOM   4489 N  N   . ARG E 2 24  ? 8.410   -16.886 33.630  1.00   17.29  ? 114  ARG E N   1 
ATOM   4490 C  CA  . ARG E 2 24  ? 9.661   -16.217 33.358  1.00   18.17  ? 114  ARG E CA  1 
ATOM   4491 C  C   . ARG E 2 24  ? 9.962   -16.238 31.869  1.00   17.89  ? 114  ARG E C   1 
ATOM   4492 O  O   . ARG E 2 24  ? 9.918   -17.288 31.242  1.00   18.14  ? 114  ARG E O   1 
ATOM   4493 C  CB  . ARG E 2 24  ? 10.809  -16.892 34.113  1.00   18.18  ? 114  ARG E CB  1 
ATOM   4494 C  CG  . ARG E 2 24  ? 12.102  -16.113 34.073  1.00   19.57  ? 114  ARG E CG  1 
ATOM   4495 C  CD  . ARG E 2 24  ? 13.263  -16.925 34.650  1.00   21.71  ? 114  ARG E CD  1 
ATOM   4496 N  NE  . ARG E 2 24  ? 14.551  -16.311 34.345  1.00   21.38  ? 114  ARG E NE  1 
ATOM   4497 C  CZ  . ARG E 2 24  ? 15.722  -16.905 34.540  1.00   23.14  ? 114  ARG E CZ  1 
ATOM   4498 N  NH1 . ARG E 2 24  ? 15.768  -18.134 35.034  1.00   24.36  ? 114  ARG E NH1 1 
ATOM   4499 N  NH2 . ARG E 2 24  ? 16.846  -16.279 34.231  1.00   24.12  ? 114  ARG E NH2 1 
ATOM   4500 N  N   . PHE E 2 25  ? 10.260  -15.068 31.315  1.00   17.79  ? 115  PHE E N   1 
ATOM   4501 C  CA  . PHE E 2 25  ? 10.835  -14.970 29.976  1.00   18.06  ? 115  PHE E CA  1 
ATOM   4502 C  C   . PHE E 2 25  ? 12.294  -14.528 30.158  1.00   18.06  ? 115  PHE E C   1 
ATOM   4503 O  O   . PHE E 2 25  ? 12.597  -13.349 30.330  1.00   18.18  ? 115  PHE E O   1 
ATOM   4504 C  CB  . PHE E 2 25  ? 10.033  -13.991 29.097  1.00   17.16  ? 115  PHE E CB  1 
ATOM   4505 C  CG  . PHE E 2 25  ? 8.603   -14.410 28.866  1.00   16.40  ? 115  PHE E CG  1 
ATOM   4506 C  CD1 . PHE E 2 25  ? 7.656   -14.286 29.874  1.00   16.53  ? 115  PHE E CD1 1 
ATOM   4507 C  CD2 . PHE E 2 25  ? 8.205   -14.926 27.643  1.00   15.66  ? 115  PHE E CD2 1 
ATOM   4508 C  CE1 . PHE E 2 25  ? 6.335   -14.665 29.663  1.00   15.55  ? 115  PHE E CE1 1 
ATOM   4509 C  CE2 . PHE E 2 25  ? 6.895   -15.312 27.428  1.00   16.08  ? 115  PHE E CE2 1 
ATOM   4510 C  CZ  . PHE E 2 25  ? 5.955   -15.177 28.444  1.00   15.96  ? 115  PHE E CZ  1 
ATOM   4511 N  N   . ASP E 2 26  ? 13.191  -15.501 30.142  1.00   19.15  ? 116  ASP E N   1 
ATOM   4512 C  CA  . ASP E 2 26  ? 14.552  -15.326 30.658  1.00   19.80  ? 116  ASP E CA  1 
ATOM   4513 C  C   . ASP E 2 26  ? 15.542  -14.631 29.720  1.00   19.56  ? 116  ASP E C   1 
ATOM   4514 O  O   . ASP E 2 26  ? 16.609  -14.189 30.154  1.00   19.12  ? 116  ASP E O   1 
ATOM   4515 C  CB  . ASP E 2 26  ? 15.112  -16.695 31.019  1.00   20.23  ? 116  ASP E CB  1 
ATOM   4516 C  CG  . ASP E 2 26  ? 14.921  -17.705 29.906  1.00   20.70  ? 116  ASP E CG  1 
ATOM   4517 O  OD1 . ASP E 2 26  ? 13.764  -18.121 29.672  1.00   21.73  ? 116  ASP E OD1 1 
ATOM   4518 O  OD2 . ASP E 2 26  ? 15.922  -18.097 29.273  1.00   20.84  ? 116  ASP E OD2 1 
ATOM   4519 N  N   . HIS E 2 27  ? 15.190  -14.545 28.442  1.00   19.12  ? 117  HIS E N   1 
ATOM   4520 C  CA  . HIS E 2 27  ? 16.102  -14.060 27.415  1.00   19.08  ? 117  HIS E CA  1 
ATOM   4521 C  C   . HIS E 2 27  ? 15.652  -12.714 26.845  1.00   19.28  ? 117  HIS E C   1 
ATOM   4522 O  O   . HIS E 2 27  ? 14.691  -12.649 26.069  1.00   19.37  ? 117  HIS E O   1 
ATOM   4523 C  CB  . HIS E 2 27  ? 16.201  -15.093 26.293  1.00   19.85  ? 117  HIS E CB  1 
ATOM   4524 C  CG  . HIS E 2 27  ? 17.156  -14.716 25.206  1.00   21.14  ? 117  HIS E CG  1 
ATOM   4525 N  ND1 . HIS E 2 27  ? 16.744  -14.409 23.926  1.00   22.23  ? 117  HIS E ND1 1 
ATOM   4526 C  CD2 . HIS E 2 27  ? 18.504  -14.596 25.206  1.00   21.53  ? 117  HIS E CD2 1 
ATOM   4527 C  CE1 . HIS E 2 27  ? 17.797  -14.120 23.184  1.00   22.26  ? 117  HIS E CE1 1 
ATOM   4528 N  NE2 . HIS E 2 27  ? 18.877  -14.223 23.937  1.00   23.16  ? 117  HIS E NE2 1 
ATOM   4529 N  N   . VAL E 2 28  ? 16.340  -11.640 27.224  1.00   18.16  ? 118  VAL E N   1 
ATOM   4530 C  CA  . VAL E 2 28  ? 15.949  -10.327 26.741  1.00   18.29  ? 118  VAL E CA  1 
ATOM   4531 C  C   . VAL E 2 28  ? 16.460  -10.026 25.331  1.00   17.69  ? 118  VAL E C   1 
ATOM   4532 O  O   . VAL E 2 28  ? 17.645  -10.205 25.006  1.00   17.71  ? 118  VAL E O   1 
ATOM   4533 C  CB  . VAL E 2 28  ? 16.181  -9.165  27.782  1.00   18.39  ? 118  VAL E CB  1 
ATOM   4534 C  CG1 . VAL E 2 28  ? 16.728  -9.700  29.114  1.00   19.09  ? 118  VAL E CG1 1 
ATOM   4535 C  CG2 . VAL E 2 28  ? 17.030  -8.049  27.218  1.00   18.53  ? 118  VAL E CG2 1 
ATOM   4536 N  N   . ILE E 2 29  ? 15.525  -9.620  24.483  1.00   16.25  ? 119  ILE E N   1 
ATOM   4537 C  CA  . ILE E 2 29  ? 15.857  -9.153  23.150  1.00   15.23  ? 119  ILE E CA  1 
ATOM   4538 C  C   . ILE E 2 29  ? 16.061  -7.641  23.243  1.00   14.93  ? 119  ILE E C   1 
ATOM   4539 O  O   . ILE E 2 29  ? 17.019  -7.102  22.693  1.00   15.40  ? 119  ILE E O   1 
ATOM   4540 C  CB  . ILE E 2 29  ? 14.746  -9.512  22.139  1.00   14.94  ? 119  ILE E CB  1 
ATOM   4541 C  CG1 . ILE E 2 29  ? 14.520  -11.035 22.115  1.00   14.53  ? 119  ILE E CG1 1 
ATOM   4542 C  CG2 . ILE E 2 29  ? 15.079  -8.972  20.746  1.00   14.43  ? 119  ILE E CG2 1 
ATOM   4543 C  CD1 . ILE E 2 29  ? 13.661  -11.519 20.960  1.00   14.78  ? 119  ILE E CD1 1 
ATOM   4544 N  N   . THR E 2 30  ? 15.161  -6.978  23.968  1.00   13.43  ? 120  THR E N   1 
ATOM   4545 C  CA  . THR E 2 30  ? 15.227  -5.546  24.224  1.00   13.52  ? 120  THR E CA  1 
ATOM   4546 C  C   . THR E 2 30  ? 14.771  -5.264  25.665  1.00   13.96  ? 120  THR E C   1 
ATOM   4547 O  O   . THR E 2 30  ? 13.912  -5.966  26.204  1.00   13.59  ? 120  THR E O   1 
ATOM   4548 C  CB  . THR E 2 30  ? 14.351  -4.758  23.230  1.00   13.45  ? 120  THR E CB  1 
ATOM   4549 O  OG1 . THR E 2 30  ? 14.636  -5.194  21.890  1.00   13.63  ? 120  THR E OG1 1 
ATOM   4550 C  CG2 . THR E 2 30  ? 14.638  -3.253  23.332  1.00   13.15  ? 120  THR E CG2 1 
ATOM   4551 N  N   . ASN E 2 31  ? 15.358  -4.252  26.285  1.00   14.36  ? 121  ASN E N   1 
ATOM   4552 C  CA  . ASN E 2 31  ? 15.035  -3.888  27.674  1.00   15.50  ? 121  ASN E CA  1 
ATOM   4553 C  C   . ASN E 2 31  ? 15.530  -2.469  27.963  1.00   16.95  ? 121  ASN E C   1 
ATOM   4554 O  O   . ASN E 2 31  ? 16.332  -2.246  28.879  1.00   17.64  ? 121  ASN E O   1 
ATOM   4555 C  CB  . ASN E 2 31  ? 15.645  -4.900  28.658  1.00   15.05  ? 121  ASN E CB  1 
ATOM   4556 C  CG  . ASN E 2 31  ? 15.087  -4.772  30.072  1.00   14.96  ? 121  ASN E CG  1 
ATOM   4557 O  OD1 . ASN E 2 31  ? 14.249  -3.924  30.345  1.00   15.75  ? 121  ASN E OD1 1 
ATOM   4558 N  ND2 . ASN E 2 31  ? 15.557  -5.623  30.971  1.00   13.92  ? 121  ASN E ND2 1 
ATOM   4559 N  N   . MET E 2 32  ? 15.061  -1.515  27.160  1.00   17.97  ? 122  MET E N   1 
ATOM   4560 C  CA  . MET E 2 32  ? 15.422  -0.103  27.321  1.00   19.16  ? 122  MET E CA  1 
ATOM   4561 C  C   . MET E 2 32  ? 14.871  0.458   28.636  1.00   19.74  ? 122  MET E C   1 
ATOM   4562 O  O   . MET E 2 32  ? 13.679  0.330   28.919  1.00   20.34  ? 122  MET E O   1 
ATOM   4563 C  CB  . MET E 2 32  ? 14.913  0.718   26.129  1.00   18.62  ? 122  MET E CB  1 
ATOM   4564 C  CG  . MET E 2 32  ? 15.516  0.303   24.789  1.00   19.60  ? 122  MET E CG  1 
ATOM   4565 S  SD  . MET E 2 32  ? 14.962  1.283   23.368  1.00   20.42  ? 122  MET E SD  1 
ATOM   4566 C  CE  . MET E 2 32  ? 15.417  2.941   23.871  1.00   18.59  ? 122  MET E CE  1 
ATOM   4567 N  N   . ASN E 2 33  ? 15.744  1.075   29.427  1.00   20.60  ? 123  ASN E N   1 
ATOM   4568 C  CA  . ASN E 2 33  ? 15.417  1.569   30.779  1.00   21.80  ? 123  ASN E CA  1 
ATOM   4569 C  C   . ASN E 2 33  ? 15.496  0.482   31.853  1.00   21.48  ? 123  ASN E C   1 
ATOM   4570 O  O   . ASN E 2 33  ? 15.351  0.763   33.042  1.00   21.44  ? 123  ASN E O   1 
ATOM   4571 C  CB  . ASN E 2 33  ? 14.046  2.268   30.819  1.00   23.04  ? 123  ASN E CB  1 
ATOM   4572 C  CG  . ASN E 2 33  ? 13.997  3.420   31.830  1.00   25.20  ? 123  ASN E CG  1 
ATOM   4573 O  OD1 . ASN E 2 33  ? 13.091  3.496   32.666  1.00   25.92  ? 123  ASN E OD1 1 
ATOM   4574 N  ND2 . ASN E 2 33  ? 14.972  4.324   31.748  1.00   25.77  ? 123  ASN E ND2 1 
ATOM   4575 N  N   . ASN E 2 34  ? 15.723  -0.755  31.417  1.00   21.42  ? 124  ASN E N   1 
ATOM   4576 C  CA  . ASN E 2 34  ? 15.886  -1.906  32.302  1.00   21.42  ? 124  ASN E CA  1 
ATOM   4577 C  C   . ASN E 2 34  ? 14.824  -1.975  33.399  1.00   20.98  ? 124  ASN E C   1 
ATOM   4578 O  O   . ASN E 2 34  ? 15.143  -2.081  34.587  1.00   20.96  ? 124  ASN E O   1 
ATOM   4579 C  CB  A ASN E 2 34  ? 17.287  -1.883  32.926  0.50   21.97  ? 124  ASN E CB  1 
ATOM   4580 C  CB  B ASN E 2 34  ? 17.300  -1.969  32.895  0.50   21.72  ? 124  ASN E CB  1 
ATOM   4581 C  CG  A ASN E 2 34  ? 18.385  -1.735  31.885  0.50   22.67  ? 124  ASN E CG  1 
ATOM   4582 C  CG  B ASN E 2 34  ? 17.788  -3.401  33.085  0.50   22.24  ? 124  ASN E CG  1 
ATOM   4583 O  OD1 A ASN E 2 34  ? 18.749  -2.698  31.207  0.50   23.41  ? 124  ASN E OD1 1 
ATOM   4584 O  OD1 B ASN E 2 34  ? 17.179  -4.191  33.811  0.50   22.78  ? 124  ASN E OD1 1 
ATOM   4585 N  ND2 A ASN E 2 34  ? 18.918  -0.525  31.755  0.50   23.38  ? 124  ASN E ND2 1 
ATOM   4586 N  ND2 B ASN E 2 34  ? 18.890  -3.741  32.425  0.50   21.79  ? 124  ASN E ND2 1 
ATOM   4587 N  N   . ASN E 2 35  ? 13.560  -1.896  32.992  1.00   19.96  ? 125  ASN E N   1 
ATOM   4588 C  CA  . ASN E 2 35  ? 12.441  -1.990  33.925  1.00   19.35  ? 125  ASN E CA  1 
ATOM   4589 C  C   . ASN E 2 35  ? 11.776  -3.367  33.931  1.00   18.97  ? 125  ASN E C   1 
ATOM   4590 O  O   . ASN E 2 35  ? 10.876  -3.625  34.726  1.00   18.12  ? 125  ASN E O   1 
ATOM   4591 C  CB  . ASN E 2 35  ? 11.407  -0.901  33.639  1.00   19.12  ? 125  ASN E CB  1 
ATOM   4592 C  CG  . ASN E 2 35  ? 11.809  0.445   34.205  1.00   19.36  ? 125  ASN E CG  1 
ATOM   4593 O  OD1 . ASN E 2 35  ? 12.499  0.522   35.228  1.00   18.82  ? 125  ASN E OD1 1 
ATOM   4594 N  ND2 . ASN E 2 35  ? 11.379  1.514   33.549  1.00   17.03  ? 125  ASN E ND2 1 
ATOM   4595 N  N   . TYR E 2 36  ? 12.221  -4.238  33.027  1.00   18.57  ? 126  TYR E N   1 
ATOM   4596 C  CA  . TYR E 2 36  ? 11.823  -5.638  33.052  1.00   18.43  ? 126  TYR E CA  1 
ATOM   4597 C  C   . TYR E 2 36  ? 12.916  -6.485  33.691  1.00   18.59  ? 126  TYR E C   1 
ATOM   4598 O  O   . TYR E 2 36  ? 14.109  -6.262  33.446  1.00   17.85  ? 126  TYR E O   1 
ATOM   4599 C  CB  . TYR E 2 36  ? 11.528  -6.150  31.639  1.00   18.03  ? 126  TYR E CB  1 
ATOM   4600 C  CG  . TYR E 2 36  ? 11.262  -7.637  31.583  1.00   17.26  ? 126  TYR E CG  1 
ATOM   4601 C  CD1 . TYR E 2 36  ? 10.026  -8.155  31.937  1.00   16.82  ? 126  TYR E CD1 1 
ATOM   4602 C  CD2 . TYR E 2 36  ? 12.253  -8.525  31.180  1.00   17.54  ? 126  TYR E CD2 1 
ATOM   4603 C  CE1 . TYR E 2 36  ? 9.781   -9.521  31.882  1.00   17.17  ? 126  TYR E CE1 1 
ATOM   4604 C  CE2 . TYR E 2 36  ? 12.020  -9.884  31.129  1.00   16.64  ? 126  TYR E CE2 1 
ATOM   4605 C  CZ  . TYR E 2 36  ? 10.785  -10.377 31.480  1.00   17.05  ? 126  TYR E CZ  1 
ATOM   4606 O  OH  . TYR E 2 36  ? 10.552  -11.735 31.426  1.00   18.89  ? 126  TYR E OH  1 
ATOM   4607 N  N   . GLU E 2 37  ? 12.503  -7.465  34.495  1.00   19.25  ? 127  GLU E N   1 
ATOM   4608 C  CA  . GLU E 2 37  ? 13.448  -8.337  35.193  1.00   19.36  ? 127  GLU E CA  1 
ATOM   4609 C  C   . GLU E 2 37  ? 13.323  -9.777  34.715  1.00   19.53  ? 127  GLU E C   1 
ATOM   4610 O  O   . GLU E 2 37  ? 12.374  -10.481 35.072  1.00   18.77  ? 127  GLU E O   1 
ATOM   4611 C  CB  . GLU E 2 37  ? 13.263  -8.249  36.718  1.00   19.66  ? 127  GLU E CB  1 
ATOM   4612 C  CG  . GLU E 2 37  ? 14.189  -9.187  37.490  1.00   19.94  ? 127  GLU E CG  1 
ATOM   4613 C  CD  . GLU E 2 37  ? 15.654  -8.953  37.152  1.00   20.61  ? 127  GLU E CD  1 
ATOM   4614 O  OE1 . GLU E 2 37  ? 16.212  -7.913  37.566  1.00   21.71  ? 127  GLU E OE1 1 
ATOM   4615 O  OE2 . GLU E 2 37  ? 16.250  -9.804  36.466  1.00   20.74  ? 127  GLU E OE2 1 
ATOM   4616 N  N   . PRO E 2 38  ? 14.288  -10.217 33.894  1.00   20.02  ? 128  PRO E N   1 
ATOM   4617 C  CA  . PRO E 2 38  ? 14.251  -11.530 33.262  1.00   20.86  ? 128  PRO E CA  1 
ATOM   4618 C  C   . PRO E 2 38  ? 14.442  -12.665 34.260  1.00   21.79  ? 128  PRO E C   1 
ATOM   4619 O  O   . PRO E 2 38  ? 14.167  -13.813 33.933  1.00   21.26  ? 128  PRO E O   1 
ATOM   4620 C  CB  . PRO E 2 38  ? 15.419  -11.489 32.265  1.00   20.56  ? 128  PRO E CB  1 
ATOM   4621 C  CG  . PRO E 2 38  ? 15.900  -10.078 32.256  1.00   20.68  ? 128  PRO E CG  1 
ATOM   4622 C  CD  . PRO E 2 38  ? 15.483  -9.447  33.520  1.00   20.01  ? 128  PRO E CD  1 
ATOM   4623 N  N   . ARG E 2 39  ? 14.897  -12.345 35.471  1.00   23.44  ? 129  ARG E N   1 
ATOM   4624 C  CA  . ARG E 2 39  ? 15.063  -13.363 36.504  1.00   24.59  ? 129  ARG E CA  1 
ATOM   4625 C  C   . ARG E 2 39  ? 13.737  -13.721 37.183  1.00   24.78  ? 129  ARG E C   1 
ATOM   4626 O  O   . ARG E 2 39  ? 13.632  -14.748 37.860  1.00   25.56  ? 129  ARG E O   1 
ATOM   4627 C  CB  . ARG E 2 39  ? 16.110  -12.926 37.535  1.00   25.93  ? 129  ARG E CB  1 
ATOM   4628 C  CG  . ARG E 2 39  ? 17.547  -12.956 37.008  1.00   27.90  ? 129  ARG E CG  1 
ATOM   4629 C  CD  . ARG E 2 39  ? 18.561  -12.908 38.149  1.00   30.39  ? 129  ARG E CD  1 
ATOM   4630 N  NE  . ARG E 2 39  ? 19.949  -12.980 37.684  1.00   31.32  ? 129  ARG E NE  1 
ATOM   4631 C  CZ  . ARG E 2 39  ? 21.011  -12.821 38.472  1.00   31.74  ? 129  ARG E CZ  1 
ATOM   4632 N  NH1 . ARG E 2 39  ? 20.848  -12.582 39.765  1.00   31.97  ? 129  ARG E NH1 1 
ATOM   4633 N  NH2 . ARG E 2 39  ? 22.237  -12.899 37.969  1.00   32.10  ? 129  ARG E NH2 1 
ATOM   4634 N  N   . SER E 2 40  ? 12.721  -12.883 36.998  1.00   24.03  ? 130  SER E N   1 
ATOM   4635 C  CA  . SER E 2 40  ? 11.393  -13.165 37.549  1.00   23.68  ? 130  SER E CA  1 
ATOM   4636 C  C   . SER E 2 40  ? 10.320  -13.282 36.468  1.00   23.19  ? 130  SER E C   1 
ATOM   4637 O  O   . SER E 2 40  ? 9.376   -14.068 36.607  1.00   22.73  ? 130  SER E O   1 
ATOM   4638 C  CB  . SER E 2 40  ? 10.979  -12.090 38.549  1.00   23.33  ? 130  SER E CB  1 
ATOM   4639 O  OG  . SER E 2 40  ? 10.916  -10.824 37.917  1.00   24.27  ? 130  SER E OG  1 
ATOM   4640 N  N   . GLY E 2 41  ? 10.466  -12.495 35.402  1.00   22.29  ? 131  GLY E N   1 
ATOM   4641 C  CA  . GLY E 2 41  ? 9.443   -12.406 34.357  1.00   21.40  ? 131  GLY E CA  1 
ATOM   4642 C  C   . GLY E 2 41  ? 8.516   -11.229 34.599  1.00   21.36  ? 131  GLY E C   1 
ATOM   4643 O  O   . GLY E 2 41  ? 7.457   -11.108 33.975  1.00   22.00  ? 131  GLY E O   1 
ATOM   4644 N  N   . LYS E 2 42  ? 8.924   -10.343 35.503  1.00   20.29  ? 132  LYS E N   1 
ATOM   4645 C  CA  . LYS E 2 42  ? 8.081   -9.224  35.898  1.00   19.61  ? 132  LYS E CA  1 
ATOM   4646 C  C   . LYS E 2 42  ? 8.574   -7.893  35.345  1.00   18.30  ? 132  LYS E C   1 
ATOM   4647 O  O   . LYS E 2 42  ? 9.771   -7.610  35.337  1.00   18.29  ? 132  LYS E O   1 
ATOM   4648 C  CB  . LYS E 2 42  ? 7.965   -9.139  37.433  1.00   19.67  ? 132  LYS E CB  1 
ATOM   4649 C  CG  . LYS E 2 42  ? 7.279   -10.336 38.071  1.00   20.60  ? 132  LYS E CG  1 
ATOM   4650 C  CD  . LYS E 2 42  ? 7.039   -10.104 39.556  1.00   21.85  ? 132  LYS E CD  1 
ATOM   4651 C  CE  . LYS E 2 42  ? 6.429   -11.334 40.214  1.00   22.39  ? 132  LYS E CE  1 
ATOM   4652 N  NZ  . LYS E 2 42  ? 6.035   -11.060 41.626  1.00   22.41  ? 132  LYS E NZ  1 
ATOM   4653 N  N   . PHE E 2 43  ? 7.634   -7.085  34.879  1.00   16.89  ? 133  PHE E N   1 
ATOM   4654 C  CA  . PHE E 2 43  ? 7.913   -5.699  34.565  1.00   17.08  ? 133  PHE E CA  1 
ATOM   4655 C  C   . PHE E 2 43  ? 7.490   -4.876  35.775  1.00   17.81  ? 133  PHE E C   1 
ATOM   4656 O  O   . PHE E 2 43  ? 6.445   -5.142  36.368  1.00   18.61  ? 133  PHE E O   1 
ATOM   4657 C  CB  . PHE E 2 43  ? 7.135   -5.257  33.315  1.00   16.46  ? 133  PHE E CB  1 
ATOM   4658 C  CG  . PHE E 2 43  ? 7.214   -3.784  33.050  1.00   15.00  ? 133  PHE E CG  1 
ATOM   4659 C  CD1 . PHE E 2 43  ? 8.260   -3.256  32.317  1.00   15.30  ? 133  PHE E CD1 1 
ATOM   4660 C  CD2 . PHE E 2 43  ? 6.259   -2.925  33.558  1.00   14.42  ? 133  PHE E CD2 1 
ATOM   4661 C  CE1 . PHE E 2 43  ? 8.353   -1.895  32.093  1.00   14.94  ? 133  PHE E CE1 1 
ATOM   4662 C  CE2 . PHE E 2 43  ? 6.345   -1.561  33.342  1.00   15.31  ? 133  PHE E CE2 1 
ATOM   4663 C  CZ  . PHE E 2 43  ? 7.393   -1.047  32.602  1.00   15.22  ? 133  PHE E CZ  1 
ATOM   4664 N  N   . THR E 2 44  ? 8.292   -3.887  36.154  1.00   18.00  ? 134  THR E N   1 
ATOM   4665 C  CA  . THR E 2 44  ? 7.921   -3.010  37.259  1.00   18.24  ? 134  THR E CA  1 
ATOM   4666 C  C   . THR E 2 44  ? 8.038   -1.553  36.837  1.00   18.10  ? 134  THR E C   1 
ATOM   4667 O  O   . THR E 2 44  ? 9.072   -1.120  36.350  1.00   17.90  ? 134  THR E O   1 
ATOM   4668 C  CB  . THR E 2 44  ? 8.775   -3.289  38.520  1.00   18.83  ? 134  THR E CB  1 
ATOM   4669 O  OG1 . THR E 2 44  ? 8.614   -4.662  38.907  1.00   19.33  ? 134  THR E OG1 1 
ATOM   4670 C  CG2 . THR E 2 44  ? 8.360   -2.391  39.670  1.00   18.63  ? 134  THR E CG2 1 
ATOM   4671 N  N   . CYS E 2 45  ? 6.960   -0.806  37.037  1.00   18.31  ? 135  CYS E N   1 
ATOM   4672 C  CA  . CYS E 2 45  ? 6.865   0.596   36.622  1.00   18.84  ? 135  CYS E CA  1 
ATOM   4673 C  C   . CYS E 2 45  ? 7.741   1.543   37.467  1.00   19.39  ? 135  CYS E C   1 
ATOM   4674 O  O   . CYS E 2 45  ? 7.705   1.508   38.697  1.00   18.45  ? 135  CYS E O   1 
ATOM   4675 C  CB  . CYS E 2 45  ? 5.390   1.022   36.674  1.00   18.44  ? 135  CYS E CB  1 
ATOM   4676 S  SG  . CYS E 2 45  ? 5.044   2.746   36.275  1.00   19.84  ? 135  CYS E SG  1 
ATOM   4677 N  N   . LYS E 2 46  ? 8.529   2.369   36.779  1.00   20.33  ? 136  LYS E N   1 
ATOM   4678 C  CA  . LYS E 2 46  ? 9.318   3.445   37.373  1.00   21.23  ? 136  LYS E CA  1 
ATOM   4679 C  C   . LYS E 2 46  ? 8.642   4.757   37.035  1.00   21.24  ? 136  LYS E C   1 
ATOM   4680 O  O   . LYS E 2 46  ? 8.580   5.677   37.844  1.00   21.43  ? 136  LYS E O   1 
ATOM   4681 C  CB  . LYS E 2 46  ? 10.696  3.518   36.717  1.00   22.20  ? 136  LYS E CB  1 
ATOM   4682 C  CG  . LYS E 2 46  ? 11.829  2.773   37.372  1.00   25.06  ? 136  LYS E CG  1 
ATOM   4683 C  CD  . LYS E 2 46  ? 13.134  3.228   36.692  1.00   27.31  ? 136  LYS E CD  1 
ATOM   4684 C  CE  . LYS E 2 46  ? 14.246  2.201   36.802  1.00   28.23  ? 136  LYS E CE  1 
ATOM   4685 N  NZ  . LYS E 2 46  ? 15.277  2.437   35.760  1.00   29.69  ? 136  LYS E NZ  1 
ATOM   4686 N  N   . VAL E 2 47  ? 8.171   4.840   35.797  1.00   20.66  ? 137  VAL E N   1 
ATOM   4687 C  CA  . VAL E 2 47  ? 7.570   6.050   35.278  1.00   21.14  ? 137  VAL E CA  1 
ATOM   4688 C  C   . VAL E 2 47  ? 6.075   5.830   35.091  1.00   21.05  ? 137  VAL E C   1 
ATOM   4689 O  O   . VAL E 2 47  ? 5.661   5.078   34.203  1.00   21.55  ? 137  VAL E O   1 
ATOM   4690 C  CB  . VAL E 2 47  ? 8.239   6.469   33.948  1.00   21.51  ? 137  VAL E CB  1 
ATOM   4691 C  CG1 . VAL E 2 47  ? 7.439   7.575   33.252  1.00   21.96  ? 137  VAL E CG1 1 
ATOM   4692 C  CG2 . VAL E 2 47  ? 9.680   6.916   34.206  1.00   21.39  ? 137  VAL E CG2 1 
ATOM   4693 N  N   . PRO E 2 48  ? 5.254   6.455   35.954  1.00   20.51  ? 138  PRO E N   1 
ATOM   4694 C  CA  . PRO E 2 48  ? 3.811   6.283   35.828  1.00   19.91  ? 138  PRO E CA  1 
ATOM   4695 C  C   . PRO E 2 48  ? 3.349   6.661   34.440  1.00   19.23  ? 138  PRO E C   1 
ATOM   4696 O  O   . PRO E 2 48  ? 3.923   7.559   33.827  1.00   19.31  ? 138  PRO E O   1 
ATOM   4697 C  CB  . PRO E 2 48  ? 3.248   7.262   36.858  1.00   20.20  ? 138  PRO E CB  1 
ATOM   4698 C  CG  . PRO E 2 48  ? 4.333   7.381   37.879  1.00   20.34  ? 138  PRO E CG  1 
ATOM   4699 C  CD  . PRO E 2 48  ? 5.609   7.317   37.095  1.00   20.75  ? 138  PRO E CD  1 
ATOM   4700 N  N   . GLY E 2 49  ? 2.336   5.965   33.938  1.00   18.00  ? 139  GLY E N   1 
ATOM   4701 C  CA  . GLY E 2 49  ? 1.801   6.293   32.636  1.00   17.66  ? 139  GLY E CA  1 
ATOM   4702 C  C   . GLY E 2 49  ? 1.086   5.148   31.955  1.00   17.02  ? 139  GLY E C   1 
ATOM   4703 O  O   . GLY E 2 49  ? 0.795   4.113   32.562  1.00   16.19  ? 139  GLY E O   1 
ATOM   4704 N  N   . LEU E 2 50  ? 0.809   5.350   30.675  1.00   16.34  ? 140  LEU E N   1 
ATOM   4705 C  CA  . LEU E 2 50  ? 0.094   4.376   29.870  1.00   15.69  ? 140  LEU E CA  1 
ATOM   4706 C  C   . LEU E 2 50  ? 1.063   3.452   29.156  1.00   15.46  ? 140  LEU E C   1 
ATOM   4707 O  O   . LEU E 2 50  ? 1.995   3.909   28.493  1.00   15.92  ? 140  LEU E O   1 
ATOM   4708 C  CB  . LEU E 2 50  ? -0.792  5.100   28.864  1.00   15.60  ? 140  LEU E CB  1 
ATOM   4709 C  CG  . LEU E 2 50  ? -2.061  5.689   29.467  1.00   16.37  ? 140  LEU E CG  1 
ATOM   4710 C  CD1 . LEU E 2 50  ? -2.617  6.750   28.556  1.00   17.11  ? 140  LEU E CD1 1 
ATOM   4711 C  CD2 . LEU E 2 50  ? -3.094  4.592   29.707  1.00   17.14  ? 140  LEU E CD2 1 
ATOM   4712 N  N   . TYR E 2 51  ? 0.842   2.148   29.302  1.00   15.12  ? 141  TYR E N   1 
ATOM   4713 C  CA  . TYR E 2 51  ? 1.695   1.143   28.682  1.00   14.32  ? 141  TYR E CA  1 
ATOM   4714 C  C   . TYR E 2 51  ? 0.878   0.187   27.837  1.00   14.05  ? 141  TYR E C   1 
ATOM   4715 O  O   . TYR E 2 51  ? -0.307  -0.023  28.102  1.00   14.53  ? 141  TYR E O   1 
ATOM   4716 C  CB  . TYR E 2 51  ? 2.431   0.334   29.745  1.00   14.35  ? 141  TYR E CB  1 
ATOM   4717 C  CG  . TYR E 2 51  ? 3.501   1.116   30.472  1.00   14.90  ? 141  TYR E CG  1 
ATOM   4718 C  CD1 . TYR E 2 51  ? 3.168   1.971   31.521  1.00   14.30  ? 141  TYR E CD1 1 
ATOM   4719 C  CD2 . TYR E 2 51  ? 4.840   0.992   30.118  1.00   14.60  ? 141  TYR E CD2 1 
ATOM   4720 C  CE1 . TYR E 2 51  ? 4.139   2.704   32.188  1.00   15.20  ? 141  TYR E CE1 1 
ATOM   4721 C  CE2 . TYR E 2 51  ? 5.827   1.721   30.782  1.00   16.35  ? 141  TYR E CE2 1 
ATOM   4722 C  CZ  . TYR E 2 51  ? 5.468   2.570   31.826  1.00   15.43  ? 141  TYR E CZ  1 
ATOM   4723 O  OH  . TYR E 2 51  ? 6.430   3.302   32.488  1.00   14.67  ? 141  TYR E OH  1 
ATOM   4724 N  N   . TYR E 2 52  ? 1.510   -0.394  26.820  1.00   12.70  ? 142  TYR E N   1 
ATOM   4725 C  CA  . TYR E 2 52  ? 0.905   -1.514  26.115  1.00   12.35  ? 142  TYR E CA  1 
ATOM   4726 C  C   . TYR E 2 52  ? 1.735   -2.755  26.376  1.00   11.69  ? 142  TYR E C   1 
ATOM   4727 O  O   . TYR E 2 52  ? 2.958   -2.721  26.251  1.00   11.73  ? 142  TYR E O   1 
ATOM   4728 C  CB  . TYR E 2 52  ? 0.788   -1.238  24.610  1.00   12.72  ? 142  TYR E CB  1 
ATOM   4729 C  CG  . TYR E 2 52  ? 0.158   -2.358  23.808  1.00   13.11  ? 142  TYR E CG  1 
ATOM   4730 C  CD1 . TYR E 2 52  ? -1.152  -2.768  24.049  1.00   12.84  ? 142  TYR E CD1 1 
ATOM   4731 C  CD2 . TYR E 2 52  ? 0.867   -2.996  22.797  1.00   14.30  ? 142  TYR E CD2 1 
ATOM   4732 C  CE1 . TYR E 2 52  ? -1.730  -3.781  23.302  1.00   14.19  ? 142  TYR E CE1 1 
ATOM   4733 C  CE2 . TYR E 2 52  ? 0.295   -4.019  22.044  1.00   13.28  ? 142  TYR E CE2 1 
ATOM   4734 C  CZ  . TYR E 2 52  ? -1.000  -4.397  22.297  1.00   14.45  ? 142  TYR E CZ  1 
ATOM   4735 O  OH  . TYR E 2 52  ? -1.563  -5.411  21.561  1.00   15.41  ? 142  TYR E OH  1 
ATOM   4736 N  N   . PHE E 2 53  ? 1.056   -3.837  26.758  1.00   11.36  ? 143  PHE E N   1 
ATOM   4737 C  CA  . PHE E 2 53  ? 1.680   -5.134  26.992  1.00   11.72  ? 143  PHE E CA  1 
ATOM   4738 C  C   . PHE E 2 53  ? 1.088   -6.177  26.060  1.00   11.50  ? 143  PHE E C   1 
ATOM   4739 O  O   . PHE E 2 53  ? -0.110  -6.156  25.770  1.00   12.11  ? 143  PHE E O   1 
ATOM   4740 C  CB  . PHE E 2 53  ? 1.473   -5.593  28.440  1.00   12.09  ? 143  PHE E CB  1 
ATOM   4741 C  CG  . PHE E 2 53  ? 2.139   -4.710  29.449  1.00   13.20  ? 143  PHE E CG  1 
ATOM   4742 C  CD1 . PHE E 2 53  ? 1.456   -3.638  30.010  1.00   12.19  ? 143  PHE E CD1 1 
ATOM   4743 C  CD2 . PHE E 2 53  ? 3.457   -4.933  29.818  1.00   13.20  ? 143  PHE E CD2 1 
ATOM   4744 C  CE1 . PHE E 2 53  ? 2.077   -2.813  30.934  1.00   12.69  ? 143  PHE E CE1 1 
ATOM   4745 C  CE2 . PHE E 2 53  ? 4.087   -4.101  30.741  1.00   13.60  ? 143  PHE E CE2 1 
ATOM   4746 C  CZ  . PHE E 2 53  ? 3.394   -3.043  31.293  1.00   12.38  ? 143  PHE E CZ  1 
ATOM   4747 N  N   . THR E 2 54  ? 1.926   -7.110  25.627  1.00   11.44  ? 144  THR E N   1 
ATOM   4748 C  CA  . THR E 2 54  ? 1.524   -8.095  24.643  1.00   11.58  ? 144  THR E CA  1 
ATOM   4749 C  C   . THR E 2 54  ? 2.409   -9.341  24.724  1.00   11.16  ? 144  THR E C   1 
ATOM   4750 O  O   . THR E 2 54  ? 3.566   -9.263  25.119  1.00   11.27  ? 144  THR E O   1 
ATOM   4751 C  CB  . THR E 2 54  ? 1.573   -7.469  23.221  1.00   11.67  ? 144  THR E CB  1 
ATOM   4752 O  OG1 . THR E 2 54  ? 1.256   -8.458  22.237  1.00   13.80  ? 144  THR E OG1 1 
ATOM   4753 C  CG2 . THR E 2 54  ? 2.952   -6.881  22.929  1.00   11.24  ? 144  THR E CG2 1 
ATOM   4754 N  N   . TYR E 2 55  ? 1.851   -10.499 24.379  1.00   11.71  ? 145  TYR E N   1 
ATOM   4755 C  CA  . TYR E 2 55  ? 2.627   -11.732 24.327  1.00   11.88  ? 145  TYR E CA  1 
ATOM   4756 C  C   . TYR E 2 55  ? 2.166   -12.614 23.175  1.00   11.94  ? 145  TYR E C   1 
ATOM   4757 O  O   . TYR E 2 55  ? 1.021   -12.536 22.732  1.00   12.11  ? 145  TYR E O   1 
ATOM   4758 C  CB  . TYR E 2 55  ? 2.554   -12.513 25.657  1.00   11.80  ? 145  TYR E CB  1 
ATOM   4759 C  CG  . TYR E 2 55  ? 1.232   -13.210 25.875  1.00   12.49  ? 145  TYR E CG  1 
ATOM   4760 C  CD1 . TYR E 2 55  ? 1.034   -14.510 25.436  1.00   13.38  ? 145  TYR E CD1 1 
ATOM   4761 C  CD2 . TYR E 2 55  ? 0.184   -12.567 26.518  1.00   12.80  ? 145  TYR E CD2 1 
ATOM   4762 C  CE1 . TYR E 2 55  ? -0.181  -15.144 25.604  1.00   13.80  ? 145  TYR E CE1 1 
ATOM   4763 C  CE2 . TYR E 2 55  ? -1.030  -13.189 26.697  1.00   13.89  ? 145  TYR E CE2 1 
ATOM   4764 C  CZ  . TYR E 2 55  ? -1.203  -14.483 26.236  1.00   14.31  ? 145  TYR E CZ  1 
ATOM   4765 O  OH  . TYR E 2 55  ? -2.399  -15.121 26.418  1.00   15.81  ? 145  TYR E OH  1 
ATOM   4766 N  N   . HIS E 2 56  ? 3.084   -13.431 22.679  1.00   11.66  ? 146  HIS E N   1 
ATOM   4767 C  CA  . HIS E 2 56  ? 2.755   -14.494 21.751  1.00   12.04  ? 146  HIS E CA  1 
ATOM   4768 C  C   . HIS E 2 56  ? 3.326   -15.769 22.342  1.00   12.30  ? 146  HIS E C   1 
ATOM   4769 O  O   . HIS E 2 56  ? 4.513   -15.835 22.630  1.00   13.42  ? 146  HIS E O   1 
ATOM   4770 C  CB  . HIS E 2 56  ? 3.373   -14.224 20.377  1.00   11.10  ? 146  HIS E CB  1 
ATOM   4771 C  CG  . HIS E 2 56  ? 3.002   -12.893 19.808  1.00   11.27  ? 146  HIS E CG  1 
ATOM   4772 N  ND1 . HIS E 2 56  ? 1.932   -12.721 18.955  1.00   9.94   ? 146  HIS E ND1 1 
ATOM   4773 C  CD2 . HIS E 2 56  ? 3.539   -11.662 19.991  1.00   10.52  ? 146  HIS E CD2 1 
ATOM   4774 C  CE1 . HIS E 2 56  ? 1.834   -11.446 18.627  1.00   10.52  ? 146  HIS E CE1 1 
ATOM   4775 N  NE2 . HIS E 2 56  ? 2.797   -10.781 19.241  1.00   10.09  ? 146  HIS E NE2 1 
ATOM   4776 N  N   . ALA E 2 57  ? 2.489   -16.777 22.540  1.00   13.18  ? 147  ALA E N   1 
ATOM   4777 C  CA  . ALA E 2 57  ? 2.968   -18.014 23.123  1.00   14.23  ? 147  ALA E CA  1 
ATOM   4778 C  C   . ALA E 2 57  ? 2.755   -19.179 22.180  1.00   14.46  ? 147  ALA E C   1 
ATOM   4779 O  O   . ALA E 2 57  ? 1.665   -19.362 21.645  1.00   15.19  ? 147  ALA E O   1 
ATOM   4780 C  CB  . ALA E 2 57  ? 2.282   -18.273 24.461  1.00   14.61  ? 147  ALA E CB  1 
ATOM   4781 N  N   . SER E 2 58  ? 3.813   -19.955 21.968  1.00   15.42  ? 148  SER E N   1 
ATOM   4782 C  CA  . SER E 2 58  ? 3.719   -21.218 21.252  1.00   15.83  ? 148  SER E CA  1 
ATOM   4783 C  C   . SER E 2 58  ? 3.243   -22.309 22.213  1.00   16.36  ? 148  SER E C   1 
ATOM   4784 O  O   . SER E 2 58  ? 3.575   -22.283 23.395  1.00   15.92  ? 148  SER E O   1 
ATOM   4785 C  CB  . SER E 2 58  ? 5.078   -21.591 20.659  1.00   15.55  ? 148  SER E CB  1 
ATOM   4786 O  OG  . SER E 2 58  ? 5.446   -20.688 19.628  1.00   16.26  ? 148  SER E OG  1 
ATOM   4787 N  N   . SER E 2 59  ? 2.470   -23.264 21.704  1.00   16.82  ? 149  SER E N   1 
ATOM   4788 C  CA  . SER E 2 59  ? 1.893   -24.302 22.551  1.00   18.03  ? 149  SER E CA  1 
ATOM   4789 C  C   . SER E 2 59  ? 1.573   -25.566 21.770  1.00   19.09  ? 149  SER E C   1 
ATOM   4790 O  O   . SER E 2 59  ? 1.353   -25.525 20.556  1.00   18.40  ? 149  SER E O   1 
ATOM   4791 C  CB  . SER E 2 59  ? 0.621   -23.805 23.255  1.00   17.40  ? 149  SER E CB  1 
ATOM   4792 O  OG  . SER E 2 59  ? -0.198  -24.559 23.537  0.0000 24.79  ? 149  SER E OG  1 
ATOM   4793 N  N   . ARG E 2 60  ? 1.538   -26.688 22.484  1.00   20.55  ? 150  ARG E N   1 
ATOM   4794 C  CA  . ARG E 2 60  ? 1.205   -27.975 21.883  1.00   22.11  ? 150  ARG E CA  1 
ATOM   4795 C  C   . ARG E 2 60  ? -0.007  -28.576 22.584  1.00   23.03  ? 150  ARG E C   1 
ATOM   4796 O  O   . ARG E 2 60  ? -0.386  -29.713 22.320  1.00   23.57  ? 150  ARG E O   1 
ATOM   4797 C  CB  . ARG E 2 60  ? 2.395   -28.935 21.960  1.00   22.15  ? 150  ARG E CB  1 
ATOM   4798 C  CG  . ARG E 2 60  ? 2.678   -30.094 21.558  0.0000 43.21  ? 150  ARG E CG  1 
ATOM   4799 C  CD  . ARG E 2 60  ? 3.484   -31.140 22.321  0.0000 50.57  ? 150  ARG E CD  1 
ATOM   4800 N  NE  . ARG E 2 60  ? 4.713   -30.571 22.878  0.0000 54.76  ? 150  ARG E NE  1 
ATOM   4801 C  CZ  . ARG E 2 60  ? 5.458   -31.142 23.821  0.0000 56.95  ? 150  ARG E CZ  1 
ATOM   4802 N  NH1 . ARG E 2 60  ? 5.113   -32.318 24.336  0.0000 56.91  ? 150  ARG E NH1 1 
ATOM   4803 N  NH2 . ARG E 2 60  ? 6.559   -30.531 24.250  0.0000 57.55  ? 150  ARG E NH2 1 
ATOM   4804 N  N   . GLY E 2 61  ? -0.610  -27.803 23.483  1.00   23.01  ? 151  GLY E N   1 
ATOM   4805 C  CA  . GLY E 2 61  ? -1.830  -28.226 24.161  1.00   23.26  ? 151  GLY E CA  1 
ATOM   4806 C  C   . GLY E 2 61  ? -2.650  -27.051 24.666  1.00   23.10  ? 151  GLY E C   1 
ATOM   4807 O  O   . GLY E 2 61  ? -2.552  -25.943 24.137  1.00   23.10  ? 151  GLY E O   1 
ATOM   4808 N  N   . ASN E 2 62  ? -3.464  -27.298 25.690  1.00   22.46  ? 152  ASN E N   1 
ATOM   4809 C  CA  . ASN E 2 62  ? -4.302  -26.256 26.270  1.00   22.24  ? 152  ASN E CA  1 
ATOM   4810 C  C   . ASN E 2 62  ? -3.493  -25.293 27.127  1.00   21.60  ? 152  ASN E C   1 
ATOM   4811 O  O   . ASN E 2 62  ? -2.702  -25.715 27.975  1.00   21.22  ? 152  ASN E O   1 
ATOM   4812 C  CB  . ASN E 2 62  ? -5.415  -26.865 27.118  1.00   22.51  ? 152  ASN E CB  1 
ATOM   4813 C  CG  . ASN E 2 62  ? -6.334  -27.762 26.326  1.00   22.95  ? 152  ASN E CG  1 
ATOM   4814 O  OD1 . ASN E 2 62  ? -6.398  -27.691 25.095  1.00   22.49  ? 152  ASN E OD1 1 
ATOM   4815 N  ND2 . ASN E 2 62  ? -7.061  -28.615 27.032  1.00   22.89  ? 152  ASN E ND2 1 
ATOM   4816 N  N   . LEU E 2 63  ? -3.707  -23.998 26.909  1.00   20.40  ? 153  LEU E N   1 
ATOM   4817 C  CA  . LEU E 2 63  ? -2.988  -22.963 27.653  1.00   19.40  ? 153  LEU E CA  1 
ATOM   4818 C  C   . LEU E 2 63  ? -3.911  -21.818 28.063  1.00   19.30  ? 153  LEU E C   1 
ATOM   4819 O  O   . LEU E 2 63  ? -4.676  -21.296 27.247  1.00   18.42  ? 153  LEU E O   1 
ATOM   4820 C  CB  . LEU E 2 63  ? -1.824  -22.427 26.817  1.00   19.44  ? 153  LEU E CB  1 
ATOM   4821 C  CG  . LEU E 2 63  ? -0.990  -21.244 27.324  1.00   18.44  ? 153  LEU E CG  1 
ATOM   4822 C  CD1 . LEU E 2 63  ? -0.147  -21.616 28.544  1.00   18.35  ? 153  LEU E CD1 1 
ATOM   4823 C  CD2 . LEU E 2 63  ? -0.103  -20.744 26.204  1.00   18.43  ? 153  LEU E CD2 1 
ATOM   4824 N  N   . CYS E 2 64  ? -3.833  -21.441 29.336  1.00   19.22  ? 154  CYS E N   1 
ATOM   4825 C  CA  . CYS E 2 64  ? -4.532  -20.274 29.849  1.00   19.39  ? 154  CYS E CA  1 
ATOM   4826 C  C   . CYS E 2 64  ? -3.544  -19.408 30.615  1.00   19.75  ? 154  CYS E C   1 
ATOM   4827 O  O   . CYS E 2 64  ? -2.855  -19.890 31.520  1.00   20.75  ? 154  CYS E O   1 
ATOM   4828 C  CB  . CYS E 2 64  ? -5.676  -20.688 30.782  1.00   19.27  ? 154  CYS E CB  1 
ATOM   4829 S  SG  . CYS E 2 64  ? -7.048  -21.531 29.984  1.00   19.92  ? 154  CYS E SG  1 
ATOM   4830 N  N   . VAL E 2 65  ? -3.475  -18.131 30.264  1.00   19.03  ? 155  VAL E N   1 
ATOM   4831 C  CA  . VAL E 2 65  ? -2.577  -17.206 30.954  1.00   19.20  ? 155  VAL E CA  1 
ATOM   4832 C  C   . VAL E 2 65  ? -3.335  -16.070 31.650  1.00   18.78  ? 155  VAL E C   1 
ATOM   4833 O  O   . VAL E 2 65  ? -4.265  -15.495 31.083  1.00   18.37  ? 155  VAL E O   1 
ATOM   4834 C  CB  . VAL E 2 65  ? -1.535  -16.615 29.973  1.00   19.42  ? 155  VAL E CB  1 
ATOM   4835 C  CG1 . VAL E 2 65  ? -0.823  -15.429 30.580  1.00   20.60  ? 155  VAL E CG1 1 
ATOM   4836 C  CG2 . VAL E 2 65  ? -0.537  -17.688 29.551  1.00   19.30  ? 155  VAL E CG2 1 
ATOM   4837 N  N   . ASN E 2 66  ? -2.935  -15.764 32.883  1.00   18.41  ? 156  ASN E N   1 
ATOM   4838 C  CA  . ASN E 2 66  ? -3.437  -14.598 33.599  1.00   18.42  ? 156  ASN E CA  1 
ATOM   4839 C  C   . ASN E 2 66  ? -2.510  -13.409 33.424  1.00   18.36  ? 156  ASN E C   1 
ATOM   4840 O  O   . ASN E 2 66  ? -1.313  -13.511 33.679  1.00   18.37  ? 156  ASN E O   1 
ATOM   4841 C  CB  . ASN E 2 66  ? -3.534  -14.886 35.096  1.00   18.26  ? 156  ASN E CB  1 
ATOM   4842 C  CG  . ASN E 2 66  ? -4.531  -15.953 35.414  1.00   18.24  ? 156  ASN E CG  1 
ATOM   4843 O  OD1 . ASN E 2 66  ? -5.498  -16.143 34.684  1.00   20.16  ? 156  ASN E OD1 1 
ATOM   4844 N  ND2 . ASN E 2 66  ? -4.311  -16.660 36.513  1.00   17.49  ? 156  ASN E ND2 1 
ATOM   4845 N  N   . LEU E 2 67  ? -3.070  -12.283 32.999  1.00   18.66  ? 157  LEU E N   1 
ATOM   4846 C  CA  . LEU E 2 67  ? -2.339  -11.027 32.973  1.00   18.27  ? 157  LEU E CA  1 
ATOM   4847 C  C   . LEU E 2 67  ? -2.521  -10.391 34.341  1.00   18.66  ? 157  LEU E C   1 
ATOM   4848 O  O   . LEU E 2 67  ? -3.644  -10.063 34.736  1.00   18.38  ? 157  LEU E O   1 
ATOM   4849 C  CB  . LEU E 2 67  ? -2.872  -10.091 31.882  1.00   17.14  ? 157  LEU E CB  1 
ATOM   4850 C  CG  . LEU E 2 67  ? -2.118  -8.761  31.787  1.00   17.55  ? 157  LEU E CG  1 
ATOM   4851 C  CD1 . LEU E 2 67  ? -0.648  -8.983  31.433  1.00   17.99  ? 157  LEU E CD1 1 
ATOM   4852 C  CD2 . LEU E 2 67  ? -2.758  -7.837  30.789  1.00   17.55  ? 157  LEU E CD2 1 
ATOM   4853 N  N   . MET E 2 68  ? -1.413  -10.234 35.060  1.00   19.50  ? 158  MET E N   1 
ATOM   4854 C  CA  . MET E 2 68  ? -1.429  -9.739  36.432  1.00   18.85  ? 158  MET E CA  1 
ATOM   4855 C  C   . MET E 2 68  ? -0.898  -8.319  36.512  1.00   19.86  ? 158  MET E C   1 
ATOM   4856 O  O   . MET E 2 68  ? 0.143   -8.004  35.930  1.00   19.00  ? 158  MET E O   1 
