data_2JGF
# 
_entry.id   2JGF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JGF         
PDBE  EBI-31395    
WWPDB D_1290031395 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JGF 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hornberg, A.'    1 
'Tunemalm, A.-K.' 2 
'Ekstrom, F.'     3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structures of Acetylcholinesterase in Complex with Organophosphorus Compounds Suggest that the Acyl Pocket Modulates the Aging Reaction by Precluding the Formation of the Trigonal Bipyramidal Transition State.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                4815 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17402711 
_citation.pdbx_database_id_DOI      10.1021/BI0621361 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hornberg, A.'    1 ? 
primary 'Tunemalm, A.-K.' 2 ? 
primary 'Ekstrom, F.'     3 ? 
# 
_cell.entry_id           2JGF 
_cell.length_a           79.060 
_cell.length_b           111.730 
_cell.length_c           224.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JGF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                     60383.109 2   3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ?                                   ? 
3 non-polymer syn 'HEXAETHYLENE GLYCOL'                    282.331   1   ?       ? ?                                   ? 
4 non-polymer syn 'TRIETHYLENE GLYCOL'                     150.173   1   ?       ? ?                                   ? 
5 water       nat water                                    18.015    174 ?       ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SXE)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SXE n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PCDNA3.1 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACES_MOUSE 1 ? ? P21836 ? 
2 PDB 2JGF       1 ? ? 2JGF   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JGF A 1   ? 543 ? P21836 32  ? 574 ? 1   543 
2 2 2JGF A 544 ? 548 ? 2JGF   544 ? 548 ? 544 548 
3 1 2JGF B 1   ? 543 ? P21836 32  ? 574 ? 1   543 
4 2 2JGF B 544 ? 548 ? 2JGF   544 ? 548 ? 544 548 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                   ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                  ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                           ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                  ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                 ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                     ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                    ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                  
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                     'POLYETHYLENE GLYCOL PEG400' 
'C12 H26 O7'     282.331 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                                      ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                                             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                    ? 'C3 H7 N O3'     105.093 
SXE 'L-peptide linking'          n 'O-{(S)-ETHOXY[(1-METHYLETHYL)AMINO]PHOSPHORYL}-L-SERINE' ? 'C8 H19 N2 O5 P' 254.221 
THR 'L-peptide linking'          y THREONINE                                                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                    ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JGF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '28% PEG750MME, 0.1M HEPES PH7.0, pH 7.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-02-02 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.131 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.131 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JGF 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   69500 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.08000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.400 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.63 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           0.48000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.600 
_reflns_shell.pdbx_redundancy        7.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JGF 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     68027 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.73 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  1384 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.935 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               43.30 
_refine.aniso_B[1][1]                            0.01000 
_refine.aniso_B[2][2]                            0.00000 
_refine.aniso_B[3][3]                            -0.01000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 2 CHAIN(S). HETEROGEN: THE P6G REPRESENTS PEG750 THAT WAS USED IN CRYSTALLIZATION.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.272 
_refine.pdbx_overall_ESU_R_Free                  0.226 
_refine.overall_SU_ML                            0.165 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.347 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8364 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             174 
_refine_hist.number_atoms_total               8580 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        19.73 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 8657  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.315  1.962  ? 11814 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.244  5.000  ? 1064  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.053 22.828 ? 396   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.697 15.000 ? 1262  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.773 15.000 ? 73    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.093  0.200  ? 1270  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 6795  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.215  0.200  ? 4627  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.316  0.200  ? 5974  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.145  0.200  ? 418   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.201  0.200  ? 40    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.255  0.200  ? 10    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.679  1.500  ? 5408  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.199  2.000  ? 8590  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.635  3.000  ? 3685  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.514  4.500  ? 3224  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             4816 
_refine_ls_shell.R_factor_R_work                  0.3090 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3390 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2JGF 
_struct.title                     'Crystal structure of mouse acetylcholinesterase inhibited by non-aged fenamiphos' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JGF 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;GLYCOPROTEIN, SERINE ESTERASE, ACETYLCHOLINESTERASE, ALTERNATIVE SPLICING, NEUROTRANSMITTER DEGRADATION, SYNAPSE, MEMBRANE, HYDROLASE, FENAMIPHOS
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SXE A 203 ? SER A 215 ? SXE A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 ALA A 241 ? VAL A 255 ? ALA A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 SER A 336 ? GLY A 342 ? SER A 336 GLY A 342 5 ? 7  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? LEU A 540 ? ARG A 534 LEU A 540 1 ? 7  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SXE B 203 ? SER B 215 ? SXE B 203 SER B 215 1 ? 13 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 265 ? ARG B 274 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P39 39 PRO B 277 ? GLU B 285 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 40 TRP B 286 ? VAL B 288 ? TRP B 286 VAL B 288 5 ? 3  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? GLY B 456 ? GLU B 450 GLY B 456 1 ? 7  
HELX_P HELX_P49 49 LEU B 457 ? ASN B 464 ? LEU B 457 ASN B 464 5 ? 8  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 534 ? ALA B 542 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.073 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.068 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
covale1 covale one  ? A GLU 202 C   ? ? ? 1_555 A SXE 203 N  ? ? A GLU 202 A SXE 203  1_555 ? ? ? ? ? ? ? 1.340 ? ?               
covale2 covale both ? A SXE 203 C   ? ? ? 1_555 A ALA 204 N  ? ? A SXE 203 A ALA 204  1_555 ? ? ? ? ? ? ? 1.334 ? ?               
covale3 covale one  ? A ASN 464 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 464 A NAG 1544 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale4 covale one  ? B GLU 202 C   ? ? ? 1_555 B SXE 203 N  ? ? B GLU 202 B SXE 203  1_555 ? ? ? ? ? ? ? 1.340 ? ?               
covale5 covale both ? B SXE 203 C   ? ? ? 1_555 B ALA 204 N  ? ? B SXE 203 B ALA 204  1_555 ? ? ? ? ? ? ? 1.337 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -3.44 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 2.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
AC 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 239 ? O VAL A 239 N VAL A 303 ? N VAL A 303 
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          2JGF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JGF 
_atom_sites.fract_transf_matrix[1][1]   0.012649 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008950 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004455 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.202  14.417  54.925  1.00 64.08 ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.740  14.720  54.831  1.00 64.18 ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 30.142  15.054  56.197  1.00 64.04 ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.876  15.326  57.148  1.00 64.21 ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.986  13.549  54.169  1.00 64.24 ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.910  12.252  54.979  1.00 63.60 ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.764  11.019  54.102  1.00 63.45 ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 30.768  10.640  53.452  1.00 62.50 ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 28.659  10.422  54.080  1.00 62.45 ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.813  15.030  56.290  1.00 63.76 ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.135  15.271  57.552  1.00 63.11 ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.922  16.141  57.365  1.00 62.92 ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.821  15.771  57.779  1.00 62.41 ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.125  17.295  56.727  1.00 63.00 ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.041  18.260  56.504  1.00 63.07 ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.523  18.311  55.063  1.00 62.52 ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.561  19.023  54.776  1.00 63.05 ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.431  19.666  57.002  1.00 63.36 ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 25.651  20.153  58.252  1.00 64.65 ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 26.186  19.543  59.552  1.00 66.91 ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.575  20.091  60.776  1.00 68.35 ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.395  19.719  61.291  1.00 69.19 ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.632  18.801  60.697  1.00 68.47 ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 23.964  20.277  62.413  1.00 69.24 ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.143  17.546  54.170  1.00 61.67 ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.776  17.550  52.754  1.00 60.70 ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.553  16.700  52.467  1.00 59.75 ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.176  15.838  53.260  1.00 59.64 ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.917  17.013  51.901  1.00 61.00 ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.253  17.667  52.127  1.00 62.68 ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.338  16.978  51.339  1.00 64.64 ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.341  16.546  51.948  1.00 65.59 ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.173  16.847  50.107  1.00 65.33 ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.963  16.944  51.299  1.00 58.49 ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.839  16.182  50.800  1.00 57.05 ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.275  14.733  50.614  1.00 56.52 ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.091  14.445  49.739  1.00 56.64 ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.389  16.779  49.469  1.00 56.80 ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.094  16.175  48.953  1.00 56.13 ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.776  15.010  49.262  1.00 55.40 ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.389  16.881  48.214  1.00 55.09 ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.740  13.814  51.443  1.00 55.76 ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.103  12.393  51.379  1.00 54.68 ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.824  11.715  50.036  1.00 53.54 ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.348  10.628  49.783  1.00 53.79 ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.239  11.761  52.479  1.00 54.69 ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.131  12.719  52.702  1.00 55.23 ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.757  14.063  52.514  1.00 55.81 ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 22.019  12.336  49.182  1.00 52.13 ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.740  11.754  47.869  1.00 51.33 ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.805  12.036  46.810  1.00 49.90 ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.763  11.470  45.710  1.00 49.94 ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.365  12.172  47.361  1.00 51.81 ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.254  11.177  47.730  1.00 54.95 ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.273  9.904   46.874  1.00 57.16 ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.553  9.947   45.670  1.00 58.15 ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.953  8.766   47.498  1.00 58.53 ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.757  12.900  47.149  1.00 47.90 ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.766  13.352  46.202  1.00 46.31 ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 26.151  12.788  46.488  1.00 45.48 ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 27.135  13.208  45.871  1.00 45.46 ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.805  14.886  46.161  1.00 46.15 ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.437  15.529  45.876  1.00 45.47 ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.498  17.032  46.025  1.00 44.47 ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.903  15.126  44.504  1.00 43.78 ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.236  11.842  47.421  1.00 44.07 ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.519  11.246  47.738  1.00 42.74 ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.580  9.822   47.204  1.00 42.01 ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.879  8.932   47.682  1.00 41.84 ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.813  11.335  49.232  1.00 42.72 ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.720  12.757  49.833  1.00 42.38 ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.853  12.742  51.371  1.00 40.53 ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.724  13.720  49.217  1.00 40.41 ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.398  9.634   46.174  1.00 40.83 ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.542  8.343   45.536  1.00 40.13 ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.023  7.933   45.531  1.00 39.75 ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.917  8.788   45.570  1.00 39.47 ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.937  8.366   44.118  1.00 40.06 ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.191  7.075   43.378  1.00 40.25 ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.457  8.570   44.209  1.00 40.28 ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.261  6.620   45.528  1.00 38.87 ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.593  6.077   45.402  1.00 38.00 ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.702  5.320   44.095  1.00 37.83 ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.817  4.539   43.751  1.00 38.17 ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.923  5.157   46.573  1.00 38.14 ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.232  4.396   46.401  1.00 37.40 ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.672  3.675   47.666  1.00 37.51 ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.136  4.583   48.720  1.00 38.18 ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.363  5.090   48.797  1.00 37.18 ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.687  5.897   49.800  1.00 37.25 ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.262  4.801   47.868  1.00 36.72 ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.781  5.567   43.361  1.00 37.37 ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.094  4.775   42.172  1.00 37.13 ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.497  4.168   42.325  1.00 37.38 ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.189  4.470   43.293  1.00 37.51 ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.953  5.597   40.883  1.00 37.01 ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.502  5.998   40.689  1.00 36.40 ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.900  6.817   40.894  1.00 34.46 ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.915  3.333   41.376  1.00 37.62 ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.167  2.577   41.511  1.00 38.47 ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.368  3.442   41.886  1.00 38.79 ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.264  2.973   42.553  1.00 39.71 ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.426  1.740   40.254  1.00 38.39 ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.828  1.095   40.089  1.00 39.77 ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 38.131  -0.084  41.029  1.00 40.46 ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 39.126  0.341   42.012  1.00 42.36 ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.363  -0.137  42.123  1.00 42.37 ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.799  -1.116  41.346  1.00 40.93 ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 41.156  0.350   43.064  1.00 45.06 ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.354  4.714   41.514  1.00 39.29 ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.503  5.572   41.710  1.00 39.71 ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.377  6.515   42.882  1.00 40.33 ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.315  7.275   43.191  1.00 40.37 ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.222  6.495   43.535  1.00 40.16 ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 37.055  7.322   44.711  1.00 40.25 ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.649  7.804   44.935  1.00 40.60 ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.687  7.225   44.410  1.00 41.02 ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.548  8.872   45.721  1.00 40.52 ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.286  9.453   46.128  1.00 40.54 ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.919  10.707  45.349  1.00 40.45 ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.775  11.558  45.056  1.00 40.03 ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.337  9.790   47.612  1.00 40.97 ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.925  8.649   48.503  1.00 42.60 ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.035  8.998   49.967  1.00 46.34 ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.087  9.470   50.430  1.00 47.15 ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.946  8.769   50.716  1.00 46.53 ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.624  10.831  45.056  1.00 40.17 ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.125  11.912  44.220  1.00 40.03 ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.050  12.685  44.959  1.00 40.38 ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.148  12.087  45.565  1.00 40.76 ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.546  11.345  42.917  1.00 39.67 ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.443  10.504  42.009  1.00 38.84 ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.599  9.746   41.017  1.00 37.56 ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.430  11.390  41.299  1.00 38.41 ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.154  14.006  44.929  1.00 40.17 ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 30.072  14.852  45.379  1.00 40.45 ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.408  15.355  44.119  1.00 40.34 ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 30.077  15.938  43.264  1.00 40.17 ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.610  16.036  46.159  1.00 40.79 ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.586  16.718  47.056  1.00 43.00 ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 30.035  18.129  47.475  1.00 45.70 ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 31.494  18.292  47.535  1.00 47.18 ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.276  17.920  48.550  1.00 49.52 ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 31.775  17.321  49.628  1.00 48.73 ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.587  18.130  48.475  1.00 51.16 ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.103  15.126  43.997  1.00 39.93 ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.341  15.629  42.870  1.00 39.83 ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.603  16.901  43.214  1.00 40.47 ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.869  17.533  44.237  1.00 40.76 ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.668  17.280  42.356  1.00 40.80 ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.843  18.446  42.602  1.00 41.36 ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.374  18.132  42.286  1.00 41.50 ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.074  17.429  41.315  1.00 41.62 ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.382  19.666  41.810  1.00 41.48 ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.662  20.951  42.213  1.00 41.86 ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.331  19.415  40.292  1.00 41.79 ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.261  22.231  41.612  1.00 41.62 ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.478  18.613  43.148  1.00 42.01 ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 21.036  18.553  42.930  1.00 42.47 ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.746  19.652  41.929  1.00 42.70 ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 21.086  20.826  42.154  1.00 42.84 ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.283  18.794  44.244  1.00 42.20 ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.773  18.577  44.200  1.00 43.10 ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.072  18.972  45.516  1.00 44.09 ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.939  19.868  45.230  1.00 50.97 ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.650  19.646  45.517  1.00 52.93 ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.246  18.550  46.163  1.00 55.28 ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.745  20.553  45.166  1.00 53.75 ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.175  19.267  40.798  1.00 42.93 ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.844  20.228  39.763  1.00 43.41 ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.343  20.385  39.634  1.00 44.11 ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.589  19.445  39.858  1.00 44.24 ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.450  19.817  38.422  1.00 43.01 ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.958  19.966  38.187  1.00 42.28 ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.215  19.669  36.740  1.00 43.43 ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.502  21.336  38.529  1.00 39.45 ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.904  21.576  39.263  1.00 45.18 ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.478  21.798  39.068  1.00 46.26 ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 16.117  21.543  37.598  1.00 45.76 ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.666  22.166  36.690  1.00 45.63 ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 16.081  23.199  39.584  1.00 47.07 ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.838  23.841  38.963  1.00 50.47 ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.550  23.494  39.716  1.00 56.02 ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 12.401  24.436  39.307  1.00 57.97 ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 11.080  23.843  39.669  1.00 60.49 ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 15.252  20.561  37.376  1.00 45.38 ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.602  20.388  36.089  1.00 45.20 ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 13.145  20.858  36.233  1.00 45.34 ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.691  21.106  37.357  1.00 45.70 ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.679  18.947  35.649  1.00 44.99 ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.416  21.033  35.105  1.00 45.26 ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 11.034  21.527  35.182  1.00 44.87 ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 10.110  20.735  36.097  1.00 44.81 ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.410   21.331  36.901  1.00 45.36 ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.551  21.455  33.739  1.00 44.66 ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.788  21.579  32.932  1.00 45.32 ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.847  20.851  33.706  1.00 45.32 ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.112  19.411  35.995  1.00 44.86 ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.205   18.584  36.793  1.00 44.27 ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.709   18.201  38.177  1.00 44.26 ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 9.063   17.408  38.867  1.00 44.57 ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.857  18.749  38.585  1.00 43.53 ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.485  18.407  39.863  1.00 42.61 ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.995  18.276  39.731  1.00 42.18 ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.531  18.495  38.652  1.00 42.24 ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.688  17.897  40.825  1.00 41.59 ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.152  17.786  40.890  1.00 40.62 ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.776  16.560  40.209  1.00 40.24 ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 15.120  15.518  40.084  1.00 39.95 ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.419  17.711  42.393  1.00 40.51 ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 14.224  17.034  42.947  1.00 40.95 ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 13.061  17.551  42.120  1.00 41.88 ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 17.044  16.702  39.791  1.00 39.26 ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.856  15.587  39.289  1.00 38.37 ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.251  15.556  39.926  1.00 37.94 ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.777  16.597  40.329  1.00 37.72 ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 18.007  15.597  37.745  1.00 38.41 ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.675  15.402  37.084  1.00 37.76 ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.667  16.871  37.259  1.00 38.35 ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.839  14.368  40.035  1.00 37.00 ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.239  14.273  40.473  1.00 36.78 ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.175  14.367  39.275  1.00 35.57 ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 22.020  13.625  38.295  1.00 34.90 ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.509  12.965  41.211  1.00 36.60 ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.562  12.759  42.248  1.00 40.01 ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.136  15.279  39.347  1.00 34.28 ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.155  15.348  38.315  1.00 33.35 ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.573  15.220  38.878  1.00 32.84 ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.941  15.902  39.836  1.00 33.34 ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 24.007  16.603  37.527  1.00 33.48 ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.355  14.327  38.282  1.00 31.89 ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.761  14.140  38.618  1.00 30.23 ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.576  14.505  37.397  1.00 30.44 ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.678  13.740  36.436  1.00 29.84 ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 28.002  12.690  39.045  1.00 29.78 ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.269  12.318  40.286  1.00 28.14 ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.950  11.873  40.222  1.00 28.37 ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.860  12.486  41.524  1.00 25.45 ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.244  11.566  41.390  1.00 28.52 ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 27.157  12.182  42.706  1.00 27.12 ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.854  11.729  42.641  1.00 26.69 ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.145  15.703  37.424  1.00 31.02 ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.739  16.267  36.228  1.00 31.12 ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.241  16.236  36.336  1.00 31.22 ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.781  16.391  37.414  1.00 31.60 ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.221  17.684  36.007  1.00 31.02 ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.690  17.826  35.991  1.00 32.48 ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.286  19.282  35.813  1.00 33.41 ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 27.022  16.941  34.918  1.00 32.46 ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.916  16.023  35.219  1.00 31.26 ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.366  16.054  35.232  1.00 32.11 ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.029  14.966  36.056  1.00 32.32 ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.005  15.218  36.758  1.00 32.89 ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.496  13.754  35.988  1.00 32.37 ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.150  12.611  36.606  1.00 32.30 ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.282  12.172  35.677  1.00 32.53 ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.039  11.854  34.517  1.00 32.93 ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.183  11.441  36.758  1.00 31.80 ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.938  11.869  37.539  1.00 31.64 ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.886  10.264  37.398  1.00 32.54 ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.766  10.897  37.411  1.00 30.08 ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.521  12.132  36.176  1.00 32.58 ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.609  11.680  35.293  1.00 32.21 ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.527  10.156  35.077  1.00 32.24 ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.340  9.416   36.036  1.00 32.50 ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.860  12.052  36.087  1.00 32.16 ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.405  12.009  37.552  1.00 31.90 ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.984  12.451  37.543  1.00 32.48 ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.619  9.700   33.832  1.00 32.12 ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.642  8.269   33.546  1.00 32.18 ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.008  7.844   33.044  1.00 32.98 ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.276  6.641   32.885  1.00 33.60 ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.543  7.840   32.556  1.00 31.33 ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.588  8.551   31.227  1.00 31.42 ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.063  7.909   30.102  1.00 31.39 ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 36.110  9.860   31.088  1.00 30.55 ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.100  8.565   28.855  1.00 31.74 ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.139  10.498  29.854  1.00 29.66 ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.650  9.857   28.741  1.00 29.59 ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.870  8.833   32.808  1.00 33.36 ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.186  8.595   32.235  1.00 33.83 ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.231  9.474   32.868  1.00 34.15 ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.920  10.531  33.412  1.00 34.68 ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.168  8.850   30.770  1.00 34.14 ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.476  9.028   32.781  1.00 33.94 ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.600  9.882   33.097  1.00 34.18 ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.633  10.986  32.056  1.00 33.94 ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.362  10.743  30.876  1.00 33.88 ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.909  9.087   33.081  1.00 34.00 ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.131  8.261   34.351  1.00 34.22 ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.215  9.116   35.589  1.00 35.31 ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.094  10.000  35.623  1.00 39.20 ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.417  8.920   36.531  1.00 35.09 ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.935  12.205  32.488  1.00 33.58 ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.925  13.261  31.500  1.00 33.91 ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.846  12.906  30.336  1.00 34.00 ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.018  12.657  30.559  1.00 35.22 ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.445  14.470  32.281  1.00 33.47 ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.088  14.174  33.711  1.00 33.14 ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.274  12.693  33.836  1.00 33.62 ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.325  12.878  29.102  1.00 33.67 ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.160  12.485  27.975  1.00 33.95 ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.155  13.585  27.548  1.00 34.36 ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.199  13.974  26.380  1.00 34.19 ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.137  12.198  26.876  1.00 33.33 ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.047  13.140  27.176  1.00 34.07 ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 43.960  13.223  28.676  1.00 33.41 ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 47.966  14.056  28.485  1.00 34.78 ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.885  15.153  28.191  1.00 35.78 ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.354  14.707  28.001  1.00 36.96 ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.684  13.519  28.177  1.00 36.59 ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.757  16.286  29.243  1.00 35.75 ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.292  16.787  29.295  1.00 35.63 ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.199  15.809  30.616  1.00 34.36 ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.204  15.668  27.612  1.00 37.38 ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.636  15.473  27.506  1.00 38.27 ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.971  14.283  26.642  1.00 39.48 ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.590  14.225  25.470  1.00 40.38 ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.663  13.314  27.232  1.00 40.19 ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.081  12.114  26.508  1.00 40.79 ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.891  11.221  26.137  1.00 40.34 ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.047  10.261  25.391  1.00 40.27 ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.124  11.328  27.328  1.00 41.06 ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.590  10.945  28.593  1.00 42.83 ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.703  11.552  26.639  1.00 40.37 ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.523  10.695  26.428  1.00 40.04 ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.629  11.131  25.265  1.00 39.07 ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.715  10.410  24.873  1.00 38.97 ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.726  10.529  27.729  1.00 40.78 ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.521  9.844   28.846  1.00 42.71 ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.719  8.728   29.520  1.00 49.52 ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.198  9.083   30.852  1.00 52.85 ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.873  8.951   31.999  1.00 55.48 ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.128  8.492   32.009  1.00 56.00 ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 49.302  9.298   33.150  1.00 56.65 ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 49.926  12.301  24.705  1.00 38.31 ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.221  12.837  23.537  1.00 37.14 ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.393  11.883  22.355  1.00 36.88 ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.505  11.432  22.108  1.00 36.84 ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.764  14.236  23.197  1.00 36.46 ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.137  14.872  21.979  1.00 35.04 ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 49.954  16.033  21.451  1.00 32.16 ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.696  17.267  22.181  1.00 31.42 ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.365  18.406  21.987  1.00 31.19 ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.318  18.478  21.063  1.00 31.48 ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.067  19.475  22.699  1.00 28.65 ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.294  11.588  21.641  1.00 36.35 ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.237  10.577  20.561  1.00 35.82 ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.134  9.135   21.062  1.00 36.17 ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.805  8.221   20.283  1.00 35.72 ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.388  10.704  19.540  1.00 35.36 ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.654  12.122  19.089  1.00 35.62 ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.639  12.897  18.526  1.00 33.90 ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.913  12.687  19.246  1.00 34.54 ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.875  14.195  18.129  1.00 33.82 ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.149  13.993  18.852  1.00 34.97 ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.123  14.749  18.289  1.00 34.21 ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.400  8.938   22.352  1.00 36.39 ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.369  7.611   22.972  1.00 37.04 ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.973  7.152   23.422  1.00 37.06 ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.116  7.975   23.749  1.00 36.83 ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.320  7.576   24.166  1.00 36.98 ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.798  7.690   23.800  1.00 39.43 ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.449  6.139   23.184  1.00 43.59 ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 50.813  6.145   21.549  1.00 43.61 ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.746  5.829   23.443  1.00 37.40 ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.552  5.262   24.048  1.00 37.50 ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.297  5.858   25.418  1.00 37.94 ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.238  6.272   26.091  1.00 37.46 ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.916  3.790   24.187  1.00 37.27 ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.759  3.532   23.017  1.00 37.14 ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.590  4.776   22.844  1.00 37.52 ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.022  5.943   25.820  1.00 38.45 ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.746  6.452   27.144  1.00 39.07 ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.093  5.410   28.182  1.00 40.20 ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 43.765  4.232   28.021  1.00 40.36 ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.240  6.688   27.119  1.00 38.72 ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.726  5.717   26.130  1.00 38.05 ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.790  5.614   25.084  1.00 38.46 ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.771  5.846   29.230  1.00 41.47 ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.054  4.984   30.356  1.00 43.53 ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.008  5.277   31.431  1.00 42.71 ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.693  6.452   31.683  1.00 43.25 ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.507  5.191   30.830  1.00 43.53 ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.551  4.735   29.757  1.00 46.29 ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 49.005  4.632   30.272  1.00 47.92 ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.559  5.672   30.745  1.00 51.75 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.598  3.506   30.180  1.00 52.42 ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.429  4.221   32.042  1.00 42.38 ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.379  4.385   33.076  1.00 41.95 ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.762  5.333   34.219  1.00 41.71 ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.915  5.331   34.665  1.00 41.68 ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.186  2.965   33.601  1.00 41.68 ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.551  2.103   32.443  1.00 42.27 ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.714  2.799   31.783  1.00 42.14 ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.811  6.143   34.674  1.00 41.38 ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.081  7.125   35.724  1.00 41.76 ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.500  6.449   37.024  1.00 42.46 ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.831  5.531   37.495  1.00 42.67 ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.873  8.038   35.956  1.00 41.73 ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.962  8.963   37.173  1.00 41.16 ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.960  10.095  36.995  1.00 40.80 ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.984  11.000  38.228  1.00 39.74 ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.979  12.093  38.105  1.00 39.42 ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.626  6.894   37.575  1.00 42.66 ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.157  6.352   38.807  1.00 43.17 ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.336  6.881   39.969  1.00 42.68 ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.981  8.063   39.977  1.00 42.87 ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.634  6.731   38.965  1.00 43.41 ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.597  5.639   38.487  1.00 47.06 ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.908  6.187   37.895  1.00 51.67 ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.290  7.488   38.454  1.00 55.03 ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.095  8.360   37.844  1.00 56.92 ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.610  8.074   36.644  1.00 58.00 ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.380  9.527   38.423  1.00 56.27 ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 43.019  6.010   40.952  1.00 42.28 ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.163  6.441   42.066  1.00 41.93 ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.687  7.702   42.740  1.00 41.60 ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.900  7.867   42.872  1.00 41.61 ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.195  5.249   43.023  1.00 41.72 ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.489  4.085   42.161  1.00 42.22 ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.396  4.589   41.067  1.00 41.93 ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.769  8.587   43.128  1.00 41.23 ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.101  9.862   43.771  1.00 40.88 ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.766  9.739   45.242  1.00 41.68 ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 41.216  8.721   45.674  1.00 42.05 ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.296  11.018  43.146  1.00 39.69 ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.818  10.784  43.185  1.00 38.42 ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.964  11.109  44.194  1.00 37.81 ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.017  10.165  42.173  1.00 37.97 ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.680  10.739  43.877  1.00 35.36 ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.684  10.153  42.643  1.00 36.41 ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.294  9.615   40.917  1.00 37.85 ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.632  9.602   41.906  1.00 37.23 ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.242  9.060   40.187  1.00 37.80 ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.927  9.062   40.689  1.00 36.99 ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.082  10.758  46.033  1.00 42.35 ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.645  10.696  47.408  1.00 43.13 ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.796  11.893  47.777  1.00 43.37 ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.878  12.956  47.141  1.00 43.43 ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.823  10.503  48.370  1.00 43.48 ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.536  11.705  48.554  1.00 43.99 ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.986  11.707  48.816  1.00 43.36 ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.057  12.724  49.254  1.00 43.44 ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.817  12.666  48.385  1.00 43.48 ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.625  11.722  47.604  1.00 43.37 ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.965  13.668  48.528  1.00 43.28 ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.740  13.698  47.757  1.00 43.40 ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.960  14.633  46.591  1.00 43.19 ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.149  15.841  46.779  1.00 42.97 ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.523  14.134  48.608  1.00 43.77 ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.245  14.011  47.809  1.00 42.78 ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.435  13.280  49.888  1.00 43.57 ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.979  14.046  45.394  1.00 43.10 ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.065  14.797  44.153  1.00 42.99 ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.793  15.597  43.972  1.00 43.05 ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.689  15.060  44.083  1.00 43.02 ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.283  13.851  42.969  1.00 43.04 ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.670  14.468  41.617  1.00 42.90 ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.883  13.778  40.999  1.00 41.73 ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.492  14.459  40.661  1.00 42.02 ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.945  16.894  43.733  1.00 43.41 ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.794  17.710  43.402  1.00 43.54 ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.394  17.440  41.949  1.00 42.38 ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.187  17.596  41.023  1.00 42.57 ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.070  19.192  43.634  1.00 44.59 ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.821  20.047  43.433  1.00 47.84 ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.584  20.473  42.269  1.00 49.88 ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.061  20.243  44.423  1.00 49.93 ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.162  16.997  41.779  1.00 41.22 ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.621  16.631  40.479  1.00 40.24 ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.365  17.474  40.217  1.00 39.38 ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.302  16.955  39.874  1.00 38.46 ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.290  15.145  40.458  1.00 39.85 ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.509  18.784  40.397  1.00 38.60 ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.365  19.677  40.372  1.00 38.04 ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.408  20.654  39.214  1.00 37.66 ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.481  21.442  39.042  1.00 38.58 ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.200  20.458  41.703  1.00 38.49 ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.185  21.494  41.793  1.00 38.14 ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.291  19.516  42.930  1.00 37.52 ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.474  20.612  38.421  1.00 36.66 ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.566  21.427  37.221  1.00 35.96 ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.155  20.620  36.079  1.00 35.79 ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.944  19.696  36.285  1.00 36.06 ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.477  22.676  37.400  1.00 35.94 ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.840  22.252  37.504  1.00 36.55 ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 31.111  23.496  38.636  1.00 35.88 ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.791  20.994  34.860  1.00 35.41 ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.417  20.416  33.679  1.00 34.59 ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.904  20.681  33.682  1.00 34.32 ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.362  21.690  34.196  1.00 34.96 ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.779  20.965  32.410  1.00 33.54 ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.397  20.431  32.159  1.00 32.77 ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.196  19.063  31.913  1.00 30.82 ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.301  21.289  32.165  1.00 30.35 ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.918  18.555  31.675  1.00 31.44 ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.012  20.812  31.928  1.00 31.29 ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.812  19.438  31.682  1.00 33.39 ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.652  19.763  33.099  1.00 33.99 ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.087  19.892  33.030  1.00 33.66 ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.532  20.441  31.690  1.00 33.65 ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.704  20.789  30.833  1.00 33.35 ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.731  18.541  33.312  1.00 33.75 ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.032  18.358  34.784  1.00 33.79 ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.313  19.078  35.200  1.00 35.49 ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.947  19.769  34.387  1.00 34.58 ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.706  18.908  36.465  1.00 35.28 ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.848  20.536  31.518  1.00 32.92 ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.410  21.044  30.286  1.00 31.93 ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.847  20.341  29.079  1.00 31.45 ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.443  19.172  29.139  1.00 31.71 ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.938  20.927  30.297  1.00 31.80 ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.564  21.698  31.430  1.00 32.87 ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.085  22.770  31.817  1.00 34.76 ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.631  21.153  31.986  1.00 34.08 ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.823  21.087  27.988  1.00 30.80 ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.489  20.596  26.677  1.00 30.21 ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.815  20.234  26.004  1.00 30.90 ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.828  20.935  26.180  1.00 30.65 ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.766  21.704  25.901  1.00 29.71 ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.516  21.302  24.480  1.00 29.15 ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.472  22.049  26.595  1.00 29.29 ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.809  19.130  25.259  1.00 31.18 ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.990  18.670  24.569  1.00 32.20 ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.437  19.708  23.575  1.00 33.11 ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.615  20.429  23.008  1.00 33.48 ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.730  17.339  23.892  1.00 31.76 ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.477  16.024  25.097  1.00 34.02 ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.748  19.794  23.381  1.00 34.23 ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.319  20.852  22.575  1.00 34.79 ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.837  20.780  21.144  1.00 35.22 ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.909  19.731  20.509  1.00 34.84 ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.844  20.869  22.651  1.00 35.18 ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.348  22.285  22.676  1.00 35.96 ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.670  22.913  23.880  1.00 36.41 ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.437  23.021  21.501  1.00 35.75 ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.113  24.229  23.906  1.00 36.20 ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.868  24.318  21.512  1.00 37.29 ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.206  24.921  22.714  1.00 37.59 ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.624  26.237  22.690  1.00 39.79 ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.324  21.900  20.644  1.00 36.08 ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.671  21.896  19.344  1.00 37.14 ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.577  23.262  18.692  1.00 38.79 ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.645  24.303  19.347  1.00 38.53 ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.261  21.291  19.454  1.00 36.46 ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.313  22.093  20.306  1.00 35.20 ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.073  21.332  20.678  1.00 36.79 ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.972  21.681  20.241  1.00 36.64 ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.232  20.274  21.489  1.00 35.46 ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.404  23.215  17.379  1.00 41.07 ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.111  24.358  16.563  1.00 43.53 ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.789  24.988  16.998  1.00 44.53 ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.802  24.284  17.197  1.00 44.41 ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 39.061  23.900  15.105  1.00 44.71 ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.663  24.972  14.133  1.00 47.02 ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.341  25.063  13.676  1.00 48.57 ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.601  25.903  13.668  1.00 48.35 ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.966  26.039  12.782  1.00 48.98 ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.237  26.889  12.777  1.00 48.97 ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.916  26.954  12.339  1.00 48.88 ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.541  27.939  11.456  1.00 49.09 ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.799  26.310  17.180  1.00 45.82 ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.608  27.071  17.562  1.00 47.29 ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.031  27.823  16.353  1.00 48.67 ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.710  28.634  15.731  1.00 48.48 ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.904  28.056  18.707  1.00 46.93 ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.714  28.974  18.965  1.00 46.21 ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.263  27.303  19.951  1.00 46.83 ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.775  27.529  16.033  1.00 50.69 ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.103  28.080  14.860  1.00 52.54 ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.932  29.584  14.985  1.00 53.68 ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.380  30.083  15.973  1.00 53.34 ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.738  27.409  14.684  1.00 52.87 ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.036  27.821  13.412  1.00 53.80 ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 31.841  29.036  13.181  1.00 55.23 ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.662  26.914  12.642  1.00 55.43 ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.409  30.293  13.964  1.00 55.38 ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.302  31.752  13.905  1.00 57.09 ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.431  32.281  12.750  1.00 57.70 ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.086  33.467  12.738  1.00 57.95 ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.700  32.426  13.845  1.00 57.53 ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.644  31.528  13.237  1.00 57.74 ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.178  32.834  15.265  1.00 57.82 ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 33.057  31.406  11.809  1.00 58.17 ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.310  31.815  10.606  1.00 58.66 ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.266  32.921  10.840  1.00 58.51 ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.247  33.905  10.101  1.00 58.60 ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.684  30.617  9.874   1.00 58.64 ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 31.198  30.919  8.438   1.00 60.11 ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.369  31.217  7.468   1.00 61.54 ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.290  29.820  7.862   1.00 59.25 ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.417  32.764  11.859  1.00 58.36 ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.443  33.807  12.219  1.00 57.93 ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.505  34.194  13.690  1.00 58.00 ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.770  33.641  14.509  1.00 57.93 ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.018  33.388  11.859  1.00 57.72 ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.805  33.006  10.411  1.00 57.36 ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.770  33.977  9.414   1.00 57.00 ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.622  31.674  10.042  1.00 56.59 ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.567  33.635  8.083   1.00 57.64 ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.415  31.317  8.715   1.00 57.34 ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.392  32.302  7.733   1.00 57.90 ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.180  31.965  6.405   1.00 57.59 ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.387  35.151  14.034  1.00 58.31 ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.499  35.729  15.391  1.00 58.18 ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.172  36.240  15.954  1.00 57.66 ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.412  36.883  15.229  1.00 58.32 ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.456  36.908  15.185  1.00 58.33 ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.340  36.451  14.032  1.00 58.86 ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.375  35.738  13.105  1.00 58.52 ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.901  35.938  17.225  1.00 56.75 ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.680  36.385  17.915  1.00 55.26 ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.444  35.527  17.663  1.00 54.35 ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.422  35.676  18.349  1.00 53.98 ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.549  34.613  16.696  1.00 52.92 ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.392  33.902  16.149  1.00 51.35 ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.082  32.575  16.858  1.00 50.95 ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.891  31.644  16.836  1.00 50.66 ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.613  33.703  14.646  1.00 50.85 ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.536  32.924  13.956  1.00 49.65 ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.211  33.351  13.990  1.00 49.03 ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.853  31.774  13.250  1.00 48.33 ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.217  32.639  13.341  1.00 48.28 ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.870  31.048  12.594  1.00 48.23 ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.546  31.484  12.636  1.00 49.53 ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.893  32.491  17.454  1.00 50.63 ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.471  31.317  18.233  1.00 50.48 ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.596  30.010  17.451  1.00 49.24 ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.090  29.016  17.973  1.00 48.97 ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.047  31.514  18.776  1.00 51.27 ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.379  30.259  19.416  1.00 55.40 ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.311  30.325  20.947  1.00 61.29 ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 20.992  31.422  21.480  1.00 63.35 ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.564  29.283  21.614  1.00 62.00 ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.173  30.023  16.191  1.00 48.28 ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.223  28.831  15.345  1.00 47.14 ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.570  28.136  15.255  1.00 46.47 ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.634  26.927  15.063  1.00 46.42 ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.651  28.892  15.384  1.00 46.15 ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.982  28.307  15.369  1.00 45.91 ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.598  28.186  16.769  1.00 45.96 ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.401  27.282  17.024  1.00 45.89 ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.941  29.067  14.415  1.00 45.90 ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.919  30.465  14.716  1.00 47.05 ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.540  28.866  12.970  1.00 44.85 ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.222  29.086  17.674  1.00 46.16 ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.836  29.128  18.999  1.00 46.62 ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.345  28.000  19.901  1.00 45.75 ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 28.114  27.441  20.688  1.00 45.75 ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.609  30.479  19.666  1.00 47.33 ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.967  31.675  18.792  1.00 51.21 ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.370  32.223  19.015  1.00 56.29 ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.306  31.419  19.289  1.00 57.41 ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.519  33.471  18.894  1.00 56.94 ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.069  27.653  19.776  1.00 44.73 ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.516  26.527  20.513  1.00 43.34 ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.409  25.284  20.419  1.00 42.05 ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.358  24.414  21.283  1.00 42.23 ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.094  26.224  20.031  1.00 43.46 ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.974  25.671  18.610  1.00 43.47 ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.251  25.350  18.100  1.00 44.52 ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.648  24.309  19.421  1.00 41.47 ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.231  25.214  19.377  1.00 40.43 ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 28.085  24.060  19.130  1.00 39.19 ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.531  24.261  19.622  1.00 38.74 ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.329  23.321  19.648  1.00 38.54 ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 28.078  23.711  17.635  1.00 38.34 ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.720  23.427  17.095  1.00 38.39 ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.062  24.127  16.130  1.00 38.32 ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.842  22.357  17.482  1.00 37.25 ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.826  23.559  15.889  1.00 37.79 ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.672  22.473  16.708  1.00 37.13 ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.939  21.310  18.397  1.00 36.70 ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.603  21.585  16.827  1.00 37.38 ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.873  20.428  18.516  1.00 38.20 ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.722  20.574  17.733  1.00 37.88 ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.852  25.489  20.004  1.00 38.07 ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.202  25.864  20.385  1.00 37.75 ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.516  25.517  21.839  1.00 37.20 ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.618  25.510  22.683  1.00 37.22 ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.399  27.363  20.148  1.00 37.88 ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.908  27.680  18.739  1.00 39.14 ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.387  26.796  17.999  1.00 39.63 ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.841  28.957  18.377  1.00 38.97 ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.798  25.234  22.143  1.00 36.53 ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.193  24.882  23.509  1.00 35.60 ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.621  25.849  24.539  1.00 35.38 ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.602  27.056  24.312  1.00 35.48 ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.708  24.990  23.463  1.00 35.14 ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 35.062  24.673  22.078  1.00 35.40 ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.950  25.220  21.220  1.00 36.33 ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.155  25.314  25.662  1.00 34.92 ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.507  26.105  26.684  1.00 34.33 ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.227  25.948  28.011  1.00 34.70 ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.707  26.300  29.070  1.00 34.90 ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 30.027  25.741  26.793  1.00 34.16 ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.788  24.331  27.340  1.00 34.85 ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 28.776  24.081  28.007  1.00 34.64 ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 30.697  23.410  27.056  1.00 33.82 ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.436  25.400  27.933  1.00 34.86 ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.373  25.334  29.052  1.00 34.87 ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.773  25.489  28.465  1.00 34.46 ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.961  25.455  27.243  1.00 34.60 ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.246  24.012  29.830  1.00 35.42 ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.958  23.845  30.669  1.00 36.91 ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.875  24.894  31.792  1.00 41.84 ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.815  24.603  32.746  1.00 46.00 ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.532  24.980  32.609  1.00 49.35 ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.133  25.689  31.546  1.00 47.63 ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.637  24.647  33.548  1.00 49.33 ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.749  25.678  29.334  1.00 33.96 ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.118  25.822  28.920  1.00 33.65 ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.612  24.682  28.034  1.00 33.72 ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.324  23.495  28.273  1.00 33.08 ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 39.001  25.885  30.143  1.00 33.68 ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.416  26.238  29.785  1.00 34.23 ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.313  26.262  30.988  1.00 36.06 ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.767  26.379  32.110  1.00 34.29 ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.551  26.143  30.802  1.00 35.24 ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.354  25.063  27.002  1.00 33.37 ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.978  24.115  26.131  1.00 33.33 ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.260  23.635  26.778  1.00 33.88 ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.122  24.436  27.138  1.00 35.14 ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.263  24.739  24.775  1.00 33.18 ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.048  25.162  23.959  1.00 33.01 ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.515  25.715  22.633  1.00 34.82 ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.166  23.967  23.730  1.00 32.94 ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.371  22.326  26.940  1.00 33.25 ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.537  21.735  27.515  1.00 33.11 ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.650  20.299  27.028  1.00 33.45 ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.641  19.618  26.766  1.00 34.01 ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.470  21.806  29.041  1.00 33.51 ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.275  20.812  29.645  1.00 31.88 ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.888  19.853  26.872  1.00 32.95 ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.160  18.481  26.491  1.00 32.05 ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.782  17.565  27.630  1.00 31.16 ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.570  16.384  27.440  1.00 30.73 ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.632  18.325  26.165  1.00 32.64 ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.942  18.425  24.708  1.00 33.19 ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.425  18.398  24.474  1.00 37.01 ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.924  17.354  24.006  1.00 37.77 ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.092  19.419  24.775  1.00 38.48 ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.699  18.134  28.820  1.00 30.83 ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.231  17.423  29.983  1.00 31.32 ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.709  17.584  29.970  1.00 31.52 ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.173  18.539  30.546  1.00 30.94 ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.843  18.038  31.249  1.00 30.80 ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.367  17.365  32.521  1.00 32.92 ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.543  16.401  32.463  1.00 36.11 ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.834  17.789  33.599  1.00 34.37 ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.027  16.650  29.308  1.00 31.38 ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.608  16.805  29.036  1.00 31.97 ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.787  15.521  29.196  1.00 31.52 ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.559  15.525  28.998  1.00 31.08 ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.435  17.323  27.615  1.00 32.26 ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.047  16.195  26.370  1.00 33.63 ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.469  14.430  29.534  1.00 30.90 ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.838  13.113  29.592  1.00 30.20 ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.971  12.949  30.854  1.00 30.11 ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.349  12.292  31.820  1.00 30.84 ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.888  12.005  29.439  1.00 29.41 ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.504  11.913  28.031  1.00 29.45 ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.444  10.736  27.888  1.00 26.69 ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.437  11.836  26.923  1.00 27.51 ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.803  13.581  30.838  1.00 30.15 ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.857  13.495  31.948  1.00 29.33 ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.524  13.078  31.401  1.00 28.92 ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.307  13.107  30.201  1.00 29.27 ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.766  14.827  32.684  1.00 29.36 ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.121  15.286  33.174  1.00 29.53 ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.498  15.152  34.522  1.00 28.74 ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 38.042  15.822  32.282  1.00 28.81 ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.762  15.566  34.955  1.00 29.21 ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.290  16.233  32.703  1.00 30.46 ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.654  16.095  34.028  1.00 30.03 ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.914  16.499  34.379  1.00 29.23 ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.644  12.636  32.275  1.00 28.66 ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.328  12.251  31.855  1.00 28.04 ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.299  12.769  32.845  1.00 28.29 ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.652  13.214  33.953  1.00 27.33 ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.227  10.734  31.682  1.00 28.11 ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.599  9.763   32.799  1.00 28.29 ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.586  9.797   33.932  1.00 27.65 ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.692  8.367   32.229  1.00 26.69 ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 30.033  12.690  32.435  1.00 27.94 ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.936  13.237  33.204  1.00 28.49 ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.859  12.185  33.410  1.00 29.33 ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.641  11.324  32.542  1.00 29.83 ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.364  14.457  32.477  1.00 28.39 ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.460  15.383  31.940  1.00 27.61 ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.230  15.967  32.712  1.00 24.50 ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.548  15.494  30.618  1.00 25.70 ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.200  12.234  34.565  1.00 29.95 ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 26.111  11.321  34.855  1.00 30.47 ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.933  12.118  35.394  1.00 30.85 ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 25.097  12.948  36.296  1.00 30.29 ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.546  10.235  35.873  1.00 30.96 ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.387  9.382   36.268  1.00 29.19 ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.682  9.365   35.304  1.00 31.07 ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.761  11.876  34.808  1.00 31.42 ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.489  12.397  35.306  1.00 32.22 ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.612  11.223  35.686  1.00 33.30 ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.402  10.315  34.876  1.00 33.87 ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.745  13.183  34.235  1.00 31.51 ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.257  14.540  33.958  1.00 30.91 ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.889  15.700  34.581  1.00 30.87 ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.203  14.907  32.955  1.00 29.78 ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.565  16.774  34.040  1.00 30.81 ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.380  16.312  33.037  1.00 30.42 ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.918  14.191  31.990  1.00 30.15 ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.248  17.007  32.193  1.00 29.79 ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.772  14.890  31.133  1.00 30.05 ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.933  16.283  31.247  1.00 30.11 ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 21.105  11.247  36.913  1.00 34.25 ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 20.162  10.258  37.395  1.00 35.20 ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 19.019  11.007  38.052  1.00 35.99 ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 19.168  12.193  38.393  1.00 36.56 ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.797  9.334   38.446  1.00 35.47 ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 21.223  10.115  39.564  1.00 35.89 ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.005  8.594   37.876  1.00 36.19 ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.854  10.351  38.194  1.00 36.50 ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.782  10.843  39.049  1.00 37.29 ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.222  11.323  40.424  1.00 38.06 ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.347  11.083  40.854  1.00 39.03 ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.872  9.622   39.181  1.00 36.99 ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.947  9.011   37.828  1.00 36.91 ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.429  9.145   37.459  1.00 36.73 ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.331  12.031  41.096  1.00 39.08 ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.565  12.451  42.455  1.00 40.19 ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.264  12.188  43.167  1.00 41.88 ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.223  12.700  42.752  1.00 42.17 ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.921  13.925  42.509  1.00 39.30 ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.303  14.442  43.871  1.00 38.37 ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.624  14.798  44.157  1.00 37.60 ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.342  14.618  44.876  1.00 38.94 ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.982  15.310  45.415  1.00 36.21 ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.700  15.131  46.145  1.00 37.95 ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 18.015  15.466  46.390  1.00 37.17 ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.361  15.965  47.610  1.00 37.40 ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.301  11.344  44.206  1.00 43.36 ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.485  10.612  44.650  1.00 44.36 ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.822  9.502   43.645  1.00 45.27 ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.961  9.143   42.844  1.00 44.79 ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.034  10.018  45.999  1.00 44.48 ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.563  9.856   45.870  1.00 43.97 ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.111  11.028  45.023  1.00 43.85 ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.051  8.978   43.678  1.00 46.68 ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.484  7.930   42.726  1.00 48.49 ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.551  6.736   42.762  1.00 49.38 ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 17.064  6.376   43.826  1.00 50.15 ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.926  7.475   42.991  1.00 48.42 ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.972  8.584   42.859  1.00 49.65 ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.365  8.004   42.818  1.00 52.08 ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.644  7.098   43.938  1.00 53.07 ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.209  7.477   45.080  1.00 53.83 ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.546  8.745   45.263  1.00 53.89 ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.439  6.590   46.042  1.00 55.54 ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.292  6.114   41.604  1.00 50.60 ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.238  5.089   41.562  1.00 51.70 ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.528  3.883   42.466  1.00 52.82 ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.694  3.576   42.735  1.00 53.08 ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.208  4.669   40.088  1.00 51.76 ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.531  5.114   39.511  1.00 50.98 ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.944  6.314   40.295  1.00 50.59 ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.475  3.219   42.937  1.00 53.96 ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.633  2.036   43.800  1.00 54.80 ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 16.155  0.805   43.021  1.00 55.11 ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.218  0.251   43.357  1.00 54.90 ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 14.309  1.714   44.517  1.00 55.11 ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.404  0.399   41.990  1.00 54.87 ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.783  -0.712  41.112  1.00 54.80 ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.690  -0.235  39.971  1.00 54.45 ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.636  0.928   39.598  1.00 54.52 ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.524  -1.366  40.533  1.00 54.88 ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.755  -0.411  39.829  1.00 55.29 ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.533  -1.131  39.413  1.00 54.24 ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.425  -0.698  38.326  1.00 53.70 ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.656  -0.166  37.107  1.00 53.20 ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.685  -0.784  36.656  1.00 53.47 ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.196  -1.977  37.969  1.00 53.82 ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 19.115  -2.826  39.206  1.00 54.36 ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.740  -2.553  39.748  1.00 54.21 ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.080  0.987   36.600  1.00 51.74 ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.428  1.598   35.457  1.00 50.45 ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.354  1.655   34.242  1.00 48.69 ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.574  1.786   34.384  1.00 48.74 ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 16.901  3.000   35.796  1.00 50.64 ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 17.912  3.715   36.496  1.00 51.42 ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 15.638  2.901   36.699  1.00 52.59 ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.769  1.527   33.044  1.00 46.82 ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.421  1.677   31.753  1.00 45.29 ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.271  2.933   31.598  1.00 43.64 ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.851  4.045   31.952  1.00 43.08 ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.237  1.693   30.786  1.00 45.48 ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.282  0.747   31.427  1.00 46.33 ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.354  1.145   32.878  1.00 46.90 ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.466  2.715   31.056  1.00 41.74 ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.489  3.725   30.882  1.00 39.75 ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.520  4.156   29.417  1.00 38.63 ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.607  3.326   28.513  1.00 38.38 ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.893  3.158   31.276  1.00 40.10 ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 24.000  4.202   31.101  1.00 38.07 ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.879  2.613   32.703  1.00 39.84 ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.440  5.461   29.191  1.00 37.21 ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.670  6.022   27.874  1.00 35.26 ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 23.013  6.716   27.904  1.00 33.90 ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.235  7.593   28.742  1.00 34.05 ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.561  7.010   27.519  1.00 35.08 ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.258  6.468   26.903  1.00 36.84 ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.096  7.376   27.170  1.00 36.46 ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.404  6.285   25.396  1.00 39.49 ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.909  6.322   27.006  1.00 32.19 ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.194  6.997   26.878  1.00 30.91 ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.288  7.817   25.593  1.00 30.48 ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.226  7.259   24.483  1.00 30.55 ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.370  6.029   26.896  1.00 31.23 ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.231  5.038   28.058  1.00 30.86 ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.696  6.812   26.891  1.00 28.60 ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.408  4.098   28.199  1.00 31.69 ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.449  9.134   25.756  1.00 28.98 ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.560  10.054  24.636  1.00 27.80 ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.983  10.172  24.163  1.00 27.32 ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.909  10.358  24.968  1.00 26.65 ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 25.076  11.449  25.042  1.00 28.48 ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.173  12.505  23.947  1.00 27.98 ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.982  13.594  23.937  1.00 27.97 ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.414  12.557  22.735  1.00 27.47 ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.785  14.325  22.789  1.00 27.26 ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.812  13.717  22.043  1.00 27.43 ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.416  11.745  22.180  1.00 27.68 ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.259  14.084  20.810  1.00 27.32 ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.864  12.107  20.964  1.00 28.01 ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.289  13.273  20.292  1.00 28.29 ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.157  10.053  22.851  1.00 27.02 ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.419  10.373  22.208  1.00 26.39 ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.180  11.539  21.246  1.00 26.61 ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.540  11.374  20.221  1.00 26.25 ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.988  9.178   21.460  1.00 26.10 ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.064  7.948   22.382  1.00 25.24 ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.373  9.526   20.897  1.00 25.60 ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.640  6.704   21.705  1.00 19.02 ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.677  12.720  21.592  1.00 26.59 ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.470  13.906  20.761  1.00 26.85 ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.149  13.892  19.393  1.00 27.55 ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.206  13.259  19.219  1.00 27.24 ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.953  15.139  21.491  1.00 27.14 ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.423  15.152  21.873  1.00 27.28 ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.415  15.396  20.925  1.00 26.19 ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.809  14.978  23.206  1.00 26.23 ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.772  15.433  21.292  1.00 27.41 ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.145  15.012  23.581  1.00 27.33 ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.128  15.250  22.629  1.00 27.80 ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.460  15.292  23.026  1.00 27.44 ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.553  14.628  18.442  1.00 27.22 ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.168  14.855  17.149  1.00 27.40 ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.037  16.108  17.111  1.00 28.08 ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.369  16.686  18.157  1.00 28.05 ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.399  16.533  15.900  1.00 28.25 ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.334  17.651  15.704  1.00 28.55 ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.457  17.242  14.748  1.00 28.92 ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.595  17.768  14.815  1.00 28.72 ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.127  16.284  13.880  1.00 28.25 ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 32.955  15.905  12.757  1.00 27.87 ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.272  15.299  13.176  1.00 28.12 ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.173  15.195  12.355  1.00 28.54 ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.387  14.909  14.452  1.00 27.92 ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.622  14.340  15.015  1.00 27.36 ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.702  15.391  15.211  1.00 28.07 ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.858  15.058  15.483  1.00 28.26 ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.174  13.206  14.143  1.00 26.79 ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.315  11.972  14.106  1.00 23.97 ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.119  11.203  15.254  1.00 22.68 ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.763  11.546  12.912  1.00 22.37 ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.323  10.030  15.218  1.00 22.82 ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.975  10.368  12.857  1.00 21.85 ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.758  9.625   14.010  1.00 22.22 ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.320  16.660  15.074  1.00 28.81 ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.230  17.778  15.325  1.00 29.33 ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.643  18.682  16.395  1.00 29.22 ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.300  19.581  16.875  1.00 30.13 ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.524  18.579  14.038  1.00 29.87 ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.336  19.350  13.534  1.00 30.32 ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.015  20.586  14.072  1.00 31.04 ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.511  18.834  12.534  1.00 32.34 ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 34.902  21.298  13.645  1.00 31.29 ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.390  19.551  12.088  1.00 32.18 ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.104  20.777  12.660  1.00 31.69 ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.007  21.496  12.256  1.00 34.43 ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.396  18.468  16.774  1.00 29.07 ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.822  19.315  17.816  1.00 28.62 ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.777  18.558  18.602  1.00 28.76 ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.475  17.394  18.308  1.00 27.72 ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.216  20.606  17.233  1.00 28.48 ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.275  20.313  16.225  1.00 27.30 ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.237  19.238  19.608  1.00 29.00 ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.216  18.669  20.450  1.00 29.54 ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.608  18.657  21.897  1.00 29.85 ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.769  18.818  22.252  1.00 30.40 ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.614  18.486  22.744  1.00 30.44 ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.810  18.546  24.185  1.00 30.78 ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.546  17.981  24.791  1.00 30.64 ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.455  18.203  24.280  1.00 31.37 ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 32.023  19.985  24.633  1.00 30.13 ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.670  17.244  25.875  1.00 30.44 ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.479  16.635  26.442  1.00 29.89 ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.731  17.641  27.290  1.00 29.36 ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.694  17.324  27.855  1.00 30.48 ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.847  15.389  27.256  1.00 29.49 ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.253  18.854  27.370  1.00 28.97 ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.707  19.893  28.241  1.00 28.66 ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.889  20.971  27.527  1.00 28.57 ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.426  21.911  28.161  1.00 29.16 ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.845  20.570  29.005  1.00 28.67 ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.792  21.109  28.114  1.00 28.06 ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.712  20.861  26.222  1.00 28.28 ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.883  21.814  25.510  1.00 28.51 ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.449  21.724  26.026  1.00 29.54 ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.988  20.657  26.450  1.00 29.58 ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.944  21.560  23.996  1.00 28.26 ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.326  21.398  23.347  1.00 26.38 ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.212  21.185  21.863  1.00 26.72 ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 29.231  22.582  23.615  1.00 23.51 ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.744  22.850  26.012  1.00 30.48 ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.364  22.890  26.503  1.00 30.99 ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.402  21.893  25.847  1.00 30.80 ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.452  21.460  26.489  1.00 31.15 ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.804  24.291  26.363  1.00 31.05 ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.449  25.254  27.317  1.00 33.52 ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 24.115  24.785  28.275  1.00 33.98 ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.297  26.478  27.102  1.00 35.05 ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.640  21.541  24.590  1.00 29.90 ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.733  20.666  23.886  1.00 29.89 ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.946  19.227  24.260  1.00 30.22 ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 21.205  18.353  23.815  1.00 31.01 ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.852  20.786  22.357  1.00 29.86 ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 21.420  22.149  21.913  1.00 29.81 ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.269  20.477  21.890  1.00 30.13 ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.966  18.964  25.061  1.00 30.15 ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.207  17.606  25.544  1.00 30.08 ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.839  17.506  27.027  1.00 30.83 ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.277  16.601  27.723  1.00 31.46 ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.670  17.191  25.327  1.00 28.91 ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.200  17.371  23.924  1.00 27.90 ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.382  17.171  22.816  1.00 26.22 ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.542  17.719  23.699  1.00 28.20 ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.866  17.332  21.522  1.00 26.00 ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 27.040  17.894  22.389  1.00 26.64 ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.184  17.697  21.311  1.00 27.22 ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.624  17.844  20.013  1.00 27.55 ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 22.042  18.447  27.521  1.00 31.41 ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.695  18.436  28.930  1.00 31.72 ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.864  17.201  29.300  1.00 32.05 ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.738  17.019  28.832  1.00 32.10 ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.960  19.702  29.293  1.00 31.40 ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.804  19.863  30.771  1.00 32.17 ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.811  18.854  31.488  1.00 33.50 ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.659  21.005  31.224  1.00 34.98 ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.436  16.348  30.138  1.00 32.24 ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.796  15.089  30.466  1.00 32.37 ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.672  15.213  31.480  1.00 32.83 ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.987  14.233  31.743  1.00 32.77 ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.463  16.408  32.040  1.00 33.01 ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.512  16.557  33.151  1.00 33.40 ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 17.072  16.169  32.799  1.00 33.09 ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.402  15.553  33.618  1.00 33.22 ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.565  17.955  33.783  1.00 32.87 ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.861  19.055  32.995  1.00 34.34 ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 18.035  20.426  33.643  1.00 34.72 ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.430  20.855  33.640  1.00 38.57 ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.943  21.753  34.487  1.00 41.66 ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 21.230  22.091  34.393  1.00 42.78 ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 19.182  22.316  35.434  1.00 40.50 ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.614  16.504  31.588  1.00 33.02 ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 15.226  16.275  31.192  1.00 33.00 ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.936  14.789  31.004  1.00 33.67 ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.920  14.289  31.485  1.00 34.02 ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.866  17.066  29.937  1.00 32.67 ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 15.249  18.502  30.007  1.00 31.94 ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.515  19.386  30.762  1.00 32.38 ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.357  18.972  29.322  1.00 32.63 ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.869  20.713  30.838  1.00 32.01 ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.721  20.303  29.395  1.00 32.85 ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.975  21.177  30.154  1.00 31.94 ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.844  14.075  30.341  1.00 34.19 ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.705  12.635  30.192  1.00 34.74 ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.779  11.924  31.540  1.00 35.42 ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 15.132  10.892  31.736  1.00 35.46 ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.757  12.081  29.238  1.00 34.40 ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.447  12.300  27.767  1.00 34.13 ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.658  12.055  26.920  1.00 31.84 ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.279  11.425  27.326  1.00 35.10 ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.578  12.484  32.450  1.00 35.70 ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.744  11.952  33.789  1.00 36.02 ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.483  12.205  34.615  1.00 36.71 ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.891  11.269  35.172  1.00 36.80 ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.953  12.583  34.452  1.00 35.48 ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 15.055  13.469  34.665  1.00 37.03 ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.860  13.842  35.417  1.00 37.15 ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.581  13.221  34.872  1.00 37.16 ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.759  12.738  35.643  1.00 37.32 ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.700  15.363  35.497  1.00 37.08 ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.868  15.845  36.686  1.00 37.19 ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.370  15.540  36.540  1.00 38.83 ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.786  15.723  35.463  1.00 38.69 ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.745  15.072  37.630  1.00 37.20 ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 12.403  13.248  33.557  1.00 37.08 ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 11.095  12.917  32.989  1.00 36.86 ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.923  11.425  32.698  1.00 37.78 ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.811   10.909  32.833  1.00 38.23 ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.766  13.785  31.754  1.00 36.49 ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.477   13.325  31.087  1.00 35.51 ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.668  15.274  32.145  1.00 34.70 ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 12.015  10.741  32.333  1.00 37.88 ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.963  9.332   31.952  1.00 38.01 ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.655  8.383   32.944  1.00 38.11 ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.678  7.161   32.746  1.00 38.13 ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.548  9.131   30.550  1.00 38.29 ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.711  9.674   29.401  1.00 39.38 ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.298  9.080   29.295  1.00 43.35 ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 10.015  7.956   29.814  1.00 40.85 ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.468   9.767   28.656  1.00 44.59 ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 13.221  8.947   34.006  1.00 38.04 ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.927  8.161   35.006  1.00 37.45 ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 15.190  7.541   34.461  1.00 37.13 ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.699  6.558   35.013  1.00 38.07 ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.700  8.101   33.371  1.00 36.49 ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.899  7.560   32.727  1.00 35.57 ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 18.171  7.900   33.483  1.00 34.71 ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.271  8.950   34.125  1.00 34.33 ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 17.008  8.061   31.310  1.00 35.86 ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 19.136  6.995   33.414  1.00 33.87 ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.497  7.326   33.788  1.00 33.09 ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 21.190  7.698   32.481  1.00 33.13 ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.263  6.896   31.527  1.00 33.16 ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 21.187  6.191   34.553  1.00 33.17 ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.656  6.502   34.802  1.00 33.82 ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.466  5.959   35.894  1.00 32.18 ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.629  8.947   32.409  1.00 32.01 ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.245  9.428   31.205  1.00 31.04 ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.691  9.717   31.507  1.00 29.58 ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 24.012  10.317  32.524  1.00 29.11 ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.523  10.667  30.650  1.00 31.48 ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.763  10.788  29.135  1.00 33.22 ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.510  11.207  28.412  1.00 33.89 ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.942  11.699  28.803  1.00 33.56 ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.559  9.251   30.623  1.00 28.72 ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.991  9.424   30.778  1.00 27.93 ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.487  9.981   29.480  1.00 27.95 ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 26.095  9.508   28.406  1.00 27.71 ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.712  8.087   31.011  1.00 28.03 ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.229  8.291   31.059  1.00 26.90 ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.222  7.427   32.285  1.00 27.47 ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.329  10.999  29.571  1.00 27.34 ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 28.004  11.516  28.391  1.00 27.20 ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.474  11.737  28.728  1.00 26.71 ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.823  11.992  29.883  1.00 26.38 ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.360  12.815  27.945  1.00 26.79 ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.545  13.776  28.969  1.00 29.30 ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.329  11.616  27.721  1.00 26.66 ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.758  11.719  27.933  1.00 26.65 ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.378  12.608  26.878  1.00 26.69 ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.864  12.689  25.744  1.00 26.98 ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.416  10.336  27.871  1.00 26.49 ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.892  9.920   26.492  1.00 26.99 ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.558  9.516   25.324  1.00 29.06 ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.008  7.907   25.919  1.00 27.58 ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.464  13.264  27.273  1.00 26.09 ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.370  13.933  26.370  1.00 26.79 ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.294  12.868  25.806  1.00 27.10 ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.659  11.937  26.509  1.00 27.44 ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.203  15.005  27.106  1.00 25.96 ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.385  16.237  27.510  1.00 27.11 ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.171  16.335  27.263  1.00 27.81 ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 35.060  17.202  28.122  1.00 26.70 ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.643  12.996  24.533  1.00 27.66 ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.685  12.189  23.923  1.00 27.83 ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.494  13.120  23.041  1.00 28.80 ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.951  14.100  22.497  1.00 28.92 ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.097  11.064  23.088  1.00 27.09 ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.207  11.518  21.948  1.00 27.50 ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.851  11.798  22.156  1.00 26.13 ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.709  11.642  20.652  1.00 25.74 ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 33.030  12.198  21.107  1.00 25.16 ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.898  12.056  19.608  1.00 26.19 ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.553  12.340  19.839  1.00 26.44 ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.745  12.755  18.786  1.00 26.27 ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.784  12.820  22.892  1.00 28.90 ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.665  13.694  22.148  1.00 29.11 ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.245  13.741  20.706  1.00 29.49 ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.899  12.713  20.113  1.00 29.36 ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.112  13.251  22.266  1.00 29.19 ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.688  13.433  23.648  1.00 29.10 ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 42.976  12.674  23.763  1.00 29.54 ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.751  11.252  23.983  1.00 29.41 ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.715  10.335  23.996  1.00 30.15 ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 44.990  10.691  23.786  1.00 28.33 ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.400  9.058   24.211  1.00 28.74 ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.263  14.953  20.162  1.00 30.07 ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.877  15.218  18.785  1.00 30.68 ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.081  15.814  18.047  1.00 31.88 ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.121  16.103  18.666  1.00 32.22 ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.718  16.232  18.734  1.00 30.63 ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.461  15.646  19.316  1.00 29.78 ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.096  17.520  19.459  1.00 29.36 ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 39.941  16.012  16.736  1.00 32.20 ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.027  16.574  15.937  1.00 31.83 ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.228  15.655  15.952  1.00 32.18 ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.074  14.423  16.022  1.00 32.21 ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.417  16.257  15.886  1.00 32.00 ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.681  15.525  15.911  1.00 31.91 ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.846  14.735  17.201  1.00 31.50 ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.332  13.609  17.181  1.00 31.61 ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 45.892  16.459  15.796  1.00 32.08 ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.746  17.549  16.722  1.00 31.54 ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.026  16.989  14.377  1.00 32.00 ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.414  15.313  18.311  1.00 30.92 ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.655  14.711  19.631  1.00 30.73 ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.973  13.394  19.764  1.00 30.65 ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.462  12.519  20.451  1.00 30.94 ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.196  15.655  20.732  1.00 30.52 ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.696  17.051  20.538  1.00 30.47 ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 45.937  17.431  21.038  1.00 31.11 ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.973  17.954  19.789  1.00 28.49 ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.431  18.719  20.829  1.00 31.31 ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.453  19.229  19.574  1.00 31.82 ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.692  19.613  20.092  1.00 31.80 ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.836  13.250  19.094  1.00 30.94 ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.077  12.027  19.184  1.00 30.38 ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.251  11.146  17.976  1.00 30.43 ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 41.874  9.971   18.024  1.00 31.00 ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.799  11.690  16.883  1.00 30.05 ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.731  10.969  15.619  1.00 29.66 ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 43.934  10.991  14.694  1.00 30.79 ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.011  10.184  13.760  1.00 31.66 ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.431  11.272  14.880  1.00 28.86 ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.221  10.761  15.594  1.00 27.18 ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.883  9.411   15.533  1.00 26.78 ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.455  11.613  16.374  1.00 24.94 ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.789  8.925   16.222  1.00 25.38 ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.360  11.155  17.077  1.00 25.61 ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.015  9.813   17.003  1.00 27.41 ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 44.879  11.885  14.936  1.00 31.12 ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.103  11.831  14.161  1.00 31.80 ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.739  10.464  14.367  1.00 32.58 ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 46.901  10.010  15.490  1.00 32.88 ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.063  12.940  14.577  1.00 31.36 ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.401  13.025  13.849  1.00 31.14 ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.849  14.491  13.722  1.00 28.77 ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.470  12.165  14.594  1.00 31.09 ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.119  9.815   13.281  1.00 33.67 ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.629  8.460   13.378  1.00 34.61 ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 48.772  8.231   12.438  1.00 35.28 ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 48.705  8.613   11.260  1.00 34.84 ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.537  7.468   13.063  1.00 34.71 ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 49.822  7.604   12.968  1.00 35.90 ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 50.779  6.897   12.117  1.00 36.37 ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.504  5.411   12.230  1.00 36.58 ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 50.990  4.751   13.143  1.00 36.42 ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.210  7.275   12.467  1.00 36.12 ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.277  8.697   11.917  1.00 37.04 ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 52.713  9.669   12.955  1.00 36.95 ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.109  8.779   10.651  1.00 38.58 ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.675  4.889   11.320  1.00 37.10 ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.156  3.527   11.513  1.00 38.48 ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.310  2.537   11.597  1.00 39.84 ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.224  2.585   10.766  1.00 40.64 ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.289  3.295   10.267  1.00 37.81 ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 47.922  4.723   9.815   1.00 37.83 ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.171  5.507   10.087  1.00 36.68 ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.298  1.691   12.622  1.00 40.97 ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.396  0.756   12.837  1.00 42.19 ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.387  1.205   13.895  1.00 42.88 ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.055  0.368   14.507  1.00 43.83 ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.498  2.511   14.122  1.00 42.60 ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.406  3.020   15.136  1.00 42.46 ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 52.942  2.693   16.562  1.00 42.95 ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.774  2.350   16.801  1.00 43.11 ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.582  4.532   14.979  1.00 42.65 ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.506  5.251   15.558  1.00 42.20 ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.861  2.811   17.511  1.00 43.18 ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.534  2.600   18.909  1.00 43.90 ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.008  3.895   19.525  1.00 43.33 ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.182  3.848   20.440  1.00 43.54 ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.773  2.133   19.690  1.00 44.48 ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.447  1.424   20.996  1.00 47.67 ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.591  1.488   22.009  1.00 52.59 ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.405  2.567   22.988  1.00 55.55 ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.212  3.619   23.131  1.00 57.17 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.293  3.760   22.360  1.00 58.00 ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.938  4.533   24.054  1.00 56.74 ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.483  5.032   19.003  1.00 42.38 ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.289  6.344   19.623  1.00 41.59 ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.137  7.190   19.056  1.00 40.34 ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.856  8.283   19.542  1.00 40.02 ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.596  7.135   19.611  1.00 42.16 ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 55.797  6.369   20.154  1.00 44.57 ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.627  5.696   19.058  1.00 48.47 ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.086  5.320   17.983  1.00 48.74 ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 57.844  5.548   19.289  1.00 51.03 ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.459  6.671   18.043  1.00 39.49 ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.263  7.313   17.492  1.00 38.08 ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.504  6.311   16.643  1.00 36.72 ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.514  6.402   15.418  1.00 37.10 ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.630  8.568   16.678  1.00 37.71 ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 48.855  5.339   17.293  1.00 35.89 ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.189  4.253   16.565  1.00 35.60 ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 46.877  4.670   15.905  1.00 35.57 ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.314  3.899   15.134  1.00 36.06 ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 47.923  3.221   17.661  1.00 35.28 ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 47.792  4.047   18.918  1.00 34.65 ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.731  5.184   18.758  1.00 35.64 ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.400  5.884   16.193  1.00 35.52 ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.090  6.334   15.695  1.00 34.39 ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 43.925  5.756   16.481  1.00 33.39 ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.123  4.925   17.379  1.00 33.14 ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.718  6.224   16.141  1.00 32.54 ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.459  5.916   16.845  1.00 31.30 ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.447  6.073   18.363  1.00 30.23 ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.576  5.511   19.023  1.00 30.61 ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 40.948  4.517   16.487  1.00 31.12 ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 40.800  4.324   15.011  1.00 32.22 ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.350  5.223   14.299  1.00 33.52 ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.199  3.151   14.525  1.00 32.58 ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.369  6.838   18.927  1.00 29.04 ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.402  6.965   20.385  1.00 28.30 ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.185  7.713   20.944  1.00 28.23 ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 40.768  7.481   22.102  1.00 27.71 ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.732  7.560   20.920  1.00 28.31 ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 44.914  6.830   20.301  1.00 27.70 ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 43.823  9.063   20.691  1.00 27.38 ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.614  8.596   20.122  1.00 27.51 ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.347  9.239   20.461  1.00 27.31 ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.286  8.187   20.689  1.00 27.37 ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.460  8.308   21.587  1.00 26.76 ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.332  7.130   19.886  1.00 27.76 ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.366  6.063   19.999  1.00 28.61 ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.669  5.247   21.231  1.00 29.43 ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.770  4.699   21.870  1.00 29.69 ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.376  5.184   18.745  1.00 28.68 ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.781  5.829   17.488  1.00 28.84 ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 36.843  4.893   16.300  1.00 27.34 ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.345  6.249   17.757  1.00 28.65 ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 38.951  5.180   21.575  1.00 30.20 ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.372  4.435   22.736  1.00 30.69 ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 38.967  5.178   23.994  1.00 31.05 ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.701  4.549   25.005  1.00 31.50 ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 40.882  4.158   22.696  1.00 30.91 ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.374  3.185   21.605  1.00 31.62 ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 42.848  2.961   21.692  1.00 29.19 ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.664  1.854   21.719  1.00 33.51 ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 38.928  6.513   23.932  1.00 31.52 ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.411  7.346   25.031  1.00 31.40 ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 36.954  6.987   25.277  1.00 31.65 ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.524  6.804   26.426  1.00 32.33 ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.500  8.834   24.694  1.00 31.32 ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 39.940  9.326   24.474  1.00 32.67 ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.898  8.604   24.833  1.00 33.00 ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.110  10.455  23.941  1.00 31.25 ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.195  6.886   24.190  1.00 31.35 ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.806  6.507   24.248  1.00 31.59 ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.698  5.113   24.885  1.00 31.77 ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.959  4.916   25.857  1.00 31.00 ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.180  6.560   22.850  1.00 31.46 ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.127  7.972   22.223  1.00 31.66 ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.581  7.968   20.799  1.00 33.09 ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 32.955  6.998   20.364  1.00 33.33 ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.827  9.056   20.057  1.00 33.73 ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.475  4.161   24.370  1.00 32.63 ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.501  2.800   24.933  1.00 32.96 ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.862  2.746   26.425  1.00 32.68 ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.289  1.974   27.177  1.00 32.75 ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.427  1.895   24.135  1.00 33.49 ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.344  0.444   24.574  1.00 34.53 ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.254  -0.391  23.771  1.00 35.45 ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.581  -0.858  22.567  1.00 36.78 ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.219  -1.323  21.494  1.00 36.29 ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.558  -1.359  21.468  1.00 34.91 ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.514  -1.724  20.445  1.00 34.34 ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.776  3.595   26.857  1.00 32.49 ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.125  3.648   28.263  1.00 33.10 ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.926  4.094   29.129  1.00 33.60 ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.702  3.551   30.211  1.00 34.13 ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.353  4.542   28.480  1.00 32.40 ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 38.915  4.633   29.899  1.00 33.72 ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.253  3.250   30.518  1.00 32.98 ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.133  5.552   29.917  1.00 32.80 ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.149  5.064   28.639  1.00 33.83 ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 33.982  5.562   29.368  1.00 33.15 ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.877  4.515   29.369  1.00 33.29 ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.129  4.404   30.342  1.00 33.57 ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.492  6.892   28.789  1.00 32.74 ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.786  3.728   28.301  1.00 33.14 ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.856  2.611   28.299  1.00 33.46 ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.240  1.554   29.362  1.00 33.96 ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.359  0.970   30.027  1.00 33.88 ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.706  2.000   26.903  1.00 33.30 ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.286  2.908   25.727  1.00 32.87 ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.677  2.097   24.609  1.00 29.90 ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.358  4.045   26.119  1.00 31.12 ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.547  1.351   29.540  1.00 33.84 ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 34.073  0.443   30.553  1.00 34.23 ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.786  0.977   31.937  1.00 34.03 ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.287  0.254   32.797  1.00 34.53 ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.574  0.164   30.337  1.00 33.94 ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.786  -0.714  29.102  1.00 34.87 ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.232  -0.851  28.614  1.00 35.56 ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.139  -0.092  28.995  1.00 36.71 ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.443  -1.839  27.745  1.00 36.59 ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 34.061  2.262   32.132  1.00 33.83 ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.743  2.942   33.367  1.00 33.08 ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.254  2.783   33.699  1.00 33.57 ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.892  2.609   34.863  1.00 33.93 ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 34.095  4.418   33.241  1.00 32.88 ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.915  5.190   34.516  1.00 32.19 ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.882  5.504   35.410  1.00 31.72 ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.694  5.739   35.029  1.00 31.69 ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.348  6.213   36.449  1.00 33.83 ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 33.005  6.375   36.241  1.00 31.60 ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.364  5.753   34.578  1.00 30.94 ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 32.039  7.015   37.026  1.00 32.47 ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.408  6.408   35.349  1.00 31.30 ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.750  7.019   36.561  1.00 31.37 ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.389  2.861   32.690  1.00 33.51 ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.966  2.718   32.946  1.00 33.57 ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.700  1.288   33.422  1.00 34.66 ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 29.041  1.095   34.435  1.00 34.94 ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 29.097  3.126   31.737  1.00 33.21 ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.655  2.657   31.914  1.00 31.72 ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 29.138  4.655   31.545  1.00 32.48 ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.265  0.300   32.726  1.00 35.21 ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.116  -1.109  33.108  1.00 35.81 ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.451  -1.350  34.570  1.00 36.03 ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.727  -2.049  35.282  1.00 35.53 ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 31.000  -2.001  32.230  1.00 35.78 ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.410  -2.249  30.885  1.00 35.98 ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 29.035  -2.863  30.977  1.00 37.10 ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.031  -2.165  30.869  1.00 38.19 ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 28.980  -4.174  31.188  1.00 38.09 ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.550  -0.755  35.016  1.00 36.18 ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 31.997  -0.999  36.362  1.00 36.44 ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.237  -0.181  37.404  1.00 36.11 ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.936  -0.678  38.488  1.00 37.00 ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.502  -0.758  36.492  1.00 36.48 ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 33.970  -0.740  37.943  1.00 37.81 ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.387  -1.193  38.100  1.00 39.94 ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.736  -1.714  39.191  1.00 39.80 ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.152  -1.030  37.122  1.00 42.87 ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.944  1.074   37.093  1.00 35.52 ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.538  2.010   38.128  1.00 34.32 ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 29.105  2.446   38.088  1.00 33.82 ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.598  2.950   39.080  1.00 33.99 ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.407  3.252   38.072  1.00 34.59 ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.873  2.940   38.187  1.00 34.83 ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.381  2.649   39.275  1.00 35.08 ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.578  3.043   37.067  1.00 35.62 ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.441  2.292   36.954  1.00 33.66 ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 27.108  2.863   36.842  1.00 33.90 ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 26.102  2.342   37.885  1.00 34.86 ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 25.215  3.087   38.305  1.00 35.12 ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.532  2.823   35.411  1.00 33.42 ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.583  4.010   35.213  1.00 33.10 ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.869  1.487   35.098  1.00 31.67 ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.271  5.363   35.341  1.00 32.24 ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.240  1.084   38.314  1.00 35.21 ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.331  0.568   39.323  1.00 35.22 ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.400  1.380   40.612  1.00 35.33 ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.396  1.498   41.307  1.00 35.55 ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.567  -0.897  39.578  1.00 35.56 ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.555  1.981   40.905  1.00 35.23 ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.665  2.934   42.026  1.00 35.45 ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.633  4.060   41.973  1.00 35.75 ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.317  4.666   42.996  1.00 36.84 ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 28.057  3.529   42.099  1.00 35.20 ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 25.127  4.348   40.783  1.00 35.62 ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 24.205  5.454   40.565  1.00 35.74 ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.789  4.949   40.350  1.00 36.25 ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.877  5.745   40.125  1.00 36.62 ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.618  6.245   39.323  1.00 35.04 ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.931  6.934   39.455  1.00 34.30 ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 27.110  6.273   39.144  1.00 33.91 ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.998  8.246   39.882  1.00 32.64 ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.338  6.919   39.257  1.00 32.63 ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.227  8.890   40.001  1.00 32.99 ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.391  8.229   39.682  1.00 32.27 ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.606  3.633   40.405  1.00 36.23 ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.317  3.040   40.104  1.00 36.43 ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 21.167  2.708   38.632  1.00 36.92 ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 20.082  2.384   38.176  1.00 37.23 ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 22.262  2.775   37.883  1.00 37.23 ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 22.232  2.398   36.474  1.00 37.37 ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.364  0.903   36.299  1.00 37.64 ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 23.047  0.243   37.070  1.00 37.67 ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.693  0.367   35.291  1.00 37.70 ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.783  -1.037  35.001  1.00 38.04 ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.817  -1.210  33.916  1.00 38.85 ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.547  -0.905  32.754  1.00 38.57 ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.420  -1.571  34.542  1.00 38.20 ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.414  -3.084  34.308  1.00 37.56 ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.497  -3.697  34.354  1.00 37.21 ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.319  -3.662  34.069  1.00 37.23 ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 24.004  -1.731  34.279  1.00 39.68 ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 25.054  -1.940  33.284  1.00 40.39 ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.664  -3.019  32.271  1.00 41.44 ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.374  -3.238  31.288  1.00 42.06 ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.249  -2.408  34.124  1.00 40.60 ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.645  -3.007  35.349  1.00 39.82 ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.418  -2.177  35.622  1.00 39.52 ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.540  -3.681  32.501  1.00 41.85 ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.094  -4.725  31.600  1.00 43.42 ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.056  -4.205  30.624  1.00 41.94 ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.534  -4.953  29.787  1.00 42.16 ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.589  -5.932  32.396  1.00 43.28 ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.735  -6.852  32.835  1.00 44.89 ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.197  -8.275  33.808  1.00 49.15 ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 21.796  -8.864  32.821  1.00 50.52 ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.771  -2.911  30.742  1.00 40.77 ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 20.887  -2.206  29.831  1.00 38.96 ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.530  -0.862  29.525  1.00 37.67 ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 21.212  0.158   30.145  1.00 37.41 ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.515  -2.019  30.461  1.00 39.43 ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.561  -1.578  29.504  1.00 40.31 ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.462  -0.886  28.578  1.00 36.16 ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.210  0.300   28.155  1.00 34.84 ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.938  0.581   26.673  1.00 33.74 ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.261  -0.222  25.791  1.00 33.19 ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.747  0.140   28.437  1.00 35.06 ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.558  1.260   27.792  1.00 34.31 ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.030  0.081   29.938  1.00 34.78 ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.303  1.711   26.405  1.00 33.15 ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 22.056  2.131   25.017  1.00 32.64 ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 23.016  3.270   24.639  1.00 31.84 ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.104  4.269   25.353  1.00 31.87 ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.589  2.519   24.805  1.00 32.26 ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.762  1.443   25.240  1.00 32.98 ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.298  2.763   23.348  1.00 33.29 ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.784  3.077   23.569  1.00 31.08 ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.602  4.151   23.014  1.00 30.61 ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.719  4.974   22.102  1.00 30.02 ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.979  4.422   21.295  1.00 30.12 ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.775  3.613   22.205  1.00 30.46 ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.805  2.692   22.877  1.00 31.65 ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.896  2.370   21.887  1.00 29.56 ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.393  3.324   24.153  1.00 33.17 ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.756  6.289   22.247  1.00 28.80 ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.157  7.126   21.216  1.00 28.29 ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.050  8.303   20.916  1.00 27.80 ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.696  8.829   21.803  1.00 27.87 ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.689  7.518   21.526  1.00 27.63 ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.506  8.553   22.612  1.00 26.21 ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.034  8.380   23.877  1.00 26.21 ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.711  9.674   22.382  1.00 26.87 ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.816  9.328   24.877  1.00 25.83 ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.482  10.625  23.384  1.00 23.65 ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 21.035  10.451  24.626  1.00 25.02 ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.106  8.694   19.657  1.00 27.71 ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.951  9.803   19.270  1.00 27.67 ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.476  10.363  17.966  1.00 27.69 ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.673  9.746   17.272  1.00 27.86 ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.985  11.533  17.623  1.00 27.89 ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.570  12.205  16.416  1.00 27.50 ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.798  12.629  15.612  1.00 28.21 ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.796  13.043  16.191  1.00 27.74 ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.697  13.391  16.780  1.00 26.87 ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.100  14.089  15.593  1.00 28.24 ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.006  15.139  15.003  1.00 27.68 ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 24.972  15.571  15.689  1.00 27.80 ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.731  15.535  13.857  1.00 26.54 ? 202  GLU A OE2 1 
HETATM 1569 N N   . SXE A 1 203 ? 25.690  12.535  14.280  1.00 29.06 ? 203  SXE A N   1 
HETATM 1570 C CA  . SXE A 1 203 ? 26.759  12.828  13.321  1.00 29.96 ? 203  SXE A CA  1 
HETATM 1571 C C   . SXE A 1 203 ? 28.004  11.971  13.583  1.00 29.64 ? 203  SXE A C   1 
HETATM 1572 O O   . SXE A 1 203 ? 27.943  10.759  13.379  1.00 29.86 ? 203  SXE A O   1 
HETATM 1573 C CB  . SXE A 1 203 ? 27.059  14.319  13.257  1.00 30.08 ? 203  SXE A CB  1 
HETATM 1574 O OG  . SXE A 1 203 ? 27.847  14.686  12.115  1.00 37.00 ? 203  SXE A OG  1 
HETATM 1575 O O1  . SXE A 1 203 ? 29.661  15.310  13.516  1.00 63.03 ? 203  SXE A O1  1 
HETATM 1576 P P1  . SXE A 1 203 ? 28.573  16.055  12.610  1.00 61.86 ? 203  SXE A P1  1 
HETATM 1577 N N1  . SXE A 1 203 ? 27.353  16.902  13.637  1.00 63.88 ? 203  SXE A N1  1 