ATOM   4857 C  CB  . MET E 2 68  ? -0.580  -10.649 37.327  1.00   19.15  ? 158  MET E CB  1 
ATOM   4858 C  CG  . MET E 2 68  ? -0.942  -12.120 37.254  1.00   17.88  ? 158  MET E CG  1 
ATOM   4859 S  SD  . MET E 2 68  ? -2.608  -12.406 37.868  1.00   19.36  ? 158  MET E SD  1 
ATOM   4860 C  CE  . MET E 2 68  ? -2.417  -11.768 39.531  1.00   19.55  ? 158  MET E CE  1 
ATOM   4861 N  N   . ARG E 2 69  ? -1.630  -7.462  37.225  1.00   21.01  ? 159  ARG E N   1 
ATOM   4862 C  CA  . ARG E 2 69  ? -1.169  -6.115  37.556  1.00   22.37  ? 159  ARG E CA  1 
ATOM   4863 C  C   . ARG E 2 69  ? -1.289  -5.898  39.062  1.00   23.67  ? 159  ARG E C   1 
ATOM   4864 O  O   . ARG E 2 69  ? -2.208  -6.421  39.698  1.00   23.32  ? 159  ARG E O   1 
ATOM   4865 C  CB  . ARG E 2 69  ? -1.970  -5.042  36.811  1.00   22.84  ? 159  ARG E CB  1 
ATOM   4866 C  CG  . ARG E 2 69  ? -1.724  -3.632  37.361  1.00   23.91  ? 159  ARG E CG  1 
ATOM   4867 C  CD  . ARG E 2 69  ? -2.520  -2.553  36.658  1.00   24.28  ? 159  ARG E CD  1 
ATOM   4868 N  NE  . ARG E 2 69  ? -3.912  -2.930  36.417  1.00   24.40  ? 159  ARG E NE  1 
ATOM   4869 C  CZ  . ARG E 2 69  ? -4.802  -2.127  35.842  1.00   24.34  ? 159  ARG E CZ  1 
ATOM   4870 N  NH1 . ARG E 2 69  ? -4.445  -0.911  35.456  1.00   24.59  ? 159  ARG E NH1 1 
ATOM   4871 N  NH2 . ARG E 2 69  ? -6.049  -2.533  35.654  1.00   24.65  ? 159  ARG E NH2 1 
ATOM   4872 N  N   . GLY E 2 70  ? -0.359  -5.132  39.626  1.00   24.49  ? 160  GLY E N   1 
ATOM   4873 C  CA  . GLY E 2 70  ? -0.387  -4.820  41.049  1.00   25.96  ? 160  GLY E CA  1 
ATOM   4874 C  C   . GLY E 2 70  ? 1.002   -4.691  41.646  1.00   26.95  ? 160  GLY E C   1 
ATOM   4875 O  O   . GLY E 2 70  ? 2.004   -4.823  40.949  1.00   26.97  ? 160  GLY E O   1 
ATOM   4876 N  N   . ARG E 2 71  ? 1.066   -4.437  42.947  1.00   28.01  ? 161  ARG E N   1 
ATOM   4877 C  CA  . ARG E 2 71  ? 2.350   -4.381  43.634  1.00   28.82  ? 161  ARG E CA  1 
ATOM   4878 C  C   . ARG E 2 71  ? 2.592   -5.680  44.374  1.00   29.01  ? 161  ARG E C   1 
ATOM   4879 O  O   . ARG E 2 71  ? 2.752   -6.739  43.765  1.00   29.25  ? 161  ARG E O   1 
ATOM   4880 C  CB  . ARG E 2 71  ? 2.382   -3.215  44.616  1.00   29.32  ? 161  ARG E CB  1 
ATOM   4881 C  CG  . ARG E 2 71  ? 2.149   -1.879  43.970  1.00   30.51  ? 161  ARG E CG  1 
ATOM   4882 C  CD  . ARG E 2 71  ? 1.846   -0.822  45.005  1.00   32.20  ? 161  ARG E CD  1 
ATOM   4883 N  NE  . ARG E 2 71  ? 1.422   0.417   44.364  1.00   33.68  ? 161  ARG E NE  1 
ATOM   4884 C  CZ  . ARG E 2 71  ? 2.202   1.480   44.214  1.00   34.38  ? 161  ARG E CZ  1 
ATOM   4885 N  NH1 . ARG E 2 71  ? 3.447   1.459   44.676  1.00   35.07  ? 161  ARG E NH1 1 
ATOM   4886 N  NH2 . ARG E 2 71  ? 1.738   2.564   43.607  1.00   34.14  ? 161  ARG E NH2 1 
ATOM   4887 N  N   . GLU E 2 72  ? 2.596   -5.588  45.697  1.00   29.20  ? 162  GLU E N   1 
ATOM   4888 C  CA  . GLU E 2 72  ? 2.804   -6.733  46.566  1.00   29.45  ? 162  GLU E CA  1 
ATOM   4889 C  C   . GLU E 2 72  ? 1.885   -7.896  46.207  1.00   29.13  ? 162  GLU E C   1 
ATOM   4890 O  O   . GLU E 2 72  ? 2.345   -9.006  45.925  1.00   29.25  ? 162  GLU E O   1 
ATOM   4891 C  CB  . GLU E 2 72  ? 2.565   -6.304  48.014  1.00   30.42  ? 162  GLU E CB  1 
ATOM   4892 C  CG  . GLU E 2 72  ? 3.253   -4.997  48.372  1.00   31.84  ? 162  GLU E CG  1 
ATOM   4893 C  CD  . GLU E 2 72  ? 4.753   -5.156  48.429  1.00   33.67  ? 162  GLU E CD  1 
ATOM   4894 O  OE1 . GLU E 2 72  ? 5.213   -6.316  48.526  1.00   34.57  ? 162  GLU E OE1 1 
ATOM   4895 O  OE2 . GLU E 2 72  ? 5.473   -4.133  48.379  1.00   35.00  ? 162  GLU E OE2 1 
ATOM   4896 N  N   . ARG E 2 73  ? 0.583   -7.635  46.224  1.00   28.71  ? 163  ARG E N   1 
ATOM   4897 C  CA  . ARG E 2 73  ? -0.405  -8.661  45.914  1.00   27.88  ? 163  ARG E CA  1 
ATOM   4898 C  C   . ARG E 2 73  ? -1.096  -8.315  44.601  1.00   27.37  ? 163  ARG E C   1 
ATOM   4899 O  O   . ARG E 2 73  ? -2.131  -7.633  44.585  1.00   27.82  ? 163  ARG E O   1 
ATOM   4900 C  CB  . ARG E 2 73  ? -1.422  -8.786  47.053  1.00   28.16  ? 163  ARG E CB  1 
ATOM   4901 C  CG  . ARG E 2 73  ? -0.857  -7.790  48.478  0.0000 20.00  ? 163  ARG E CG  1 
ATOM   4902 C  CD  . ARG E 2 73  ? -0.497  -9.239  48.759  0.0000 20.00  ? 163  ARG E CD  1 
ATOM   4903 N  NE  . ARG E 2 73  ? -0.125  -9.451  50.155  0.0000 20.00  ? 163  ARG E NE  1 
ATOM   4904 C  CZ  . ARG E 2 73  ? 1.096   -9.252  50.642  0.0000 20.00  ? 163  ARG E CZ  1 
ATOM   4905 N  NH1 . ARG E 2 73  ? 2.068   -8.837  49.843  0.0000 20.00  ? 163  ARG E NH1 1 
ATOM   4906 N  NH2 . ARG E 2 73  ? 1.339   -9.472  51.926  0.0000 20.00  ? 163  ARG E NH2 1 
ATOM   4907 N  N   . ALA E 2 74  ? -0.505  -8.775  43.501  1.00   25.71  ? 164  ALA E N   1 
ATOM   4908 C  CA  . ALA E 2 74  ? -1.007  -8.466  42.169  1.00   24.66  ? 164  ALA E CA  1 
ATOM   4909 C  C   . ALA E 2 74  ? -2.365  -9.103  41.934  1.00   24.01  ? 164  ALA E C   1 
ATOM   4910 O  O   . ALA E 2 74  ? -2.614  -10.228 42.360  1.00   24.11  ? 164  ALA E O   1 
ATOM   4911 C  CB  . ALA E 2 74  ? -0.019  -8.933  41.107  1.00   24.10  ? 164  ALA E CB  1 
ATOM   4912 N  N   . GLN E 2 75  ? -3.233  -8.375  41.240  1.00   23.03  ? 165  GLN E N   1 
ATOM   4913 C  CA  . GLN E 2 75  ? -4.556  -8.866  40.890  1.00   21.85  ? 165  GLN E CA  1 
ATOM   4914 C  C   . GLN E 2 75  ? -4.630  -9.109  39.385  1.00   21.58  ? 165  GLN E C   1 
ATOM   4915 O  O   . GLN E 2 75  ? -3.978  -8.409  38.598  1.00   19.95  ? 165  GLN E O   1 
ATOM   4916 C  CB  . GLN E 2 75  ? -5.613  -7.846  41.305  1.00   22.32  ? 165  GLN E CB  1 
ATOM   4917 C  CG  . GLN E 2 75  ? -5.690  -7.563  42.876  0.0000 20.00  ? 165  GLN E CG  1 
ATOM   4918 C  CD  . GLN E 2 75  ? -6.171  -8.927  43.332  0.0000 20.00  ? 165  GLN E CD  1 
ATOM   4919 O  OE1 . GLN E 2 75  ? -7.153  -9.457  42.814  0.0000 20.00  ? 165  GLN E OE1 1 
ATOM   4920 N  NE2 . GLN E 2 75  ? -5.476  -9.502  44.309  0.0000 20.00  ? 165  GLN E NE2 1 
ATOM   4921 N  N   . LYS E 2 76  ? -5.426  -10.095 38.981  1.00   20.18  ? 166  LYS E N   1 
ATOM   4922 C  CA  . LYS E 2 76  ? -5.546  -10.396 37.563  1.00   20.56  ? 166  LYS E CA  1 
ATOM   4923 C  C   . LYS E 2 76  ? -6.386  -9.354  36.827  1.00   19.20  ? 166  LYS E C   1 
ATOM   4924 O  O   . LYS E 2 76  ? -7.384  -8.837  37.347  1.00   18.02  ? 166  LYS E O   1 
ATOM   4925 C  CB  . LYS E 2 76  ? -6.106  -11.802 37.333  1.00   21.51  ? 166  LYS E CB  1 
ATOM   4926 C  CG  . LYS E 2 76  ? -7.535  -11.842 36.885  1.00   23.46  ? 166  LYS E CG  1 
ATOM   4927 C  CD  . LYS E 2 76  ? -8.038  -13.268 36.883  1.00   25.15  ? 166  LYS E CD  1 
ATOM   4928 C  CE  . LYS E 2 76  ? -9.526  -13.310 36.599  1.00   25.74  ? 166  LYS E CE  1 
ATOM   4929 N  NZ  . LYS E 2 76  ? -9.798  -13.055 35.154  1.00   26.90  ? 166  LYS E NZ  1 
ATOM   4930 N  N   . VAL E 2 77  ? -5.959  -9.045  35.612  1.00   17.78  ? 167  VAL E N   1 
ATOM   4931 C  CA  . VAL E 2 77  ? -6.677  -8.112  34.767  1.00   16.71  ? 167  VAL E CA  1 
ATOM   4932 C  C   . VAL E 2 77  ? -7.586  -8.928  33.858  1.00   16.15  ? 167  VAL E C   1 
ATOM   4933 O  O   . VAL E 2 77  ? -8.799  -8.731  33.836  1.00   14.69  ? 167  VAL E O   1 
ATOM   4934 C  CB  . VAL E 2 77  ? -5.685  -7.242  33.957  1.00   17.36  ? 167  VAL E CB  1 
ATOM   4935 C  CG1 . VAL E 2 77  ? -6.406  -6.373  32.927  1.00   16.38  ? 167  VAL E CG1 1 
ATOM   4936 C  CG2 . VAL E 2 77  ? -4.859  -6.377  34.911  1.00   17.31  ? 167  VAL E CG2 1 
ATOM   4937 N  N   . VAL E 2 78  ? -6.988  -9.872  33.132  1.00   15.46  ? 168  VAL E N   1 
ATOM   4938 C  CA  . VAL E 2 78  ? -7.739  -10.765 32.262  1.00   15.31  ? 168  VAL E CA  1 
ATOM   4939 C  C   . VAL E 2 78  ? -7.117  -12.158 32.223  1.00   15.85  ? 168  VAL E C   1 
ATOM   4940 O  O   . VAL E 2 78  ? -5.974  -12.354 32.608  1.00   15.49  ? 168  VAL E O   1 
ATOM   4941 C  CB  . VAL E 2 78  ? -7.816  -10.229 30.814  1.00   14.64  ? 168  VAL E CB  1 
ATOM   4942 C  CG1 . VAL E 2 78  ? -8.742  -9.024  30.724  1.00   12.97  ? 168  VAL E CG1 1 
ATOM   4943 C  CG2 . VAL E 2 78  ? -6.425  -9.902  30.293  1.00   13.78  ? 168  VAL E CG2 1 
ATOM   4944 N  N   . THR E 2 79  ? -7.890  -13.124 31.752  1.00   17.23  ? 169  THR E N   1 
ATOM   4945 C  CA  . THR E 2 79  ? -7.380  -14.460 31.518  1.00   18.07  ? 169  THR E CA  1 
ATOM   4946 C  C   . THR E 2 79  ? -7.557  -14.777 30.041  1.00   17.95  ? 169  THR E C   1 
ATOM   4947 O  O   . THR E 2 79  ? -8.657  -14.622 29.517  1.00   18.49  ? 169  THR E O   1 
ATOM   4948 C  CB  . THR E 2 79  ? -8.146  -15.489 32.360  1.00   18.36  ? 169  THR E CB  1 
ATOM   4949 O  OG1 . THR E 2 79  ? -7.991  -15.171 33.749  1.00   19.37  ? 169  THR E OG1 1 
ATOM   4950 C  CG2 . THR E 2 79  ? -7.624  -16.889 32.102  1.00   18.65  ? 169  THR E CG2 1 
ATOM   4951 N  N   . PHE E 2 80  ? -6.476  -15.178 29.367  1.00   17.36  ? 170  PHE E N   1 
ATOM   4952 C  CA  . PHE E 2 80  ? -6.549  -15.642 27.977  1.00   17.15  ? 170  PHE E CA  1 
ATOM   4953 C  C   . PHE E 2 80  ? -6.384  -17.156 27.909  1.00   17.30  ? 170  PHE E C   1 
ATOM   4954 O  O   . PHE E 2 80  ? -5.395  -17.681 28.403  1.00   17.07  ? 170  PHE E O   1 
ATOM   4955 C  CB  . PHE E 2 80  ? -5.433  -15.033 27.120  1.00   16.85  ? 170  PHE E CB  1 
ATOM   4956 C  CG  . PHE E 2 80  ? -5.551  -13.551 26.906  1.00   16.13  ? 170  PHE E CG  1 
ATOM   4957 C  CD1 . PHE E 2 80  ? -6.434  -13.040 25.974  1.00   16.61  ? 170  PHE E CD1 1 
ATOM   4958 C  CD2 . PHE E 2 80  ? -4.747  -12.675 27.609  1.00   15.23  ? 170  PHE E CD2 1 
ATOM   4959 C  CE1 . PHE E 2 80  ? -6.529  -11.675 25.761  1.00   16.45  ? 170  PHE E CE1 1 
ATOM   4960 C  CE2 . PHE E 2 80  ? -4.833  -11.317 27.405  1.00   15.81  ? 170  PHE E CE2 1 
ATOM   4961 C  CZ  . PHE E 2 80  ? -5.730  -10.813 26.487  1.00   16.39  ? 170  PHE E CZ  1 
ATOM   4962 N  N   . CYS E 2 81  ? -7.338  -17.843 27.283  1.00   17.08  ? 171  CYS E N   1 
ATOM   4963 C  CA  . CYS E 2 81  ? -7.230  -19.279 27.032  1.00   16.92  ? 171  CYS E CA  1 
ATOM   4964 C  C   . CYS E 2 81  ? -7.273  -19.575 25.534  1.00   16.75  ? 171  CYS E C   1 
ATOM   4965 O  O   . CYS E 2 81  ? -8.084  -19.003 24.799  1.00   15.28  ? 171  CYS E O   1 
ATOM   4966 C  CB  . CYS E 2 81  ? -8.372  -20.038 27.702  1.00   17.86  ? 171  CYS E CB  1 
ATOM   4967 S  SG  . CYS E 2 81  ? -8.345  -20.034 29.505  1.00   19.89  ? 171  CYS E SG  1 
ATOM   4968 N  N   . ASP E 2 82  ? -6.403  -20.476 25.093  1.00   16.28  ? 172  ASP E N   1 
ATOM   4969 C  CA  . ASP E 2 82  ? -6.409  -20.949 23.720  1.00   16.78  ? 172  ASP E CA  1 
ATOM   4970 C  C   . ASP E 2 82  ? -6.079  -22.432 23.766  1.00   18.18  ? 172  ASP E C   1 
ATOM   4971 O  O   . ASP E 2 82  ? -5.016  -22.822 24.264  1.00   17.79  ? 172  ASP E O   1 
ATOM   4972 C  CB  . ASP E 2 82  ? -5.378  -20.193 22.882  1.00   15.97  ? 172  ASP E CB  1 
ATOM   4973 C  CG  . ASP E 2 82  ? -5.705  -20.208 21.387  1.00   14.56  ? 172  ASP E CG  1 
ATOM   4974 O  OD1 . ASP E 2 82  ? -5.401  -19.209 20.708  1.00   13.04  ? 172  ASP E OD1 1 
ATOM   4975 O  OD2 . ASP E 2 82  ? -6.268  -21.208 20.892  1.00   12.66  ? 172  ASP E OD2 1 
ATOM   4976 N  N   . TYR E 2 83  ? -7.008  -23.250 23.276  1.00   19.61  ? 173  TYR E N   1 
ATOM   4977 C  CA  . TYR E 2 83  ? -6.914  -24.703 23.413  1.00   21.29  ? 173  TYR E CA  1 
ATOM   4978 C  C   . TYR E 2 83  ? -6.408  -25.367 22.143  1.00   22.44  ? 173  TYR E C   1 
ATOM   4979 O  O   . TYR E 2 83  ? -6.693  -24.916 21.036  1.00   22.59  ? 173  TYR E O   1 
ATOM   4980 C  CB  . TYR E 2 83  ? -8.269  -25.293 23.798  1.00   21.25  ? 173  TYR E CB  1 
ATOM   4981 C  CG  . TYR E 2 83  ? -8.620  -25.150 25.263  1.00   22.13  ? 173  TYR E CG  1 
ATOM   4982 C  CD1 . TYR E 2 83  ? -7.943  -24.252 26.083  1.00   22.19  ? 173  TYR E CD1 1 
ATOM   4983 C  CD2 . TYR E 2 83  ? -9.645  -25.898 25.821  1.00   23.09  ? 173  TYR E CD2 1 
ATOM   4984 C  CE1 . TYR E 2 83  ? -8.272  -24.113 27.422  1.00   22.21  ? 173  TYR E CE1 1 
ATOM   4985 C  CE2 . TYR E 2 83  ? -9.984  -25.764 27.162  1.00   23.21  ? 173  TYR E CE2 1 
ATOM   4986 C  CZ  . TYR E 2 83  ? -9.299  -24.870 27.954  1.00   22.76  ? 173  TYR E CZ  1 
ATOM   4987 O  OH  . TYR E 2 83  ? -9.644  -24.744 29.287  1.00   23.65  ? 173  TYR E OH  1 
ATOM   4988 N  N   . ALA E 2 84  ? -5.647  -26.438 22.319  1.00   23.59  ? 174  ALA E N   1 
ATOM   4989 C  CA  . ALA E 2 84  ? -5.126  -27.196 21.202  1.00   25.70  ? 174  ALA E CA  1 
ATOM   4990 C  C   . ALA E 2 84  ? -5.201  -28.684 21.527  1.00   26.92  ? 174  ALA E C   1 
ATOM   4991 O  O   . ALA E 2 84  ? -4.763  -29.120 22.591  1.00   27.48  ? 174  ALA E O   1 
ATOM   4992 C  CB  . ALA E 2 84  ? -3.689  -26.772 20.894  1.00   25.25  ? 174  ALA E CB  1 
ATOM   4993 N  N   . TYR E 2 85  ? -5.773  -29.453 20.611  1.00   28.64  ? 175  TYR E N   1 
ATOM   4994 C  CA  . TYR E 2 85  ? -5.929  -30.893 20.790  1.00   30.43  ? 175  TYR E CA  1 
ATOM   4995 C  C   . TYR E 2 85  ? -5.123  -31.653 19.735  1.00   30.82  ? 175  TYR E C   1 
ATOM   4996 O  O   . TYR E 2 85  ? -5.590  -31.831 18.607  1.00   31.26  ? 175  TYR E O   1 
ATOM   4997 C  CB  . TYR E 2 85  ? -7.409  -31.262 20.686  1.00   31.35  ? 175  TYR E CB  1 
ATOM   4998 C  CG  . TYR E 2 85  ? -7.736  -32.710 20.969  1.00   33.01  ? 175  TYR E CG  1 
ATOM   4999 C  CD1 . TYR E 2 85  ? -7.850  -33.174 22.273  1.00   34.05  ? 175  TYR E CD1 1 
ATOM   5000 C  CD2 . TYR E 2 85  ? -7.969  -33.606 19.932  1.00   34.21  ? 175  TYR E CD2 1 
ATOM   5001 C  CE1 . TYR E 2 85  ? -8.162  -34.499 22.539  1.00   34.76  ? 175  TYR E CE1 1 
ATOM   5002 C  CE2 . TYR E 2 85  ? -8.285  -34.935 20.186  1.00   34.46  ? 175  TYR E CE2 1 
ATOM   5003 C  CZ  . TYR E 2 85  ? -8.380  -35.374 21.490  1.00   34.93  ? 175  TYR E CZ  1 
ATOM   5004 O  OH  . TYR E 2 85  ? -8.691  -36.691 21.752  1.00   34.81  ? 175  TYR E OH  1 
ATOM   5005 N  N   . ASN E 2 86  ? -3.915  -32.086 20.104  1.00   30.53  ? 176  ASN E N   1 
ATOM   5006 C  CA  . ASN E 2 86  ? -3.047  -32.861 19.209  1.00   30.80  ? 176  ASN E CA  1 
ATOM   5007 C  C   . ASN E 2 86  ? -2.531  -32.045 18.021  1.00   29.97  ? 176  ASN E C   1 
ATOM   5008 O  O   . ASN E 2 86  ? -2.642  -32.477 16.875  1.00   30.32  ? 176  ASN E O   1 
ATOM   5009 C  CB  . ASN E 2 86  ? -3.772  -34.130 18.718  1.00   31.16  ? 176  ASN E CB  1 
ATOM   5010 C  CG  . ASN E 2 86  ? -2.832  -35.135 18.052  1.00   31.90  ? 176  ASN E CG  1 
ATOM   5011 O  OD1 . ASN E 2 86  ? -1.615  -35.093 18.238  1.00   32.71  ? 176  ASN E OD1 1 
ATOM   5012 N  ND2 . ASN E 2 86  ? -3.406  -36.052 17.276  1.00   32.41  ? 176  ASN E ND2 1 
ATOM   5013 N  N   . THR E 2 87  ? -1.964  -30.872 18.303  1.00   28.96  ? 177  THR E N   1 
ATOM   5014 C  CA  . THR E 2 87  ? -1.511  -29.954 17.256  1.00   27.82  ? 177  THR E CA  1 
ATOM   5015 C  C   . THR E 2 87  ? -0.640  -28.830 17.854  1.00   26.42  ? 177  THR E C   1 
ATOM   5016 O  O   . THR E 2 87  ? -0.618  -28.652 19.077  1.00   27.10  ? 177  THR E O   1 
ATOM   5017 C  CB  . THR E 2 87  ? -2.724  -29.373 16.469  1.00   28.27  ? 177  THR E CB  1 
ATOM   5018 O  OG1 . THR E 2 87  ? -2.266  -28.446 15.481  1.00   30.12  ? 177  THR E OG1 1 
ATOM   5019 C  CG2 . THR E 2 87  ? -3.710  -28.667 17.402  1.00   28.98  ? 177  THR E CG2 1 
ATOM   5020 N  N   . PHE E 2 88  ? 0.089   -28.099 17.008  1.00   23.63  ? 178  PHE E N   1 
ATOM   5021 C  CA  . PHE E 2 88  ? 0.880   -26.940 17.458  1.00   21.03  ? 178  PHE E CA  1 
ATOM   5022 C  C   . PHE E 2 88  ? 0.133   -25.636 17.199  1.00   18.25  ? 178  PHE E C   1 
ATOM   5023 O  O   . PHE E 2 88  ? -0.482  -25.473 16.147  1.00   16.02  ? 178  PHE E O   1 
ATOM   5024 C  CB  . PHE E 2 88  ? 2.249   -26.882 16.759  1.00   21.88  ? 178  PHE E CB  1 
ATOM   5025 C  CG  . PHE E 2 88  ? 3.250   -27.859 17.300  1.00   22.96  ? 178  PHE E CG  1 
ATOM   5026 C  CD1 . PHE E 2 88  ? 3.058   -29.227 17.142  1.00   23.03  ? 178  PHE E CD1 1 
ATOM   5027 C  CD2 . PHE E 2 88  ? 4.381   -27.415 17.973  1.00   22.74  ? 178  PHE E CD2 1 
ATOM   5028 C  CE1 . PHE E 2 88  ? 3.976   -30.128 17.653  1.00   23.57  ? 178  PHE E CE1 1 
ATOM   5029 C  CE2 . PHE E 2 88  ? 5.303   -28.314 18.484  1.00   22.70  ? 178  PHE E CE2 1 
ATOM   5030 C  CZ  . PHE E 2 88  ? 5.100   -29.668 18.325  1.00   22.95  ? 178  PHE E CZ  1 
ATOM   5031 N  N   . GLN E 2 89  ? 0.197   -24.709 18.155  1.00   15.87  ? 179  GLN E N   1 
ATOM   5032 C  CA  . GLN E 2 89  ? -0.497  -23.433 18.021  1.00   14.28  ? 179  GLN E CA  1 
ATOM   5033 C  C   . GLN E 2 89  ? 0.359   -22.241 18.431  1.00   13.52  ? 179  GLN E C   1 
ATOM   5034 O  O   . GLN E 2 89  ? 1.362   -22.380 19.127  1.00   13.23  ? 179  GLN E O   1 
ATOM   5035 C  CB  . GLN E 2 89  ? -1.787  -23.422 18.845  1.00   14.51  ? 179  GLN E CB  1 
ATOM   5036 C  CG  . GLN E 2 89  ? -1.555  -23.532 20.356  1.00   14.42  ? 179  GLN E CG  1 
ATOM   5037 C  CD  . GLN E 2 89  ? -2.754  -23.128 21.170  1.00   14.73  ? 179  GLN E CD  1 
ATOM   5038 O  OE1 . GLN E 2 89  ? -3.713  -22.567 20.645  1.00   15.27  ? 179  GLN E OE1 1 
ATOM   5039 N  NE2 . GLN E 2 89  ? -2.708  -23.403 22.469  1.00   14.97  ? 179  GLN E NE2 1 
ATOM   5040 N  N   . VAL E 2 90  ? -0.053  -21.063 17.989  1.00   12.52  ? 180  VAL E N   1 
ATOM   5041 C  CA  . VAL E 2 90  ? 0.449   -19.824 18.563  1.00   12.33  ? 180  VAL E CA  1 
ATOM   5042 C  C   . VAL E 2 90  ? -0.755  -18.978 18.957  1.00   12.83  ? 180  VAL E C   1 
ATOM   5043 O  O   . VAL E 2 90  ? -1.668  -18.748 18.146  1.00   12.21  ? 180  VAL E O   1 
ATOM   5044 C  CB  . VAL E 2 90  ? 1.422   -19.058 17.614  1.00   12.31  ? 180  VAL E CB  1 
ATOM   5045 C  CG1 . VAL E 2 90  ? 0.770   -18.765 16.277  1.00   11.43  ? 180  VAL E CG1 1 
ATOM   5046 C  CG2 . VAL E 2 90  ? 1.929   -17.767 18.280  1.00   11.41  ? 180  VAL E CG2 1 
ATOM   5047 N  N   . THR E 2 91  ? -0.782  -18.568 20.224  1.00   12.95  ? 181  THR E N   1 
ATOM   5048 C  CA  . THR E 2 91  ? -1.834  -17.702 20.716  1.00   13.57  ? 181  THR E CA  1 
ATOM   5049 C  C   . THR E 2 91  ? -1.265  -16.354 21.141  1.00   13.85  ? 181  THR E C   1 
ATOM   5050 O  O   . THR E 2 91  ? -0.048  -16.181 21.243  1.00   13.76  ? 181  THR E O   1 
ATOM   5051 C  CB  . THR E 2 91  ? -2.599  -18.330 21.892  1.00   14.30  ? 181  THR E CB  1 
ATOM   5052 O  OG1 . THR E 2 91  ? -3.769  -17.550 22.165  1.00   14.65  ? 181  THR E OG1 1 
ATOM   5053 C  CG2 . THR E 2 91  ? -1.728  -18.383 23.141  1.00   13.57  ? 181  THR E CG2 1 
ATOM   5054 N  N   . THR E 2 92  ? -2.153  -15.400 21.397  1.00   14.14  ? 182  THR E N   1 
ATOM   5055 C  CA  . THR E 2 92  ? -1.715  -14.037 21.666  1.00   14.42  ? 182  THR E CA  1 
ATOM   5056 C  C   . THR E 2 92  ? -2.695  -13.257 22.535  1.00   13.81  ? 182  THR E C   1 
ATOM   5057 O  O   . THR E 2 92  ? -3.899  -13.518 22.533  1.00   13.19  ? 182  THR E O   1 
ATOM   5058 C  CB  . THR E 2 92  ? -1.510  -13.257 20.360  1.00   14.18  ? 182  THR E CB  1 
ATOM   5059 O  OG1 . THR E 2 92  ? -1.054  -11.937 20.656  1.00   15.05  ? 182  THR E OG1 1 
ATOM   5060 C  CG2 . THR E 2 92  ? -2.820  -13.157 19.595  1.00   15.99  ? 182  THR E CG2 1 
ATOM   5061 N  N   . GLY E 2 93  ? -2.156  -12.286 23.265  1.00   13.16  ? 183  GLY E N   1 
ATOM   5062 C  CA  . GLY E 2 93  ? -2.962  -11.395 24.082  1.00   13.01  ? 183  GLY E CA  1 
ATOM   5063 C  C   . GLY E 2 93  ? -2.287  -10.040 24.135  1.00   13.08  ? 183  GLY E C   1 
ATOM   5064 O  O   . GLY E 2 93  ? -1.084  -9.923  23.898  1.00   13.58  ? 183  GLY E O   1 
ATOM   5065 N  N   . GLY E 2 94  ? -3.074  -9.015  24.431  1.00   13.31  ? 184  GLY E N   1 
ATOM   5066 C  CA  . GLY E 2 94  ? -2.577  -7.654  24.549  1.00   12.69  ? 184  GLY E CA  1 
ATOM   5067 C  C   . GLY E 2 94  ? -3.448  -6.856  25.500  1.00   12.77  ? 184  GLY E C   1 
ATOM   5068 O  O   . GLY E 2 94  ? -4.595  -7.213  25.756  1.00   12.84  ? 184  GLY E O   1 
ATOM   5069 N  N   . MET E 2 95  ? -2.903  -5.765  26.017  1.00   13.01  ? 185  MET E N   1 
ATOM   5070 C  CA  . MET E 2 95  ? -3.639  -4.904  26.930  1.00   12.67  ? 185  MET E CA  1 
ATOM   5071 C  C   . MET E 2 95  ? -2.954  -3.552  27.117  1.00   11.77  ? 185  MET E C   1 
ATOM   5072 O  O   . MET E 2 95  ? -1.743  -3.484  27.360  1.00   11.56  ? 185  MET E O   1 
ATOM   5073 C  CB  . MET E 2 95  ? -3.797  -5.588  28.293  1.00   12.90  ? 185  MET E CB  1 
ATOM   5074 C  CG  . MET E 2 95  ? -4.650  -4.809  29.262  1.00   13.63  ? 185  MET E CG  1 
ATOM   5075 S  SD  . MET E 2 95  ? -6.381  -4.913  28.810  1.00   15.20  ? 185  MET E SD  1 
ATOM   5076 C  CE  . MET E 2 95  ? -6.620  -6.679  28.798  1.00   13.80  ? 185  MET E CE  1 
ATOM   5077 N  N   . VAL E 2 96  ? -3.738  -2.484  26.993  1.00   11.43  ? 186  VAL E N   1 
ATOM   5078 C  CA  . VAL E 2 96  ? -3.308  -1.149  27.386  1.00   11.44  ? 186  VAL E CA  1 
ATOM   5079 C  C   . VAL E 2 96  ? -3.606  -1.009  28.883  1.00   12.84  ? 186  VAL E C   1 
ATOM   5080 O  O   . VAL E 2 96  ? -4.745  -1.216  29.315  1.00   13.18  ? 186  VAL E O   1 
ATOM   5081 C  CB  . VAL E 2 96  ? -4.071  -0.048  26.589  1.00   11.40  ? 186  VAL E CB  1 
ATOM   5082 C  CG1 . VAL E 2 96  ? -3.780  1.338   27.148  1.00   10.44  ? 186  VAL E CG1 1 
ATOM   5083 C  CG2 . VAL E 2 96  ? -3.716  -0.106  25.092  1.00   10.43  ? 186  VAL E CG2 1 
ATOM   5084 N  N   . LEU E 2 97  ? -2.586  -0.680  29.669  1.00   13.63  ? 187  LEU E N   1 
ATOM   5085 C  CA  . LEU E 2 97  ? -2.753  -0.470  31.108  1.00   15.31  ? 187  LEU E CA  1 
ATOM   5086 C  C   . LEU E 2 97  ? -2.223  0.896   31.561  1.00   16.96  ? 187  LEU E C   1 
ATOM   5087 O  O   . LEU E 2 97  ? -1.170  1.349   31.103  1.00   17.18  ? 187  LEU E O   1 
ATOM   5088 C  CB  . LEU E 2 97  ? -2.051  -1.577  31.906  1.00   14.02  ? 187  LEU E CB  1 
ATOM   5089 C  CG  . LEU E 2 97  ? -2.626  -3.001  31.832  1.00   13.50  ? 187  LEU E CG  1 
ATOM   5090 C  CD1 . LEU E 2 97  ? -1.686  -4.006  32.504  1.00   11.96  ? 187  LEU E CD1 1 
ATOM   5091 C  CD2 . LEU E 2 97  ? -4.032  -3.079  32.443  1.00   11.66  ? 187  LEU E CD2 1 
ATOM   5092 N  N   . LYS E 2 98  ? -2.964  1.540   32.455  1.00   18.55  ? 188  LYS E N   1 
ATOM   5093 C  CA  . LYS E 2 98  ? -2.475  2.708   33.186  1.00   20.69  ? 188  LYS E CA  1 
ATOM   5094 C  C   . LYS E 2 98  ? -1.711  2.194   34.405  1.00   21.18  ? 188  LYS E C   1 
ATOM   5095 O  O   . LYS E 2 98  ? -2.255  1.431   35.198  1.00   22.55  ? 188  LYS E O   1 
ATOM   5096 C  CB  . LYS E 2 98  ? -3.660  3.576   33.624  1.00   21.21  ? 188  LYS E CB  1 
ATOM   5097 C  CG  . LYS E 2 98  ? -3.306  4.942   34.184  1.00   22.64  ? 188  LYS E CG  1 
ATOM   5098 C  CD  . LYS E 2 98  ? -4.568  5.787   34.383  1.00   23.38  ? 188  LYS E CD  1 
ATOM   5099 C  CE  . LYS E 2 98  ? -4.223  7.273   34.472  1.00   24.54  ? 188  LYS E CE  1 
ATOM   5100 N  NZ  . LYS E 2 98  ? -5.434  8.143   34.526  1.00   26.02  ? 188  LYS E NZ  1 
ATOM   5101 N  N   . LEU E 2 99  ? -0.450  2.590   34.546  1.00   21.35  ? 189  LEU E N   1 
ATOM   5102 C  CA  . LEU E 2 99  ? 0.397   2.087   35.633  1.00   21.41  ? 189  LEU E CA  1 
ATOM   5103 C  C   . LEU E 2 99  ? 0.873   3.193   36.567  1.00   21.81  ? 189  LEU E C   1 
ATOM   5104 O  O   . LEU E 2 99  ? 1.153   4.311   36.122  1.00   20.97  ? 189  LEU E O   1 
ATOM   5105 C  CB  . LEU E 2 99  ? 1.619   1.362   35.064  1.00   21.51  ? 189  LEU E CB  1 
ATOM   5106 C  CG  . LEU E 2 99  ? 1.700   -0.168  35.137  1.00   22.00  ? 189  LEU E CG  1 
ATOM   5107 C  CD1 . LEU E 2 99  ? 0.333   -0.823  35.052  1.00   21.97  ? 189  LEU E CD1 1 
ATOM   5108 C  CD2 . LEU E 2 99  ? 2.628   -0.704  34.057  1.00   21.37  ? 189  LEU E CD2 1 
ATOM   5109 N  N   . GLU E 2 100 ? 0.976   2.861   37.856  1.00   22.27  ? 190  GLU E N   1 
ATOM   5110 C  CA  . GLU E 2 100 ? 1.567   3.749   38.854  1.00   23.75  ? 190  GLU E CA  1 
ATOM   5111 C  C   . GLU E 2 100 ? 2.958   3.251   39.263  1.00   24.04  ? 190  GLU E C   1 
ATOM   5112 O  O   . GLU E 2 100 ? 3.318   2.094   39.023  1.00   23.43  ? 190  GLU E O   1 
ATOM   5113 C  CB  . GLU E 2 100 ? 0.667   3.853   40.097  1.00   24.71  ? 190  GLU E CB  1 
ATOM   5114 C  CG  . GLU E 2 100 ? -0.748  4.373   39.819  1.00   26.91  ? 190  GLU E CG  1 
ATOM   5115 C  CD  . GLU E 2 100 ? -0.786  5.866   39.532  1.00   29.53  ? 190  GLU E CD  1 
ATOM   5116 O  OE1 . GLU E 2 100 ? -0.332  6.648   40.397  1.00   31.50  ? 190  GLU E OE1 1 
ATOM   5117 O  OE2 . GLU E 2 100 ? -1.279  6.265   38.451  1.00   30.47  ? 190  GLU E OE2 1 
ATOM   5118 N  N   . GLN E 2 101 ? 3.733   4.126   39.896  1.00   23.88  ? 191  GLN E N   1 
ATOM   5119 C  CA  . GLN E 2 101 ? 5.084   3.773   40.322  1.00   24.03  ? 191  GLN E CA  1 
ATOM   5120 C  C   . GLN E 2 101 ? 5.080   2.568   41.259  1.00   23.25  ? 191  GLN E C   1 
ATOM   5121 O  O   . GLN E 2 101 ? 4.245   2.472   42.167  1.00   22.90  ? 191  GLN E O   1 
ATOM   5122 C  CB  . GLN E 2 101 ? 5.774   4.975   40.978  1.00   24.51  ? 191  GLN E CB  1 
ATOM   5123 C  CG  . GLN E 2 101 ? 7.274   4.788   41.167  1.00   26.10  ? 191  GLN E CG  1 
ATOM   5124 C  CD  . GLN E 2 101 ? 8.064   6.063   40.944  1.00   26.99  ? 191  GLN E CD  1 
ATOM   5125 O  OE1 . GLN E 2 101 ? 9.281   6.021   40.790  1.00   27.87  ? 191  GLN E OE1 1 
ATOM   5126 N  NE2 . GLN E 2 101 ? 7.374   7.204   40.912  1.00   27.45  ? 191  GLN E NE2 1 
ATOM   5127 N  N   . GLY E 2 102 ? 6.005   1.641   41.015  1.00   22.34  ? 192  GLY E N   1 
ATOM   5128 C  CA  . GLY E 2 102 ? 6.097   0.409   41.790  1.00   21.60  ? 192  GLY E CA  1 
ATOM   5129 C  C   . GLY E 2 102 ? 5.181   -0.731  41.365  1.00   21.24  ? 192  GLY E C   1 
ATOM   5130 O  O   . GLY E 2 102 ? 5.367   -1.862  41.805  1.00   20.93  ? 192  GLY E O   1 
ATOM   5131 N  N   . GLU E 2 103 ? 4.178   -0.447  40.532  1.00   21.13  ? 193  GLU E N   1 
ATOM   5132 C  CA  . GLU E 2 103 ? 3.242   -1.487  40.075  1.00   21.01  ? 193  GLU E CA  1 
ATOM   5133 C  C   . GLU E 2 103 ? 3.902   -2.485  39.118  1.00   20.48  ? 193  GLU E C   1 
ATOM   5134 O  O   . GLU E 2 103 ? 4.525   -2.080  38.135  1.00   20.14  ? 193  GLU E O   1 
ATOM   5135 C  CB  . GLU E 2 103 ? 2.004   -0.864  39.408  1.00   21.08  ? 193  GLU E CB  1 
ATOM   5136 C  CG  . GLU E 2 103 ? 0.890   -0.488  40.383  1.00   22.00  ? 193  GLU E CG  1 
ATOM   5137 C  CD  . GLU E 2 103 ? -0.335  0.108   39.700  1.00   22.33  ? 193  GLU E CD  1 
ATOM   5138 O  OE1 . GLU E 2 103 ? -1.336  0.382   40.396  1.00   24.60  ? 193  GLU E OE1 1 
ATOM   5139 O  OE2 . GLU E 2 103 ? -0.311  0.317   38.474  1.00   21.76  ? 193  GLU E OE2 1 
ATOM   5140 N  N   . ASN E 2 104 ? 3.763   -3.780  39.411  1.00   19.55  ? 194  ASN E N   1 
ATOM   5141 C  CA  . ASN E 2 104 ? 4.286   -4.834  38.543  1.00   18.77  ? 194  ASN E CA  1 
ATOM   5142 C  C   . ASN E 2 104 ? 3.253   -5.242  37.493  1.00   18.09  ? 194  ASN E C   1 
ATOM   5143 O  O   . ASN E 2 104 ? 2.047   -5.146  37.722  1.00   17.56  ? 194  ASN E O   1 
ATOM   5144 C  CB  . ASN E 2 104 ? 4.647   -6.101  39.328  1.00   18.98  ? 194  ASN E CB  1 
ATOM   5145 C  CG  . ASN E 2 104 ? 5.552   -5.840  40.525  1.00   20.90  ? 194  ASN E CG  1 
ATOM   5146 O  OD1 . ASN E 2 104 ? 5.210   -6.187  41.663  1.00   20.40  ? 194  ASN E OD1 1 
ATOM   5147 N  ND2 . ASN E 2 104 ? 6.718   -5.260  40.274  1.00   20.78  ? 194  ASN E ND2 1 
ATOM   5148 N  N   . VAL E 2 105 ? 3.735   -5.708  36.347  1.00   16.55  ? 195  VAL E N   1 
ATOM   5149 C  CA  . VAL E 2 105 ? 2.868   -6.350  35.365  1.00   15.57  ? 195  VAL E CA  1 
ATOM   5150 C  C   . VAL E 2 105 ? 3.563   -7.620  34.922  1.00   14.68  ? 195  VAL E C   1 
ATOM   5151 O  O   . VAL E 2 105 ? 4.773   -7.626  34.696  1.00   15.57  ? 195  VAL E O   1 
ATOM   5152 C  CB  . VAL E 2 105 ? 2.565   -5.445  34.157  1.00   15.51  ? 195  VAL E CB  1 
ATOM   5153 C  CG1 . VAL E 2 105 ? 1.917   -6.246  33.024  1.00   15.14  ? 195  VAL E CG1 1 
ATOM   5154 C  CG2 . VAL E 2 105 ? 1.652   -4.297  34.569  1.00   15.20  ? 195  VAL E CG2 1 
ATOM   5155 N  N   . PHE E 2 106 ? 2.815   -8.708  34.831  1.00   13.20  ? 196  PHE E N   1 
ATOM   5156 C  CA  . PHE E 2 106 ? 3.421   -9.973  34.465  1.00   12.54  ? 196  PHE E CA  1 
ATOM   5157 C  C   . PHE E 2 106 ? 2.396   -11.022 34.081  1.00   11.96  ? 196  PHE E C   1 
ATOM   5158 O  O   . PHE E 2 106 ? 1.195   -10.801 34.208  1.00   11.11  ? 196  PHE E O   1 
ATOM   5159 C  CB  . PHE E 2 106 ? 4.320   -10.489 35.588  1.00   12.89  ? 196  PHE E CB  1 
ATOM   5160 C  CG  . PHE E 2 106 ? 3.621   -10.655 36.907  1.00   12.74  ? 196  PHE E CG  1 
ATOM   5161 C  CD1 . PHE E 2 106 ? 3.014   -11.855 37.237  1.00   13.20  ? 196  PHE E CD1 1 
ATOM   5162 C  CD2 . PHE E 2 106 ? 3.597   -9.620  37.825  1.00   11.88  ? 196  PHE E CD2 1 
ATOM   5163 C  CE1 . PHE E 2 106 ? 2.387   -12.022 38.470  1.00   14.19  ? 196  PHE E CE1 1 
ATOM   5164 C  CE2 . PHE E 2 106 ? 2.965   -9.775  39.059  1.00   12.63  ? 196  PHE E CE2 1 
ATOM   5165 C  CZ  . PHE E 2 106 ? 2.359   -10.978 39.375  1.00   12.23  ? 196  PHE E CZ  1 
ATOM   5166 N  N   . LEU E 2 107 ? 2.890   -12.157 33.594  1.00   11.86  ? 197  LEU E N   1 
ATOM   5167 C  CA  . LEU E 2 107 ? 2.043   -13.267 33.197  1.00   12.60  ? 197  LEU E CA  1 
ATOM   5168 C  C   . LEU E 2 107 ? 2.140   -14.373 34.243  1.00   13.88  ? 197  LEU E C   1 
ATOM   5169 O  O   . LEU E 2 107 ? 3.216   -14.614 34.802  1.00   13.94  ? 197  LEU E O   1 
ATOM   5170 C  CB  . LEU E 2 107 ? 2.452   -13.792 31.815  1.00   12.14  ? 197  LEU E CB  1 
ATOM   5171 C  CG  . LEU E 2 107 ? 2.308   -12.782 30.668  1.00   12.80  ? 197  LEU E CG  1 
ATOM   5172 C  CD1 . LEU E 2 107 ? 2.671   -13.392 29.308  1.00   12.28  ? 197  LEU E CD1 1 
ATOM   5173 C  CD2 . LEU E 2 107 ? 0.887   -12.212 30.633  1.00   13.60  ? 197  LEU E CD2 1 
ATOM   5174 N  N   . GLN E 2 108 ? 1.018   -15.044 34.492  1.00   14.81  ? 198  GLN E N   1 
ATOM   5175 C  CA  . GLN E 2 108 ? 0.932   -16.060 35.536  1.00   16.23  ? 198  GLN E CA  1 
ATOM   5176 C  C   . GLN E 2 108 ? 0.273   -17.348 35.027  1.00   16.67  ? 198  GLN E C   1 
ATOM   5177 O  O   . GLN E 2 108 ? -0.764  -17.316 34.346  1.00   16.85  ? 198  GLN E O   1 
ATOM   5178 C  CB  . GLN E 2 108 ? 0.180   -15.510 36.749  1.00   16.58  ? 198  GLN E CB  1 
ATOM   5179 C  CG  . GLN E 2 108 ? -0.244  -16.580 37.743  1.00   19.44  ? 198  GLN E CG  1 
ATOM   5180 C  CD  . GLN E 2 108 ? -1.176  -16.058 38.804  1.00   20.10  ? 198  GLN E CD  1 
ATOM   5181 O  OE1 . GLN E 2 108 ? -2.379  -15.917 38.582  1.00   21.07  ? 198  GLN E OE1 1 
ATOM   5182 N  NE2 . GLN E 2 108 ? -0.629  -15.782 39.976  1.00   21.26  ? 198  GLN E NE2 1 
ATOM   5183 N  N   . ALA E 2 109 ? 0.889   -18.480 35.357  1.00   16.88  ? 199  ALA E N   1 
ATOM   5184 C  CA  . ALA E 2 109 ? 0.434   -19.782 34.876  1.00   17.39  ? 199  ALA E CA  1 
ATOM   5185 C  C   . ALA E 2 109 ? -0.821  -20.269 35.594  1.00   18.23  ? 199  ALA E C   1 
ATOM   5186 O  O   . ALA E 2 109 ? -1.137  -19.802 36.684  1.00   18.04  ? 199  ALA E O   1 
ATOM   5187 C  CB  . ALA E 2 109 ? 1.551   -20.808 35.011  1.00   17.38  ? 199  ALA E CB  1 
ATOM   5188 N  N   . THR E 2 110 ? -1.522  -21.212 34.962  1.00   19.92  ? 200  THR E N   1 
ATOM   5189 C  CA  . THR E 2 110 ? -2.737  -21.826 35.495  1.00   21.23  ? 200  THR E CA  1 
ATOM   5190 C  C   . THR E 2 110 ? -2.636  -23.348 35.377  1.00   22.90  ? 200  THR E C   1 
ATOM   5191 O  O   . THR E 2 110 ? -1.568  -23.884 35.089  1.00   23.65  ? 200  THR E O   1 
ATOM   5192 C  CB  . THR E 2 110 ? -3.993  -21.383 34.702  1.00   21.29  ? 200  THR E CB  1 
ATOM   5193 O  OG1 . THR E 2 110 ? -3.936  -21.931 33.380  1.00   20.56  ? 200  THR E OG1 1 
ATOM   5194 C  CG2 . THR E 2 110 ? -4.076  -19.866 34.606  1.00   20.76  ? 200  THR E CG2 1 
ATOM   5195 N  N   . ASP E 2 111 ? -3.760  -24.031 35.587  1.00   24.93  ? 201  ASP E N   1 
ATOM   5196 C  CA  . ASP E 2 111 ? -3.866  -25.482 35.404  1.00   26.49  ? 201  ASP E CA  1 
ATOM   5197 C  C   . ASP E 2 111 ? -3.593  -25.895 33.954  1.00   26.65  ? 201  ASP E C   1 
ATOM   5198 O  O   . ASP E 2 111 ? -3.111  -27.003 33.688  1.00   27.03  ? 201  ASP E O   1 
ATOM   5199 C  CB  . ASP E 2 111 ? -5.267  -25.956 35.809  1.00   27.68  ? 201  ASP E CB  1 
ATOM   5200 C  CG  . ASP E 2 111 ? -5.358  -27.469 35.964  1.00   30.12  ? 201  ASP E CG  1 
ATOM   5201 O  OD1 . ASP E 2 111 ? -4.781  -28.002 36.946  1.00   31.45  ? 201  ASP E OD1 1 
ATOM   5202 O  OD2 . ASP E 2 111 ? -6.025  -28.122 35.117  1.00   31.11  ? 201  ASP E OD2 1 
ATOM   5203 N  N   . LYS E 2 112 ? -3.929  -25.007 33.022  1.00   26.51  ? 202  LYS E N   1 
ATOM   5204 C  CA  . LYS E 2 112 ? -3.653  -25.220 31.603  1.00   26.15  ? 202  LYS E CA  1 
ATOM   5205 C  C   . LYS E 2 112 ? -2.320  -24.545 31.263  1.00   25.89  ? 202  LYS E C   1 
ATOM   5206 O  O   . LYS E 2 112 ? -2.246  -23.330 31.071  1.00   24.77  ? 202  LYS E O   1 
ATOM   5207 C  CB  . LYS E 2 112 ? -4.790  -24.651 30.750  1.00   26.41  ? 202  LYS E CB  1 
ATOM   5208 C  CG  . LYS E 2 112 ? -6.159  -25.259 31.034  1.00   27.47  ? 202  LYS E CG  1 
ATOM   5209 C  CD  . LYS E 2 112 ? -6.659  -24.902 32.432  1.00   28.77  ? 202  LYS E CD  1 
ATOM   5210 C  CE  . LYS E 2 112 ? -8.165  -25.135 32.597  1.00   30.06  ? 202  LYS E CE  1 
ATOM   5211 N  NZ  . LYS E 2 112 ? -8.576  -26.541 32.332  1.00   30.52  ? 202  LYS E NZ  1 
ATOM   5212 N  N   . ASN E 2 113 ? -1.262  -25.345 31.197  1.00   26.01  ? 203  ASN E N   1 
ATOM   5213 C  CA  . ASN E 2 113 ? 0.087   -24.797 31.210  1.00   26.44  ? 203  ASN E CA  1 
ATOM   5214 C  C   . ASN E 2 113 ? 0.975   -25.229 30.050  1.00   26.20  ? 203  ASN E C   1 
ATOM   5215 O  O   . ASN E 2 113 ? 2.201   -25.189 30.160  1.00   26.00  ? 203  ASN E O   1 
ATOM   5216 C  CB  . ASN E 2 113 ? 0.769   -25.136 32.544  1.00   27.05  ? 203  ASN E CB  1 
ATOM   5217 C  CG  . ASN E 2 113 ? 0.994   -26.633 32.727  1.00   28.34  ? 203  ASN E CG  1 
ATOM   5218 O  OD1 . ASN E 2 113 ? 0.698   -27.436 31.836  1.00   29.97  ? 203  ASN E OD1 1 
ATOM   5219 N  ND2 . ASN E 2 113 ? 1.528   -27.013 33.882  1.00   28.20  ? 203  ASN E ND2 1 
ATOM   5220 N  N   . SER E 2 114 ? 0.364   -25.649 28.947  1.00   25.75  ? 204  SER E N   1 
ATOM   5221 C  CA  . SER E 2 114 ? 1.132   -26.075 27.782  1.00   25.89  ? 204  SER E CA  1 
ATOM   5222 C  C   . SER E 2 114 ? 1.778   -24.890 27.063  1.00   25.80  ? 204  SER E C   1 
ATOM   5223 O  O   . SER E 2 114 ? 1.119   -24.167 26.316  1.00   25.36  ? 204  SER E O   1 
ATOM   5224 C  CB  . SER E 2 114 ? 0.254   -26.858 26.812  1.00   25.98  ? 204  SER E CB  1 
ATOM   5225 O  OG  . SER E 2 114 ? 1.002   -27.253 25.675  1.00   26.95  ? 204  SER E OG  1 
ATOM   5226 N  N   . LEU E 2 115 ? 3.076   -24.710 27.283  1.00   26.01  ? 205  LEU E N   1 
ATOM   5227 C  CA  . LEU E 2 115 ? 3.791   -23.545 26.776  1.00   26.71  ? 205  LEU E CA  1 
ATOM   5228 C  C   . LEU E 2 115 ? 5.204   -23.932 26.367  1.00   27.36  ? 205  LEU E C   1 
ATOM   5229 O  O   . LEU E 2 115 ? 5.973   -24.416 27.185  1.00   27.63  ? 205  LEU E O   1 
ATOM   5230 C  CB  . LEU E 2 115 ? 3.840   -22.451 27.854  1.00   26.39  ? 205  LEU E CB  1 
ATOM   5231 C  CG  . LEU E 2 115 ? 4.757   -21.238 27.662  1.00   25.73  ? 205  LEU E CG  1 
ATOM   5232 C  CD1 . LEU E 2 115 ? 4.268   -20.360 26.538  1.00   25.53  ? 205  LEU E CD1 1 
ATOM   5233 C  CD2 . LEU E 2 115 ? 4.844   -20.434 28.943  1.00   26.29  ? 205  LEU E CD2 1 
ATOM   5234 N  N   . LEU E 2 116 ? 5.543   -23.717 25.101  1.00   28.21  ? 206  LEU E N   1 
ATOM   5235 C  CA  . LEU E 2 116 ? 6.870   -24.048 24.601  1.00   28.84  ? 206  LEU E CA  1 
ATOM   5236 C  C   . LEU E 2 116 ? 7.719   -22.795 24.466  1.00   29.53  ? 206  LEU E C   1 
ATOM   5237 O  O   . LEU E 2 116 ? 7.221   -21.731 24.089  1.00   29.85  ? 206  LEU E O   1 
ATOM   5238 C  CB  . LEU E 2 116 ? 6.774   -24.734 23.234  1.00   29.27  ? 206  LEU E CB  1 
ATOM   5239 C  CG  . LEU E 2 116 ? 6.012   -26.059 23.159  1.00   29.64  ? 206  LEU E CG  1 
ATOM   5240 C  CD1 . LEU E 2 116 ? 5.489   -26.292 21.755  1.00   30.49  ? 206  LEU E CD1 1 
ATOM   5241 C  CD2 . LEU E 2 116 ? 6.901   -27.202 23.603  1.00   30.07  ? 206  LEU E CD2 1 
ATOM   5242 N  N   . GLY E 2 117 ? 9.005   -22.929 24.759  1.00   29.58  ? 207  GLY E N   1 
ATOM   5243 C  CA  . GLY E 2 117 ? 9.951   -21.849 24.541  1.00   30.24  ? 207  GLY E CA  1 
ATOM   5244 C  C   . GLY E 2 117 ? 11.219  -22.373 23.895  1.00   30.59  ? 207  GLY E C   1 
ATOM   5245 O  O   . GLY E 2 117 ? 12.070  -22.948 24.568  1.00   30.22  ? 207  GLY E O   1 
ATOM   5246 N  N   . MET E 2 118 ? 11.346  -22.171 22.587  1.00   31.01  ? 208  MET E N   1 
ATOM   5247 C  CA  . MET E 2 118 ? 12.494  -22.690 21.856  1.00   31.81  ? 208  MET E CA  1 
ATOM   5248 C  C   . MET E 2 118 ? 12.667  -22.030 20.500  1.00   31.50  ? 208  MET E C   1 
ATOM   5249 O  O   . MET E 2 118 ? 11.715  -21.508 19.926  1.00   31.49  ? 208  MET E O   1 
ATOM   5250 C  CB  . MET E 2 118 ? 12.331  -24.186 21.654  1.00   32.52  ? 208  MET E CB  1 
ATOM   5251 C  CG  . MET E 2 118 ? 11.071  -24.537 20.896  1.00   34.27  ? 208  MET E CG  1 
ATOM   5252 S  SD  . MET E 2 118 ? 10.981  -26.298 20.599  1.00   36.82  ? 208  MET E SD  1 
ATOM   5253 C  CE  . MET E 2 118 ? 11.574  -26.913 22.182  1.00   35.36  ? 208  MET E CE  1 
ATOM   5254 N  N   . GLU E 2 119 ? 13.889  -22.074 19.983  1.00   31.57  ? 209  GLU E N   1 
ATOM   5255 C  CA  . GLU E 2 119 ? 14.130  -21.928 18.559  0.0000 30.93  ? 209  GLU E CA  1 
ATOM   5256 C  C   . GLU E 2 119 ? 13.240  -21.966 17.360  1.00   24.24  ? 209  GLU E C   1 
ATOM   5257 O  O   . GLU E 2 119 ? 13.320  -23.141 17.732  1.00   25.30  ? 209  GLU E O   1 
ATOM   5258 C  CB  . GLU E 2 119 ? 15.507  -22.502 18.229  0.0000 31.77  ? 209  GLU E CB  1 
ATOM   5259 C  CG  . GLU E 2 119 ? 15.738  -22.775 16.753  0.0000 34.54  ? 209  GLU E CG  1 
ATOM   5260 C  CD  . GLU E 2 119 ? 16.696  -21.790 16.126  0.0000 36.15  ? 209  GLU E CD  1 
ATOM   5261 O  OE1 . GLU E 2 119 ? 17.530  -21.225 16.869  0.0000 36.97  ? 209  GLU E OE1 1 
ATOM   5262 O  OE2 . GLU E 2 119 ? 16.625  -21.596 14.891  0.0000 36.86  ? 209  GLU E OE2 1 
ATOM   5263 N  N   . GLY E 2 120 ? 12.280  -21.542 16.548  1.00   23.77  ? 210  GLY E N   1 
ATOM   5264 C  CA  . GLY E 2 120 ? 11.420  -22.482 15.831  1.00   22.23  ? 210  GLY E CA  1 
ATOM   5265 C  C   . GLY E 2 120 ? 10.023  -22.495 16.406  1.00   21.20  ? 210  GLY E C   1 
ATOM   5266 O  O   . GLY E 2 120 ? 9.054   -22.805 15.712  1.00   21.02  ? 210  GLY E O   1 
ATOM   5267 N  N   . ALA E 2 121 ? 9.919   -22.136 17.681  1.00   20.31  ? 211  ALA E N   1 
ATOM   5268 C  CA  . ALA E 2 121 ? 8.630   -22.055 18.361  1.00   19.16  ? 211  ALA E CA  1 
ATOM   5269 C  C   . ALA E 2 121 ? 8.758   -21.192 19.604  1.00   18.12  ? 211  ALA E C   1 
ATOM   5270 O  O   . ALA E 2 121 ? 8.704   -21.698 20.723  1.00   17.43  ? 211  ALA E O   1 
ATOM   5271 C  CB  . ALA E 2 121 ? 8.141   -23.436 18.744  1.00   19.73  ? 211  ALA E CB  1 
ATOM   5272 N  N   . ASN E 2 122 ? 8.912   -19.887 19.397  1.00   17.41  ? 212  ASN E N   1 
ATOM   5273 C  CA  . ASN E 2 122 ? 9.202   -18.976 20.487  1.00   16.27  ? 212  ASN E CA  1 
ATOM   5274 C  C   . ASN E 2 122 ? 7.964   -18.616 21.276  1.00   14.67  ? 212  ASN E C   1 
ATOM   5275 O  O   . ASN E 2 122 ? 6.851   -18.683 20.760  1.00   14.50  ? 212  ASN E O   1 
ATOM   5276 C  CB  . ASN E 2 122 ? 9.858   -17.699 19.963  1.00   17.18  ? 212  ASN E CB  1 
ATOM   5277 C  CG  . ASN E 2 122 ? 11.069  -17.976 19.098  1.00   18.27  ? 212  ASN E CG  1 
ATOM   5278 O  OD1 . ASN E 2 122 ? 11.358  -17.222 18.183  1.00   19.65  ? 212  ASN E OD1 1 
ATOM   5279 N  ND2 . ASN E 2 122 ? 11.767  -19.068 19.370  1.00   19.52  ? 212  ASN E ND2 1 
ATOM   5280 N  N   . SER E 2 123 ? 8.171   -18.249 22.536  1.00   13.13  ? 213  SER E N   1 
ATOM   5281 C  CA  . SER E 2 123 ? 7.150   -17.557 23.325  1.00   11.62  ? 213  SER E CA  1 
ATOM   5282 C  C   . SER E 2 123 ? 7.733   -16.230 23.789  1.00   11.37  ? 213  SER E C   1 
ATOM   5283 O  O   . SER E 2 123 ? 8.869   -16.171 24.286  1.00   10.79  ? 213  SER E O   1 
ATOM   5284 C  CB  . SER E 2 123 ? 6.706   -18.397 24.517  1.00   11.45  ? 213  SER E CB  1 
ATOM   5285 O  OG  . SER E 2 123 ? 6.007   -19.545 24.078  1.00   12.40  ? 213  SER E OG  1 
ATOM   5286 N  N   . ILE E 2 124 ? 6.968   -15.161 23.633  1.00   10.31  ? 214  ILE E N   1 
ATOM   5287 C  CA  . ILE E 2 124 ? 7.514   -13.840 23.858  1.00   9.97   ? 214  ILE E CA  1 
ATOM   5288 C  C   . ILE E 2 124 ? 6.586   -12.929 24.649  1.00   10.59  ? 214  ILE E C   1 
ATOM   5289 O  O   . ILE E 2 124 ? 5.364   -13.029 24.556  1.00   10.49  ? 214  ILE E O   1 
ATOM   5290 C  CB  . ILE E 2 124 ? 7.905   -13.174 22.524  1.00   9.95   ? 214  ILE E CB  1 
ATOM   5291 C  CG1 . ILE E 2 124 ? 8.880   -12.016 22.765  1.00   9.29   ? 214  ILE E CG1 1 
ATOM   5292 C  CG2 . ILE E 2 124 ? 6.657   -12.749 21.735  1.00   8.48   ? 214  ILE E CG2 1 
ATOM   5293 C  CD1 . ILE E 2 124 ? 9.427   -11.392 21.478  1.00   8.76   ? 214  ILE E CD1 1 
ATOM   5294 N  N   . PHE E 2 125 ? 7.187   -12.039 25.426  1.00   11.03  ? 215  PHE E N   1 
ATOM   5295 C  CA  . PHE E 2 125 ? 6.455   -11.128 26.282  1.00   11.09  ? 215  PHE E CA  1 
ATOM   5296 C  C   . PHE E 2 125 ? 7.083   -9.763  26.067  1.00   11.11  ? 215  PHE E C   1 
ATOM   5297 O  O   . PHE E 2 125 ? 8.302   -9.633  26.121  1.00   11.27  ? 215  PHE E O   1 
ATOM   5298 C  CB  . PHE E 2 125 ? 6.600   -11.575 27.738  1.00   12.10  ? 215  PHE E CB  1 
ATOM   5299 C  CG  . PHE E 2 125 ? 5.852   -10.715 28.728  1.00   13.35  ? 215  PHE E CG  1 
ATOM   5300 C  CD1 . PHE E 2 125 ? 4.647   -10.111 28.387  1.00   12.62  ? 215  PHE E CD1 1 
ATOM   5301 C  CD2 . PHE E 2 125 ? 6.340   -10.542 30.014  1.00   13.86  ? 215  PHE E CD2 1 
ATOM   5302 C  CE1 . PHE E 2 125 ? 3.948   -9.333  29.315  1.00   13.85  ? 215  PHE E CE1 1 
ATOM   5303 C  CE2 . PHE E 2 125 ? 5.647   -9.756  30.941  1.00   13.61  ? 215  PHE E CE2 1 
ATOM   5304 C  CZ  . PHE E 2 125 ? 4.453   -9.159  30.589  1.00   12.96  ? 215  PHE E CZ  1 
ATOM   5305 N  N   . SER E 2 126 ? 6.255   -8.755  25.797  1.00   10.95  ? 216  SER E N   1 
ATOM   5306 C  CA  . SER E 2 126 ? 6.746   -7.434  25.427  1.00   10.69  ? 216  SER E CA  1 
ATOM   5307 C  C   . SER E 2 126 ? 5.872   -6.362  26.042  1.00   10.99  ? 216  SER E C   1 
ATOM   5308 O  O   . SER E 2 126 ? 4.705   -6.605  26.364  1.00   10.96  ? 216  SER E O   1 
ATOM   5309 C  CB  . SER E 2 126 ? 6.752   -7.256  23.902  1.00   11.01  ? 216  SER E CB  1 
ATOM   5310 O  OG  . SER E 2 126 ? 7.560   -8.231  23.248  1.00   11.49  ? 216  SER E OG  1 
ATOM   5311 N  N   . GLY E 2 127 ? 6.428   -5.165  26.183  1.00   10.57  ? 217  GLY E N   1 
ATOM   5312 C  CA  . GLY E 2 127 ? 5.673   -4.052  26.725  1.00   11.66  ? 217  GLY E CA  1 
ATOM   5313 C  C   . GLY E 2 127 ? 6.403   -2.758  26.471  1.00   12.58  ? 217  GLY E C   1 
ATOM   5314 O  O   . GLY E 2 127 ? 7.633   -2.727  26.467  1.00   13.66  ? 217  GLY E O   1 
ATOM   5315 N  N   . PHE E 2 128 ? 5.647   -1.685  26.254  1.00   13.19  ? 218  PHE E N   1 
ATOM   5316 C  CA  . PHE E 2 128 ? 6.247   -0.370  26.061  1.00   13.24  ? 218  PHE E CA  1 
ATOM   5317 C  C   . PHE E 2 128 ? 5.409   0.777   26.612  1.00   13.69  ? 218  PHE E C   1 
ATOM   5318 O  O   . PHE E 2 128 ? 4.180   0.689   26.710  1.00   13.04  ? 218  PHE E O   1 
ATOM   5319 C  CB  . PHE E 2 128 ? 6.600   -0.118  24.580  1.00   13.19  ? 218  PHE E CB  1 
ATOM   5320 C  CG  . PHE E 2 128 ? 5.452   -0.311  23.619  1.00   13.07  ? 218  PHE E CG  1 
ATOM   5321 C  CD1 . PHE E 2 128 ? 4.698   0.774   23.190  1.00   14.03  ? 218  PHE E CD1 1 
ATOM   5322 C  CD2 . PHE E 2 128 ? 5.146   -1.568  23.124  1.00   13.45  ? 218  PHE E CD2 1 
ATOM   5323 C  CE1 . PHE E 2 128 ? 3.656   0.613   22.282  1.00   13.90  ? 218  PHE E CE1 1 
ATOM   5324 C  CE2 . PHE E 2 128 ? 4.095   -1.744  22.222  1.00   13.77  ? 218  PHE E CE2 1 
ATOM   5325 C  CZ  . PHE E 2 128 ? 3.353   -0.645  21.799  1.00   14.18  ? 218  PHE E CZ  1 
ATOM   5326 N  N   . LEU E 2 129 ? 6.094   1.858   26.966  1.00   14.17  ? 219  LEU E N   1 
ATOM   5327 C  CA  . LEU E 2 129 ? 5.432   3.084   27.372  1.00   14.94  ? 219  LEU E CA  1 
ATOM   5328 C  C   . LEU E 2 129 ? 4.814   3.799   26.174  1.00   15.98  ? 219  LEU E C   1 
ATOM   5329 O  O   . LEU E 2 129 ? 5.480   4.006   25.162  1.00   15.89  ? 219  LEU E O   1 
ATOM   5330 C  CB  . LEU E 2 129 ? 6.438   4.009   28.039  1.00   14.68  ? 219  LEU E CB  1 
ATOM   5331 C  CG  . LEU E 2 129 ? 5.893   5.387   28.401  1.00   14.67  ? 219  LEU E CG  1 
ATOM   5332 C  CD1 . LEU E 2 129 ? 5.026   5.291   29.642  1.00   13.36  ? 219  LEU E CD1 1 
ATOM   5333 C  CD2 . LEU E 2 129 ? 7.047   6.359   28.625  1.00   15.96  ? 219  LEU E CD2 1 
ATOM   5334 N  N   . LEU E 2 130 ? 3.542   4.175   26.302  1.00   17.39  ? 220  LEU E N   1 
ATOM   5335 C  CA  . LEU E 2 130 ? 2.849   4.960   25.288  1.00   18.54  ? 220  LEU E CA  1 
ATOM   5336 C  C   . LEU E 2 130 ? 2.916   6.450   25.615  1.00   20.51  ? 220  LEU E C   1 
ATOM   5337 O  O   . LEU E 2 130 ? 3.360   7.263   24.793  1.00   20.83  ? 220  LEU E O   1 
ATOM   5338 C  CB  . LEU E 2 130 ? 1.389   4.507   25.173  1.00   18.03  ? 220  LEU E CB  1 
ATOM   5339 C  CG  . LEU E 2 130 ? 1.184   3.104   24.589  1.00   17.03  ? 220  LEU E CG  1 
ATOM   5340 C  CD1 . LEU E 2 130 ? -0.204  2.576   24.883  1.00   16.34  ? 220  LEU E CD1 1 
ATOM   5341 C  CD2 . LEU E 2 130 ? 1.461   3.109   23.089  1.00   18.91  ? 220  LEU E CD2 1 
ATOM   5342 N  N   . PHE E 2 131 ? 2.476   6.794   26.823  1.00   21.80  ? 221  PHE E N   1 
ATOM   5343 C  CA  . PHE E 2 131 ? 2.445   8.169   27.286  1.00   24.27  ? 221  PHE E CA  1 
ATOM   5344 C  C   . PHE E 2 131 ? 2.739   8.187   28.778  1.00   25.49  ? 221  PHE E C   1 
ATOM   5345 O  O   . PHE E 2 131 ? 2.069   7.502   29.547  1.00   24.72  ? 221  PHE E O   1 
ATOM   5346 C  CB  . PHE E 2 131 ? 1.066   8.809   27.054  1.00   24.79  ? 221  PHE E CB  1 
ATOM   5347 C  CG  . PHE E 2 131 ? 0.482   8.552   25.689  1.00   25.98  ? 221  PHE E CG  1 
ATOM   5348 C  CD1 . PHE E 2 131 ? -0.454  7.544   25.500  1.00   26.42  ? 221  PHE E CD1 1 
ATOM   5349 C  CD2 . PHE E 2 131 ? 0.848   9.335   24.602  1.00   26.66  ? 221  PHE E CD2 1 
ATOM   5350 C  CE1 . PHE E 2 131 ? -1.002  7.309   24.242  1.00   27.23  ? 221  PHE E CE1 1 
ATOM   5351 C  CE2 . PHE E 2 131 ? 0.308   9.107   23.343  1.00   27.03  ? 221  PHE E CE2 1 
ATOM   5352 C  CZ  . PHE E 2 131 ? -0.619  8.090   23.163  1.00   26.73  ? 221  PHE E CZ  1 
ATOM   5353 N  N   . PRO E 2 132 ? 3.739   8.979   29.187  1.00   27.24  ? 222  PRO E N   1 
ATOM   5354 C  CA  . PRO E 2 132 ? 4.096   9.185   30.589  1.00   28.52  ? 222  PRO E CA  1 
ATOM   5355 C  C   . PRO E 2 132 ? 3.162   10.193  31.254  1.00   30.06  ? 222  PRO E C   1 
ATOM   5356 O  O   . PRO E 2 132 ? 2.736   11.155  30.609  1.00   30.21  ? 222  PRO E O   1 
ATOM   5357 C  CB  . PRO E 2 132 ? 5.514   9.777   30.514  1.00   28.37  ? 222  PRO E CB  1 
ATOM   5358 C  CG  . PRO E 2 132 ? 5.881   9.825   29.042  1.00   28.13  ? 222  PRO E CG  1 
ATOM   5359 C  CD  . PRO E 2 132 ? 4.606   9.745   28.278  1.00   27.64  ? 222  PRO E CD  1 
ATOM   5360 N  N   . ASP E 2 133 ? 2.849   9.977   32.528  1.00   31.08  ? 223  ASP E N   1 
ATOM   5361 C  CA  . ASP E 2 133 ? 2.050   10.935  33.289  1.00   32.48  ? 223  ASP E CA  1 
ATOM   5362 C  C   . ASP E 2 133 ? 2.777   12.267  33.461  1.00   33.05  ? 223  ASP E C   1 
ATOM   5363 O  O   . ASP E 2 133 ? 3.900   12.318  33.967  1.00   33.70  ? 223  ASP E O   1 
ATOM   5364 C  CB  . ASP E 2 133 ? 1.678   10.370  34.659  1.00   32.95  ? 223  ASP E CB  1 
ATOM   5365 C  CG  . ASP E 2 133 ? 0.403   9.565   34.625  1.00   33.75  ? 223  ASP E CG  1 
ATOM   5366 O  OD1 . ASP E 2 133 ? 0.086   9.000   33.558  1.00   34.19  ? 223  ASP E OD1 1 
ATOM   5367 O  OD2 . ASP E 2 133 ? -0.287  9.497   35.664  1.00   34.59  ? 223  ASP E OD2 1 
ATOM   5368 N  N   . MET E 2 134 ? 2.257   13.322  33.097  1.00   33.11  ? 224  MET E N   1 
ATOM   5369 N  N   . LYS F 3 3   ? 9.261   12.614  6.651   1.00   22.82  ? 89   LYS F N   1 
ATOM   5370 C  CA  . LYS F 3 3   ? 8.732   12.649  8.042   1.00   22.19  ? 89   LYS F CA  1 
ATOM   5371 C  C   . LYS F 3 3   ? 9.799   12.215  9.036   1.00   21.77  ? 89   LYS F C   1 
ATOM   5372 O  O   . LYS F 3 3   ? 10.784  11.575  8.673   1.00   22.21  ? 89   LYS F O   1 
ATOM   5373 C  CB  . LYS F 3 3   ? 7.495   11.751  8.185   1.00   21.72  ? 89   LYS F CB  1 
ATOM   5374 C  CG  . LYS F 3 3   ? 6.610   11.976  7.513   0.0000 65.05  ? 89   LYS F CG  1 
ATOM   5375 C  CD  . LYS F 3 3   ? 5.296   11.631  8.202   0.0000 70.78  ? 89   LYS F CD  1 
ATOM   5376 C  CE  . LYS F 3 3   ? 4.139   11.569  7.207   0.0000 73.75  ? 89   LYS F CE  1 
ATOM   5377 N  NZ  . LYS F 3 3   ? 2.807   11.457  7.873   0.0000 75.62  ? 89   LYS F NZ  1 
ATOM   5378 N  N   . PHE F 3 4   ? 9.589   12.571  10.297  1.00   21.68  ? 90   PHE F N   1 
ATOM   5379 C  CA  . PHE F 3 4   ? 10.478  12.168  11.377  1.00   20.90  ? 90   PHE F CA  1 
ATOM   5380 C  C   . PHE F 3 4   ? 9.823   11.044  12.178  1.00   19.99  ? 90   PHE F C   1 
ATOM   5381 O  O   . PHE F 3 4   ? 10.176  10.770  13.330  1.00   19.42  ? 90   PHE F O   1 
ATOM   5382 C  CB  . PHE F 3 4   ? 10.818  13.378  12.250  1.00   21.60  ? 90   PHE F CB  1 
ATOM   5383 C  CG  . PHE F 3 4   ? 11.833  14.299  11.623  1.00   22.40  ? 90   PHE F CG  1 
ATOM   5384 C  CD1 . PHE F 3 4   ? 13.057  14.529  12.236  1.00   22.55  ? 90   PHE F CD1 1 
ATOM   5385 C  CD2 . PHE F 3 4   ? 11.574  14.910  10.406  1.00   21.94  ? 90   PHE F CD2 1 
ATOM   5386 C  CE1 . PHE F 3 4   ? 13.998  15.367  11.650  1.00   22.61  ? 90   PHE F CE1 1 
ATOM   5387 C  CE2 . PHE F 3 4   ? 12.516  15.748  9.814   1.00   22.60  ? 90   PHE F CE2 1 
ATOM   5388 C  CZ  . PHE F 3 4   ? 13.725  15.973  10.438  1.00   21.66  ? 90   PHE F CZ  1 
ATOM   5389 N  N   . GLN F 3 5   ? 8.859   10.394  11.536  1.00   18.73  ? 91   GLN F N   1 
ATOM   5390 C  CA  . GLN F 3 5   ? 8.171   9.248   12.104  1.00   17.54  ? 91   GLN F CA  1 
ATOM   5391 C  C   . GLN F 3 5   ? 8.305   8.062   11.164  1.00   17.16  ? 91   GLN F C   1 
ATOM   5392 O  O   . GLN F 3 5   ? 8.892   8.174   10.079  1.00   16.31  ? 91   GLN F O   1 
ATOM   5393 C  CB  . GLN F 3 5   ? 6.691   9.570   12.312  1.00   17.59  ? 91   GLN F CB  1 
ATOM   5394 C  CG  . GLN F 3 5   ? 6.426   10.822  13.134  1.00   18.20  ? 91   GLN F CG  1 
ATOM   5395 C  CD  . GLN F 3 5   ? 6.577   10.584  14.646  1.00   19.09  ? 91   GLN F CD  1 
ATOM   5396 O  OE1 . GLN F 3 5   ? 6.555   9.443   15.120  1.00   19.07  ? 91   GLN F OE1 1 
ATOM   5397 N  NE2 . GLN F 3 5   ? 6.718   11.666  15.400  1.00   18.15  ? 91   GLN F NE2 1 
ATOM   5398 N  N   . SER F 3 6   ? 7.748   6.924   11.574  1.00   16.79  ? 92   SER F N   1 
ATOM   5399 C  CA  . SER F 3 6   ? 7.825   5.794   10.699  0.0000 13.45  ? 92   SER F CA  1 
ATOM   5400 C  C   . SER F 3 6   ? 6.795   4.758   11.020  1.00   9.35   ? 92   SER F C   1 
ATOM   5401 O  O   . SER F 3 6   ? 6.630   4.444   12.200  1.00   8.69   ? 92   SER F O   1 
ATOM   5402 C  CB  . SER F 3 6   ? 9.186   5.099   10.785  0.0000 14.10  ? 92   SER F CB  1 
ATOM   5403 O  OG  . SER F 3 6   ? 9.221   3.947   9.956   0.0000 15.67  ? 92   SER F OG  1 
ATOM   5404 N  N   . VAL F 3 7   ? 5.913   4.479   10.058  1.00   9.32   ? 93   VAL F N   1 
ATOM   5405 C  CA  . VAL F 3 7   ? 4.763   3.614   10.282  1.00   8.69   ? 93   VAL F CA  1 
ATOM   5406 C  C   . VAL F 3 7   ? 4.330   2.951   8.965   1.00   8.57   ? 93   VAL F C   1 
ATOM   5407 O  O   . VAL F 3 7   ? 4.387   3.574   7.898   1.00   7.31   ? 93   VAL F O   1 
ATOM   5408 C  CB  . VAL F 3 7   ? 3.577   4.428   10.875  1.00   9.50   ? 93   VAL F CB  1 
ATOM   5409 C  CG1 . VAL F 3 7   ? 2.972   5.349   9.820   1.00   10.78  ? 93   VAL F CG1 1 
ATOM   5410 C  CG2 . VAL F 3 7   ? 2.516   3.517   11.433  1.00   10.66  ? 93   VAL F CG2 1 
ATOM   5411 N  N   . PHE F 3 8   ? 3.920   1.686   9.031   1.00   6.98   ? 94   PHE F N   1 
ATOM   5412 C  CA  . PHE F 3 8   ? 3.303   1.039   7.876   1.00   6.73   ? 94   PHE F CA  1 
ATOM   5413 C  C   . PHE F 3 8   ? 2.338   -0.045  8.337   1.00   6.97   ? 94   PHE F C   1 
ATOM   5414 O  O   . PHE F 3 8   ? 2.481   -0.586  9.439   1.00   6.23   ? 94   PHE F O   1 
ATOM   5415 C  CB  . PHE F 3 8   ? 4.354   0.448   6.915   1.00   5.72   ? 94   PHE F CB  1 
ATOM   5416 C  CG  . PHE F 3 8   ? 5.133   -0.690  7.496   1.00   5.15   ? 94   PHE F CG  1 
ATOM   5417 C  CD1 . PHE F 3 8   ? 4.697   -2.006  7.336   1.00   4.16   ? 94   PHE F CD1 1 
ATOM   5418 C  CD2 . PHE F 3 8   ? 6.288   -0.449  8.232   1.00   5.24   ? 94   PHE F CD2 1 
ATOM   5419 C  CE1 . PHE F 3 8   ? 5.423   -3.067  7.891   1.00   5.54   ? 94   PHE F CE1 1 
ATOM   5420 C  CE2 . PHE F 3 8   ? 7.012   -1.492  8.793   1.00   6.13   ? 94   PHE F CE2 1 
ATOM   5421 C  CZ  . PHE F 3 8   ? 6.582   -2.813  8.615   1.00   5.55   ? 94   PHE F CZ  1 
ATOM   5422 N  N   . THR F 3 9   ? 1.331   -0.315  7.510   1.00   7.23   ? 95   THR F N   1 
ATOM   5423 C  CA  . THR F 3 9   ? 0.596   -1.581  7.574   1.00   7.10   ? 95   THR F CA  1 
ATOM   5424 C  C   . THR F 3 9   ? 0.407   -2.061  6.155   1.00   6.69   ? 95   THR F C   1 
ATOM   5425 O  O   . THR F 3 9   ? -0.151  -1.341  5.334   1.00   7.16   ? 95   THR F O   1 
ATOM   5426 C  CB  . THR F 3 9   ? -0.765  -1.466  8.255   1.00   6.84   ? 95   THR F CB  1 
ATOM   5427 O  OG1 . THR F 3 9   ? -0.567  -1.336  9.666   1.00   10.09  ? 95   THR F OG1 1 
ATOM   5428 C  CG2 . THR F 3 9   ? -1.562  -2.732  8.012   1.00   7.55   ? 95   THR F CG2 1 
ATOM   5429 N  N   . VAL F 3 10  ? 0.912   -3.258  5.865   1.00   5.77   ? 96   VAL F N   1 
ATOM   5430 C  CA  . VAL F 3 10  ? 0.837   -3.820  4.533   1.00   6.19   ? 96   VAL F CA  1 
ATOM   5431 C  C   . VAL F 3 10  ? 0.141   -5.179  4.618   1.00   7.03   ? 96   VAL F C   1 
ATOM   5432 O  O   . VAL F 3 10  ? 0.054   -5.784  5.701   1.00   4.60   ? 96   VAL F O   1 
ATOM   5433 C  CB  . VAL F 3 10  ? 2.252   -3.945  3.873   1.00   6.13   ? 96   VAL F CB  1 
ATOM   5434 C  CG1 . VAL F 3 10  ? 2.842   -2.547  3.577   1.00   6.10   ? 96   VAL F CG1 1 
ATOM   5435 C  CG2 . VAL F 3 10  ? 3.214   -4.720  4.761   1.00   4.79   ? 96   VAL F CG2 1 
ATOM   5436 N  N   . THR F 3 11  ? -0.351  -5.650  3.478   1.00   6.73   ? 97   THR F N   1 
ATOM   5437 C  CA  . THR F 3 11  ? -1.128  -6.866  3.443   1.00   8.39   ? 97   THR F CA  1 
ATOM   5438 C  C   . THR F 3 11  ? -0.726  -7.672  2.238   1.00   9.09   ? 97   THR F C   1 
ATOM   5439 O  O   . THR F 3 11  ? -0.189  -7.141  1.264   1.00   7.58   ? 97   THR F O   1 
ATOM   5440 C  CB  . THR F 3 11  ? -2.653  -6.594  3.389   1.00   9.55   ? 97   THR F CB  1 
ATOM   5441 O  OG1 . THR F 3 11  ? -3.369  -7.843  3.381   1.00   12.68  ? 97   THR F OG1 1 
ATOM   5442 C  CG2 . THR F 3 11  ? -3.015  -5.821  2.155   1.00   8.46   ? 97   THR F CG2 1 
ATOM   5443 N  N   . ARG F 3 12  ? -0.972  -8.968  2.314   1.00   10.67  ? 98   ARG F N   1 
ATOM   5444 C  CA  . ARG F 3 12  ? -0.675  -9.817  1.194   1.00   14.14  ? 98   ARG F CA  1 
ATOM   5445 C  C   . ARG F 3 12  ? -1.934  -10.025 0.369   1.00   15.10  ? 98   ARG F C   1 
ATOM   5446 O  O   . ARG F 3 12  ? -2.845  -10.731 0.785   1.00   16.49  ? 98   ARG F O   1 
ATOM   5447 C  CB  . ARG F 3 12  ? -0.083  -11.140 1.676   1.00   14.28  ? 98   ARG F CB  1 
ATOM   5448 C  CG  . ARG F 3 12  ? 0.732   -11.820 0.617   1.00   16.19  ? 98   ARG F CG  1 
ATOM   5449 C  CD  . ARG F 3 12  ? 1.688   -12.847 1.185   1.00   16.62  ? 98   ARG F CD  1 
ATOM   5450 N  NE  . ARG F 3 12  ? 2.317   -13.551 0.079   1.00   17.83  ? 98   ARG F NE  1 
ATOM   5451 C  CZ  . ARG F 3 12  ? 1.758   -14.565 -0.559  1.00   17.35  ? 98   ARG F CZ  1 
ATOM   5452 N  NH1 . ARG F 3 12  ? 0.560   -15.006 -0.189  1.00   18.46  ? 98   ARG F NH1 1 
ATOM   5453 N  NH2 . ARG F 3 12  ? 2.394   -15.129 -1.575  1.00   18.80  ? 98   ARG F NH2 1 
ATOM   5454 N  N   . GLN F 3 13  ? -2.001  -9.403  -0.801  1.00   16.92  ? 99   GLN F N   1 
ATOM   5455 C  CA  . GLN F 3 13  ? -3.193  -9.572  -1.639  1.00   18.32  ? 99   GLN F CA  1 
ATOM   5456 C  C   . GLN F 3 13  ? -2.972  -10.535 -2.801  1.00   18.72  ? 99   GLN F C   1 
ATOM   5457 O  O   . GLN F 3 13  ? -2.612  -10.137 -3.925  1.00   18.22  ? 99   GLN F O   1 
ATOM   5458 C  CB  . GLN F 3 13  ? -3.766  -8.242  -2.118  1.00   18.55  ? 99   GLN F CB  1 
ATOM   5459 C  CG  . GLN F 3 13  ? -5.139  -8.423  -2.755  1.00   22.29  ? 99   GLN F CG  1 
ATOM   5460 C  CD  . GLN F 3 13  ? -6.007  -7.195  -2.648  1.00   23.42  ? 99   GLN F CD  1 
ATOM   5461 O  OE1 . GLN F 3 13  ? -5.510  -6.091  -2.431  1.00   25.23  ? 99   GLN F OE1 1 
ATOM   5462 N  NE2 . GLN F 3 13  ? -7.315  -7.377  -2.799  1.00   24.17  ? 99   GLN F NE2 1 
ATOM   5463 N  N   . THR F 3 14  ? -3.200  -11.808 -2.507  1.00   19.53  ? 100  THR F N   1 
ATOM   5464 C  CA  . THR F 3 14  ? -2.990  -12.882 -3.461  1.00   20.87  ? 100  THR F CA  1 
ATOM   5465 C  C   . THR F 3 14  ? -3.541  -14.187 -2.869  1.00   21.39  ? 100  THR F C   1 
ATOM   5466 O  O   . THR F 3 14  ? -3.651  -14.335 -1.649  1.00   21.54  ? 100  THR F O   1 
ATOM   5467 C  CB  . THR F 3 14  ? -1.487  -13.031 -3.844  1.00   21.08  ? 100  THR F CB  1 
ATOM   5468 O  OG1 . THR F 3 14  ? -1.331  -14.047 -4.848  1.00   21.76  ? 100  THR F OG1 1 
ATOM   5469 C  CG2 . THR F 3 14  ? -0.642  -13.391 -2.632  1.00   20.74  ? 100  THR F CG2 1 
ATOM   5470 N  N   . HIS F 3 15  ? -3.897  -15.120 -3.738  1.00   21.73  ? 101  HIS F N   1 
ATOM   5471 C  CA  . HIS F 3 15  ? -4.476  -16.377 -3.299  1.00   22.20  ? 101  HIS F CA  1 
ATOM   5472 C  C   . HIS F 3 15  ? -3.410  -17.480 -3.298  1.00   22.07  ? 101  HIS F C   1 
ATOM   5473 O  O   . HIS F 3 15  ? -3.523  -18.460 -2.574  1.00   22.13  ? 101  HIS F O   1 
ATOM   5474 C  CB  . HIS F 3 15  ? -5.676  -16.731 -4.187  1.00   22.31  ? 101  HIS F CB  1 
ATOM   5475 C  CG  . HIS F 3 15  ? -6.489  -17.885 -3.691  1.00   22.50  ? 101  HIS F CG  1 
ATOM   5476 N  ND1 . HIS F 3 15  ? -6.736  -18.106 -2.352  1.00   22.93  ? 101  HIS F ND1 1 
ATOM   5477 C  CD2 . HIS F 3 15  ? -7.141  -18.866 -4.360  1.00   23.35  ? 101  HIS F CD2 1 
ATOM   5478 C  CE1 . HIS F 3 15  ? -7.479  -19.190 -2.217  1.00   23.26  ? 101  HIS F CE1 1 
ATOM   5479 N  NE2 . HIS F 3 15  ? -7.740  -19.669 -3.420  1.00   23.97  ? 101  HIS F NE2 1 
ATOM   5480 N  N   . GLN F 3 16  ? -2.360  -17.297 -4.094  1.00   21.87  ? 102  GLN F N   1 
ATOM   5481 C  CA  . GLN F 3 16  ? -1.147  -18.192 -4.081  0.0000 21.24  ? 102  GLN F CA  1 
ATOM   5482 C  C   . GLN F 3 16  ? -0.310  -17.811 -2.586  1.00   14.66  ? 102  GLN F C   1 
ATOM   5483 O  O   . GLN F 3 16  ? 0.309   -16.747 -2.690  1.00   14.83  ? 102  GLN F O   1 
ATOM   5484 C  CB  . GLN F 3 16  ? -0.357  -18.101 -5.401  0.0000 21.16  ? 102  GLN F CB  1 
ATOM   5485 C  CG  . GLN F 3 16  ? -1.231  -18.056 -6.684  0.0000 24.53  ? 102  GLN F CG  1 
ATOM   5486 C  CD  . GLN F 3 16  ? -0.420  -18.089 -7.995  0.0000 25.06  ? 102  GLN F CD  1 
ATOM   5487 O  OE1 . GLN F 3 16  ? -0.342  -17.091 -8.734  0.0000 27.15  ? 102  GLN F OE1 1 
ATOM   5488 N  NE2 . GLN F 3 16  ? 0.175   -19.245 -8.291  0.0000 28.94  ? 102  GLN F NE2 1 
ATOM   5489 N  N   . PRO F 3 17  ? 0.216   -18.903 -2.016  1.00   14.59  ? 103  PRO F N   1 
ATOM   5490 C  CA  . PRO F 3 17  ? 1.031   -18.763 -0.829  1.00   14.58  ? 103  PRO F CA  1 
ATOM   5491 C  C   . PRO F 3 17  ? 2.481   -18.473 -1.209  1.00   14.03  ? 103  PRO F C   1 
ATOM   5492 O  O   . PRO F 3 17  ? 2.846   -18.576 -2.384  1.00   14.66  ? 103  PRO F O   1 
ATOM   5493 C  CB  . PRO F 3 17  ? 0.889   -20.124 -0.138  1.00   14.66  ? 103  PRO F CB  1 
ATOM   5494 C  CG  . PRO F 3 17  ? 0.320   -21.073 -1.182  1.00   14.97  ? 103  PRO F CG  1 
ATOM   5495 C  CD  . PRO F 3 17  ? 0.098   -20.303 -2.450  1.00   14.88  ? 103  PRO F CD  1 
ATOM   5496 N  N   . PRO F 3 18  ? 3.300   -18.069 -0.230  1.00   13.30  ? 104  PRO F N   1 
ATOM   5497 C  CA  . PRO F 3 18  ? 4.708   -17.850 -0.543  1.00   13.03  ? 104  PRO F CA  1 
ATOM   5498 C  C   . PRO F 3 18  ? 5.372   -19.154 -0.957  1.00   13.07  ? 104  PRO F C   1 
ATOM   5499 O  O   . PRO F 3 18  ? 4.840   -20.228 -0.694  1.00   11.79  ? 104  PRO F O   1 
ATOM   5500 C  CB  . PRO F 3 18  ? 5.312   -17.392 0.793   1.00   12.86  ? 104  PRO F CB  1 
ATOM   5501 C  CG  . PRO F 3 18  ? 4.164   -17.070 1.689   1.00   12.28  ? 104  PRO F CG  1 
ATOM   5502 C  CD  . PRO F 3 18  ? 2.972   -17.803 1.182   1.00   12.55  ? 104  PRO F CD  1 
ATOM   5503 N  N   . ALA F 3 19  ? 6.527   -19.046 -1.608  1.00   13.25  ? 105  ALA F N   1 
ATOM   5504 C  CA  . ALA F 3 19  ? 7.401   -20.180 -1.826  1.00   12.97  ? 105  ALA F CA  1 
ATOM   5505 C  C   . ALA F 3 19  ? 8.005   -20.642 -0.490  1.00   13.85  ? 105  ALA F C   1 
ATOM   5506 O  O   . ALA F 3 19  ? 8.273   -19.817 0.405   1.00   12.86  ? 105  ALA F O   1 
ATOM   5507 C  CB  . ALA F 3 19  ? 8.507   -19.787 -2.804  1.00   14.31  ? 105  ALA F CB  1 
ATOM   5508 N  N   . PRO F 3 20  ? 8.212   -21.964 -0.336  1.00   13.93  ? 106  PRO F N   1 
ATOM   5509 C  CA  . PRO F 3 20  ? 8.832   -22.494 0.889   1.00   14.09  ? 106  PRO F CA  1 
ATOM   5510 C  C   . PRO F 3 20  ? 10.191  -21.852 1.119   1.00   13.68  ? 106  PRO F C   1 
ATOM   5511 O  O   . PRO F 3 20  ? 10.905  -21.578 0.154   1.00   13.12  ? 106  PRO F O   1 
ATOM   5512 C  CB  . PRO F 3 20  ? 9.016   -23.978 0.579   1.00   14.08  ? 106  PRO F CB  1 
ATOM   5513 C  CG  . PRO F 3 20  ? 7.989   -24.269 -0.475  1.00   14.24  ? 106  PRO F CG  1 
ATOM   5514 C  CD  . PRO F 3 20  ? 7.876   -23.027 -1.294  1.00   14.28  ? 106  PRO F CD  1 
ATOM   5515 N  N   . ASN F 3 21  ? 10.535  -21.606 2.378   1.00   12.99  ? 107  ASN F N   1 
ATOM   5516 C  CA  . ASN F 3 21  ? 11.828  -21.019 2.711   1.00   13.99  ? 107  ASN F CA  1 
ATOM   5517 C  C   . ASN F 3 21  ? 12.141  -19.727 1.943   1.00   14.24  ? 107  ASN F C   1 
ATOM   5518 O  O   . ASN F 3 21  ? 13.247  -19.544 1.414   1.00   15.11  ? 107  ASN F O   1 
ATOM   5519 C  CB  . ASN F 3 21  ? 12.939  -22.055 2.504   1.00   13.52  ? 107  ASN F CB  1 
ATOM   5520 C  CG  . ASN F 3 21  ? 12.717  -23.297 3.324   1.00   14.35  ? 107  ASN F CG  1 
ATOM   5521 O  OD1 . ASN F 3 21  ? 12.765  -23.250 4.553   1.00   14.48  ? 107  ASN F OD1 1 
ATOM   5522 N  ND2 . ASN F 3 21  ? 12.455  -24.424 2.651   1.00   13.69  ? 107  ASN F ND2 1 
ATOM   5523 N  N   . SER F 3 22  ? 11.173  -18.824 1.891   1.00   14.15  ? 108  SER F N   1 
ATOM   5524 C  CA  . SER F 3 22  ? 11.362  -17.574 1.167   1.00   14.02  ? 108  SER F CA  1 
ATOM   5525 C  C   . SER F 3 22  ? 10.878  -16.391 1.983   1.00   13.81  ? 108  SER F C   1 
ATOM   5526 O  O   . SER F 3 22  ? 10.089  -16.545 2.920   1.00   12.69  ? 108  SER F O   1 
ATOM   5527 C  CB  . SER F 3 22  ? 10.608  -17.600 -0.171  1.00   13.94  ? 108  SER F CB  1 
ATOM   5528 O  OG  . SER F 3 22  ? 9.201   -17.564 0.050   1.00   13.73  ? 108  SER F OG  1 
ATOM   5529 N  N   . LEU F 3 23  ? 11.355  -15.209 1.604   1.00   13.18  ? 109  LEU F N   1 
ATOM   5530 C  CA  . LEU F 3 23  ? 10.845  -13.965 2.134   1.00   13.69  ? 109  LEU F CA  1 
ATOM   5531 C  C   . LEU F 3 23  ? 9.379   -13.770 1.737   1.00   13.27  ? 109  LEU F C   1 
ATOM   5532 O  O   . LEU F 3 23  ? 8.995   -14.010 0.593   1.00   12.85  ? 109  LEU F O   1 
ATOM   5533 C  CB  . LEU F 3 23  ? 11.713  -12.801 1.635   1.00   13.69  ? 109  LEU F CB  1 
ATOM   5534 C  CG  . LEU F 3 23  ? 11.381  -11.386 2.095   1.00   13.63  ? 109  LEU F CG  1 
ATOM   5535 C  CD1 . LEU F 3 23  ? 12.601  -10.500 1.986   1.00   13.45  ? 109  LEU F CD1 1 
ATOM   5536 C  CD2 . LEU F 3 23  ? 10.244  -10.814 1.271   1.00   14.57  ? 109  LEU F CD2 1 
ATOM   5537 N  N   . ILE F 3 24  ? 8.560   -13.337 2.691   1.00   13.44  ? 110  ILE F N   1 
ATOM   5538 C  CA  . ILE F 3 24  ? 7.149   -13.063 2.414   1.00   13.57  ? 110  ILE F CA  1 
ATOM   5539 C  C   . ILE F 3 24  ? 6.917   -11.632 1.946   1.00   13.34  ? 110  ILE F C   1 
ATOM   5540 O  O   . ILE F 3 24  ? 7.146   -10.686 2.698   1.00   13.01  ? 110  ILE F O   1 
ATOM   5541 C  CB  . ILE F 3 24  ? 6.250   -13.276 3.650   1.00   13.59  ? 110  ILE F CB  1 
ATOM   5542 C  CG1 . ILE F 3 24  ? 6.520   -14.632 4.304   1.00   13.30  ? 110  ILE F CG1 1 
ATOM   5543 C  CG2 . ILE F 3 24  ? 4.794   -13.168 3.235   1.00   14.29  ? 110  ILE F CG2 1 
ATOM   5544 C  CD1 . ILE F 3 24  ? 5.879   -14.789 5.670   1.00   13.65  ? 110  ILE F CD1 1 
ATOM   5545 N  N   A ARG F 3 25  ? 6.479   -11.476 0.698   0.50   13.27  ? 111  ARG F N   1 
ATOM   5546 N  N   B ARG F 3 25  ? 6.438   -11.482 0.714   0.50   12.95  ? 111  ARG F N   1 
ATOM   5547 C  CA  A ARG F 3 25  ? 6.134   -10.157 0.185   0.50   13.39  ? 111  ARG F CA  1 
ATOM   5548 C  CA  B ARG F 3 25  ? 6.152   -10.167 0.157   0.50   12.77  ? 111  ARG F CA  1 
ATOM   5549 C  C   A ARG F 3 25  ? 4.698   -9.773  0.507   0.50   13.35  ? 111  ARG F C   1 
ATOM   5550 C  C   B ARG F 3 25  ? 4.704   -9.735  0.412   0.50   13.03  ? 111  ARG F C   1 
ATOM   5551 O  O   A ARG F 3 25  ? 3.764   -10.550 0.301   0.50   13.20  ? 111  ARG F O   1 
ATOM   5552 O  O   B ARG F 3 25  ? 3.760   -10.452 0.066   0.50   12.88  ? 111  ARG F O   1 
ATOM   5553 C  CB  A ARG F 3 25  ? 6.362   -10.050 -1.325  0.50   13.57  ? 111  ARG F CB  1 
ATOM   5554 C  CB  B ARG F 3 25  ? 6.441   -10.150 -1.344  0.50   12.65  ? 111  ARG F CB  1 
ATOM   5555 C  CG  A ARG F 3 25  ? 7.464   -9.068  -1.710  0.50   14.39  ? 111  ARG F CG  1 
ATOM   5556 C  CG  B ARG F 3 25  ? 7.923   -10.109 -1.703  0.50   11.91  ? 111  ARG F CG  1 
ATOM   5557 C  CD  A ARG F 3 25  ? 7.658   -9.005  -3.216  0.50   14.03  ? 111  ARG F CD  1 
ATOM   5558 C  CD  B ARG F 3 25  ? 8.100   -10.121 -3.221  0.50   11.86  ? 111  ARG F CD  1 
ATOM   5559 N  NE  A ARG F 3 25  ? 6.976   -7.888  -3.866  0.50   13.72  ? 111  ARG F NE  1 
ATOM   5560 N  NE  B ARG F 3 25  ? 9.386   -9.570  -3.647  0.50   10.06  ? 111  ARG F NE  1 
ATOM   5561 C  CZ  A ARG F 3 25  ? 5.747   -7.935  -4.381  0.50   14.05  ? 111  ARG F CZ  1 
ATOM   5562 C  CZ  B ARG F 3 25  ? 10.531  -10.238 -3.594  0.50   9.62   ? 111  ARG F CZ  1 
ATOM   5563 N  NH1 A ARG F 3 25  ? 5.024   -9.043  -4.299  0.50   13.14  ? 111  ARG F NH1 1 
ATOM   5564 N  NH1 B ARG F 3 25  ? 10.554  -11.475 -3.122  0.50   9.16   ? 111  ARG F NH1 1 
ATOM   5565 N  NH2 A ARG F 3 25  ? 5.232   -6.861  -4.969  0.50   13.11  ? 111  ARG F NH2 1 
ATOM   5566 N  NH2 B ARG F 3 25  ? 11.651  -9.667  -3.997  0.50   9.51   ? 111  ARG F NH2 1 
ATOM   5567 N  N   . PHE F 3 26  ? 4.540   -8.559  1.013   1.00   12.64  ? 112  PHE F N   1 
ATOM   5568 C  CA  . PHE F 3 26  ? 3.230   -7.965  1.197   1.00   12.52  ? 112  PHE F CA  1 
ATOM   5569 C  C   . PHE F 3 26  ? 3.088   -6.882  0.124   1.00   12.92  ? 112  PHE F C   1 
ATOM   5570 O  O   . PHE F 3 26  ? 3.717   -5.823  0.201   1.00   13.85  ? 112  PHE F O   1 
ATOM   5571 C  CB  . PHE F 3 26  ? 3.106   -7.404  2.615   1.00   11.61  ? 112  PHE F CB  1 
ATOM   5572 C  CG  . PHE F 3 26  ? 3.115   -8.467  3.679   1.00   11.59  ? 112  PHE F CG  1 
ATOM   5573 C  CD1 . PHE F 3 26  ? 4.303   -9.071  4.071   1.00   10.79  ? 112  PHE F CD1 1 
ATOM   5574 C  CD2 . PHE F 3 26  ? 1.930   -8.883  4.276   1.00   10.63  ? 112  PHE F CD2 1 
ATOM   5575 C  CE1 . PHE F 3 26  ? 4.312   -10.057 5.041   1.00   10.49  ? 112  PHE F CE1 1 
ATOM   5576 C  CE2 . PHE F 3 26  ? 1.934   -9.865  5.239   1.00   9.60   ? 112  PHE F CE2 1 
ATOM   5577 C  CZ  . PHE F 3 26  ? 3.126   -10.460 5.624   1.00   10.64  ? 112  PHE F CZ  1 
ATOM   5578 N  N   . ASN F 3 27  ? 2.285   -7.171  -0.897  1.00   11.85  ? 113  ASN F N   1 
ATOM   5579 C  CA  . ASN F 3 27  ? 2.216   -6.335  -2.088  1.00   11.40  ? 113  ASN F CA  1 
ATOM   5580 C  C   . ASN F 3 27  ? 1.270   -5.125  -1.988  1.00   11.22  ? 113  ASN F C   1 
ATOM   5581 O  O   . ASN F 3 27  ? 1.375   -4.179  -2.778  1.00   12.98  ? 113  ASN F O   1 
ATOM   5582 C  CB  . ASN F 3 27  ? 1.848   -7.205  -3.310  1.00   10.68  ? 113  ASN F CB  1 
ATOM   5583 C  CG  . ASN F 3 27  ? 0.517   -7.932  -3.130  1.00   11.28  ? 113  ASN F CG  1 
ATOM   5584 O  OD1 . ASN F 3 27  ? 0.195   -8.403  -2.035  1.00   10.33  ? 113  ASN F OD1 1 
ATOM   5585 N  ND2 . ASN F 3 27  ? -0.261  -8.022  -4.204  1.00   9.71   ? 113  ASN F ND2 1 
ATOM   5586 N  N   . ALA F 3 28  ? 0.355   -5.157  -1.029  1.00   9.81   ? 114  ALA F N   1 
ATOM   5587 C  CA  . ALA F 3 28  ? -0.681  -4.138  -0.907  1.00   9.95   ? 114  ALA F CA  1 
ATOM   5588 C  C   . ALA F 3 28  ? -0.470  -3.309  0.357   1.00   10.81  ? 114  ALA F C   1 
ATOM   5589 O  O   . ALA F 3 28  ? -0.108  -3.848  1.406   1.00   11.19  ? 114  ALA F O   1 
ATOM   5590 C  CB  . ALA F 3 28  ? -2.061  -4.786  -0.885  1.00   10.79  ? 114  ALA F CB  1 
ATOM   5591 N  N   . VAL F 3 29  ? -0.700  -2.003  0.243   1.00   9.74   ? 115  VAL F N   1 