HETATM 1578 C C1  . SXE A 1 203 ? 27.434  18.196  14.350  1.00 62.59 ? 203  SXE A C1  1 
HETATM 1579 C C3  . SXE A 1 203 ? 26.314  19.159  13.955  1.00 61.95 ? 203  SXE A C3  1 
HETATM 1580 C C2  . SXE A 1 203 ? 27.382  18.037  15.864  1.00 60.65 ? 203  SXE A C2  1 
HETATM 1581 O O2  . SXE A 1 203 ? 29.384  17.105  11.672  1.00 64.71 ? 203  SXE A O2  1 
HETATM 1582 C C4  . SXE A 1 203 ? 29.165  18.527  11.708  1.00 65.64 ? 203  SXE A C4  1 
HETATM 1583 C C5  . SXE A 1 203 ? 30.395  19.306  12.124  1.00 65.46 ? 203  SXE A C5  1 
ATOM   1584 N N   . ALA A 1 204 ? 29.117  12.570  14.010  1.00 28.95 ? 204  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 204 ? 30.314  11.777  14.310  1.00 29.04 ? 204  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 204 ? 30.062  10.942  15.553  1.00 28.84 ? 204  ALA A C   1 
ATOM   1587 O O   . ALA A 1 204 ? 30.773  9.963   15.809  1.00 28.68 ? 204  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 204 ? 31.554  12.650  14.494  1.00 28.13 ? 204  ALA A CB  1 
ATOM   1589 N N   . GLY A 1 205 ? 29.057  11.347  16.329  1.00 28.54 ? 205  GLY A N   1 
ATOM   1590 C CA  . GLY A 1 205 ? 28.656  10.600  17.506  1.00 28.79 ? 205  GLY A CA  1 
ATOM   1591 C C   . GLY A 1 205 ? 27.983  9.335   16.999  1.00 29.30 ? 205  GLY A C   1 
ATOM   1592 O O   . GLY A 1 205 ? 28.256  8.227   17.456  1.00 29.69 ? 205  GLY A O   1 
ATOM   1593 N N   . ALA A 1 206 ? 27.138  9.496   16.003  1.00 29.12 ? 206  ALA A N   1 
ATOM   1594 C CA  . ALA A 1 206 ? 26.470  8.354   15.435  1.00 29.69 ? 206  ALA A CA  1 
ATOM   1595 C C   . ALA A 1 206 ? 27.503  7.457   14.776  1.00 29.84 ? 206  ALA A C   1 
ATOM   1596 O O   . ALA A 1 206 ? 27.457  6.238   14.946  1.00 30.96 ? 206  ALA A O   1 
ATOM   1597 C CB  . ALA A 1 206 ? 25.390  8.789   14.437  1.00 29.06 ? 206  ALA A CB  1 
ATOM   1598 N N   . ALA A 1 207 ? 28.423  8.042   14.024  1.00 29.22 ? 207  ALA A N   1 
ATOM   1599 C CA  . ALA A 1 207 ? 29.434  7.244   13.375  1.00 29.67 ? 207  ALA A CA  1 
ATOM   1600 C C   . ALA A 1 207 ? 30.208  6.500   14.452  1.00 29.85 ? 207  ALA A C   1 
ATOM   1601 O O   . ALA A 1 207 ? 30.408  5.294   14.354  1.00 30.10 ? 207  ALA A O   1 
ATOM   1602 C CB  . ALA A 1 207 ? 30.364  8.115   12.529  1.00 29.47 ? 207  ALA A CB  1 
ATOM   1603 N N   . SER A 1 208 ? 30.611  7.225   15.495  1.00 30.14 ? 208  SER A N   1 
ATOM   1604 C CA  . SER A 1 208 ? 31.218  6.611   16.672  1.00 30.45 ? 208  SER A CA  1 
ATOM   1605 C C   . SER A 1 208 ? 30.417  5.398   17.187  1.00 29.93 ? 208  SER A C   1 
ATOM   1606 O O   . SER A 1 208 ? 30.977  4.310   17.317  1.00 29.74 ? 208  SER A O   1 
ATOM   1607 C CB  . SER A 1 208 ? 31.439  7.642   17.782  1.00 30.40 ? 208  SER A CB  1 
ATOM   1608 O OG  . SER A 1 208 ? 32.633  8.376   17.551  1.00 31.87 ? 208  SER A OG  1 
ATOM   1609 N N   . VAL A 1 209 ? 29.124  5.579   17.455  1.00 29.30 ? 209  VAL A N   1 
ATOM   1610 C CA  . VAL A 1 209 ? 28.274  4.481   17.931  1.00 29.06 ? 209  VAL A CA  1 
ATOM   1611 C C   . VAL A 1 209 ? 28.427  3.254   17.027  1.00 29.87 ? 209  VAL A C   1 
ATOM   1612 O O   . VAL A 1 209 ? 28.655  2.145   17.507  1.00 29.32 ? 209  VAL A O   1 
ATOM   1613 C CB  . VAL A 1 209 ? 26.784  4.900   18.019  1.00 28.72 ? 209  VAL A CB  1 
ATOM   1614 C CG1 . VAL A 1 209 ? 25.865  3.684   18.116  1.00 26.53 ? 209  VAL A CG1 1 
ATOM   1615 C CG2 . VAL A 1 209 ? 26.569  5.808   19.208  1.00 28.03 ? 209  VAL A CG2 1 
ATOM   1616 N N   . GLY A 1 210 ? 28.332  3.489   15.719  1.00 30.40 ? 210  GLY A N   1 
ATOM   1617 C CA  . GLY A 1 210 ? 28.450  2.456   14.708  1.00 31.61 ? 210  GLY A CA  1 
ATOM   1618 C C   . GLY A 1 210 ? 29.797  1.777   14.729  1.00 32.66 ? 210  GLY A C   1 
ATOM   1619 O O   . GLY A 1 210 ? 29.905  0.582   14.468  1.00 33.59 ? 210  GLY A O   1 
ATOM   1620 N N   . MET A 1 211 ? 30.842  2.500   15.067  1.00 32.94 ? 211  MET A N   1 
ATOM   1621 C CA  . MET A 1 211 ? 32.100  1.812   15.175  1.00 34.03 ? 211  MET A CA  1 
ATOM   1622 C C   . MET A 1 211 ? 32.223  0.949   16.415  1.00 33.97 ? 211  MET A C   1 
ATOM   1623 O O   . MET A 1 211 ? 32.842  -0.123  16.361  1.00 34.80 ? 211  MET A O   1 
ATOM   1624 C CB  . MET A 1 211 ? 33.246  2.766   14.997  1.00 34.27 ? 211  MET A CB  1 
ATOM   1625 C CG  . MET A 1 211 ? 33.335  3.192   13.546  1.00 34.25 ? 211  MET A CG  1 
ATOM   1626 S SD  . MET A 1 211 ? 34.293  4.651   13.565  1.00 36.98 ? 211  MET A SD  1 
ATOM   1627 C CE  . MET A 1 211 ? 33.615  5.520   12.153  1.00 35.52 ? 211  MET A CE  1 
ATOM   1628 N N   . HIS A 1 212 ? 31.604  1.365   17.517  1.00 33.13 ? 212  HIS A N   1 
ATOM   1629 C CA  . HIS A 1 212 ? 31.494  0.464   18.641  1.00 32.59 ? 212  HIS A CA  1 
ATOM   1630 C C   . HIS A 1 212 ? 30.708  -0.791  18.261  1.00 33.37 ? 212  HIS A C   1 
ATOM   1631 O O   . HIS A 1 212 ? 31.097  -1.887  18.633  1.00 33.77 ? 212  HIS A O   1 
ATOM   1632 C CB  . HIS A 1 212 ? 30.932  1.168   19.869  1.00 31.66 ? 212  HIS A CB  1 
ATOM   1633 C CG  . HIS A 1 212 ? 31.836  2.230   20.381  1.00 28.94 ? 212  HIS A CG  1 
ATOM   1634 N ND1 . HIS A 1 212 ? 33.126  1.964   20.779  1.00 27.05 ? 212  HIS A ND1 1 
ATOM   1635 C CD2 . HIS A 1 212 ? 31.674  3.569   20.487  1.00 26.12 ? 212  HIS A CD2 1 
ATOM   1636 C CE1 . HIS A 1 212 ? 33.714  3.090   21.139  1.00 26.21 ? 212  HIS A CE1 1 
ATOM   1637 N NE2 . HIS A 1 212 ? 32.856  4.080   20.964  1.00 27.61 ? 212  HIS A NE2 1 
ATOM   1638 N N   . ILE A 1 213 ? 29.637  -0.644  17.489  1.00 33.85 ? 213  ILE A N   1 
ATOM   1639 C CA  . ILE A 1 213 ? 28.918  -1.811  16.992  1.00 34.30 ? 213  ILE A CA  1 
ATOM   1640 C C   . ILE A 1 213 ? 29.881  -2.710  16.214  1.00 35.33 ? 213  ILE A C   1 
ATOM   1641 O O   . ILE A 1 213 ? 29.792  -3.920  16.292  1.00 36.09 ? 213  ILE A O   1 
ATOM   1642 C CB  . ILE A 1 213 ? 27.739  -1.411  16.090  1.00 33.83 ? 213  ILE A CB  1 
ATOM   1643 C CG1 . ILE A 1 213 ? 26.607  -0.819  16.924  1.00 33.41 ? 213  ILE A CG1 1 
ATOM   1644 C CG2 . ILE A 1 213 ? 27.235  -2.599  15.264  1.00 33.05 ? 213  ILE A CG2 1 
ATOM   1645 C CD1 . ILE A 1 213 ? 25.500  -0.175  16.078  1.00 32.82 ? 213  ILE A CD1 1 
ATOM   1646 N N   . LEU A 1 214 ? 30.816  -2.107  15.487  1.00 36.11 ? 214  LEU A N   1 
ATOM   1647 C CA  . LEU A 1 214 ? 31.644  -2.833  14.532  1.00 36.35 ? 214  LEU A CA  1 
ATOM   1648 C C   . LEU A 1 214 ? 32.958  -3.330  15.102  1.00 36.59 ? 214  LEU A C   1 
ATOM   1649 O O   . LEU A 1 214 ? 33.707  -4.017  14.419  1.00 36.91 ? 214  LEU A O   1 
ATOM   1650 C CB  . LEU A 1 214 ? 31.917  -1.958  13.300  1.00 36.34 ? 214  LEU A CB  1 
ATOM   1651 C CG  . LEU A 1 214 ? 30.704  -1.644  12.420  1.00 36.52 ? 214  LEU A CG  1 
ATOM   1652 C CD1 . LEU A 1 214 ? 31.128  -0.850  11.207  1.00 34.92 ? 214  LEU A CD1 1 
ATOM   1653 C CD2 . LEU A 1 214 ? 29.941  -2.912  12.001  1.00 35.32 ? 214  LEU A CD2 1 
ATOM   1654 N N   . SER A 1 215 ? 33.245  -2.982  16.347  1.00 36.98 ? 215  SER A N   1 
ATOM   1655 C CA  . SER A 1 215 ? 34.520  -3.316  16.951  1.00 37.20 ? 215  SER A CA  1 
ATOM   1656 C C   . SER A 1 215 ? 34.244  -4.197  18.145  1.00 38.42 ? 215  SER A C   1 
ATOM   1657 O O   . SER A 1 215 ? 33.632  -3.748  19.111  1.00 38.73 ? 215  SER A O   1 
ATOM   1658 C CB  . SER A 1 215 ? 35.210  -2.038  17.396  1.00 37.17 ? 215  SER A CB  1 
ATOM   1659 O OG  . SER A 1 215 ? 36.512  -2.275  17.884  1.00 35.35 ? 215  SER A OG  1 
ATOM   1660 N N   . LEU A 1 216 ? 34.698  -5.449  18.082  1.00 39.83 ? 216  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 216 ? 34.315  -6.482  19.048  1.00 40.35 ? 216  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 216 ? 34.531  -6.140  20.521  1.00 39.80 ? 216  LEU A C   1 
ATOM   1663 O O   . LEU A 1 216 ? 33.668  -6.419  21.342  1.00 39.84 ? 216  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 216 ? 34.984  -7.840  18.715  1.00 41.00 ? 216  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 216 ? 34.476  -9.077  19.504  1.00 41.41 ? 216  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 216 ? 32.958  -9.329  19.305  1.00 43.25 ? 216  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 216 ? 35.275  -10.353 19.169  1.00 42.57 ? 216  LEU A CD2 1 
ATOM   1668 N N   . PRO A 1 217 ? 35.686  -5.545  20.876  1.00 39.61 ? 217  PRO A N   1 
ATOM   1669 C CA  . PRO A 1 217 ? 35.832  -5.227  22.302  1.00 39.29 ? 217  PRO A CA  1 
ATOM   1670 C C   . PRO A 1 217 ? 34.840  -4.178  22.862  1.00 39.48 ? 217  PRO A C   1 
ATOM   1671 O O   . PRO A 1 217 ? 34.784  -3.974  24.083  1.00 40.16 ? 217  PRO A O   1 
ATOM   1672 C CB  . PRO A 1 217 ? 37.277  -4.726  22.401  1.00 39.15 ? 217  PRO A CB  1 
ATOM   1673 C CG  . PRO A 1 217 ? 37.940  -5.196  21.162  1.00 38.91 ? 217  PRO A CG  1 
ATOM   1674 C CD  . PRO A 1 217 ? 36.888  -5.179  20.114  1.00 38.66 ? 217  PRO A CD  1 
ATOM   1675 N N   . SER A 1 218 ? 34.081  -3.511  22.004  1.00 38.95 ? 218  SER A N   1 
ATOM   1676 C CA  . SER A 1 218 ? 33.101  -2.536  22.481  1.00 39.27 ? 218  SER A CA  1 
ATOM   1677 C C   . SER A 1 218 ? 31.754  -3.199  22.595  1.00 39.49 ? 218  SER A C   1 
ATOM   1678 O O   . SER A 1 218 ? 30.875  -2.716  23.306  1.00 39.06 ? 218  SER A O   1 
ATOM   1679 C CB  . SER A 1 218 ? 32.979  -1.346  21.535  1.00 39.01 ? 218  SER A CB  1 
ATOM   1680 O OG  . SER A 1 218 ? 34.147  -0.548  21.557  1.00 39.71 ? 218  SER A OG  1 
ATOM   1681 N N   . ARG A 1 219 ? 31.604  -4.317  21.887  1.00 39.77 ? 219  ARG A N   1 
ATOM   1682 C CA  . ARG A 1 219 ? 30.334  -5.038  21.822  1.00 39.87 ? 219  ARG A CA  1 
ATOM   1683 C C   . ARG A 1 219 ? 29.795  -5.507  23.163  1.00 39.55 ? 219  ARG A C   1 
ATOM   1684 O O   . ARG A 1 219 ? 28.589  -5.503  23.373  1.00 39.32 ? 219  ARG A O   1 
ATOM   1685 C CB  . ARG A 1 219 ? 30.421  -6.190  20.834  1.00 39.72 ? 219  ARG A CB  1 
ATOM   1686 C CG  . ARG A 1 219 ? 30.301  -5.698  19.413  1.00 41.78 ? 219  ARG A CG  1 
ATOM   1687 C CD  . ARG A 1 219 ? 29.134  -4.691  19.290  1.00 45.42 ? 219  ARG A CD  1 
ATOM   1688 N NE  . ARG A 1 219 ? 27.826  -5.316  19.525  1.00 48.49 ? 219  ARG A NE  1 
ATOM   1689 C CZ  . ARG A 1 219 ? 27.172  -6.073  18.640  1.00 51.49 ? 219  ARG A CZ  1 
ATOM   1690 N NH1 . ARG A 1 219 ? 27.689  -6.310  17.435  1.00 51.58 ? 219  ARG A NH1 1 
ATOM   1691 N NH2 . ARG A 1 219 ? 25.989  -6.599  18.961  1.00 53.87 ? 219  ARG A NH2 1 
ATOM   1692 N N   . SER A 1 220 ? 30.696  -5.891  24.064  1.00 39.45 ? 220  SER A N   1 
ATOM   1693 C CA  . SER A 1 220 ? 30.311  -6.320  25.395  1.00 39.26 ? 220  SER A CA  1 
ATOM   1694 C C   . SER A 1 220 ? 29.888  -5.170  26.279  1.00 38.62 ? 220  SER A C   1 
ATOM   1695 O O   . SER A 1 220 ? 29.410  -5.400  27.382  1.00 39.18 ? 220  SER A O   1 
ATOM   1696 C CB  . SER A 1 220 ? 31.456  -7.089  26.078  1.00 39.88 ? 220  SER A CB  1 
ATOM   1697 O OG  . SER A 1 220 ? 32.634  -6.303  26.231  1.00 41.16 ? 220  SER A OG  1 
ATOM   1698 N N   . LEU A 1 221 ? 30.060  -3.933  25.811  1.00 37.90 ? 221  LEU A N   1 
ATOM   1699 C CA  . LEU A 1 221 ? 29.907  -2.775  26.684  1.00 36.69 ? 221  LEU A CA  1 
ATOM   1700 C C   . LEU A 1 221 ? 28.569  -2.076  26.547  1.00 36.04 ? 221  LEU A C   1 
ATOM   1701 O O   . LEU A 1 221 ? 28.277  -1.144  27.307  1.00 36.21 ? 221  LEU A O   1 
ATOM   1702 C CB  . LEU A 1 221 ? 31.064  -1.796  26.496  1.00 36.84 ? 221  LEU A CB  1 
ATOM   1703 C CG  . LEU A 1 221 ? 32.480  -2.388  26.557  1.00 37.65 ? 221  LEU A CG  1 
ATOM   1704 C CD1 . LEU A 1 221 ? 33.521  -1.291  26.327  1.00 37.40 ? 221  LEU A CD1 1 
ATOM   1705 C CD2 . LEU A 1 221 ? 32.739  -3.111  27.886  1.00 36.43 ? 221  LEU A CD2 1 
ATOM   1706 N N   . PHE A 1 222 ? 27.746  -2.528  25.603  1.00 34.82 ? 222  PHE A N   1 
ATOM   1707 C CA  . PHE A 1 222 ? 26.407  -1.953  25.413  1.00 34.02 ? 222  PHE A CA  1 
ATOM   1708 C C   . PHE A 1 222 ? 25.499  -2.990  24.765  1.00 34.24 ? 222  PHE A C   1 
ATOM   1709 O O   . PHE A 1 222 ? 25.971  -4.008  24.284  1.00 33.41 ? 222  PHE A O   1 
ATOM   1710 C CB  . PHE A 1 222 ? 26.462  -0.690  24.551  1.00 33.06 ? 222  PHE A CB  1 
ATOM   1711 C CG  . PHE A 1 222 ? 26.873  -0.947  23.130  1.00 31.36 ? 222  PHE A CG  1 
ATOM   1712 C CD1 . PHE A 1 222 ? 28.205  -1.129  22.798  1.00 30.68 ? 222  PHE A CD1 1 
ATOM   1713 C CD2 . PHE A 1 222 ? 25.933  -1.000  22.122  1.00 32.55 ? 222  PHE A CD2 1 
ATOM   1714 C CE1 . PHE A 1 222 ? 28.593  -1.372  21.488  1.00 30.67 ? 222  PHE A CE1 1 
ATOM   1715 C CE2 . PHE A 1 222 ? 26.317  -1.249  20.788  1.00 32.50 ? 222  PHE A CE2 1 
ATOM   1716 C CZ  . PHE A 1 222 ? 27.650  -1.441  20.487  1.00 31.71 ? 222  PHE A CZ  1 
ATOM   1717 N N   . HIS A 1 223 ? 24.205  -2.696  24.708  1.00 34.69 ? 223  HIS A N   1 
ATOM   1718 C CA  . HIS A 1 223 ? 23.236  -3.680  24.272  1.00 35.80 ? 223  HIS A CA  1 
ATOM   1719 C C   . HIS A 1 223 ? 22.387  -3.218  23.102  1.00 35.96 ? 223  HIS A C   1 
ATOM   1720 O O   . HIS A 1 223 ? 21.875  -4.042  22.332  1.00 36.58 ? 223  HIS A O   1 
ATOM   1721 C CB  . HIS A 1 223 ? 22.382  -4.082  25.474  1.00 36.17 ? 223  HIS A CB  1 
ATOM   1722 C CG  . HIS A 1 223 ? 23.210  -4.426  26.674  1.00 37.83 ? 223  HIS A CG  1 
ATOM   1723 N ND1 . HIS A 1 223 ? 23.792  -5.670  26.848  1.00 37.50 ? 223  HIS A ND1 1 
ATOM   1724 C CD2 . HIS A 1 223 ? 23.635  -3.661  27.707  1.00 36.67 ? 223  HIS A CD2 1 
ATOM   1725 C CE1 . HIS A 1 223 ? 24.493  -5.671  27.966  1.00 37.14 ? 223  HIS A CE1 1 
ATOM   1726 N NE2 . HIS A 1 223 ? 24.420  -4.462  28.501  1.00 39.66 ? 223  HIS A NE2 1 
ATOM   1727 N N   . ARG A 1 224 ? 22.263  -1.902  22.973  1.00 35.82 ? 224  ARG A N   1 
ATOM   1728 C CA  . ARG A 1 224 ? 21.391  -1.257  21.996  1.00 36.10 ? 224  ARG A CA  1 
ATOM   1729 C C   . ARG A 1 224 ? 22.018  0.060   21.518  1.00 35.44 ? 224  ARG A C   1 
ATOM   1730 O O   . ARG A 1 224 ? 22.842  0.660   22.214  1.00 35.67 ? 224  ARG A O   1 
ATOM   1731 C CB  . ARG A 1 224 ? 20.015  -1.003  22.617  1.00 36.22 ? 224  ARG A CB  1 
ATOM   1732 C CG  . ARG A 1 224 ? 19.118  -2.216  22.562  1.00 37.72 ? 224  ARG A CG  1 
ATOM   1733 C CD  . ARG A 1 224 ? 17.795  -2.039  23.303  1.00 37.77 ? 224  ARG A CD  1 
ATOM   1734 N NE  . ARG A 1 224 ? 17.940  -1.986  24.758  1.00 41.53 ? 224  ARG A NE  1 
ATOM   1735 C CZ  . ARG A 1 224 ? 18.381  -2.978  25.532  1.00 43.74 ? 224  ARG A CZ  1 
ATOM   1736 N NH1 . ARG A 1 224 ? 18.770  -4.142  25.009  1.00 46.67 ? 224  ARG A NH1 1 
ATOM   1737 N NH2 . ARG A 1 224 ? 18.458  -2.795  26.844  1.00 44.44 ? 224  ARG A NH2 1 
ATOM   1738 N N   . ALA A 1 225 ? 21.641  0.503   20.328  1.00 34.59 ? 225  ALA A N   1 
ATOM   1739 C CA  . ALA A 1 225 ? 22.344  1.605   19.715  1.00 34.09 ? 225  ALA A CA  1 
ATOM   1740 C C   . ALA A 1 225 ? 21.421  2.524   18.930  1.00 33.70 ? 225  ALA A C   1 
ATOM   1741 O O   . ALA A 1 225 ? 20.546  2.050   18.205  1.00 33.70 ? 225  ALA A O   1 
ATOM   1742 C CB  . ALA A 1 225 ? 23.435  1.077   18.837  1.00 34.16 ? 225  ALA A CB  1 
ATOM   1743 N N   . VAL A 1 226 ? 21.619  3.831   19.101  1.00 33.02 ? 226  VAL A N   1 
ATOM   1744 C CA  . VAL A 1 226 ? 20.948  4.845   18.300  1.00 32.70 ? 226  VAL A CA  1 
ATOM   1745 C C   . VAL A 1 226 ? 21.965  5.657   17.526  1.00 32.51 ? 226  VAL A C   1 
ATOM   1746 O O   . VAL A 1 226 ? 22.893  6.201   18.108  1.00 33.13 ? 226  VAL A O   1 
ATOM   1747 C CB  . VAL A 1 226 ? 20.121  5.812   19.144  1.00 32.90 ? 226  VAL A CB  1 
ATOM   1748 C CG1 . VAL A 1 226 ? 19.428  6.834   18.229  1.00 32.77 ? 226  VAL A CG1 1 
ATOM   1749 C CG2 . VAL A 1 226 ? 19.090  5.056   19.997  1.00 32.63 ? 226  VAL A CG2 1 
ATOM   1750 N N   . LEU A 1 227 ? 21.787  5.731   16.211  1.00 32.05 ? 227  LEU A N   1 
ATOM   1751 C CA  . LEU A 1 227 ? 22.672  6.496   15.345  1.00 30.87 ? 227  LEU A CA  1 
ATOM   1752 C C   . LEU A 1 227 ? 21.882  7.602   14.659  1.00 30.82 ? 227  LEU A C   1 
ATOM   1753 O O   . LEU A 1 227 ? 21.052  7.344   13.782  1.00 31.21 ? 227  LEU A O   1 
ATOM   1754 C CB  . LEU A 1 227 ? 23.320  5.581   14.304  1.00 30.87 ? 227  LEU A CB  1 
ATOM   1755 C CG  . LEU A 1 227 ? 24.281  4.471   14.754  1.00 30.52 ? 227  LEU A CG  1 
ATOM   1756 C CD1 . LEU A 1 227 ? 23.558  3.268   15.347  1.00 29.04 ? 227  LEU A CD1 1 
ATOM   1757 C CD2 . LEU A 1 227 ? 25.130  4.033   13.583  1.00 30.15 ? 227  LEU A CD2 1 
ATOM   1758 N N   . GLN A 1 228 ? 22.126  8.835   15.076  1.00 30.63 ? 228  GLN A N   1 
ATOM   1759 C CA  . GLN A 1 228 ? 21.381  9.980   14.559  1.00 30.78 ? 228  GLN A CA  1 
ATOM   1760 C C   . GLN A 1 228 ? 22.194  10.693  13.490  1.00 31.19 ? 228  GLN A C   1 
ATOM   1761 O O   . GLN A 1 228 ? 23.266  11.243  13.777  1.00 31.54 ? 228  GLN A O   1 
ATOM   1762 C CB  . GLN A 1 228 ? 21.001  10.939  15.696  1.00 30.40 ? 228  GLN A CB  1 
ATOM   1763 C CG  . GLN A 1 228 ? 20.138  10.280  16.744  1.00 30.64 ? 228  GLN A CG  1 
ATOM   1764 C CD  . GLN A 1 228 ? 19.935  11.088  17.993  1.00 31.83 ? 228  GLN A CD  1 
ATOM   1765 O OE1 . GLN A 1 228 ? 19.713  10.523  19.068  1.00 32.61 ? 228  GLN A OE1 1 
ATOM   1766 N NE2 . GLN A 1 228 ? 19.989  12.409  17.875  1.00 32.59 ? 228  GLN A NE2 1 
ATOM   1767 N N   . SER A 1 229 ? 21.697  10.669  12.250  1.00 31.02 ? 229  SER A N   1 
ATOM   1768 C CA  . SER A 1 229 ? 22.327  11.397  11.150  1.00 30.42 ? 229  SER A CA  1 
ATOM   1769 C C   . SER A 1 229 ? 23.822  11.149  11.094  1.00 30.59 ? 229  SER A C   1 
ATOM   1770 O O   . SER A 1 229 ? 24.619  12.110  11.072  1.00 30.23 ? 229  SER A O   1 
ATOM   1771 C CB  . SER A 1 229 ? 22.111  12.897  11.289  1.00 30.22 ? 229  SER A CB  1 
ATOM   1772 O OG  . SER A 1 229 ? 20.787  13.194  11.616  1.00 30.68 ? 229  SER A OG  1 
ATOM   1773 N N   . GLY A 1 230 ? 24.200  9.871   11.041  1.00 30.11 ? 230  GLY A N   1 
ATOM   1774 C CA  . GLY A 1 230 ? 25.611  9.490   10.987  1.00 29.96 ? 230  GLY A CA  1 
ATOM   1775 C C   . GLY A 1 230 ? 25.799  7.987   10.981  1.00 30.28 ? 230  GLY A C   1 
ATOM   1776 O O   . GLY A 1 230 ? 24.946  7.236   11.477  1.00 30.33 ? 230  GLY A O   1 
ATOM   1777 N N   . THR A 1 231 ? 26.908  7.541   10.395  1.00 30.05 ? 231  THR A N   1 
ATOM   1778 C CA  . THR A 1 231 ? 27.148  6.129   10.200  1.00 30.14 ? 231  THR A CA  1 
ATOM   1779 C C   . THR A 1 231 ? 28.629  5.860   10.165  1.00 30.43 ? 231  THR A C   1 
ATOM   1780 O O   . THR A 1 231 ? 29.397  6.708   9.728   1.00 30.78 ? 231  THR A O   1 
ATOM   1781 C CB  . THR A 1 231 ? 26.567  5.634   8.857   1.00 30.79 ? 231  THR A CB  1 
ATOM   1782 O OG1 . THR A 1 231 ? 27.234  6.295   7.775   1.00 30.74 ? 231  THR A OG1 1 
ATOM   1783 C CG2 . THR A 1 231 ? 25.058  5.883   8.769   1.00 30.23 ? 231  THR A CG2 1 
ATOM   1784 N N   . PRO A 1 232 ? 29.050  4.653   10.596  1.00 30.62 ? 232  PRO A N   1 
ATOM   1785 C CA  . PRO A 1 232 ? 30.470  4.344   10.516  1.00 30.04 ? 232  PRO A CA  1 
ATOM   1786 C C   . PRO A 1 232 ? 30.911  4.269   9.048   1.00 29.97 ? 232  PRO A C   1 
ATOM   1787 O O   . PRO A 1 232 ? 32.047  4.594   8.730   1.00 30.07 ? 232  PRO A O   1 
ATOM   1788 C CB  . PRO A 1 232 ? 30.558  2.975   11.183  1.00 30.37 ? 232  PRO A CB  1 
ATOM   1789 C CG  . PRO A 1 232 ? 29.195  2.388   11.057  1.00 30.08 ? 232  PRO A CG  1 
ATOM   1790 C CD  . PRO A 1 232 ? 28.256  3.527   11.121  1.00 30.26 ? 232  PRO A CD  1 
ATOM   1791 N N   . ASN A 1 233 ? 30.005  3.838   8.174   1.00 29.46 ? 233  ASN A N   1 
ATOM   1792 C CA  . ASN A 1 233 ? 30.251  3.778   6.748   1.00 29.55 ? 233  ASN A CA  1 
ATOM   1793 C C   . ASN A 1 233 ? 29.949  5.133   6.109   1.00 30.08 ? 233  ASN A C   1 
ATOM   1794 O O   . ASN A 1 233 ? 29.384  6.022   6.762   1.00 29.94 ? 233  ASN A O   1 
ATOM   1795 C CB  . ASN A 1 233 ? 29.359  2.725   6.117   1.00 29.28 ? 233  ASN A CB  1 
ATOM   1796 C CG  . ASN A 1 233 ? 27.893  2.970   6.405   1.00 30.33 ? 233  ASN A CG  1 
ATOM   1797 O OD1 . ASN A 1 233 ? 27.132  3.385   5.527   1.00 31.17 ? 233  ASN A OD1 1 
ATOM   1798 N ND2 . ASN A 1 233 ? 27.493  2.747   7.652   1.00 31.64 ? 233  ASN A ND2 1 
ATOM   1799 N N   . GLY A 1 234 ? 30.295  5.285   4.834   1.00 29.99 ? 234  GLY A N   1 
ATOM   1800 C CA  . GLY A 1 234 ? 30.136  6.568   4.170   1.00 30.64 ? 234  GLY A CA  1 
ATOM   1801 C C   . GLY A 1 234 ? 31.454  7.293   3.948   1.00 30.60 ? 234  GLY A C   1 
ATOM   1802 O O   . GLY A 1 234 ? 32.504  6.821   4.378   1.00 30.77 ? 234  GLY A O   1 
ATOM   1803 N N   . PRO A 1 235 ? 31.407  8.461   3.292   1.00 30.47 ? 235  PRO A N   1 
ATOM   1804 C CA  . PRO A 1 235 ? 32.625  9.023   2.733   1.00 30.18 ? 235  PRO A CA  1 
ATOM   1805 C C   . PRO A 1 235 ? 33.485  9.824   3.704   1.00 30.10 ? 235  PRO A C   1 
ATOM   1806 O O   . PRO A 1 235 ? 34.619  10.202  3.353   1.00 30.73 ? 235  PRO A O   1 
ATOM   1807 C CB  . PRO A 1 235 ? 32.093  9.927   1.611   1.00 30.07 ? 235  PRO A CB  1 
ATOM   1808 C CG  . PRO A 1 235 ? 30.750  10.359  2.067   1.00 29.49 ? 235  PRO A CG  1 
ATOM   1809 C CD  . PRO A 1 235 ? 30.233  9.315   3.026   1.00 30.63 ? 235  PRO A CD  1 
ATOM   1810 N N   . TRP A 1 236 ? 32.985  10.075  4.911   1.00 29.16 ? 236  TRP A N   1 
ATOM   1811 C CA  . TRP A 1 236 ? 33.685  10.987  5.820   1.00 28.34 ? 236  TRP A CA  1 
ATOM   1812 C C   . TRP A 1 236 ? 34.128  10.415  7.167   1.00 28.63 ? 236  TRP A C   1 
ATOM   1813 O O   . TRP A 1 236 ? 35.022  10.976  7.809   1.00 27.99 ? 236  TRP A O   1 
ATOM   1814 C CB  . TRP A 1 236 ? 32.816  12.220  6.079   1.00 26.36 ? 236  TRP A CB  1 
ATOM   1815 C CG  . TRP A 1 236 ? 31.469  11.903  6.665   1.00 24.94 ? 236  TRP A CG  1 
ATOM   1816 C CD1 . TRP A 1 236 ? 30.286  11.739  5.983   1.00 22.91 ? 236  TRP A CD1 1 
ATOM   1817 C CD2 . TRP A 1 236 ? 31.154  11.726  8.055   1.00 22.64 ? 236  TRP A CD2 1 
ATOM   1818 N NE1 . TRP A 1 236 ? 29.254  11.499  6.870   1.00 20.34 ? 236  TRP A NE1 1 
ATOM   1819 C CE2 . TRP A 1 236 ? 29.761  11.472  8.143   1.00 21.73 ? 236  TRP A CE2 1 
ATOM   1820 C CE3 . TRP A 1 236 ? 31.904  11.786  9.235   1.00 21.14 ? 236  TRP A CE3 1 
ATOM   1821 C CZ2 . TRP A 1 236 ? 29.117  11.260  9.358   1.00 22.32 ? 236  TRP A CZ2 1 
ATOM   1822 C CZ3 . TRP A 1 236 ? 31.269  11.569  10.438  1.00 21.85 ? 236  TRP A CZ3 1 
ATOM   1823 C CH2 . TRP A 1 236 ? 29.885  11.310  10.496  1.00 23.28 ? 236  TRP A CH2 1 
ATOM   1824 N N   . ALA A 1 237 ? 33.480  9.344   7.617   1.00 28.85 ? 237  ALA A N   1 
ATOM   1825 C CA  . ALA A 1 237 ? 33.725  8.865   8.987   1.00 29.92 ? 237  ALA A CA  1 
ATOM   1826 C C   . ALA A 1 237 ? 35.056  8.118   9.183   1.00 30.63 ? 237  ALA A C   1 
ATOM   1827 O O   . ALA A 1 237 ? 35.514  7.984   10.316  1.00 30.60 ? 237  ALA A O   1 
ATOM   1828 C CB  . ALA A 1 237 ? 32.560  8.046   9.514   1.00 29.48 ? 237  ALA A CB  1 
ATOM   1829 N N   . THR A 1 238 ? 35.681  7.658   8.100   1.00 31.16 ? 238  THR A N   1 
ATOM   1830 C CA  . THR A 1 238 ? 36.935  6.902   8.219   1.00 32.23 ? 238  THR A CA  1 
ATOM   1831 C C   . THR A 1 238 ? 37.919  7.254   7.138   1.00 33.20 ? 238  THR A C   1 
ATOM   1832 O O   . THR A 1 238 ? 37.553  7.801   6.099   1.00 33.70 ? 238  THR A O   1 
ATOM   1833 C CB  . THR A 1 238 ? 36.732  5.358   8.164   1.00 32.03 ? 238  THR A CB  1 
ATOM   1834 O OG1 . THR A 1 238 ? 36.036  4.998   6.960   1.00 30.73 ? 238  THR A OG1 1 
ATOM   1835 C CG2 . THR A 1 238 ? 35.959  4.875   9.364   1.00 31.51 ? 238  THR A CG2 1 
ATOM   1836 N N   . VAL A 1 239 ? 39.183  6.939   7.391   1.00 34.28 ? 239  VAL A N   1 
ATOM   1837 C CA  . VAL A 1 239 ? 40.215  7.054   6.368   1.00 34.69 ? 239  VAL A CA  1 
ATOM   1838 C C   . VAL A 1 239 ? 41.020  5.768   6.326   1.00 35.31 ? 239  VAL A C   1 
ATOM   1839 O O   . VAL A 1 239 ? 41.104  5.047   7.321   1.00 35.75 ? 239  VAL A O   1 
ATOM   1840 C CB  . VAL A 1 239 ? 41.154  8.239   6.626   1.00 34.80 ? 239  VAL A CB  1 
ATOM   1841 C CG1 . VAL A 1 239 ? 40.497  9.545   6.148   1.00 34.55 ? 239  VAL A CG1 1 
ATOM   1842 C CG2 . VAL A 1 239 ? 41.584  8.293   8.104   1.00 34.03 ? 239  VAL A CG2 1 
ATOM   1843 N N   . SER A 1 240 ? 41.584  5.467   5.161   1.00 35.54 ? 240  SER A N   1 
ATOM   1844 C CA  . SER A 1 240 ? 42.494  4.350   5.013   1.00 35.42 ? 240  SER A CA  1 
ATOM   1845 C C   . SER A 1 240 ? 43.715  4.632   5.887   1.00 35.38 ? 240  SER A C   1 
ATOM   1846 O O   . SER A 1 240 ? 43.982  5.786   6.221   1.00 34.85 ? 240  SER A O   1 
ATOM   1847 C CB  . SER A 1 240 ? 42.921  4.229   3.555   1.00 35.04 ? 240  SER A CB  1 
ATOM   1848 O OG  . SER A 1 240 ? 43.865  5.244   3.262   1.00 35.70 ? 240  SER A OG  1 
ATOM   1849 N N   . ALA A 1 241 ? 44.449  3.587   6.261   1.00 35.71 ? 241  ALA A N   1 
ATOM   1850 C CA  . ALA A 1 241 ? 45.712  3.784   6.967   1.00 36.29 ? 241  ALA A CA  1 
ATOM   1851 C C   . ALA A 1 241 ? 46.652  4.719   6.188   1.00 36.58 ? 241  ALA A C   1 
ATOM   1852 O O   . ALA A 1 241 ? 47.192  5.672   6.748   1.00 36.51 ? 241  ALA A O   1 
ATOM   1853 C CB  . ALA A 1 241 ? 46.377  2.467   7.242   1.00 36.32 ? 241  ALA A CB  1 
ATOM   1854 N N   . GLY A 1 242 ? 46.805  4.465   4.891   1.00 37.10 ? 242  GLY A N   1 
ATOM   1855 C CA  . GLY A 1 242 ? 47.677  5.283   4.029   1.00 37.76 ? 242  GLY A CA  1 
ATOM   1856 C C   . GLY A 1 242 ? 47.355  6.763   4.020   1.00 37.95 ? 242  GLY A C   1 
ATOM   1857 O O   . GLY A 1 242 ? 48.259  7.617   4.034   1.00 38.24 ? 242  GLY A O   1 
ATOM   1858 N N   . GLU A 1 243 ? 46.062  7.069   3.987   1.00 37.86 ? 243  GLU A N   1 
ATOM   1859 C CA  . GLU A 1 243 ? 45.619  8.446   3.921   1.00 37.94 ? 243  GLU A CA  1 
ATOM   1860 C C   . GLU A 1 243 ? 45.846  9.141   5.267   1.00 38.19 ? 243  GLU A C   1 
ATOM   1861 O O   . GLU A 1 243 ? 46.236  10.323  5.307   1.00 38.52 ? 243  GLU A O   1 
ATOM   1862 C CB  . GLU A 1 243 ? 44.166  8.514   3.426   1.00 38.23 ? 243  GLU A CB  1 
ATOM   1863 C CG  . GLU A 1 243 ? 43.522  9.913   3.323   1.00 39.41 ? 243  GLU A CG  1 
ATOM   1864 C CD  . GLU A 1 243 ? 44.308  10.961  2.507   1.00 41.14 ? 243  GLU A CD  1 
ATOM   1865 O OE1 . GLU A 1 243 ? 43.857  12.127  2.511   1.00 40.80 ? 243  GLU A OE1 1 
ATOM   1866 O OE2 . GLU A 1 243 ? 45.345  10.650  1.861   1.00 41.59 ? 243  GLU A OE2 1 
ATOM   1867 N N   . ALA A 1 244 ? 45.651  8.414   6.368   1.00 38.13 ? 244  ALA A N   1 
ATOM   1868 C CA  . ALA A 1 244 ? 45.939  8.981   7.692   1.00 38.27 ? 244  ALA A CA  1 
ATOM   1869 C C   . ALA A 1 244 ? 47.440  9.198   7.898   1.00 38.92 ? 244  ALA A C   1 
ATOM   1870 O O   . ALA A 1 244 ? 47.853  10.187  8.520   1.00 39.51 ? 244  ALA A O   1 
ATOM   1871 C CB  . ALA A 1 244 ? 45.357  8.136   8.793   1.00 37.72 ? 244  ALA A CB  1 
ATOM   1872 N N   . ARG A 1 245 ? 48.255  8.293   7.363   1.00 39.25 ? 245  ARG A N   1 
ATOM   1873 C CA  . ARG A 1 245 ? 49.700  8.473   7.381   1.00 40.07 ? 245  ARG A CA  1 
ATOM   1874 C C   . ARG A 1 245 ? 50.005  9.775   6.671   1.00 40.00 ? 245  ARG A C   1 
ATOM   1875 O O   . ARG A 1 245 ? 50.691  10.654  7.202   1.00 39.36 ? 245  ARG A O   1 
ATOM   1876 C CB  . ARG A 1 245 ? 50.408  7.314   6.668   1.00 40.14 ? 245  ARG A CB  1 
ATOM   1877 C CG  . ARG A 1 245 ? 51.943  7.392   6.679   1.00 40.41 ? 245  ARG A CG  1 
ATOM   1878 C CD  . ARG A 1 245 ? 52.586  5.981   6.548   1.00 41.19 ? 245  ARG A CD  1 
ATOM   1879 N NE  . ARG A 1 245 ? 52.446  5.164   7.765   1.00 41.96 ? 245  ARG A NE  1 
ATOM   1880 C CZ  . ARG A 1 245 ? 53.202  5.323   8.849   1.00 43.53 ? 245  ARG A CZ  1 
ATOM   1881 N NH1 . ARG A 1 245 ? 54.147  6.259   8.882   1.00 43.76 ? 245  ARG A NH1 1 
ATOM   1882 N NH2 . ARG A 1 245 ? 53.014  4.558   9.914   1.00 44.19 ? 245  ARG A NH2 1 
ATOM   1883 N N   . ARG A 1 246 ? 49.454  9.887   5.469   1.00 40.29 ? 246  ARG A N   1 
ATOM   1884 C CA  . ARG A 1 246 ? 49.658  11.047  4.627   1.00 40.81 ? 246  ARG A CA  1 
ATOM   1885 C C   . ARG A 1 246 ? 49.265  12.331  5.360   1.00 40.65 ? 246  ARG A C   1 
ATOM   1886 O O   . ARG A 1 246 ? 50.093  13.241  5.511   1.00 41.05 ? 246  ARG A O   1 
ATOM   1887 C CB  . ARG A 1 246 ? 48.852  10.873  3.355   1.00 41.22 ? 246  ARG A CB  1 
ATOM   1888 C CG  . ARG A 1 246 ? 49.258  11.766  2.231   1.00 43.49 ? 246  ARG A CG  1 
ATOM   1889 C CD  . ARG A 1 246 ? 48.040  12.068  1.349   1.00 46.21 ? 246  ARG A CD  1 
ATOM   1890 N NE  . ARG A 1 246 ? 47.929  13.513  1.185   1.00 48.47 ? 246  ARG A NE  1 
ATOM   1891 C CZ  . ARG A 1 246 ? 46.949  14.273  1.658   1.00 48.74 ? 246  ARG A CZ  1 
ATOM   1892 N NH1 . ARG A 1 246 ? 45.920  13.747  2.300   1.00 47.79 ? 246  ARG A NH1 1 
ATOM   1893 N NH2 . ARG A 1 246 ? 46.994  15.581  1.445   1.00 52.20 ? 246  ARG A NH2 1 
ATOM   1894 N N   . ARG A 1 247 ? 48.026  12.400  5.847   1.00 40.05 ? 247  ARG A N   1 
ATOM   1895 C CA  . ARG A 1 247 ? 47.565  13.600  6.547   1.00 39.66 ? 247  ARG A CA  1 
ATOM   1896 C C   . ARG A 1 247 ? 48.388  13.935  7.777   1.00 39.58 ? 247  ARG A C   1 
ATOM   1897 O O   . ARG A 1 247 ? 48.583  15.111  8.094   1.00 40.25 ? 247  ARG A O   1 
ATOM   1898 C CB  . ARG A 1 247 ? 46.099  13.477  6.940   1.00 39.50 ? 247  ARG A CB  1 
ATOM   1899 C CG  . ARG A 1 247 ? 45.193  13.298  5.766   1.00 39.27 ? 247  ARG A CG  1 
ATOM   1900 C CD  . ARG A 1 247 ? 43.758  13.343  6.177   1.00 39.69 ? 247  ARG A CD  1 
ATOM   1901 N NE  . ARG A 1 247 ? 42.914  12.974  5.053   1.00 40.58 ? 247  ARG A NE  1 
ATOM   1902 C CZ  . ARG A 1 247 ? 41.587  12.961  5.066   1.00 41.23 ? 247  ARG A CZ  1 
ATOM   1903 N NH1 . ARG A 1 247 ? 40.904  13.305  6.152   1.00 41.59 ? 247  ARG A NH1 1 
ATOM   1904 N NH2 . ARG A 1 247 ? 40.944  12.603  3.977   1.00 41.88 ? 247  ARG A NH2 1 
ATOM   1905 N N   . ALA A 1 248 ? 48.857  12.908  8.475   1.00 39.30 ? 248  ALA A N   1 
ATOM   1906 C CA  . ALA A 1 248 ? 49.580  13.104  9.726   1.00 39.20 ? 248  ALA A CA  1 
ATOM   1907 C C   . ALA A 1 248 ? 50.989  13.606  9.480   1.00 39.30 ? 248  ALA A C   1 
ATOM   1908 O O   . ALA A 1 248 ? 51.462  14.511  10.173  1.00 39.23 ? 248  ALA A O   1 
ATOM   1909 C CB  . ALA A 1 248 ? 49.611  11.823  10.525  1.00 39.19 ? 248  ALA A CB  1 
ATOM   1910 N N   . THR A 1 249 ? 51.655  12.994  8.500   1.00 39.47 ? 249  THR A N   1 
ATOM   1911 C CA  . THR A 1 249 ? 52.973  13.412  8.060   1.00 39.78 ? 249  THR A CA  1 
ATOM   1912 C C   . THR A 1 249 ? 52.916  14.848  7.571   1.00 39.35 ? 249  THR A C   1 
ATOM   1913 O O   . THR A 1 249 ? 53.794  15.650  7.907   1.00 39.31 ? 249  THR A O   1 
ATOM   1914 C CB  . THR A 1 249 ? 53.513  12.510  6.927   1.00 40.01 ? 249  THR A CB  1 
ATOM   1915 O OG1 . THR A 1 249 ? 53.560  11.154  7.381   1.00 42.30 ? 249  THR A OG1 1 
ATOM   1916 C CG2 . THR A 1 249 ? 54.925  12.942  6.501   1.00 40.24 ? 249  THR A CG2 1 
ATOM   1917 N N   . LEU A 1 250 ? 51.884  15.169  6.789   1.00 39.06 ? 250  LEU A N   1 
ATOM   1918 C CA  . LEU A 1 250 ? 51.751  16.512  6.246   1.00 39.13 ? 250  LEU A CA  1 
ATOM   1919 C C   . LEU A 1 250 ? 51.526  17.519  7.361   1.00 39.32 ? 250  LEU A C   1 
ATOM   1920 O O   . LEU A 1 250 ? 52.161  18.585  7.377   1.00 39.33 ? 250  LEU A O   1 
ATOM   1921 C CB  . LEU A 1 250 ? 50.663  16.598  5.168   1.00 39.20 ? 250  LEU A CB  1 
ATOM   1922 C CG  . LEU A 1 250 ? 50.391  17.987  4.551   1.00 40.31 ? 250  LEU A CG  1 
ATOM   1923 C CD1 . LEU A 1 250 ? 51.674  18.708  4.055   1.00 41.63 ? 250  LEU A CD1 1 
ATOM   1924 C CD2 . LEU A 1 250 ? 49.359  17.923  3.440   1.00 39.03 ? 250  LEU A CD2 1 
ATOM   1925 N N   . LEU A 1 251 ? 50.649  17.183  8.310   1.00 39.25 ? 251  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 251 ? 50.408  18.091  9.422   1.00 38.86 ? 251  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 251 ? 51.716  18.355  10.147  1.00 38.76 ? 251  LEU A C   1 
ATOM   1928 O O   . LEU A 1 251 ? 52.008  19.503  10.522  1.00 38.44 ? 251  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 251 ? 49.360  17.559  10.403  1.00 38.78 ? 251  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 251 ? 49.254  18.587  11.531  1.00 37.91 ? 251  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 251 ? 48.002  19.421  11.394  1.00 38.68 ? 251  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 251 ? 49.341  17.966  12.896  1.00 38.02 ? 251  LEU A CD2 1 
ATOM   1933 N N   . ALA A 1 252 ? 52.482  17.281  10.342  1.00 38.74 ? 252  ALA A N   1 
ATOM   1934 C CA  . ALA A 1 252 ? 53.804  17.341  10.966  1.00 39.04 ? 252  ALA A CA  1 
ATOM   1935 C C   . ALA A 1 252 ? 54.720  18.304  10.218  1.00 39.52 ? 252  ALA A C   1 
ATOM   1936 O O   . ALA A 1 252 ? 55.250  19.234  10.818  1.00 39.52 ? 252  ALA A O   1 
ATOM   1937 C CB  . ALA A 1 252 ? 54.418  15.956  11.052  1.00 38.76 ? 252  ALA A CB  1 
ATOM   1938 N N   . ARG A 1 253 ? 54.880  18.114  8.910   1.00 40.59 ? 253  ARG A N   1 
ATOM   1939 C CA  . ARG A 1 253 ? 55.617  19.096  8.105   1.00 42.06 ? 253  ARG A CA  1 
ATOM   1940 C C   . ARG A 1 253 ? 55.170  20.518  8.449   1.00 42.16 ? 253  ARG A C   1 
ATOM   1941 O O   . ARG A 1 253 ? 55.995  21.349  8.836   1.00 42.28 ? 253  ARG A O   1 
ATOM   1942 C CB  . ARG A 1 253 ? 55.462  18.845  6.608   1.00 42.31 ? 253  ARG A CB  1 
ATOM   1943 C CG  . ARG A 1 253 ? 56.317  17.730  6.056   1.00 46.31 ? 253  ARG A CG  1 
ATOM   1944 C CD  . ARG A 1 253 ? 56.826  18.076  4.636   1.00 52.76 ? 253  ARG A CD  1 
ATOM   1945 N NE  . ARG A 1 253 ? 55.870  17.718  3.576   1.00 57.48 ? 253  ARG A NE  1 
ATOM   1946 C CZ  . ARG A 1 253 ? 55.197  18.585  2.807   1.00 60.34 ? 253  ARG A CZ  1 
ATOM   1947 N NH1 . ARG A 1 253 ? 54.363  18.124  1.871   1.00 60.29 ? 253  ARG A NH1 1 
ATOM   1948 N NH2 . ARG A 1 253 ? 55.352  19.908  2.955   1.00 60.71 ? 253  ARG A NH2 1 
ATOM   1949 N N   . LEU A 1 254 ? 53.862  20.773  8.364   1.00 42.59 ? 254  LEU A N   1 
ATOM   1950 C CA  . LEU A 1 254 ? 53.320  22.129  8.537   1.00 43.22 ? 254  LEU A CA  1 
ATOM   1951 C C   . LEU A 1 254 ? 53.676  22.804  9.849   1.00 43.95 ? 254  LEU A C   1 
ATOM   1952 O O   . LEU A 1 254 ? 53.665  24.019  9.915   1.00 44.60 ? 254  LEU A O   1 
ATOM   1953 C CB  . LEU A 1 254 ? 51.804  22.176  8.322   1.00 42.55 ? 254  LEU A CB  1 
ATOM   1954 C CG  . LEU A 1 254 ? 51.307  21.867  6.908   1.00 42.95 ? 254  LEU A CG  1 
ATOM   1955 C CD1 . LEU A 1 254 ? 49.805  21.599  6.858   1.00 41.03 ? 254  LEU A CD1 1 
ATOM   1956 C CD2 . LEU A 1 254 ? 51.708  22.943  5.912   1.00 42.23 ? 254  LEU A CD2 1 
ATOM   1957 N N   . VAL A 1 255 ? 53.987  22.031  10.883  1.00 45.10 ? 255  VAL A N   1 
ATOM   1958 C CA  . VAL A 1 255 ? 54.314  22.602  12.195  1.00 45.89 ? 255  VAL A CA  1 
ATOM   1959 C C   . VAL A 1 255 ? 55.796  22.473  12.555  1.00 47.45 ? 255  VAL A C   1 
ATOM   1960 O O   . VAL A 1 255 ? 56.241  22.974  13.608  1.00 47.80 ? 255  VAL A O   1 
ATOM   1961 C CB  . VAL A 1 255 ? 53.446  22.010  13.339  1.00 45.63 ? 255  VAL A CB  1 
ATOM   1962 C CG1 . VAL A 1 255 ? 51.991  22.381  13.140  1.00 44.39 ? 255  VAL A CG1 1 
ATOM   1963 C CG2 . VAL A 1 255 ? 53.636  20.503  13.459  1.00 43.97 ? 255  VAL A CG2 1 
ATOM   1964 N N   . GLY A 1 256 ? 56.543  21.785  11.691  1.00 48.58 ? 256  GLY A N   1 
ATOM   1965 C CA  . GLY A 1 256 ? 58.000  21.724  11.790  1.00 49.93 ? 256  GLY A CA  1 
ATOM   1966 C C   . GLY A 1 256 ? 58.553  20.375  12.215  1.00 50.91 ? 256  GLY A C   1 
ATOM   1967 O O   . GLY A 1 256 ? 59.473  20.320  13.039  1.00 51.34 ? 256  GLY A O   1 
ATOM   1968 N N   . CYS A 1 257 ? 58.018  19.291  11.644  1.00 50.97 ? 257  CYS A N   1 
ATOM   1969 C CA  . CYS A 1 257 ? 58.360  17.949  12.093  1.00 51.16 ? 257  CYS A CA  1 
ATOM   1970 C C   . CYS A 1 257 ? 58.542  16.957  10.925  1.00 51.60 ? 257  CYS A C   1 
ATOM   1971 O O   . CYS A 1 257 ? 59.669  16.500  10.638  1.00 51.72 ? 257  CYS A O   1 
ATOM   1972 C CB  . CYS A 1 257 ? 57.314  17.445  13.111  1.00 50.81 ? 257  CYS A CB  1 
ATOM   1973 S SG  . CYS A 1 257 ? 57.091  18.460  14.645  1.00 50.29 ? 257  CYS A SG  1 
ATOM   1974 N N   . ASN A 1 265 ? 61.339  7.216   10.341  1.00 59.38 ? 265  ASN A N   1 
ATOM   1975 C CA  . ASN A 1 265 ? 61.112  6.857   11.743  1.00 59.43 ? 265  ASN A CA  1 
ATOM   1976 C C   . ASN A 1 265 ? 59.926  7.648   12.322  1.00 58.66 ? 265  ASN A C   1 
ATOM   1977 O O   . ASN A 1 265 ? 60.002  8.881   12.473  1.00 58.66 ? 265  ASN A O   1 
ATOM   1978 C CB  . ASN A 1 265 ? 62.393  7.110   12.570  1.00 60.05 ? 265  ASN A CB  1 
ATOM   1979 C CG  . ASN A 1 265 ? 62.513  6.203   13.810  1.00 61.17 ? 265  ASN A CG  1 
ATOM   1980 O OD1 . ASN A 1 265 ? 62.553  6.691   14.946  1.00 62.06 ? 265  ASN A OD1 1 
ATOM   1981 N ND2 . ASN A 1 265 ? 62.607  4.886   13.588  1.00 61.70 ? 265  ASN A ND2 1 
ATOM   1982 N N   . ASP A 1 266 ? 58.845  6.932   12.644  1.00 57.53 ? 266  ASP A N   1 
ATOM   1983 C CA  . ASP A 1 266 ? 57.633  7.529   13.221  1.00 56.19 ? 266  ASP A CA  1 
ATOM   1984 C C   . ASP A 1 266 ? 57.886  8.177   14.584  1.00 55.72 ? 266  ASP A C   1 