ATOM   5592 C  CA  . VAL F 3 29  ? -0.424  -1.065  1.304   1.00   9.55   ? 115  VAL F CA  1 
ATOM   5593 C  C   . VAL F 3 29  ? -1.724  -0.497  1.854   1.00   9.47   ? 115  VAL F C   1 
ATOM   5594 O  O   . VAL F 3 29  ? -2.564  0.004   1.095   1.00   8.91   ? 115  VAL F O   1 
ATOM   5595 C  CB  . VAL F 3 29  ? 0.404   0.117   0.771   1.00   9.77   ? 115  VAL F CB  1 
ATOM   5596 C  CG1 . VAL F 3 29  ? 0.557   1.193   1.843   1.00   11.67  ? 115  VAL F CG1 1 
ATOM   5597 C  CG2 . VAL F 3 29  ? 1.753   -0.355  0.289   1.00   11.36  ? 115  VAL F CG2 1 
ATOM   5598 N  N   . LEU F 3 30  ? -1.899  -0.576  3.166   1.00   8.08   ? 116  LEU F N   1 
ATOM   5599 C  CA  . LEU F 3 30  ? -2.984  0.152   3.803   1.00   9.02   ? 116  LEU F CA  1 
ATOM   5600 C  C   . LEU F 3 30  ? -2.497  1.549   4.198   1.00   9.11   ? 116  LEU F C   1 
ATOM   5601 O  O   . LEU F 3 30  ? -3.186  2.543   3.982   1.00   9.35   ? 116  LEU F O   1 
ATOM   5602 C  CB  . LEU F 3 30  ? -3.514  -0.596  5.028   1.00   9.95   ? 116  LEU F CB  1 
ATOM   5603 C  CG  . LEU F 3 30  ? -4.049  -2.027  4.872   1.00   11.11  ? 116  LEU F CG  1 
ATOM   5604 C  CD1 . LEU F 3 30  ? -4.617  -2.527  6.225   1.00   11.70  ? 116  LEU F CD1 1 
ATOM   5605 C  CD2 . LEU F 3 30  ? -5.103  -2.122  3.800   1.00   10.97  ? 116  LEU F CD2 1 
ATOM   5606 N  N   . THR F 3 31  ? -1.314  1.613   4.797   1.00   8.64   ? 117  THR F N   1 
ATOM   5607 C  CA  . THR F 3 31  ? -0.630  2.885   5.029   1.00   8.83   ? 117  THR F CA  1 
ATOM   5608 C  C   . THR F 3 31  ? 0.870   2.641   5.009   1.00   8.75   ? 117  THR F C   1 
ATOM   5609 O  O   . THR F 3 31  ? 1.327   1.570   5.402   1.00   7.91   ? 117  THR F O   1 
ATOM   5610 C  CB  . THR F 3 31  ? -1.081  3.597   6.332   1.00   9.60   ? 117  THR F CB  1 
ATOM   5611 O  OG1 . THR F 3 31  ? -0.563  4.934   6.352   1.00   12.32  ? 117  THR F OG1 1 
ATOM   5612 C  CG2 . THR F 3 31  ? -0.628  2.857   7.587   1.00   9.82   ? 117  THR F CG2 1 
ATOM   5613 N  N   . ASN F 3 32  ? 1.619   3.619   4.506   1.00   8.45   ? 118  ASN F N   1 
ATOM   5614 C  CA  . ASN F 3 32  ? 3.063   3.502   4.360   1.00   9.41   ? 118  ASN F CA  1 
ATOM   5615 C  C   . ASN F 3 32  ? 3.622   4.851   3.931   1.00   10.00  ? 118  ASN F C   1 
ATOM   5616 O  O   . ASN F 3 32  ? 4.266   4.949   2.889   1.00   8.84   ? 118  ASN F O   1 
ATOM   5617 C  CB  . ASN F 3 32  ? 3.381   2.451   3.300   1.00   8.91   ? 118  ASN F CB  1 
ATOM   5618 C  CG  . ASN F 3 32  ? 4.858   2.079   3.245   1.00   10.36  ? 118  ASN F CG  1 
ATOM   5619 O  OD1 . ASN F 3 32  ? 5.583   2.152   4.247   1.00   9.61   ? 118  ASN F OD1 1 
ATOM   5620 N  ND2 . ASN F 3 32  ? 5.301   1.646   2.073   1.00   8.86   ? 118  ASN F ND2 1 
ATOM   5621 N  N   . PRO F 3 33  ? 3.386   5.900   4.746   1.00   10.85  ? 119  PRO F N   1 
ATOM   5622 C  CA  . PRO F 3 33  ? 3.597   7.263   4.254   1.00   11.35  ? 119  PRO F CA  1 
ATOM   5623 C  C   . PRO F 3 33  ? 5.063   7.637   4.059   1.00   11.96  ? 119  PRO F C   1 
ATOM   5624 O  O   . PRO F 3 33  ? 5.363   8.531   3.262   1.00   12.56  ? 119  PRO F O   1 
ATOM   5625 C  CB  . PRO F 3 33  ? 2.930   8.143   5.311   1.00   11.64  ? 119  PRO F CB  1 
ATOM   5626 C  CG  . PRO F 3 33  ? 2.825   7.300   6.549   1.00   11.62  ? 119  PRO F CG  1 
ATOM   5627 C  CD  . PRO F 3 33  ? 2.933   5.854   6.151   1.00   11.29  ? 119  PRO F CD  1 
ATOM   5628 N  N   . GLN F 3 34  ? 5.970   6.954   4.753   1.00   11.94  ? 120  GLN F N   1 
ATOM   5629 C  CA  . GLN F 3 34  ? 7.398   7.224   4.583   1.00   12.11  ? 120  GLN F CA  1 
ATOM   5630 C  C   . GLN F 3 34  ? 8.051   6.333   3.529   1.00   11.94  ? 120  GLN F C   1 
ATOM   5631 O  O   . GLN F 3 34  ? 9.208   6.556   3.155   1.00   11.68  ? 120  GLN F O   1 
ATOM   5632 C  CB  . GLN F 3 34  ? 8.148   7.097   5.910   1.00   12.10  ? 120  GLN F CB  1 
ATOM   5633 C  CG  . GLN F 3 34  ? 7.723   8.100   6.983   1.00   12.02  ? 120  GLN F CG  1 
ATOM   5634 C  CD  . GLN F 3 34  ? 6.490   7.665   7.740   1.00   11.73  ? 120  GLN F CD  1 
ATOM   5635 O  OE1 . GLN F 3 34  ? 6.100   6.495   7.694   1.00   11.94  ? 120  GLN F OE1 1 
ATOM   5636 N  NE2 . GLN F 3 34  ? 5.870   8.601   8.450   1.00   10.76  ? 120  GLN F NE2 1 
ATOM   5637 N  N   . GLY F 3 35  ? 7.311   5.327   3.065   1.00   11.36  ? 121  GLY F N   1 
ATOM   5638 C  CA  . GLY F 3 35  ? 7.829   4.377   2.092   1.00   10.47  ? 121  GLY F CA  1 
ATOM   5639 C  C   . GLY F 3 35  ? 8.868   3.449   2.700   1.00   10.31  ? 121  GLY F C   1 
ATOM   5640 O  O   . GLY F 3 35  ? 9.655   2.839   1.984   1.00   9.56   ? 121  GLY F O   1 
ATOM   5641 N  N   . ASP F 3 36  ? 8.850   3.331   4.026   1.00   9.90   ? 122  ASP F N   1 
ATOM   5642 C  CA  . ASP F 3 36  ? 9.802   2.485   4.747   1.00   10.31  ? 122  ASP F CA  1 
ATOM   5643 C  C   . ASP F 3 36  ? 9.631   0.985   4.460   1.00   10.03  ? 122  ASP F C   1 
ATOM   5644 O  O   . ASP F 3 36  ? 10.609  0.249   4.452   1.00   9.79   ? 122  ASP F O   1 
ATOM   5645 C  CB  . ASP F 3 36  ? 9.748   2.769   6.254   1.00   10.35  ? 122  ASP F CB  1 
ATOM   5646 C  CG  . ASP F 3 36  ? 10.274  4.157   6.608   1.00   11.85  ? 122  ASP F CG  1 
ATOM   5647 O  OD1 . ASP F 3 36  ? 11.004  4.748   5.790   1.00   12.22  ? 122  ASP F OD1 1 
ATOM   5648 O  OD2 . ASP F 3 36  ? 9.950   4.668   7.702   1.00   12.77  ? 122  ASP F OD2 1 
ATOM   5649 N  N   . TYR F 3 37  ? 8.403   0.528   4.225   1.00   10.10  ? 123  TYR F N   1 
ATOM   5650 C  CA  . TYR F 3 37  ? 8.223   -0.823  3.677   1.00   10.08  ? 123  TYR F CA  1 
ATOM   5651 C  C   . TYR F 3 37  ? 8.192   -0.778  2.147   1.00   10.29  ? 123  TYR F C   1 
ATOM   5652 O  O   . TYR F 3 37  ? 7.377   -0.076  1.552   1.00   9.99   ? 123  TYR F O   1 
ATOM   5653 C  CB  . TYR F 3 37  ? 6.955   -1.491  4.184   1.00   9.97   ? 123  TYR F CB  1 
ATOM   5654 C  CG  . TYR F 3 37  ? 6.846   -2.950  3.766   1.00   10.25  ? 123  TYR F CG  1 
ATOM   5655 C  CD1 . TYR F 3 37  ? 7.351   -3.964  4.567   1.00   11.06  ? 123  TYR F CD1 1 
ATOM   5656 C  CD2 . TYR F 3 37  ? 6.259   -3.308  2.563   1.00   11.14  ? 123  TYR F CD2 1 
ATOM   5657 C  CE1 . TYR F 3 37  ? 7.254   -5.294  4.194   1.00   10.23  ? 123  TYR F CE1 1 
ATOM   5658 C  CE2 . TYR F 3 37  ? 6.155   -4.643  2.175   1.00   10.67  ? 123  TYR F CE2 1 
ATOM   5659 C  CZ  . TYR F 3 37  ? 6.650   -5.625  2.994   1.00   11.07  ? 123  TYR F CZ  1 
ATOM   5660 O  OH  . TYR F 3 37  ? 6.560   -6.945  2.605   1.00   11.69  ? 123  TYR F OH  1 
ATOM   5661 N  N   . ASP F 3 38  ? 9.085   -1.530  1.519   1.00   10.68  ? 124  ASP F N   1 
ATOM   5662 C  CA  . ASP F 3 38  ? 9.190   -1.546  0.061   1.00   11.14  ? 124  ASP F CA  1 
ATOM   5663 C  C   . ASP F 3 38  ? 8.458   -2.771  -0.496  1.00   10.49  ? 124  ASP F C   1 
ATOM   5664 O  O   . ASP F 3 38  ? 8.918   -3.887  -0.348  1.00   9.68   ? 124  ASP F O   1 
ATOM   5665 C  CB  . ASP F 3 38  ? 10.668  -1.559  -0.330  1.00   12.05  ? 124  ASP F CB  1 
ATOM   5666 C  CG  . ASP F 3 38  ? 10.896  -1.429  -1.838  1.00   14.30  ? 124  ASP F CG  1 
ATOM   5667 O  OD1 . ASP F 3 38  ? 9.989   -1.732  -2.639  1.00   14.33  ? 124  ASP F OD1 1 
ATOM   5668 O  OD2 . ASP F 3 38  ? 12.014  -1.031  -2.215  1.00   15.33  ? 124  ASP F OD2 1 
ATOM   5669 N  N   . THR F 3 39  ? 7.310   -2.551  -1.130  1.00   11.02  ? 125  THR F N   1 
ATOM   5670 C  CA  . THR F 3 39  ? 6.510   -3.651  -1.667  1.00   11.98  ? 125  THR F CA  1 
ATOM   5671 C  C   . THR F 3 39  ? 7.180   -4.389  -2.829  1.00   12.94  ? 125  THR F C   1 
ATOM   5672 O  O   . THR F 3 39  ? 6.813   -5.525  -3.149  1.00   13.75  ? 125  THR F O   1 
ATOM   5673 C  CB  . THR F 3 39  ? 5.091   -3.189  -2.082  1.00   12.07  ? 125  THR F CB  1 
ATOM   5674 O  OG1 . THR F 3 39  ? 5.164   -2.325  -3.223  1.00   13.33  ? 125  THR F OG1 1 
ATOM   5675 C  CG2 . THR F 3 39  ? 4.421   -2.446  -0.939  1.00   11.75  ? 125  THR F CG2 1 
ATOM   5676 N  N   . SER F 3 40  ? 8.165   -3.762  -3.459  1.00   13.00  ? 126  SER F N   1 
ATOM   5677 C  CA  . SER F 3 40  ? 8.857   -4.426  -4.557  1.00   14.14  ? 126  SER F CA  1 
ATOM   5678 C  C   . SER F 3 40  ? 9.877   -5.477  -4.092  1.00   14.56  ? 126  SER F C   1 
ATOM   5679 O  O   . SER F 3 40  ? 10.145  -6.440  -4.810  1.00   14.58  ? 126  SER F O   1 
ATOM   5680 C  CB  . SER F 3 40  ? 9.491   -3.404  -5.497  1.00   14.49  ? 126  SER F CB  1 
ATOM   5681 O  OG  A SER F 3 40  ? 8.473   -2.732  -6.224  0.50   14.88  ? 126  SER F OG  1 
ATOM   5682 O  OG  B SER F 3 40  ? 10.696  -2.886  -4.957  0.50   14.24  ? 126  SER F OG  1 
ATOM   5683 N  N   . THR F 3 41  ? 10.427  -5.292  -2.892  1.00   14.17  ? 127  THR F N   1 
ATOM   5684 C  CA  . THR F 3 41  ? 11.436  -6.202  -2.353  1.00   14.10  ? 127  THR F CA  1 
ATOM   5685 C  C   . THR F 3 41  ? 10.908  -6.997  -1.154  1.00   13.09  ? 127  THR F C   1 
ATOM   5686 O  O   . THR F 3 41  ? 11.449  -8.052  -0.808  1.00   11.86  ? 127  THR F O   1 
ATOM   5687 C  CB  . THR F 3 41  ? 12.688  -5.436  -1.897  1.00   14.65  ? 127  THR F CB  1 
ATOM   5688 O  OG1 . THR F 3 41  ? 12.370  -4.655  -0.732  1.00   14.85  ? 127  THR F OG1 1 
ATOM   5689 C  CG2 . THR F 3 41  ? 13.178  -4.518  -3.002  1.00   14.23  ? 127  THR F CG2 1 
ATOM   5690 N  N   . GLY F 3 42  ? 9.854   -6.489  -0.527  1.00   11.79  ? 128  GLY F N   1 
ATOM   5691 C  CA  . GLY F 3 42  ? 9.274   -7.143  0.647   1.00   11.70  ? 128  GLY F CA  1 
ATOM   5692 C  C   . GLY F 3 42  ? 10.002  -6.810  1.936   1.00   12.22  ? 128  GLY F C   1 
ATOM   5693 O  O   . GLY F 3 42  ? 9.835   -7.493  2.956   1.00   13.62  ? 128  GLY F O   1 
ATOM   5694 N  N   . LYS F 3 43  ? 10.810  -5.755  1.912   1.00   12.07  ? 129  LYS F N   1 
ATOM   5695 C  CA  . LYS F 3 43  ? 11.612  -5.417  3.084   1.00   12.40  ? 129  LYS F CA  1 
ATOM   5696 C  C   . LYS F 3 43  ? 11.318  -4.027  3.656   1.00   12.03  ? 129  LYS F C   1 
ATOM   5697 O  O   . LYS F 3 43  ? 11.150  -3.061  2.916   1.00   10.84  ? 129  LYS F O   1 
ATOM   5698 C  CB  . LYS F 3 43  ? 13.111  -5.530  2.766   1.00   13.07  ? 129  LYS F CB  1 
ATOM   5699 C  CG  . LYS F 3 43  ? 13.582  -6.915  2.369   1.00   13.66  ? 129  LYS F CG  1 
ATOM   5700 C  CD  . LYS F 3 43  ? 15.078  -6.910  2.062   1.00   14.82  ? 129  LYS F CD  1 
ATOM   5701 C  CE  . LYS F 3 43  ? 15.595  -8.324  1.736   1.00   15.52  ? 129  LYS F CE  1 
ATOM   5702 N  NZ  . LYS F 3 43  ? 17.095  -8.343  1.688   1.00   16.77  ? 129  LYS F NZ  1 
ATOM   5703 N  N   . PHE F 3 44  ? 11.265  -3.950  4.985   1.00   12.35  ? 130  PHE F N   1 
ATOM   5704 C  CA  . PHE F 3 44  ? 11.318  -2.677  5.690   1.00   11.99  ? 130  PHE F CA  1 
ATOM   5705 C  C   . PHE F 3 44  ? 12.772  -2.232  5.756   1.00   12.02  ? 130  PHE F C   1 
ATOM   5706 O  O   . PHE F 3 44  ? 13.665  -3.033  6.063   1.00   11.51  ? 130  PHE F O   1 
ATOM   5707 C  CB  . PHE F 3 44  ? 10.773  -2.828  7.109   1.00   12.47  ? 130  PHE F CB  1 
ATOM   5708 C  CG  . PHE F 3 44  ? 11.050  -1.644  8.000   1.00   13.77  ? 130  PHE F CG  1 
ATOM   5709 C  CD1 . PHE F 3 44  ? 10.122  -0.612  8.114   1.00   14.14  ? 130  PHE F CD1 1 
ATOM   5710 C  CD2 . PHE F 3 44  ? 12.229  -1.563  8.729   1.00   14.46  ? 130  PHE F CD2 1 
ATOM   5711 C  CE1 . PHE F 3 44  ? 10.365  0.476   8.927   1.00   13.69  ? 130  PHE F CE1 1 
ATOM   5712 C  CE2 . PHE F 3 44  ? 12.479  -0.475  9.550   1.00   13.74  ? 130  PHE F CE2 1 
ATOM   5713 C  CZ  . PHE F 3 44  ? 11.545  0.546   9.647   1.00   13.69  ? 130  PHE F CZ  1 
ATOM   5714 N  N   . THR F 3 45  ? 13.020  -0.961  5.464   1.00   11.35  ? 131  THR F N   1 
ATOM   5715 C  CA  . THR F 3 45  ? 14.349  -0.404  5.688   1.00   11.51  ? 131  THR F CA  1 
ATOM   5716 C  C   . THR F 3 45  ? 14.295  0.829   6.591   1.00   11.03  ? 131  THR F C   1 
ATOM   5717 O  O   . THR F 3 45  ? 13.548  1.775   6.342   1.00   10.04  ? 131  THR F O   1 
ATOM   5718 C  CB  . THR F 3 45  ? 15.075  -0.075  4.365   1.00   11.81  ? 131  THR F CB  1 
ATOM   5719 O  OG1 . THR F 3 45  ? 15.159  -1.261  3.559   1.00   12.84  ? 131  THR F OG1 1 
ATOM   5720 C  CG2 . THR F 3 45  ? 16.483  0.436   4.644   1.00   12.12  ? 131  THR F CG2 1 
ATOM   5721 N  N   . CYS F 3 46  ? 15.092  0.806   7.650   1.00   11.42  ? 132  CYS F N   1 
ATOM   5722 C  CA  . CYS F 3 46  ? 15.072  1.878   8.629   1.00   11.49  ? 132  CYS F CA  1 
ATOM   5723 C  C   . CYS F 3 46  ? 15.635  3.181   8.051   1.00   11.53  ? 132  CYS F C   1 
ATOM   5724 O  O   . CYS F 3 46  ? 16.763  3.195   7.577   1.00   11.54  ? 132  CYS F O   1 
ATOM   5725 C  CB  . CYS F 3 46  ? 15.852  1.440   9.869   1.00   11.96  ? 132  CYS F CB  1 
ATOM   5726 S  SG  . CYS F 3 46  ? 15.933  2.669   11.194  1.00   13.02  ? 132  CYS F SG  1 
ATOM   5727 N  N   . LYS F 3 47  ? 14.826  4.250   8.061   1.00   11.95  ? 133  LYS F N   1 
ATOM   5728 C  CA  . LYS F 3 47  ? 15.279  5.602   7.702   1.00   12.69  ? 133  LYS F CA  1 
ATOM   5729 C  C   . LYS F 3 47  ? 15.569  6.401   8.961   1.00   12.72  ? 133  LYS F C   1 
ATOM   5730 O  O   . LYS F 3 47  ? 16.531  7.156   9.020   1.00   12.94  ? 133  LYS F O   1 
ATOM   5731 C  CB  . LYS F 3 47  ? 14.223  6.374   6.887   1.00   12.51  ? 133  LYS F CB  1 
ATOM   5732 C  CG  . LYS F 3 47  ? 13.988  5.885   5.441   1.00   14.86  ? 133  LYS F CG  1 
ATOM   5733 C  CD  . LYS F 3 47  ? 13.174  6.931   4.652   1.00   13.81  ? 133  LYS F CD  1 
ATOM   5734 C  CE  . LYS F 3 47  ? 12.856  6.495   3.228   1.00   15.20  ? 133  LYS F CE  1 
ATOM   5735 N  NZ  . LYS F 3 47  ? 11.817  5.414   3.144   1.00   13.64  ? 133  LYS F NZ  1 
ATOM   5736 N  N   . VAL F 3 48  ? 14.698  6.259   9.954   1.00   13.02  ? 134  VAL F N   1 
ATOM   5737 C  CA  . VAL F 3 48  ? 14.845  6.966   11.216  1.00   12.82  ? 134  VAL F CA  1 
ATOM   5738 C  C   . VAL F 3 48  ? 15.207  5.974   12.319  1.00   12.78  ? 134  VAL F C   1 
ATOM   5739 O  O   . VAL F 3 48  ? 14.415  5.098   12.656  1.00   13.49  ? 134  VAL F O   1 
ATOM   5740 C  CB  . VAL F 3 48  ? 13.535  7.689   11.607  1.00   13.08  ? 134  VAL F CB  1 
ATOM   5741 C  CG1 . VAL F 3 48  ? 13.731  8.495   12.878  1.00   13.03  ? 134  VAL F CG1 1 
ATOM   5742 C  CG2 . VAL F 3 48  ? 13.063  8.583   10.467  1.00   13.04  ? 134  VAL F CG2 1 
ATOM   5743 N  N   . PRO F 3 49  ? 16.397  6.127   12.910  1.00   12.72  ? 135  PRO F N   1 
ATOM   5744 C  CA  . PRO F 3 49  ? 16.824  5.162   13.904  1.00   12.76  ? 135  PRO F CA  1 
ATOM   5745 C  C   . PRO F 3 49  ? 16.006  5.302   15.188  1.00   12.81  ? 135  PRO F C   1 
ATOM   5746 O  O   . PRO F 3 49  ? 15.494  6.385   15.476  1.00   12.88  ? 135  PRO F O   1 
ATOM   5747 C  CB  . PRO F 3 49  ? 18.283  5.535   14.142  1.00   12.30  ? 135  PRO F CB  1 
ATOM   5748 C  CG  . PRO F 3 49  ? 18.360  6.981   13.821  1.00   12.28  ? 135  PRO F CG  1 
ATOM   5749 C  CD  . PRO F 3 49  ? 17.374  7.216   12.727  1.00   12.79  ? 135  PRO F CD  1 
ATOM   5750 N  N   . GLY F 3 50  ? 15.867  4.203   15.923  1.00   12.35  ? 136  GLY F N   1 
ATOM   5751 C  CA  . GLY F 3 50  ? 15.152  4.206   17.202  1.00   12.87  ? 136  GLY F CA  1 
ATOM   5752 C  C   . GLY F 3 50  ? 14.458  2.890   17.512  1.00   12.79  ? 136  GLY F C   1 
ATOM   5753 O  O   . GLY F 3 50  ? 14.743  1.859   16.896  1.00   12.20  ? 136  GLY F O   1 
ATOM   5754 N  N   . LEU F 3 51  ? 13.544  2.930   18.476  1.00   13.06  ? 137  LEU F N   1 
ATOM   5755 C  CA  . LEU F 3 51  ? 12.839  1.737   18.900  1.00   13.15  ? 137  LEU F CA  1 
ATOM   5756 C  C   . LEU F 3 51  ? 11.558  1.538   18.118  1.00   12.59  ? 137  LEU F C   1 
ATOM   5757 O  O   . LEU F 3 51  ? 10.706  2.427   18.067  1.00   12.55  ? 137  LEU F O   1 
ATOM   5758 C  CB  . LEU F 3 51  ? 12.488  1.786   20.389  1.00   14.08  ? 137  LEU F CB  1 
ATOM   5759 C  CG  . LEU F 3 51  ? 11.801  0.457   20.708  1.00   14.83  ? 137  LEU F CG  1 
ATOM   5760 C  CD1 . LEU F 3 51  ? 12.795  -0.525  21.322  1.00   14.95  ? 137  LEU F CD1 1 
ATOM   5761 C  CD2 . LEU F 3 51  ? 10.546  0.606   21.552  1.00   15.57  ? 137  LEU F CD2 1 
ATOM   5762 N  N   . TYR F 3 52  ? 11.418  0.347   17.551  1.00   11.78  ? 138  TYR F N   1 
ATOM   5763 C  CA  . TYR F 3 52  ? 10.296  0.002   16.694  1.00   11.61  ? 138  TYR F CA  1 
ATOM   5764 C  C   . TYR F 3 52  ? 9.524   -1.181  17.246  1.00   10.82  ? 138  TYR F C   1 
ATOM   5765 O  O   . TYR F 3 52  ? 10.095  -2.070  17.868  1.00   10.41  ? 138  TYR F O   1 
ATOM   5766 C  CB  . TYR F 3 52  ? 10.811  -0.389  15.303  1.00   11.69  ? 138  TYR F CB  1 
ATOM   5767 C  CG  . TYR F 3 52  ? 11.166  0.776   14.420  1.00   11.31  ? 138  TYR F CG  1 
ATOM   5768 C  CD1 . TYR F 3 52  ? 12.390  1.439   14.559  1.00   12.42  ? 138  TYR F CD1 1 
ATOM   5769 C  CD2 . TYR F 3 52  ? 10.285  1.216   13.445  1.00   10.70  ? 138  TYR F CD2 1 
ATOM   5770 C  CE1 . TYR F 3 52  ? 12.716  2.513   13.748  1.00   11.98  ? 138  TYR F CE1 1 
ATOM   5771 C  CE2 . TYR F 3 52  ? 10.593  2.284   12.635  1.00   11.32  ? 138  TYR F CE2 1 
ATOM   5772 C  CZ  . TYR F 3 52  ? 11.810  2.932   12.785  1.00   12.60  ? 138  TYR F CZ  1 
ATOM   5773 O  OH  . TYR F 3 52  ? 12.112  3.998   11.955  1.00   13.34  ? 138  TYR F OH  1 
ATOM   5774 N  N   . TYR F 3 53  ? 8.225   -1.201  16.986  1.00   10.81  ? 139  TYR F N   1 
ATOM   5775 C  CA  . TYR F 3 53  ? 7.424   -2.388  17.206  1.00   9.55   ? 139  TYR F CA  1 
ATOM   5776 C  C   . TYR F 3 53  ? 7.005   -2.975  15.852  1.00   10.14  ? 139  TYR F C   1 
ATOM   5777 O  O   . TYR F 3 53  ? 6.534   -2.257  14.966  1.00   10.05  ? 139  TYR F O   1 
ATOM   5778 C  CB  . TYR F 3 53  ? 6.212   -2.042  18.058  1.00   9.43   ? 139  TYR F CB  1 
ATOM   5779 C  CG  . TYR F 3 53  ? 5.286   -3.204  18.362  1.00   9.95   ? 139  TYR F CG  1 
ATOM   5780 C  CD1 . TYR F 3 53  ? 5.761   -4.382  18.919  1.00   8.57   ? 139  TYR F CD1 1 
ATOM   5781 C  CD2 . TYR F 3 53  ? 3.918   -3.094  18.128  1.00   11.04  ? 139  TYR F CD2 1 
ATOM   5782 C  CE1 . TYR F 3 53  ? 4.890   -5.441  19.197  1.00   11.40  ? 139  TYR F CE1 1 
ATOM   5783 C  CE2 . TYR F 3 53  ? 3.043   -4.128  18.417  1.00   10.62  ? 139  TYR F CE2 1 
ATOM   5784 C  CZ  . TYR F 3 53  ? 3.529   -5.296  18.945  1.00   10.69  ? 139  TYR F CZ  1 
ATOM   5785 O  OH  . TYR F 3 53  ? 2.640   -6.318  19.215  1.00   11.25  ? 139  TYR F OH  1 
ATOM   5786 N  N   . PHE F 3 54  ? 7.229   -4.275  15.690  1.00   9.69   ? 140  PHE F N   1 
ATOM   5787 C  CA  . PHE F 3 54  ? 6.794   -5.017  14.517  1.00   9.31   ? 140  PHE F CA  1 
ATOM   5788 C  C   . PHE F 3 54  ? 5.820   -6.101  14.963  1.00   9.23   ? 140  PHE F C   1 
ATOM   5789 O  O   . PHE F 3 54  ? 6.018   -6.743  15.990  1.00   10.74  ? 140  PHE F O   1 
ATOM   5790 C  CB  . PHE F 3 54  ? 7.991   -5.653  13.799  1.00   9.62   ? 140  PHE F CB  1 
ATOM   5791 C  CG  . PHE F 3 54  ? 8.996   -4.658  13.309  1.00   10.36  ? 140  PHE F CG  1 
ATOM   5792 C  CD1 . PHE F 3 54  ? 10.145  -4.394  14.046  1.00   9.33   ? 140  PHE F CD1 1 
ATOM   5793 C  CD2 . PHE F 3 54  ? 8.799   -3.988  12.109  1.00   9.08   ? 140  PHE F CD2 1 
ATOM   5794 C  CE1 . PHE F 3 54  ? 11.069  -3.480  13.602  1.00   9.17   ? 140  PHE F CE1 1 
ATOM   5795 C  CE2 . PHE F 3 54  ? 9.720   -3.061  11.655  1.00   9.97   ? 140  PHE F CE2 1 
ATOM   5796 C  CZ  . PHE F 3 54  ? 10.860  -2.801  12.404  1.00   9.11   ? 140  PHE F CZ  1 
ATOM   5797 N  N   . VAL F 3 55  ? 4.751   -6.286  14.205  1.00   8.55   ? 141  VAL F N   1 
ATOM   5798 C  CA  . VAL F 3 55  ? 3.738   -7.264  14.551  1.00   7.39   ? 141  VAL F CA  1 
ATOM   5799 C  C   . VAL F 3 55  ? 3.047   -7.715  13.265  1.00   6.82   ? 141  VAL F C   1 
ATOM   5800 O  O   . VAL F 3 55  ? 2.914   -6.939  12.326  1.00   6.70   ? 141  VAL F O   1 
ATOM   5801 C  CB  . VAL F 3 55  ? 2.738   -6.700  15.607  1.00   6.71   ? 141  VAL F CB  1 
ATOM   5802 C  CG1 . VAL F 3 55  ? 2.045   -5.446  15.100  1.00   8.78   ? 141  VAL F CG1 1 
ATOM   5803 C  CG2 . VAL F 3 55  ? 1.720   -7.748  16.031  1.00   8.93   ? 141  VAL F CG2 1 
ATOM   5804 N  N   . TYR F 3 56  ? 2.652   -8.982  13.203  1.00   6.24   ? 142  TYR F N   1 
ATOM   5805 C  CA  . TYR F 3 56  ? 1.934   -9.483  12.038  1.00   5.91   ? 142  TYR F CA  1 
ATOM   5806 C  C   . TYR F 3 56  ? 0.816   -10.404 12.491  1.00   5.99   ? 142  TYR F C   1 
ATOM   5807 O  O   . TYR F 3 56  ? 0.863   -10.967 13.588  1.00   4.18   ? 142  TYR F O   1 
ATOM   5808 C  CB  . TYR F 3 56  ? 2.866   -10.261 11.098  1.00   6.03   ? 142  TYR F CB  1 
ATOM   5809 C  CG  . TYR F 3 56  ? 3.265   -11.591 11.684  1.00   5.85   ? 142  TYR F CG  1 
ATOM   5810 C  CD1 . TYR F 3 56  ? 2.489   -12.731 11.492  1.00   6.15   ? 142  TYR F CD1 1 
ATOM   5811 C  CD2 . TYR F 3 56  ? 4.397   -11.698 12.466  1.00   6.32   ? 142  TYR F CD2 1 
ATOM   5812 C  CE1 . TYR F 3 56  ? 2.852   -13.949 12.074  1.00   5.60   ? 142  TYR F CE1 1 
ATOM   5813 C  CE2 . TYR F 3 56  ? 4.767   -12.896 13.035  1.00   5.90   ? 142  TYR F CE2 1 
ATOM   5814 C  CZ  . TYR F 3 56  ? 3.999   -14.010 12.846  1.00   6.03   ? 142  TYR F CZ  1 
ATOM   5815 O  OH  . TYR F 3 56  ? 4.411   -15.180 13.443  1.00   6.31   ? 142  TYR F OH  1 
ATOM   5816 N  N   . HIS F 3 57  ? -0.169  -10.563 11.613  1.00   6.10   ? 143  HIS F N   1 
ATOM   5817 C  CA  . HIS F 3 57  ? -1.304  -11.462 11.813  1.00   5.85   ? 143  HIS F CA  1 
ATOM   5818 C  C   . HIS F 3 57  ? -1.521  -12.137 10.464  1.00   6.20   ? 143  HIS F C   1 
ATOM   5819 O  O   . HIS F 3 57  ? -1.951  -11.486 9.522   1.00   6.40   ? 143  HIS F O   1 
ATOM   5820 C  CB  . HIS F 3 57  ? -2.548  -10.658 12.225  1.00   4.87   ? 143  HIS F CB  1 
ATOM   5821 C  CG  . HIS F 3 57  ? -2.413  -9.998  13.564  1.00   6.49   ? 143  HIS F CG  1 
ATOM   5822 N  ND1 . HIS F 3 57  ? -2.754  -10.632 14.741  1.00   4.78   ? 143  HIS F ND1 1 
ATOM   5823 C  CD2 . HIS F 3 57  ? -1.936  -8.780  13.917  1.00   5.70   ? 143  HIS F CD2 1 
ATOM   5824 C  CE1 . HIS F 3 57  ? -2.496  -9.832  15.760  1.00   6.35   ? 143  HIS F CE1 1 
ATOM   5825 N  NE2 . HIS F 3 57  ? -1.999  -8.703  15.287  1.00   6.67   ? 143  HIS F NE2 1 
ATOM   5826 N  N   . ALA F 3 58  ? -1.199  -13.424 10.368  1.00   6.30   ? 144  ALA F N   1 
ATOM   5827 C  CA  . ALA F 3 58  ? -1.222  -14.126 9.095   1.00   6.57   ? 144  ALA F CA  1 
ATOM   5828 C  C   . ALA F 3 58  ? -2.188  -15.308 9.102   1.00   7.23   ? 144  ALA F C   1 
ATOM   5829 O  O   . ALA F 3 58  ? -2.061  -16.224 9.923   1.00   6.66   ? 144  ALA F O   1 
ATOM   5830 C  CB  . ALA F 3 58  ? 0.182   -14.593 8.740   1.00   7.19   ? 144  ALA F CB  1 
ATOM   5831 N  N   . SER F 3 59  ? -3.159  -15.269 8.186   1.00   7.73   ? 145  SER F N   1 
ATOM   5832 C  CA  . SER F 3 59  ? -4.150  -16.336 8.033   1.00   8.00   ? 145  SER F CA  1 
ATOM   5833 C  C   . SER F 3 59  ? -3.618  -17.511 7.193   1.00   8.63   ? 145  SER F C   1 
ATOM   5834 O  O   . SER F 3 59  ? -2.923  -17.309 6.187   1.00   9.58   ? 145  SER F O   1 
ATOM   5835 C  CB  . SER F 3 59  ? -5.426  -15.777 7.392   1.00   8.09   ? 145  SER F CB  1 
ATOM   5836 O  OG  . SER F 3 59  ? -6.074  -14.829 8.232   1.00   7.60   ? 145  SER F OG  1 
ATOM   5837 N  N   . HIS F 3 60  ? -3.978  -18.731 7.586   1.00   8.71   ? 146  HIS F N   1 
ATOM   5838 C  CA  . HIS F 3 60  ? -3.485  -19.952 6.927   1.00   8.59   ? 146  HIS F CA  1 
ATOM   5839 C  C   . HIS F 3 60  ? -4.492  -21.095 7.056   1.00   8.65   ? 146  HIS F C   1 
ATOM   5840 O  O   . HIS F 3 60  ? -5.234  -21.138 8.024   1.00   8.32   ? 146  HIS F O   1 
ATOM   5841 C  CB  . HIS F 3 60  ? -2.107  -20.373 7.486   1.00   7.75   ? 146  HIS F CB  1 
ATOM   5842 C  CG  . HIS F 3 60  ? -2.104  -20.751 8.948   1.00   6.98   ? 146  HIS F CG  1 
ATOM   5843 N  ND1 . HIS F 3 60  ? -2.055  -19.820 9.967   1.00   8.93   ? 146  HIS F ND1 1 
ATOM   5844 C  CD2 . HIS F 3 60  ? -2.083  -21.962 9.555   1.00   6.61   ? 146  HIS F CD2 1 
ATOM   5845 C  CE1 . HIS F 3 60  ? -2.026  -20.439 11.136  1.00   5.30   ? 146  HIS F CE1 1 
ATOM   5846 N  NE2 . HIS F 3 60  ? -2.049  -21.739 10.914  1.00   6.44   ? 146  HIS F NE2 1 
ATOM   5847 N  N   . THR F 3 61  ? -4.525  -21.997 6.076   1.00   9.69   ? 147  THR F N   1 
ATOM   5848 C  CA  . THR F 3 61  ? -5.381  -23.196 6.136   1.00   11.18  ? 147  THR F CA  1 
ATOM   5849 C  C   . THR F 3 61  ? -4.580  -24.509 6.059   1.00   11.70  ? 147  THR F C   1 
ATOM   5850 O  O   . THR F 3 61  ? -5.152  -25.605 5.930   1.00   12.10  ? 147  THR F O   1 
ATOM   5851 C  CB  . THR F 3 61  ? -6.477  -23.198 5.042   1.00   11.44  ? 147  THR F CB  1 
ATOM   5852 O  OG1 . THR F 3 61  ? -5.911  -22.784 3.794   1.00   12.93  ? 147  THR F OG1 1 
ATOM   5853 C  CG2 . THR F 3 61  ? -7.631  -22.256 5.425   1.00   11.72  ? 147  THR F CG2 1 
ATOM   5854 N  N   . ALA F 3 62  ? -3.261  -24.376 6.135   1.00   11.95  ? 148  ALA F N   1 
ATOM   5855 C  CA  . ALA F 3 62  ? -2.333  -25.488 6.327   1.00   11.91  ? 148  ALA F CA  1 
ATOM   5856 C  C   . ALA F 3 62  ? -1.216  -24.947 7.203   1.00   11.90  ? 148  ALA F C   1 
ATOM   5857 O  O   . ALA F 3 62  ? -1.240  -23.774 7.583   1.00   12.07  ? 148  ALA F O   1 
ATOM   5858 C  CB  . ALA F 3 62  ? -1.774  -25.975 4.988   1.00   12.14  ? 148  ALA F CB  1 
ATOM   5859 N  N   . ASN F 3 63  ? -0.227  -25.777 7.507   1.00   11.55  ? 149  ASN F N   1 
ATOM   5860 C  CA  . ASN F 3 63  ? 0.824   -25.369 8.425   1.00   11.31  ? 149  ASN F CA  1 
ATOM   5861 C  C   . ASN F 3 63  ? 1.560   -24.111 7.943   1.00   11.09  ? 149  ASN F C   1 
ATOM   5862 O  O   . ASN F 3 63  ? 1.898   -23.970 6.755   1.00   9.94   ? 149  ASN F O   1 
ATOM   5863 C  CB  . ASN F 3 63  ? 1.813   -26.510 8.678   1.00   11.36  ? 149  ASN F CB  1 
ATOM   5864 C  CG  . ASN F 3 63  ? 1.190   -27.684 9.422   1.00   11.70  ? 149  ASN F CG  1 
ATOM   5865 O  OD1 . ASN F 3 63  ? 0.009   -27.665 9.775   1.00   11.74  ? 149  ASN F OD1 1 
ATOM   5866 N  ND2 . ASN F 3 63  ? 1.991   -28.720 9.661   1.00   10.59  ? 149  ASN F ND2 1 
ATOM   5867 N  N   . LEU F 3 64  ? 1.790   -23.191 8.877   1.00   9.70   ? 150  LEU F N   1 
ATOM   5868 C  CA  . LEU F 3 64  ? 2.502   -21.958 8.576   1.00   8.25   ? 150  LEU F CA  1 
ATOM   5869 C  C   . LEU F 3 64  ? 3.400   -21.589 9.744   1.00   8.27   ? 150  LEU F C   1 
ATOM   5870 O  O   . LEU F 3 64  ? 2.930   -21.503 10.882  1.00   8.13   ? 150  LEU F O   1 
ATOM   5871 C  CB  . LEU F 3 64  ? 1.517   -20.809 8.327   1.00   7.11   ? 150  LEU F CB  1 
ATOM   5872 C  CG  . LEU F 3 64  ? 2.130   -19.402 8.309   1.00   7.27   ? 150  LEU F CG  1 
ATOM   5873 C  CD1 . LEU F 3 64  ? 3.093   -19.234 7.119   1.00   7.11   ? 150  LEU F CD1 1 
ATOM   5874 C  CD2 . LEU F 3 64  ? 1.044   -18.326 8.284   1.00   8.07   ? 150  LEU F CD2 1 
ATOM   5875 N  N   . CYS F 3 65  ? 4.683   -21.396 9.452   1.00   8.73   ? 151  CYS F N   1 
ATOM   5876 C  CA  . CYS F 3 65  ? 5.632   -20.771 10.375  1.00   9.84   ? 151  CYS F CA  1 
ATOM   5877 C  C   . CYS F 3 65  ? 6.077   -19.461 9.760   1.00   9.62   ? 151  CYS F C   1 
ATOM   5878 O  O   . CYS F 3 65  ? 6.369   -19.394 8.575   1.00   9.41   ? 151  CYS F O   1 
ATOM   5879 C  CB  . CYS F 3 65  ? 6.879   -21.631 10.592  1.00   10.04  ? 151  CYS F CB  1 
ATOM   5880 S  SG  . CYS F 3 65  ? 6.583   -23.173 11.432  1.00   11.44  ? 151  CYS F SG  1 
ATOM   5881 N  N   . VAL F 3 66  ? 6.112   -18.416 10.570  1.00   10.36  ? 152  VAL F N   1 
ATOM   5882 C  CA  . VAL F 3 66  ? 6.595   -17.126 10.117  1.00   9.27   ? 152  VAL F CA  1 
ATOM   5883 C  C   . VAL F 3 66  ? 7.824   -16.764 10.933  1.00   10.65  ? 152  VAL F C   1 
ATOM   5884 O  O   . VAL F 3 66  ? 7.828   -16.855 12.176  1.00   9.82   ? 152  VAL F O   1 
ATOM   5885 C  CB  . VAL F 3 66  ? 5.533   -16.027 10.282  1.00   9.41   ? 152  VAL F CB  1 
ATOM   5886 C  CG1 . VAL F 3 66  ? 6.087   -14.663 9.824   1.00   7.92   ? 152  VAL F CG1 1 
ATOM   5887 C  CG2 . VAL F 3 66  ? 4.278   -16.380 9.524   1.00   6.99   ? 152  VAL F CG2 1 
ATOM   5888 N  N   . LEU F 3 67  ? 8.870   -16.383 10.216  1.00   10.78  ? 153  LEU F N   1 
ATOM   5889 C  CA  . LEU F 3 67  ? 10.113  -15.968 10.809  1.00   11.83  ? 153  LEU F CA  1 
ATOM   5890 C  C   . LEU F 3 67  ? 10.253  -14.468 10.614  1.00   11.72  ? 153  LEU F C   1 
ATOM   5891 O  O   . LEU F 3 67  ? 10.041  -13.974 9.511   1.00   11.49  ? 153  LEU F O   1 
ATOM   5892 C  CB  . LEU F 3 67  ? 11.264  -16.662 10.080  1.00   12.28  ? 153  LEU F CB  1 
ATOM   5893 C  CG  . LEU F 3 67  ? 11.474  -18.166 10.201  1.00   12.59  ? 153  LEU F CG  1 
ATOM   5894 C  CD1 . LEU F 3 67  ? 10.265  -18.959 9.734   1.00   12.86  ? 153  LEU F CD1 1 
ATOM   5895 C  CD2 . LEU F 3 67  ? 12.699  -18.542 9.402   1.00   13.54  ? 153  LEU F CD2 1 
ATOM   5896 N  N   . LEU F 3 68  ? 10.625  -13.739 11.661  1.00   11.66  ? 154  LEU F N   1 
ATOM   5897 C  CA  . LEU F 3 68  ? 10.995  -12.336 11.466  1.00   11.95  ? 154  LEU F CA  1 
ATOM   5898 C  C   . LEU F 3 68  ? 12.511  -12.194 11.441  1.00   11.82  ? 154  LEU F C   1 
ATOM   5899 O  O   . LEU F 3 68  ? 13.194  -12.693 12.334  1.00   11.17  ? 154  LEU F O   1 
ATOM   5900 C  CB  . LEU F 3 68  ? 10.399  -11.429 12.545  1.00   12.54  ? 154  LEU F CB  1 
ATOM   5901 C  CG  . LEU F 3 68  ? 10.799  -9.956  12.383  1.00   13.31  ? 154  LEU F CG  1 
ATOM   5902 C  CD1 . LEU F 3 68  ? 9.610   -9.020  12.642  1.00   14.43  ? 154  LEU F CD1 1 
ATOM   5903 C  CD2 . LEU F 3 68  ? 11.991  -9.592  13.273  1.00   14.52  ? 154  LEU F CD2 1 
ATOM   5904 N  N   . TYR F 3 69  ? 13.019  -11.513 10.415  1.00   11.42  ? 155  TYR F N   1 
ATOM   5905 C  CA  . TYR F 3 69  ? 14.452  -11.301 10.254  1.00   11.75  ? 155  TYR F CA  1 
ATOM   5906 C  C   . TYR F 3 69  ? 14.855  -9.841  10.486  1.00   11.82  ? 155  TYR F C   1 
ATOM   5907 O  O   . TYR F 3 69  ? 14.115  -8.914  10.152  1.00   10.87  ? 155  TYR F O   1 
ATOM   5908 C  CB  . TYR F 3 69  ? 14.915  -11.760 8.856   1.00   12.73  ? 155  TYR F CB  1 
ATOM   5909 C  CG  . TYR F 3 69  ? 15.164  -13.252 8.743   1.00   13.25  ? 155  TYR F CG  1 
ATOM   5910 C  CD1 . TYR F 3 69  ? 14.125  -14.134 8.468   1.00   12.73  ? 155  TYR F CD1 1 
ATOM   5911 C  CD2 . TYR F 3 69  ? 16.440  -13.780 8.917   1.00   14.50  ? 155  TYR F CD2 1 
ATOM   5912 C  CE1 . TYR F 3 69  ? 14.349  -15.498 8.372   1.00   13.20  ? 155  TYR F CE1 1 
ATOM   5913 C  CE2 . TYR F 3 69  ? 16.675  -15.152 8.815   1.00   13.60  ? 155  TYR F CE2 1 
ATOM   5914 C  CZ  . TYR F 3 69  ? 15.624  -16.000 8.553   1.00   13.56  ? 155  TYR F CZ  1 
ATOM   5915 O  OH  . TYR F 3 69  ? 15.843  -17.357 8.454   1.00   14.19  ? 155  TYR F OH  1 
ATOM   5916 N  N   . ARG F 3 70  ? 16.044  -9.649  11.050  1.00   11.94  ? 156  ARG F N   1 
ATOM   5917 C  CA  . ARG F 3 70  ? 16.612  -8.320  11.215  1.00   12.41  ? 156  ARG F CA  1 
ATOM   5918 C  C   . ARG F 3 70  ? 18.057  -8.342  10.730  1.00   12.85  ? 156  ARG F C   1 
ATOM   5919 O  O   . ARG F 3 70  ? 18.884  -9.051  11.291  1.00   12.93  ? 156  ARG F O   1 
ATOM   5920 C  CB  . ARG F 3 70  ? 16.559  -7.901  12.684  1.00   12.73  ? 156  ARG F CB  1 
ATOM   5921 C  CG  . ARG F 3 70  ? 17.049  -6.475  12.958  1.00   12.64  ? 156  ARG F CG  1 
ATOM   5922 C  CD  . ARG F 3 70  ? 17.589  -6.363  14.376  1.00   15.06  ? 156  ARG F CD  1 
ATOM   5923 N  NE  . ARG F 3 70  ? 18.442  -5.188  14.537  1.00   15.68  ? 156  ARG F NE  1 
ATOM   5924 C  CZ  . ARG F 3 70  ? 18.771  -4.654  15.710  1.00   16.05  ? 156  ARG F CZ  1 
ATOM   5925 N  NH1 . ARG F 3 70  ? 18.304  -5.185  16.838  1.00   14.99  ? 156  ARG F NH1 1 
ATOM   5926 N  NH2 . ARG F 3 70  ? 19.555  -3.576  15.750  1.00   14.28  ? 156  ARG F NH2 1 
ATOM   5927 N  N   . SER F 3 71  ? 18.349  -7.584  9.676   1.00   13.19  ? 157  SER F N   1 
ATOM   5928 C  CA  . SER F 3 71  ? 19.701  -7.500  9.135   1.00   13.39  ? 157  SER F CA  1 
ATOM   5929 C  C   . SER F 3 71  ? 20.350  -8.873  8.968   1.00   13.83  ? 157  SER F C   1 
ATOM   5930 O  O   . SER F 3 71  ? 21.518  -9.054  9.330   1.00   13.41  ? 157  SER F O   1 
ATOM   5931 C  CB  . SER F 3 71  ? 20.587  -6.628  10.040  1.00   13.67  ? 157  SER F CB  1 
ATOM   5932 O  OG  . SER F 3 71  ? 20.145  -5.286  10.045  1.00   13.39  ? 157  SER F OG  1 
ATOM   5933 N  N   . GLY F 3 72  ? 19.589  -9.835  8.444   1.00   14.05  ? 158  GLY F N   1 
ATOM   5934 C  CA  . GLY F 3 72  ? 20.113  -11.170 8.124   1.00   13.93  ? 158  GLY F CA  1 
ATOM   5935 C  C   . GLY F 3 72  ? 20.021  -12.215 9.226   1.00   14.72  ? 158  GLY F C   1 
ATOM   5936 O  O   . GLY F 3 72  ? 20.352  -13.384 9.010   1.00   15.16  ? 158  GLY F O   1 
ATOM   5937 N  N   . VAL F 3 73  ? 19.577  -11.797 10.407  1.00   13.96  ? 159  VAL F N   1 
ATOM   5938 C  CA  . VAL F 3 73  ? 19.505  -12.669 11.575  1.00   14.09  ? 159  VAL F CA  1 
ATOM   5939 C  C   . VAL F 3 73  ? 18.058  -12.971 11.980  1.00   13.84  ? 159  VAL F C   1 
ATOM   5940 O  O   . VAL F 3 73  ? 17.247  -12.058 12.119  1.00   12.50  ? 159  VAL F O   1 
ATOM   5941 C  CB  . VAL F 3 73  ? 20.225  -12.017 12.771  1.00   14.18  ? 159  VAL F CB  1 
ATOM   5942 C  CG1 . VAL F 3 73  ? 20.078  -12.872 14.033  1.00   14.36  ? 159  VAL F CG1 1 
ATOM   5943 C  CG2 . VAL F 3 73  ? 21.695  -11.785 12.435  1.00   15.04  ? 159  VAL F CG2 1 
ATOM   5944 N  N   . LYS F 3 74  ? 17.747  -14.253 12.166  1.00   14.16  ? 160  LYS F N   1 
ATOM   5945 C  CA  . LYS F 3 74  ? 16.422  -14.685 12.594  1.00   14.37  ? 160  LYS F CA  1 
ATOM   5946 C  C   . LYS F 3 74  ? 16.187  -14.289 14.045  1.00   14.56  ? 160  LYS F C   1 
ATOM   5947 O  O   . LYS F 3 74  ? 16.947  -14.669 14.944  1.00   14.89  ? 160  LYS F O   1 
ATOM   5948 C  CB  . LYS F 3 74  ? 16.270  -16.201 12.429  1.00   15.31  ? 160  LYS F CB  1 
ATOM   5949 C  CG  . LYS F 3 74  ? 14.871  -16.726 12.719  1.00   15.70  ? 160  LYS F CG  1 
ATOM   5950 C  CD  . LYS F 3 74  ? 14.731  -18.223 12.379  1.00   17.34  ? 160  LYS F CD  1 
ATOM   5951 C  CE  . LYS F 3 74  ? 15.735  -19.084 13.132  1.00   18.14  ? 160  LYS F CE  1 
ATOM   5952 N  NZ  . LYS F 3 74  ? 15.537  -20.539 12.853  1.00   20.43  ? 160  LYS F NZ  1 
ATOM   5953 N  N   . VAL F 3 75  ? 15.135  -13.515 14.275  1.00   14.09  ? 161  VAL F N   1 
ATOM   5954 C  CA  . VAL F 3 75  ? 14.887  -12.973 15.595  1.00   13.44  ? 161  VAL F CA  1 
ATOM   5955 C  C   . VAL F 3 75  ? 13.895  -13.813 16.390  1.00   13.30  ? 161  VAL F C   1 
ATOM   5956 O  O   . VAL F 3 75  ? 14.164  -14.170 17.546  1.00   12.27  ? 161  VAL F O   1 
ATOM   5957 C  CB  . VAL F 3 75  ? 14.369  -11.526 15.534  1.00   13.75  ? 161  VAL F CB  1 
ATOM   5958 C  CG1 . VAL F 3 75  ? 14.016  -11.048 16.951  1.00   13.73  ? 161  VAL F CG1 1 
ATOM   5959 C  CG2 . VAL F 3 75  ? 15.421  -10.618 14.913  1.00   14.12  ? 161  VAL F CG2 1 