ATOM   1985 O O   . ASP A 1 266 ? 57.417  9.290   14.845  1.00 55.66 ? 266  ASP A O   1 
ATOM   1986 C CB  . ASP A 1 266 ? 56.512  6.489   13.331  1.00 55.79 ? 266  ASP A CB  1 
ATOM   1987 C CG  . ASP A 1 266 ? 55.896  6.135   11.978  1.00 55.05 ? 266  ASP A CG  1 
ATOM   1988 O OD1 . ASP A 1 266 ? 55.991  6.947   11.030  1.00 54.42 ? 266  ASP A OD1 1 
ATOM   1989 O OD2 . ASP A 1 266 ? 55.298  5.043   11.864  1.00 52.73 ? 266  ASP A OD2 1 
ATOM   1990 N N   . THR A 1 267 ? 58.636  7.480   15.436  1.00 54.98 ? 267  THR A N   1 
ATOM   1991 C CA  . THR A 1 267 ? 58.972  7.948   16.783  1.00 54.31 ? 267  THR A CA  1 
ATOM   1992 C C   . THR A 1 267 ? 59.425  9.404   16.821  1.00 54.09 ? 267  THR A C   1 
ATOM   1993 O O   . THR A 1 267 ? 58.915  10.197  17.600  1.00 54.05 ? 267  THR A O   1 
ATOM   1994 C CB  . THR A 1 267 ? 60.075  7.063   17.417  1.00 54.28 ? 267  THR A CB  1 
ATOM   1995 O OG1 . THR A 1 267 ? 59.696  5.687   17.318  1.00 53.93 ? 267  THR A OG1 1 
ATOM   1996 C CG2 . THR A 1 267 ? 60.298  7.415   18.893  1.00 54.07 ? 267  THR A CG2 1 
ATOM   1997 N N   . GLU A 1 268 ? 60.382  9.746   15.969  1.00 54.17 ? 268  GLU A N   1 
ATOM   1998 C CA  . GLU A 1 268 ? 61.023  11.063  15.979  1.00 54.51 ? 268  GLU A CA  1 
ATOM   1999 C C   . GLU A 1 268 ? 59.999  12.146  15.586  1.00 52.94 ? 268  GLU A C   1 
ATOM   2000 O O   . GLU A 1 268 ? 60.011  13.271  16.109  1.00 52.94 ? 268  GLU A O   1 
ATOM   2001 C CB  . GLU A 1 268 ? 62.246  11.042  15.027  1.00 54.50 ? 268  GLU A CB  1 
ATOM   2002 C CG  . GLU A 1 268 ? 63.284  12.161  15.218  1.00 56.50 ? 268  GLU A CG  1 
ATOM   2003 C CD  . GLU A 1 268 ? 64.423  12.112  14.168  1.00 57.45 ? 268  GLU A CD  1 
ATOM   2004 O OE1 . GLU A 1 268 ? 65.235  11.143  14.208  1.00 59.91 ? 268  GLU A OE1 1 
ATOM   2005 O OE2 . GLU A 1 268 ? 64.512  13.047  13.316  1.00 59.34 ? 268  GLU A OE2 1 
ATOM   2006 N N   . LEU A 1 269 ? 59.110  11.776  14.670  1.00 51.29 ? 269  LEU A N   1 
ATOM   2007 C CA  . LEU A 1 269 ? 58.077  12.658  14.175  1.00 49.65 ? 269  LEU A CA  1 
ATOM   2008 C C   . LEU A 1 269 ? 56.999  12.883  15.233  1.00 48.52 ? 269  LEU A C   1 
ATOM   2009 O O   . LEU A 1 269 ? 56.621  14.020  15.509  1.00 48.30 ? 269  LEU A O   1 
ATOM   2010 C CB  . LEU A 1 269 ? 57.489  12.083  12.887  1.00 49.78 ? 269  LEU A CB  1 
ATOM   2011 C CG  . LEU A 1 269 ? 56.379  12.878  12.199  1.00 49.93 ? 269  LEU A CG  1 
ATOM   2012 C CD1 . LEU A 1 269 ? 56.610  12.905  10.709  1.00 50.04 ? 269  LEU A CD1 1 
ATOM   2013 C CD2 . LEU A 1 269 ? 55.006  12.304  12.521  1.00 50.18 ? 269  LEU A CD2 1 
ATOM   2014 N N   . ILE A 1 270 ? 56.520  11.799  15.836  1.00 47.28 ? 270  ILE A N   1 
ATOM   2015 C CA  . ILE A 1 270 ? 55.499  11.906  16.866  1.00 45.93 ? 270  ILE A CA  1 
ATOM   2016 C C   . ILE A 1 270 ? 56.053  12.621  18.079  1.00 45.48 ? 270  ILE A C   1 
ATOM   2017 O O   . ILE A 1 270 ? 55.363  13.432  18.688  1.00 45.31 ? 270  ILE A O   1 
ATOM   2018 C CB  . ILE A 1 270 ? 54.944  10.543  17.251  1.00 45.70 ? 270  ILE A CB  1 
ATOM   2019 C CG1 . ILE A 1 270 ? 54.282  9.921   16.033  1.00 45.72 ? 270  ILE A CG1 1 
ATOM   2020 C CG2 . ILE A 1 270 ? 53.935  10.679  18.374  1.00 44.38 ? 270  ILE A CG2 1 
ATOM   2021 C CD1 . ILE A 1 270 ? 54.323  8.419   16.019  1.00 46.42 ? 270  ILE A CD1 1 
ATOM   2022 N N   . ALA A 1 271 ? 57.310  12.340  18.406  1.00 44.88 ? 271  ALA A N   1 
ATOM   2023 C CA  . ALA A 1 271 ? 57.956  12.987  19.524  1.00 44.82 ? 271  ALA A CA  1 
ATOM   2024 C C   . ALA A 1 271 ? 57.995  14.490  19.306  1.00 44.85 ? 271  ALA A C   1 
ATOM   2025 O O   . ALA A 1 271 ? 57.823  15.262  20.248  1.00 45.10 ? 271  ALA A O   1 
ATOM   2026 C CB  . ALA A 1 271 ? 59.355  12.437  19.720  1.00 44.73 ? 271  ALA A CB  1 
ATOM   2027 N N   . CYS A 1 272 ? 58.220  14.895  18.059  1.00 45.22 ? 272  CYS A N   1 
ATOM   2028 C CA  . CYS A 1 272 ? 58.253  16.307  17.692  1.00 44.82 ? 272  CYS A CA  1 
ATOM   2029 C C   . CYS A 1 272 ? 56.870  16.936  17.801  1.00 43.84 ? 272  CYS A C   1 
ATOM   2030 O O   . CYS A 1 272 ? 56.723  18.038  18.350  1.00 43.87 ? 272  CYS A O   1 
ATOM   2031 C CB  . CYS A 1 272 ? 58.788  16.479  16.272  1.00 45.58 ? 272  CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 272 ? 58.834  18.201  15.736  1.00 47.14 ? 272  CYS A SG  1 
ATOM   2033 N N   . LEU A 1 273 ? 55.864  16.235  17.280  1.00 42.53 ? 273  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 273 ? 54.467  16.664  17.418  1.00 41.59 ? 273  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 273 ? 54.079  16.870  18.873  1.00 41.22 ? 273  LEU A C   1 
ATOM   2036 O O   . LEU A 1 273 ? 53.369  17.832  19.201  1.00 41.37 ? 273  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 273 ? 53.509  15.680  16.744  1.00 41.35 ? 273  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 273 ? 53.494  15.724  15.216  1.00 40.84 ? 273  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 273 ? 52.702  14.572  14.618  1.00 40.70 ? 273  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 273 ? 52.951  17.048  14.726  1.00 41.09 ? 273  LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 274 ? 54.568  15.992  19.751  1.00 40.40 ? 274  ARG A N   1 
ATOM   2042 C CA  . ARG A 1 274 ? 54.272  16.109  21.176  1.00 39.81 ? 274  ARG A CA  1 
ATOM   2043 C C   . ARG A 1 274 ? 54.917  17.334  21.827  1.00 39.62 ? 274  ARG A C   1 
ATOM   2044 O O   . ARG A 1 274 ? 54.510  17.754  22.913  1.00 39.61 ? 274  ARG A O   1 
ATOM   2045 C CB  . ARG A 1 274 ? 54.624  14.825  21.923  1.00 39.48 ? 274  ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 274 ? 53.812  13.603  21.465  1.00 40.38 ? 274  ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 274 ? 53.968  12.433  22.417  1.00 41.94 ? 274  ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 274 ? 55.374  12.220  22.732  1.00 44.35 ? 274  ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 274 ? 56.122  11.245  22.223  1.00 45.97 ? 274  ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 274 ? 55.576  10.364  21.384  1.00 45.47 ? 274  ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 274 ? 57.415  11.150  22.560  1.00 44.76 ? 274  ARG A NH2 1 
ATOM   2052 N N   . THR A 1 275 ? 55.903  17.928  21.167  1.00 39.41 ? 275  THR A N   1 
ATOM   2053 C CA  . THR A 1 275 ? 56.539  19.120  21.727  1.00 39.78 ? 275  THR A CA  1 
ATOM   2054 C C   . THR A 1 275 ? 55.798  20.371  21.269  1.00 39.59 ? 275  THR A C   1 
ATOM   2055 O O   . THR A 1 275 ? 56.076  21.457  21.744  1.00 39.71 ? 275  THR A O   1 
ATOM   2056 C CB  . THR A 1 275 ? 58.034  19.275  21.307  1.00 39.95 ? 275  THR A CB  1 
ATOM   2057 O OG1 . THR A 1 275 ? 58.102  19.623  19.918  1.00 40.71 ? 275  THR A OG1 1 
ATOM   2058 C CG2 . THR A 1 275 ? 58.840  18.007  21.561  1.00 39.83 ? 275  THR A CG2 1 
ATOM   2059 N N   . ARG A 1 276 ? 54.877  20.218  20.324  1.00 39.78 ? 276  ARG A N   1 
ATOM   2060 C CA  . ARG A 1 276 ? 54.160  21.358  19.774  1.00 39.71 ? 276  ARG A CA  1 
ATOM   2061 C C   . ARG A 1 276 ? 53.037  21.762  20.687  1.00 39.03 ? 276  ARG A C   1 
ATOM   2062 O O   . ARG A 1 276 ? 52.383  20.913  21.282  1.00 39.12 ? 276  ARG A O   1 
ATOM   2063 C CB  . ARG A 1 276 ? 53.621  21.044  18.383  1.00 40.04 ? 276  ARG A CB  1 
ATOM   2064 C CG  . ARG A 1 276 ? 54.705  20.850  17.336  1.00 42.64 ? 276  ARG A CG  1 
ATOM   2065 C CD  . ARG A 1 276 ? 55.596  22.095  17.147  1.00 47.32 ? 276  ARG A CD  1 
ATOM   2066 N NE  . ARG A 1 276 ? 56.717  21.774  16.258  1.00 52.88 ? 276  ARG A NE  1 
ATOM   2067 C CZ  . ARG A 1 276 ? 57.990  21.613  16.643  1.00 54.83 ? 276  ARG A CZ  1 
ATOM   2068 N NH1 . ARG A 1 276 ? 58.352  21.770  17.919  1.00 54.36 ? 276  ARG A NH1 1 
ATOM   2069 N NH2 . ARG A 1 276 ? 58.915  21.307  15.734  1.00 54.20 ? 276  ARG A NH2 1 
ATOM   2070 N N   . PRO A 1 277 ? 52.813  23.074  20.824  1.00 38.66 ? 277  PRO A N   1 
ATOM   2071 C CA  . PRO A 1 277 ? 51.669  23.515  21.623  1.00 37.91 ? 277  PRO A CA  1 
ATOM   2072 C C   . PRO A 1 277 ? 50.390  23.023  20.967  1.00 37.55 ? 277  PRO A C   1 
ATOM   2073 O O   . PRO A 1 277 ? 50.316  22.977  19.740  1.00 37.30 ? 277  PRO A O   1 
ATOM   2074 C CB  . PRO A 1 277 ? 51.732  25.045  21.532  1.00 37.85 ? 277  PRO A CB  1 
ATOM   2075 C CG  . PRO A 1 277 ? 53.093  25.370  21.069  1.00 38.33 ? 277  PRO A CG  1 
ATOM   2076 C CD  . PRO A 1 277 ? 53.567  24.197  20.245  1.00 38.10 ? 277  PRO A CD  1 
ATOM   2077 N N   . ALA A 1 278 ? 49.393  22.661  21.771  1.00 37.26 ? 278  ALA A N   1 
ATOM   2078 C CA  . ALA A 1 278 ? 48.103  22.199  21.247  1.00 36.70 ? 278  ALA A CA  1 
ATOM   2079 C C   . ALA A 1 278 ? 47.537  23.103  20.148  1.00 36.31 ? 278  ALA A C   1 
ATOM   2080 O O   . ALA A 1 278 ? 47.013  22.619  19.140  1.00 35.97 ? 278  ALA A O   1 
ATOM   2081 C CB  . ALA A 1 278 ? 47.089  22.031  22.389  1.00 36.55 ? 278  ALA A CB  1 
ATOM   2082 N N   . GLN A 1 279 ? 47.664  24.416  20.349  1.00 36.72 ? 279  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 279 ? 47.060  25.416  19.466  1.00 36.39 ? 279  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 279 ? 47.698  25.459  18.089  1.00 37.30 ? 279  GLN A C   1 
ATOM   2085 O O   . GLN A 1 279 ? 47.022  25.786  17.106  1.00 38.10 ? 279  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 279 ? 47.092  26.793  20.111  1.00 36.06 ? 279  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 279 ? 46.204  27.817  19.416  1.00 34.57 ? 279  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 279 ? 44.725  27.407  19.357  1.00 32.02 ? 279  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 279 ? 44.085  27.120  20.384  1.00 29.50 ? 279  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 279 ? 44.186  27.380  18.148  1.00 27.89 ? 279  GLN A NE2 1 
ATOM   2091 N N   . ASP A 1 280 ? 48.986  25.134  18.012  1.00 37.87 ? 280  ASP A N   1 
ATOM   2092 C CA  . ASP A 1 280 ? 49.668  24.963  16.734  1.00 38.71 ? 280  ASP A CA  1 
ATOM   2093 C C   . ASP A 1 280 ? 49.022  23.875  15.900  1.00 38.09 ? 280  ASP A C   1 
ATOM   2094 O O   . ASP A 1 280 ? 48.926  24.006  14.682  1.00 38.13 ? 280  ASP A O   1 
ATOM   2095 C CB  . ASP A 1 280 ? 51.123  24.545  16.943  1.00 39.54 ? 280  ASP A CB  1 
ATOM   2096 C CG  . ASP A 1 280 ? 52.074  25.712  17.038  1.00 43.02 ? 280  ASP A CG  1 
ATOM   2097 O OD1 . ASP A 1 280 ? 51.665  26.817  17.489  1.00 46.21 ? 280  ASP A OD1 1 
ATOM   2098 O OD2 . ASP A 1 280 ? 53.257  25.491  16.685  1.00 46.07 ? 280  ASP A OD2 1 
ATOM   2099 N N   . LEU A 1 281 ? 48.623  22.784  16.545  1.00 37.96 ? 281  LEU A N   1 
ATOM   2100 C CA  . LEU A 1 281 ? 48.089  21.641  15.811  1.00 38.17 ? 281  LEU A CA  1 
ATOM   2101 C C   . LEU A 1 281 ? 46.721  22.033  15.272  1.00 38.53 ? 281  LEU A C   1 
ATOM   2102 O O   . LEU A 1 281 ? 46.416  21.807  14.108  1.00 38.45 ? 281  LEU A O   1 
ATOM   2103 C CB  . LEU A 1 281 ? 48.034  20.377  16.681  1.00 37.83 ? 281  LEU A CB  1 
ATOM   2104 C CG  . LEU A 1 281 ? 49.309  19.901  17.400  1.00 37.70 ? 281  LEU A CG  1 
ATOM   2105 C CD1 . LEU A 1 281 ? 49.062  18.597  18.123  1.00 37.67 ? 281  LEU A CD1 1 
ATOM   2106 C CD2 . LEU A 1 281 ? 50.507  19.735  16.467  1.00 38.14 ? 281  LEU A CD2 1 
ATOM   2107 N N   . VAL A 1 282 ? 45.929  22.697  16.109  1.00 39.32 ? 282  VAL A N   1 
ATOM   2108 C CA  . VAL A 1 282 ? 44.618  23.160  15.688  1.00 39.87 ? 282  VAL A CA  1 
ATOM   2109 C C   . VAL A 1 282 ? 44.734  24.144  14.517  1.00 40.64 ? 282  VAL A C   1 
ATOM   2110 O O   . VAL A 1 282 ? 43.942  24.064  13.564  1.00 40.26 ? 282  VAL A O   1 
ATOM   2111 C CB  . VAL A 1 282 ? 43.794  23.740  16.870  1.00 39.75 ? 282  VAL A CB  1 
ATOM   2112 C CG1 . VAL A 1 282 ? 42.565  24.460  16.358  1.00 38.40 ? 282  VAL A CG1 1 
ATOM   2113 C CG2 . VAL A 1 282 ? 43.374  22.614  17.803  1.00 39.47 ? 282  VAL A CG2 1 
ATOM   2114 N N   . ASP A 1 283 ? 45.725  25.045  14.590  1.00 41.20 ? 283  ASP A N   1 
ATOM   2115 C CA  . ASP A 1 283 ? 45.977  26.041  13.537  1.00 41.84 ? 283  ASP A CA  1 
ATOM   2116 C C   . ASP A 1 283 ? 46.235  25.434  12.162  1.00 42.09 ? 283  ASP A C   1 
ATOM   2117 O O   . ASP A 1 283 ? 46.012  26.098  11.149  1.00 42.65 ? 283  ASP A O   1 
ATOM   2118 C CB  . ASP A 1 283 ? 47.139  26.976  13.902  1.00 41.92 ? 283  ASP A CB  1 
ATOM   2119 C CG  . ASP A 1 283 ? 46.758  28.023  14.958  1.00 43.61 ? 283  ASP A CG  1 
ATOM   2120 O OD1 . ASP A 1 283 ? 45.556  28.166  15.283  1.00 44.41 ? 283  ASP A OD1 1 
ATOM   2121 O OD2 . ASP A 1 283 ? 47.679  28.696  15.483  1.00 45.28 ? 283  ASP A OD2 1 
ATOM   2122 N N   . HIS A 1 284 ? 46.695  24.186  12.112  1.00 41.93 ? 284  HIS A N   1 
ATOM   2123 C CA  . HIS A 1 284 ? 46.996  23.572  10.821  1.00 42.19 ? 284  HIS A CA  1 
ATOM   2124 C C   . HIS A 1 284 ? 46.172  22.359  10.481  1.00 42.19 ? 284  HIS A C   1 
ATOM   2125 O O   . HIS A 1 284 ? 46.374  21.762  9.415   1.00 41.56 ? 284  HIS A O   1 
ATOM   2126 C CB  . HIS A 1 284 ? 48.482  23.233  10.701  1.00 42.35 ? 284  HIS A CB  1 
ATOM   2127 C CG  . HIS A 1 284 ? 49.362  24.428  10.823  1.00 43.10 ? 284  HIS A CG  1 
ATOM   2128 N ND1 . HIS A 1 284 ? 49.887  24.840  12.030  1.00 43.68 ? 284  HIS A ND1 1 
ATOM   2129 C CD2 . HIS A 1 284 ? 49.759  25.337  9.903   1.00 43.61 ? 284  HIS A CD2 1 
ATOM   2130 C CE1 . HIS A 1 284 ? 50.591  25.941  11.843  1.00 45.01 ? 284  HIS A CE1 1 
ATOM   2131 N NE2 . HIS A 1 284 ? 50.525  26.266  10.561  1.00 45.42 ? 284  HIS A NE2 1 
ATOM   2132 N N   . GLU A 1 285 ? 45.246  21.985  11.361  1.00 42.34 ? 285  GLU A N   1 
ATOM   2133 C CA  . GLU A 1 285 ? 44.486  20.766  11.107  1.00 42.89 ? 285  GLU A CA  1 
ATOM   2134 C C   . GLU A 1 285 ? 43.651  20.802  9.818   1.00 42.94 ? 285  GLU A C   1 
ATOM   2135 O O   . GLU A 1 285 ? 43.443  19.770  9.205   1.00 43.21 ? 285  GLU A O   1 
ATOM   2136 C CB  . GLU A 1 285 ? 43.701  20.287  12.328  1.00 42.75 ? 285  GLU A CB  1 
ATOM   2137 C CG  . GLU A 1 285 ? 42.500  21.097  12.721  1.00 44.23 ? 285  GLU A CG  1 
ATOM   2138 C CD  . GLU A 1 285 ? 41.649  20.362  13.744  1.00 45.94 ? 285  GLU A CD  1 
ATOM   2139 O OE1 . GLU A 1 285 ? 41.218  20.981  14.736  1.00 48.16 ? 285  GLU A OE1 1 
ATOM   2140 O OE2 . GLU A 1 285 ? 41.401  19.153  13.560  1.00 47.37 ? 285  GLU A OE2 1 
ATOM   2141 N N   . TRP A 1 286 ? 43.241  21.985  9.377   1.00 43.12 ? 286  TRP A N   1 
ATOM   2142 C CA  . TRP A 1 286 ? 42.451  22.111  8.146   1.00 43.46 ? 286  TRP A CA  1 
ATOM   2143 C C   . TRP A 1 286 ? 43.271  22.226  6.874   1.00 44.33 ? 286  TRP A C   1 
ATOM   2144 O O   . TRP A 1 286 ? 42.719  22.232  5.776   1.00 44.69 ? 286  TRP A O   1 
ATOM   2145 C CB  . TRP A 1 286 ? 41.477  23.277  8.261   1.00 43.05 ? 286  TRP A CB  1 
ATOM   2146 C CG  . TRP A 1 286 ? 40.487  22.987  9.319   1.00 42.38 ? 286  TRP A CG  1 
ATOM   2147 C CD1 . TRP A 1 286 ? 40.483  23.465  10.590  1.00 41.88 ? 286  TRP A CD1 1 
ATOM   2148 C CD2 . TRP A 1 286 ? 39.403  22.064  9.228   1.00 41.08 ? 286  TRP A CD2 1 
ATOM   2149 N NE1 . TRP A 1 286 ? 39.435  22.926  11.291  1.00 42.07 ? 286  TRP A NE1 1 
ATOM   2150 C CE2 . TRP A 1 286 ? 38.754  22.063  10.474  1.00 41.32 ? 286  TRP A CE2 1 
ATOM   2151 C CE3 . TRP A 1 286 ? 38.907  21.248  8.202   1.00 41.25 ? 286  TRP A CE3 1 
ATOM   2152 C CZ2 . TRP A 1 286 ? 37.629  21.285  10.729  1.00 42.76 ? 286  TRP A CZ2 1 
ATOM   2153 C CZ3 . TRP A 1 286 ? 37.790  20.475  8.451   1.00 42.76 ? 286  TRP A CZ3 1 
ATOM   2154 C CH2 . TRP A 1 286 ? 37.161  20.498  9.710   1.00 43.05 ? 286  TRP A CH2 1 
ATOM   2155 N N   . HIS A 1 287 ? 44.589  22.321  7.019   1.00 45.03 ? 287  HIS A N   1 
ATOM   2156 C CA  . HIS A 1 287 ? 45.460  22.489  5.875   1.00 45.31 ? 287  HIS A CA  1 
ATOM   2157 C C   . HIS A 1 287 ? 45.900  21.158  5.262   1.00 45.39 ? 287  HIS A C   1 
ATOM   2158 O O   . HIS A 1 287 ? 46.779  21.140  4.406   1.00 45.37 ? 287  HIS A O   1 
ATOM   2159 C CB  . HIS A 1 287 ? 46.699  23.281  6.268   1.00 45.78 ? 287  HIS A CB  1 
ATOM   2160 C CG  . HIS A 1 287 ? 46.417  24.651  6.791   1.00 46.33 ? 287  HIS A CG  1 
ATOM   2161 N ND1 . HIS A 1 287 ? 45.550  25.521  6.173   1.00 48.54 ? 287  HIS A ND1 1 
ATOM   2162 C CD2 . HIS A 1 287 ? 46.939  25.321  7.845   1.00 48.02 ? 287  HIS A CD2 1 
ATOM   2163 C CE1 . HIS A 1 287 ? 45.516  26.657  6.849   1.00 50.25 ? 287  HIS A CE1 1 
ATOM   2164 N NE2 . HIS A 1 287 ? 46.355  26.562  7.867   1.00 48.92 ? 287  HIS A NE2 1 
ATOM   2165 N N   . VAL A 1 288 ? 45.295  20.050  5.676   1.00 45.40 ? 288  VAL A N   1 
ATOM   2166 C CA  . VAL A 1 288 ? 45.816  18.745  5.279   1.00 45.80 ? 288  VAL A CA  1 
ATOM   2167 C C   . VAL A 1 288 ? 44.875  17.915  4.405   1.00 46.63 ? 288  VAL A C   1 
ATOM   2168 O O   . VAL A 1 288 ? 45.212  16.782  4.039   1.00 46.78 ? 288  VAL A O   1 
ATOM   2169 C CB  . VAL A 1 288 ? 46.320  17.906  6.507   1.00 45.64 ? 288  VAL A CB  1 
ATOM   2170 C CG1 . VAL A 1 288 ? 47.341  18.689  7.325   1.00 44.53 ? 288  VAL A CG1 1 
ATOM   2171 C CG2 . VAL A 1 288 ? 45.163  17.449  7.386   1.00 45.55 ? 288  VAL A CG2 1 
ATOM   2172 N N   . LEU A 1 289 ? 43.714  18.472  4.062   1.00 47.51 ? 289  LEU A N   1 
ATOM   2173 C CA  . LEU A 1 289 ? 42.707  17.750  3.272   1.00 48.56 ? 289  LEU A CA  1 
ATOM   2174 C C   . LEU A 1 289 ? 43.079  17.757  1.804   1.00 49.52 ? 289  LEU A C   1 
ATOM   2175 O O   . LEU A 1 289 ? 43.506  18.796  1.287   1.00 49.52 ? 289  LEU A O   1 
ATOM   2176 C CB  . LEU A 1 289 ? 41.308  18.358  3.454   1.00 48.70 ? 289  LEU A CB  1 
ATOM   2177 C CG  . LEU A 1 289 ? 40.569  18.093  4.776   1.00 49.04 ? 289  LEU A CG  1 
ATOM   2178 C CD1 . LEU A 1 289 ? 39.396  19.069  4.944   1.00 49.40 ? 289  LEU A CD1 1 
ATOM   2179 C CD2 . LEU A 1 289 ? 40.108  16.632  4.887   1.00 48.00 ? 289  LEU A CD2 1 
ATOM   2180 N N   . PRO A 1 290 ? 42.896  16.606  1.118   1.00 50.51 ? 290  PRO A N   1 
ATOM   2181 C CA  . PRO A 1 290 ? 43.375  16.432  -0.262  1.00 51.30 ? 290  PRO A CA  1 
ATOM   2182 C C   . PRO A 1 290 ? 42.695  17.346  -1.279  1.00 52.32 ? 290  PRO A C   1 
ATOM   2183 O O   . PRO A 1 290 ? 43.344  17.779  -2.242  1.00 52.82 ? 290  PRO A O   1 
ATOM   2184 C CB  . PRO A 1 290 ? 43.072  14.958  -0.566  1.00 51.10 ? 290  PRO A CB  1 
ATOM   2185 C CG  . PRO A 1 290 ? 42.029  14.559  0.395   1.00 50.70 ? 290  PRO A CG  1 
ATOM   2186 C CD  . PRO A 1 290 ? 42.212  15.399  1.619   1.00 50.53 ? 290  PRO A CD  1 
ATOM   2187 N N   . GLN A 1 291 ? 41.407  17.627  -1.073  1.00 53.05 ? 291  GLN A N   1 
ATOM   2188 C CA  . GLN A 1 291 ? 40.650  18.498  -1.976  1.00 53.85 ? 291  GLN A CA  1 
ATOM   2189 C C   . GLN A 1 291 ? 39.869  19.561  -1.201  1.00 54.12 ? 291  GLN A C   1 
ATOM   2190 O O   . GLN A 1 291 ? 39.662  19.446  0.019   1.00 54.55 ? 291  GLN A O   1 
ATOM   2191 C CB  . GLN A 1 291 ? 39.683  17.699  -2.869  1.00 53.75 ? 291  GLN A CB  1 
ATOM   2192 C CG  . GLN A 1 291 ? 40.285  16.512  -3.628  1.00 55.09 ? 291  GLN A CG  1 
ATOM   2193 C CD  . GLN A 1 291 ? 40.251  15.217  -2.810  1.00 57.47 ? 291  GLN A CD  1 
ATOM   2194 O OE1 . GLN A 1 291 ? 39.489  15.097  -1.837  1.00 59.96 ? 291  GLN A OE1 1 
ATOM   2195 N NE2 . GLN A 1 291 ? 41.076  14.247  -3.197  1.00 55.66 ? 291  GLN A NE2 1 
ATOM   2196 N N   . GLU A 1 292 ? 39.463  20.604  -1.924  1.00 53.91 ? 292  GLU A N   1 
ATOM   2197 C CA  . GLU A 1 292 ? 38.506  21.580  -1.436  1.00 53.90 ? 292  GLU A CA  1 
ATOM   2198 C C   . GLU A 1 292 ? 37.214  20.813  -1.145  1.00 52.60 ? 292  GLU A C   1 
ATOM   2199 O O   . GLU A 1 292 ? 36.642  20.161  -2.028  1.00 52.21 ? 292  GLU A O   1 
ATOM   2200 C CB  . GLU A 1 292 ? 38.285  22.656  -2.501  1.00 53.89 ? 292  GLU A CB  1 
ATOM   2201 C CG  . GLU A 1 292 ? 37.664  23.951  -1.985  1.00 55.64 ? 292  GLU A CG  1 
ATOM   2202 C CD  . GLU A 1 292 ? 37.325  24.934  -3.109  1.00 56.13 ? 292  GLU A CD  1 
ATOM   2203 O OE1 . GLU A 1 292 ? 37.754  24.707  -4.267  1.00 58.36 ? 292  GLU A OE1 1 
ATOM   2204 O OE2 . GLU A 1 292 ? 36.623  25.938  -2.833  1.00 59.45 ? 292  GLU A OE2 1 
ATOM   2205 N N   . SER A 1 293 ? 36.778  20.857  0.105   1.00 51.63 ? 293  SER A N   1 
ATOM   2206 C CA  . SER A 1 293 ? 35.675  19.998  0.523   1.00 50.84 ? 293  SER A CA  1 
ATOM   2207 C C   . SER A 1 293 ? 34.817  20.588  1.629   1.00 49.75 ? 293  SER A C   1 
ATOM   2208 O O   . SER A 1 293 ? 35.256  21.449  2.372   1.00 49.72 ? 293  SER A O   1 
ATOM   2209 C CB  . SER A 1 293 ? 36.213  18.641  0.977   1.00 50.75 ? 293  SER A CB  1 
ATOM   2210 O OG  . SER A 1 293 ? 37.003  18.798  2.141   1.00 52.17 ? 293  SER A OG  1 
ATOM   2211 N N   . ILE A 1 294 ? 33.576  20.118  1.687   1.00 48.84 ? 294  ILE A N   1 
ATOM   2212 C CA  . ILE A 1 294 ? 32.707  20.274  2.840   1.00 47.36 ? 294  ILE A CA  1 
ATOM   2213 C C   . ILE A 1 294 ? 32.336  18.862  3.293   1.00 46.70 ? 294  ILE A C   1 
ATOM   2214 O O   . ILE A 1 294 ? 32.433  17.912  2.512   1.00 46.67 ? 294  ILE A O   1 
ATOM   2215 C CB  . ILE A 1 294 ? 31.450  21.110  2.511   1.00 47.43 ? 294  ILE A CB  1 
ATOM   2216 C CG1 . ILE A 1 294 ? 30.770  20.600  1.237   1.00 47.29 ? 294  ILE A CG1 1 
ATOM   2217 C CG2 . ILE A 1 294 ? 31.822  22.599  2.392   1.00 47.20 ? 294  ILE A CG2 1 
ATOM   2218 C CD1 . ILE A 1 294 ? 29.321  20.974  1.132   1.00 46.41 ? 294  ILE A CD1 1 
ATOM   2219 N N   . PHE A 1 295 ? 31.946  18.724  4.557   1.00 45.76 ? 295  PHE A N   1 
ATOM   2220 C CA  . PHE A 1 295 ? 31.671  17.419  5.166   1.00 44.77 ? 295  PHE A CA  1 
ATOM   2221 C C   . PHE A 1 295 ? 32.865  16.471  5.033   1.00 44.07 ? 295  PHE A C   1 
ATOM   2222 O O   . PHE A 1 295 ? 32.704  15.272  4.862   1.00 43.74 ? 295  PHE A O   1 
ATOM   2223 C CB  . PHE A 1 295 ? 30.405  16.783  4.590   1.00 44.82 ? 295  PHE A CB  1 
ATOM   2224 C CG  . PHE A 1 295 ? 29.517  16.136  5.635   1.00 46.53 ? 295  PHE A CG  1 
ATOM   2225 C CD1 . PHE A 1 295 ? 30.058  15.316  6.637   1.00 46.70 ? 295  PHE A CD1 1 
ATOM   2226 C CD2 . PHE A 1 295 ? 28.138  16.341  5.619   1.00 46.14 ? 295  PHE A CD2 1 
ATOM   2227 C CE1 . PHE A 1 295 ? 29.248  14.738  7.608   1.00 45.56 ? 295  PHE A CE1 1 
ATOM   2228 C CE2 . PHE A 1 295 ? 27.323  15.751  6.590   1.00 46.29 ? 295  PHE A CE2 1 
ATOM   2229 C CZ  . PHE A 1 295 ? 27.883  14.956  7.591   1.00 45.10 ? 295  PHE A CZ  1 
ATOM   2230 N N   . ARG A 1 296 ? 34.066  17.034  5.065   1.00 43.52 ? 296  ARG A N   1 
ATOM   2231 C CA  . ARG A 1 296 ? 35.276  16.250  5.232   1.00 42.73 ? 296  ARG A CA  1 
ATOM   2232 C C   . ARG A 1 296 ? 36.055  16.838  6.388   1.00 42.62 ? 296  ARG A C   1 
ATOM   2233 O O   . ARG A 1 296 ? 36.080  18.068  6.603   1.00 42.72 ? 296  ARG A O   1 
ATOM   2234 C CB  . ARG A 1 296 ? 36.143  16.240  3.980   1.00 42.48 ? 296  ARG A CB  1 
ATOM   2235 C CG  . ARG A 1 296 ? 35.521  15.542  2.784   1.00 42.48 ? 296  ARG A CG  1 
ATOM   2236 C CD  . ARG A 1 296 ? 35.261  14.056  2.999   1.00 42.24 ? 296  ARG A CD  1 
ATOM   2237 N NE  . ARG A 1 296 ? 34.625  13.491  1.808   1.00 43.48 ? 296  ARG A NE  1 
ATOM   2238 C CZ  . ARG A 1 296 ? 33.310  13.413  1.601   1.00 41.81 ? 296  ARG A CZ  1 
ATOM   2239 N NH1 . ARG A 1 296 ? 32.443  13.841  2.516   1.00 40.99 ? 296  ARG A NH1 1 
ATOM   2240 N NH2 . ARG A 1 296 ? 32.863  12.898  0.470   1.00 40.86 ? 296  ARG A NH2 1 
ATOM   2241 N N   . PHE A 1 297 ? 36.680  15.944  7.140   1.00 41.60 ? 297  PHE A N   1 
ATOM   2242 C CA  . PHE A 1 297 ? 37.404  16.328  8.324   1.00 40.56 ? 297  PHE A CA  1 
ATOM   2243 C C   . PHE A 1 297 ? 38.736  15.601  8.318   1.00 39.20 ? 297  PHE A C   1 
ATOM   2244 O O   . PHE A 1 297 ? 38.834  14.472  7.870   1.00 38.79 ? 297  PHE A O   1 
ATOM   2245 C CB  . PHE A 1 297 ? 36.557  16.007  9.552   1.00 41.20 ? 297  PHE A CB  1 
ATOM   2246 C CG  . PHE A 1 297 ? 35.066  16.222  9.331   1.00 42.31 ? 297  PHE A CG  1 
ATOM   2247 C CD1 . PHE A 1 297 ? 34.524  17.515  9.295   1.00 43.23 ? 297  PHE A CD1 1 
ATOM   2248 C CD2 . PHE A 1 297 ? 34.207  15.135  9.149   1.00 41.24 ? 297  PHE A CD2 1 
ATOM   2249 C CE1 . PHE A 1 297 ? 33.131  17.721  9.088   1.00 42.24 ? 297  PHE A CE1 1 
ATOM   2250 C CE2 . PHE A 1 297 ? 32.830  15.337  8.941   1.00 41.10 ? 297  PHE A CE2 1 
ATOM   2251 C CZ  . PHE A 1 297 ? 32.298  16.630  8.916   1.00 41.11 ? 297  PHE A CZ  1 
ATOM   2252 N N   . SER A 1 298 ? 39.762  16.279  8.804   1.00 38.10 ? 298  SER A N   1 
ATOM   2253 C CA  . SER A 1 298 ? 41.136  15.856  8.624   1.00 36.76 ? 298  SER A CA  1 
ATOM   2254 C C   . SER A 1 298 ? 41.526  14.591  9.375   1.00 35.34 ? 298  SER A C   1 
ATOM   2255 O O   . SER A 1 298 ? 42.163  13.680  8.825   1.00 34.55 ? 298  SER A O   1 
ATOM   2256 C CB  . SER A 1 298 ? 42.030  16.987  9.077   1.00 36.93 ? 298  SER A CB  1 
ATOM   2257 O OG  . SER A 1 298 ? 41.803  18.107  8.262   1.00 39.44 ? 298  SER A OG  1 
ATOM   2258 N N   . PHE A 1 299 ? 41.162  14.545  10.643  1.00 33.85 ? 299  PHE A N   1 
ATOM   2259 C CA  . PHE A 1 299 ? 41.602  13.458  11.475  1.00 32.89 ? 299  PHE A CA  1 
ATOM   2260 C C   . PHE A 1 299 ? 40.410  12.744  12.016  1.00 32.29 ? 299  PHE A C   1 
ATOM   2261 O O   . PHE A 1 299 ? 39.727  13.248  12.890  1.00 32.55 ? 299  PHE A O   1 
ATOM   2262 C CB  . PHE A 1 299 ? 42.551  13.984  12.534  1.00 32.64 ? 299  PHE A CB  1 
ATOM   2263 C CG  . PHE A 1 299 ? 43.817  14.470  11.949  1.00 32.74 ? 299  PHE A CG  1 
ATOM   2264 C CD1 . PHE A 1 299 ? 44.798  13.569  11.557  1.00 34.53 ? 299  PHE A CD1 1 
ATOM   2265 C CD2 . PHE A 1 299 ? 44.000  15.814  11.678  1.00 32.91 ? 299  PHE A CD2 1 
ATOM   2266 C CE1 . PHE A 1 299 ? 45.981  14.008  10.959  1.00 33.81 ? 299  PHE A CE1 1 
ATOM   2267 C CE2 . PHE A 1 299 ? 45.170  16.262  11.071  1.00 33.69 ? 299  PHE A CE2 1 
ATOM   2268 C CZ  . PHE A 1 299 ? 46.164  15.365  10.727  1.00 34.08 ? 299  PHE A CZ  1 
ATOM   2269 N N   . VAL A 1 300 ? 40.138  11.587  11.426  1.00 31.77 ? 300  VAL A N   1 
ATOM   2270 C CA  . VAL A 1 300 ? 38.942  10.813  11.726  1.00 31.72 ? 300  VAL A CA  1 
ATOM   2271 C C   . VAL A 1 300 ? 39.344  9.350   12.035  1.00 32.18 ? 300  VAL A C   1 
ATOM   2272 O O   . VAL A 1 300 ? 40.501  8.991   11.887  1.00 32.04 ? 300  VAL A O   1 
ATOM   2273 C CB  . VAL A 1 300 ? 37.888  10.934  10.570  1.00 31.04 ? 300  VAL A CB  1 
ATOM   2274 C CG1 . VAL A 1 300 ? 37.567  12.378  10.294  1.00 29.97 ? 300  VAL A CG1 1 
ATOM   2275 C CG2 . VAL A 1 300 ? 38.373  10.291  9.290   1.00 31.62 ? 300  VAL A CG2 1 
ATOM   2276 N N   . PRO A 1 301 ? 38.404  8.517   12.511  1.00 32.74 ? 301  PRO A N   1 
ATOM   2277 C CA  . PRO A 1 301 ? 38.744  7.113   12.665  1.00 32.88 ? 301  PRO A CA  1 
ATOM   2278 C C   . PRO A 1 301 ? 39.469  6.520   11.448  1.00 33.81 ? 301  PRO A C   1 
ATOM   2279 O O   . PRO A 1 301 ? 39.038  6.682   10.296  1.00 33.53 ? 301  PRO A O   1 
ATOM   2280 C CB  . PRO A 1 301 ? 37.388  6.452   12.872  1.00 32.51 ? 301  PRO A CB  1 
ATOM   2281 C CG  . PRO A 1 301 ? 36.606  7.479   13.609  1.00 32.59 ? 301  PRO A CG  1 
ATOM   2282 C CD  . PRO A 1 301 ? 37.042  8.805   13.011  1.00 32.70 ? 301  PRO A CD  1 
ATOM   2283 N N   . VAL A 1 302 ? 40.585  5.854   11.724  1.00 34.38 ? 302  VAL A N   1 
ATOM   2284 C CA  . VAL A 1 302 ? 41.353  5.186   10.692  1.00 35.13 ? 302  VAL A CA  1 
ATOM   2285 C C   . VAL A 1 302 ? 41.086  3.667   10.693  1.00 35.74 ? 302  VAL A C   1 
ATOM   2286 O O   . VAL A 1 302 ? 40.933  3.050   11.757  1.00 35.88 ? 302  VAL A O   1 
ATOM   2287 C CB  . VAL A 1 302 ? 42.867  5.506   10.822  1.00 34.84 ? 302  VAL A CB  1 
ATOM   2288 C CG1 . VAL A 1 302 ? 43.395  5.146   12.192  1.00 34.18 ? 302  VAL A CG1 1 
ATOM   2289 C CG2 . VAL A 1 302 ? 43.644  4.790   9.767   1.00 35.24 ? 302  VAL A CG2 1 
ATOM   2290 N N   . VAL A 1 303 ? 41.003  3.090   9.494   1.00 36.14 ? 303  VAL A N   1 
ATOM   2291 C CA  . VAL A 1 303 ? 40.858  1.647   9.313   1.00 36.67 ? 303  VAL A CA  1 
ATOM   2292 C C   . VAL A 1 303 ? 42.212  1.027   9.612   1.00 37.29 ? 303  VAL A C   1 
ATOM   2293 O O   . VAL A 1 303 ? 43.085  0.923   8.734   1.00 37.48 ? 303  VAL A O   1 
ATOM   2294 C CB  . VAL A 1 303 ? 40.398  1.313   7.892   1.00 36.25 ? 303  VAL A CB  1 
ATOM   2295 C CG1 . VAL A 1 303 ? 40.391  -0.174  7.665   1.00 37.05 ? 303  VAL A CG1 1 
ATOM   2296 C CG2 . VAL A 1 303 ? 39.015  1.868   7.657   1.00 36.38 ? 303  VAL A CG2 1 
ATOM   2297 N N   . ASP A 1 304 ? 42.388  0.646   10.871  1.00 37.94 ? 304  ASP A N   1 
ATOM   2298 C CA  . ASP A 1 304 ? 43.701  0.276   11.383  1.00 38.95 ? 304  ASP A CA  1 
ATOM   2299 C C   . ASP A 1 304 ? 43.967  -1.231  11.381  1.00 39.47 ? 304  ASP A C   1 
ATOM   2300 O O   . ASP A 1 304 ? 45.092  -1.658  11.639  1.00 39.51 ? 304  ASP A O   1 
ATOM   2301 C CB  . ASP A 1 304 ? 43.922  0.861   12.784  1.00 38.86 ? 304  ASP A CB  1 
ATOM   2302 C CG  . ASP A 1 304 ? 42.813  0.477   13.782  1.00 39.74 ? 304  ASP A CG  1 
ATOM   2303 O OD1 . ASP A 1 304 ? 41.722  0.022   13.369  1.00 39.70 ? 304  ASP A OD1 1 
ATOM   2304 O OD2 . ASP A 1 304 ? 43.041  0.658   14.999  1.00 40.60 ? 304  ASP A OD2 1 
ATOM   2305 N N   . GLY A 1 305 ? 42.946  -2.027  11.072  1.00 39.89 ? 305  GLY A N   1 
ATOM   2306 C CA  . GLY A 1 305 ? 43.046  -3.486  11.207  1.00 40.88 ? 305  GLY A CA  1 
ATOM   2307 C C   . GLY A 1 305 ? 43.093  -3.909  12.676  1.00 41.58 ? 305  GLY A C   1 
ATOM   2308 O O   . GLY A 1 305 ? 43.390  -5.069  12.979  1.00 42.29 ? 305  GLY A O   1 
ATOM   2309 N N   . ASP A 1 306 ? 42.807  -2.966  13.586  1.00 41.15 ? 306  ASP A N   1 
ATOM   2310 C CA  . ASP A 1 306 ? 42.729  -3.236  15.021  1.00 40.61 ? 306  ASP A CA  1 
ATOM   2311 C C   . ASP A 1 306 ? 41.341  -2.871  15.557  1.00 40.57 ? 306  ASP A C   1 
ATOM   2312 O O   . ASP A 1 306 ? 40.455  -3.744  15.619  1.00 41.13 ? 306  ASP A O   1 
ATOM   2313 C CB  . ASP A 1 306 ? 43.826  -2.491  15.795  1.00 40.47 ? 306  ASP A CB  1 
ATOM   2314 C CG  . ASP A 1 306 ? 43.816  -2.808  17.295  1.00 40.27 ? 306  ASP A CG  1 
ATOM   2315 O OD1 . ASP A 1 306 ? 43.085  -3.727  17.744  1.00 37.37 ? 306  ASP A OD1 1 
ATOM   2316 O OD2 . ASP A 1 306 ? 44.556  -2.130  18.030  1.00 41.00 ? 306  ASP A OD2 1 
ATOM   2317 N N   . PHE A 1 307 ? 41.152  -1.603  15.951  1.00 39.59 ? 307  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 307 ? 39.820  -1.097  16.300  1.00 38.60 ? 307  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 307 ? 38.855  -1.400  15.173  1.00 38.93 ? 307  PHE A C   1 
ATOM   2320 O O   . PHE A 1 307 ? 37.799  -1.939  15.404  1.00 39.73 ? 307  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 307 ? 39.819  0.410   16.588  1.00 37.64 ? 307  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 307 ? 38.624  0.862   17.379  1.00 36.09 ? 307  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 307 ? 37.349  0.851   16.816  1.00 33.18 ? 307  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 307 ? 38.765  1.261   18.702  1.00 34.58 ? 307  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 307 ? 36.247  1.228   17.548  1.00 32.68 ? 307  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 307 ? 37.648  1.657   19.453  1.00 34.48 ? 307  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 307 ? 36.393  1.638   18.879  1.00 33.33 ? 307  PHE A CZ  1 
ATOM   2328 N N   . LEU A 1 308 ? 39.230  -1.065  13.949  1.00 39.59 ? 308  LEU A N   1 
ATOM   2329 C CA  . LEU A 1 308 ? 38.431  -1.416  12.797  1.00 40.66 ? 308  LEU A CA  1 
ATOM   2330 C C   . LEU A 1 308 ? 39.163  -2.467  11.979  1.00 41.47 ? 308  LEU A C   1 
ATOM   2331 O O   . LEU A 1 308 ? 40.188  -2.172  11.365  1.00 41.75 ? 308  LEU A O   1 
ATOM   2332 C CB  . LEU A 1 308 ? 38.136  -0.176  11.962  1.00 40.60 ? 308  LEU A CB  1 
ATOM   2333 C CG  . LEU A 1 308 ? 37.125  0.777   12.585  1.00 40.47 ? 308  LEU A CG  1 
ATOM   2334 C CD1 . LEU A 1 308 ? 37.019  2.027   11.739  1.00 39.75 ? 308  LEU A CD1 1 
ATOM   2335 C CD2 . LEU A 1 308 ? 35.770  0.068   12.721  1.00 41.15 ? 308  LEU A CD2 1 
ATOM   2336 N N   . SER A 1 309 ? 38.651  -3.696  11.992  1.00 42.02 ? 309  SER A N   1 
ATOM   2337 C CA  . SER A 1 309 ? 39.387  -4.819  11.423  1.00 42.76 ? 309  SER A CA  1 
ATOM   2338 C C   . SER A 1 309 ? 39.372  -4.748  9.904   1.00 43.37 ? 309  SER A C   1 
ATOM   2339 O O   . SER A 1 309 ? 40.290  -5.222  9.237   1.00 43.75 ? 309  SER A O   1 
ATOM   2340 C CB  . SER A 1 309 ? 38.842  -6.158  11.934  1.00 42.61 ? 309  SER A CB  1 
ATOM   2341 O OG  . SER A 1 309 ? 37.557  -6.421  11.410  1.00 43.91 ? 309  SER A OG  1 
ATOM   2342 N N   . ASP A 1 310 ? 38.327  -4.132  9.366   1.00 43.88 ? 310  ASP A N   1 
ATOM   2343 C CA  . ASP A 1 310 ? 38.258  -3.804  7.948   1.00 43.89 ? 310  ASP A CA  1 
ATOM   2344 C C   . ASP A 1 310 ? 37.532  -2.460  7.786   1.00 43.87 ? 310  ASP A C   1 
ATOM   2345 O O   . ASP A 1 310 ? 37.194  -1.834  8.781   1.00 44.17 ? 310  ASP A O   1 
ATOM   2346 C CB  . ASP A 1 310 ? 37.521  -4.917  7.215   1.00 43.88 ? 310  ASP A CB  1 
ATOM   2347 C CG  . ASP A 1 310 ? 37.938  -5.038  5.770   1.00 44.45 ? 310  ASP A CG  1 
ATOM   2348 O OD1 . ASP A 1 310 ? 38.371  -4.026  5.157   1.00 45.04 ? 310  ASP A OD1 1 
ATOM   2349 O OD2 . ASP A 1 310 ? 37.822  -6.156  5.247   1.00 43.92 ? 310  ASP A OD2 1 
ATOM   2350 N N   . THR A 1 311 ? 37.284  -2.011  6.557   1.00 43.80 ? 311  THR A N   1 
ATOM   2351 C CA  . THR A 1 311 ? 36.470  -0.808  6.351   1.00 43.80 ? 311  THR A CA  1 
ATOM   2352 C C   . THR A 1 311 ? 35.075  -1.043  6.923   1.00 43.93 ? 311  THR A C   1 
ATOM   2353 O O   . THR A 1 311 ? 34.601  -2.171  6.915   1.00 44.47 ? 311  THR A O   1 
ATOM   2354 C CB  . THR A 1 311 ? 36.289  -0.453  4.858   1.00 43.65 ? 311  THR A CB  1 
ATOM   2355 O OG1 . THR A 1 311 ? 35.538  -1.487  4.211   1.00 44.12 ? 311  THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 311 ? 37.630  -0.245  4.153   1.00 42.88 ? 311  THR A CG2 1 
ATOM   2357 N N   . PRO A 1 312 ? 34.409  0.008   7.428   1.00 43.92 ? 312  PRO A N   1 
ATOM   2358 C CA  . PRO A 1 312 ? 33.027  -0.180  7.864   1.00 44.16 ? 312  PRO A CA  1 
ATOM   2359 C C   . PRO A 1 312 ? 32.114  -0.830  6.823   1.00 44.60 ? 312  PRO A C   1 
ATOM   2360 O O   . PRO A 1 312 ? 31.363  -1.737  7.158   1.00 44.18 ? 312  PRO A O   1 
ATOM   2361 C CB  . PRO A 1 312 ? 32.583  1.243   8.184   1.00 43.82 ? 312  PRO A CB  1 
ATOM   2362 C CG  . PRO A 1 312 ? 33.825  1.858   8.677   1.00 43.81 ? 312  PRO A CG  1 
ATOM   2363 C CD  . PRO A 1 312 ? 34.860  1.379   7.700   1.00 43.54 ? 312  PRO A CD  1 
ATOM   2364 N N   . GLU A 1 313 ? 32.183  -0.378  5.577   1.00 45.92 ? 313  GLU A N   1 
ATOM   2365 C CA  . GLU A 1 313 ? 31.436  -1.006  4.488   1.00 47.36 ? 313  GLU A CA  1 
ATOM   2366 C C   . GLU A 1 313 ? 31.612  -2.540  4.495   1.00 47.85 ? 313  GLU A C   1 
ATOM   2367 O O   . GLU A 1 313 ? 30.627  -3.277  4.559   1.00 48.09 ? 313  GLU A O   1 
ATOM   2368 C CB  . GLU A 1 313 ? 31.817  -0.391  3.131   1.00 47.72 ? 313  GLU A CB  1 
ATOM   2369 C CG  . GLU A 1 313 ? 31.216  1.032   2.870   1.00 50.27 ? 313  GLU A CG  1 
ATOM   2370 C CD  . GLU A 1 313 ? 32.034  2.218   3.477   1.00 52.72 ? 313  GLU A CD  1 
ATOM   2371 O OE1 . GLU A 1 313 ? 33.037  2.011   4.226   1.00 52.62 ? 313  GLU A OE1 1 
ATOM   2372 O OE2 . GLU A 1 313 ? 31.653  3.380   3.191   1.00 53.26 ? 313  GLU A OE2 1 
ATOM   2373 N N   . ALA A 1 314 ? 32.859  -3.012  4.480   1.00 48.03 ? 314  ALA A N   1 
ATOM   2374 C CA  . ALA A 1 314 ? 33.149  -4.435  4.527   1.00 48.25 ? 314  ALA A CA  1 
ATOM   2375 C C   . ALA A 1 314 ? 32.541  -5.121  5.751   1.00 48.98 ? 314  ALA A C   1 
ATOM   2376 O O   . ALA A 1 314 ? 31.969  -6.213  5.640   1.00 49.17 ? 314  ALA A O   1 
ATOM   2377 C CB  . ALA A 1 314 ? 34.635  -4.666  4.473   1.00 48.28 ? 314  ALA A CB  1 
ATOM   2378 N N   . LEU A 1 315 ? 32.652  -4.476  6.909   1.00 49.52 ? 315  LEU A N   1 
ATOM   2379 C CA  . LEU A 1 315 ? 32.110  -5.023  8.157   1.00 50.15 ? 315  LEU A CA  1 
ATOM   2380 C C   . LEU A 1 315 ? 30.576  -5.040  8.235   1.00 51.07 ? 315  LEU A C   1 
ATOM   2381 O O   . LEU A 1 315 ? 30.012  -5.971  8.791   1.00 51.74 ? 315  LEU A O   1 
ATOM   2382 C CB  . LEU A 1 315 ? 32.719  -4.325  9.380   1.00 49.76 ? 315  LEU A CB  1 
ATOM   2383 C CG  . LEU A 1 315 ? 34.242  -4.423  9.515   1.00 48.28 ? 315  LEU A CG  1 
ATOM   2384 C CD1 . LEU A 1 315 ? 34.716  -3.583  10.654  1.00 46.20 ? 315  LEU A CD1 1 
ATOM   2385 C CD2 . LEU A 1 315 ? 34.703  -5.859  9.699   1.00 47.08 ? 315  LEU A CD2 1 
ATOM   2386 N N   . ILE A 1 316 ? 29.896  -4.038  7.689   1.00 52.14 ? 316  ILE A N   1 
ATOM   2387 C CA  . ILE A 1 316 ? 28.426  -4.084  7.665   1.00 53.50 ? 316  ILE A CA  1 
ATOM   2388 C C   . ILE A 1 316 ? 27.898  -5.000  6.556   1.00 54.83 ? 316  ILE A C   1 
ATOM   2389 O O   . ILE A 1 316 ? 26.802  -5.530  6.673   1.00 54.95 ? 316  ILE A O   1 
ATOM   2390 C CB  . ILE A 1 316 ? 27.732  -2.684  7.570   1.00 53.13 ? 316  ILE A CB  1 
ATOM   2391 C CG1 . ILE A 1 316 ? 27.930  -2.052  6.192   1.00 52.78 ? 316  ILE A CG1 1 
ATOM   2392 C CG2 . ILE A 1 316 ? 28.167  -1.762  8.708   1.00 53.11 ? 316  ILE A CG2 1 
ATOM   2393 C CD1 . ILE A 1 316 ? 26.999  -0.918  5.908   1.00 53.94 ? 316  ILE A CD1 1 
ATOM   2394 N N   . ASN A 1 317 ? 28.674  -5.174  5.485   1.00 56.48 ? 317  ASN A N   1 
ATOM   2395 C CA  . ASN A 1 317 ? 28.309  -6.096  4.404   1.00 57.95 ? 317  ASN A CA  1 
ATOM   2396 C C   . ASN A 1 317 ? 28.277  -7.550  4.872   1.00 58.48 ? 317  ASN A C   1 
ATOM   2397 O O   . ASN A 1 317 ? 27.480  -8.340  4.371   1.00 59.00 ? 317  ASN A O   1 
ATOM   2398 C CB  . ASN A 1 317 ? 29.283  -5.989  3.219   1.00 58.33 ? 317  ASN A CB  1 
ATOM   2399 C CG  . ASN A 1 317 ? 29.067  -4.735  2.364   1.00 60.03 ? 317  ASN A CG  1 
ATOM   2400 O OD1 . ASN A 1 317 ? 28.114  -3.960  2.569   1.00 62.08 ? 317  ASN A OD1 1 
ATOM   2401 N ND2 . ASN A 1 317 ? 29.971  -4.527  1.394   1.00 59.80 ? 317  ASN A ND2 1 
ATOM   2402 N N   . THR A 1 318 ? 29.132  -7.891  5.837   1.00 58.98 ? 318  THR A N   1 
ATOM   2403 C CA  . THR A 1 318 ? 29.401  -9.288  6.176   1.00 59.52 ? 318  THR A CA  1 
ATOM   2404 C C   . THR A 1 318 ? 29.253  -9.595  7.670   1.00 59.98 ? 318  THR A C   1 
ATOM   2405 O O   . THR A 1 318 ? 29.565  -10.704 8.123   1.00 60.10 ? 318  THR A O   1 
ATOM   2406 C CB  . THR A 1 318 ? 30.837  -9.676  5.783   1.00 59.72 ? 318  THR A CB  1 
ATOM   2407 O OG1 . THR A 1 318 ? 31.745  -9.168  6.771   1.00 59.39 ? 318  THR A OG1 1 
ATOM   2408 C CG2 . THR A 1 318 ? 31.211  -9.144  4.381   1.00 59.73 ? 318  THR A CG2 1 
ATOM   2409 N N   . GLY A 1 319 ? 28.800  -8.616  8.441   1.00 60.28 ? 319  GLY A N   1 
ATOM   2410 C CA  . GLY A 1 319 ? 28.644  -8.807  9.876   1.00 60.78 ? 319  GLY A CA  1 
ATOM   2411 C C   . GLY A 1 319 ? 27.395  -9.579  10.275  1.00 61.31 ? 319  GLY A C   1 
ATOM   2412 O O   . GLY A 1 319 ? 26.363  -9.555  9.583   1.00 61.23 ? 319  GLY A O   1 
ATOM   2413 N N   . ASP A 1 320 ? 27.507  -10.264 11.407  1.00 61.65 ? 320  ASP A N   1 
ATOM   2414 C CA  . ASP A 1 320 ? 26.401  -10.969 12.020  1.00 61.96 ? 320  ASP A CA  1 
ATOM   2415 C C   . ASP A 1 320 ? 25.804  -10.058 13.092  1.00 61.78 ? 320  ASP A C   1 
ATOM   2416 O O   . ASP A 1 320 ? 26.389  -9.883  14.168  1.00 61.83 ? 320  ASP A O   1 
ATOM   2417 C CB  . ASP A 1 320 ? 26.920  -12.277 12.640  1.00 62.49 ? 320  ASP A CB  1 
ATOM   2418 C CG  . ASP A 1 320 ? 25.806  -13.157 13.202  1.00 63.13 ? 320  ASP A CG  1 
ATOM   2419 O OD1 . ASP A 1 320 ? 24.720  -13.243 12.578  1.00 64.52 ? 320  ASP A OD1 1 
ATOM   2420 O OD2 . ASP A 1 320 ? 26.031  -13.775 14.267  1.00 62.91 ? 320  ASP A OD2 1 
ATOM   2421 N N   . PHE A 1 321 ? 24.645  -9.472  12.796  1.00 61.61 ? 321  PHE A N   1 
ATOM   2422 C CA  . PHE A 1 321 ? 24.001  -8.529  13.722  1.00 61.37 ? 321  PHE A CA  1 
ATOM   2423 C C   . PHE A 1 321 ? 22.688  -9.065  14.291  1.00 61.93 ? 321  PHE A C   1 
ATOM   2424 O O   . PHE A 1 321 ? 21.723  -8.316  14.454  1.00 62.32 ? 321  PHE A O   1 
ATOM   2425 C CB  . PHE A 1 321 ? 23.797  -7.165  13.047  1.00 60.72 ? 321  PHE A CB  1 
ATOM   2426 C CG  . PHE A 1 321 ? 25.041  -6.620  12.412  1.00 59.30 ? 321  PHE A CG  1 
ATOM   2427 C CD1 . PHE A 1 321 ? 26.125  -6.245  13.193  1.00 57.25 ? 321  PHE A CD1 1 
ATOM   2428 C CD2 . PHE A 1 321 ? 25.140  -6.511  11.027  1.00 58.37 ? 321  PHE A CD2 1 
ATOM   2429 C CE1 . PHE A 1 321 ? 27.285  -5.765  12.614  1.00 57.36 ? 321  PHE A CE1 1 
ATOM   2430 C CE2 . PHE A 1 321 ? 26.297  -6.015  10.434  1.00 57.84 ? 321  PHE A CE2 1 
ATOM   2431 C CZ  . PHE A 1 321 ? 27.371  -5.641  11.233  1.00 58.30 ? 321  PHE A CZ  1 
ATOM   2432 N N   . GLN A 1 322 ? 22.687  -10.359 14.620  1.00 62.21 ? 322  GLN A N   1 
ATOM   2433 C CA  . GLN A 1 322 ? 21.506  -11.101 15.079  1.00 62.31 ? 322  GLN A CA  1 
ATOM   2434 C C   . GLN A 1 322 ? 20.825  -10.449 16.302  1.00 61.85 ? 322  GLN A C   1 
ATOM   2435 O O   . GLN A 1 322 ? 19.636  -10.116 16.273  1.00 62.07 ? 322  GLN A O   1 
ATOM   2436 C CB  . GLN A 1 322 ? 21.920  -12.555 15.390  1.00 62.81 ? 322  GLN A CB  1 
ATOM   2437 C CG  . GLN A 1 322 ? 20.898  -13.646 15.010  1.00 64.15 ? 322  GLN A CG  1 
ATOM   2438 C CD  . GLN A 1 322 ? 20.748  -13.852 13.490  1.00 66.63 ? 322  GLN A CD  1 
ATOM   2439 O OE1 . GLN A 1 322 ? 19.624  -14.006 12.985  1.00 66.20 ? 322  GLN A OE1 1 
ATOM   2440 N NE2 . GLN A 1 322 ? 21.881  -13.853 12.758  1.00 66.15 ? 322  GLN A NE2 1 
ATOM   2441 N N   . ASP A 1 323 ? 21.590  -10.258 17.368  1.00 61.00 ? 323  ASP A N   1 
ATOM   2442 C CA  . ASP A 1 323 ? 21.062  -9.695  18.612  1.00 60.46 ? 323  ASP A CA  1 
ATOM   2443 C C   . ASP A 1 323 ? 20.689  -8.208  18.503  1.00 59.23 ? 323  ASP A C   1 
ATOM   2444 O O   . ASP A 1 323 ? 19.701  -7.764  19.098  1.00 59.45 ? 323  ASP A O   1 
ATOM   2445 C CB  . ASP A 1 323 ? 22.082  -9.890  19.741  1.00 61.07 ? 323  ASP A CB  1 
ATOM   2446 C CG  . ASP A 1 323 ? 23.515  -9.540  19.310  1.00 62.99 ? 323  ASP A CG  1 
ATOM   2447 O OD1 . ASP A 1 323 ? 23.767  -9.356  18.088  1.00 64.60 ? 323  ASP A OD1 1 
ATOM   2448 O OD2 . ASP A 1 323 ? 24.397  -9.459  20.199  1.00 65.02 ? 323  ASP A OD2 1 
ATOM   2449 N N   . LEU A 1 324 ? 21.474  -7.467  17.716  1.00 57.17 ? 324  LEU A N   1 
ATOM   2450 C CA  . LEU A 1 324 ? 21.444  -5.997  17.643  1.00 54.89 ? 324  LEU A CA  1 
ATOM   2451 C C   . LEU A 1 324 ? 20.092  -5.307  17.439  1.00 53.01 ? 324  LEU A C   1 
ATOM   2452 O O   . LEU A 1 324 ? 19.369  -5.594  16.482  1.00 52.58 ? 324  LEU A O   1 
ATOM   2453 C CB  . LEU A 1 324 ? 22.412  -5.533  16.554  1.00 55.12 ? 324  LEU A CB  1 
ATOM   2454 C CG  . LEU A 1 324 ? 23.114  -4.195  16.760  1.00 55.42 ? 324  LEU A CG  1 
ATOM   2455 C CD1 . LEU A 1 324 ? 23.791  -4.108  18.124  1.00 56.15 ? 324  LEU A CD1 1 
ATOM   2456 C CD2 . LEU A 1 324 ? 24.120  -4.010  15.662  1.00 56.15 ? 324  LEU A CD2 1 
ATOM   2457 N N   . GLN A 1 325 ? 19.769  -4.394  18.353  1.00 50.73 ? 325  GLN A N   1 
ATOM   2458 C CA  . GLN A 1 325 ? 18.652  -3.477  18.163  1.00 49.05 ? 325  GLN A CA  1 
ATOM   2459 C C   . GLN A 1 325 ? 19.174  -2.066  17.906  1.00 47.45 ? 325  GLN A C   1 
ATOM   2460 O O   . GLN A 1 325 ? 19.899  -1.483  18.729  1.00 47.14 ? 325  GLN A O   1 
ATOM   2461 C CB  . GLN A 1 325 ? 17.703  -3.459  19.358  1.00 49.20 ? 325  GLN A CB  1 
ATOM   2462 C CG  . GLN A 1 325 ? 16.918  -4.723  19.586  1.00 50.50 ? 325  GLN A CG  1 
ATOM   2463 C CD  . GLN A 1 325 ? 17.477  -5.550  20.722  1.00 52.71 ? 325  GLN A CD  1 
ATOM   2464 O OE1 . GLN A 1 325 ? 17.852  -5.025  21.780  1.00 52.51 ? 325  GLN A OE1 1 
ATOM   2465 N NE2 . GLN A 1 325 ? 17.537  -6.860  20.512  1.00 53.76 ? 325  GLN A NE2 1 
ATOM   2466 N N   . VAL A 1 326 ? 18.786  -1.517  16.766  1.00 45.28 ? 326  VAL A N   1 
ATOM   2467 C CA  . VAL A 1 326 ? 19.355  -0.269  16.304  1.00 43.64 ? 326  VAL A CA  1 
ATOM   2468 C C   . VAL A 1 326 ? 18.254  0.681   15.898  1.00 42.35 ? 326  VAL A C   1 
ATOM   2469 O O   . VAL A 1 326 ? 17.341  0.316   15.168  1.00 42.64 ? 326  VAL A O   1 
ATOM   2470 C CB  . VAL A 1 326 ? 20.327  -0.515  15.118  1.00 43.54 ? 326  VAL A CB  1 
ATOM   2471 C CG1 . VAL A 1 326 ? 20.781  0.754   14.524  1.00 43.66 ? 326  VAL A CG1 1 
ATOM   2472 C CG2 . VAL A 1 326 ? 21.535  -1.257  15.586  1.00 43.12 ? 326  VAL A CG2 1 
ATOM   2473 N N   . LEU A 1 327 ? 18.343  1.903   16.383  1.00 40.80 ? 327  LEU A N   1 
ATOM   2474 C CA  . LEU A 1 327 ? 17.476  2.969   15.919  1.00 39.74 ? 327  LEU A CA  1 
ATOM   2475 C C   . LEU A 1 327 ? 18.332  3.949   15.105  1.00 38.58 ? 327  LEU A C   1 
ATOM   2476 O O   . LEU A 1 327 ? 19.360  4.421   15.584  1.00 38.50 ? 327  LEU A O   1 
ATOM   2477 C CB  . LEU A 1 327 ? 16.789  3.647   17.115  1.00 39.88 ? 327  LEU A CB  1 
ATOM   2478 C CG  . LEU A 1 327 ? 15.875  4.861   16.926  1.00 40.29 ? 327  LEU A CG  1 
ATOM   2479 C CD1 . LEU A 1 327 ? 15.068  4.761   15.672  1.00 40.94 ? 327  LEU A CD1 1 
ATOM   2480 C CD2 . LEU A 1 327 ? 14.940  4.965   18.092  1.00 41.52 ? 327  LEU A CD2 1 
ATOM   2481 N N   . VAL A 1 328 ? 17.925  4.215   13.869  1.00 37.19 ? 328  VAL A N   1 
ATOM   2482 C CA  . VAL A 1 328 ? 18.677  5.093   12.970  1.00 36.49 ? 328  VAL A CA  1 
ATOM   2483 C C   . VAL A 1 328 ? 17.746  6.052   12.282  1.00 36.01 ? 328  VAL A C   1 
ATOM   2484 O O   . VAL A 1 328 ? 16.589  5.730   12.056  1.00 36.86 ? 328  VAL A O   1 
ATOM   2485 C CB  . VAL A 1 328 ? 19.448  4.318   11.852  1.00 36.53 ? 328  VAL A CB  1 
ATOM   2486 C CG1 . VAL A 1 328 ? 20.442  3.363   12.447  1.00 36.61 ? 328  VAL A CG1 1 
ATOM   2487 C CG2 . VAL A 1 328 ? 18.503  3.576   10.933  1.00 35.57 ? 328  VAL A CG2 1 
ATOM   2488 N N   . GLY A 1 329 ? 18.254  7.220   11.917  1.00 35.19 ? 329  GLY A N   1 
ATOM   2489 C CA  . GLY A 1 329 ? 17.453  8.177   11.169  1.00 33.52 ? 329  GLY A CA  1 
ATOM   2490 C C   . GLY A 1 329 ? 18.232  9.400   10.757  1.00 32.69 ? 329  GLY A C   1 
ATOM   2491 O O   . GLY A 1 329 ? 19.452  9.443   10.913  1.00 32.93 ? 329  GLY A O   1 
ATOM   2492 N N   . VAL A 1 330 ? 17.513  10.392  10.241  1.00 31.52 ? 330  VAL A N   1 
ATOM   2493 C CA  . VAL A 1 330 ? 18.091  11.548  9.586   1.00 30.71 ? 330  VAL A CA  1 
ATOM   2494 C C   . VAL A 1 330 ? 17.138  12.737  9.752   1.00 31.49 ? 330  VAL A C   1 
ATOM   2495 O O   . VAL A 1 330 ? 15.956  12.557  10.088  1.00 31.32 ? 330  VAL A O   1 
ATOM   2496 C CB  . VAL A 1 330 ? 18.318  11.289  8.065   1.00 30.75 ? 330  VAL A CB  1 
ATOM   2497 C CG1 . VAL A 1 330 ? 19.327  10.148  7.818   1.00 30.42 ? 330  VAL A CG1 1 
ATOM   2498 C CG2 . VAL A 1 330 ? 17.000  10.999  7.342   1.00 29.41 ? 330  VAL A CG2 1 
ATOM   2499 N N   . VAL A 1 331 ? 17.653  13.946  9.532   1.00 31.89 ? 331  VAL A N   1 
ATOM   2500 C CA  . VAL A 1 331 ? 16.836  15.161  9.523   1.00 32.40 ? 331  VAL A CA  1 
ATOM   2501 C C   . VAL A 1 331 ? 16.439  15.445  8.084   1.00 33.20 ? 331  VAL A C   1 
ATOM   2502 O O   . VAL A 1 331 ? 16.996  14.851  7.160   1.00 33.33 ? 331  VAL A O   1 
ATOM   2503 C CB  . VAL A 1 331 ? 17.578  16.387  10.130  1.00 32.55 ? 331  VAL A CB  1 
ATOM   2504 C CG1 . VAL A 1 331 ? 17.728  16.224  11.617  1.00 32.08 ? 331  VAL A CG1 1 
ATOM   2505 C CG2 . VAL A 1 331 ? 18.950  16.617  9.456   1.00 31.51 ? 331  VAL A CG2 1 
ATOM   2506 N N   . LYS A 1 332 ? 15.462  16.324  7.893   1.00 33.83 ? 332  LYS A N   1 
ATOM   2507 C CA  . LYS A 1 332 ? 14.960  16.618  6.558   1.00 34.75 ? 332  LYS A CA  1 
ATOM   2508 C C   . LYS A 1 332 ? 16.083  17.147  5.676   1.00 33.90 ? 332  LYS A C   1 
ATOM   2509 O O   . LYS A 1 332 ? 16.222  16.737  4.529   1.00 34.12 ? 332  LYS A O   1 
ATOM   2510 C CB  . LYS A 1 332 ? 13.804  17.631  6.619   1.00 34.60 ? 332  LYS A CB  1 
ATOM   2511 C CG  . LYS A 1 332 ? 12.796  17.555  5.453   1.00 36.00 ? 332  LYS A CG  1 
ATOM   2512 C CD  . LYS A 1 332 ? 11.610  18.547  5.672   1.00 37.25 ? 332  LYS A CD  1 
ATOM   2513 C CE  . LYS A 1 332 ? 11.642  19.794  4.714   1.00 44.57 ? 332  LYS A CE  1 
ATOM   2514 N NZ  . LYS A 1 332 ? 12.439  21.030  5.193   1.00 44.19 ? 332  LYS A NZ  1 
ATOM   2515 N N   . ASP A 1 333 ? 16.901  18.039  6.219   1.00 33.17 ? 333  ASP A N   1 
ATOM   2516 C CA  . ASP A 1 333 ? 17.889  18.727  5.394   1.00 32.28 ? 333  ASP A CA  1 
ATOM   2517 C C   . ASP A 1 333 ? 19.287  18.542  5.960   1.00 32.04 ? 333  ASP A C   1 
ATOM   2518 O O   . ASP A 1 333 ? 19.855  19.450  6.564   1.00 31.92 ? 333  ASP A O   1 
ATOM   2519 C CB  . ASP A 1 333 ? 17.509  20.193  5.249   1.00 32.34 ? 333  ASP A CB  1 
ATOM   2520 C CG  . ASP A 1 333 ? 16.103  20.366  4.726   1.00 32.07 ? 333  ASP A CG  1 
ATOM   2521 O OD1 . ASP A 1 333 ? 15.180  20.452  5.545   1.00 34.48 ? 333  ASP A OD1 1 
ATOM   2522 O OD2 . ASP A 1 333 ? 15.905  20.370  3.504   1.00 31.45 ? 333  ASP A OD2 1 
ATOM   2523 N N   . GLU A 1 334 ? 19.824  17.337  5.774   1.00 31.49 ? 334  GLU A N   1 
ATOM   2524 C CA  . GLU A 1 334 ? 21.120  16.983  6.303   1.00 30.80 ? 334  GLU A CA  1 
ATOM   2525 C C   . GLU A 1 334 ? 22.208  17.874  5.738   1.00 30.92 ? 334  GLU A C   1 
ATOM   2526 O O   . GLU A 1 334 ? 23.163  18.191  6.439   1.00 31.26 ? 334  GLU A O   1 
ATOM   2527 C CB  . GLU A 1 334 ? 21.447  15.512  5.993   1.00 30.52 ? 334  GLU A CB  1 
ATOM   2528 C CG  . GLU A 1 334 ? 20.623  14.494  6.785   1.00 29.89 ? 334  GLU A CG  1 
ATOM   2529 C CD  . GLU A 1 334 ? 21.012  14.427  8.252   1.00 31.52 ? 334  GLU A CD  1 
ATOM   2530 O OE1 . GLU A 1 334 ? 22.035  15.036  8.649   1.00 30.85 ? 334  GLU A OE1 1 
ATOM   2531 O OE2 . GLU A 1 334 ? 20.295  13.757  9.026   1.00 32.14 ? 334  GLU A OE2 1 
ATOM   2532 N N   . GLY A 1 335 ? 22.056  18.285  4.483   1.00 30.87 ? 335  GLY A N   1 
ATOM   2533 C CA  . GLY A 1 335 ? 23.130  18.933  3.760   1.00 31.63 ? 335  GLY A CA  1 
ATOM   2534 C C   . GLY A 1 335 ? 23.207  20.431  3.893   1.00 32.82 ? 335  GLY A C   1 
ATOM   2535 O O   . GLY A 1 335 ? 24.263  21.015  3.657   1.00 32.81 ? 335  GLY A O   1 
ATOM   2536 N N   . SER A 1 336 ? 22.105  21.063  4.287   1.00 33.84 ? 336  SER A N   1 
ATOM   2537 C CA  . SER A 1 336 ? 21.995  22.510  4.162   1.00 35.20 ? 336  SER A CA  1 
ATOM   2538 C C   . SER A 1 336 ? 23.069  23.282  4.965   1.00 36.26 ? 336  SER A C   1 
ATOM   2539 O O   . SER A 1 336 ? 23.676  24.197  4.444   1.00 36.78 ? 336  SER A O   1 
ATOM   2540 C CB  . SER A 1 336 ? 20.580  22.972  4.500   1.00 34.90 ? 336  SER A CB  1 
ATOM   2541 O OG  . SER A 1 336 ? 20.262  22.677  5.842   1.00 34.50 ? 336  SER A OG  1 
ATOM   2542 N N   . TYR A 1 337 ? 23.306  22.868  6.208   1.00 37.59 ? 337  TYR A N   1 
ATOM   2543 C CA  . TYR A 1 337 ? 24.319  23.428  7.111   1.00 38.83 ? 337  TYR A CA  1 
ATOM   2544 C C   . TYR A 1 337 ? 25.699  23.553  6.451   1.00 38.70 ? 337  TYR A C   1 
ATOM   2545 O O   . TYR A 1 337 ? 26.351  24.602  6.503   1.00 37.82 ? 337  TYR A O   1 
ATOM   2546 C CB  . TYR A 1 337 ? 24.412  22.523  8.348   1.00 40.37 ? 337  TYR A CB  1 
ATOM   2547 C CG  . TYR A 1 337 ? 25.100  23.099  9.551   1.00 42.36 ? 337  TYR A CG  1 
ATOM   2548 C CD1 . TYR A 1 337 ? 24.367  23.513  10.666  1.00 44.28 ? 337  TYR A CD1 1 
ATOM   2549 C CD2 . TYR A 1 337 ? 26.490  23.195  9.598   1.00 44.69 ? 337  TYR A CD2 1 
ATOM   2550 C CE1 . TYR A 1 337 ? 25.009  24.042  11.809  1.00 45.52 ? 337  TYR A CE1 1 
ATOM   2551 C CE2 . TYR A 1 337 ? 27.144  23.709  10.710  1.00 45.59 ? 337  TYR A CE2 1 
ATOM   2552 C CZ  . TYR A 1 337 ? 26.406  24.138  11.818  1.00 45.91 ? 337  TYR A CZ  1 
ATOM   2553 O OH  . TYR A 1 337 ? 27.090  24.658  12.915  1.00 45.61 ? 337  TYR A OH  1 
ATOM   2554 N N   . PHE A 1 338 ? 26.118  22.468  5.813   1.00 39.02 ? 338  PHE A N   1 
ATOM   2555 C CA  . PHE A 1 338 ? 27.449  22.346  5.243   1.00 39.00 ? 338  PHE A CA  1 
ATOM   2556 C C   . PHE A 1 338 ? 27.710  23.269  4.060   1.00 39.39 ? 338  PHE A C   1 
ATOM   2557 O O   . PHE A 1 338 ? 28.854  23.611  3.772   1.00 39.33 ? 338  PHE A O   1 
ATOM   2558 C CB  . PHE A 1 338 ? 27.699  20.880  4.890   1.00 38.87 ? 338  PHE A CB  1 
ATOM   2559 C CG  . PHE A 1 338 ? 27.548  19.976  6.065   1.00 39.15 ? 338  PHE A CG  1 
ATOM   2560 C CD1 . PHE A 1 338 ? 26.355  19.294  6.287   1.00 38.84 ? 338  PHE A CD1 1 
ATOM   2561 C CD2 . PHE A 1 338 ? 28.573  19.870  7.006   1.00 38.15 ? 338  PHE A CD2 1 
ATOM   2562 C CE1 . PHE A 1 338 ? 26.204  18.497  7.413   1.00 38.09 ? 338  PHE A CE1 1 
ATOM   2563 C CE2 . PHE A 1 338 ? 28.430  19.085  8.116   1.00 36.57 ? 338  PHE A CE2 1 
ATOM   2564 C CZ  . PHE A 1 338 ? 27.243  18.394  8.329   1.00 36.89 ? 338  PHE A CZ  1 
ATOM   2565 N N   . LEU A 1 339 ? 26.649  23.705  3.398   1.00 39.93 ? 339  LEU A N   1 
ATOM   2566 C CA  . LEU A 1 339 ? 26.816  24.510  2.205   1.00 40.45 ? 339  LEU A CA  1 
ATOM   2567 C C   . LEU A 1 339 ? 27.395  25.899  2.478   1.00 40.93 ? 339  LEU A C   1 
ATOM   2568 O O   . LEU A 1 339 ? 28.033  26.483  1.603   1.00 40.47 ? 339  LEU A O   1 
ATOM   2569 C CB  . LEU A 1 339 ? 25.491  24.622  1.466   1.00 40.54 ? 339  LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 339 ? 24.820  23.296  1.130   1.00 40.22 ? 339  LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 339 ? 23.582  23.568  0.296   1.00 39.84 ? 339  LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 339 ? 25.793  22.384  0.390   1.00 39.24 ? 339  LEU A CD2 1 
ATOM   2573 N N   . VAL A 1 340 ? 27.177  26.425  3.685   1.00 41.83 ? 340  VAL A N   1 
ATOM   2574 C CA  . VAL A 1 340 ? 27.696  27.758  4.032   1.00 42.38 ? 340  VAL A CA  1 
ATOM   2575 C C   . VAL A 1 340 ? 29.160  27.709  4.444   1.00 43.25 ? 340  VAL A C   1 
ATOM   2576 O O   . VAL A 1 340 ? 29.820  28.742  4.564   1.00 43.14 ? 340  VAL A O   1 
ATOM   2577 C CB  . VAL A 1 340 ? 26.858  28.479  5.102   1.00 42.04 ? 340  VAL A CB  1 
ATOM   2578 C CG1 . VAL A 1 340 ? 25.396  28.457  4.719   1.00 41.74 ? 340  VAL A CG1 1 
ATOM   2579 C CG2 . VAL A 1 340 ? 27.064  27.868  6.483   1.00 42.03 ? 340  VAL A CG2 1 
ATOM   2580 N N   . TYR A 1 341 ? 29.667  26.500  4.639   1.00 44.17 ? 341  TYR A N   1 
ATOM   2581 C CA  . TYR A 1 341 ? 31.054  26.333  5.024   1.00 45.54 ? 341  TYR A CA  1 
ATOM   2582 C C   . TYR A 1 341 ? 32.004  26.102  3.847   1.00 45.93 ? 341  TYR A C   1 
ATOM   2583 O O   . TYR A 1 341 ? 33.013  25.411  3.984   1.00 46.53 ? 341  TYR A O   1 
ATOM   2584 C CB  . TYR A 1 341 ? 31.190  25.236  6.082   1.00 45.75 ? 341  TYR A CB  1 
ATOM   2585 C CG  . TYR A 1 341 ? 30.742  25.704  7.431   1.00 46.20 ? 341  TYR A CG  1 
ATOM   2586 C CD1 . TYR A 1 341 ? 29.436  25.480  7.869   1.00 45.57 ? 341  TYR A CD1 1 
ATOM   2587 C CD2 . TYR A 1 341 ? 31.620  26.394  8.271   1.00 46.52 ? 341  TYR A CD2 1 
ATOM   2588 C CE1 . TYR A 1 341 ? 29.015  25.926  9.117   1.00 46.06 ? 341  TYR A CE1 1 
ATOM   2589 C CE2 . TYR A 1 341 ? 31.213  26.843  9.520   1.00 47.18 ? 341  TYR A CE2 1 
ATOM   2590 C CZ  . TYR A 1 341 ? 29.909  26.606  9.939   1.00 47.12 ? 341  TYR A CZ  1 
ATOM   2591 O OH  . TYR A 1 341 ? 29.504  27.049  11.178  1.00 47.24 ? 341  TYR A OH  1 
ATOM   2592 N N   . GLY A 1 342 ? 31.690  26.695  2.701   1.00 46.37 ? 342  GLY A N   1 
ATOM   2593 C CA  . GLY A 1 342 ? 32.619  26.684  1.582   1.00 46.52 ? 342  GLY A CA  1 
ATOM   2594 C C   . GLY A 1 342 ? 32.090  26.219  0.241   1.00 46.55 ? 342  GLY A C   1 
ATOM   2595 O O   . GLY A 1 342 ? 32.864  25.695  -0.586  1.00 46.87 ? 342  GLY A O   1 
ATOM   2596 N N   . VAL A 1 343 ? 30.786  26.380  0.017   1.00 45.55 ? 343  VAL A N   1 
ATOM   2597 C CA  . VAL A 1 343 ? 30.292  26.378  -1.344  1.00 45.04 ? 343  VAL A CA  1 
ATOM   2598 C C   . VAL A 1 343 ? 29.972  27.822  -1.729  1.00 44.83 ? 343  VAL A C   1 
ATOM   2599 O O   . VAL A 1 343 ? 29.106  28.467  -1.119  1.00 44.68 ? 343  VAL A O   1 
ATOM   2600 C CB  . VAL A 1 343 ? 29.086  25.451  -1.572  1.00 45.14 ? 343  VAL A CB  1 
ATOM   2601 C CG1 . VAL A 1 343 ? 28.656  25.515  -3.032  1.00 44.61 ? 343  VAL A CG1 1 
ATOM   2602 C CG2 . VAL A 1 343 ? 29.437  24.016  -1.210  1.00 45.33 ? 343  VAL A CG2 1 
ATOM   2603 N N   . PRO A 1 344 ? 30.697  28.354  -2.727  1.00 44.60 ? 344  PRO A N   1 
ATOM   2604 C CA  . PRO A 1 344 ? 30.407  29.721  -3.167  1.00 44.02 ? 344  PRO A CA  1 
ATOM   2605 C C   . PRO A 1 344 ? 28.946  29.796  -3.581  1.00 43.61 ? 344  PRO A C   1 
ATOM   2606 O O   . PRO A 1 344 ? 28.443  28.863  -4.224  1.00 43.17 ? 344  PRO A O   1 
ATOM   2607 C CB  . PRO A 1 344 ? 31.309  29.906  -4.389  1.00 43.80 ? 344  PRO A CB  1 
ATOM   2608 C CG  . PRO A 1 344 ? 32.395  28.887  -4.218  1.00 44.43 ? 344  PRO A CG  1 
ATOM   2609 C CD  . PRO A 1 344 ? 31.792  27.732  -3.495  1.00 44.39 ? 344  PRO A CD  1 
ATOM   2610 N N   . GLY A 1 345 ? 28.278  30.881  -3.196  1.00 42.92 ? 345  GLY A N   1 
ATOM   2611 C CA  . GLY A 1 345 ? 26.866  31.051  -3.483  1.00 42.50 ? 345  GLY A CA  1 
ATOM   2612 C C   . GLY A 1 345 ? 25.995  30.941  -2.253  1.00 42.19 ? 345  GLY A C   1 
ATOM   2613 O O   . GLY A 1 345 ? 24.979  31.614  -2.163  1.00 42.00 ? 345  GLY A O   1 
ATOM   2614 N N   . PHE A 1 346 ? 26.399  30.103  -1.297  1.00 42.17 ? 346  PHE A N   1 
ATOM   2615 C CA  . PHE A 1 346 ? 25.565  29.802  -0.126  1.00 41.63 ? 346  PHE A CA  1 
ATOM   2616 C C   . PHE A 1 346 ? 25.916  30.634  1.106   1.00 41.53 ? 346  PHE A C   1 
ATOM   2617 O O   . PHE A 1 346 ? 27.079  30.939  1.341   1.00 40.95 ? 346  PHE A O   1 
ATOM   2618 C CB  . PHE A 1 346 ? 25.606  28.300  0.184   1.00 41.39 ? 346  PHE A CB  1 
ATOM   2619 C CG  . PHE A 1 346 ? 24.963  27.448  -0.884  1.00 40.25 ? 346  PHE A CG  1 
ATOM   2620 C CD1 . PHE A 1 346 ? 25.698  26.995  -1.963  1.00 39.09 ? 346  PHE A CD1 1 
ATOM   2621 C CD2 . PHE A 1 346 ? 23.611  27.114  -0.805  1.00 39.18 ? 346  PHE A CD2 1 
ATOM   2622 C CE1 . PHE A 1 346 ? 25.099  26.223  -2.948  1.00 39.23 ? 346  PHE A CE1 1 
ATOM   2623 C CE2 . PHE A 1 346 ? 23.005  26.359  -1.777  1.00 38.19 ? 346  PHE A CE2 1 
ATOM   2624 C CZ  . PHE A 1 346 ? 23.743  25.914  -2.856  1.00 39.78 ? 346  PHE A CZ  1 
ATOM   2625 N N   . SER A 1 347 ? 24.892  31.003  1.875   1.00 41.55 ? 347  SER A N   1 
ATOM   2626 C CA  . SER A 1 347 ? 25.058  31.831  3.074   1.00 41.98 ? 347  SER A CA  1 
ATOM   2627 C C   . SER A 1 347 ? 23.834  31.790  3.991   1.00 42.37 ? 347  SER A C   1 
ATOM   2628 O O   . SER A 1 347 ? 22.709  31.536  3.533   1.00 42.97 ? 347  SER A O   1 
ATOM   2629 C CB  . SER A 1 347 ? 25.361  33.284  2.684   1.00 41.90 ? 347  SER A CB  1 
ATOM   2630 O OG  . SER A 1 347 ? 24.969  34.181  3.703   1.00 42.00 ? 347  SER A OG  1 
ATOM   2631 N N   . LYS A 1 348 ? 24.040  32.067  5.275   1.00 42.16 ? 348  LYS A N   1 
ATOM   2632 C CA  . LYS A 1 348 ? 22.923  32.138  6.202   1.00 42.34 ? 348  LYS A CA  1 
ATOM   2633 C C   . LYS A 1 348 ? 22.174  33.468  6.068   1.00 42.78 ? 348  LYS A C   1 
ATOM   2634 O O   . LYS A 1 348 ? 21.029  33.580  6.498   1.00 42.28 ? 348  LYS A O   1 
ATOM   2635 C CB  . LYS A 1 348 ? 23.381  31.904  7.653   1.00 42.15 ? 348  LYS A CB  1 
ATOM   2636 C CG  . LYS A 1 348 ? 24.155  33.058  8.289   1.00 42.60 ? 348  LYS A CG  1 
ATOM   2637 C CD  . LYS A 1 348 ? 24.254  32.913  9.797   1.00 42.48 ? 348  LYS A CD  1 
ATOM   2638 C CE  . LYS A 1 348 ? 24.473  34.260  10.502  1.00 43.17 ? 348  LYS A CE  1 
ATOM   2639 N NZ  . LYS A 1 348 ? 23.258  35.154  10.515  1.00 43.83 ? 348  LYS A NZ  1 
ATOM   2640 N N   . ASP A 1 349 ? 22.820  34.466  5.467   1.00 43.51 ? 349  ASP A N   1 
ATOM   2641 C CA  . ASP A 1 349 ? 22.253  35.827  5.425   1.00 44.62 ? 349  ASP A CA  1 
ATOM   2642 C C   . ASP A 1 349 ? 21.357  36.152  4.222   1.00 45.16 ? 349  ASP A C   1 
ATOM   2643 O O   . ASP A 1 349 ? 20.686  37.181  4.215   1.00 45.12 ? 349  ASP A O   1 
ATOM   2644 C CB  . ASP A 1 349 ? 23.345  36.879  5.629   1.00 44.25 ? 349  ASP A CB  1 
ATOM   2645 C CG  . ASP A 1 349 ? 24.075  36.698  6.958   1.00 44.81 ? 349  ASP A CG  1 
ATOM   2646 O OD1 . ASP A 1 349 ? 23.393  36.464  7.991   1.00 40.86 ? 349  ASP A OD1 1 
ATOM   2647 O OD2 . ASP A 1 349 ? 25.336  36.769  6.954   1.00 46.12 ? 349  ASP A OD2 1 
ATOM   2648 N N   . ASN A 1 350 ? 21.338  35.271  3.222   1.00 45.99 ? 350  ASN A N   1 
ATOM   2649 C CA  . ASN A 1 350 ? 20.354  35.356  2.149   1.00 46.70 ? 350  ASN A CA  1 
ATOM   2650 C C   . ASN A 1 350 ? 19.758  33.989  1.790   1.00 46.80 ? 350  ASN A C   1 
ATOM   2651 O O   . ASN A 1 350 ? 20.049  32.986  2.454   1.00 46.70 ? 350  ASN A O   1 
ATOM   2652 C CB  . ASN A 1 350 ? 20.917  36.079  0.918   1.00 46.65 ? 350  ASN A CB  1 
ATOM   2653 C CG  . ASN A 1 350 ? 22.127  35.394  0.346   1.00 48.77 ? 350  ASN A CG  1 
ATOM   2654 O OD1 . ASN A 1 350 ? 22.106  34.177  0.109   1.00 51.84 ? 350  ASN A OD1 1 
ATOM   2655 N ND2 . ASN A 1 350 ? 23.205  36.164  0.111   1.00 47.67 ? 350  ASN A ND2 1 
ATOM   2656 N N   . GLU A 1 351 ? 18.922  33.973  0.748   1.00 46.80 ? 351  GLU A N   1 
ATOM   2657 C CA  . GLU A 1 351 ? 18.201  32.773  0.295   1.00 46.86 ? 351  GLU A CA  1 
ATOM   2658 C C   . GLU A 1 351 ? 19.074  31.761  -0.456  1.00 45.53 ? 351  GLU A C   1 
ATOM   2659 O O   . GLU A 1 351 ? 18.631  30.640  -0.742  1.00 45.44 ? 351  GLU A O   1 
ATOM   2660 C CB  . GLU A 1 351 ? 17.034  33.176  -0.608  1.00 47.50 ? 351  GLU A CB  1 
ATOM   2661 C CG  . GLU A 1 351 ? 16.161  34.293  -0.069  1.00 51.40 ? 351  GLU A CG  1 
ATOM   2662 C CD  . GLU A 1 351 ? 15.245  33.849  1.053   1.00 56.63 ? 351  GLU A CD  1 
ATOM   2663 O OE1 . GLU A 1 351 ? 15.085  32.613  1.268   1.00 58.52 ? 351  GLU A OE1 1 
ATOM   2664 O OE2 . GLU A 1 351 ? 14.672  34.754  1.717   1.00 59.31 ? 351  GLU A OE2 1 
ATOM   2665 N N   . SER A 1 352 ? 20.292  32.174  -0.791  1.00 44.12 ? 352  SER A N   1 
ATOM   2666 C CA  . SER A 1 352 ? 21.270  31.321  -1.464  1.00 43.41 ? 352  SER A CA  1 
ATOM   2667 C C   . SER A 1 352 ? 20.741  30.676  -2.750  1.00 42.85 ? 352  SER A C   1 
ATOM   2668 O O   . SER A 1 352 ? 20.992  29.505  -3.027  1.00 42.85 ? 352  SER A O   1 
ATOM   2669 C CB  . SER A 1 352 ? 21.821  30.255  -0.501  1.00 43.29 ? 352  SER A CB  1 
ATOM   2670 O OG  . SER A 1 352 ? 21.972  30.783  0.802   1.00 42.55 ? 352  SER A OG  1 
ATOM   2671 N N   . LEU A 1 353 ? 20.003  31.449  -3.529  1.00 42.03 ? 353  LEU A N   1 
ATOM   2672 C CA  . LEU A 1 353 ? 19.660  31.045  -4.866  1.00 41.70 ? 353  LEU A CA  1 
ATOM   2673 C C   . LEU A 1 353 ? 20.944  31.028  -5.698  1.00 41.51 ? 353  LEU A C   1 
ATOM   2674 O O   . LEU A 1 353 ? 21.676  32.017  -5.768  1.00 41.59 ? 353  LEU A O   1 
ATOM   2675 C CB  . LEU A 1 353 ? 18.612  31.994  -5.453  1.00 41.97 ? 353  LEU A CB  1 
ATOM   2676 C CG  . LEU A 1 353 ? 17.276  32.141  -4.703  1.00 42.43 ? 353  LEU A CG  1 
ATOM   2677 C CD1 . LEU A 1 353 ? 16.275  32.991  -5.491  1.00 42.71 ? 353  LEU A CD1 1 
ATOM   2678 C CD2 . LEU A 1 353 ? 16.666  30.795  -4.397  1.00 41.17 ? 353  LEU A CD2 1 
ATOM   2679 N N   . ILE A 1 354 ? 21.238  29.884  -6.296  1.00 40.96 ? 354  ILE A N   1 
ATOM   2680 C CA  . ILE A 1 354 ? 22.502  29.703  -6.987  1.00 40.34 ? 354  ILE A CA  1 
ATOM   2681 C C   . ILE A 1 354 ? 22.314  29.434  -8.472  1.00 40.51 ? 354  ILE A C   1 
ATOM   2682 O O   . ILE A 1 354 ? 21.226  29.053  -8.921  1.00 40.93 ? 354  ILE A O   1 
ATOM   2683 C CB  . ILE A 1 354 ? 23.336  28.563  -6.378  1.00 40.35 ? 354  ILE A CB  1 
ATOM   2684 C CG1 . ILE A 1 354 ? 22.537  27.252  -6.339  1.00 38.94 ? 354  ILE A CG1 1 
ATOM   2685 C CG2 . ILE A 1 354 ? 23.873  28.958  -5.016  1.00 39.72 ? 354  ILE A CG2 1 
ATOM   2686 C CD1 . ILE A 1 354 ? 23.410  26.044  -6.462  1.00 38.53 ? 354  ILE A CD1 1 
ATOM   2687 N N   . SER A 1 355 ? 23.386  29.629  -9.224  1.00 40.30 ? 355  SER A N   1 
ATOM   2688 C CA  . SER A 1 355 ? 23.365  29.439  -10.654 1.00 40.82 ? 355  SER A CA  1 
ATOM   2689 C C   . SER A 1 355 ? 23.718  27.999  -10.973 1.00 41.24 ? 355  SER A C   1 
ATOM   2690 O O   . SER A 1 355 ? 24.196  27.252  -10.116 1.00 41.67 ? 355  SER A O   1 
ATOM   2691 C CB  . SER A 1 355 ? 24.385  30.371  -11.305 1.00 41.30 ? 355  SER A CB  1 
ATOM   2692 O OG  . SER A 1 355 ? 25.720  29.944  -11.029 1.00 40.66 ? 355  SER A OG  1 
ATOM   2693 N N   . ARG A 1 356 ? 23.513  27.607  -12.219 1.00 41.64 ? 356  ARG A N   1 
ATOM   2694 C CA  . ARG A 1 356 ? 23.823  26.251  -12.615 1.00 42.03 ? 356  ARG A CA  1 
ATOM   2695 C C   . ARG A 1 356 ? 25.325  26.049  -12.482 1.00 42.12 ? 356  ARG A C   1 
ATOM   2696 O O   . ARG A 1 356 ? 25.790  24.950  -12.152 1.00 42.40 ? 356  ARG A O   1 
ATOM   2697 C CB  . ARG A 1 356 ? 23.349  25.995  -14.041 1.00 42.25 ? 356  ARG A CB  1 
ATOM   2698 C CG  . ARG A 1 356 ? 23.584  24.579  -14.498 1.00 43.90 ? 356  ARG A CG  1 
ATOM   2699 C CD  . ARG A 1 356 ? 22.427  24.002  -15.287 1.00 44.85 ? 356  ARG A CD  1 
ATOM   2700 N NE  . ARG A 1 356 ? 22.707  22.597  -15.551 1.00 45.41 ? 356  ARG A NE  1 
ATOM   2701 C CZ  . ARG A 1 356 ? 22.249  21.575  -14.830 1.00 46.25 ? 356  ARG A CZ  1 
ATOM   2702 N NH1 . ARG A 1 356 ? 21.436  21.777  -13.791 1.00 46.79 ? 356  ARG A NH1 1 
ATOM   2703 N NH2 . ARG A 1 356 ? 22.592  20.337  -15.171 1.00 45.72 ? 356  ARG A NH2 1 
ATOM   2704 N N   . ALA A 1 357 ? 26.071  27.131  -12.710 1.00 41.80 ? 357  ALA A N   1 
ATOM   2705 C CA  . ALA A 1 357 ? 27.516  27.115  -12.605 1.00 41.17 ? 357  ALA A CA  1 
ATOM   2706 C C   . ALA A 1 357 ? 27.907  26.848  -11.163 1.00 40.74 ? 357  ALA A C   1 
ATOM   2707 O O   . ALA A 1 357 ? 28.735  25.969  -10.888 1.00 40.88 ? 357  ALA A O   1 
ATOM   2708 C CB  . ALA A 1 357 ? 28.112  28.439  -13.096 1.00 41.21 ? 357  ALA A CB  1 
ATOM   2709 N N   . GLN A 1 358 ? 27.301  27.594  -10.243 1.00 39.76 ? 358  GLN A N   1 
ATOM   2710 C CA  . GLN A 1 358 ? 27.583  27.424  -8.825  1.00 38.88 ? 358  GLN A CA  1 
ATOM   2711 C C   . GLN A 1 358 ? 27.189  26.029  -8.333  1.00 38.62 ? 358  GLN A C   1 
ATOM   2712 O O   . GLN A 1 358 ? 27.763  25.516  -7.369  1.00 38.57 ? 358  GLN A O   1 
ATOM   2713 C CB  . GLN A 1 358 ? 26.887  28.504  -8.008  1.00 38.73 ? 358  GLN A CB  1 
ATOM   2714 C CG  . GLN A 1 358 ? 27.386  29.914  -8.288  1.00 38.81 ? 358  GLN A CG  1 
ATOM   2715 C CD  . GLN A 1 358 ? 26.617  30.979  -7.527  1.00 39.63 ? 358  GLN A CD  1 
ATOM   2716 O OE1 . GLN A 1 358 ? 25.387  30.975  -7.502  1.00 41.95 ? 358  GLN A OE1 1 
ATOM   2717 N NE2 . GLN A 1 358 ? 27.340  31.909  -6.913  1.00 39.77 ? 358  GLN A NE2 1 
ATOM   2718 N N   . PHE A 1 359 ? 26.221  25.410  -9.007  1.00 38.03 ? 359  PHE A N   1 
ATOM   2719 C CA  . PHE A 1 359 ? 25.809  24.061  -8.677  1.00 37.48 ? 359  PHE A CA  1 
ATOM   2720 C C   . PHE A 1 359 ? 26.882  23.053  -9.095  1.00 37.86 ? 359  PHE A C   1 
ATOM   2721 O O   . PHE A 1 359 ? 27.306  22.224  -8.296  1.00 37.41 ? 359  PHE A O   1 
ATOM   2722 C CB  . PHE A 1 359 ? 24.466  23.758  -9.327  1.00 37.15 ? 359  PHE A CB  1 
ATOM   2723 C CG  . PHE A 1 359 ? 23.975  22.359  -9.103  1.00 36.17 ? 359  PHE A CG  1 
ATOM   2724 C CD1 . PHE A 1 359 ? 23.787  21.506  -10.168 1.00 35.30 ? 359  PHE A CD1 1 
ATOM   2725 C CD2 . PHE A 1 359 ? 23.694  21.898  -7.825  1.00 35.80 ? 359  PHE A CD2 1 
ATOM   2726 C CE1 . PHE A 1 359 ? 23.336  20.220  -9.972  1.00 34.30 ? 359  PHE A CE1 1 
ATOM   2727 C CE2 . PHE A 1 359 ? 23.253  20.617  -7.623  1.00 34.91 ? 359  PHE A CE2 1 
ATOM   2728 C CZ  . PHE A 1 359 ? 23.066  19.776  -8.704  1.00 35.43 ? 359  PHE A CZ  1 
ATOM   2729 N N   . LEU A 1 360 ? 27.330  23.149  -10.345 1.00 38.36 ? 360  LEU A N   1 
ATOM   2730 C CA  . LEU A 1 360 ? 28.384  22.298  -10.866 1.00 38.74 ? 360  LEU A CA  1 
ATOM   2731 C C   . LEU A 1 360 ? 29.671  22.378  -10.033 1.00 38.71 ? 360  LEU A C   1 
ATOM   2732 O O   . LEU A 1 360 ? 30.345  21.365  -9.808  1.00 39.14 ? 360  LEU A O   1 
ATOM   2733 C CB  . LEU A 1 360 ? 28.660  22.640  -12.335 1.00 39.33 ? 360  LEU A CB  1 
ATOM   2734 C CG  . LEU A 1 360 ? 27.509  22.584  -13.368 1.00 41.10 ? 360  LEU A CG  1 
ATOM   2735 C CD1 . LEU A 1 360 ? 28.030  22.832  -14.797 1.00 43.04 ? 360  LEU A CD1 1 
ATOM   2736 C CD2 . LEU A 1 360 ? 26.703  21.283  -13.330 1.00 40.73 ? 360  LEU A CD2 1 
ATOM   2737 N N   . ALA A 1 361 ? 30.000  23.582  -9.578  1.00 38.25 ? 361  ALA A N   1 
ATOM   2738 C CA  . ALA A 1 361 ? 31.140  23.803  -8.705  1.00 37.93 ? 361  ALA A CA  1 
ATOM   2739 C C   . ALA A 1 361 ? 30.892  23.250  -7.299  1.00 38.05 ? 361  ALA A C   1 
ATOM   2740 O O   . ALA A 1 361 ? 31.798  22.683  -6.680  1.00 38.44 ? 361  ALA A O   1 
ATOM   2741 C CB  . ALA A 1 361 ? 31.483  25.280  -8.657  1.00 37.22 ? 361  ALA A CB  1 
ATOM   2742 N N   . GLY A 1 362 ? 29.666  23.418  -6.798  1.00 38.36 ? 362  GLY A N   1 
ATOM   2743 C CA  . GLY A 1 362 ? 29.276  22.911  -5.486  1.00 37.76 ? 362  GLY A CA  1 
ATOM   2744 C C   . GLY A 1 362 ? 29.355  21.398  -5.412  1.00 38.22 ? 362  GLY A C   1 
ATOM   2745 O O   . GLY A 1 362 ? 29.718  20.832  -4.378  1.00 38.73 ? 362  GLY A O   1 
ATOM   2746 N N   . VAL A 1 363 ? 29.005  20.739  -6.511  1.00 38.23 ? 363  VAL A N   1 
ATOM   2747 C CA  . VAL A 1 363 ? 29.080  19.297  -6.607  1.00 38.01 ? 363  VAL A CA  1 
ATOM   2748 C C   . VAL A 1 363 ? 30.533  18.840  -6.515  1.00 39.22 ? 363  VAL A C   1 
ATOM   2749 O O   . VAL A 1 363 ? 30.814  17.813  -5.896  1.00 40.24 ? 363  VAL A O   1 
ATOM   2750 C CB  . VAL A 1 363 ? 28.410  18.788  -7.891  1.00 37.56 ? 363  VAL A CB  1 
ATOM   2751 C CG1 . VAL A 1 363 ? 28.764  17.330  -8.168  1.00 36.99 ? 363  VAL A CG1 1 
ATOM   2752 C CG2 . VAL A 1 363 ? 26.907  18.955  -7.795  1.00 36.16 ? 363  VAL A CG2 1 
ATOM   2753 N N   . ARG A 1 364 ? 31.457  19.594  -7.109  1.00 39.73 ? 364  ARG A N   1 
ATOM   2754 C CA  . ARG A 1 364 ? 32.874  19.239  -7.038  1.00 40.52 ? 364  ARG A CA  1 
ATOM   2755 C C   . ARG A 1 364 ? 33.381  19.317  -5.606  1.00 40.49 ? 364  ARG A C   1 
ATOM   2756 O O   . ARG A 1 364 ? 34.203  18.498  -5.193  1.00 40.75 ? 364  ARG A O   1 
ATOM   2757 C CB  . ARG A 1 364 ? 33.736  20.133  -7.928  1.00 41.12 ? 364  ARG A CB  1 
ATOM   2758 C CG  . ARG A 1 364 ? 33.479  19.985  -9.417  1.00 43.05 ? 364  ARG A CG  1 
ATOM   2759 C CD  . ARG A 1 364 ? 32.971  18.597  -9.746  1.00 45.42 ? 364  ARG A CD  1 
ATOM   2760 N NE  . ARG A 1 364 ? 34.027  17.598  -9.764  1.00 47.96 ? 364  ARG A NE  1 
ATOM   2761 C CZ  . ARG A 1 364 ? 34.709  17.269  -10.858 1.00 49.48 ? 364  ARG A CZ  1 
ATOM   2762 N NH1 . ARG A 1 364 ? 34.448  17.876  -12.021 1.00 47.85 ? 364  ARG A NH1 1 
ATOM   2763 N NH2 . ARG A 1 364 ? 35.655  16.338  -10.784 1.00 49.11 ? 364  ARG A NH2 1 
ATOM   2764 N N   . ILE A 1 365 ? 32.872  20.287  -4.854  1.00 39.80 ? 365  ILE A N   1 
ATOM   2765 C CA  . ILE A 1 365 ? 33.293  20.476  -3.478  1.00 39.37 ? 365  ILE A CA  1 
ATOM   2766 C C   . ILE A 1 365 ? 32.563  19.531  -2.539  1.00 39.37 ? 365  ILE A C   1 
ATOM   2767 O O   . ILE A 1 365 ? 33.170  18.974  -1.623  1.00 39.07 ? 365  ILE A O   1 
ATOM   2768 C CB  . ILE A 1 365 ? 33.084  21.933  -3.015  1.00 39.21 ? 365  ILE A CB  1 
ATOM   2769 C CG1 . ILE A 1 365 ? 33.799  22.897  -3.963  1.00 38.71 ? 365  ILE A CG1 1 
ATOM   2770 C CG2 . ILE A 1 365 ? 33.563  22.118  -1.567  1.00 38.41 ? 365  ILE A CG2 1 
ATOM   2771 C CD1 . ILE A 1 365 ? 33.371  24.350  -3.810  1.00 39.07 ? 365  ILE A CD1 1 
ATOM   2772 N N   . GLY A 1 366 ? 31.261  19.370  -2.761  1.00 39.79 ? 366  GLY A N   1 
ATOM   2773 C CA  . GLY A 1 366 ? 30.418  18.485  -1.947  1.00 40.17 ? 366  GLY A CA  1 
ATOM   2774 C C   . GLY A 1 366 ? 30.789  17.026  -2.120  1.00 40.96 ? 366  GLY A C   1 
ATOM   2775 O O   . GLY A 1 366 ? 30.649  16.226  -1.195  1.00 42.00 ? 366  GLY A O   1 
ATOM   2776 N N   . VAL A 1 367 ? 31.293  16.667  -3.293  1.00 41.06 ? 367  VAL A N   1 
ATOM   2777 C CA  . VAL A 1 367 ? 31.647  15.288  -3.548  1.00 41.13 ? 367  VAL A CA  1 
ATOM   2778 C C   . VAL A 1 367 ? 33.097  15.274  -3.972  1.00 42.10 ? 367  VAL A C   1 
ATOM   2779 O O   . VAL A 1 367 ? 33.397  14.890  -5.104  1.00 42.64 ? 367  VAL A O   1 
ATOM   2780 C CB  . VAL A 1 367 ? 30.782  14.678  -4.686  1.00 41.05 ? 367  VAL A CB  1 
ATOM   2781 C CG1 . VAL A 1 367 ? 30.747  13.168  -4.572  1.00 39.96 ? 367  VAL A CG1 1 
ATOM   2782 C CG2 . VAL A 1 367 ? 29.363  15.271  -4.698  1.00 39.62 ? 367  VAL A CG2 1 
ATOM   2783 N N   . PRO A 1 368 ? 34.017  15.662  -3.064  1.00 42.60 ? 368  PRO A N   1 
ATOM   2784 C CA  . PRO A 1 368 ? 35.391  15.969  -3.468  1.00 42.83 ? 368  PRO A CA  1 
ATOM   2785 C C   . PRO A 1 368 ? 36.145  14.767  -4.007  1.00 43.69 ? 368  PRO A C   1 
ATOM   2786 O O   . PRO A 1 368 ? 37.184  14.931  -4.622  1.00 44.03 ? 368  PRO A O   1 
ATOM   2787 C CB  . PRO A 1 368 ? 36.032  16.454  -2.174  1.00 42.63 ? 368  PRO A CB  1 
ATOM   2788 C CG  . PRO A 1 368 ? 35.239  15.804  -1.102  1.00 42.43 ? 368  PRO A CG  1 
ATOM   2789 C CD  . PRO A 1 368 ? 33.841  15.783  -1.606  1.00 42.47 ? 368  PRO A CD  1 
ATOM   2790 N N   . GLN A 1 369 ? 35.611  13.574  -3.779  1.00 44.87 ? 369  GLN A N   1 
ATOM   2791 C CA  . GLN A 1 369 ? 36.218  12.318  -4.229  1.00 46.13 ? 369  GLN A CA  1 
ATOM   2792 C C   . GLN A 1 369 ? 35.763  11.902  -5.624  1.00 46.63 ? 369  GLN A C   1 
ATOM   2793 O O   . GLN A 1 369 ? 36.314  10.961  -6.193  1.00 47.33 ? 369  GLN A O   1 
ATOM   2794 C CB  . GLN A 1 369 ? 35.911  11.187  -3.229  1.00 46.25 ? 369  GLN A CB  1 
ATOM   2795 C CG  . GLN A 1 369 ? 36.926  11.045  -2.060  1.00 48.00 ? 369  GLN A CG  1 
ATOM   2796 C CD  . GLN A 1 369 ? 36.945  12.244  -1.080  1.00 49.32 ? 369  GLN A CD  1 
ATOM   2797 O OE1 . GLN A 1 369 ? 36.112  12.341  -0.154  1.00 47.73 ? 369  GLN A OE1 1 
ATOM   2798 N NE2 . GLN A 1 369 ? 37.920  13.143  -1.270  1.00 48.04 ? 369  GLN A NE2 1 