ATOM   5960 N  N   . VAL F 3 76  ? 12.744  -14.094 15.777  1.00   12.14  ? 162  VAL F N   1 
ATOM   5961 C  CA  . VAL F 3 76  ? 11.698  -14.909 16.396  1.00   12.29  ? 162  VAL F CA  1 
ATOM   5962 C  C   . VAL F 3 76  ? 10.967  -15.761 15.353  1.00   12.05  ? 162  VAL F C   1 
ATOM   5963 O  O   . VAL F 3 76  ? 10.882  -15.379 14.194  1.00   12.32  ? 162  VAL F O   1 
ATOM   5964 C  CB  . VAL F 3 76  ? 10.671  -14.044 17.165  1.00   12.59  ? 162  VAL F CB  1 
ATOM   5965 C  CG1 . VAL F 3 76  ? 11.260  -13.546 18.502  1.00   14.25  ? 162  VAL F CG1 1 
ATOM   5966 C  CG2 . VAL F 3 76  ? 10.188  -12.866 16.311  1.00   12.39  ? 162  VAL F CG2 1 
ATOM   5967 N  N   . THR F 3 77  ? 10.448  -16.912 15.775  1.00   11.91  ? 163  THR F N   1 
ATOM   5968 C  CA  . THR F 3 77  ? 9.645   -17.782 14.912  1.00   12.35  ? 163  THR F CA  1 
ATOM   5969 C  C   . THR F 3 77  ? 8.406   -18.257 15.666  1.00   11.53  ? 163  THR F C   1 
ATOM   5970 O  O   . THR F 3 77  ? 8.482   -18.644 16.837  1.00   11.96  ? 163  THR F O   1 
ATOM   5971 C  CB  . THR F 3 77  ? 10.424  -19.040 14.454  1.00   12.64  ? 163  THR F CB  1 
ATOM   5972 O  OG1 . THR F 3 77  ? 11.695  -18.664 13.915  1.00   14.14  ? 163  THR F OG1 1 
ATOM   5973 C  CG2 . THR F 3 77  ? 9.639   -19.824 13.405  1.00   13.16  ? 163  THR F CG2 1 
ATOM   5974 N  N   . PHE F 3 78  ? 7.264   -18.220 14.992  1.00   10.33  ? 164  PHE F N   1 
ATOM   5975 C  CA  . PHE F 3 78  ? 6.005   -18.667 15.570  1.00   9.10   ? 164  PHE F CA  1 
ATOM   5976 C  C   . PHE F 3 78  ? 5.297   -19.557 14.547  1.00   9.45   ? 164  PHE F C   1 
ATOM   5977 O  O   . PHE F 3 78  ? 5.166   -19.181 13.380  1.00   8.12   ? 164  PHE F O   1 
ATOM   5978 C  CB  . PHE F 3 78  ? 5.125   -17.462 15.935  1.00   8.73   ? 164  PHE F CB  1 
ATOM   5979 C  CG  . PHE F 3 78  ? 5.791   -16.477 16.858  1.00   8.18   ? 164  PHE F CG  1 
ATOM   5980 C  CD1 . PHE F 3 78  ? 6.429   -15.355 16.353  1.00   6.65   ? 164  PHE F CD1 1 
ATOM   5981 C  CD2 . PHE F 3 78  ? 5.777   -16.676 18.241  1.00   9.85   ? 164  PHE F CD2 1 
ATOM   5982 C  CE1 . PHE F 3 78  ? 7.040   -14.446 17.189  1.00   8.80   ? 164  PHE F CE1 1 
ATOM   5983 C  CE2 . PHE F 3 78  ? 6.401   -15.758 19.099  1.00   8.88   ? 164  PHE F CE2 1 
ATOM   5984 C  CZ  . PHE F 3 78  ? 7.032   -14.648 18.568  1.00   8.05   ? 164  PHE F CZ  1 
ATOM   5985 N  N   . CYS F 3 79  ? 4.846   -20.728 14.989  1.00   10.05  ? 165  CYS F N   1 
ATOM   5986 C  CA  . CYS F 3 79  ? 4.227   -21.698 14.098  1.00   11.44  ? 165  CYS F CA  1 
ATOM   5987 C  C   . CYS F 3 79  ? 2.807   -22.029 14.505  1.00   11.54  ? 165  CYS F C   1 
ATOM   5988 O  O   . CYS F 3 79  ? 2.489   -22.113 15.685  1.00   12.88  ? 165  CYS F O   1 
ATOM   5989 C  CB  . CYS F 3 79  ? 5.054   -22.982 14.033  1.00   11.25  ? 165  CYS F CB  1 
ATOM   5990 S  SG  . CYS F 3 79  ? 6.731   -22.731 13.406  1.00   14.00  ? 165  CYS F SG  1 
ATOM   5991 N  N   . GLY F 3 80  ? 1.958   -22.218 13.509  1.00   11.34  ? 166  GLY F N   1 
ATOM   5992 C  CA  . GLY F 3 80  ? 0.585   -22.653 13.728  1.00   11.98  ? 166  GLY F CA  1 
ATOM   5993 C  C   . GLY F 3 80  ? 0.288   -23.819 12.807  1.00   12.63  ? 166  GLY F C   1 
ATOM   5994 O  O   . GLY F 3 80  ? 0.606   -23.772 11.618  1.00   11.97  ? 166  GLY F O   1 
ATOM   5995 N  N   . HIS F 3 81  ? -0.295  -24.879 13.358  1.00   12.89  ? 167  HIS F N   1 
ATOM   5996 C  CA  . HIS F 3 81  ? -0.639  -26.036 12.552  1.00   14.83  ? 167  HIS F CA  1 
ATOM   5997 C  C   . HIS F 3 81  ? -2.142  -26.173 12.429  1.00   15.22  ? 167  HIS F C   1 
ATOM   5998 O  O   . HIS F 3 81  ? -2.865  -26.056 13.412  1.00   15.07  ? 167  HIS F O   1 
ATOM   5999 C  CB  . HIS F 3 81  ? -0.035  -27.316 13.137  1.00   15.14  ? 167  HIS F CB  1 
ATOM   6000 C  CG  . HIS F 3 81  ? 1.460   -27.349 13.087  1.00   16.22  ? 167  HIS F CG  1 
ATOM   6001 N  ND1 . HIS F 3 81  ? 2.182   -28.518 13.158  1.00   16.03  ? 167  HIS F ND1 1 
ATOM   6002 C  CD2 . HIS F 3 81  ? 2.368   -26.353 12.954  1.00   16.25  ? 167  HIS F CD2 1 
ATOM   6003 C  CE1 . HIS F 3 81  ? 3.471   -28.240 13.088  1.00   16.81  ? 167  HIS F CE1 1 
ATOM   6004 N  NE2 . HIS F 3 81  ? 3.611   -26.934 12.959  1.00   15.86  ? 167  HIS F NE2 1 
ATOM   6005 N  N   . THR F 3 82  ? -2.600  -26.423 11.209  1.00   16.10  ? 168  THR F N   1 
ATOM   6006 C  CA  . THR F 3 82  ? -4.010  -26.635 10.953  1.00   17.58  ? 168  THR F CA  1 
ATOM   6007 C  C   . THR F 3 82  ? -4.180  -27.507 9.720   1.00   18.54  ? 168  THR F C   1 
ATOM   6008 O  O   . THR F 3 82  ? -3.261  -27.633 8.902   1.00   18.26  ? 168  THR F O   1 
ATOM   6009 C  CB  . THR F 3 82  ? -4.735  -25.313 10.720  1.00   17.68  ? 168  THR F CB  1 
ATOM   6010 O  OG1 . THR F 3 82  ? -6.150  -25.533 10.764  1.00   19.40  ? 168  THR F OG1 1 
ATOM   6011 C  CG2 . THR F 3 82  ? -4.365  -24.743 9.366   1.00   18.08  ? 168  THR F CG2 1 
ATOM   6012 N  N   . SER F 3 83  ? -5.358  -28.108 9.596   1.00   19.69  ? 169  SER F N   1 
ATOM   6013 C  CA  . SER F 3 83  ? -5.696  -28.906 8.433   1.00   20.88  ? 169  SER F CA  1 
ATOM   6014 C  C   . SER F 3 83  ? -7.082  -28.504 7.949   1.00   20.90  ? 169  SER F C   1 
ATOM   6015 O  O   . SER F 3 83  ? -8.084  -28.708 8.645   1.00   21.15  ? 169  SER F O   1 
ATOM   6016 C  CB  . SER F 3 83  ? -5.656  -30.398 8.781   1.00   22.05  ? 169  SER F CB  1 
ATOM   6017 O  OG  . SER F 3 83  ? -5.673  -31.197 7.609   1.00   24.15  ? 169  SER F OG  1 
ATOM   6018 N  N   . LYS F 3 84  ? -7.119  -27.900 6.765   1.00   20.94  ? 170  LYS F N   1 
ATOM   6019 C  CA  . LYS F 3 84  ? -8.361  -27.490 6.108   1.00   20.60  ? 170  LYS F CA  1 
ATOM   6020 C  C   . LYS F 3 84  ? -8.938  -26.195 6.671   1.00   19.31  ? 170  LYS F C   1 
ATOM   6021 O  O   . LYS F 3 84  ? -9.291  -25.307 5.912   1.00   19.33  ? 170  LYS F O   1 
ATOM   6022 C  CB  . LYS F 3 84  ? -9.424  -28.598 6.161   1.00   21.21  ? 170  LYS F CB  1 
ATOM   6023 C  CG  . LYS F 3 84  ? -9.145  -29.808 5.284   1.00   23.42  ? 170  LYS F CG  1 
ATOM   6024 C  CD  . LYS F 3 84  ? -10.284 -30.835 5.396   1.00   25.03  ? 170  LYS F CD  1 
ATOM   6025 C  CE  . LYS F 3 84  ? -10.699 -31.049 6.856   1.00   24.97  ? 170  LYS F CE  1 
ATOM   6026 N  NZ  . LYS F 3 84  ? -11.680 -32.167 7.007   1.00   25.75  ? 170  LYS F NZ  1 
ATOM   6027 N  N   . THR F 3 85  ? -9.036  -26.103 7.996   1.00   17.35  ? 171  THR F N   1 
ATOM   6028 C  CA  . THR F 3 85  ? -9.709  -24.985 8.639   1.00   16.07  ? 171  THR F CA  1 
ATOM   6029 C  C   . THR F 3 85  ? -8.766  -23.794 8.893   1.00   14.41  ? 171  THR F C   1 
ATOM   6030 O  O   . THR F 3 85  ? -7.549  -23.958 8.971   1.00   14.92  ? 171  THR F O   1 
ATOM   6031 C  CB  . THR F 3 85  ? -10.408 -25.425 9.956   1.00   15.86  ? 171  THR F CB  1 
ATOM   6032 O  OG1 . THR F 3 85  ? -9.426  -25.925 10.860  1.00   16.28  ? 171  THR F OG1 1 
ATOM   6033 C  CG2 . THR F 3 85  ? -11.451 -26.522 9.694   1.00   17.25  ? 171  THR F CG2 1 
ATOM   6034 N  N   . ASN F 3 86  ? -9.348  -22.607 9.035   1.00   11.85  ? 172  ASN F N   1 
ATOM   6035 C  CA  . ASN F 3 86  ? -8.598  -21.352 9.075   1.00   10.36  ? 172  ASN F CA  1 
ATOM   6036 C  C   . ASN F 3 86  ? -8.242  -20.899 10.489  1.00   10.99  ? 172  ASN F C   1 
ATOM   6037 O  O   . ASN F 3 86  ? -9.098  -20.894 11.385  1.00   10.34  ? 172  ASN F O   1 
ATOM   6038 C  CB  . ASN F 3 86  ? -9.407  -20.256 8.355   1.00   9.50   ? 172  ASN F CB  1 
ATOM   6039 C  CG  . ASN F 3 86  ? -8.602  -18.982 8.087   1.00   9.44   ? 172  ASN F CG  1 
ATOM   6040 O  OD1 . ASN F 3 86  ? -8.168  -18.731 6.962   1.00   7.80   ? 172  ASN F OD1 1 
ATOM   6041 N  ND2 . ASN F 3 86  ? -8.436  -18.158 9.114   1.00   9.02   ? 172  ASN F ND2 1 
ATOM   6042 N  N   . GLN F 3 87  ? -6.975  -20.525 10.678  1.00   11.32  ? 173  GLN F N   1 
ATOM   6043 C  CA  . GLN F 3 87  ? -6.531  -19.878 11.911  1.00   11.71  ? 173  GLN F CA  1 
ATOM   6044 C  C   . GLN F 3 87  ? -5.613  -18.691 11.608  1.00   10.78  ? 173  GLN F C   1 
ATOM   6045 O  O   . GLN F 3 87  ? -5.265  -18.438 10.453  1.00   10.37  ? 173  GLN F O   1 
ATOM   6046 C  CB  . GLN F 3 87  ? -5.812  -20.873 12.819  1.00   13.30  ? 173  GLN F CB  1 
ATOM   6047 C  CG  . GLN F 3 87  ? -6.679  -22.004 13.287  1.00   17.58  ? 173  GLN F CG  1 
ATOM   6048 C  CD  . GLN F 3 87  ? -5.965  -22.904 14.253  1.00   19.28  ? 173  GLN F CD  1 
ATOM   6049 O  OE1 . GLN F 3 87  ? -4.965  -23.521 13.910  1.00   21.08  ? 173  GLN F OE1 1 
ATOM   6050 N  NE2 . GLN F 3 87  ? -6.471  -22.981 15.478  1.00   22.06  ? 173  GLN F NE2 1 
ATOM   6051 N  N   . VAL F 3 88  ? -5.225  -17.968 12.653  1.00   10.31  ? 174  VAL F N   1 
ATOM   6052 C  CA  . VAL F 3 88  ? -4.367  -16.796 12.496  1.00   9.99   ? 174  VAL F CA  1 
ATOM   6053 C  C   . VAL F 3 88  ? -3.067  -16.969 13.262  1.00   10.05  ? 174  VAL F C   1 
ATOM   6054 O  O   . VAL F 3 88  ? -3.063  -17.154 14.480  1.00   11.00  ? 174  VAL F O   1 
ATOM   6055 C  CB  . VAL F 3 88  ? -5.055  -15.501 12.967  1.00   9.77   ? 174  VAL F CB  1 
ATOM   6056 C  CG1 . VAL F 3 88  ? -4.110  -14.323 12.842  1.00   9.75   ? 174  VAL F CG1 1 
ATOM   6057 C  CG2 . VAL F 3 88  ? -6.329  -15.239 12.148  1.00   11.72  ? 174  VAL F CG2 1 
ATOM   6058 N  N   . ASN F 3 89  ? -1.965  -16.904 12.536  1.00   9.13   ? 175  ASN F N   1 
ATOM   6059 C  CA  . ASN F 3 89  ? -0.650  -16.970 13.136  1.00   9.74   ? 175  ASN F CA  1 
ATOM   6060 C  C   . ASN F 3 89  ? -0.221  -15.540 13.390  1.00   9.36   ? 175  ASN F C   1 
ATOM   6061 O  O   . ASN F 3 89  ? -0.276  -14.704 12.493  1.00   10.44  ? 175  ASN F O   1 
ATOM   6062 C  CB  . ASN F 3 89  ? 0.323   -17.700 12.203  1.00   8.76   ? 175  ASN F CB  1 
ATOM   6063 C  CG  . ASN F 3 89  ? 1.768   -17.702 12.715  1.00   9.80   ? 175  ASN F CG  1 
ATOM   6064 O  OD1 . ASN F 3 89  ? 2.197   -16.785 13.411  1.00   9.23   ? 175  ASN F OD1 1 
ATOM   6065 N  ND2 . ASN F 3 89  ? 2.533   -18.736 12.335  1.00   7.90   ? 175  ASN F ND2 1 
ATOM   6066 N  N   . SER F 3 90  ? 0.183   -15.265 14.619  1.00   8.54   ? 176  SER F N   1 
ATOM   6067 C  CA  . SER F 3 90  ? 0.549   -13.928 15.012  1.00   8.79   ? 176  SER F CA  1 
ATOM   6068 C  C   . SER F 3 90  ? 1.905   -13.929 15.717  1.00   9.54   ? 176  SER F C   1 
ATOM   6069 O  O   . SER F 3 90  ? 2.288   -14.903 16.380  1.00   10.23  ? 176  SER F O   1 
ATOM   6070 C  CB  . SER F 3 90  ? -0.519  -13.345 15.937  1.00   8.66   ? 176  SER F CB  1 
ATOM   6071 O  OG  A SER F 3 90  ? -0.376  -13.831 17.258  0.50   5.41   ? 176  SER F OG  1 
ATOM   6072 O  OG  B SER F 3 90  ? -0.327  -11.952 16.110  0.50   11.07  ? 176  SER F OG  1 
ATOM   6073 N  N   . GLY F 3 91  ? 2.630   -12.827 15.582  1.00   9.62   ? 177  GLY F N   1 
ATOM   6074 C  CA  . GLY F 3 91  ? 3.948   -12.721 16.188  1.00   10.16  ? 177  GLY F CA  1 
ATOM   6075 C  C   . GLY F 3 91  ? 4.361   -11.267 16.200  1.00   10.55  ? 177  GLY F C   1 
ATOM   6076 O  O   . GLY F 3 91  ? 3.793   -10.454 15.463  1.00   9.74   ? 177  GLY F O   1 
ATOM   6077 N  N   . GLY F 3 92  ? 5.343   -10.936 17.035  1.00   9.57   ? 178  GLY F N   1 
ATOM   6078 C  CA  . GLY F 3 92  ? 5.767   -9.545  17.193  1.00   9.77   ? 178  GLY F CA  1 
ATOM   6079 C  C   . GLY F 3 92  ? 6.938   -9.378  18.150  1.00   9.48   ? 178  GLY F C   1 
ATOM   6080 O  O   . GLY F 3 92  ? 7.263   -10.290 18.902  1.00   8.38   ? 178  GLY F O   1 
ATOM   6081 N  N   . VAL F 3 93  ? 7.578   -8.211  18.105  1.00   9.23   ? 179  VAL F N   1 
ATOM   6082 C  CA  . VAL F 3 93  ? 8.800   -7.975  18.866  1.00   8.85   ? 179  VAL F CA  1 
ATOM   6083 C  C   . VAL F 3 93  ? 9.183   -6.496  18.786  1.00   9.15   ? 179  VAL F C   1 
ATOM   6084 O  O   . VAL F 3 93  ? 8.840   -5.804  17.811  1.00   8.86   ? 179  VAL F O   1 
ATOM   6085 C  CB  . VAL F 3 93  ? 9.963   -8.848  18.316  1.00   9.52   ? 179  VAL F CB  1 
ATOM   6086 C  CG1 . VAL F 3 93  ? 10.292  -8.459  16.858  1.00   9.40   ? 179  VAL F CG1 1 
ATOM   6087 C  CG2 . VAL F 3 93  ? 11.212  -8.766  19.213  1.00   8.94   ? 179  VAL F CG2 1 
ATOM   6088 N  N   . LEU F 3 94  ? 9.878   -6.011  19.814  1.00   9.92   ? 180  LEU F N   1 
ATOM   6089 C  CA  . LEU F 3 94  ? 10.395  -4.635  19.835  1.00   10.73  ? 180  LEU F CA  1 
ATOM   6090 C  C   . LEU F 3 94  ? 11.882  -4.671  19.531  1.00   11.48  ? 180  LEU F C   1 
ATOM   6091 O  O   . LEU F 3 94  ? 12.614  -5.476  20.118  1.00   11.55  ? 180  LEU F O   1 
ATOM   6092 C  CB  . LEU F 3 94  ? 10.162  -3.988  21.208  1.00   11.27  ? 180  LEU F CB  1 
ATOM   6093 C  CG  . LEU F 3 94  ? 8.700   -3.730  21.574  1.00   12.89  ? 180  LEU F CG  1 
ATOM   6094 C  CD1 . LEU F 3 94  ? 8.518   -3.556  23.088  1.00   13.15  ? 180  LEU F CD1 1 
ATOM   6095 C  CD2 . LEU F 3 94  ? 8.198   -2.501  20.830  1.00   13.54  ? 180  LEU F CD2 1 
ATOM   6096 N  N   . LEU F 3 95  ? 12.318  -3.814  18.608  1.00   11.67  ? 181  LEU F N   1 
ATOM   6097 C  CA  . LEU F 3 95  ? 13.708  -3.777  18.169  1.00   11.95  ? 181  LEU F CA  1 
ATOM   6098 C  C   . LEU F 3 95  ? 14.212  -2.340  18.075  1.00   12.27  ? 181  LEU F C   1 
ATOM   6099 O  O   . LEU F 3 95  ? 13.560  -1.483  17.459  1.00   11.62  ? 181  LEU F O   1 
ATOM   6100 C  CB  . LEU F 3 95  ? 13.863  -4.460  16.799  1.00   11.96  ? 181  LEU F CB  1 
ATOM   6101 C  CG  . LEU F 3 95  ? 13.510  -5.951  16.673  1.00   11.68  ? 181  LEU F CG  1 
ATOM   6102 C  CD1 . LEU F 3 95  ? 13.572  -6.394  15.205  1.00   11.73  ? 181  LEU F CD1 1 
ATOM   6103 C  CD2 . LEU F 3 95  ? 14.446  -6.807  17.514  1.00   10.81  ? 181  LEU F CD2 1 
ATOM   6104 N  N   . ARG F 3 96  ? 15.366  -2.084  18.687  1.00   12.11  ? 182  ARG F N   1 
ATOM   6105 C  CA  . ARG F 3 96  ? 16.051  -0.789  18.547  1.00   13.28  ? 182  ARG F CA  1 
ATOM   6106 C  C   . ARG F 3 96  ? 16.996  -0.782  17.336  1.00   12.77  ? 182  ARG F C   1 
ATOM   6107 O  O   . ARG F 3 96  ? 18.092  -1.334  17.398  1.00   13.39  ? 182  ARG F O   1 
ATOM   6108 C  CB  . ARG F 3 96  ? 16.833  -0.434  19.821  1.00   13.23  ? 182  ARG F CB  1 
ATOM   6109 C  CG  . ARG F 3 96  ? 17.467  0.960   19.750  1.00   14.63  ? 182  ARG F CG  1 
ATOM   6110 C  CD  . ARG F 3 96  ? 18.302  1.283   20.980  1.00   17.07  ? 182  ARG F CD  1 
ATOM   6111 N  NE  . ARG F 3 96  ? 18.386  2.728   21.189  1.00   18.72  ? 182  ARG F NE  1 
ATOM   6112 C  CZ  . ARG F 3 96  ? 18.868  3.295   22.289  1.00   19.91  ? 182  ARG F CZ  1 
ATOM   6113 N  NH1 . ARG F 3 96  ? 19.327  2.539   23.284  1.00   19.52  ? 182  ARG F NH1 1 
ATOM   6114 N  NH2 . ARG F 3 96  ? 18.892  4.618   22.392  1.00   20.47  ? 182  ARG F NH2 1 
ATOM   6115 N  N   . LEU F 3 97  ? 16.570  -0.146  16.250  1.00   12.91  ? 183  LEU F N   1 
ATOM   6116 C  CA  . LEU F 3 97  ? 17.260  -0.240  14.959  1.00   13.22  ? 183  LEU F CA  1 
ATOM   6117 C  C   . LEU F 3 97  ? 18.140  0.974   14.636  1.00   14.32  ? 183  LEU F C   1 
ATOM   6118 O  O   . LEU F 3 97  ? 17.793  2.110   14.961  1.00   14.65  ? 183  LEU F O   1 
ATOM   6119 C  CB  . LEU F 3 97  ? 16.243  -0.417  13.826  1.00   12.71  ? 183  LEU F CB  1 
ATOM   6120 C  CG  . LEU F 3 97  ? 15.164  -1.501  13.864  1.00   11.94  ? 183  LEU F CG  1 
ATOM   6121 C  CD1 . LEU F 3 97  ? 14.281  -1.377  12.634  1.00   11.86  ? 183  LEU F CD1 1 
ATOM   6122 C  CD2 . LEU F 3 97  ? 15.754  -2.887  13.939  1.00   12.03  ? 183  LEU F CD2 1 
ATOM   6123 N  N   . GLN F 3 98  ? 19.253  0.735   13.944  1.00   14.64  ? 184  GLN F N   1 
ATOM   6124 C  CA  . GLN F 3 98  ? 20.085  1.781   13.357  0.0000 15.65  ? 184  GLN F CA  1 
ATOM   6125 C  C   . GLN F 3 98  ? 19.747  2.156   11.847  1.00   13.75  ? 184  GLN F C   1 
ATOM   6126 O  O   . GLN F 3 98  ? 19.126  1.266   11.259  1.00   12.98  ? 184  GLN F O   1 
ATOM   6127 C  CB  . GLN F 3 98  ? 21.571  1.392   13.416  0.0000 16.90  ? 184  GLN F CB  1 
ATOM   6128 C  CG  . GLN F 3 98  ? 22.046  0.749   14.720  0.0000 20.88  ? 184  GLN F CG  1 
ATOM   6129 C  CD  . GLN F 3 98  ? 22.423  -0.725  14.557  0.0000 23.72  ? 184  GLN F CD  1 
ATOM   6130 O  OE1 . GLN F 3 98  ? 22.734  -1.190  13.448  0.0000 25.75  ? 184  GLN F OE1 1 
ATOM   6131 N  NE2 . GLN F 3 98  ? 22.418  -1.461  15.662  0.0000 23.82  ? 184  GLN F NE2 1 
ATOM   6132 N  N   . VAL F 3 99  ? 20.053  3.326   11.291  1.00   13.91  ? 185  VAL F N   1 
ATOM   6133 C  CA  . VAL F 3 99  ? 19.698  3.657   9.917   1.00   14.11  ? 185  VAL F CA  1 
ATOM   6134 C  C   . VAL F 3 99  ? 20.196  2.565   8.981   1.00   14.21  ? 185  VAL F C   1 
ATOM   6135 O  O   . VAL F 3 99  ? 21.325  2.095   9.127   1.00   14.24  ? 185  VAL F O   1 
ATOM   6136 C  CB  . VAL F 3 99  ? 20.344  4.994   9.485   1.00   14.91  ? 185  VAL F CB  1 
ATOM   6137 C  CG1 . VAL F 3 99  ? 20.260  5.185   7.949   1.00   15.19  ? 185  VAL F CG1 1 
ATOM   6138 C  CG2 . VAL F 3 99  ? 19.711  6.183   10.224  1.00   15.33  ? 185  VAL F CG2 1 
ATOM   6139 N  N   . GLY F 3 100 ? 19.362  2.163   8.023   1.00   13.39  ? 186  GLY F N   1 
ATOM   6140 C  CA  . GLY F 3 100 ? 19.803  1.238   6.981   1.00   13.34  ? 186  GLY F CA  1 
ATOM   6141 C  C   . GLY F 3 100 ? 19.492  -0.226  7.243   1.00   12.58  ? 186  GLY F C   1 
ATOM   6142 O  O   . GLY F 3 100 ? 19.513  -1.044  6.317   1.00   12.89  ? 186  GLY F O   1 
ATOM   6143 N  N   . GLU F 3 101 ? 19.181  -0.557  8.492   1.00   12.00  ? 187  GLU F N   1 
ATOM   6144 C  CA  . GLU F 3 101 ? 18.848  -1.932  8.854   1.00   12.37  ? 187  GLU F CA  1 
ATOM   6145 C  C   . GLU F 3 101 ? 17.572  -2.400  8.175   1.00   12.10  ? 187  GLU F C   1 
ATOM   6146 O  O   . GLU F 3 101 ? 16.606  -1.642  8.063   1.00   10.99  ? 187  GLU F O   1 
ATOM   6147 C  CB  . GLU F 3 101 ? 18.699  -2.088  10.373  1.00   12.53  ? 187  GLU F CB  1 
ATOM   6148 C  CG  . GLU F 3 101 ? 20.006  -2.053  11.112  1.00   13.59  ? 187  GLU F CG  1 
ATOM   6149 C  CD  . GLU F 3 101 ? 19.929  -2.760  12.448  1.00   14.04  ? 187  GLU F CD  1 
ATOM   6150 O  OE1 . GLU F 3 101 ? 19.961  -4.014  12.474  1.00   13.87  ? 187  GLU F OE1 1 
ATOM   6151 O  OE2 . GLU F 3 101 ? 19.850  -2.053  13.468  1.00   12.74  ? 187  GLU F OE2 1 
ATOM   6152 N  N   . GLU F 3 102 ? 17.582  -3.659  7.733   1.00   12.06  ? 188  GLU F N   1 
ATOM   6153 C  CA  . GLU F 3 102 ? 16.444  -4.263  7.063   1.00   11.57  ? 188  GLU F CA  1 
ATOM   6154 C  C   . GLU F 3 102 ? 15.672  -5.210  7.974   1.00   11.65  ? 188  GLU F C   1 
ATOM   6155 O  O   . GLU F 3 102 ? 16.269  -5.942  8.776   1.00   11.82  ? 188  GLU F O   1 
ATOM   6156 C  CB  . GLU F 3 102 ? 16.915  -5.027  5.826   1.00   12.47  ? 188  GLU F CB  1 
ATOM   6157 C  CG  . GLU F 3 102 ? 17.619  -4.161  4.798   1.00   15.44  ? 188  GLU F CG  1 
ATOM   6158 C  CD  . GLU F 3 102 ? 18.093  -4.962  3.599   1.00   17.22  ? 188  GLU F CD  1 
ATOM   6159 O  OE1 . GLU F 3 102 ? 18.235  -6.192  3.741   1.00   16.97  ? 188  GLU F OE1 1 
ATOM   6160 O  OE2 . GLU F 3 102 ? 18.326  -4.361  2.522   1.00   19.56  ? 188  GLU F OE2 1 
ATOM   6161 N  N   . VAL F 3 103 ? 14.344  -5.196  7.849   1.00   10.40  ? 189  VAL F N   1 
ATOM   6162 C  CA  . VAL F 3 103 ? 13.507  -6.155  8.558   1.00   9.96   ? 189  VAL F CA  1 
ATOM   6163 C  C   . VAL F 3 103 ? 12.523  -6.808  7.598   1.00   9.73   ? 189  VAL F C   1 
ATOM   6164 O  O   . VAL F 3 103 ? 11.941  -6.136  6.751   1.00   10.80  ? 189  VAL F O   1 
ATOM   6165 C  CB  . VAL F 3 103 ? 12.731  -5.493  9.719   1.00   9.76   ? 189  VAL F CB  1 
ATOM   6166 C  CG1 . VAL F 3 103 ? 11.718  -6.463  10.289  1.00   8.82   ? 189  VAL F CG1 1 
ATOM   6167 C  CG2 . VAL F 3 103 ? 13.704  -5.036  10.797  1.00   9.25   ? 189  VAL F CG2 1 
ATOM   6168 N  N   . TRP F 3 104 ? 12.348  -8.120  7.712   1.00   8.52   ? 190  TRP F N   1 
ATOM   6169 C  CA  . TRP F 3 104 ? 11.359  -8.799  6.883   1.00   8.30   ? 190  TRP F CA  1 
ATOM   6170 C  C   . TRP F 3 104 ? 10.821  -10.043 7.552   1.00   7.96   ? 190  TRP F C   1 
ATOM   6171 O  O   . TRP F 3 104 ? 11.357  -10.494 8.551   1.00   8.45   ? 190  TRP F O   1 
ATOM   6172 C  CB  . TRP F 3 104 ? 11.946  -9.150  5.510   1.00   7.74   ? 190  TRP F CB  1 
ATOM   6173 C  CG  . TRP F 3 104 ? 13.085  -10.156 5.554   1.00   8.12   ? 190  TRP F CG  1 
ATOM   6174 C  CD1 . TRP F 3 104 ? 12.986  -11.528 5.450   1.00   8.13   ? 190  TRP F CD1 1 
ATOM   6175 C  CD2 . TRP F 3 104 ? 14.481  -9.865  5.682   1.00   6.44   ? 190  TRP F CD2 1 
ATOM   6176 N  NE1 . TRP F 3 104 ? 14.235  -12.097 5.510   1.00   6.91   ? 190  TRP F NE1 1 
ATOM   6177 C  CE2 . TRP F 3 104 ? 15.172  -11.102 5.653   1.00   7.64   ? 190  TRP F CE2 1 
ATOM   6178 C  CE3 . TRP F 3 104 ? 15.216  -8.682  5.819   1.00   7.60   ? 190  TRP F CE3 1 
ATOM   6179 C  CZ2 . TRP F 3 104 ? 16.566  -11.186 5.756   1.00   6.93   ? 190  TRP F CZ2 1 
ATOM   6180 C  CZ3 . TRP F 3 104 ? 16.600  -8.764  5.927   1.00   7.40   ? 190  TRP F CZ3 1 
ATOM   6181 C  CH2 . TRP F 3 104 ? 17.262  -10.008 5.887   1.00   8.46   ? 190  TRP F CH2 1 
ATOM   6182 N  N   . LEU F 3 105 ? 9.742   -10.576 6.987   1.00   7.31   ? 191  LEU F N   1 
ATOM   6183 C  CA  . LEU F 3 105 ? 9.153   -11.825 7.422   1.00   6.84   ? 191  LEU F CA  1 
ATOM   6184 C  C   . LEU F 3 105 ? 9.404   -12.885 6.354   1.00   7.57   ? 191  LEU F C   1 
ATOM   6185 O  O   . LEU F 3 105 ? 9.447   -12.583 5.154   1.00   8.12   ? 191  LEU F O   1 
ATOM   6186 C  CB  . LEU F 3 105 ? 7.640   -11.649 7.626   1.00   7.02   ? 191  LEU F CB  1 
ATOM   6187 C  CG  . LEU F 3 105 ? 7.183   -10.621 8.673   1.00   7.34   ? 191  LEU F CG  1 
ATOM   6188 C  CD1 . LEU F 3 105 ? 5.680   -10.650 8.844   1.00   7.18   ? 191  LEU F CD1 1 
ATOM   6189 C  CD2 . LEU F 3 105 ? 7.865   -10.841 10.011  1.00   5.39   ? 191  LEU F CD2 1 
ATOM   6190 N  N   . ALA F 3 106 ? 9.567   -14.123 6.794   1.00   6.91   ? 192  ALA F N   1 
ATOM   6191 C  CA  . ALA F 3 106 ? 9.903   -15.219 5.913   1.00   7.38   ? 192  ALA F CA  1 
ATOM   6192 C  C   . ALA F 3 106 ? 9.111   -16.431 6.367   1.00   7.61   ? 192  ALA F C   1 
ATOM   6193 O  O   . ALA F 3 106 ? 8.651   -16.478 7.525   1.00   6.52   ? 192  ALA F O   1 
ATOM   6194 C  CB  . ALA F 3 106 ? 11.400  -15.524 5.997   1.00   6.86   ? 192  ALA F CB  1 
ATOM   6195 N  N   . VAL F 3 107 ? 8.949   -17.401 5.467   1.00   7.84   ? 193  VAL F N   1 
ATOM   6196 C  CA  . VAL F 3 107 ? 8.420   -18.718 5.849   1.00   8.63   ? 193  VAL F CA  1 
ATOM   6197 C  C   . VAL F 3 107 ? 9.507   -19.795 5.775   1.00   9.80   ? 193  VAL F C   1 
ATOM   6198 O  O   . VAL F 3 107 ? 10.567  -19.589 5.165   1.00   10.67  ? 193  VAL F O   1 
ATOM   6199 C  CB  . VAL F 3 107 ? 7.189   -19.130 5.000   1.00   8.35   ? 193  VAL F CB  1 
ATOM   6200 C  CG1 . VAL F 3 107 ? 5.999   -18.284 5.361   1.00   6.80   ? 193  VAL F CG1 1 
ATOM   6201 C  CG2 . VAL F 3 107 ? 7.488   -19.014 3.492   1.00   7.71   ? 193  VAL F CG2 1 
ATOM   6202 N  N   . ASN F 3 108 ? 9.258   -20.939 6.403   1.00   10.27  ? 194  ASN F N   1 
ATOM   6203 C  CA  . ASN F 3 108 ? 10.177  -22.063 6.259   1.00   11.29  ? 194  ASN F CA  1 
ATOM   6204 C  C   . ASN F 3 108 ? 9.552   -23.140 5.395   1.00   11.44  ? 194  ASN F C   1 
ATOM   6205 O  O   . ASN F 3 108 ? 9.012   -22.822 4.342   1.00   11.79  ? 194  ASN F O   1 
ATOM   6206 C  CB  . ASN F 3 108 ? 10.696  -22.598 7.611   1.00   11.04  ? 194  ASN F CB  1 
ATOM   6207 C  CG  . ASN F 3 108 ? 9.586   -23.050 8.554   1.00   11.41  ? 194  ASN F CG  1 
ATOM   6208 O  OD1 . ASN F 3 108 ? 8.448   -23.273 8.154   1.00   11.04  ? 194  ASN F OD1 1 
ATOM   6209 N  ND2 . ASN F 3 108 ? 9.934   -23.201 9.826   1.00   11.18  ? 194  ASN F ND2 1 
ATOM   6210 N  N   . ASP F 3 109 ? 9.630   -24.403 5.813   1.00   12.34  ? 195  ASP F N   1 
ATOM   6211 C  CA  . ASP F 3 109 ? 9.031   -25.482 5.025   1.00   13.41  ? 195  ASP F CA  1 
ATOM   6212 C  C   . ASP F 3 109 ? 7.510   -25.440 5.177   1.00   13.36  ? 195  ASP F C   1 
ATOM   6213 O  O   . ASP F 3 109 ? 6.778   -25.946 4.335   1.00   13.38  ? 195  ASP F O   1 
ATOM   6214 C  CB  . ASP F 3 109 ? 9.587   -26.853 5.432   1.00   13.93  ? 195  ASP F CB  1 
ATOM   6215 C  CG  . ASP F 3 109 ? 11.021  -27.070 4.968   1.00   14.70  ? 195  ASP F CG  1 
ATOM   6216 O  OD1 . ASP F 3 109 ? 11.361  -26.642 3.845   1.00   15.61  ? 195  ASP F OD1 1 
ATOM   6217 O  OD2 . ASP F 3 109 ? 11.806  -27.686 5.721   1.00   15.83  ? 195  ASP F OD2 1 
ATOM   6218 N  N   . TYR F 3 110 ? 7.053   -24.831 6.270   1.00   13.38  ? 196  TYR F N   1 
ATOM   6219 C  CA  . TYR F 3 110 ? 5.637   -24.574 6.504   1.00   12.87  ? 196  TYR F CA  1 
ATOM   6220 C  C   . TYR F 3 110 ? 5.296   -23.158 6.034   1.00   13.04  ? 196  TYR F C   1 
ATOM   6221 O  O   . TYR F 3 110 ? 5.572   -22.173 6.732   1.00   12.23  ? 196  TYR F O   1 
ATOM   6222 C  CB  . TYR F 3 110 ? 5.305   -24.736 7.994   1.00   13.38  ? 196  TYR F CB  1 
ATOM   6223 C  CG  . TYR F 3 110 ? 5.426   -26.149 8.510   1.00   12.47  ? 196  TYR F CG  1 
ATOM   6224 C  CD1 . TYR F 3 110 ? 5.569   -26.407 9.871   1.00   13.06  ? 196  TYR F CD1 1 
ATOM   6225 C  CD2 . TYR F 3 110 ? 5.401   -27.230 7.635   1.00   12.55  ? 196  TYR F CD2 1 
ATOM   6226 C  CE1 . TYR F 3 110 ? 5.671   -27.715 10.347  1.00   12.23  ? 196  TYR F CE1 1 
ATOM   6227 C  CE2 . TYR F 3 110 ? 5.500   -28.531 8.094   1.00   12.43  ? 196  TYR F CE2 1 
ATOM   6228 C  CZ  . TYR F 3 110 ? 5.640   -28.768 9.450   1.00   12.55  ? 196  TYR F CZ  1 
ATOM   6229 O  OH  . TYR F 3 110 ? 5.735   -30.063 9.897   1.00   13.23  ? 196  TYR F OH  1 
ATOM   6230 N  N   . TYR F 3 111 ? 4.682   -23.069 4.857   1.00   13.34  ? 197  TYR F N   1 
ATOM   6231 C  CA  . TYR F 3 111 ? 4.575   -21.807 4.129   1.00   14.90  ? 197  TYR F CA  1 
ATOM   6232 C  C   . TYR F 3 111 ? 3.149   -21.354 3.785   1.00   14.51  ? 197  TYR F C   1 
ATOM   6233 O  O   . TYR F 3 111 ? 2.976   -20.412 3.028   1.00   14.25  ? 197  TYR F O   1 
ATOM   6234 C  CB  . TYR F 3 111 ? 5.359   -21.929 2.817   1.00   16.27  ? 197  TYR F CB  1 
ATOM   6235 C  CG  . TYR F 3 111 ? 4.825   -23.021 1.916   1.00   18.28  ? 197  TYR F CG  1 
ATOM   6236 C  CD1 . TYR F 3 111 ? 3.803   -22.765 1.012   1.00   19.89  ? 197  TYR F CD1 1 
ATOM   6237 C  CD2 . TYR F 3 111 ? 5.330   -24.317 1.985   1.00   19.60  ? 197  TYR F CD2 1 
ATOM   6238 C  CE1 . TYR F 3 111 ? 3.302   -23.772 0.188   1.00   21.83  ? 197  TYR F CE1 1 
ATOM   6239 C  CE2 . TYR F 3 111 ? 4.836   -25.330 1.171   1.00   20.98  ? 197  TYR F CE2 1 
ATOM   6240 C  CZ  . TYR F 3 111 ? 3.825   -25.052 0.271   1.00   21.96  ? 197  TYR F CZ  1 
ATOM   6241 O  OH  . TYR F 3 111 ? 3.331   -26.054 -0.548  1.00   22.17  ? 197  TYR F OH  1 
ATOM   6242 N  N   . ASP F 3 112 ? 2.123   -22.003 4.315   1.00   14.55  ? 198  ASP F N   1 
ATOM   6243 C  CA  . ASP F 3 112 ? 0.771   -21.709 3.818   1.00   15.18  ? 198  ASP F CA  1 
ATOM   6244 C  C   . ASP F 3 112 ? 0.237   -20.355 4.292   1.00   15.43  ? 198  ASP F C   1 
ATOM   6245 O  O   . ASP F 3 112 ? 0.234   -20.061 5.491   1.00   16.07  ? 198  ASP F O   1 
ATOM   6246 C  CB  . ASP F 3 112 ? -0.203  -22.841 4.169   1.00   15.23  ? 198  ASP F CB  1 
ATOM   6247 C  CG  . ASP F 3 112 ? -1.602  -22.585 3.649   1.00   15.55  ? 198  ASP F CG  1 
ATOM   6248 O  OD1 . ASP F 3 112 ? -2.349  -21.818 4.291   1.00   15.17  ? 198  ASP F OD1 1 
ATOM   6249 O  OD2 . ASP F 3 112 ? -1.958  -23.150 2.590   1.00   16.27  ? 198  ASP F OD2 1 
ATOM   6250 N  N   . MET F 3 113 ? -0.189  -19.519 3.348   1.00   15.70  ? 199  MET F N   1 
ATOM   6251 C  CA  . MET F 3 113 ? -0.849  -18.255 3.692   1.00   15.52  ? 199  MET F CA  1 
ATOM   6252 C  C   . MET F 3 113 ? -2.167  -18.082 2.951   1.00   15.78  ? 199  MET F C   1 
ATOM   6253 O  O   . MET F 3 113 ? -2.543  -16.985 2.544   1.00   15.96  ? 199  MET F O   1 
ATOM   6254 C  CB  . MET F 3 113 ? 0.072   -17.062 3.439   1.00   15.11  ? 199  MET F CB  1 
ATOM   6255 C  CG  . MET F 3 113 ? 1.319   -17.072 4.304   1.00   15.40  ? 199  MET F CG  1 
ATOM   6256 S  SD  . MET F 3 113 ? 2.254   -15.539 4.180   1.00   16.98  ? 199  MET F SD  1 
ATOM   6257 C  CE  . MET F 3 113 ? 1.158   -14.451 5.075   1.00   12.38  ? 199  MET F CE  1 
ATOM   6258 N  N   . VAL F 3 114 ? -2.882  -19.179 2.785   1.00   16.54  ? 200  VAL F N   1 
ATOM   6259 C  CA  . VAL F 3 114 ? -4.121  -19.150 2.033   1.00   16.65  ? 200  VAL F CA  1 
ATOM   6260 C  C   . VAL F 3 114 ? -5.277  -19.121 3.030   1.00   17.00  ? 200  VAL F C   1 
ATOM   6261 O  O   . VAL F 3 114 ? -5.781  -20.161 3.446   1.00   18.01  ? 200  VAL F O   1 
ATOM   6262 C  CB  . VAL F 3 114 ? -4.219  -20.369 1.082   1.00   16.85  ? 200  VAL F CB  1 
ATOM   6263 C  CG1 A VAL F 3 114 ? -5.505  -20.333 0.259   0.50   15.89  ? 200  VAL F CG1 1 
ATOM   6264 C  CG1 B VAL F 3 114 ? -3.153  -20.273 -0.010  0.50   17.63  ? 200  VAL F CG1 1 
ATOM   6265 C  CG2 A VAL F 3 114 ? -2.984  -20.455 0.182   0.50   17.15  ? 200  VAL F CG2 1 
ATOM   6266 C  CG2 B VAL F 3 114 ? -4.054  -21.640 1.837   0.50   17.21  ? 200  VAL F CG2 1 
ATOM   6267 N  N   . GLY F 3 115 ? -5.672  -17.924 3.444   1.00   16.63  ? 201  GLY F N   1 
ATOM   6268 C  CA  . GLY F 3 115 ? -6.814  -17.795 4.337   1.00   16.52  ? 201  GLY F CA  1 
ATOM   6269 C  C   . GLY F 3 115 ? -8.084  -18.118 3.578   1.00   16.21  ? 201  GLY F C   1 
ATOM   6270 O  O   . GLY F 3 115 ? -8.096  -18.106 2.343   1.00   16.21  ? 201  GLY F O   1 
ATOM   6271 N  N   . ILE F 3 116 ? -9.157  -18.419 4.296   1.00   16.09  ? 202  ILE F N   1 
ATOM   6272 C  CA  . ILE F 3 116 ? -10.464 -18.515 3.648   1.00   16.26  ? 202  ILE F CA  1 
ATOM   6273 C  C   . ILE F 3 116 ? -10.919 -17.114 3.241   1.00   16.35  ? 202  ILE F C   1 
ATOM   6274 O  O   . ILE F 3 116 ? -10.304 -16.123 3.636   1.00   15.72  ? 202  ILE F O   1 
ATOM   6275 C  CB  . ILE F 3 116 ? -11.524 -19.138 4.569   1.00   17.02  ? 202  ILE F CB  1 
ATOM   6276 C  CG1 . ILE F 3 116 ? -11.606 -18.360 5.887   1.00   17.09  ? 202  ILE F CG1 1 
ATOM   6277 C  CG2 . ILE F 3 116 ? -11.241 -20.623 4.801   1.00   16.87  ? 202  ILE F CG2 1 
ATOM   6278 C  CD1 . ILE F 3 116 ? -12.856 -18.659 6.674   1.00   19.44  ? 202  ILE F CD1 1 
ATOM   6279 N  N   . GLN F 3 117 ? -11.989 -17.031 2.450   1.00   15.85  ? 203  GLN F N   1 
ATOM   6280 C  CA  . GLN F 3 117 ? -12.582 -15.759 2.059   0.0000 21.10  ? 203  GLN F CA  1 
ATOM   6281 C  C   . GLN F 3 117 ? -13.035 -14.734 3.386   1.00   17.12  ? 203  GLN F C   1 
ATOM   6282 O  O   . GLN F 3 117 ? -13.588 -15.321 4.324   1.00   17.01  ? 203  GLN F O   1 
ATOM   6283 C  CB  . GLN F 3 117 ? -13.862 -15.981 1.233   0.0000 21.95  ? 203  GLN F CB  1 
ATOM   6284 C  CG  . GLN F 3 117 ? -13.882 -15.294 -0.148  0.0000 25.07  ? 203  GLN F CG  1 
ATOM   6285 C  CD  . GLN F 3 117 ? -15.188 -15.550 -0.916  0.0000 24.98  ? 203  GLN F CD  1 
ATOM   6286 O  OE1 . GLN F 3 117 ? -15.569 -16.699 -1.163  0.0000 27.68  ? 203  GLN F OE1 1 
ATOM   6287 N  NE2 . GLN F 3 117 ? -15.876 -14.474 -1.290  0.0000 26.89  ? 203  GLN F NE2 1 
ATOM   6288 N  N   . GLY F 3 118 ? -12.368 -13.592 3.541   1.00   16.30  ? 204  GLY F N   1 
ATOM   6289 C  CA  . GLY F 3 118 ? -12.592 -12.745 4.706   1.00   15.35  ? 204  GLY F CA  1 
ATOM   6290 C  C   . GLY F 3 118 ? -11.571 -12.947 5.804   1.00   14.36  ? 204  GLY F C   1 
ATOM   6291 O  O   . GLY F 3 118 ? -11.729 -12.426 6.904   1.00   15.13  ? 204  GLY F O   1 
ATOM   6292 N  N   . SER F 3 119 ? -10.517 -13.703 5.512   1.00   13.22  ? 205  SER F N   1 
ATOM   6293 C  CA  . SER F 3 119 ? -9.404  -13.823 6.438   1.00   11.80  ? 205  SER F CA  1 
ATOM   6294 C  C   . SER F 3 119 ? -8.108  -13.452 5.720   1.00   12.01  ? 205  SER F C   1 
ATOM   6295 O  O   . SER F 3 119 ? -7.679  -14.129 4.785   1.00   10.99  ? 205  SER F O   1 
ATOM   6296 C  CB  . SER F 3 119 ? -9.317  -15.222 7.051   1.00   11.40  ? 205  SER F CB  1 
ATOM   6297 O  OG  . SER F 3 119 ? -8.544  -15.183 8.241   1.00   8.94   ? 205  SER F OG  1 
ATOM   6298 N  N   . ASP F 3 120 ? -7.494  -12.367 6.179   1.00   11.58  ? 206  ASP F N   1 
ATOM   6299 C  CA  . ASP F 3 120 ? -6.387  -11.742 5.480   1.00   11.31  ? 206  ASP F CA  1 
ATOM   6300 C  C   . ASP F 3 120 ? -5.053  -11.885 6.243   1.00   10.33  ? 206  ASP F C   1 
ATOM   6301 O  O   . ASP F 3 120 ? -5.012  -12.461 7.327   1.00   9.15   ? 206  ASP F O   1 
ATOM   6302 C  CB  . ASP F 3 120 ? -6.727  -10.272 5.248   1.00   12.01  ? 206  ASP F CB  1 
ATOM   6303 C  CG  . ASP F 3 120 ? -7.946  -10.089 4.345   1.00   14.18  ? 206  ASP F CG  1 
ATOM   6304 O  OD1 . ASP F 3 120 ? -8.917  -9.419  4.759   1.00   15.77  ? 206  ASP F OD1 1 
ATOM   6305 O  OD2 . ASP F 3 120 ? -7.943  -10.623 3.216   1.00   15.38  ? 206  ASP F OD2 1 
ATOM   6306 N  N   . SER F 3 121 ? -3.975  -11.355 5.668   1.00   8.62   ? 207  SER F N   1 
ATOM   6307 C  CA  . SER F 3 121 ? -2.649  -11.451 6.274   1.00   8.34   ? 207  SER F CA  1 
ATOM   6308 C  C   . SER F 3 121 ? -1.996  -10.070 6.264   1.00   7.92   ? 207  SER F C   1 
ATOM   6309 O  O   . SER F 3 121 ? -1.912  -9.429  5.208   1.00   7.43   ? 207  SER F O   1 
ATOM   6310 C  CB  . SER F 3 121 ? -1.785  -12.468 5.524   1.00   8.52   ? 207  SER F CB  1 
ATOM   6311 O  OG  . SER F 3 121 ? -2.127  -13.807 5.868   1.00   10.54  ? 207  SER F OG  1 
ATOM   6312 N  N   . VAL F 3 122 ? -1.529  -9.624  7.430   1.00   6.49   ? 208  VAL F N   1 
ATOM   6313 C  CA  . VAL F 3 122 ? -1.130  -8.222  7.624   1.00   6.50   ? 208  VAL F CA  1 
ATOM   6314 C  C   . VAL F 3 122 ? 0.199   -8.092  8.396   1.00   6.80   ? 208  VAL F C   1 
ATOM   6315 O  O   . VAL F 3 122 ? 0.511   -8.925  9.256   1.00   6.91   ? 208  VAL F O   1 
ATOM   6316 C  CB  . VAL F 3 122 ? -2.280  -7.447  8.330   1.00   6.49   ? 208  VAL F CB  1 
ATOM   6317 C  CG1 A VAL F 3 122 ? -2.206  -7.611  9.850   0.50   5.15   ? 208  VAL F CG1 1 
ATOM   6318 C  CG1 B VAL F 3 122 ? -1.811  -6.094  8.825   0.50   7.67   ? 208  VAL F CG1 1 
ATOM   6319 C  CG2 A VAL F 3 122 ? -2.265  -5.984  7.944   0.50   6.36   ? 208  VAL F CG2 1 
ATOM   6320 C  CG2 B VAL F 3 122 ? -3.463  -7.290  7.392   0.50   7.77   ? 208  VAL F CG2 1 
ATOM   6321 N  N   . PHE F 3 123 ? 0.980   -7.062  8.069   1.00   6.03   ? 209  PHE F N   1 
ATOM   6322 C  CA  . PHE F 3 123 ? 2.287   -6.812  8.682   1.00   6.43   ? 209  PHE F CA  1 
ATOM   6323 C  C   . PHE F 3 123 ? 2.375   -5.331  8.971   1.00   6.77   ? 209  PHE F C   1 
ATOM   6324 O  O   . PHE F 3 123 ? 2.259   -4.516  8.059   1.00   7.15   ? 209  PHE F O   1 
ATOM   6325 C  CB  . PHE F 3 123 ? 3.411   -7.240  7.727   1.00   6.61   ? 209  PHE F CB  1 
ATOM   6326 C  CG  . PHE F 3 123 ? 4.810   -7.058  8.272   1.00   6.47   ? 209  PHE F CG  1 
ATOM   6327 C  CD1 . PHE F 3 123 ? 5.067   -7.084  9.640   1.00   6.75   ? 209  PHE F CD1 1 
ATOM   6328 C  CD2 . PHE F 3 123 ? 5.877   -6.916  7.406   1.00   6.33   ? 209  PHE F CD2 1 
ATOM   6329 C  CE1 . PHE F 3 123 ? 6.361   -6.930  10.122  1.00   6.99   ? 209  PHE F CE1 1 
ATOM   6330 C  CE2 . PHE F 3 123 ? 7.177   -6.767  7.882   1.00   7.38   ? 209  PHE F CE2 1 
ATOM   6331 C  CZ  . PHE F 3 123 ? 7.414   -6.768  9.239   1.00   8.44   ? 209  PHE F CZ  1 
ATOM   6332 N  N   . SER F 3 124 ? 2.558   -4.987  10.242  1.00   6.28   ? 210  SER F N   1 
ATOM   6333 C  CA  . SER F 3 124 ? 2.635   -3.595  10.669  1.00   7.27   ? 210  SER F CA  1 
ATOM   6334 C  C   . SER F 3 124 ? 3.930   -3.344  11.429  1.00   7.97   ? 210  SER F C   1 
ATOM   6335 O  O   . SER F 3 124 ? 4.503   -4.256  12.041  1.00   7.78   ? 210  SER F O   1 
ATOM   6336 C  CB  . SER F 3 124 ? 1.462   -3.243  11.591  1.00   6.63   ? 210  SER F CB  1 
ATOM   6337 O  OG  . SER F 3 124 ? 0.223   -3.487  10.969  1.00   7.30   ? 210  SER F OG  1 
ATOM   6338 N  N   . GLY F 3 125 ? 4.382   -2.097  11.392  1.00   7.83   ? 211  GLY F N   1 
ATOM   6339 C  CA  . GLY F 3 125 ? 5.529   -1.679  12.186  1.00   8.16   ? 211  GLY F CA  1 
ATOM   6340 C  C   . GLY F 3 125 ? 5.456   -0.180  12.402  1.00   8.23   ? 211  GLY F C   1 
ATOM   6341 O  O   . GLY F 3 125 ? 4.954   0.544   11.541  1.00   6.87   ? 211  GLY F O   1 
ATOM   6342 N  N   . PHE F 3 126 ? 5.938   0.291   13.551  1.00   7.83   ? 212  PHE F N   1 
ATOM   6343 C  CA  . PHE F 3 126 ? 5.998   1.728   13.786  1.00   8.50   ? 212  PHE F CA  1 
ATOM   6344 C  C   . PHE F 3 126 ? 7.083   2.134   14.782  1.00   9.53   ? 212  PHE F C   1 
ATOM   6345 O  O   . PHE F 3 126 ? 7.397   1.393   15.713  1.00   8.34   ? 212  PHE F O   1 
ATOM   6346 C  CB  . PHE F 3 126 ? 4.629   2.291   14.210  1.00   8.49   ? 212  PHE F CB  1 
ATOM   6347 C  CG  . PHE F 3 126 ? 3.871   1.415   15.174  1.00   8.68   ? 212  PHE F CG  1 
ATOM   6348 C  CD1 . PHE F 3 126 ? 4.006   1.592   16.553  1.00   8.54   ? 212  PHE F CD1 1 
ATOM   6349 C  CD2 . PHE F 3 126 ? 3.015   0.429   14.706  1.00   7.85   ? 212  PHE F CD2 1 
ATOM   6350 C  CE1 . PHE F 3 126 ? 3.301   0.799   17.446  1.00   8.46   ? 212  PHE F CE1 1 
ATOM   6351 C  CE2 . PHE F 3 126 ? 2.320   -0.372  15.583  1.00   7.79   ? 212  PHE F CE2 1 
ATOM   6352 C  CZ  . PHE F 3 126 ? 2.463   -0.191  16.964  1.00   8.34   ? 212  PHE F CZ  1 
ATOM   6353 N  N   . LEU F 3 127 ? 7.643   3.321   14.558  1.00   10.23  ? 213  LEU F N   1 
ATOM   6354 C  CA  . LEU F 3 127 ? 8.634   3.914   15.439  1.00   11.75  ? 213  LEU F CA  1 
ATOM   6355 C  C   . LEU F 3 127 ? 7.955   4.448   16.692  1.00   13.12  ? 213  LEU F C   1 
ATOM   6356 O  O   . LEU F 3 127 ? 6.965   5.175   16.600  1.00   13.82  ? 213  LEU F O   1 
ATOM   6357 C  CB  . LEU F 3 127 ? 9.317   5.065   14.715  1.00   11.43  ? 213  LEU F CB  1 
ATOM   6358 C  CG  . LEU F 3 127 ? 10.285  5.932   15.510  1.00   12.61  ? 213  LEU F CG  1 
ATOM   6359 C  CD1 . LEU F 3 127 ? 11.394  5.097   16.113  1.00   11.66  ? 213  LEU F CD1 1 
ATOM   6360 C  CD2 . LEU F 3 127 ? 10.847  7.007   14.581  1.00   11.76  ? 213  LEU F CD2 1 
ATOM   6361 N  N   . LEU F 3 128 ? 8.486   4.082   17.854  1.00   13.69  ? 214  LEU F N   1 
ATOM   6362 C  CA  . LEU F 3 128 ? 7.942   4.534   19.128  1.00   14.87  ? 214  LEU F CA  1 
ATOM   6363 C  C   . LEU F 3 128 ? 8.843   5.579   19.795  1.00   15.68  ? 214  LEU F C   1 
ATOM   6364 O  O   . LEU F 3 128 ? 8.353   6.583   20.307  1.00   16.50  ? 214  LEU F O   1 
ATOM   6365 C  CB  . LEU F 3 128 ? 7.742   3.346   20.072  1.00   14.55  ? 214  LEU F CB  1 
ATOM   6366 C  CG  . LEU F 3 128 ? 6.611   2.378   19.708  1.00   15.51  ? 214  LEU F CG  1 
ATOM   6367 C  CD1 . LEU F 3 128 ? 6.774   1.060   20.448  1.00   13.93  ? 214  LEU F CD1 1 
ATOM   6368 C  CD2 . LEU F 3 128 ? 5.250   3.019   19.995  1.00   14.80  ? 214  LEU F CD2 1 
ATOM   6369 N  N   . PHE F 3 129 ? 10.151  5.327   19.801  1.00   16.54  ? 215  PHE F N   1 
ATOM   6370 C  CA  . PHE F 3 129 ? 11.120  6.253   20.396  1.00   17.25  ? 215  PHE F CA  1 
ATOM   6371 C  C   . PHE F 3 129 ? 12.295  6.521   19.450  1.00   17.52  ? 215  PHE F C   1 
ATOM   6372 O  O   . PHE F 3 129 ? 13.166  5.668   19.269  1.00   17.38  ? 215  PHE F O   1 
ATOM   6373 C  CB  . PHE F 3 129 ? 11.672  5.714   21.723  1.00   17.04  ? 215  PHE F CB  1 
ATOM   6374 C  CG  . PHE F 3 129 ? 10.629  5.158   22.648  1.00   17.06  ? 215  PHE F CG  1 
ATOM   6375 C  CD1 . PHE F 3 129 ? 9.583   5.948   23.097  1.00   17.62  ? 215  PHE F CD1 1 
ATOM   6376 C  CD2 . PHE F 3 129 ? 10.723  3.853   23.099  1.00   17.00  ? 215  PHE F CD2 1 
ATOM   6377 C  CE1 . PHE F 3 129 ? 8.630   5.433   23.964  1.00   18.81  ? 215  PHE F CE1 1 
ATOM   6378 C  CE2 . PHE F 3 129 ? 9.775   3.325   23.957  1.00   18.04  ? 215  PHE F CE2 1 
ATOM   6379 C  CZ  . PHE F 3 129 ? 8.727   4.109   24.389  1.00   18.25  ? 215  PHE F CZ  1 
ATOM   6380 N  N   . PRO F 3 130 ? 12.342  7.720   18.873  1.00   18.41  ? 216  PRO F N   1 
ATOM   6381 C  CA  . PRO F 3 130 ? 13.458  8.069   17.996  1.00   19.41  ? 216  PRO F CA  1 
ATOM   6382 C  C   . PRO F 3 130 ? 14.778  8.195   18.754  1.00   20.59  ? 216  PRO F C   1 
ATOM   6383 O  O   . PRO F 3 130 ? 14.795  8.598   19.924  1.00   20.50  ? 216  PRO F O   1 
ATOM   6384 C  CB  . PRO F 3 130 ? 13.060  9.444   17.446  1.00   19.09  ? 216  PRO F CB  1 
ATOM   6385 C  CG  . PRO F 3 130 ? 11.599  9.622   17.800  1.00   19.59  ? 216  PRO F CG  1 
ATOM   6386 C  CD  . PRO F 3 130 ? 11.370  8.815   19.019  1.00   18.81  ? 216  PRO F CD  1 
ATOM   6387 N  N   . ASP F 3 131 ? 15.876  7.839   18.100  1.00   22.20  ? 217  ASP F N   1 
ATOM   6388 C  CA  . ASP F 3 131 ? 17.177  8.302   18.563  1.00   24.15  ? 217  ASP F CA  1 
ATOM   6389 C  C   . ASP F 3 131 ? 17.886  9.091   17.471  1.00   24.99  ? 217  ASP F C   1 
ATOM   6390 O  O   . ASP F 3 131 ? 17.238  9.931   16.828  1.00   25.35  ? 217  ASP F O   1 
ATOM   6391 C  CB  . ASP F 3 131 ? 18.046  7.181   19.161  1.00   24.82  ? 217  ASP F CB  1 
ATOM   6392 C  CG  . ASP F 3 131 ? 17.883  5.860   18.459  1.00   26.25  ? 217  ASP F CG  1 
ATOM   6393 O  OD1 . ASP F 3 131 ? 17.809  5.857   17.213  1.00   28.50  ? 217  ASP F OD1 1 
ATOM   6394 O  OD2 . ASP F 3 131 ? 17.857  4.816   19.151  1.00   25.96  ? 217  ASP F OD2 1 
ATOM   6395 O  OXT . ASP F 3 131 ? 19.086  8.939   17.219  1.00   25.47  ? 217  ASP F OXT 1 
HETATM 6396 C  C1  . NAG G 4 .   ? 7.147   -17.221 -31.879 1.00   69.28  ? 1223 NAG A C1  1 
HETATM 6397 C  C2  . NAG G 4 .   ? 6.707   -18.512 -32.547 1.00   69.27  ? 1223 NAG A C2  1 
HETATM 6398 C  C3  . NAG G 4 .   ? 7.406   -18.722 -33.884 1.00   69.19  ? 1223 NAG A C3  1 
HETATM 6399 C  C4  . NAG G 4 .   ? 7.406   -17.444 -34.716 1.00   69.36  ? 1223 NAG A C4  1 
HETATM 6400 C  C5  . NAG G 4 .   ? 7.903   -16.266 -33.887 1.00   69.36  ? 1223 NAG A C5  1 
HETATM 6401 C  C6  . NAG G 4 .   ? 7.896   -14.976 -34.701 1.00   69.38  ? 1223 NAG A C6  1 
HETATM 6402 C  C7  . NAG G 4 .   ? 6.140   -20.006 -30.708 1.00   69.24  ? 1223 NAG A C7  1 
HETATM 6403 C  C8  . NAG G 4 .   ? 5.071   -20.981 -31.111 1.00   69.42  ? 1223 NAG A C8  1 
HETATM 6404 N  N2  . NAG G 4 .   ? 6.990   -19.619 -31.654 1.00   69.42  ? 1223 NAG A N2  1 
HETATM 6405 O  O1  . NAG G 4 .   ? 6.282   -16.995 -30.794 1.00   69.17  ? 1223 NAG A O1  1 
HETATM 6406 O  O3  . NAG G 4 .   ? 6.734   -19.745 -34.580 1.00   68.76  ? 1223 NAG A O3  1 
HETATM 6407 O  O4  . NAG G 4 .   ? 8.234   -17.607 -35.845 1.00   69.73  ? 1223 NAG A O4  1 
HETATM 6408 O  O5  . NAG G 4 .   ? 7.067   -16.120 -32.761 1.00   69.32  ? 1223 NAG A O5  1 
HETATM 6409 O  O6  . NAG G 4 .   ? 7.435   -13.909 -33.901 1.00   69.15  ? 1223 NAG A O6  1 
HETATM 6410 O  O7  . NAG G 4 .   ? 6.211   -19.602 -29.551 1.00   69.18  ? 1223 NAG A O7  1 
HETATM 6411 CA CA  . CA  H 5 .   ? -20.705 -13.152 -20.893 1.00   19.70  ? 1224 CA  B CA  1 
HETATM 6412 N  N   . SEP I 6 .   ? -19.782 9.309   2.337   0.75   41.91  ? 1223 SEP D N   1 
HETATM 6413 C  CA  . SEP I 6 .   ? -18.542 9.650   1.584   0.75   41.73  ? 1223 SEP D CA  1 
HETATM 6414 C  CB  . SEP I 6 .   ? -17.316 9.008   2.236   0.75   41.77  ? 1223 SEP D CB  1 
HETATM 6415 O  OG  . SEP I 6 .   ? -17.439 7.598   2.278   0.75   42.12  ? 1223 SEP D OG  1 
HETATM 6416 C  C   . SEP I 6 .   ? -18.643 9.224   0.124   0.75   41.53  ? 1223 SEP D C   1 
HETATM 6417 O  O   . SEP I 6 .   ? -18.321 10.000  -0.774  0.75   41.13  ? 1223 SEP D O   1 
HETATM 6418 P  P   . SEP I 6 .   ? -15.995 6.890   2.365   0.75   41.39  ? 1223 SEP D P   1 
HETATM 6419 O  O1P . SEP I 6 .   ? -15.096 7.545   3.524   0.75   41.76  ? 1223 SEP D O1P 1 
HETATM 6420 O  O2P . SEP I 6 .   ? -15.252 7.071   0.951   0.75   42.85  ? 1223 SEP D O2P 1 
HETATM 6421 O  O3P . SEP I 6 .   ? -16.190 5.316   2.619   0.75   42.12  ? 1223 SEP D O3P 1 
HETATM 6422 CA CA  . CA  J 5 .   ? -5.741  -22.986 19.559  1.00   22.17  ? 1224 CA  E CA  1 
HETATM 6423 O  O   . HOH K 7 .   ? 13.238  3.361   -26.165 1.00   40.98  ? 2001 HOH A O   1 
HETATM 6424 O  O   . HOH K 7 .   ? 0.328   -21.586 -22.650 1.00   15.54  ? 2002 HOH A O   1 
HETATM 6425 O  O   . HOH K 7 .   ? -6.365  -15.615 -29.480 1.00   16.10  ? 2003 HOH A O   1 
HETATM 6426 O  O   . HOH K 7 .   ? -1.440  -25.767 -26.803 1.00   39.80  ? 2004 HOH A O   1 
HETATM 6427 O  O   . HOH K 7 .   ? 3.912   -23.030 -17.969 1.00   25.69  ? 2005 HOH A O   1 
HETATM 6428 O  O   . HOH K 7 .   ? 0.153   -23.420 -20.071 1.00   23.29  ? 2006 HOH A O   1 
HETATM 6429 O  O   . HOH K 7 .   ? 3.974   -23.522 -13.921 1.00   11.75  ? 2007 HOH A O   1 
HETATM 6430 O  O   . HOH K 7 .   ? 1.092   -26.793 -14.360 1.00   20.03  ? 2008 HOH A O   1 
HETATM 6431 O  O   . HOH K 7 .   ? 2.890   -19.145 -32.762 1.00   32.30  ? 2009 HOH A O   1 
HETATM 6432 O  O   . HOH K 7 .   ? 1.069   -10.763 -36.055 1.00   25.76  ? 2010 HOH A O   1 
HETATM 6433 O  O   . HOH K 7 .   ? 4.266   -14.324 -33.704 1.00   21.48  ? 2011 HOH A O   1 
HETATM 6434 O  O   . HOH K 7 .   ? 1.039   -3.405  -34.716 1.00   13.89  ? 2012 HOH A O   1 
HETATM 6435 O  O   . HOH K 7 .   ? 8.352   -9.758  -32.033 1.00   22.10  ? 2013 HOH A O   1 
HETATM 6436 O  O   . HOH K 7 .   ? 14.469  -16.498 -22.874 1.00   41.28  ? 2014 HOH A O   1 
HETATM 6437 O  O   . HOH K 7 .   ? 2.021   -14.404 -20.008 1.00   10.00  ? 2015 HOH A O   1 
HETATM 6438 O  O   . HOH K 7 .   ? 7.384   -19.682 -18.871 1.00   22.05  ? 2016 HOH A O   1 
HETATM 6439 O  O   . HOH K 7 .   ? 18.018  -0.176  -18.138 1.00   27.26  ? 2017 HOH A O   1 
HETATM 6440 O  O   . HOH K 7 .   ? -7.233  -2.770  -18.198 1.00   12.87  ? 2018 HOH A O   1 
HETATM 6441 O  O   . HOH K 7 .   ? -16.944 -19.292 -17.602 1.00   21.69  ? 2019 HOH A O   1 
HETATM 6442 O  O   . HOH K 7 .   ? -0.940  -14.282 -8.018  1.00   11.11  ? 2020 HOH A O   1 
HETATM 6443 O  O   . HOH K 7 .   ? 1.444   -8.270  -10.600 1.00   17.50  ? 2021 HOH A O   1 
HETATM 6444 O  O   . HOH K 7 .   ? -4.008  -10.514 -12.871 1.00   65.69  ? 2022 HOH A O   1 
HETATM 6445 O  O   . HOH K 7 .   ? 3.905   -8.411  -8.959  1.00   13.54  ? 2023 HOH A O   1 
HETATM 6446 O  O   . HOH K 7 .   ? 13.407  -11.761 -12.250 1.00   14.86  ? 2024 HOH A O   1 
HETATM 6447 O  O   . HOH K 7 .   ? 19.985  -9.833  -7.648  1.00   23.56  ? 2025 HOH A O   1 
HETATM 6448 O  O   . HOH K 7 .   ? 4.583   -17.602 -4.408  1.00   24.00  ? 2026 HOH A O   1 
HETATM 6449 O  O   . HOH K 7 .   ? 1.032   -6.929  -6.628  1.00   20.09  ? 2027 HOH A O   1 
HETATM 6450 O  O   . HOH K 7 .   ? -2.752  -9.804  -10.980 1.00   18.90  ? 2028 HOH A O   1 
HETATM 6451 O  O   . HOH K 7 .   ? -15.932 -12.270 -16.353 1.00   12.59  ? 2029 HOH A O   1 
HETATM 6452 O  O   . HOH K 7 .   ? -17.663 -19.586 -8.619  1.00   8.09   ? 2030 HOH A O   1 
HETATM 6453 O  O   . HOH K 7 .   ? -18.173 -22.320 -11.210 1.00   20.05  ? 2031 HOH A O   1 
HETATM 6454 O  O   . HOH K 7 .   ? -23.364 -19.986 -13.740 1.00   25.54  ? 2032 HOH A O   1 
HETATM 6455 O  O   . HOH K 7 .   ? -19.457 -20.259 -19.247 1.00   15.28  ? 2033 HOH A O   1 
HETATM 6456 O  O   . HOH K 7 .   ? -19.616 -20.596 -26.720 1.00   32.19  ? 2034 HOH A O   1 
HETATM 6457 O  O   . HOH K 7 .   ? -14.049 -9.120  -17.953 1.00   13.18  ? 2035 HOH A O   1 
HETATM 6458 O  O   . HOH K 7 .   ? -6.533  -1.803  -13.534 1.00   6.37   ? 2036 HOH A O   1 
HETATM 6459 O  O   . HOH K 7 .   ? 1.559   -2.010  -8.461  1.00   13.05  ? 2037 HOH A O   1 
HETATM 6460 O  O   . HOH K 7 .   ? 4.461   -1.467  -8.180  1.00   11.34  ? 2038 HOH A O   1 
HETATM 6461 O  O   . HOH K 7 .   ? 10.025  -1.899  -8.653  1.00   24.53  ? 2039 HOH A O   1 
HETATM 6462 O  O   . HOH K 7 .   ? 6.321   -3.450  -8.197  1.00   19.50  ? 2040 HOH A O   1 
HETATM 6463 O  O   . HOH K 7 .   ? 16.517  -0.907  -12.635 1.00   21.23  ? 2041 HOH A O   1 
HETATM 6464 O  O   . HOH K 7 .   ? 11.021  -4.323  -8.928  1.00   22.81  ? 2042 HOH A O   1 
HETATM 6465 O  O   . HOH K 7 .   ? 14.783  -8.338  -11.740 1.00   19.15  ? 2043 HOH A O   1 
HETATM 6466 O  O   . HOH K 7 .   ? -1.592  -26.608 -17.577 1.00   28.12  ? 2044 HOH A O   1 
HETATM 6467 O  O   . HOH K 7 .   ? -4.896  -24.743 -14.992 1.00   20.17  ? 2045 HOH A O   1 
HETATM 6468 O  O   . HOH K 7 .   ? -0.871  -20.463 -10.765 1.00   15.54  ? 2046 HOH A O   1 
HETATM 6469 O  O   . HOH K 7 .   ? -7.752  -18.925 -7.774  1.00   24.25  ? 2047 HOH A O   1 
HETATM 6470 O  O   . HOH K 7 .   ? -9.106  -25.997 -14.952 1.00   21.94  ? 2048 HOH A O   1 
HETATM 6471 O  O   . HOH K 7 .   ? -7.140  -24.633 -21.309 1.00   23.11  ? 2049 HOH A O   1 
HETATM 6472 O  O   . HOH K 7 .   ? -6.213  -23.873 -23.659 1.00   35.85  ? 2050 HOH A O   1 
HETATM 6473 O  O   . HOH K 7 .   ? -9.529  -26.280 -28.850 1.00   39.63  ? 2051 HOH A O   1 
HETATM 6474 O  O   . HOH K 7 .   ? -6.608  -20.251 -29.690 1.00   13.92  ? 2052 HOH A O   1 
HETATM 6475 O  O   . HOH K 7 .   ? -6.710  -20.071 -33.951 1.00   45.53  ? 2053 HOH A O   1 
HETATM 6476 O  O   . HOH K 7 .   ? -8.122  -17.865 -29.158 1.00   15.50  ? 2054 HOH A O   1 
HETATM 6477 O  O   . HOH K 7 .   ? -10.065 -14.746 -34.289 1.00   17.17  ? 2055 HOH A O   1 
HETATM 6478 O  O   . HOH K 7 .   ? -12.718 -13.117 -26.969 1.00   20.46  ? 2056 HOH A O   1 
HETATM 6479 O  O   . HOH K 7 .   ? -8.241  -17.915 -26.459 1.00   12.11  ? 2057 HOH A O   1 
HETATM 6480 O  O   . HOH K 7 .   ? -4.830  -5.952  -24.194 1.00   26.40  ? 2058 HOH A O   1 
HETATM 6481 O  O   . HOH K 7 .   ? 3.491   6.487   -22.399 1.00   33.99  ? 2059 HOH A O   1 
HETATM 6482 O  O   . HOH K 7 .   ? 10.466  -16.744 -37.577 1.00   31.59  ? 2060 HOH A O   1 
HETATM 6483 O  O   . HOH L 7 .   ? -23.329 1.854   -36.126 1.00   24.59  ? 2001 HOH B O   1 
HETATM 6484 O  O   . HOH L 7 .   ? -23.473 4.017   -24.367 1.00   18.65  ? 2002 HOH B O   1 
HETATM 6485 O  O   . HOH L 7 .   ? -30.903 -2.379  -31.046 1.00   40.98  ? 2003 HOH B O   1 
HETATM 6486 O  O   . HOH L 7 .   ? -17.057 -2.113  -41.335 1.00   19.28  ? 2004 HOH B O   1 
HETATM 6487 O  O   . HOH L 7 .   ? -20.643 0.134   -41.915 1.00   21.40  ? 2005 HOH B O   1 
HETATM 6488 O  O   . HOH L 7 .   ? -15.977 1.480   -34.237 1.00   12.46  ? 2006 HOH B O   1 
HETATM 6489 O  O   . HOH L 7 .   ? -24.416 6.385   -33.730 1.00   47.10  ? 2007 HOH B O   1 
HETATM 6490 O  O   . HOH L 7 .   ? -14.919 14.832  -21.197 1.00   31.67  ? 2008 HOH B O   1 
HETATM 6491 O  O   . HOH L 7 .   ? -12.209 14.986  -21.620 1.00   15.18  ? 2009 HOH B O   1 
HETATM 6492 O  O   . HOH L 7 .   ? -11.984 13.367  -37.406 1.00   23.65  ? 2010 HOH B O   1 
HETATM 6493 O  O   . HOH L 7 .   ? -8.610  12.196  -31.606 1.00   10.05  ? 2011 HOH B O   1 
HETATM 6494 O  O   . HOH L 7 .   ? -19.560 4.110   -40.427 1.00   31.09  ? 2012 HOH B O   1 
HETATM 6495 O  O   . HOH L 7 .   ? -11.821 9.008   -38.618 1.00   18.92  ? 2013 HOH B O   1 
HETATM 6496 O  O   . HOH L 7 .   ? -8.016  11.712  -38.457 1.00   18.58  ? 2014 HOH B O   1 
HETATM 6497 O  O   . HOH L 7 .   ? -3.157  10.291  -35.183 1.00   12.74  ? 2015 HOH B O   1 
HETATM 6498 O  O   . HOH L 7 .   ? -7.672  -1.630  -20.539 1.00   8.45   ? 2016 HOH B O   1 
HETATM 6499 O  O   . HOH L 7 .   ? -23.776 -2.707  -18.700 1.00   18.65  ? 2017 HOH B O   1 
HETATM 6500 O  O   . HOH L 7 .   ? -8.480  5.016   -45.678 1.00   41.17  ? 2018 HOH B O   1 
HETATM 6501 O  O   . HOH L 7 .   ? -3.554  3.570   -49.539 1.00   18.34  ? 2019 HOH B O   1 
HETATM 6502 O  O   . HOH L 7 .   ? -15.964 -7.105  -18.315 1.00   19.80  ? 2020 HOH B O   1 
HETATM 6503 O  O   . HOH L 7 .   ? -20.382 -9.395  -17.358 1.00   15.36  ? 2021 HOH B O   1 
HETATM 6504 O  O   . HOH L 7 .   ? -9.967  -4.384  -20.787 1.00   22.39  ? 2022 HOH B O   1 
HETATM 6505 O  O   . HOH L 7 .   ? -21.643 -7.774  -33.394 1.00   24.32  ? 2023 HOH B O   1 
HETATM 6506 O  O   . HOH L 7 .   ? -21.088 -17.145 -35.091 1.00   45.75  ? 2024 HOH B O   1 
HETATM 6507 O  O   . HOH L 7 .   ? -28.142 -6.539  -26.360 1.00   23.02  ? 2025 HOH B O   1 
HETATM 6508 O  O   . HOH L 7 .   ? -28.799 5.383   -15.936 1.00   39.60  ? 2026 HOH B O   1 
HETATM 6509 O  O   . HOH L 7 .   ? -12.909 3.201   -22.591 1.00   12.62  ? 2027 HOH B O   1 
HETATM 6510 O  O   . HOH L 7 .   ? 4.342   3.352   -37.027 1.00   22.84  ? 2028 HOH B O   1 
HETATM 6511 O  O   . HOH M 7 .   ? 11.752  11.606  -15.193 1.00   25.74  ? 2001 HOH C O   1 
HETATM 6512 O  O   . HOH M 7 .   ? 11.475  15.711  -14.389 1.00   23.64  ? 2002 HOH C O   1 
HETATM 6513 O  O   . HOH M 7 .   ? 8.745   7.539   -8.501  1.00   24.62  ? 2003 HOH C O   1 
HETATM 6514 O  O   . HOH M 7 .   ? 9.333   14.480  -7.628  1.00   23.87  ? 2004 HOH C O   1 
HETATM 6515 O  O   . HOH M 7 .   ? 2.061   15.697  -8.208  1.00   11.18  ? 2005 HOH C O   1 
HETATM 6516 O  O   . HOH M 7 .   ? 3.634   17.355  -15.697 1.00   24.77  ? 2006 HOH C O   1 
HETATM 6517 O  O   . HOH M 7 .   ? 2.037   9.886   -15.775 1.00   17.29  ? 2007 HOH C O   1 
HETATM 6518 O  O   . HOH M 7 .   ? -10.290 -7.138  -4.144  1.00   21.03  ? 2008 HOH C O   1 
HETATM 6519 O  O   . HOH M 7 .   ? -16.977 0.692   -0.099  1.00   5.38   ? 2009 HOH C O   1 
HETATM 6520 O  O   . HOH M 7 .   ? -15.529 -7.369  5.296   1.00   38.88  ? 2010 HOH C O   1 
HETATM 6521 O  O   . HOH M 7 .   ? -13.202 -8.701  5.212   1.00   21.54  ? 2011 HOH C O   1 
HETATM 6522 O  O   . HOH M 7 .   ? -16.488 -9.569  5.563   1.00   32.30  ? 2012 HOH C O   1 
HETATM 6523 O  O   . HOH M 7 .   ? -19.992 -1.451  3.186   1.00   21.93  ? 2013 HOH C O   1 
HETATM 6524 O  O   . HOH M 7 .   ? -23.416 -3.627  2.342   1.00   20.36  ? 2014 HOH C O   1 
HETATM 6525 O  O   . HOH M 7 .   ? -26.441 2.844   1.129   1.00   21.86  ? 2015 HOH C O   1 
HETATM 6526 O  O   . HOH M 7 .   ? -29.566 3.173   -0.478  1.00   25.26  ? 2016 HOH C O   1 
HETATM 6527 O  O   . HOH M 7 .   ? -19.924 1.927   0.464   1.00   16.35  ? 2017 HOH C O   1 
HETATM 6528 O  O   . HOH M 7 .   ? -11.261 0.816   5.263   1.00   20.58  ? 2018 HOH C O   1 
HETATM 6529 O  O   . HOH M 7 .   ? -5.715  2.401   3.558   1.00   9.02   ? 2019 HOH C O   1 
HETATM 6530 O  O   . HOH M 7 .   ? -0.590  8.806   -7.029  1.00   5.26   ? 2020 HOH C O   1 
HETATM 6531 O  O   . HOH M 7 .   ? 3.043   4.063   -3.926  1.00   10.98  ? 2021 HOH C O   1 
HETATM 6532 O  O   . HOH M 7 .   ? 3.199   10.855  -1.707  1.00   29.51  ? 2022 HOH C O   1 
HETATM 6533 O  O   . HOH M 7 .   ? -3.306  9.820   -0.341  1.00   15.63  ? 2023 HOH C O   1 
HETATM 6534 O  O   . HOH M 7 .   ? -5.427  12.830  -3.014  1.00   8.07   ? 2024 HOH C O   1 
HETATM 6535 O  O   . HOH M 7 .   ? 0.358   14.041  -9.438  1.00   6.78   ? 2025 HOH C O   1 
HETATM 6536 O  O   . HOH M 7 .   ? -4.578  7.618   0.704   1.00   18.49  ? 2026 HOH C O   1 
HETATM 6537 O  O   . HOH M 7 .   ? -7.635  5.391   6.802   1.00   20.53  ? 2027 HOH C O   1 
HETATM 6538 O  O   . HOH M 7 .   ? -9.781  12.988  -1.143  1.00   23.46  ? 2028 HOH C O   1 
HETATM 6539 O  O   . HOH M 7 .   ? -13.744 5.410   -6.030  1.00   8.13   ? 2029 HOH C O   1 
HETATM 6540 O  O   . HOH M 7 .   ? -7.968  12.669  -3.288  1.00   16.26  ? 2030 HOH C O   1 
HETATM 6541 O  O   . HOH M 7 .   ? -5.034  19.096  -6.646  1.00   17.61  ? 2031 HOH C O   1 
HETATM 6542 O  O   . HOH M 7 .   ? -4.640  14.718  -4.708  1.00   17.64  ? 2032 HOH C O   1 
HETATM 6543 O  O   . HOH M 7 .   ? -1.717  13.909  -1.581  1.00   15.68  ? 2033 HOH C O   1 
HETATM 6544 O  O   . HOH M 7 .   ? -2.939  14.558  -10.832 1.00   10.55  ? 2034 HOH C O   1 
HETATM 6545 O  O   . HOH M 7 .   ? -10.830 1.324   -21.298 1.00   23.55  ? 2035 HOH C O   1 
HETATM 6546 O  O   . HOH M 7 .   ? -31.229 -9.754  -12.066 1.00   26.95  ? 2036 HOH C O   1 
HETATM 6547 O  O   . HOH M 7 .   ? -26.340 -6.472  -6.100  1.00   13.64  ? 2037 HOH C O   1 
HETATM 6548 O  O   . HOH M 7 .   ? -16.628 14.693  -18.800 1.00   16.98  ? 2038 HOH C O   1 
HETATM 6549 O  O   . HOH M 7 .   ? -14.482 18.053  -8.818  1.00   22.57  ? 2039 HOH C O   1 
HETATM 6550 O  O   . HOH M 7 .   ? -20.642 11.076  -20.386 1.00   22.75  ? 2040 HOH C O   1 
HETATM 6551 O  O   . HOH M 7 .   ? -28.446 -12.319 -11.338 1.00   28.79  ? 2041 HOH C O   1 
HETATM 6552 O  O   . HOH M 7 .   ? -24.826 -16.697 -13.480 1.00   30.76  ? 2042 HOH C O   1 
HETATM 6553 O  O   . HOH M 7 .   ? -22.974 -11.679 -16.947 1.00   12.42  ? 2043 HOH C O   1 
HETATM 6554 O  O   . HOH M 7 .   ? -22.575 -12.988 -19.174 1.00   14.93  ? 2044 HOH C O   1 
HETATM 6555 O  O   . HOH M 7 .   ? -19.462 -8.752  -15.116 1.00   11.11  ? 2045 HOH C O   1 
HETATM 6556 O  O   . HOH M 7 .   ? -6.387  20.487  -18.103 1.00   19.37  ? 2046 HOH C O   1 
HETATM 6557 O  O   . HOH M 7 .   ? -6.275  23.350  -14.368 1.00   14.08  ? 2047 HOH C O   1 
HETATM 6558 O  O   . HOH M 7 .   ? -10.885 19.473  -5.092  1.00   18.33  ? 2048 HOH C O   1 
HETATM 6559 O  O   . HOH M 7 .   ? -16.624 16.579  -6.847  1.00   20.45  ? 2049 HOH C O   1 
HETATM 6560 O  O   . HOH M 7 .   ? -27.768 3.812   -11.729 1.00   19.73  ? 2050 HOH C O   1 
HETATM 6561 O  O   . HOH M 7 .   ? -29.384 -2.835  -3.169  1.00   40.66  ? 2051 HOH C O   1 
HETATM 6562 O  O   . HOH M 7 .   ? -30.071 1.193   -9.394  1.00   26.71  ? 2052 HOH C O   1 
HETATM 6563 O  O   . HOH M 7 .   ? -22.306 -12.242 -3.364  1.00   17.39  ? 2053 HOH C O   1 
HETATM 6564 O  O   . HOH M 7 .   ? -16.534 -7.692  -1.096  1.00   21.87  ? 2054 HOH C O   1 
HETATM 6565 O  O   . HOH M 7 .   ? -9.672  -15.526 -0.153  1.00   33.37  ? 2055 HOH C O   1 
HETATM 6566 O  O   . HOH M 7 .   ? -13.462 -9.655  -4.434  1.00   18.29  ? 2056 HOH C O   1 
HETATM 6567 O  O   . HOH M 7 .   ? -6.141  -12.800 -5.319  1.00   24.65  ? 2057 HOH C O   1 
HETATM 6568 O  O   . HOH M 7 .   ? -13.881 -7.645  -5.220  1.00   20.57  ? 2058 HOH C O   1 
HETATM 6569 O  O   . HOH M 7 .   ? -3.410  17.097  -22.128 1.00   21.02  ? 2059 HOH C O   1 
HETATM 6570 O  O   . HOH M 7 .   ? -5.500  19.900  -20.659 1.00   32.55  ? 2060 HOH C O   1 
HETATM 6571 O  O   . HOH N 7 .   ? 5.470   14.956  27.478  1.00   39.42  ? 2001 HOH D O   1 
HETATM 6572 O  O   . HOH N 7 .   ? 1.654   16.894  27.753  1.00   48.73  ? 2002 HOH D O   1 
HETATM 6573 O  O   . HOH N 7 .   ? -13.955 -10.867 28.209  1.00   14.07  ? 2003 HOH D O   1 
HETATM 6574 O  O   . HOH N 7 .   ? -22.167 -7.097  21.129  1.00   13.11  ? 2004 HOH D O   1 
HETATM 6575 O  O   . HOH N 7 .   ? -16.542 -12.226 33.725  1.00   28.15  ? 2005 HOH D O   1 
HETATM 6576 O  O   . HOH N 7 .   ? -24.602 -4.665  17.243  1.00   22.53  ? 2006 HOH D O   1 
HETATM 6577 O  O   . HOH N 7 .   ? -24.986 -9.628  19.102  1.00   37.06  ? 2007 HOH D O   1 
HETATM 6578 O  O   . HOH N 7 .   ? -25.153 -4.495  12.723  1.00   13.40  ? 2008 HOH D O   1 
HETATM 6579 O  O   . HOH N 7 .   ? -22.992 -7.994  18.787  1.00   26.59  ? 2009 HOH D O   1 
HETATM 6580 O  O   . HOH N 7 .   ? -20.624 -3.684  31.837  1.00   25.26  ? 2010 HOH D O   1 
HETATM 6581 O  O   . HOH N 7 .   ? -5.528  0.685   33.301  1.00   11.61  ? 2011 HOH D O   1 
HETATM 6582 O  O   . HOH N 7 .   ? -14.494 4.997   30.595  1.00   23.10  ? 2012 HOH D O   1 
HETATM 6583 O  O   . HOH N 7 .   ? -10.502 7.779   31.610  1.00   36.67  ? 2013 HOH D O   1 
HETATM 6584 O  O   . HOH N 7 .   ? -8.513  5.168   31.827  1.00   20.01  ? 2014 HOH D O   1 
HETATM 6585 O  O   . HOH N 7 .   ? -8.877  11.097  22.517  1.00   26.05  ? 2015 HOH D O   1 
HETATM 6586 O  O   . HOH N 7 .   ? -18.869 1.561   31.120  1.00   31.92  ? 2016 HOH D O   1 
HETATM 6587 O  O   . HOH N 7 .   ? -21.927 -0.658  29.770  1.00   29.77  ? 2017 HOH D O   1 
HETATM 6588 O  O   . HOH N 7 .   ? -15.840 -2.821  18.751  1.00   7.67   ? 2018 HOH D O   1 
HETATM 6589 O  O   . HOH N 7 .   ? -23.007 0.221   17.416  1.00   24.90  ? 2019 HOH D O   1 
HETATM 6590 O  O   . HOH N 7 .   ? -8.822  10.516  19.962  1.00   16.73  ? 2020 HOH D O   1 
HETATM 6591 O  O   . HOH N 7 .   ? -12.608 10.941  21.357  1.00   17.18  ? 2021 HOH D O   1 
HETATM 6592 O  O   . HOH N 7 .   ? -12.890 -22.019 16.326  1.00   19.05  ? 2022 HOH D O   1 
HETATM 6593 O  O   . HOH N 7 .   ? -14.823 -5.283  6.791   1.00   15.08  ? 2023 HOH D O   1 
HETATM 6594 O  O   . HOH N 7 .   ? -11.215 1.446   7.764   1.00   8.08   ? 2024 HOH D O   1 
HETATM 6595 O  O   . HOH N 7 .   ? -18.192 8.711   11.044  1.00   14.94  ? 2025 HOH D O   1 
HETATM 6596 O  O   . HOH N 7 .   ? -16.544 18.288  4.896   1.00   9.96   ? 2026 HOH D O   1 
HETATM 6597 O  O   . HOH N 7 .   ? -19.200 15.244  5.584   1.00   37.09  ? 2027 HOH D O   1 
HETATM 6598 O  O   . HOH N 7 .   ? -20.792 3.713   9.703   1.00   35.97  ? 2028 HOH D O   1 
HETATM 6599 O  O   . HOH N 7 .   ? -15.696 0.057   2.258   1.00   23.09  ? 2029 HOH D O   1 
HETATM 6600 O  O   . HOH N 7 .   ? -8.891  -0.646  5.331   1.00   12.66  ? 2030 HOH D O   1 
HETATM 6601 O  O   . HOH N 7 .   ? -9.839  -5.416  9.565   1.00   18.53  ? 2031 HOH D O   1 
HETATM 6602 O  O   . HOH N 7 .   ? -12.934 -22.998 7.209   1.00   16.04  ? 2032 HOH D O   1 
HETATM 6603 O  O   . HOH N 7 .   ? -11.397 -28.140 12.616  1.00   24.97  ? 2033 HOH D O   1 
HETATM 6604 O  O   . HOH N 7 .   ? -12.756 -24.852 18.068  1.00   16.53  ? 2034 HOH D O   1 
HETATM 6605 O  O   . HOH N 7 .   ? -4.872  -15.575 16.410  1.00   19.78  ? 2035 HOH D O   1 
HETATM 6606 O  O   . HOH N 7 .   ? -4.565  1.866   7.114   1.00   10.90  ? 2036 HOH D O   1 
HETATM 6607 O  O   . HOH N 7 .   ? -3.352  6.332   5.479   1.00   22.00  ? 2037 HOH D O   1 
HETATM 6608 O  O   . HOH N 7 .   ? -7.760  9.436   7.480   1.00   24.68  ? 2038 HOH D O   1 
HETATM 6609 O  O   . HOH N 7 .   ? -5.189  4.663   6.997   1.00   16.37  ? 2039 HOH D O   1 
HETATM 6610 O  O   . HOH N 7 .   ? -5.411  12.513  10.112  1.00   24.37  ? 2040 HOH D O   1 
HETATM 6611 O  O   . HOH N 7 .   ? -10.399 9.604   7.548   1.00   18.86  ? 2041 HOH D O   1 
HETATM 6612 O  O   . HOH N 7 .   ? -9.441  15.863  11.158  1.00   15.59  ? 2042 HOH D O   1 
HETATM 6613 O  O   . HOH N 7 .   ? -15.588 11.306  10.532  1.00   23.85  ? 2043 HOH D O   1 
HETATM 6614 O  O   . HOH N 7 .   ? -18.183 10.814  15.604  1.00   15.41  ? 2044 HOH D O   1 
HETATM 6615 O  O   . HOH N 7 .   ? -20.296 -7.871  9.389   1.00   17.94  ? 2045 HOH D O   1 
HETATM 6616 O  O   . HOH N 7 .   ? -25.721 -11.117 16.625  1.00   24.29  ? 2046 HOH D O   1 
HETATM 6617 O  O   . HOH N 7 .   ? -22.966 -13.342 13.733  1.00   24.91  ? 2047 HOH D O   1 
HETATM 6618 O  O   . HOH N 7 .   ? -20.916 -13.273 5.461   1.00   29.36  ? 2048 HOH D O   1 
HETATM 6619 O  O   . HOH N 7 .   ? -20.827 -20.271 11.864  1.00   22.03  ? 2049 HOH D O   1 
HETATM 6620 O  O   . HOH N 7 .   ? -21.584 -13.063 18.802  1.00   21.75  ? 2050 HOH D O   1 
HETATM 6621 O  O   . HOH N 7 .   ? -18.916 -12.333 25.169  1.00   21.70  ? 2051 HOH D O   1 
HETATM 6622 O  O   . HOH N 7 .   ? -17.988 -12.998 28.421  1.00   19.41  ? 2052 HOH D O   1 
HETATM 6623 O  O   . HOH N 7 .   ? -11.087 -22.994 31.823  1.00   26.71  ? 2053 HOH D O   1 
HETATM 6624 O  O   . HOH N 7 .   ? -17.078 -23.288 28.455  1.00   39.57  ? 2054 HOH D O   1 
HETATM 6625 O  O   . HOH N 7 .   ? -15.088 -13.210 27.648  1.00   17.66  ? 2055 HOH D O   1 
HETATM 6626 O  O   . HOH N 7 .   ? -11.588 -13.991 32.945  1.00   22.49  ? 2056 HOH D O   1 
HETATM 6627 O  O   . HOH N 7 .   ? -9.280  -15.521 25.968  1.00   19.53  ? 2057 HOH D O   1 
HETATM 6628 O  O   . HOH N 7 .   ? -15.376 -13.508 24.977  1.00   12.11  ? 2058 HOH D O   1 
HETATM 6629 O  O   . HOH N 7 .   ? -5.246  -5.832  23.179  1.00   25.99  ? 2059 HOH D O   1 
HETATM 6630 O  O   . HOH O 7 .   ? 14.276  11.599  23.924  1.00   45.23  ? 2001 HOH E O   1 
HETATM 6631 O  O   . HOH O 7 .   ? 9.641   12.287  27.504  1.00   39.83  ? 2002 HOH E O   1 
HETATM 6632 O  O   . HOH O 7 .   ? 8.603   -19.480 34.774  1.00   30.87  ? 2003 HOH E O   1 
HETATM 6633 O  O   . HOH O 7 .   ? 11.111  -18.784 23.168  1.00   12.69  ? 2004 HOH E O   1 
HETATM 6634 O  O   . HOH O 7 .   ? 10.544  -25.404 26.381  1.00   42.26  ? 2005 HOH E O   1 
HETATM 6635 O  O   . HOH O 7 .   ? 0.138   -27.199 39.110  1.00   30.16  ? 2006 HOH E O   1 
HETATM 6636 O  O   . HOH O 7 .   ? 5.972   -17.283 40.893  1.00   25.75  ? 2007 HOH E O   1 
HETATM 6637 O  O   . HOH O 7 .   ? 17.487  -14.359 32.737  1.00   22.26  ? 2008 HOH E O   1 
HETATM 6638 O  O   . HOH O 7 .   ? 19.857  -10.730 25.876  1.00   21.46  ? 2009 HOH E O   1 
HETATM 6639 O  O   . HOH O 7 .   ? 12.620  -1.964  30.290  1.00   11.81  ? 2010 HOH E O   1 
HETATM 6640 O  O   . HOH O 7 .   ? 18.472  -9.713  35.512  1.00   38.51  ? 2011 HOH E O   1 
HETATM 6641 O  O   . HOH O 7 .   ? 5.725   -12.868 33.184  1.00   15.26  ? 2012 HOH E O   1 
HETATM 6642 O  O   . HOH O 7 .   ? 10.859  -5.791  37.339  1.00   22.07  ? 2013 HOH E O   1 
HETATM 6643 O  O   . HOH O 7 .   ? 8.649   2.352   33.900  1.00   14.83  ? 2014 HOH E O   1 
HETATM 6644 O  O   . HOH O 7 .   ? -0.525  -6.500  19.439  1.00   20.30  ? 2015 HOH E O   1 
HETATM 6645 O  O   . HOH O 7 .   ? -6.673  -28.353 29.737  1.00   33.34  ? 2016 HOH E O   1 
HETATM 6646 O  O   . HOH O 7 .   ? -7.711  -4.323  35.782  1.00   18.53  ? 2017 HOH E O   1 
HETATM 6647 O  O   . HOH O 7 .   ? 2.397   -7.004  41.394  1.00   43.95  ? 2018 HOH E O   1 
HETATM 6648 O  O   . HOH O 7 .   ? 0.488   -12.160 49.771  1.00   23.49  ? 2019 HOH E O   1 
HETATM 6649 O  O   . HOH O 7 .   ? 1.848   -11.025 43.086  1.00   32.14  ? 2020 HOH E O   1 
HETATM 6650 O  O   . HOH O 7 .   ? -6.632  -11.586 41.209  1.00   21.48  ? 2021 HOH E O   1 
HETATM 6651 O  O   . HOH O 7 .   ? -2.090  -33.178 14.228  1.00   38.85  ? 2022 HOH E O   1 
HETATM 6652 O  O   . HOH O 7 .   ? 0.193   -33.434 17.990  1.00   28.81  ? 2023 HOH E O   1 
HETATM 6653 O  O   . HOH O 7 .   ? -4.404  -33.528 22.208  1.00   33.60  ? 2024 HOH E O   1 
HETATM 6654 O  O   . HOH O 7 .   ? -2.435  -21.582 16.058  1.00   13.04  ? 2025 HOH E O   1 
HETATM 6655 O  O   . HOH O 7 .   ? -1.881  -16.341 16.997  1.00   19.88  ? 2026 HOH E O   1 
HETATM 6656 O  O   . HOH O 7 .   ? 2.730   6.552   40.691  1.00   26.34  ? 2027 HOH E O   1 
HETATM 6657 O  O   . HOH O 7 .   ? -2.729  0.881   37.820  1.00   29.14  ? 2028 HOH E O   1 
HETATM 6658 O  O   . HOH O 7 .   ? -2.347  -27.516 37.442  1.00   33.26  ? 2029 HOH E O   1 
HETATM 6659 O  O   . HOH O 7 .   ? -0.441  -21.437 32.235  1.00   26.43  ? 2030 HOH E O   1 
HETATM 6660 O  O   . HOH O 7 .   ? 4.581   -25.793 31.188  1.00   38.88  ? 2031 HOH E O   1 
HETATM 6661 O  O   . HOH O 7 .   ? 3.341   -26.690 25.198  1.00   25.60  ? 2032 HOH E O   1 
HETATM 6662 O  O   . HOH O 7 .   ? 13.101  -25.824 17.938  1.00   19.70  ? 2033 HOH E O   1 
HETATM 6663 O  O   . HOH O 7 .   ? 13.340  -18.445 16.469  1.00   24.69  ? 2034 HOH E O   1 
HETATM 6664 O  O   . HOH O 7 .   ? 6.114   -9.296  21.409  1.00   17.77  ? 2035 HOH E O   1 
HETATM 6665 O  O   . HOH P 7 .   ? 11.075  14.259  7.210   1.00   27.48  ? 2001 HOH F O   1 
HETATM 6666 O  O   . HOH P 7 .   ? 8.238   11.372  4.415   1.00   20.87  ? 2002 HOH F O   1 
HETATM 6667 O  O   . HOH P 7 .   ? 3.956   11.770  4.915   1.00   21.46  ? 2003 HOH F O   1 
HETATM 6668 O  O   . HOH P 7 .   ? 11.582  9.371   6.919   1.00   11.74  ? 2004 HOH F O   1 
HETATM 6669 O  O   . HOH P 7 .   ? 7.348   13.968  10.671  1.00   18.37  ? 2005 HOH F O   1 
HETATM 6670 O  O   . HOH P 7 .   ? 6.131   6.987   14.503  1.00   19.89  ? 2006 HOH F O   1 
HETATM 6671 O  O   . HOH P 7 .   ? 5.334   -14.037 -1.152  1.00   2.00   ? 2007 HOH F O   1 
HETATM 6672 O  O   . HOH P 7 .   ? -4.439  -14.310 -6.626  1.00   34.17  ? 2008 HOH F O   1 
HETATM 6673 O  O   . HOH P 7 .   ? -3.992  -17.082 -6.820  1.00   33.86  ? 2009 HOH F O   1 
HETATM 6674 O  O   . HOH P 7 .   ? 3.028   -21.000 -4.109  1.00   29.96  ? 2010 HOH F O   1 
HETATM 6675 O  O   . HOH P 7 .   ? 4.149   -22.266 -2.657  1.00   21.84  ? 2011 HOH F O   1 
HETATM 6676 O  O   . HOH P 7 .   ? 7.936   -16.176 -1.618  1.00   13.68  ? 2012 HOH F O   1 
HETATM 6677 O  O   . HOH P 7 .   ? 13.678  -15.306 -0.399  1.00   23.34  ? 2013 HOH F O   1 
HETATM 6678 O  O   . HOH P 7 .   ? 8.380   -9.156  4.657   1.00   11.25  ? 2014 HOH F O   1 
HETATM 6679 O  O   . HOH P 7 .   ? 2.622   -3.153  -4.771  1.00   15.44  ? 2015 HOH F O   1 
HETATM 6680 O  O   . HOH P 7 .   ? 6.403   4.166   5.833   1.00   7.47   ? 2016 HOH F O   1 
HETATM 6681 O  O   . HOH P 7 .   ? 4.130   2.160   -0.685  1.00   29.21  ? 2017 HOH F O   1 
HETATM 6682 O  O   . HOH P 7 .   ? 0.440   5.833   2.695   1.00   10.83  ? 2018 HOH F O   1 
HETATM 6683 O  O   . HOH P 7 .   ? 7.208   8.934   0.611   1.00   26.59  ? 2019 HOH F O   1 
HETATM 6684 O  O   . HOH P 7 .   ? 9.031   6.879   -0.252  1.00   27.03  ? 2020 HOH F O   1 
HETATM 6685 O  O   . HOH P 7 .   ? 8.687   2.222   -0.638  1.00   12.25  ? 2021 HOH F O   1 
HETATM 6686 O  O   . HOH P 7 .   ? 12.065  1.225   1.775   1.00   9.29   ? 2022 HOH F O   1 
HETATM 6687 O  O   . HOH P 7 .   ? 10.740  7.238   8.095   1.00   14.36  ? 2023 HOH F O   1 
HETATM 6688 O  O   . HOH P 7 .   ? 13.791  -9.324  -1.420  1.00   18.52  ? 2024 HOH F O   1 
HETATM 6689 O  O   . HOH P 7 .   ? 13.896  -2.643  -0.279  1.00   28.67  ? 2025 HOH F O   1 
HETATM 6690 O  O   . HOH P 7 .   ? 12.911  -1.183  2.306   1.00   13.54  ? 2026 HOH F O   1 
HETATM 6691 O  O   . HOH P 7 .   ? 13.406  2.713   3.748   1.00   12.02  ? 2027 HOH F O   1 
HETATM 6692 O  O   . HOH P 7 .   ? 11.552  5.182   0.461   1.00   19.98  ? 2028 HOH F O   1 
HETATM 6693 O  O   . HOH P 7 .   ? 12.273  4.379   9.470   1.00   8.84   ? 2029 HOH F O   1 
HETATM 6694 O  O   . HOH P 7 .   ? 3.488   -8.301  20.130  1.00   17.07  ? 2030 HOH F O   1 
HETATM 6695 O  O   . HOH P 7 .   ? -1.823  -6.642  16.882  1.00   15.45  ? 2031 HOH F O   1 
HETATM 6696 O  O   . HOH P 7 .   ? -5.005  -27.978 4.959   1.00   19.59  ? 2032 HOH F O   1 
HETATM 6697 O  O   . HOH P 7 .   ? 20.980  -8.692  13.166  1.00   17.83  ? 2033 HOH F O   1 
HETATM 6698 O  O   . HOH P 7 .   ? 20.465  -4.940  7.329   1.00   17.79  ? 2034 HOH F O   1 
HETATM 6699 O  O   . HOH P 7 .   ? 19.630  -16.595 11.835  1.00   18.78  ? 2035 HOH F O   1 
HETATM 6700 O  O   . HOH P 7 .   ? 19.133  -16.500 15.367  1.00   32.09  ? 2036 HOH F O   1 
HETATM 6701 O  O   . HOH P 7 .   ? 13.131  -21.012 13.119  1.00   24.26  ? 2037 HOH F O   1 
HETATM 6702 O  O   . HOH P 7 .   ? 16.061  -13.441 19.316  1.00   25.76  ? 2038 HOH F O   1 
HETATM 6703 O  O   . HOH P 7 .   ? 4.959   -21.573 17.288  1.00   12.09  ? 2039 HOH F O   1 
HETATM 6704 O  O   . HOH P 7 .   ? -1.487  -29.956 8.625   1.00   27.99  ? 2040 HOH F O   1 
HETATM 6705 O  O   . HOH P 7 .   ? -9.546  -30.459 9.649   1.00   43.06  ? 2041 HOH F O   1 
HETATM 6706 O  O   . HOH P 7 .   ? -8.387  -24.982 12.586  1.00   35.68  ? 2042 HOH F O   1 
HETATM 6707 O  O   . HOH P 7 .   ? -3.433  -24.303 15.768  1.00   17.36  ? 2043 HOH F O   1 
HETATM 6708 O  O   . HOH P 7 .   ? -5.090  -24.970 17.877  1.00   14.31  ? 2044 HOH F O   1 
HETATM 6709 O  O   . HOH P 7 .   ? -2.033  -19.921 13.906  1.00   8.69   ? 2045 HOH F O   1 
HETATM 6710 O  O   . HOH P 7 .   ? 20.608  -1.229  18.058  1.00   24.54  ? 2046 HOH F O   1 
HETATM 6711 O  O   . HOH P 7 .   ? 19.352  3.459   16.917  1.00   30.84  ? 2047 HOH F O   1 
HETATM 6712 O  O   . HOH P 7 .   ? 21.779  4.909   13.196  1.00   10.73  ? 2048 HOH F O   1 
HETATM 6713 O  O   . HOH P 7 .   ? 20.241  -7.396  5.563   1.00   20.03  ? 2049 HOH F O   1 
HETATM 6714 O  O   . HOH P 7 .   ? 14.977  -15.079 4.802   1.00   30.15  ? 2050 HOH F O   1 
HETATM 6715 O  O   . HOH P 7 .   ? 12.896  -22.532 10.565  1.00   21.90  ? 2051 HOH F O   1 
HETATM 6716 O  O   . HOH P 7 .   ? 7.505   -27.716 2.061   1.00   23.39  ? 2052 HOH F O   1 
HETATM 6717 O  O   . HOH P 7 .   ? 10.981  -25.632 8.249   1.00   18.23  ? 2053 HOH F O   1 
HETATM 6718 O  O   . HOH P 7 .   ? -4.194  -24.272 2.217   1.00   15.96  ? 2054 HOH F O   1 
HETATM 6719 O  O   . HOH P 7 .   ? -13.535 -19.183 1.610   1.00   16.99  ? 2055 HOH F O   1 
HETATM 6720 O  O   . HOH P 7 .   ? -15.794 -14.032 6.495   1.00   25.79  ? 2056 HOH F O   1 
HETATM 6721 O  O   . HOH P 7 .   ? -14.219 -11.515 7.823   1.00   30.59  ? 2057 HOH F O   1 
HETATM 6722 O  O   . HOH P 7 .   ? -3.442  -14.573 3.945   1.00   33.86  ? 2058 HOH F O   1 
HETATM 6723 O  O   . HOH P 7 .   ? -0.885  -5.509  12.374  1.00   9.84   ? 2059 HOH F O   1 
HETATM 6724 O  O   . HOH P 7 .   ? 15.166  4.745   20.822  1.00   26.59  ? 2060 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   90  90  GLN GLN A . n 
A 1 2   PRO 2   91  91  PRO PRO A . n 
A 1 3   ARG 3   92  92  ARG ARG A . n 
A 1 4   PRO 4   93  93  PRO PRO A . n 
A 1 5   ALA 5   94  94  ALA ALA A . n 
A 1 6   PHE 6   95  95  PHE PHE A . n 
A 1 7   SER 7   96  96  SER SER A . n 
A 1 8   ALA 8   97  97  ALA ALA A . n 
A 1 9   ILE 9   98  98  ILE ILE A . n 
A 1 10  ARG 10  99  99  ARG ARG A . n 
A 1 11  ARG 11  100 100 ARG ARG A . n 
A 1 12  ASN 12  101 101 ASN ASN A . n 
A 1 13  PRO 13  102 102 PRO PRO A . n 
A 1 14  PRO 14  103 103 PRO PRO A . n 
A 1 15  MET 15  104 104 MET MET A . n 
A 1 16  GLY 16  105 105 GLY GLY A . n 
A 1 17  GLY 17  106 106 GLY GLY A . n 
A 1 18  ASN 18  107 107 ASN ASN A . n 
A 1 19  VAL 19  108 108 VAL VAL A . n 
A 1 20  VAL 20  109 109 VAL VAL A . n 
A 1 21  ILE 21  110 110 ILE ILE A . n 
A 1 22  PHE 22  111 111 PHE PHE A . n 
A 1 23  ASP 23  112 112 ASP ASP A . n 
A 1 24  THR 24  113 113 THR THR A . n 
A 1 25  VAL 25  114 114 VAL VAL A . n 
A 1 26  ILE 26  115 115 ILE ILE A . n 
A 1 27  THR 27  116 116 THR THR A . n 
A 1 28  ASN 28  117 117 ASN ASN A . n 
A 1 29  GLN 29  118 118 GLN GLN A . n 
A 1 30  GLU 30  119 119 GLU GLU A . n 
A 1 31  GLU 31  120 120 GLU GLU A . n 
A 1 32  PRO 32  121 121 PRO PRO A . n 
A 1 33  TYR 33  122 122 TYR TYR A . n 
A 1 34  GLN 34  123 123 GLN GLN A . n 
A 1 35  ASN 35  124 124 ASN ASN A . n 
A 1 36  HIS 36  125 125 HIS HIS A . n 
A 1 37  SER 37  126 126 SER SER A . n 
A 1 38  GLY 38  127 127 GLY GLY A . n 
A 1 39  ARG 39  128 128 ARG ARG A . n 
A 1 40  PHE 40  129 129 PHE PHE A . n 
A 1 41  VAL 41  130 130 VAL VAL A . n 
A 1 42  CYS 42  131 131 CYS CYS A . n 
A 1 43  THR 43  132 132 THR THR A . n 
A 1 44  VAL 44  133 133 VAL VAL A . n 
A 1 45  PRO 45  134 134 PRO PRO A . n 
A 1 46  GLY 46  135 135 GLY GLY A . n 
A 1 47  TYR 47  136 136 TYR TYR A . n 
A 1 48  TYR 48  137 137 TYR TYR A . n 
A 1 49  TYR 49  138 138 TYR TYR A . n 
A 1 50  PHE 50  139 139 PHE PHE A . n 
A 1 51  THR 51  140 140 THR THR A . n 
A 1 52  PHE 52  141 141 PHE PHE A . n 
A 1 53  GLN 53  142 142 GLN GLN A . n 
A 1 54  VAL 54  143 143 VAL VAL A . n 
A 1 55  LEU 55  144 144 LEU LEU A . n 
A 1 56  SER 56  145 145 SER SER A . n 
A 1 57  GLN 57  146 146 GLN GLN A . n 
A 1 58  TRP 58  147 147 TRP TRP A . n 
A 1 59  GLU 59  148 148 GLU GLU A . n 
A 1 60  ILE 60  149 149 ILE ILE A . n 
A 1 61  CYS 61  150 150 CYS CYS A . n 
A 1 62  LEU 62  151 151 LEU LEU A . n 
A 1 63  SER 63  152 152 SER SER A . n 
A 1 64  ILE 64  153 153 ILE ILE A . n 
A 1 65  VAL 65  154 154 VAL VAL A . n 
A 1 66  SER 66  155 155 SER SER A . n 
A 1 67  SER 67  156 156 SER SER A . n 
A 1 68  SER 68  157 157 SER SER A . n 
A 1 69  ARG 69  158 158 ARG ARG A . n 
A 1 70  GLY 70  159 159 GLY GLY A . n 
A 1 71  GLN 71  160 160 GLN GLN A . n 
A 1 72  VAL 72  161 161 VAL VAL A . n 
A 1 73  ARG 73  162 162 ARG ARG A . n 
A 1 74  ARG 74  163 163 ARG ARG A . n 
A 1 75  SER 75  164 164 SER SER A . n 
A 1 76  LEU 76  165 165 LEU LEU A . n 
A 1 77  GLY 77  166 166 GLY GLY A . n 
A 1 78  PHE 78  167 167 PHE PHE A . n 
A 1 79  CYS 79  168 168 CYS CYS A . n 
A 1 80  ASP 80  169 169 ASP ASP A . n 
A 1 81  THR 81  170 170 THR THR A . n 
A 1 82  THR 82  171 171 THR THR A . n 
A 1 83  ASN 83  172 172 ASN ASN A . n 
A 1 84  LYS 84  173 173 LYS LYS A . n 
A 1 85  GLY 85  174 174 GLY GLY A . n 
A 1 86  LEU 86  175 175 LEU LEU A . n 
A 1 87  PHE 87  176 176 PHE PHE A . n 
A 1 88  GLN 88  177 177 GLN GLN A . n 
A 1 89  VAL 89  178 178 VAL VAL A . n 
A 1 90  VAL 90  179 179 VAL VAL A . n 
A 1 91  SER 91  180 180 SER SER A . n 
A 1 92  GLY 92  181 181 GLY GLY A . n 
A 1 93  GLY 93  182 182 GLY GLY A . n 
A 1 94  MET 94  183 183 MET MET A . n 
A 1 95  VAL 95  184 184 VAL VAL A . n 
A 1 96  LEU 96  185 185 LEU LEU A . n 
A 1 97  GLN 97  186 186 GLN GLN A . n 
A 1 98  LEU 98  187 187 LEU LEU A . n 
A 1 99  GLN 99  188 188 GLN GLN A . n 
A 1 100 GLN 100 189 189 GLN GLN A . n 
A 1 101 GLY 101 190 190 GLY GLY A . n 
A 1 102 ASP 102 191 191 ASP ASP A . n 
A 1 103 GLN 103 192 192 GLN GLN A . n 
A 1 104 VAL 104 193 193 VAL VAL A . n 
A 1 105 TRP 105 194 194 TRP TRP A . n 
A 1 106 VAL 106 195 195 VAL VAL A . n 
A 1 107 GLU 107 196 196 GLU GLU A . n 
A 1 108 LYS 108 197 197 LYS LYS A . n 
A 1 109 ASP 109 198 198 ASP ASP A . n 
A 1 110 PRO 110 199 199 PRO PRO A . n 
A 1 111 LYS 111 200 200 LYS LYS A . n 
A 1 112 LYS 112 201 201 LYS LYS A . n 
A 1 113 GLY 113 202 202 GLY GLY A . n 
A 1 114 HIS 114 203 203 HIS HIS A . n 
A 1 115 ILE 115 204 204 ILE ILE A . n 
A 1 116 TYR 116 205 205 TYR TYR A . n 
A 1 117 GLN 117 206 206 GLN GLN A . n 
A 1 118 GLY 118 207 207 GLY GLY A . n 
A 1 119 SER 119 208 208 SER SER A . n 
A 1 120 GLU 120 209 209 GLU GLU A . n 
A 1 121 ALA 121 210 210 ALA ALA A . n 
A 1 122 ASP 122 211 211 ASP ASP A . n 
A 1 123 SER 123 212 212 SER SER A . n 
A 1 124 VAL 124 213 213 VAL VAL A . n 
A 1 125 PHE 125 214 214 PHE PHE A . n 
A 1 126 SER 126 215 215 SER SER A . n 
A 1 127 GLY 127 216 216 GLY GLY A . n 
A 1 128 PHE 128 217 217 PHE PHE A . n 
A 1 129 LEU 129 218 218 LEU LEU A . n 
A 1 130 ILE 130 219 219 ILE ILE A . n 
A 1 131 PHE 131 220 220 PHE PHE A . n 
A 1 132 PRO 132 221 221 PRO PRO A . n 
A 1 133 SER 133 222 222 SER SER A . n 
A 1 134 ALA 134 223 ?   ?   ?   A . n 
B 2 1   ALA 1   91  91  ALA ALA B . n 
B 2 2   THR 2   92  92  THR THR B . n 
B 2 3   GLN 3   93  93  GLN GLN B . n 
B 2 4   LYS 4   94  94  LYS LYS B . n 
B 2 5   ILE 5   95  95  ILE ILE B . n 
B 2 6   ALA 6   96  96  ALA ALA B . n 
B 2 7   PHE 7   97  97  PHE PHE B . n 
B 2 8   SER 8   98  98  SER SER B . n 
B 2 9   ALA 9   99  99  ALA ALA B . n 
B 2 10  THR 10  100 100 THR THR B . n 
B 2 11  ARG 11  101 101 ARG ARG B . n 
B 2 12  THR 12  102 102 THR THR B . n 
B 2 13  ILE 13  103 103 ILE ILE B . n 
B 2 14  ASN 14  104 104 ASN ASN B . n 
B 2 15  VAL 15  105 105 VAL VAL B . n 
B 2 16  PRO 16  106 106 PRO PRO B . n 
B 2 17  LEU 17  107 107 LEU LEU B . n 
B 2 18  ARG 18  108 108 ARG ARG B . n 
B 2 19  ARG 19  109 109 ARG ARG B . n 
B 2 20  ASP 20  110 110 ASP ASP B . n 
B 2 21  GLN 21  111 111 GLN GLN B . n 
B 2 22  THR 22  112 112 THR THR B . n 
B 2 23  ILE 23  113 113 ILE ILE B . n 
B 2 24  ARG 24  114 114 ARG ARG B . n 
B 2 25  PHE 25  115 115 PHE PHE B . n 
B 2 26  ASP 26  116 116 ASP ASP B . n 
B 2 27  HIS 27  117 117 HIS HIS B . n 
B 2 28  VAL 28  118 118 VAL VAL B . n 
B 2 29  ILE 29  119 119 ILE ILE B . n 
B 2 30  THR 30  120 120 THR THR B . n 
B 2 31  ASN 31  121 121 ASN ASN B . n 
B 2 32  MET 32  122 122 MET MET B . n 
B 2 33  ASN 33  123 123 ASN ASN B . n 
B 2 34  ASN 34  124 124 ASN ASN B . n 
B 2 35  ASN 35  125 125 ASN ASN B . n 
B 2 36  TYR 36  126 126 TYR TYR B . n 
B 2 37  GLU 37  127 127 GLU GLU B . n 
B 2 38  PRO 38  128 128 PRO PRO B . n 
B 2 39  ARG 39  129 129 ARG ARG B . n 
B 2 40  SER 40  130 130 SER SER B . n 
B 2 41  GLY 41  131 131 GLY GLY B . n 
B 2 42  LYS 42  132 132 LYS LYS B . n 
B 2 43  PHE 43  133 133 PHE PHE B . n 
B 2 44  THR 44  134 134 THR THR B . n 
B 2 45  CYS 45  135 135 CYS CYS B . n 
B 2 46  LYS 46  136 136 LYS LYS B . n 
B 2 47  VAL 47  137 137 VAL VAL B . n 
B 2 48  PRO 48  138 138 PRO PRO B . n 
B 2 49  GLY 49  139 139 GLY GLY B . n 
B 2 50  LEU 50  140 140 LEU LEU B . n 
B 2 51  TYR 51  141 141 TYR TYR B . n 
B 2 52  TYR 52  142 142 TYR TYR B . n 
B 2 53  PHE 53  143 143 PHE PHE B . n 
B 2 54  THR 54  144 144 THR THR B . n 
B 2 55  TYR 55  145 145 TYR TYR B . n 
B 2 56  HIS 56  146 146 HIS HIS B . n 
B 2 57  ALA 57  147 147 ALA ALA B . n 
B 2 58  SER 58  148 148 SER SER B . n 
B 2 59  SER 59  149 149 SER SER B . n 
B 2 60  ARG 60  150 150 ARG ARG B . n 
B 2 61  GLY 61  151 151 GLY GLY B . n 
B 2 62  ASN 62  152 152 ASN ASN B . n 
B 2 63  LEU 63  153 153 LEU LEU B . n 
B 2 64  CYS 64  154 154 CYS CYS B . n 
B 2 65  VAL 65  155 155 VAL VAL B . n 
B 2 66  ASN 66  156 156 ASN ASN B . n 
B 2 67  LEU 67  157 157 LEU LEU B . n 
B 2 68  MET 68  158 158 MET MET B . n 
B 2 69  ARG 69  159 159 ARG ARG B . n 
B 2 70  GLY 70  160 160 GLY GLY B . n 
B 2 71  ARG 71  161 161 ARG ARG B . n 
B 2 72  GLU 72  162 162 GLU GLU B . n 
B 2 73  ARG 73  163 163 ARG ARG B . n 
B 2 74  ALA 74  164 164 ALA ALA B . n 
B 2 75  GLN 75  165 165 GLN GLN B . n 
B 2 76  LYS 76  166 166 LYS LYS B . n 
B 2 77  VAL 77  167 167 VAL VAL B . n 
B 2 78  VAL 78  168 168 VAL VAL B . n 
B 2 79  THR 79  169 169 THR THR B . n 
B 2 80  PHE 80  170 170 PHE PHE B . n 
B 2 81  CYS 81  171 171 CYS CYS B . n 
B 2 82  ASP 82  172 172 ASP ASP B . n 
B 2 83  TYR 83  173 173 TYR TYR B . n 
B 2 84  ALA 84  174 174 ALA ALA B . n 
B 2 85  TYR 85  175 175 TYR TYR B . n 
B 2 86  ASN 86  176 176 ASN ASN B . n 
B 2 87  THR 87  177 177 THR THR B . n 
B 2 88  PHE 88  178 178 PHE PHE B . n 
B 2 89  GLN 89  179 179 GLN GLN B . n 
B 2 90  VAL 90  180 180 VAL VAL B . n 
B 2 91  THR 91  181 181 THR THR B . n 
B 2 92  THR 92  182 182 THR THR B . n 
B 2 93  GLY 93  183 183 GLY GLY B . n 
B 2 94  GLY 94  184 184 GLY GLY B . n 
B 2 95  MET 95  185 185 MET MET B . n 
B 2 96  VAL 96  186 186 VAL VAL B . n 
B 2 97  LEU 97  187 187 LEU LEU B . n 
B 2 98  LYS 98  188 188 LYS LYS B . n 
B 2 99  LEU 99  189 189 LEU LEU B . n 
B 2 100 GLU 100 190 190 GLU GLU B . n 
B 2 101 GLN 101 191 191 GLN GLN B . n 
B 2 102 GLY 102 192 192 GLY GLY B . n 
B 2 103 GLU 103 193 193 GLU GLU B . n 
B 2 104 ASN 104 194 194 ASN ASN B . n 
B 2 105 VAL 105 195 195 VAL VAL B . n 
B 2 106 PHE 106 196 196 PHE PHE B . n 
B 2 107 LEU 107 197 197 LEU LEU B . n 
B 2 108 GLN 108 198 198 GLN GLN B . n 
B 2 109 ALA 109 199 199 ALA ALA B . n 
B 2 110 THR 110 200 200 THR THR B . n 
B 2 111 ASP 111 201 201 ASP ASP B . n 
B 2 112 LYS 112 202 202 LYS LYS B . n 
B 2 113 ASN 113 203 203 ASN ASN B . n 
B 2 114 SER 114 204 204 SER SER B . n 
B 2 115 LEU 115 205 205 LEU LEU B . n 
B 2 116 LEU 116 206 206 LEU LEU B . n 
B 2 117 GLY 117 207 207 GLY GLY B . n 
B 2 118 MET 118 208 208 MET MET B . n 
B 2 119 GLU 119 209 209 GLU GLU B . n 
B 2 120 GLY 120 210 210 GLY GLY B . n 
B 2 121 ALA 121 211 211 ALA ALA B . n 
B 2 122 ASN 122 212 212 ASN ASN B . n 
B 2 123 SER 123 213 213 SER SER B . n 
B 2 124 ILE 124 214 214 ILE ILE B . n 
B 2 125 PHE 125 215 215 PHE PHE B . n 
B 2 126 SER 126 216 216 SER SER B . n 
B 2 127 GLY 127 217 217 GLY GLY B . n 
B 2 128 PHE 128 218 218 PHE PHE B . n 
B 2 129 LEU 129 219 219 LEU LEU B . n 
B 2 130 LEU 130 220 220 LEU LEU B . n 
B 2 131 PHE 131 221 221 PHE PHE B . n 
B 2 132 PRO 132 222 222 PRO PRO B . n 
B 2 133 ASP 133 223 223 ASP ASP B . n 
B 2 134 MET 134 224 224 MET MET B . n 
B 2 135 GLU 135 225 ?   ?   ?   B . n 
B 2 136 ALA 136 226 ?   ?   ?   B . n 
C 3 1   LYS 1   87  87  LYS LYS C . n 
C 3 2   GLN 2   88  88  GLN GLN C . n 
C 3 3   LYS 3   89  89  LYS LYS C . n 
C 3 4   PHE 4   90  90  PHE PHE C . n 
C 3 5   GLN 5   91  91  GLN GLN C . n 
C 3 6   SER 6   92  92  SER SER C . n 
C 3 7   VAL 7   93  93  VAL VAL C . n 
C 3 8   PHE 8   94  94  PHE PHE C . n 
C 3 9   THR 9   95  95  THR THR C . n 
C 3 10  VAL 10  96  96  VAL VAL C . n 
C 3 11  THR 11  97  97  THR THR C . n 
C 3 12  ARG 12  98  98  ARG ARG C . n 
C 3 13  GLN 13  99  99  GLN GLN C . n 
C 3 14  THR 14  100 100 THR THR C . n 
C 3 15  HIS 15  101 101 HIS HIS C . n 
C 3 16  GLN 16  102 102 GLN GLN C . n 
C 3 17  PRO 17  103 103 PRO PRO C . n 
C 3 18  PRO 18  104 104 PRO PRO C . n 
C 3 19  ALA 19  105 105 ALA ALA C . n 
C 3 20  PRO 20  106 106 PRO PRO C . n 
C 3 21  ASN 21  107 107 ASN ASN C . n 
C 3 22  SER 22  108 108 SER SER C . n 
C 3 23  LEU 23  109 109 LEU LEU C . n 
C 3 24  ILE 24  110 110 ILE ILE C . n 
C 3 25  ARG 25  111 111 ARG ARG C . n 
C 3 26  PHE 26  112 112 PHE PHE C . n 
C 3 27  ASN 27  113 113 ASN ASN C . n 
C 3 28  ALA 28  114 114 ALA ALA C . n 
C 3 29  VAL 29  115 115 VAL VAL C . n 
C 3 30  LEU 30  116 116 LEU LEU C . n 
C 3 31  THR 31  117 117 THR THR C . n 
C 3 32  ASN 32  118 118 ASN ASN C . n 
C 3 33  PRO 33  119 119 PRO PRO C . n 
C 3 34  GLN 34  120 120 GLN GLN C . n 
C 3 35  GLY 35  121 121 GLY GLY C . n 
C 3 36  ASP 36  122 122 ASP ASP C . n 
C 3 37  TYR 37  123 123 TYR TYR C . n 
C 3 38  ASP 38  124 124 ASP ASP C . n 
C 3 39  THR 39  125 125 THR THR C . n 
C 3 40  SER 40  126 126 SER SER C . n 
C 3 41  THR 41  127 127 THR THR C . n 
C 3 42  GLY 42  128 128 GLY GLY C . n 
C 3 43  LYS 43  129 129 LYS LYS C . n 
C 3 44  PHE 44  130 130 PHE PHE C . n 
C 3 45  THR 45  131 131 THR THR C . n 
C 3 46  CYS 46  132 132 CYS CYS C . n 
C 3 47  LYS 47  133 133 LYS LYS C . n 
C 3 48  VAL 48  134 134 VAL VAL C . n 
C 3 49  PRO 49  135 135 PRO PRO C . n 
C 3 50  GLY 50  136 136 GLY GLY C . n 
C 3 51  LEU 51  137 137 LEU LEU C . n 
C 3 52  TYR 52  138 138 TYR TYR C . n 
C 3 53  TYR 53  139 139 TYR TYR C . n 
C 3 54  PHE 54  140 140 PHE PHE C . n 
C 3 55  VAL 55  141 141 VAL VAL C . n 
C 3 56  TYR 56  142 142 TYR TYR C . n 
C 3 57  HIS 57  143 143 HIS HIS C . n 
C 3 58  ALA 58  144 144 ALA ALA C . n 
C 3 59  SER 59  145 145 SER SER C . n 
C 3 60  HIS 60  146 146 HIS HIS C . n 
C 3 61  THR 61  147 147 THR THR C . n 
C 3 62  ALA 62  148 148 ALA ALA C . n 
C 3 63  ASN 63  149 149 ASN ASN C . n 
C 3 64  LEU 64  150 150 LEU LEU C . n 
C 3 65  CYS 65  151 151 CYS CYS C . n 
C 3 66  VAL 66  152 152 VAL VAL C . n 
C 3 67  LEU 67  153 153 LEU LEU C . n 
C 3 68  LEU 68  154 154 LEU LEU C . n 
C 3 69  TYR 69  155 155 TYR TYR C . n 
C 3 70  ARG 70  156 156 ARG ARG C . n 
C 3 71  SER 71  157 157 SER SER C . n 
C 3 72  GLY 72  158 158 GLY GLY C . n 
C 3 73  VAL 73  159 159 VAL VAL C . n 
C 3 74  LYS 74  160 160 LYS LYS C . n 
C 3 75  VAL 75  161 161 VAL VAL C . n 
C 3 76  VAL 76  162 162 VAL VAL C . n 
C 3 77  THR 77  163 163 THR THR C . n 
C 3 78  PHE 78  164 164 PHE PHE C . n 
C 3 79  CYS 79  165 165 CYS CYS C . n 
C 3 80  GLY 80  166 166 GLY GLY C . n 
C 3 81  HIS 81  167 167 HIS HIS C . n 
C 3 82  THR 82  168 168 THR THR C . n 
C 3 83  SER 83  169 169 SER SER C . n 
C 3 84  LYS 84  170 170 LYS LYS C . n 
C 3 85  THR 85  171 171 THR THR C . n 
C 3 86  ASN 86  172 172 ASN ASN C . n 
C 3 87  GLN 87  173 173 GLN GLN C . n 
C 3 88  VAL 88  174 174 VAL VAL C . n 
C 3 89  ASN 89  175 175 ASN ASN C . n 
C 3 90  SER 90  176 176 SER SER C . n 
C 3 91  GLY 91  177 177 GLY GLY C . n 
C 3 92  GLY 92  178 178 GLY GLY C . n 
C 3 93  VAL 93  179 179 VAL VAL C . n 
C 3 94  LEU 94  180 180 LEU LEU C . n 
C 3 95  LEU 95  181 181 LEU LEU C . n 
C 3 96  ARG 96  182 182 ARG ARG C . n 
C 3 97  LEU 97  183 183 LEU LEU C . n 
C 3 98  GLN 98  184 184 GLN GLN C . n 
C 3 99  VAL 99  185 185 VAL VAL C . n 
C 3 100 GLY 100 186 186 GLY GLY C . n 
C 3 101 GLU 101 187 187 GLU GLU C . n 
C 3 102 GLU 102 188 188 GLU GLU C . n 
C 3 103 VAL 103 189 189 VAL VAL C . n 
C 3 104 TRP 104 190 190 TRP TRP C . n 
C 3 105 LEU 105 191 191 LEU LEU C . n 
C 3 106 ALA 106 192 192 ALA ALA C . n 
C 3 107 VAL 107 193 193 VAL VAL C . n 
C 3 108 ASN 108 194 194 ASN ASN C . n 
C 3 109 ASP 109 195 195 ASP ASP C . n 
C 3 110 TYR 110 196 196 TYR TYR C . n 
C 3 111 TYR 111 197 197 TYR TYR C . n 
C 3 112 ASP 112 198 198 ASP ASP C . n 
C 3 113 MET 113 199 199 MET MET C . n 
C 3 114 VAL 114 200 200 VAL VAL C . n 
C 3 115 GLY 115 201 201 GLY GLY C . n 
C 3 116 ILE 116 202 202 ILE ILE C . n 
C 3 117 GLN 117 203 203 GLN GLN C . n 
C 3 118 GLY 118 204 204 GLY GLY C . n 
C 3 119 SER 119 205 205 SER SER C . n 
C 3 120 ASP 120 206 206 ASP ASP C . n 
C 3 121 SER 121 207 207 SER SER C . n 
C 3 122 VAL 122 208 208 VAL VAL C . n 
C 3 123 PHE 123 209 209 PHE PHE C . n 
C 3 124 SER 124 210 210 SER SER C . n 
C 3 125 GLY 125 211 211 GLY GLY C . n 
C 3 126 PHE 126 212 212 PHE PHE C . n 
C 3 127 LEU 127 213 213 LEU LEU C . n 
C 3 128 LEU 128 214 214 LEU LEU C . n 
C 3 129 PHE 129 215 215 PHE PHE C . n 
C 3 130 PRO 130 216 216 PRO PRO C . n 
C 3 131 ASP 131 217 217 ASP ASP C . n 
D 1 1   GLN 1   90  90  GLN GLN D . n 
D 1 2   PRO 2   91  91  PRO PRO D . n 
D 1 3   ARG 3   92  92  ARG ARG D . n 
D 1 4   PRO 4   93  93  PRO PRO D . n 
D 1 5   ALA 5   94  94  ALA ALA D . n 
D 1 6   PHE 6   95  95  PHE PHE D . n 
D 1 7   SER 7   96  96  SER SER D . n 
D 1 8   ALA 8   97  97  ALA ALA D . n 
D 1 9   ILE 9   98  98  ILE ILE D . n 
D 1 10  ARG 10  99  99  ARG ARG D . n 
D 1 11  ARG 11  100 100 ARG ARG D . n 
D 1 12  ASN 12  101 101 ASN ASN D . n 
D 1 13  PRO 13  102 102 PRO PRO D . n 
D 1 14  PRO 14  103 103 PRO PRO D . n 
D 1 15  MET 15  104 104 MET MET D . n 
D 1 16  GLY 16  105 105 GLY GLY D . n 
D 1 17  GLY 17  106 106 GLY GLY D . n 
D 1 18  ASN 18  107 107 ASN ASN D . n 
D 1 19  VAL 19  108 108 VAL VAL D . n 
D 1 20  VAL 20  109 109 VAL VAL D . n 
D 1 21  ILE 21  110 110 ILE ILE D . n 
D 1 22  PHE 22  111 111 PHE PHE D . n 
D 1 23  ASP 23  112 112 ASP ASP D . n 
D 1 24  THR 24  113 113 THR THR D . n 
D 1 25  VAL 25  114 114 VAL VAL D . n 
D 1 26  ILE 26  115 115 ILE ILE D . n 
D 1 27  THR 27  116 116 THR THR D . n 
D 1 28  ASN 28  117 117 ASN ASN D . n 
D 1 29  GLN 29  118 118 GLN GLN D . n 
D 1 30  GLU 30  119 119 GLU GLU D . n 
D 1 31  GLU 31  120 120 GLU GLU D . n 
D 1 32  PRO 32  121 121 PRO PRO D . n 
D 1 33  TYR 33  122 122 TYR TYR D . n 
D 1 34  GLN 34  123 123 GLN GLN D . n 
D 1 35  ASN 35  124 124 ASN ASN D . n 
D 1 36  HIS 36  125 125 HIS HIS D . n 
D 1 37  SER 37  126 126 SER SER D . n 
D 1 38  GLY 38  127 127 GLY GLY D . n 
D 1 39  ARG 39  128 128 ARG ARG D . n 
D 1 40  PHE 40  129 129 PHE PHE D . n 
D 1 41  VAL 41  130 130 VAL VAL D . n 
D 1 42  CYS 42  131 131 CYS CYS D . n 
D 1 43  THR 43  132 132 THR THR D . n 
D 1 44  VAL 44  133 133 VAL VAL D . n 
D 1 45  PRO 45  134 134 PRO PRO D . n 
D 1 46  GLY 46  135 135 GLY GLY D . n 
D 1 47  TYR 47  136 136 TYR TYR D . n 
D 1 48  TYR 48  137 137 TYR TYR D . n 
D 1 49  TYR 49  138 138 TYR TYR D . n 
D 1 50  PHE 50  139 139 PHE PHE D . n 
D 1 51  THR 51  140 140 THR THR D . n 
D 1 52  PHE 52  141 141 PHE PHE D . n 
D 1 53  GLN 53  142 142 GLN GLN D . n 
D 1 54  VAL 54  143 143 VAL VAL D . n 
D 1 55  LEU 55  144 144 LEU LEU D . n 
D 1 56  SER 56  145 145 SER SER D . n 
D 1 57  GLN 57  146 146 GLN GLN D . n 
D 1 58  TRP 58  147 147 TRP TRP D . n 
D 1 59  GLU 59  148 148 GLU GLU D . n 
D 1 60  ILE 60  149 149 ILE ILE D . n 
D 1 61  CYS 61  150 150 CYS CYS D . n 
D 1 62  LEU 62  151 151 LEU LEU D . n 
D 1 63  SER 63  152 152 SER SER D . n 
D 1 64  ILE 64  153 153 ILE ILE D . n 
D 1 65  VAL 65  154 154 VAL VAL D . n 
D 1 66  SER 66  155 155 SER SER D . n 
D 1 67  SER 67  156 156 SER SER D . n 
D 1 68  SER 68  157 157 SER SER D . n 
D 1 69  ARG 69  158 158 ARG ARG D . n 
D 1 70  GLY 70  159 159 GLY GLY D . n 
D 1 71  GLN 71  160 160 GLN GLN D . n 
D 1 72  VAL 72  161 161 VAL VAL D . n 
D 1 73  ARG 73  162 162 ARG ARG D . n 
D 1 74  ARG 74  163 163 ARG ARG D . n 
D 1 75  SER 75  164 164 SER SER D . n 
D 1 76  LEU 76  165 165 LEU LEU D . n 
D 1 77  GLY 77  166 166 GLY GLY D . n 
D 1 78  PHE 78  167 167 PHE PHE D . n 
D 1 79  CYS 79  168 168 CYS CYS D . n 
D 1 80  ASP 80  169 169 ASP ASP D . n 
D 1 81  THR 81  170 170 THR THR D . n 
D 1 82  THR 82  171 171 THR THR D . n 
D 1 83  ASN 83  172 172 ASN ASN D . n 
D 1 84  LYS 84  173 173 LYS LYS D . n 
D 1 85  GLY 85  174 174 GLY GLY D . n 
D 1 86  LEU 86  175 175 LEU LEU D . n 
D 1 87  PHE 87  176 176 PHE PHE D . n 
D 1 88  GLN 88  177 177 GLN GLN D . n 
D 1 89  VAL 89  178 178 VAL VAL D . n 
D 1 90  VAL 90  179 179 VAL VAL D . n 
D 1 91  SER 91  180 180 SER SER D . n 
D 1 92  GLY 92  181 181 GLY GLY D . n 
D 1 93  GLY 93  182 182 GLY GLY D . n 
D 1 94  MET 94  183 183 MET MET D . n 
D 1 95  VAL 95  184 184 VAL VAL D . n 
D 1 96  LEU 96  185 185 LEU LEU D . n 
D 1 97  GLN 97  186 186 GLN GLN D . n 
D 1 98  LEU 98  187 187 LEU LEU D . n 
D 1 99  GLN 99  188 188 GLN GLN D . n 
D 1 100 GLN 100 189 189 GLN GLN D . n 
D 1 101 GLY 101 190 190 GLY GLY D . n 
D 1 102 ASP 102 191 191 ASP ASP D . n 
D 1 103 GLN 103 192 192 GLN GLN D . n 
D 1 104 VAL 104 193 193 VAL VAL D . n 
D 1 105 TRP 105 194 194 TRP TRP D . n 
D 1 106 VAL 106 195 195 VAL VAL D . n 
D 1 107 GLU 107 196 196 GLU GLU D . n 
D 1 108 LYS 108 197 197 LYS LYS D . n 
D 1 109 ASP 109 198 198 ASP ASP D . n 
D 1 110 PRO 110 199 199 PRO PRO D . n 
D 1 111 LYS 111 200 200 LYS LYS D . n 
D 1 112 LYS 112 201 201 LYS LYS D . n 
D 1 113 GLY 113 202 202 GLY GLY D . n 
D 1 114 HIS 114 203 203 HIS HIS D . n 
D 1 115 ILE 115 204 204 ILE ILE D . n 
D 1 116 TYR 116 205 205 TYR TYR D . n 
D 1 117 GLN 117 206 206 GLN GLN D . n 
D 1 118 GLY 118 207 207 GLY GLY D . n 
D 1 119 SER 119 208 208 SER SER D . n 
D 1 120 GLU 120 209 209 GLU GLU D . n 
D 1 121 ALA 121 210 210 ALA ALA D . n 
D 1 122 ASP 122 211 211 ASP ASP D . n 
D 1 123 SER 123 212 212 SER SER D . n 
D 1 124 VAL 124 213 213 VAL VAL D . n 
D 1 125 PHE 125 214 214 PHE PHE D . n 
D 1 126 SER 126 215 215 SER SER D . n 
D 1 127 GLY 127 216 216 GLY GLY D . n 
D 1 128 PHE 128 217 217 PHE PHE D . n 
D 1 129 LEU 129 218 218 LEU LEU D . n 
D 1 130 ILE 130 219 219 ILE ILE D . n 
D 1 131 PHE 131 220 220 PHE PHE D . n 
D 1 132 PRO 132 221 221 PRO PRO D . n 
D 1 133 SER 133 222 222 SER SER D . n 
D 1 134 ALA 134 223 ?   ?   ?   D . n 
E 2 1   ALA 1   91  ?   ?   ?   E . n 
E 2 2   THR 2   92  92  THR THR E . n 
E 2 3   GLN 3   93  93  GLN GLN E . n 
E 2 4   LYS 4   94  94  LYS LYS E . n 
E 2 5   ILE 5   95  95  ILE ILE E . n 
E 2 6   ALA 6   96  96  ALA ALA E . n 
E 2 7   PHE 7   97  97  PHE PHE E . n 
E 2 8   SER 8   98  98  SER SER E . n 
E 2 9   ALA 9   99  99  ALA ALA E . n 
E 2 10  THR 10  100 100 THR THR E . n 
E 2 11  ARG 11  101 101 ARG ARG E . n 
E 2 12  THR 12  102 102 THR THR E . n 
E 2 13  ILE 13  103 103 ILE ILE E . n 
E 2 14  ASN 14  104 104 ASN ASN E . n 
E 2 15  VAL 15  105 105 VAL VAL E . n 
E 2 16  PRO 16  106 106 PRO PRO E . n 
E 2 17  LEU 17  107 107 LEU LEU E . n 
E 2 18  ARG 18  108 108 ARG ARG E . n 
E 2 19  ARG 19  109 109 ARG ARG E . n 
E 2 20  ASP 20  110 110 ASP ASP E . n 
E 2 21  GLN 21  111 111 GLN GLN E . n 
E 2 22  THR 22  112 112 THR THR E . n 
E 2 23  ILE 23  113 113 ILE ILE E . n 
E 2 24  ARG 24  114 114 ARG ARG E . n 
E 2 25  PHE 25  115 115 PHE PHE E . n 
E 2 26  ASP 26  116 116 ASP ASP E . n 
E 2 27  HIS 27  117 117 HIS HIS E . n 
E 2 28  VAL 28  118 118 VAL VAL E . n 
E 2 29  ILE 29  119 119 ILE ILE E . n 
E 2 30  THR 30  120 120 THR THR E . n 
E 2 31  ASN 31  121 121 ASN ASN E . n 
E 2 32  MET 32  122 122 MET MET E . n 
E 2 33  ASN 33  123 123 ASN ASN E . n 
E 2 34  ASN 34  124 124 ASN ASN E . n 
E 2 35  ASN 35  125 125 ASN ASN E . n 
E 2 36  TYR 36  126 126 TYR TYR E . n 
E 2 37  GLU 37  127 127 GLU GLU E . n 
E 2 38  PRO 38  128 128 PRO PRO E . n 
E 2 39  ARG 39  129 129 ARG ARG E . n 
E 2 40  SER 40  130 130 SER SER E . n 
E 2 41  GLY 41  131 131 GLY GLY E . n 
E 2 42  LYS 42  132 132 LYS LYS E . n 
E 2 43  PHE 43  133 133 PHE PHE E . n 
E 2 44  THR 44  134 134 THR THR E . n 
E 2 45  CYS 45  135 135 CYS CYS E . n 
E 2 46  LYS 46  136 136 LYS LYS E . n 
E 2 47  VAL 47  137 137 VAL VAL E . n 
E 2 48  PRO 48  138 138 PRO PRO E . n 
E 2 49  GLY 49  139 139 GLY GLY E . n 
E 2 50  LEU 50  140 140 LEU LEU E . n 
E 2 51  TYR 51  141 141 TYR TYR E . n 
E 2 52  TYR 52  142 142 TYR TYR E . n 
E 2 53  PHE 53  143 143 PHE PHE E . n 
E 2 54  THR 54  144 144 THR THR E . n 
E 2 55  TYR 55  145 145 TYR TYR E . n 
E 2 56  HIS 56  146 146 HIS HIS E . n 
E 2 57  ALA 57  147 147 ALA ALA E . n 
E 2 58  SER 58  148 148 SER SER E . n 
E 2 59  SER 59  149 149 SER SER E . n 
E 2 60  ARG 60  150 150 ARG ARG E . n 
E 2 61  GLY 61  151 151 GLY GLY E . n 
E 2 62  ASN 62  152 152 ASN ASN E . n 
E 2 63  LEU 63  153 153 LEU LEU E . n 
E 2 64  CYS 64  154 154 CYS CYS E . n 
E 2 65  VAL 65  155 155 VAL VAL E . n 
E 2 66  ASN 66  156 156 ASN ASN E . n 
E 2 67  LEU 67  157 157 LEU LEU E . n 
E 2 68  MET 68  158 158 MET MET E . n 
E 2 69  ARG 69  159 159 ARG ARG E . n 
E 2 70  GLY 70  160 160 GLY GLY E . n 
E 2 71  ARG 71  161 161 ARG ARG E . n 
E 2 72  GLU 72  162 162 GLU GLU E . n 
E 2 73  ARG 73  163 163 ARG ARG E . n 
E 2 74  ALA 74  164 164 ALA ALA E . n 
E 2 75  GLN 75  165 165 GLN GLN E . n 
E 2 76  LYS 76  166 166 LYS LYS E . n 
E 2 77  VAL 77  167 167 VAL VAL E . n 
E 2 78  VAL 78  168 168 VAL VAL E . n 
E 2 79  THR 79  169 169 THR THR E . n 
E 2 80  PHE 80  170 170 PHE PHE E . n 
E 2 81  CYS 81  171 171 CYS CYS E . n 
E 2 82  ASP 82  172 172 ASP ASP E . n 
E 2 83  TYR 83  173 173 TYR TYR E . n 
E 2 84  ALA 84  174 174 ALA ALA E . n 
E 2 85  TYR 85  175 175 TYR TYR E . n 
E 2 86  ASN 86  176 176 ASN ASN E . n 
E 2 87  THR 87  177 177 THR THR E . n 
E 2 88  PHE 88  178 178 PHE PHE E . n 
E 2 89  GLN 89  179 179 GLN GLN E . n 
E 2 90  VAL 90  180 180 VAL VAL E . n 
E 2 91  THR 91  181 181 THR THR E . n 
E 2 92  THR 92  182 182 THR THR E . n 
E 2 93  GLY 93  183 183 GLY GLY E . n 
E 2 94  GLY 94  184 184 GLY GLY E . n 
E 2 95  MET 95  185 185 MET MET E . n 
E 2 96  VAL 96  186 186 VAL VAL E . n 
E 2 97  LEU 97  187 187 LEU LEU E . n 
E 2 98  LYS 98  188 188 LYS LYS E . n 
E 2 99  LEU 99  189 189 LEU LEU E . n 
E 2 100 GLU 100 190 190 GLU GLU E . n 
E 2 101 GLN 101 191 191 GLN GLN E . n 
E 2 102 GLY 102 192 192 GLY GLY E . n 
E 2 103 GLU 103 193 193 GLU GLU E . n 
E 2 104 ASN 104 194 194 ASN ASN E . n 
E 2 105 VAL 105 195 195 VAL VAL E . n 
E 2 106 PHE 106 196 196 PHE PHE E . n 
E 2 107 LEU 107 197 197 LEU LEU E . n 
E 2 108 GLN 108 198 198 GLN GLN E . n 
E 2 109 ALA 109 199 199 ALA ALA E . n 
E 2 110 THR 110 200 200 THR THR E . n 
E 2 111 ASP 111 201 201 ASP ASP E . n 
E 2 112 LYS 112 202 202 LYS LYS E . n 
E 2 113 ASN 113 203 203 ASN ASN E . n 
E 2 114 SER 114 204 204 SER SER E . n 
E 2 115 LEU 115 205 205 LEU LEU E . n 
E 2 116 LEU 116 206 206 LEU LEU E . n 
E 2 117 GLY 117 207 207 GLY GLY E . n 
E 2 118 MET 118 208 208 MET MET E . n 
E 2 119 GLU 119 209 209 GLU GLU E . n 
E 2 120 GLY 120 210 210 GLY GLY E . n 
E 2 121 ALA 121 211 211 ALA ALA E . n 
E 2 122 ASN 122 212 212 ASN ASN E . n 
E 2 123 SER 123 213 213 SER SER E . n 
E 2 124 ILE 124 214 214 ILE ILE E . n 
E 2 125 PHE 125 215 215 PHE PHE E . n 
E 2 126 SER 126 216 216 SER SER E . n 
E 2 127 GLY 127 217 217 GLY GLY E . n 
E 2 128 PHE 128 218 218 PHE PHE E . n 
E 2 129 LEU 129 219 219 LEU LEU E . n 
E 2 130 LEU 130 220 220 LEU LEU E . n 
E 2 131 PHE 131 221 221 PHE PHE E . n 
E 2 132 PRO 132 222 222 PRO PRO E . n 
E 2 133 ASP 133 223 223 ASP ASP E . n 
E 2 134 MET 134 224 224 MET MET E . n 
E 2 135 GLU 135 225 ?   ?   ?   E . n 
E 2 136 ALA 136 226 ?   ?   ?   E . n 
F 3 1   LYS 1   87  ?   ?   ?   F . n 
F 3 2   GLN 2   88  ?   ?   ?   F . n 
F 3 3   LYS 3   89  89  LYS LYS F . n 
F 3 4   PHE 4   90  90  PHE PHE F . n 
F 3 5   GLN 5   91  91  GLN GLN F . n 
F 3 6   SER 6   92  92  SER SER F . n 
F 3 7   VAL 7   93  93  VAL VAL F . n 
F 3 8   PHE 8   94  94  PHE PHE F . n 
F 3 9   THR 9   95  95  THR THR F . n 
F 3 10  VAL 10  96  96  VAL VAL F . n 
F 3 11  THR 11  97  97  THR THR F . n 
F 3 12  ARG 12  98  98  ARG ARG F . n 
F 3 13  GLN 13  99  99  GLN GLN F . n 
F 3 14  THR 14  100 100 THR THR F . n 
F 3 15  HIS 15  101 101 HIS HIS F . n 
F 3 16  GLN 16  102 102 GLN GLN F . n 
F 3 17  PRO 17  103 103 PRO PRO F . n 
F 3 18  PRO 18  104 104 PRO PRO F . n 
F 3 19  ALA 19  105 105 ALA ALA F . n 
F 3 20  PRO 20  106 106 PRO PRO F . n 
F 3 21  ASN 21  107 107 ASN ASN F . n 
F 3 22  SER 22  108 108 SER SER F . n 
F 3 23  LEU 23  109 109 LEU LEU F . n 
F 3 24  ILE 24  110 110 ILE ILE F . n 
F 3 25  ARG 25  111 111 ARG ARG F . n 
F 3 26  PHE 26  112 112 PHE PHE F . n 
F 3 27  ASN 27  113 113 ASN ASN F . n 
F 3 28  ALA 28  114 114 ALA ALA F . n 
F 3 29  VAL 29  115 115 VAL VAL F . n 
F 3 30  LEU 30  116 116 LEU LEU F . n 
F 3 31  THR 31  117 117 THR THR F . n 
F 3 32  ASN 32  118 118 ASN ASN F . n 
F 3 33  PRO 33  119 119 PRO PRO F . n 
F 3 34  GLN 34  120 120 GLN GLN F . n 
F 3 35  GLY 35  121 121 GLY GLY F . n 
F 3 36  ASP 36  122 122 ASP ASP F . n 
F 3 37  TYR 37  123 123 TYR TYR F . n 
F 3 38  ASP 38  124 124 ASP ASP F . n 
F 3 39  THR 39  125 125 THR THR F . n 
F 3 40  SER 40  126 126 SER SER F . n 
F 3 41  THR 41  127 127 THR THR F . n 
F 3 42  GLY 42  128 128 GLY GLY F . n 
F 3 43  LYS 43  129 129 LYS LYS F . n 
F 3 44  PHE 44  130 130 PHE PHE F . n 
F 3 45  THR 45  131 131 THR THR F . n 
F 3 46  CYS 46  132 132 CYS CYS F . n 
F 3 47  LYS 47  133 133 LYS LYS F . n 
F 3 48  VAL 48  134 134 VAL VAL F . n 
F 3 49  PRO 49  135 135 PRO PRO F . n 
F 3 50  GLY 50  136 136 GLY GLY F . n 
F 3 51  LEU 51  137 137 LEU LEU F . n 
F 3 52  TYR 52  138 138 TYR TYR F . n 
F 3 53  TYR 53  139 139 TYR TYR F . n 
F 3 54  PHE 54  140 140 PHE PHE F . n 
F 3 55  VAL 55  141 141 VAL VAL F . n 
F 3 56  TYR 56  142 142 TYR TYR F . n 
F 3 57  HIS 57  143 143 HIS HIS F . n 
F 3 58  ALA 58  144 144 ALA ALA F . n 
F 3 59  SER 59  145 145 SER SER F . n 
F 3 60  HIS 60  146 146 HIS HIS F . n 
F 3 61  THR 61  147 147 THR THR F . n 
F 3 62  ALA 62  148 148 ALA ALA F . n 
F 3 63  ASN 63  149 149 ASN ASN F . n 
F 3 64  LEU 64  150 150 LEU LEU F . n 
F 3 65  CYS 65  151 151 CYS CYS F . n 
F 3 66  VAL 66  152 152 VAL VAL F . n 
F 3 67  LEU 67  153 153 LEU LEU F . n 
F 3 68  LEU 68  154 154 LEU LEU F . n 
F 3 69  TYR 69  155 155 TYR TYR F . n 
F 3 70  ARG 70  156 156 ARG ARG F . n 
F 3 71  SER 71  157 157 SER SER F . n 
F 3 72  GLY 72  158 158 GLY GLY F . n 
F 3 73  VAL 73  159 159 VAL VAL F . n 
F 3 74  LYS 74  160 160 LYS LYS F . n 
F 3 75  VAL 75  161 161 VAL VAL F . n 
F 3 76  VAL 76  162 162 VAL VAL F . n 
F 3 77  THR 77  163 163 THR THR F . n 
F 3 78  PHE 78  164 164 PHE PHE F . n 
F 3 79  CYS 79  165 165 CYS CYS F . n 
F 3 80  GLY 80  166 166 GLY GLY F . n 
F 3 81  HIS 81  167 167 HIS HIS F . n 
F 3 82  THR 82  168 168 THR THR F . n 
F 3 83  SER 83  169 169 SER SER F . n 
F 3 84  LYS 84  170 170 LYS LYS F . n 
F 3 85  THR 85  171 171 THR THR F . n 
F 3 86  ASN 86  172 172 ASN ASN F . n 
F 3 87  GLN 87  173 173 GLN GLN F . n 
F 3 88  VAL 88  174 174 VAL VAL F . n 
F 3 89  ASN 89  175 175 ASN ASN F . n 
F 3 90  SER 90  176 176 SER SER F . n 
F 3 91  GLY 91  177 177 GLY GLY F . n 
F 3 92  GLY 92  178 178 GLY GLY F . n 
F 3 93  VAL 93  179 179 VAL VAL F . n 
F 3 94  LEU 94  180 180 LEU LEU F . n 
F 3 95  LEU 95  181 181 LEU LEU F . n 
F 3 96  ARG 96  182 182 ARG ARG F . n 
F 3 97  LEU 97  183 183 LEU LEU F . n 
F 3 98  GLN 98  184 184 GLN GLN F . n 
F 3 99  VAL 99  185 185 VAL VAL F . n 
F 3 100 GLY 100 186 186 GLY GLY F . n 
F 3 101 GLU 101 187 187 GLU GLU F . n 
F 3 102 GLU 102 188 188 GLU GLU F . n 
F 3 103 VAL 103 189 189 VAL VAL F . n 
F 3 104 TRP 104 190 190 TRP TRP F . n 
F 3 105 LEU 105 191 191 LEU LEU F . n 
F 3 106 ALA 106 192 192 ALA ALA F . n 
F 3 107 VAL 107 193 193 VAL VAL F . n 
F 3 108 ASN 108 194 194 ASN ASN F . n 
F 3 109 ASP 109 195 195 ASP ASP F . n 
F 3 110 TYR 110 196 196 TYR TYR F . n 
F 3 111 TYR 111 197 197 TYR TYR F . n 
F 3 112 ASP 112 198 198 ASP ASP F . n 
F 3 113 MET 113 199 199 MET MET F . n 
F 3 114 VAL 114 200 200 VAL VAL F . n 
F 3 115 GLY 115 201 201 GLY GLY F . n 
F 3 116 ILE 116 202 202 ILE ILE F . n 
F 3 117 GLN 117 203 203 GLN GLN F . n 
F 3 118 GLY 118 204 204 GLY GLY F . n 
F 3 119 SER 119 205 205 SER SER F . n 
F 3 120 ASP 120 206 206 ASP ASP F . n 
F 3 121 SER 121 207 207 SER SER F . n 
F 3 122 VAL 122 208 208 VAL VAL F . n 
F 3 123 PHE 123 209 209 PHE PHE F . n 
F 3 124 SER 124 210 210 SER SER F . n 
F 3 125 GLY 125 211 211 GLY GLY F . n 
F 3 126 PHE 126 212 212 PHE PHE F . n 
F 3 127 LEU 127 213 213 LEU LEU F . n 
F 3 128 LEU 128 214 214 LEU LEU F . n 
F 3 129 PHE 129 215 215 PHE PHE F . n 
F 3 130 PRO 130 216 216 PRO PRO F . n 
F 3 131 ASP 131 217 217 ASP ASP F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 NAG 1  1223 1223 NAG NAG A . 
H 5 CA  1  1224 1224 CA  CA  B . 
I 6 SEP 1  1223 1223 SEP SEP D . 
J 5 CA  1  1224 1224 CA  CA  E . 
K 7 HOH 1  2001 2001 HOH HOH A . 
K 7 HOH 2  2002 2002 HOH HOH A . 
K 7 HOH 3  2003 2003 HOH HOH A . 
K 7 HOH 4  2004 2004 HOH HOH A . 
K 7 HOH 5  2005 2005 HOH HOH A . 
K 7 HOH 6  2006 2006 HOH HOH A . 
K 7 HOH 7  2007 2007 HOH HOH A . 
K 7 HOH 8  2008 2008 HOH HOH A . 
K 7 HOH 9  2009 2009 HOH HOH A . 
K 7 HOH 10 2010 2010 HOH HOH A . 
K 7 HOH 11 2011 2011 HOH HOH A . 
K 7 HOH 12 2012 2012 HOH HOH A . 
K 7 HOH 13 2013 2013 HOH HOH A . 
K 7 HOH 14 2014 2014 HOH HOH A . 
K 7 HOH 15 2015 2015 HOH HOH A . 
K 7 HOH 16 2016 2016 HOH HOH A . 
K 7 HOH 17 2017 2017 HOH HOH A . 
K 7 HOH 18 2018 2018 HOH HOH A . 
K 7 HOH 19 2019 2019 HOH HOH A . 
K 7 HOH 20 2020 2020 HOH HOH A . 
K 7 HOH 21 2021 2021 HOH HOH A . 
K 7 HOH 22 2022 2022 HOH HOH A . 
K 7 HOH 23 2023 2023 HOH HOH A . 
K 7 HOH 24 2024 2024 HOH HOH A . 
K 7 HOH 25 2025 2025 HOH HOH A . 
K 7 HOH 26 2026 2026 HOH HOH A . 
K 7 HOH 27 2027 2027 HOH HOH A . 
K 7 HOH 28 2028 2028 HOH HOH A . 
K 7 HOH 29 2029 2029 HOH HOH A . 
K 7 HOH 30 2030 2030 HOH HOH A . 
K 7 HOH 31 2031 2031 HOH HOH A . 
K 7 HOH 32 2032 2032 HOH HOH A . 
K 7 HOH 33 2033 2033 HOH HOH A . 
K 7 HOH 34 2034 2034 HOH HOH A . 
K 7 HOH 35 2035 2035 HOH HOH A . 
K 7 HOH 36 2036 2036 HOH HOH A . 
K 7 HOH 37 2037 2037 HOH HOH A . 
K 7 HOH 38 2038 2038 HOH HOH A . 
K 7 HOH 39 2039 2039 HOH HOH A . 
K 7 HOH 40 2040 2040 HOH HOH A . 
K 7 HOH 41 2041 2041 HOH HOH A . 
K 7 HOH 42 2042 2042 HOH HOH A . 
K 7 HOH 43 2043 2043 HOH HOH A . 
K 7 HOH 44 2044 2044 HOH HOH A . 
K 7 HOH 45 2045 2045 HOH HOH A . 
K 7 HOH 46 2046 2046 HOH HOH A . 
K 7 HOH 47 2047 2047 HOH HOH A . 
K 7 HOH 48 2048 2048 HOH HOH A . 
K 7 HOH 49 2049 2049 HOH HOH A . 
K 7 HOH 50 2050 2050 HOH HOH A . 
K 7 HOH 51 2051 2051 HOH HOH A . 
K 7 HOH 52 2052 2052 HOH HOH A . 
K 7 HOH 53 2053 2053 HOH HOH A . 
K 7 HOH 54 2054 2054 HOH HOH A . 
K 7 HOH 55 2055 2055 HOH HOH A . 
K 7 HOH 56 2056 2056 HOH HOH A . 
K 7 HOH 57 2057 2057 HOH HOH A . 
K 7 HOH 58 2058 2058 HOH HOH A . 
K 7 HOH 59 2059 2059 HOH HOH A . 
K 7 HOH 60 2060 2060 HOH HOH A . 
L 7 HOH 1  2001 2001 HOH HOH B . 
L 7 HOH 2  2002 2002 HOH HOH B . 
L 7 HOH 3  2003 2003 HOH HOH B . 
L 7 HOH 4  2004 2004 HOH HOH B . 
L 7 HOH 5  2005 2005 HOH HOH B . 
L 7 HOH 6  2006 2006 HOH HOH B . 
L 7 HOH 7  2007 2007 HOH HOH B . 
L 7 HOH 8  2008 2008 HOH HOH B . 
L 7 HOH 9  2009 2009 HOH HOH B . 
L 7 HOH 10 2010 2010 HOH HOH B . 
L 7 HOH 11 2011 2011 HOH HOH B . 
L 7 HOH 12 2012 2012 HOH HOH B . 
L 7 HOH 13 2013 2013 HOH HOH B . 
L 7 HOH 14 2014 2014 HOH HOH B . 
L 7 HOH 15 2015 2015 HOH HOH B . 
L 7 HOH 16 2016 2016 HOH HOH B . 
L 7 HOH 17 2017 2017 HOH HOH B . 
L 7 HOH 18 2018 2018 HOH HOH B . 
L 7 HOH 19 2019 2019 HOH HOH B . 
L 7 HOH 20 2020 2020 HOH HOH B . 
L 7 HOH 21 2021 2021 HOH HOH B . 
L 7 HOH 22 2022 2022 HOH HOH B . 
L 7 HOH 23 2023 2023 HOH HOH B . 
L 7 HOH 24 2024 2024 HOH HOH B . 
L 7 HOH 25 2025 2025 HOH HOH B . 
L 7 HOH 26 2026 2026 HOH HOH B . 
L 7 HOH 27 2027 2027 HOH HOH B . 
L 7 HOH 28 2028 2028 HOH HOH B . 
M 7 HOH 1  2001 2001 HOH HOH C . 
M 7 HOH 2  2002 2002 HOH HOH C . 
M 7 HOH 3  2003 2003 HOH HOH C . 
M 7 HOH 4  2004 2004 HOH HOH C . 
M 7 HOH 5  2005 2005 HOH HOH C . 
M 7 HOH 6  2006 2006 HOH HOH C . 
M 7 HOH 7  2007 2007 HOH HOH C . 
M 7 HOH 8  2008 2008 HOH HOH C . 
M 7 HOH 9  2009 2009 HOH HOH C . 
M 7 HOH 10 2010 2010 HOH HOH C . 
M 7 HOH 11 2011 2011 HOH HOH C . 
M 7 HOH 12 2012 2012 HOH HOH C . 
M 7 HOH 13 2013 2013 HOH HOH C . 
M 7 HOH 14 2014 2014 HOH HOH C . 
M 7 HOH 15 2015 2015 HOH HOH C . 
M 7 HOH 16 2016 2016 HOH HOH C . 
M 7 HOH 17 2017 2017 HOH HOH C . 
M 7 HOH 18 2018 2018 HOH HOH C . 
M 7 HOH 19 2019 2019 HOH HOH C . 
M 7 HOH 20 2020 2020 HOH HOH C . 
M 7 HOH 21 2021 2021 HOH HOH C . 
M 7 HOH 22 2022 2022 HOH HOH C . 
M 7 HOH 23 2023 2023 HOH HOH C . 
M 7 HOH 24 2024 2024 HOH HOH C . 
M 7 HOH 25 2025 2025 HOH HOH C . 
M 7 HOH 26 2026 2026 HOH HOH C . 
M 7 HOH 27 2027 2027 HOH HOH C . 
M 7 HOH 28 2028 2028 HOH HOH C . 
M 7 HOH 29 2029 2029 HOH HOH C . 
M 7 HOH 30 2030 2030 HOH HOH C . 
M 7 HOH 31 2031 2031 HOH HOH C . 
M 7 HOH 32 2032 2032 HOH HOH C . 
M 7 HOH 33 2033 2033 HOH HOH C . 
M 7 HOH 34 2034 2034 HOH HOH C . 
M 7 HOH 35 2035 2035 HOH HOH C . 
M 7 HOH 36 2036 2036 HOH HOH C . 
M 7 HOH 37 2037 2037 HOH HOH C . 
M 7 HOH 38 2038 2038 HOH HOH C . 
M 7 HOH 39 2039 2039 HOH HOH C . 
M 7 HOH 40 2040 2040 HOH HOH C . 
M 7 HOH 41 2041 2041 HOH HOH C . 
M 7 HOH 42 2042 2042 HOH HOH C . 
M 7 HOH 43 2043 2043 HOH HOH C . 
M 7 HOH 44 2044 2044 HOH HOH C . 
M 7 HOH 45 2045 2045 HOH HOH C . 
M 7 HOH 46 2046 2046 HOH HOH C . 
M 7 HOH 47 2047 2047 HOH HOH C . 
M 7 HOH 48 2048 2048 HOH HOH C . 
M 7 HOH 49 2049 2049 HOH HOH C . 
M 7 HOH 50 2050 2050 HOH HOH C . 
M 7 HOH 51 2051 2051 HOH HOH C . 
M 7 HOH 52 2052 2052 HOH HOH C . 
M 7 HOH 53 2053 2053 HOH HOH C . 
M 7 HOH 54 2054 2054 HOH HOH C . 
M 7 HOH 55 2055 2055 HOH HOH C . 
M 7 HOH 56 2056 2056 HOH HOH C . 
M 7 HOH 57 2057 2057 HOH HOH C . 
M 7 HOH 58 2058 2058 HOH HOH C . 
M 7 HOH 59 2059 2059 HOH HOH C . 
M 7 HOH 60 2060 2060 HOH HOH C . 
N 7 HOH 1  2001 2001 HOH HOH D . 
N 7 HOH 2  2002 2002 HOH HOH D . 
N 7 HOH 3  2003 2003 HOH HOH D . 
N 7 HOH 4  2004 2004 HOH HOH D . 
N 7 HOH 5  2005 2005 HOH HOH D . 
N 7 HOH 6  2006 2006 HOH HOH D . 
N 7 HOH 7  2007 2007 HOH HOH D . 
N 7 HOH 8  2008 2008 HOH HOH D . 
N 7 HOH 9  2009 2009 HOH HOH D . 
N 7 HOH 10 2010 2010 HOH HOH D . 
N 7 HOH 11 2011 2011 HOH HOH D . 
N 7 HOH 12 2012 2012 HOH HOH D . 
N 7 HOH 13 2013 2013 HOH HOH D . 
N 7 HOH 14 2014 2014 HOH HOH D . 
N 7 HOH 15 2015 2015 HOH HOH D . 
N 7 HOH 16 2016 2016 HOH HOH D . 
N 7 HOH 17 2017 2017 HOH HOH D . 
N 7 HOH 18 2018 2018 HOH HOH D . 
N 7 HOH 19 2019 2019 HOH HOH D . 
N 7 HOH 20 2020 2020 HOH HOH D . 
N 7 HOH 21 2021 2021 HOH HOH D . 
N 7 HOH 22 2022 2022 HOH HOH D . 
N 7 HOH 23 2023 2023 HOH HOH D . 
N 7 HOH 24 2024 2024 HOH HOH D . 
N 7 HOH 25 2025 2025 HOH HOH D . 
N 7 HOH 26 2026 2026 HOH HOH D . 
N 7 HOH 27 2027 2027 HOH HOH D . 
N 7 HOH 28 2028 2028 HOH HOH D . 
N 7 HOH 29 2029 2029 HOH HOH D . 
N 7 HOH 30 2030 2030 HOH HOH D . 
N 7 HOH 31 2031 2031 HOH HOH D . 
N 7 HOH 32 2032 2032 HOH HOH D . 
N 7 HOH 33 2033 2033 HOH HOH D . 
N 7 HOH 34 2034 2034 HOH HOH D . 
N 7 HOH 35 2035 2035 HOH HOH D . 
N 7 HOH 36 2036 2036 HOH HOH D . 
N 7 HOH 37 2037 2037 HOH HOH D . 
N 7 HOH 38 2038 2038 HOH HOH D . 
N 7 HOH 39 2039 2039 HOH HOH D . 
N 7 HOH 40 2040 2040 HOH HOH D . 
N 7 HOH 41 2041 2041 HOH HOH D . 
N 7 HOH 42 2042 2042 HOH HOH D . 
N 7 HOH 43 2043 2043 HOH HOH D . 
N 7 HOH 44 2044 2044 HOH HOH D . 
N 7 HOH 45 2045 2045 HOH HOH D . 
N 7 HOH 46 2046 2046 HOH HOH D . 
N 7 HOH 47 2047 2047 HOH HOH D . 
N 7 HOH 48 2048 2048 HOH HOH D . 
N 7 HOH 49 2049 2049 HOH HOH D . 
N 7 HOH 50 2050 2050 HOH HOH D . 
N 7 HOH 51 2051 2051 HOH HOH D . 
N 7 HOH 52 2052 2052 HOH HOH D . 
N 7 HOH 53 2053 2053 HOH HOH D . 
N 7 HOH 54 2054 2054 HOH HOH D . 
N 7 HOH 55 2055 2055 HOH HOH D . 
N 7 HOH 56 2056 2056 HOH HOH D . 
N 7 HOH 57 2057 2057 HOH HOH D . 
N 7 HOH 58 2058 2058 HOH HOH D . 
N 7 HOH 59 2059 2059 HOH HOH D . 
O 7 HOH 1  2001 2001 HOH HOH E . 
O 7 HOH 2  2002 2002 HOH HOH E . 
O 7 HOH 3  2003 2003 HOH HOH E . 
O 7 HOH 4  2004 2004 HOH HOH E . 
O 7 HOH 5  2005 2005 HOH HOH E . 
O 7 HOH 6  2006 2006 HOH HOH E . 
O 7 HOH 7  2007 2007 HOH HOH E . 
O 7 HOH 8  2008 2008 HOH HOH E . 
O 7 HOH 9  2009 2009 HOH HOH E . 
O 7 HOH 10 2010 2010 HOH HOH E . 
O 7 HOH 11 2011 2011 HOH HOH E . 
O 7 HOH 12 2012 2012 HOH HOH E . 
O 7 HOH 13 2013 2013 HOH HOH E . 
O 7 HOH 14 2014 2014 HOH HOH E . 
O 7 HOH 15 2015 2015 HOH HOH E . 
O 7 HOH 16 2016 2016 HOH HOH E . 
O 7 HOH 17 2017 2017 HOH HOH E . 
O 7 HOH 18 2018 2018 HOH HOH E . 
O 7 HOH 19 2019 2019 HOH HOH E . 
O 7 HOH 20 2020 2020 HOH HOH E . 
O 7 HOH 21 2021 2021 HOH HOH E . 
O 7 HOH 22 2022 2022 HOH HOH E . 
O 7 HOH 23 2023 2023 HOH HOH E . 
O 7 HOH 24 2024 2024 HOH HOH E . 
O 7 HOH 25 2025 2025 HOH HOH E . 
O 7 HOH 26 2026 2026 HOH HOH E . 
O 7 HOH 27 2027 2027 HOH HOH E . 
O 7 HOH 28 2028 2028 HOH HOH E . 
O 7 HOH 29 2029 2029 HOH HOH E . 
O 7 HOH 30 2030 2030 HOH HOH E . 
O 7 HOH 31 2031 2031 HOH HOH E . 
O 7 HOH 32 2032 2032 HOH HOH E . 
O 7 HOH 33 2033 2033 HOH HOH E . 
O 7 HOH 34 2034 2034 HOH HOH E . 
O 7 HOH 35 2035 2035 HOH HOH E . 
P 7 HOH 1  2001 2001 HOH HOH F . 
P 7 HOH 2  2002 2002 HOH HOH F . 
P 7 HOH 3  2003 2003 HOH HOH F . 
P 7 HOH 4  2004 2004 HOH HOH F . 
P 7 HOH 5  2005 2005 HOH HOH F . 
P 7 HOH 6  2006 2006 HOH HOH F . 
P 7 HOH 7  2007 2007 HOH HOH F . 
P 7 HOH 8  2008 2008 HOH HOH F . 
P 7 HOH 9  2009 2009 HOH HOH F . 
P 7 HOH 10 2010 2010 HOH HOH F . 
P 7 HOH 11 2011 2011 HOH HOH F . 
P 7 HOH 12 2012 2012 HOH HOH F . 
P 7 HOH 13 2013 2013 HOH HOH F . 
P 7 HOH 14 2014 2014 HOH HOH F . 
P 7 HOH 15 2015 2015 HOH HOH F . 
P 7 HOH 16 2016 2016 HOH HOH F . 
P 7 HOH 17 2017 2017 HOH HOH F . 
P 7 HOH 18 2018 2018 HOH HOH F . 
P 7 HOH 19 2019 2019 HOH HOH F . 
P 7 HOH 20 2020 2020 HOH HOH F . 
P 7 HOH 21 2021 2021 HOH HOH F . 
P 7 HOH 22 2022 2022 HOH HOH F . 
P 7 HOH 23 2023 2023 HOH HOH F . 
P 7 HOH 24 2024 2024 HOH HOH F . 
P 7 HOH 25 2025 2025 HOH HOH F . 
P 7 HOH 26 2026 2026 HOH HOH F . 
P 7 HOH 27 2027 2027 HOH HOH F . 
P 7 HOH 28 2028 2028 HOH HOH F . 
P 7 HOH 29 2029 2029 HOH HOH F . 
P 7 HOH 30 2030 2030 HOH HOH F . 
P 7 HOH 31 2031 2031 HOH HOH F . 
P 7 HOH 32 2032 2032 HOH HOH F . 
P 7 HOH 33 2033 2033 HOH HOH F . 
P 7 HOH 34 2034 2034 HOH HOH F . 
P 7 HOH 35 2035 2035 HOH HOH F . 
P 7 HOH 36 2036 2036 HOH HOH F . 
P 7 HOH 37 2037 2037 HOH HOH F . 
P 7 HOH 38 2038 2038 HOH HOH F . 
P 7 HOH 39 2039 2039 HOH HOH F . 
P 7 HOH 40 2040 2040 HOH HOH F . 
P 7 HOH 41 2041 2041 HOH HOH F . 
P 7 HOH 42 2042 2042 HOH HOH F . 
P 7 HOH 43 2043 2043 HOH HOH F . 
P 7 HOH 44 2044 2044 HOH HOH F . 
P 7 HOH 45 2045 2045 HOH HOH F . 
P 7 HOH 46 2046 2046 HOH HOH F . 
P 7 HOH 47 2047 2047 HOH HOH F . 
P 7 HOH 48 2048 2048 HOH HOH F . 
P 7 HOH 49 2049 2049 HOH HOH F . 
P 7 HOH 50 2050 2050 HOH HOH F . 
P 7 HOH 51 2051 2051 HOH HOH F . 
P 7 HOH 52 2052 2052 HOH HOH F . 
P 7 HOH 53 2053 2053 HOH HOH F . 
P 7 HOH 54 2054 2054 HOH HOH F . 
P 7 HOH 55 2055 2055 HOH HOH F . 
P 7 HOH 56 2056 2056 HOH HOH F . 
P 7 HOH 57 2057 2057 HOH HOH F . 
P 7 HOH 58 2058 2058 HOH HOH F . 
P 7 HOH 59 2059 2059 HOH HOH F . 
P 7 HOH 60 2060 2060 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PQS trimeric 3 
2 software_defined_assembly PQS trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,K,L,M 
2 1 D,E,F,I,J,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6830  ? 
1 MORE         -55.6 ? 
1 'SSA (A^2)'  19240 ? 
2 'ABSA (A^2)' 6810  ? 
2 MORE         -54.7 ? 
2 'SSA (A^2)'  18990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLN 88 ? A GLN 177 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 OD2 ? B ASP 82 ? B ASP 172  ? 1_555 97.1  ? 
2  OE1 ? A GLN 88 ? A GLN 177 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 O   ? B TYR 83 ? B TYR 173  ? 1_555 94.7  ? 
3  OD2 ? B ASP 82 ? B ASP 172 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 O   ? B TYR 83 ? B TYR 173  ? 1_555 100.0 ? 
4  OE1 ? A GLN 88 ? A GLN 177 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 OE1 ? B GLN 89 ? B GLN 179  ? 1_555 168.1 ? 
5  OD2 ? B ASP 82 ? B ASP 172 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 OE1 ? B GLN 89 ? B GLN 179  ? 1_555 74.9  ? 
6  O   ? B TYR 83 ? B TYR 173 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 OE1 ? B GLN 89 ? B GLN 179  ? 1_555 95.4  ? 
7  OE1 ? A GLN 88 ? A GLN 177 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 O   ? M HOH .  ? C HOH 2044 ? 1_555 88.1  ? 
8  OD2 ? B ASP 82 ? B ASP 172 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 O   ? M HOH .  ? C HOH 2044 ? 1_555 165.4 ? 
9  O   ? B TYR 83 ? B TYR 173 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 O   ? M HOH .  ? C HOH 2044 ? 1_555 93.1  ? 
10 OE1 ? B GLN 89 ? B GLN 179 ? 1_555 CA ? H CA . ? B CA 1224 ? 1_555 O   ? M HOH .  ? C HOH 2044 ? 1_555 97.6  ? 
11 OE1 ? D GLN 88 ? D GLN 177 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 OD2 ? E ASP 82 ? E ASP 172  ? 1_555 93.5  ? 
12 OE1 ? D GLN 88 ? D GLN 177 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 O   ? E TYR 83 ? E TYR 173  ? 1_555 83.4  ? 
13 OD2 ? E ASP 82 ? E ASP 172 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 O   ? E TYR 83 ? E TYR 173  ? 1_555 99.3  ? 
14 OE1 ? D GLN 88 ? D GLN 177 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 OE1 ? E GLN 89 ? E GLN 179  ? 1_555 170.8 ? 
15 OD2 ? E ASP 82 ? E ASP 172 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 OE1 ? E GLN 89 ? E GLN 179  ? 1_555 77.9  ? 
16 O   ? E TYR 83 ? E TYR 173 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 OE1 ? E GLN 89 ? E GLN 179  ? 1_555 100.7 ? 
17 OE1 ? D GLN 88 ? D GLN 177 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 O   ? P HOH .  ? F HOH 2044 ? 1_555 86.2  ? 
18 OD2 ? E ASP 82 ? E ASP 172 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 O   ? P HOH .  ? F HOH 2044 ? 1_555 176.6 ? 
19 O   ? E TYR 83 ? E TYR 173 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 O   ? P HOH .  ? F HOH 2044 ? 1_555 84.1  ? 
20 OE1 ? E GLN 89 ? E GLN 179 ? 1_555 CA ? J CA . ? E CA 1224 ? 1_555 O   ? P HOH .  ? F HOH 2044 ? 1_555 102.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-19 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-12-05 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' Advisory                    
4  4 'Structure model' 'Data collection'           
5  4 'Structure model' 'Database references'       
6  4 'Structure model' 'Source and taxonomy'       
7  4 'Structure model' 'Structure summary'         
8  5 'Structure model' 'Data collection'           
9  5 'Structure model' 'Derived calculations'      
10 5 'Structure model' Other                       
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                     
2  4 'Structure model' entity                       
3  4 'Structure model' entity_name_com              
4  4 'Structure model' entity_src_nat               
5  4 'Structure model' pdbx_entity_src_syn          
6  4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
7  4 'Structure model' struct_ref                   
8  4 'Structure model' struct_ref_seq               
9  5 'Structure model' chem_comp                    
10 5 'Structure model' entity                       
11 5 'Structure model' pdbx_chem_comp_identifier    
12 5 'Structure model' pdbx_database_status         
13 5 'Structure model' pdbx_entity_nonpoly          
14 5 'Structure model' pdbx_struct_conn_angle       
15 5 'Structure model' struct_conn                  
16 5 'Structure model' struct_site                  
17 5 'Structure model' struct_site_gen              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_id_ASTM'                   
2  4 'Structure model' '_citation.journal_id_CSD'                    
3  4 'Structure model' '_citation.page_last'                         
4  4 'Structure model' '_citation.pdbx_database_id_DOI'              
5  4 'Structure model' '_entity.pdbx_description'                    
6  4 'Structure model' '_entity.src_method'                          
7  4 'Structure model' '_struct_ref.pdbx_align_begin'                
8  4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'        
9  4 'Structure model' '_struct_ref_seq.db_align_beg'                
10 4 'Structure model' '_struct_ref_seq.db_align_end'                
11 5 'Structure model' '_chem_comp.name'                             
12 5 'Structure model' '_chem_comp.type'                             
13 5 'Structure model' '_entity.pdbx_description'                    
14 5 'Structure model' '_pdbx_database_status.status_code_sf'        
15 5 'Structure model' '_pdbx_entity_nonpoly.name'                   
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
27 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
28 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
29 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
30 5 'Structure model' '_pdbx_struct_conn_angle.value'               
31 5 'Structure model' '_struct_conn.pdbx_dist_value'                
32 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
33 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
34 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
35 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
36 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
37 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
38 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
39 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
40 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
41 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
42 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
43 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
44 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
45 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE1 E GLN 93  ? ? O   E HOH 2002 ? ? 1.66 
2  1 O   E GLN 93  ? ? N   E LYS 94   ? ? 1.69 
3  1 N   E THR 92  ? ? O   E HOH 2001 ? ? 1.99 
4  1 NE  C ARG 111 ? ? O   C THR 125  ? ? 2.01 
5  1 OE2 B GLU 162 ? B O   B HOH 2019 ? ? 2.02 
6  1 CG  D GLN 160 ? ? N   D SEP 1223 ? ? 2.04 
7  1 O   D LEU 165 ? ? O   D HOH 2031 ? ? 2.09 
8  1 NH2 B ARG 161 ? ? OE1 B GLU 190  ? A 2.15 
9  1 OD1 C ASP 217 ? ? O   C HOH 2060 ? ? 2.17 
10 1 NE  C ARG 182 ? ? O   C HOH 2060 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 NH2 B ARG 163 ? ? 1_555 CB  D THR 113 ? ? 1_554 0.57 
2  1 OE2 A GLU 148 ? ? 1_555 NZ  C LYS 87  ? ? 1_445 0.78 
3  1 CD  A GLU 148 ? ? 1_555 NZ  C LYS 87  ? ? 1_445 0.82 
4  1 CZ  B ARG 163 ? ? 1_555 CG2 D THR 113 ? ? 1_554 1.20 
5  1 NH2 B ARG 163 ? ? 1_555 OG1 D THR 113 ? ? 1_554 1.31 
6  1 NH1 B ARG 163 ? ? 1_555 CG2 D THR 113 ? ? 1_554 1.37 
7  1 NH2 B ARG 163 ? ? 1_555 CG2 D THR 113 ? ? 1_554 1.61 
8  1 CZ  B ARG 163 ? ? 1_555 CB  D THR 113 ? ? 1_554 1.61 
9  1 OE1 A GLU 148 ? ? 1_555 NZ  C LYS 87  ? ? 1_445 1.62 
10 1 OE2 A GLU 148 ? ? 1_555 CE  C LYS 87  ? ? 1_445 1.69 
11 1 CZ  B ARG 163 ? ? 1_555 OG1 D THR 113 ? ? 1_554 1.78 
12 1 NH2 B ARG 163 ? ? 1_555 CA  D THR 113 ? ? 1_554 2.10 
13 1 N   A ASN 117 ? ? 1_555 NH2 E ARG 163 ? ? 1_554 2.11 
14 1 CG  A GLU 148 ? ? 1_555 NZ  C LYS 87  ? ? 1_445 2.13 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CB A GLN 90  ? ? CG A GLN 90  ? ? 2.026 1.521 0.505  0.027 N 
2  1 N  A ARG 92  ? ? CA A ARG 92  ? ? 1.974 1.459 0.515  0.020 N 
3  1 N  B GLN 93  ? ? CA B GLN 93  ? ? 1.674 1.459 0.215  0.020 N 
4  1 C  B GLN 93  ? ? O  B GLN 93  ? ? 0.904 1.229 -0.325 0.019 N 
5  1 C  B GLN 93  ? ? N  B LYS 94  ? ? 1.507 1.336 0.171  0.023 Y 
6  1 CB B ARG 109 ? ? CG B ARG 109 ? ? 0.783 1.521 -0.738 0.027 N 
7  1 N  B ARG 129 ? ? CA B ARG 129 ? ? 1.580 1.459 0.121  0.020 N 
8  1 CB B SER 149 ? ? OG B SER 149 ? ? 1.146 1.418 -0.272 0.013 N 
9  1 CB B ARG 150 ? ? CG B ARG 150 ? ? 1.263 1.521 -0.258 0.027 N 
10 1 N  B TYR 175 ? ? CA B TYR 175 ? ? 1.663 1.459 0.204  0.020 N 
11 1 CA B TYR 175 ? ? C  B TYR 175 ? ? 1.714 1.525 0.189  0.026 N 
12 1 N  B ASP 201 ? ? CA B ASP 201 ? ? 1.585 1.459 0.126  0.020 N 
13 1 CA B ASP 201 ? ? C  B ASP 201 ? ? 1.719 1.525 0.194  0.026 N 
14 1 N  C LYS 87  ? ? CA C LYS 87  ? ? 1.797 1.459 0.338  0.020 N 
15 1 CA C LYS 87  ? ? C  C LYS 87  ? ? 1.687 1.525 0.162  0.026 N 
16 1 N  D VAL 109 ? ? CA D VAL 109 ? ? 1.323 1.459 -0.136 0.020 N 
17 1 N  E GLN 93  ? ? CA E GLN 93  ? ? 2.978 1.459 1.519  0.020 N 
18 1 C  E GLN 93  ? ? O  E GLN 93  ? ? 0.817 1.229 -0.412 0.019 N 
19 1 C  E GLN 93  ? ? N  E LYS 94  ? ? 1.066 1.336 -0.270 0.023 Y 
20 1 CA E ASN 104 ? ? C  E ASN 104 ? ? 1.913 1.525 0.388  0.026 N 
21 1 CB E ARG 109 ? ? CG E ARG 109 ? ? 0.872 1.521 -0.649 0.027 N 
22 1 CB E SER 149 ? ? OG E SER 149 ? ? 1.148 1.418 -0.270 0.013 N 
23 1 CB E ARG 150 ? ? CG E ARG 150 ? ? 1.259 1.521 -0.262 0.027 N 
24 1 CB E ARG 163 ? ? CG E ARG 163 ? ? 1.828 1.521 0.307  0.027 N 
25 1 CB F LYS 89  ? ? CG F LYS 89  ? ? 1.134 1.521 -0.387 0.027 N 
26 1 CA F GLN 102 ? ? C  F GLN 102 ? ? 1.755 1.525 0.230  0.026 N 
27 1 CA F GLN 203 ? ? C  F GLN 203 ? ? 1.737 1.525 0.212  0.026 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA A GLN 90  ? ? CB A GLN 90  ? ? CG A GLN 90  ? ? 135.14 113.40 21.74  2.20 N 
2  1 CB A GLN 90  ? ? CG A GLN 90  ? ? CD A GLN 90  ? ? 131.57 111.60 19.97  2.60 N 
3  1 CA A ARG 92  ? ? C  A ARG 92  ? ? O  A ARG 92  ? ? 100.18 120.10 -19.92 2.10 N 
4  1 CB A GLN 160 ? ? CG A GLN 160 ? ? CD A GLN 160 ? ? 90.97  111.60 -20.63 2.60 N 
5  1 CA B GLN 93  ? ? C  B GLN 93  ? ? O  B GLN 93  ? ? 88.74  120.10 -31.36 2.10 N 
6  1 CA B GLN 93  ? ? C  B GLN 93  ? ? N  B LYS 94  ? ? 135.16 117.20 17.96  2.20 Y 
7  1 O  B GLN 93  ? ? C  B GLN 93  ? ? N  B LYS 94  ? ? 105.64 122.70 -17.06 1.60 Y 
8  1 C  B GLN 93  ? ? N  B LYS 94  ? ? CA B LYS 94  ? ? 151.66 121.70 29.96  2.50 Y 
9  1 CA B ARG 150 ? ? CB B ARG 150 ? ? CG B ARG 150 ? ? 137.60 113.40 24.20  2.20 N 
10 1 CA B ARG 163 ? ? CB B ARG 163 ? ? CG B ARG 163 ? ? 127.40 113.40 14.00  2.20 N 
11 1 CB B ARG 163 ? ? CG B ARG 163 ? ? CD B ARG 163 ? ? 78.12  111.60 -33.48 2.60 N 
12 1 CB B TYR 175 ? ? CA B TYR 175 ? ? C  B TYR 175 ? ? 124.15 110.40 13.75  2.00 N 
13 1 CA B TYR 175 ? ? C  B TYR 175 ? ? O  B TYR 175 ? ? 69.39  120.10 -50.71 2.10 N 
14 1 CA B TYR 175 ? ? C  B TYR 175 ? ? N  B ASN 176 ? ? 160.00 117.20 42.80  2.20 Y 
15 1 CA B ASP 201 ? ? C  B ASP 201 ? ? O  B ASP 201 ? ? 141.49 120.10 21.39  2.10 N 
16 1 CA B ASP 201 ? ? C  B ASP 201 ? ? N  B LYS 202 ? ? 94.96  117.20 -22.24 2.20 Y 
17 1 CA C LYS 87  ? ? C  C LYS 87  ? ? O  C LYS 87  ? ? 134.62 120.10 14.52  2.10 N 
18 1 CA C LYS 87  ? ? C  C LYS 87  ? ? N  C GLN 88  ? ? 101.46 117.20 -15.74 2.20 Y 
19 1 CA C LYS 170 ? ? C  C LYS 170 ? ? O  C LYS 170 ? ? 103.81 120.10 -16.29 2.10 N 
20 1 CA D GLN 90  ? ? CB D GLN 90  ? ? CG D GLN 90  ? ? 130.32 113.40 16.92  2.20 N 
21 1 CA D ARG 92  ? ? CB D ARG 92  ? ? CG D ARG 92  ? ? 128.46 113.40 15.06  2.20 N 
22 1 C  E THR 92  ? ? N  E GLN 93  ? ? CA E GLN 93  ? ? 72.66  121.70 -49.04 2.50 Y 
23 1 CA E GLN 93  ? ? C  E GLN 93  ? ? O  E GLN 93  ? ? 99.33  120.10 -20.77 2.10 N 
24 1 CA E GLN 93  ? ? C  E GLN 93  ? ? N  E LYS 94  ? ? 132.23 117.20 15.03  2.20 Y 
25 1 CA E ASN 104 ? ? C  E ASN 104 ? ? O  E ASN 104 ? ? 86.07  120.10 -34.03 2.10 N 
26 1 CA E ASN 104 ? ? C  E ASN 104 ? ? N  E VAL 105 ? ? 100.68 117.20 -16.52 2.20 Y 
27 1 CA E ARG 150 ? ? CB E ARG 150 ? ? CG E ARG 150 ? ? 137.39 113.40 23.99  2.20 N 
28 1 CB E ARG 163 ? ? CG E ARG 163 ? ? CD E ARG 163 ? ? 72.41  111.60 -39.19 2.60 N 
29 1 N  E GLU 209 ? ? CA E GLU 209 ? ? C  E GLU 209 ? ? 133.31 111.00 22.31  2.70 N 
30 1 CA E GLU 209 ? ? C  E GLU 209 ? ? O  E GLU 209 ? ? 75.16  120.10 -44.94 2.10 N 
31 1 CA E GLU 209 ? ? C  E GLU 209 ? ? N  E GLY 210 ? ? 156.09 116.20 39.89  2.00 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 100 ? ? -155.86 -46.42  
2  1 ARG A 100 ? ? -155.86 -45.35  
3  1 MET A 104 ? B -77.75  -169.06 
4  1 ASN A 117 ? ? -153.69 68.13   
5  1 GLU A 119 ? A 81.79   2.81    
6  1 TRP A 147 ? ? -126.20 -102.15 
7  1 SER A 164 ? ? -147.18 -154.51 
8  1 THR B 92  ? ? -132.47 -63.77  
9  1 GLN B 93  ? ? -72.60  42.67   
10 1 LYS B 94  ? ? -48.71  82.62   
11 1 ASN B 104 ? ? -97.48  31.20   
12 1 ASP B 110 ? ? 76.41   -1.09   
13 1 ASN B 121 ? ? -159.66 56.87   
14 1 ASN B 123 ? ? 81.60   -4.84   
15 1 ARG B 161 ? ? -91.12  -108.52 
16 1 ARG B 161 ? ? -91.12  -108.10 
17 1 TYR B 175 ? ? -59.11  46.63   
18 1 ASN B 176 ? ? 81.09   45.58   
19 1 THR B 177 ? ? -177.23 148.43  
20 1 ASP B 201 ? ? -18.76  -59.02  
21 1 ALA B 211 ? ? -158.49 80.00   
22 1 ASN C 118 ? ? -170.25 55.45   
23 1 LYS C 170 ? ? 60.36   -17.47  
24 1 ASN C 194 ? ? -111.00 -129.75 
25 1 ARG D 100 ? A -164.71 -24.99  
26 1 ARG D 100 ? B -147.71 -74.36  
27 1 ASN D 101 ? A -149.80 52.94   
28 1 ASN D 101 ? B -116.81 63.60   
29 1 MET D 104 ? A -95.87  -151.49 
30 1 MET D 104 ? B -95.12  -149.55 
31 1 ASN D 117 ? ? -165.24 61.27   
32 1 GLU D 119 ? A 78.24   -3.30   
33 1 GLU D 119 ? B 77.43   -0.77   
34 1 TRP D 147 ? ? -125.48 -102.61 
35 1 SER D 164 ? ? -151.49 -156.47 
36 1 LYS D 201 ? ? -158.40 83.32   
37 1 ASN E 104 ? ? -104.81 58.79   
38 1 ASN E 121 ? ? -162.84 57.01   
39 1 ASN E 123 ? ? 82.75   -5.79   
40 1 ARG E 161 ? ? -100.65 -112.89 
41 1 GLU E 209 ? ? -13.39  67.11   
42 1 ALA E 211 ? ? -160.74 71.43   
43 1 ASN F 118 ? ? -172.64 58.35   
44 1 LYS F 170 ? ? 78.81   -48.48  
45 1 ASN F 194 ? ? -107.75 -133.87 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   E 
_pdbx_validate_peptide_omega.auth_seq_id_1    209 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   E 
_pdbx_validate_peptide_omega.auth_seq_id_2    210 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -145.40 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 ARG A 92  ? ? 25.84  
2 1 GLN B 93  ? ? 44.05  
3 1 TYR B 175 ? ? 42.41  
4 1 LYS C 170 ? ? -23.51 
5 1 ASN E 104 ? ? 34.40  
6 1 GLU E 209 ? ? 34.10  
7 1 GLN F 102 ? ? -21.57 
8 1 GLN F 203 ? ? 13.36  
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   E 
_pdbx_validate_polymer_linkage.auth_comp_id_1   GLN 
_pdbx_validate_polymer_linkage.auth_seq_id_1    93 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   E 
_pdbx_validate_polymer_linkage.auth_comp_id_2   LYS 
_pdbx_validate_polymer_linkage.auth_seq_id_2    94 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.07 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ARG 108  ? CG  ? B ARG 18  CG  
2  1 Y 1 B ARG 108  ? CD  ? B ARG 18  CD  
3  1 Y 1 B ARG 108  ? NE  ? B ARG 18  NE  
4  1 Y 1 B ARG 108  ? CZ  ? B ARG 18  CZ  
5  1 Y 1 B ARG 108  ? NH1 ? B ARG 18  NH1 
6  1 Y 1 B ARG 108  ? NH2 ? B ARG 18  NH2 
7  1 Y 1 B MET 224  ? CA  ? B MET 134 CA  
8  1 Y 1 B MET 224  ? C   ? B MET 134 C   
9  1 Y 1 B MET 224  ? O   ? B MET 134 O   
10 1 Y 1 B MET 224  ? CB  ? B MET 134 CB  
11 1 Y 1 B MET 224  ? CG  ? B MET 134 CG  
12 1 Y 1 B MET 224  ? SD  ? B MET 134 SD  
13 1 Y 1 B MET 224  ? CE  ? B MET 134 CE  
14 1 Y 1 E ARG 108  ? CG  ? E ARG 18  CG  
15 1 Y 1 E ARG 108  ? CD  ? E ARG 18  CD  
16 1 Y 1 E ARG 108  ? NE  ? E ARG 18  NE  
17 1 Y 1 E ARG 108  ? CZ  ? E ARG 18  CZ  
18 1 Y 1 E ARG 108  ? NH1 ? E ARG 18  NH1 
19 1 Y 1 E ARG 108  ? NH2 ? E ARG 18  NH2 
20 1 Y 1 E MET 224  ? CA  ? E MET 134 CA  
21 1 Y 1 E MET 224  ? C   ? E MET 134 C   
22 1 Y 1 E MET 224  ? O   ? E MET 134 O   
23 1 Y 1 E MET 224  ? CB  ? E MET 134 CB  
24 1 Y 1 E MET 224  ? CG  ? E MET 134 CG  
25 1 Y 1 E MET 224  ? SD  ? E MET 134 SD  
26 1 Y 1 E MET 224  ? CE  ? E MET 134 CE  
27 1 N 1 D SEP 1223 ? OXT ? I SEP 1   OXT 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 223 ? A ALA 134 
2 1 Y 1 B GLU 225 ? B GLU 135 
3 1 Y 1 B ALA 226 ? B ALA 136 
4 1 Y 1 D ALA 223 ? D ALA 134 
5 1 Y 1 E ALA 91  ? E ALA 1   
6 1 Y 1 E GLU 225 ? E GLU 135 
7 1 Y 1 E ALA 226 ? E ALA 136 
8 1 Y 1 F LYS 87  ? F LYS 1   
9 1 Y 1 F GLN 88  ? F GLN 2   
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 'CALCIUM ION'                            CA  
6 PHOSPHOSERINE                            SEP 
7 water                                    HOH 
#