ATOM   2799 N N   . ALA A 1 370 ? 34.755  12.583  -6.168  1.00 47.00 ? 370  ALA A N   1 
ATOM   2800 C CA  . ALA A 1 370 ? 34.221  12.255  -7.498  1.00 47.40 ? 370  ALA A CA  1 
ATOM   2801 C C   . ALA A 1 370 ? 35.144  12.659  -8.638  1.00 47.78 ? 370  ALA A C   1 
ATOM   2802 O O   . ALA A 1 370 ? 35.614  13.795  -8.713  1.00 47.65 ? 370  ALA A O   1 
ATOM   2803 C CB  . ALA A 1 370 ? 32.864  12.891  -7.704  1.00 47.11 ? 370  ALA A CB  1 
ATOM   2804 N N   . SER A 1 371 ? 35.372  11.719  -9.545  1.00 48.57 ? 371  SER A N   1 
ATOM   2805 C CA  . SER A 1 371 ? 36.038  12.011  -10.799 1.00 49.20 ? 371  SER A CA  1 
ATOM   2806 C C   . SER A 1 371 ? 35.142  12.916  -11.647 1.00 49.65 ? 371  SER A C   1 
ATOM   2807 O O   . SER A 1 371 ? 34.056  13.293  -11.222 1.00 49.88 ? 371  SER A O   1 
ATOM   2808 C CB  . SER A 1 371 ? 36.293  10.711  -11.540 1.00 49.01 ? 371  SER A CB  1 
ATOM   2809 O OG  . SER A 1 371 ? 35.070  10.156  -11.982 1.00 49.44 ? 371  SER A OG  1 
ATOM   2810 N N   . ASP A 1 372 ? 35.588  13.252  -12.852 1.00 50.20 ? 372  ASP A N   1 
ATOM   2811 C CA  . ASP A 1 372 ? 34.789  14.089  -13.736 1.00 50.47 ? 372  ASP A CA  1 
ATOM   2812 C C   . ASP A 1 372 ? 33.466  13.448  -14.136 1.00 50.16 ? 372  ASP A C   1 
ATOM   2813 O O   . ASP A 1 372 ? 32.421  14.098  -14.110 1.00 50.37 ? 372  ASP A O   1 
ATOM   2814 C CB  . ASP A 1 372 ? 35.600  14.498  -14.960 1.00 50.86 ? 372  ASP A CB  1 
ATOM   2815 C CG  . ASP A 1 372 ? 36.547  15.649  -14.664 1.00 52.10 ? 372  ASP A CG  1 
ATOM   2816 O OD1 . ASP A 1 372 ? 36.460  16.226  -13.558 1.00 51.10 ? 372  ASP A OD1 1 
ATOM   2817 O OD2 . ASP A 1 372 ? 37.378  15.979  -15.540 1.00 54.94 ? 372  ASP A OD2 1 
ATOM   2818 N N   . LEU A 1 373 ? 33.519  12.170  -14.485 1.00 49.79 ? 373  LEU A N   1 
ATOM   2819 C CA  . LEU A 1 373 ? 32.344  11.443  -14.911 1.00 49.09 ? 373  LEU A CA  1 
ATOM   2820 C C   . LEU A 1 373 ? 31.384  11.267  -13.740 1.00 48.68 ? 373  LEU A C   1 
ATOM   2821 O O   . LEU A 1 373 ? 30.174  11.455  -13.887 1.00 48.72 ? 373  LEU A O   1 
ATOM   2822 C CB  . LEU A 1 373 ? 32.739  10.082  -15.504 1.00 49.04 ? 373  LEU A CB  1 
ATOM   2823 C CG  . LEU A 1 373 ? 31.597  9.255   -16.108 1.00 49.19 ? 373  LEU A CG  1 
ATOM   2824 C CD1 . LEU A 1 373 ? 30.789  10.061  -17.130 1.00 47.92 ? 373  LEU A CD1 1 
ATOM   2825 C CD2 . LEU A 1 373 ? 32.108  7.949   -16.722 1.00 49.28 ? 373  LEU A CD2 1 
ATOM   2826 N N   . ALA A 1 374 ? 31.925  10.906  -12.578 1.00 47.79 ? 374  ALA A N   1 
ATOM   2827 C CA  . ALA A 1 374 ? 31.104  10.714  -11.390 1.00 46.65 ? 374  ALA A CA  1 
ATOM   2828 C C   . ALA A 1 374 ? 30.312  11.971  -11.054 1.00 46.03 ? 374  ALA A C   1 
ATOM   2829 O O   . ALA A 1 374 ? 29.112  11.895  -10.802 1.00 45.66 ? 374  ALA A O   1 
ATOM   2830 C CB  . ALA A 1 374 ? 31.958  10.276  -10.213 1.00 46.69 ? 374  ALA A CB  1 
ATOM   2831 N N   . ALA A 1 375 ? 30.988  13.121  -11.071 1.00 45.38 ? 375  ALA A N   1 
ATOM   2832 C CA  . ALA A 1 375 ? 30.367  14.403  -10.753 1.00 45.19 ? 375  ALA A CA  1 
ATOM   2833 C C   . ALA A 1 375 ? 29.326  14.756  -11.800 1.00 45.47 ? 375  ALA A C   1 
ATOM   2834 O O   . ALA A 1 375 ? 28.277  15.332  -11.497 1.00 45.90 ? 375  ALA A O   1 
ATOM   2835 C CB  . ALA A 1 375 ? 31.413  15.492  -10.664 1.00 45.09 ? 375  ALA A CB  1 
ATOM   2836 N N   . GLU A 1 376 ? 29.624  14.398  -13.040 1.00 45.32 ? 376  GLU A N   1 
ATOM   2837 C CA  . GLU A 1 376 ? 28.682  14.551  -14.123 1.00 45.37 ? 376  GLU A CA  1 
ATOM   2838 C C   . GLU A 1 376 ? 27.400  13.774  -13.799 1.00 44.12 ? 376  GLU A C   1 
ATOM   2839 O O   . GLU A 1 376 ? 26.294  14.310  -13.916 1.00 43.72 ? 376  GLU A O   1 
ATOM   2840 C CB  . GLU A 1 376 ? 29.317  14.027  -15.404 1.00 46.25 ? 376  GLU A CB  1 
ATOM   2841 C CG  . GLU A 1 376 ? 28.521  14.303  -16.638 1.00 50.81 ? 376  GLU A CG  1 
ATOM   2842 C CD  . GLU A 1 376 ? 28.594  15.755  -17.021 1.00 56.08 ? 376  GLU A CD  1 
ATOM   2843 O OE1 . GLU A 1 376 ? 29.678  16.163  -17.524 1.00 58.07 ? 376  GLU A OE1 1 
ATOM   2844 O OE2 . GLU A 1 376 ? 27.575  16.466  -16.800 1.00 57.35 ? 376  GLU A OE2 1 
ATOM   2845 N N   . ALA A 1 377 ? 27.566  12.523  -13.368 1.00 42.59 ? 377  ALA A N   1 
ATOM   2846 C CA  . ALA A 1 377 ? 26.435  11.683  -12.998 1.00 41.62 ? 377  ALA A CA  1 
ATOM   2847 C C   . ALA A 1 377 ? 25.590  12.325  -11.899 1.00 40.99 ? 377  ALA A C   1 
ATOM   2848 O O   . ALA A 1 377 ? 24.363  12.345  -12.003 1.00 40.78 ? 377  ALA A O   1 
ATOM   2849 C CB  . ALA A 1 377 ? 26.890  10.300  -12.581 1.00 40.88 ? 377  ALA A CB  1 
ATOM   2850 N N   . VAL A 1 378 ? 26.254  12.853  -10.866 1.00 40.12 ? 378  VAL A N   1 
ATOM   2851 C CA  . VAL A 1 378 ? 25.575  13.501  -9.746  1.00 39.11 ? 378  VAL A CA  1 
ATOM   2852 C C   . VAL A 1 378 ? 24.744  14.653  -10.272 1.00 39.21 ? 378  VAL A C   1 
ATOM   2853 O O   . VAL A 1 378 ? 23.545  14.753  -9.986  1.00 39.37 ? 378  VAL A O   1 
ATOM   2854 C CB  . VAL A 1 378 ? 26.570  14.018  -8.666  1.00 38.97 ? 378  VAL A CB  1 
ATOM   2855 C CG1 . VAL A 1 378 ? 25.843  14.770  -7.581  1.00 37.21 ? 378  VAL A CG1 1 
ATOM   2856 C CG2 . VAL A 1 378 ? 27.368  12.872  -8.063  1.00 37.78 ? 378  VAL A CG2 1 
ATOM   2857 N N   . VAL A 1 379 ? 25.387  15.502  -11.063 1.00 39.19 ? 379  VAL A N   1 
ATOM   2858 C CA  . VAL A 1 379 ? 24.750  16.685  -11.608 1.00 39.64 ? 379  VAL A CA  1 
ATOM   2859 C C   . VAL A 1 379 ? 23.552  16.281  -12.454 1.00 40.12 ? 379  VAL A C   1 
ATOM   2860 O O   . VAL A 1 379 ? 22.489  16.902  -12.397 1.00 39.82 ? 379  VAL A O   1 
ATOM   2861 C CB  . VAL A 1 379 ? 25.742  17.499  -12.465 1.00 39.70 ? 379  VAL A CB  1 
ATOM   2862 C CG1 . VAL A 1 379 ? 24.991  18.437  -13.405 1.00 37.58 ? 379  VAL A CG1 1 
ATOM   2863 C CG2 . VAL A 1 379 ? 26.698  18.251  -11.560 1.00 39.15 ? 379  VAL A CG2 1 
ATOM   2864 N N   . LEU A 1 380 ? 23.748  15.227  -13.233 1.00 40.74 ? 380  LEU A N   1 
ATOM   2865 C CA  . LEU A 1 380 ? 22.713  14.685  -14.087 1.00 41.63 ? 380  LEU A CA  1 
ATOM   2866 C C   . LEU A 1 380 ? 21.530  14.213  -13.264 1.00 41.33 ? 380  LEU A C   1 
ATOM   2867 O O   . LEU A 1 380 ? 20.388  14.609  -13.518 1.00 41.97 ? 380  LEU A O   1 
ATOM   2868 C CB  . LEU A 1 380 ? 23.282  13.537  -14.905 1.00 42.18 ? 380  LEU A CB  1 
ATOM   2869 C CG  . LEU A 1 380 ? 23.831  13.809  -16.307 1.00 44.43 ? 380  LEU A CG  1 
ATOM   2870 C CD1 . LEU A 1 380 ? 22.753  13.436  -17.329 1.00 46.19 ? 380  LEU A CD1 1 
ATOM   2871 C CD2 . LEU A 1 380 ? 24.389  15.248  -16.524 1.00 45.44 ? 380  LEU A CD2 1 
ATOM   2872 N N   . HIS A 1 381 ? 21.814  13.395  -12.263 1.00 40.62 ? 381  HIS A N   1 
ATOM   2873 C CA  . HIS A 1 381 ? 20.783  12.853  -11.393 1.00 40.40 ? 381  HIS A CA  1 
ATOM   2874 C C   . HIS A 1 381 ? 19.958  13.901  -10.629 1.00 40.06 ? 381  HIS A C   1 
ATOM   2875 O O   . HIS A 1 381 ? 18.758  13.739  -10.475 1.00 40.02 ? 381  HIS A O   1 
ATOM   2876 C CB  . HIS A 1 381 ? 21.415  11.891  -10.403 1.00 40.25 ? 381  HIS A CB  1 
ATOM   2877 C CG  . HIS A 1 381 ? 20.436  11.261  -9.477  1.00 41.07 ? 381  HIS A CG  1 
ATOM   2878 N ND1 . HIS A 1 381 ? 19.860  10.038  -9.729  1.00 43.56 ? 381  HIS A ND1 1 
ATOM   2879 C CD2 . HIS A 1 381 ? 19.925  11.682  -8.299  1.00 43.44 ? 381  HIS A CD2 1 
ATOM   2880 C CE1 . HIS A 1 381 ? 19.041  9.727   -8.742  1.00 44.46 ? 381  HIS A CE1 1 
ATOM   2881 N NE2 . HIS A 1 381 ? 19.063  10.708  -7.859  1.00 44.50 ? 381  HIS A NE2 1 
ATOM   2882 N N   . TYR A 1 382 ? 20.606  14.959  -10.149 1.00 39.52 ? 382  TYR A N   1 
ATOM   2883 C CA  . TYR A 1 382 ? 19.951  15.925  -9.267  1.00 39.07 ? 382  TYR A CA  1 
ATOM   2884 C C   . TYR A 1 382 ? 19.384  17.152  -9.988  1.00 39.32 ? 382  TYR A C   1 
ATOM   2885 O O   . TYR A 1 382 ? 18.625  17.913  -9.400  1.00 39.27 ? 382  TYR A O   1 
ATOM   2886 C CB  . TYR A 1 382 ? 20.909  16.372  -8.156  1.00 38.70 ? 382  TYR A CB  1 
ATOM   2887 C CG  . TYR A 1 382 ? 21.059  15.371  -7.039  1.00 37.01 ? 382  TYR A CG  1 
ATOM   2888 C CD1 . TYR A 1 382 ? 21.978  14.322  -7.135  1.00 36.03 ? 382  TYR A CD1 1 
ATOM   2889 C CD2 . TYR A 1 382 ? 20.283  15.472  -5.882  1.00 36.70 ? 382  TYR A CD2 1 
ATOM   2890 C CE1 . TYR A 1 382 ? 22.105  13.387  -6.115  1.00 35.33 ? 382  TYR A CE1 1 
ATOM   2891 C CE2 . TYR A 1 382 ? 20.415  14.564  -4.845  1.00 35.78 ? 382  TYR A CE2 1 
ATOM   2892 C CZ  . TYR A 1 382 ? 21.323  13.524  -4.970  1.00 36.57 ? 382  TYR A CZ  1 
ATOM   2893 O OH  . TYR A 1 382 ? 21.448  12.622  -3.953  1.00 36.91 ? 382  TYR A OH  1 
ATOM   2894 N N   . THR A 1 383 ? 19.767  17.354  -11.245 1.00 39.80 ? 383  THR A N   1 
ATOM   2895 C CA  . THR A 1 383 ? 19.155  18.373  -12.074 1.00 40.24 ? 383  THR A CA  1 
ATOM   2896 C C   . THR A 1 383 ? 17.716  17.980  -12.310 1.00 40.90 ? 383  THR A C   1 
ATOM   2897 O O   . THR A 1 383 ? 17.438  16.810  -12.568 1.00 41.19 ? 383  THR A O   1 
ATOM   2898 C CB  . THR A 1 383 ? 19.879  18.502  -13.420 1.00 40.12 ? 383  THR A CB  1 
ATOM   2899 O OG1 . THR A 1 383 ? 21.163  19.075  -13.193 1.00 41.29 ? 383  THR A OG1 1 
ATOM   2900 C CG2 . THR A 1 383 ? 19.131  19.416  -14.363 1.00 39.92 ? 383  THR A CG2 1 
ATOM   2901 N N   . ASP A 1 384 ? 16.812  18.947  -12.168 1.00 41.81 ? 384  ASP A N   1 
ATOM   2902 C CA  . ASP A 1 384 ? 15.436  18.818  -12.625 1.00 43.05 ? 384  ASP A CA  1 
ATOM   2903 C C   . ASP A 1 384 ? 15.384  19.302  -14.062 1.00 43.24 ? 384  ASP A C   1 
ATOM   2904 O O   . ASP A 1 384 ? 15.351  20.513  -14.314 1.00 43.44 ? 384  ASP A O   1 
ATOM   2905 C CB  . ASP A 1 384 ? 14.493  19.686  -11.783 1.00 43.58 ? 384  ASP A CB  1 
ATOM   2906 C CG  . ASP A 1 384 ? 13.082  19.793  -12.392 1.00 46.56 ? 384  ASP A CG  1 
ATOM   2907 O OD1 . ASP A 1 384 ? 12.828  19.204  -13.474 1.00 48.29 ? 384  ASP A OD1 1 
ATOM   2908 O OD2 . ASP A 1 384 ? 12.219  20.479  -11.792 1.00 49.69 ? 384  ASP A OD2 1 
ATOM   2909 N N   . TRP A 1 385 ? 15.354  18.371  -15.008 1.00 43.22 ? 385  TRP A N   1 
ATOM   2910 C CA  . TRP A 1 385 ? 15.367  18.751  -16.423 1.00 43.64 ? 385  TRP A CA  1 
ATOM   2911 C C   . TRP A 1 385 ? 14.143  19.546  -16.952 1.00 44.15 ? 385  TRP A C   1 
ATOM   2912 O O   . TRP A 1 385 ? 14.150  20.026  -18.084 1.00 44.69 ? 385  TRP A O   1 
ATOM   2913 C CB  . TRP A 1 385 ? 15.747  17.561  -17.284 1.00 42.67 ? 385  TRP A CB  1 
ATOM   2914 C CG  . TRP A 1 385 ? 17.069  17.058  -16.869 1.00 42.12 ? 385  TRP A CG  1 
ATOM   2915 C CD1 . TRP A 1 385 ? 17.325  16.022  -16.025 1.00 41.23 ? 385  TRP A CD1 1 
ATOM   2916 C CD2 . TRP A 1 385 ? 18.333  17.606  -17.226 1.00 40.59 ? 385  TRP A CD2 1 
ATOM   2917 N NE1 . TRP A 1 385 ? 18.675  15.866  -15.861 1.00 39.94 ? 385  TRP A NE1 1 
ATOM   2918 C CE2 . TRP A 1 385 ? 19.320  16.828  -16.588 1.00 40.10 ? 385  TRP A CE2 1 
ATOM   2919 C CE3 . TRP A 1 385 ? 18.729  18.682  -18.026 1.00 40.98 ? 385  TRP A CE3 1 
ATOM   2920 C CZ2 . TRP A 1 385 ? 20.685  17.086  -16.726 1.00 41.70 ? 385  TRP A CZ2 1 
ATOM   2921 C CZ3 . TRP A 1 385 ? 20.088  18.944  -18.167 1.00 41.32 ? 385  TRP A CZ3 1 
ATOM   2922 C CH2 . TRP A 1 385 ? 21.050  18.149  -17.515 1.00 41.86 ? 385  TRP A CH2 1 
ATOM   2923 N N   . LEU A 1 386 ? 13.117  19.706  -16.127 1.00 44.81 ? 386  LEU A N   1 
ATOM   2924 C CA  . LEU A 1 386 ? 12.032  20.627  -16.461 1.00 45.93 ? 386  LEU A CA  1 
ATOM   2925 C C   . LEU A 1 386 ? 12.492  22.068  -16.249 1.00 46.28 ? 386  LEU A C   1 
ATOM   2926 O O   . LEU A 1 386 ? 12.214  22.943  -17.069 1.00 47.09 ? 386  LEU A O   1 
ATOM   2927 C CB  . LEU A 1 386 ? 10.784  20.339  -15.630 1.00 45.84 ? 386  LEU A CB  1 
ATOM   2928 C CG  . LEU A 1 386 ? 9.997   19.089  -16.024 1.00 47.54 ? 386  LEU A CG  1 
ATOM   2929 C CD1 . LEU A 1 386 ? 9.695   18.170  -14.813 1.00 48.92 ? 386  LEU A CD1 1 
ATOM   2930 C CD2 . LEU A 1 386 ? 8.736   19.490  -16.752 1.00 49.17 ? 386  LEU A CD2 1 
ATOM   2931 N N   . HIS A 1 387 ? 13.199  22.311  -15.149 1.00 46.42 ? 387  HIS A N   1 
ATOM   2932 C CA  . HIS A 1 387 ? 13.696  23.642  -14.850 1.00 46.54 ? 387  HIS A CA  1 
ATOM   2933 C C   . HIS A 1 387 ? 15.185  23.598  -14.477 1.00 45.64 ? 387  HIS A C   1 
ATOM   2934 O O   . HIS A 1 387 ? 15.543  23.948  -13.357 1.00 45.65 ? 387  HIS A O   1 
ATOM   2935 C CB  . HIS A 1 387 ? 12.881  24.267  -13.710 1.00 47.31 ? 387  HIS A CB  1 
ATOM   2936 C CG  . HIS A 1 387 ? 11.410  23.969  -13.757 1.00 49.23 ? 387  HIS A CG  1 
ATOM   2937 N ND1 . HIS A 1 387 ? 10.838  22.931  -13.051 1.00 51.23 ? 387  HIS A ND1 1 
ATOM   2938 C CD2 . HIS A 1 387 ? 10.389  24.594  -14.396 1.00 51.53 ? 387  HIS A CD2 1 
ATOM   2939 C CE1 . HIS A 1 387 ? 9.530   22.926  -13.255 1.00 50.72 ? 387  HIS A CE1 1 
ATOM   2940 N NE2 . HIS A 1 387 ? 9.232   23.921  -14.072 1.00 50.74 ? 387  HIS A NE2 1 
ATOM   2941 N N   . PRO A 1 388 ? 16.061  23.189  -15.422 1.00 45.18 ? 388  PRO A N   1 
ATOM   2942 C CA  . PRO A 1 388 ? 17.478  22.947  -15.099 1.00 44.39 ? 388  PRO A CA  1 
ATOM   2943 C C   . PRO A 1 388 ? 18.232  24.166  -14.615 1.00 43.76 ? 388  PRO A C   1 
ATOM   2944 O O   . PRO A 1 388 ? 19.343  24.028  -14.102 1.00 43.91 ? 388  PRO A O   1 
ATOM   2945 C CB  . PRO A 1 388 ? 18.084  22.484  -16.439 1.00 44.06 ? 388  PRO A CB  1 
ATOM   2946 C CG  . PRO A 1 388 ? 17.168  22.950  -17.472 1.00 44.48 ? 388  PRO A CG  1 
ATOM   2947 C CD  . PRO A 1 388 ? 15.790  22.942  -16.856 1.00 45.28 ? 388  PRO A CD  1 
ATOM   2948 N N   . GLU A 1 389 ? 17.643  25.345  -14.797 1.00 43.27 ? 389  GLU A N   1 
ATOM   2949 C CA  . GLU A 1 389 ? 18.319  26.598  -14.492 1.00 42.54 ? 389  GLU A CA  1 
ATOM   2950 C C   . GLU A 1 389 ? 17.729  27.296  -13.274 1.00 41.45 ? 389  GLU A C   1 
ATOM   2951 O O   . GLU A 1 389 ? 18.185  28.382  -12.900 1.00 41.30 ? 389  GLU A O   1 
ATOM   2952 C CB  . GLU A 1 389 ? 18.297  27.541  -15.709 1.00 43.12 ? 389  GLU A CB  1 
ATOM   2953 C CG  . GLU A 1 389 ? 19.202  27.117  -16.898 1.00 45.21 ? 389  GLU A CG  1 
ATOM   2954 C CD  . GLU A 1 389 ? 20.665  27.539  -16.733 1.00 49.21 ? 389  GLU A CD  1 
ATOM   2955 O OE1 . GLU A 1 389 ? 21.101  27.847  -15.595 1.00 50.62 ? 389  GLU A OE1 1 
ATOM   2956 O OE2 . GLU A 1 389 ? 21.394  27.563  -17.747 1.00 49.82 ? 389  GLU A OE2 1 
ATOM   2957 N N   . ASP A 1 390 ? 16.720  26.679  -12.660 1.00 40.24 ? 390  ASP A N   1 
ATOM   2958 C CA  . ASP A 1 390 ? 16.019  27.298  -11.536 1.00 39.57 ? 390  ASP A CA  1 
ATOM   2959 C C   . ASP A 1 390 ? 16.878  27.370  -10.271 1.00 39.02 ? 390  ASP A C   1 
ATOM   2960 O O   . ASP A 1 390 ? 17.279  26.344  -9.736  1.00 38.09 ? 390  ASP A O   1 
ATOM   2961 C CB  . ASP A 1 390 ? 14.696  26.586  -11.228 1.00 39.62 ? 390  ASP A CB  1 
ATOM   2962 C CG  . ASP A 1 390 ? 13.884  27.322  -10.181 1.00 39.90 ? 390  ASP A CG  1 
ATOM   2963 O OD1 . ASP A 1 390 ? 12.961  28.044  -10.558 1.00 43.33 ? 390  ASP A OD1 1 
ATOM   2964 O OD2 . ASP A 1 390 ? 14.186  27.245  -8.980  1.00 41.85 ? 390  ASP A OD2 1 
ATOM   2965 N N   . PRO A 1 391 ? 17.111  28.590  -9.768  1.00 39.07 ? 391  PRO A N   1 
ATOM   2966 C CA  . PRO A 1 391 ? 18.028  28.824  -8.660  1.00 39.06 ? 391  PRO A CA  1 
ATOM   2967 C C   . PRO A 1 391 ? 17.553  28.180  -7.363  1.00 39.26 ? 391  PRO A C   1 
ATOM   2968 O O   . PRO A 1 391 ? 18.384  27.709  -6.579  1.00 39.28 ? 391  PRO A O   1 
ATOM   2969 C CB  . PRO A 1 391 ? 18.039  30.358  -8.517  1.00 39.17 ? 391  PRO A CB  1 
ATOM   2970 C CG  . PRO A 1 391 ? 17.452  30.888  -9.767  1.00 38.91 ? 391  PRO A CG  1 
ATOM   2971 C CD  . PRO A 1 391 ? 16.484  29.841  -10.227 1.00 39.04 ? 391  PRO A CD  1 
ATOM   2972 N N   . THR A 1 392 ? 16.240  28.165  -7.125  1.00 39.04 ? 392  THR A N   1 
ATOM   2973 C CA  . THR A 1 392 ? 15.721  27.529  -5.916  1.00 38.62 ? 392  THR A CA  1 
ATOM   2974 C C   . THR A 1 392 ? 15.931  26.015  -5.958  1.00 38.48 ? 392  THR A C   1 
ATOM   2975 O O   . THR A 1 392 ? 16.363  25.425  -4.969  1.00 38.28 ? 392  THR A O   1 
ATOM   2976 C CB  . THR A 1 392 ? 14.245  27.884  -5.659  1.00 38.81 ? 392  THR A CB  1 
ATOM   2977 O OG1 . THR A 1 392 ? 14.149  29.268  -5.287  1.00 39.54 ? 392  THR A OG1 1 
ATOM   2978 C CG2 . THR A 1 392 ? 13.664  27.026  -4.522  1.00 37.94 ? 392  THR A CG2 1 
ATOM   2979 N N   . HIS A 1 393 ? 15.627  25.385  -7.092  1.00 38.13 ? 393  HIS A N   1 
ATOM   2980 C CA  . HIS A 1 393 ? 15.850  23.965  -7.205  1.00 38.22 ? 393  HIS A CA  1 
ATOM   2981 C C   . HIS A 1 393 ? 17.324  23.676  -7.014  1.00 37.07 ? 393  HIS A C   1 
ATOM   2982 O O   . HIS A 1 393 ? 17.693  22.853  -6.197  1.00 37.98 ? 393  HIS A O   1 
ATOM   2983 C CB  . HIS A 1 393 ? 15.402  23.393  -8.545  1.00 39.10 ? 393  HIS A CB  1 
ATOM   2984 C CG  . HIS A 1 393 ? 15.869  21.984  -8.753  1.00 43.15 ? 393  HIS A CG  1 
ATOM   2985 N ND1 . HIS A 1 393 ? 15.238  20.898  -8.175  1.00 47.98 ? 393  HIS A ND1 1 
ATOM   2986 C CD2 . HIS A 1 393 ? 16.951  21.485  -9.404  1.00 46.02 ? 393  HIS A CD2 1 
ATOM   2987 C CE1 . HIS A 1 393 ? 15.885  19.789  -8.501  1.00 48.56 ? 393  HIS A CE1 1 
ATOM   2988 N NE2 . HIS A 1 393 ? 16.931  20.119  -9.243  1.00 47.02 ? 393  HIS A NE2 1 
ATOM   2989 N N   . LEU A 1 394 ? 18.161  24.377  -7.763  1.00 35.73 ? 394  LEU A N   1 
ATOM   2990 C CA  . LEU A 1 394 ? 19.597  24.197  -7.727  1.00 34.01 ? 394  LEU A CA  1 
ATOM   2991 C C   . LEU A 1 394 ? 20.177  24.354  -6.306  1.00 33.90 ? 394  LEU A C   1 
ATOM   2992 O O   . LEU A 1 394 ? 21.069  23.614  -5.896  1.00 32.73 ? 394  LEU A O   1 
ATOM   2993 C CB  . LEU A 1 394 ? 20.246  25.158  -8.720  1.00 33.53 ? 394  LEU A CB  1 
ATOM   2994 C CG  . LEU A 1 394 ? 19.993  24.833  -10.203 1.00 31.66 ? 394  LEU A CG  1 
ATOM   2995 C CD1 . LEU A 1 394 ? 20.286  26.038  -11.105 1.00 28.52 ? 394  LEU A CD1 1 
ATOM   2996 C CD2 . LEU A 1 394 ? 20.768  23.579  -10.673 1.00 28.26 ? 394  LEU A CD2 1 
ATOM   2997 N N   . ARG A 1 395 ? 19.645  25.312  -5.558  1.00 33.80 ? 395  ARG A N   1 
ATOM   2998 C CA  . ARG A 1 395 ? 20.023  25.478  -4.184  1.00 34.00 ? 395  ARG A CA  1 
ATOM   2999 C C   . ARG A 1 395 ? 19.657  24.242  -3.369  1.00 34.93 ? 395  ARG A C   1 
ATOM   3000 O O   . ARG A 1 395 ? 20.517  23.681  -2.673  1.00 35.26 ? 395  ARG A O   1 
ATOM   3001 C CB  . ARG A 1 395 ? 19.382  26.722  -3.612  1.00 33.53 ? 395  ARG A CB  1 
ATOM   3002 C CG  . ARG A 1 395 ? 19.541  26.856  -2.125  1.00 33.64 ? 395  ARG A CG  1 
ATOM   3003 C CD  . ARG A 1 395 ? 18.208  26.702  -1.484  1.00 35.62 ? 395  ARG A CD  1 
ATOM   3004 N NE  . ARG A 1 395 ? 17.568  27.995  -1.336  1.00 36.15 ? 395  ARG A NE  1 
ATOM   3005 C CZ  . ARG A 1 395 ? 16.261  28.188  -1.188  1.00 35.88 ? 395  ARG A CZ  1 
ATOM   3006 N NH1 . ARG A 1 395 ? 15.414  27.166  -1.174  1.00 31.49 ? 395  ARG A NH1 1 
ATOM   3007 N NH2 . ARG A 1 395 ? 15.810  29.435  -1.044  1.00 37.45 ? 395  ARG A NH2 1 
ATOM   3008 N N   . ASP A 1 396 ? 18.402  23.800  -3.472  1.00 35.27 ? 396  ASP A N   1 
ATOM   3009 C CA  . ASP A 1 396 ? 17.938  22.630  -2.723  1.00 35.40 ? 396  ASP A CA  1 
ATOM   3010 C C   . ASP A 1 396 ? 18.635  21.353  -3.182  1.00 35.28 ? 396  ASP A C   1 
ATOM   3011 O O   . ASP A 1 396 ? 18.829  20.412  -2.397  1.00 35.14 ? 396  ASP A O   1 
ATOM   3012 C CB  . ASP A 1 396 ? 16.418  22.472  -2.832  1.00 35.56 ? 396  ASP A CB  1 
ATOM   3013 C CG  . ASP A 1 396 ? 15.651  23.660  -2.223  1.00 36.80 ? 396  ASP A CG  1 
ATOM   3014 O OD1 . ASP A 1 396 ? 16.193  24.357  -1.325  1.00 35.23 ? 396  ASP A OD1 1 
ATOM   3015 O OD2 . ASP A 1 396 ? 14.498  23.891  -2.648  1.00 37.85 ? 396  ASP A OD2 1 
ATOM   3016 N N   . ALA A 1 397 ? 19.022  21.332  -4.448  1.00 35.03 ? 397  ALA A N   1 
ATOM   3017 C CA  . ALA A 1 397 ? 19.627  20.145  -5.023  1.00 35.28 ? 397  ALA A CA  1 
ATOM   3018 C C   . ALA A 1 397 ? 21.025  20.011  -4.467  1.00 35.02 ? 397  ALA A C   1 
ATOM   3019 O O   . ALA A 1 397 ? 21.472  18.903  -4.107  1.00 35.37 ? 397  ALA A O   1 
ATOM   3020 C CB  . ALA A 1 397 ? 19.658  20.235  -6.537  1.00 35.62 ? 397  ALA A CB  1 
ATOM   3021 N N   . MET A 1 398 ? 21.699  21.152  -4.371  1.00 34.07 ? 398  MET A N   1 
ATOM   3022 C CA  . MET A 1 398 ? 23.027  21.208  -3.803  1.00 33.21 ? 398  MET A CA  1 
ATOM   3023 C C   . MET A 1 398 ? 22.981  20.685  -2.378  1.00 33.12 ? 398  MET A C   1 
ATOM   3024 O O   . MET A 1 398 ? 23.878  19.957  -1.957  1.00 33.04 ? 398  MET A O   1 
ATOM   3025 C CB  . MET A 1 398 ? 23.580  22.636  -3.819  1.00 32.62 ? 398  MET A CB  1 
ATOM   3026 C CG  . MET A 1 398 ? 25.050  22.720  -3.444  1.00 31.79 ? 398  MET A CG  1 
ATOM   3027 S SD  . MET A 1 398 ? 26.076  21.883  -4.655  1.00 31.77 ? 398  MET A SD  1 
ATOM   3028 C CE  . MET A 1 398 ? 26.534  20.410  -3.780  1.00 31.35 ? 398  MET A CE  1 
ATOM   3029 N N   . SER A 1 399 ? 21.950  21.081  -1.638  1.00 32.43 ? 399  SER A N   1 
ATOM   3030 C CA  . SER A 1 399 ? 21.784  20.612  -0.279  1.00 32.42 ? 399  SER A CA  1 
ATOM   3031 C C   . SER A 1 399 ? 21.577  19.100  -0.292  1.00 32.44 ? 399  SER A C   1 
ATOM   3032 O O   . SER A 1 399 ? 22.242  18.374  0.434   1.00 32.54 ? 399  SER A O   1 
ATOM   3033 C CB  . SER A 1 399 ? 20.606  21.308  0.381   1.00 31.97 ? 399  SER A CB  1 
ATOM   3034 O OG  . SER A 1 399 ? 20.274  20.685  1.609   1.00 33.18 ? 399  SER A OG  1 
ATOM   3035 N N   . ALA A 1 400 ? 20.693  18.639  -1.171  1.00 32.61 ? 400  ALA A N   1 
ATOM   3036 C CA  . ALA A 1 400 ? 20.317  17.236  -1.260  1.00 32.70 ? 400  ALA A CA  1 
ATOM   3037 C C   . ALA A 1 400 ? 21.536  16.377  -1.551  1.00 32.91 ? 400  ALA A C   1 
ATOM   3038 O O   . ALA A 1 400 ? 21.717  15.321  -0.956  1.00 32.33 ? 400  ALA A O   1 
ATOM   3039 C CB  . ALA A 1 400 ? 19.241  17.036  -2.325  1.00 32.30 ? 400  ALA A CB  1 
ATOM   3040 N N   . VAL A 1 401 ? 22.376  16.864  -2.461  1.00 33.58 ? 401  VAL A N   1 
ATOM   3041 C CA  . VAL A 1 401 ? 23.586  16.162  -2.873  1.00 33.52 ? 401  VAL A CA  1 
ATOM   3042 C C   . VAL A 1 401 ? 24.468  15.926  -1.661  1.00 33.81 ? 401  VAL A C   1 
ATOM   3043 O O   . VAL A 1 401 ? 24.932  14.815  -1.422  1.00 34.39 ? 401  VAL A O   1 
ATOM   3044 C CB  . VAL A 1 401 ? 24.349  16.975  -3.944  1.00 33.56 ? 401  VAL A CB  1 
ATOM   3045 C CG1 . VAL A 1 401 ? 25.772  16.473  -4.110  1.00 32.93 ? 401  VAL A CG1 1 
ATOM   3046 C CG2 . VAL A 1 401 ? 23.600  16.926  -5.265  1.00 32.22 ? 401  VAL A CG2 1 
ATOM   3047 N N   . VAL A 1 402 ? 24.659  16.969  -0.872  1.00 33.47 ? 402  VAL A N   1 
ATOM   3048 C CA  . VAL A 1 402 ? 25.586  16.897  0.221   1.00 33.67 ? 402  VAL A CA  1 
ATOM   3049 C C   . VAL A 1 402 ? 24.960  16.085  1.333   1.00 34.25 ? 402  VAL A C   1 
ATOM   3050 O O   . VAL A 1 402 ? 25.613  15.213  1.932   1.00 34.45 ? 402  VAL A O   1 
ATOM   3051 C CB  . VAL A 1 402 ? 25.985  18.299  0.682   1.00 33.58 ? 402  VAL A CB  1 
ATOM   3052 C CG1 . VAL A 1 402 ? 26.718  18.242  2.004   1.00 33.14 ? 402  VAL A CG1 1 
ATOM   3053 C CG2 . VAL A 1 402 ? 26.852  18.946  -0.383  1.00 32.90 ? 402  VAL A CG2 1 
ATOM   3054 N N   . GLY A 1 403 ? 23.681  16.362  1.576   1.00 34.41 ? 403  GLY A N   1 
ATOM   3055 C CA  . GLY A 1 403 ? 22.882  15.610  2.535   1.00 34.25 ? 403  GLY A CA  1 
ATOM   3056 C C   . GLY A 1 403 ? 22.857  14.116  2.261   1.00 34.45 ? 403  GLY A C   1 
ATOM   3057 O O   . GLY A 1 403 ? 23.124  13.326  3.168   1.00 34.95 ? 403  GLY A O   1 
ATOM   3058 N N   . ASP A 1 404 ? 22.551  13.736  1.018   1.00 33.73 ? 404  ASP A N   1 
ATOM   3059 C CA  . ASP A 1 404 ? 22.374  12.335  0.646   1.00 33.58 ? 404  ASP A CA  1 
ATOM   3060 C C   . ASP A 1 404 ? 23.654  11.547  0.664   1.00 33.69 ? 404  ASP A C   1 
ATOM   3061 O O   . ASP A 1 404 ? 23.678  10.414  1.125   1.00 34.30 ? 404  ASP A O   1 
ATOM   3062 C CB  . ASP A 1 404 ? 21.806  12.215  -0.762  1.00 33.29 ? 404  ASP A CB  1 
ATOM   3063 C CG  . ASP A 1 404 ? 20.447  12.797  -0.877  1.00 33.09 ? 404  ASP A CG  1 
ATOM   3064 O OD1 . ASP A 1 404 ? 19.758  12.968  0.163   1.00 31.64 ? 404  ASP A OD1 1 
ATOM   3065 O OD2 . ASP A 1 404 ? 20.071  13.089  -2.023  1.00 35.10 ? 404  ASP A OD2 1 
ATOM   3066 N N   . HIS A 1 405 ? 24.702  12.150  0.119   1.00 33.41 ? 405  HIS A N   1 
ATOM   3067 C CA  . HIS A 1 405 ? 25.987  11.510  -0.052  1.00 32.85 ? 405  HIS A CA  1 
ATOM   3068 C C   . HIS A 1 405 ? 26.639  11.251  1.296   1.00 33.03 ? 405  HIS A C   1 
ATOM   3069 O O   . HIS A 1 405 ? 27.287  10.225  1.499   1.00 33.10 ? 405  HIS A O   1 
ATOM   3070 C CB  . HIS A 1 405 ? 26.866  12.414  -0.916  1.00 32.47 ? 405  HIS A CB  1 
ATOM   3071 C CG  . HIS A 1 405 ? 28.293  11.987  -1.009  1.00 31.40 ? 405  HIS A CG  1 
ATOM   3072 N ND1 . HIS A 1 405 ? 28.666  10.710  -1.361  1.00 30.65 ? 405  HIS A ND1 1 
ATOM   3073 C CD2 . HIS A 1 405 ? 29.442  12.679  -0.822  1.00 31.74 ? 405  HIS A CD2 1 
ATOM   3074 C CE1 . HIS A 1 405 ? 29.984  10.632  -1.392  1.00 30.87 ? 405  HIS A CE1 1 
ATOM   3075 N NE2 . HIS A 1 405 ? 30.478  11.812  -1.064  1.00 31.40 ? 405  HIS A NE2 1 
ATOM   3076 N N   . ASN A 1 406 ? 26.456  12.177  2.227   1.00 33.03 ? 406  ASN A N   1 
ATOM   3077 C CA  . ASN A 1 406 ? 27.140  12.074  3.505   1.00 32.78 ? 406  ASN A CA  1 
ATOM   3078 C C   . ASN A 1 406 ? 26.347  11.414  4.599   1.00 32.64 ? 406  ASN A C   1 
ATOM   3079 O O   . ASN A 1 406 ? 26.919  10.826  5.504   1.00 32.96 ? 406  ASN A O   1 
ATOM   3080 C CB  . ASN A 1 406 ? 27.582  13.446  3.955   1.00 32.79 ? 406  ASN A CB  1 
ATOM   3081 C CG  . ASN A 1 406 ? 28.711  13.970  3.123   1.00 32.84 ? 406  ASN A CG  1 
ATOM   3082 O OD1 . ASN A 1 406 ? 29.750  13.327  3.020   1.00 33.50 ? 406  ASN A OD1 1 
ATOM   3083 N ND2 . ASN A 1 406 ? 28.519  15.136  2.514   1.00 32.00 ? 406  ASN A ND2 1 
ATOM   3084 N N   . VAL A 1 407 ? 25.026  11.505  4.531   1.00 32.87 ? 407  VAL A N   1 
ATOM   3085 C CA  . VAL A 1 407 ? 24.213  11.032  5.639   1.00 32.68 ? 407  VAL A CA  1 
ATOM   3086 C C   . VAL A 1 407 ? 23.101  10.106  5.205   1.00 33.58 ? 407  VAL A C   1 
ATOM   3087 O O   . VAL A 1 407 ? 23.078  8.943   5.645   1.00 33.78 ? 407  VAL A O   1 
ATOM   3088 C CB  . VAL A 1 407 ? 23.609  12.185  6.463   1.00 32.42 ? 407  VAL A CB  1 
ATOM   3089 C CG1 . VAL A 1 407 ? 22.790  11.623  7.611   1.00 31.44 ? 407  VAL A CG1 1 
ATOM   3090 C CG2 . VAL A 1 407 ? 24.705  13.132  6.987   1.00 31.78 ? 407  VAL A CG2 1 
ATOM   3091 N N   . VAL A 1 408 ? 22.183  10.602  4.361   1.00 33.86 ? 408  VAL A N   1 
ATOM   3092 C CA  . VAL A 1 408 ? 20.935  9.880   4.104   1.00 34.03 ? 408  VAL A CA  1 
ATOM   3093 C C   . VAL A 1 408 ? 21.219  8.513   3.480   1.00 34.82 ? 408  VAL A C   1 
ATOM   3094 O O   . VAL A 1 408 ? 20.664  7.507   3.926   1.00 34.97 ? 408  VAL A O   1 
ATOM   3095 C CB  . VAL A 1 408 ? 19.927  10.676  3.255   1.00 34.10 ? 408  VAL A CB  1 
ATOM   3096 C CG1 . VAL A 1 408 ? 18.597  9.937   3.183   1.00 33.76 ? 408  VAL A CG1 1 
ATOM   3097 C CG2 . VAL A 1 408 ? 19.693  12.065  3.846   1.00 34.12 ? 408  VAL A CG2 1 
ATOM   3098 N N   . CYS A 1 409 ? 22.119  8.474   2.496   1.00 34.90 ? 409  CYS A N   1 
ATOM   3099 C CA  . CYS A 1 409 ? 22.414  7.236   1.805   1.00 35.23 ? 409  CYS A CA  1 
ATOM   3100 C C   . CYS A 1 409 ? 23.309  6.293   2.604   1.00 34.97 ? 409  CYS A C   1 
ATOM   3101 O O   . CYS A 1 409 ? 23.042  5.093   2.638   1.00 35.69 ? 409  CYS A O   1 
ATOM   3102 C CB  . CYS A 1 409 ? 22.900  7.480   0.369   1.00 35.43 ? 409  CYS A CB  1 
ATOM   3103 S SG  . CYS A 1 409 ? 21.594  8.261   -0.642  1.00 37.79 ? 409  CYS A SG  1 
ATOM   3104 N N   . PRO A 1 410 ? 24.373  6.811   3.244   1.00 34.50 ? 410  PRO A N   1 
ATOM   3105 C CA  . PRO A 1 410 ? 25.014  6.016   4.306   1.00 33.96 ? 410  PRO A CA  1 
ATOM   3106 C C   . PRO A 1 410 ? 24.046  5.369   5.326   1.00 33.33 ? 410  PRO A C   1 
ATOM   3107 O O   . PRO A 1 410 ? 24.176  4.183   5.624   1.00 33.07 ? 410  PRO A O   1 
ATOM   3108 C CB  . PRO A 1 410 ? 25.924  7.034   4.970   1.00 33.42 ? 410  PRO A CB  1 
ATOM   3109 C CG  . PRO A 1 410 ? 26.340  7.887   3.829   1.00 33.52 ? 410  PRO A CG  1 
ATOM   3110 C CD  . PRO A 1 410 ? 25.111  8.061   2.997   1.00 34.02 ? 410  PRO A CD  1 
ATOM   3111 N N   . VAL A 1 411 ? 23.087  6.126   5.838   1.00 33.17 ? 411  VAL A N   1 
ATOM   3112 C CA  . VAL A 1 411 ? 22.094  5.568   6.764   1.00 33.52 ? 411  VAL A CA  1 
ATOM   3113 C C   . VAL A 1 411 ? 21.245  4.469   6.104   1.00 33.97 ? 411  VAL A C   1 
ATOM   3114 O O   . VAL A 1 411 ? 20.992  3.436   6.713   1.00 33.51 ? 411  VAL A O   1 
ATOM   3115 C CB  . VAL A 1 411 ? 21.207  6.659   7.387   1.00 33.06 ? 411  VAL A CB  1 
ATOM   3116 C CG1 . VAL A 1 411 ? 20.013  6.058   8.091   1.00 33.46 ? 411  VAL A CG1 1 
ATOM   3117 C CG2 . VAL A 1 411 ? 22.004  7.462   8.370   1.00 33.37 ? 411  VAL A CG2 1 
ATOM   3118 N N   . ALA A 1 412 ? 20.842  4.681   4.855   1.00 34.70 ? 412  ALA A N   1 
ATOM   3119 C CA  . ALA A 1 412 ? 20.105  3.667   4.109   1.00 35.86 ? 412  ALA A CA  1 
ATOM   3120 C C   . ALA A 1 412 ? 20.948  2.404   3.915   1.00 36.43 ? 412  ALA A C   1 
ATOM   3121 O O   . ALA A 1 412 ? 20.480  1.306   4.174   1.00 36.53 ? 412  ALA A O   1 
ATOM   3122 C CB  . ALA A 1 412 ? 19.632  4.215   2.774   1.00 35.80 ? 412  ALA A CB  1 
ATOM   3123 N N   . GLN A 1 413 ? 22.192  2.575   3.486   1.00 37.08 ? 413  GLN A N   1 
ATOM   3124 C CA  . GLN A 1 413 ? 23.107  1.464   3.335   1.00 38.65 ? 413  GLN A CA  1 
ATOM   3125 C C   . GLN A 1 413 ? 23.222  0.723   4.680   1.00 39.12 ? 413  GLN A C   1 
ATOM   3126 O O   . GLN A 1 413 ? 23.086  -0.503  4.736   1.00 38.75 ? 413  GLN A O   1 
ATOM   3127 C CB  . GLN A 1 413 ? 24.459  1.970   2.808   1.00 39.06 ? 413  GLN A CB  1 
ATOM   3128 C CG  . GLN A 1 413 ? 25.552  0.920   2.596   1.00 42.69 ? 413  GLN A CG  1 
ATOM   3129 C CD  . GLN A 1 413 ? 25.201  -0.143  1.535   1.00 48.54 ? 413  GLN A CD  1 
ATOM   3130 O OE1 . GLN A 1 413 ? 24.367  0.089   0.640   1.00 50.35 ? 413  GLN A OE1 1 
ATOM   3131 N NE2 . GLN A 1 413 ? 25.847  -1.321  1.636   1.00 47.80 ? 413  GLN A NE2 1 
ATOM   3132 N N   . LEU A 1 414 ? 23.413  1.473   5.767   1.00 39.73 ? 414  LEU A N   1 
ATOM   3133 C CA  . LEU A 1 414 ? 23.529  0.867   7.090   1.00 39.86 ? 414  LEU A CA  1 
ATOM   3134 C C   . LEU A 1 414 ? 22.268  0.116   7.483   1.00 40.21 ? 414  LEU A C   1 
ATOM   3135 O O   . LEU A 1 414 ? 22.353  -1.073  7.804   1.00 40.32 ? 414  LEU A O   1 
ATOM   3136 C CB  . LEU A 1 414 ? 23.895  1.905   8.154   1.00 39.81 ? 414  LEU A CB  1 
ATOM   3137 C CG  . LEU A 1 414 ? 24.085  1.447   9.602   1.00 38.99 ? 414  LEU A CG  1 
ATOM   3138 C CD1 . LEU A 1 414 ? 25.318  0.589   9.777   1.00 40.46 ? 414  LEU A CD1 1 
ATOM   3139 C CD2 . LEU A 1 414 ? 24.209  2.662   10.470  1.00 39.42 ? 414  LEU A CD2 1 
ATOM   3140 N N   . ALA A 1 415 ? 21.119  0.799   7.443   1.00 40.30 ? 415  ALA A N   1 
ATOM   3141 C CA  . ALA A 1 415 ? 19.827  0.214   7.816   1.00 40.92 ? 415  ALA A CA  1 
ATOM   3142 C C   . ALA A 1 415 ? 19.547  -1.051  7.003   1.00 42.38 ? 415  ALA A C   1 
ATOM   3143 O O   . ALA A 1 415 ? 19.175  -2.098  7.555   1.00 42.19 ? 415  ALA A O   1 
ATOM   3144 C CB  . ALA A 1 415 ? 18.707  1.225   7.646   1.00 40.01 ? 415  ALA A CB  1 
ATOM   3145 N N   . GLY A 1 416 ? 19.758  -0.948  5.691   1.00 43.73 ? 416  GLY A N   1 
ATOM   3146 C CA  . GLY A 1 416 ? 19.620  -2.072  4.782   1.00 45.65 ? 416  GLY A CA  1 
ATOM   3147 C C   . GLY A 1 416 ? 20.485  -3.262  5.166   1.00 46.86 ? 416  GLY A C   1 
ATOM   3148 O O   . GLY A 1 416 ? 19.980  -4.375  5.323   1.00 47.55 ? 416  GLY A O   1 
ATOM   3149 N N   . ARG A 1 417 ? 21.785  -3.040  5.319   1.00 47.51 ? 417  ARG A N   1 
ATOM   3150 C CA  . ARG A 1 417 ? 22.687  -4.136  5.620   1.00 48.19 ? 417  ARG A CA  1 
ATOM   3151 C C   . ARG A 1 417 ? 22.361  -4.769  6.967   1.00 48.33 ? 417  ARG A C   1 
ATOM   3152 O O   . ARG A 1 417 ? 22.213  -5.986  7.058   1.00 48.57 ? 417  ARG A O   1 
ATOM   3153 C CB  . ARG A 1 417 ? 24.148  -3.696  5.554   1.00 48.27 ? 417  ARG A CB  1 
ATOM   3154 C CG  . ARG A 1 417 ? 24.651  -3.264  4.165   1.00 51.63 ? 417  ARG A CG  1 
ATOM   3155 C CD  . ARG A 1 417 ? 23.911  -3.913  2.971   1.00 57.92 ? 417  ARG A CD  1 
ATOM   3156 N NE  . ARG A 1 417 ? 24.080  -5.367  2.894   1.00 62.58 ? 417  ARG A NE  1 
ATOM   3157 C CZ  . ARG A 1 417 ? 24.877  -6.001  2.034   1.00 65.71 ? 417  ARG A CZ  1 
ATOM   3158 N NH1 . ARG A 1 417 ? 25.608  -5.323  1.146   1.00 66.75 ? 417  ARG A NH1 1 
ATOM   3159 N NH2 . ARG A 1 417 ? 24.947  -7.329  2.067   1.00 67.35 ? 417  ARG A NH2 1 
ATOM   3160 N N   . LEU A 1 418 ? 22.233  -3.944  8.004   1.00 48.55 ? 418  LEU A N   1 
ATOM   3161 C CA  . LEU A 1 418 ? 21.900  -4.436  9.338   1.00 48.24 ? 418  LEU A CA  1 
ATOM   3162 C C   . LEU A 1 418 ? 20.607  -5.266  9.367   1.00 48.53 ? 418  LEU A C   1 
ATOM   3163 O O   . LEU A 1 418 ? 20.601  -6.372  9.913   1.00 48.44 ? 418  LEU A O   1 
ATOM   3164 C CB  . LEU A 1 418 ? 21.817  -3.290  10.339  1.00 47.81 ? 418  LEU A CB  1 
ATOM   3165 C CG  . LEU A 1 418 ? 23.064  -2.454  10.621  1.00 47.21 ? 418  LEU A CG  1 
ATOM   3166 C CD1 . LEU A 1 418 ? 22.771  -1.519  11.781  1.00 45.04 ? 418  LEU A CD1 1 
ATOM   3167 C CD2 . LEU A 1 418 ? 24.297  -3.294  10.902  1.00 44.65 ? 418  LEU A CD2 1 
ATOM   3168 N N   . ALA A 1 419 ? 19.531  -4.750  8.770   1.00 48.75 ? 419  ALA A N   1 
ATOM   3169 C CA  . ALA A 1 419 ? 18.270  -5.491  8.686   1.00 49.31 ? 419  ALA A CA  1 
ATOM   3170 C C   . ALA A 1 419 ? 18.457  -6.860  8.004   1.00 49.92 ? 419  ALA A C   1 
ATOM   3171 O O   . ALA A 1 419 ? 18.114  -7.907  8.575   1.00 49.93 ? 419  ALA A O   1 
ATOM   3172 C CB  . ALA A 1 419 ? 17.202  -4.669  7.974   1.00 49.12 ? 419  ALA A CB  1 
ATOM   3173 N N   . ALA A 1 420 ? 19.039  -6.844  6.805   1.00 50.40 ? 420  ALA A N   1 
ATOM   3174 C CA  . ALA A 1 420 ? 19.323  -8.065  6.054   1.00 50.74 ? 420  ALA A CA  1 
ATOM   3175 C C   . ALA A 1 420 ? 20.136  -9.090  6.836   1.00 50.88 ? 420  ALA A C   1 
ATOM   3176 O O   . ALA A 1 420 ? 20.222  -10.247 6.429   1.00 51.30 ? 420  ALA A O   1 
ATOM   3177 C CB  . ALA A 1 420 ? 20.035  -7.731  4.737   1.00 50.74 ? 420  ALA A CB  1 
ATOM   3178 N N   . GLN A 1 421 ? 20.730  -8.679  7.952   1.00 50.98 ? 421  GLN A N   1 
ATOM   3179 C CA  . GLN A 1 421 ? 21.680  -9.553  8.657   1.00 51.04 ? 421  GLN A CA  1 
ATOM   3180 C C   . GLN A 1 421 ? 21.368  -9.768  10.137  1.00 50.42 ? 421  GLN A C   1 
ATOM   3181 O O   . GLN A 1 421 ? 22.275  -9.975  10.963  1.00 50.08 ? 421  GLN A O   1 
ATOM   3182 C CB  . GLN A 1 421 ? 23.113  -9.053  8.456   1.00 51.22 ? 421  GLN A CB  1 
ATOM   3183 C CG  . GLN A 1 421 ? 23.586  -9.172  7.011   1.00 53.29 ? 421  GLN A CG  1 
ATOM   3184 C CD  . GLN A 1 421 ? 24.663  -8.170  6.664   1.00 57.25 ? 421  GLN A CD  1 
ATOM   3185 O OE1 . GLN A 1 421 ? 25.070  -8.054  5.504   1.00 59.00 ? 421  GLN A OE1 1 
ATOM   3186 N NE2 . GLN A 1 421 ? 25.130  -7.429  7.668   1.00 58.25 ? 421  GLN A NE2 1 
ATOM   3187 N N   . GLY A 1 422 ? 20.079  -9.698  10.461  1.00 49.76 ? 422  GLY A N   1 
ATOM   3188 C CA  . GLY A 1 422 ? 19.604  -10.064 11.789  1.00 48.95 ? 422  GLY A CA  1 
ATOM   3189 C C   . GLY A 1 422 ? 19.237  -8.948  12.741  1.00 48.21 ? 422  GLY A C   1 
ATOM   3190 O O   . GLY A 1 422 ? 18.742  -9.212  13.836  1.00 48.62 ? 422  GLY A O   1 
ATOM   3191 N N   . ALA A 1 423 ? 19.480  -7.701  12.362  1.00 47.21 ? 423  ALA A N   1 
ATOM   3192 C CA  . ALA A 1 423 ? 19.254  -6.617  13.314  1.00 46.14 ? 423  ALA A CA  1 
ATOM   3193 C C   . ALA A 1 423 ? 17.797  -6.284  13.362  1.00 45.34 ? 423  ALA A C   1 
ATOM   3194 O O   . ALA A 1 423 ? 17.088  -6.479  12.388  1.00 45.26 ? 423  ALA A O   1 
ATOM   3195 C CB  . ALA A 1 423 ? 20.059  -5.392  12.952  1.00 46.26 ? 423  ALA A CB  1 
ATOM   3196 N N   . ARG A 1 424 ? 17.344  -5.822  14.519  1.00 44.87 ? 424  ARG A N   1 
ATOM   3197 C CA  . ARG A 1 424 ? 16.082  -5.119  14.592  1.00 44.30 ? 424  ARG A CA  1 
ATOM   3198 C C   . ARG A 1 424 ? 16.456  -3.667  14.385  1.00 43.51 ? 424  ARG A C   1 
ATOM   3199 O O   . ARG A 1 424 ? 17.158  -3.072  15.210  1.00 43.35 ? 424  ARG A O   1 
ATOM   3200 C CB  . ARG A 1 424 ? 15.388  -5.324  15.940  1.00 44.50 ? 424  ARG A CB  1 
ATOM   3201 C CG  . ARG A 1 424 ? 13.903  -4.991  15.888  1.00 47.00 ? 424  ARG A CG  1 
ATOM   3202 C CD  . ARG A 1 424 ? 13.044  -5.964  16.723  1.00 52.34 ? 424  ARG A CD  1 
ATOM   3203 N NE  . ARG A 1 424 ? 12.456  -5.364  17.930  1.00 54.82 ? 424  ARG A NE  1 
ATOM   3204 C CZ  . ARG A 1 424 ? 12.802  -5.673  19.185  1.00 57.61 ? 424  ARG A CZ  1 
ATOM   3205 N NH1 . ARG A 1 424 ? 13.752  -6.579  19.427  1.00 59.43 ? 424  ARG A NH1 1 
ATOM   3206 N NH2 . ARG A 1 424 ? 12.197  -5.078  20.208  1.00 56.71 ? 424  ARG A NH2 1 
ATOM   3207 N N   . VAL A 1 425 ? 16.018  -3.115  13.261  1.00 42.74 ? 425  VAL A N   1 
ATOM   3208 C CA  . VAL A 1 425 ? 16.299  -1.733  12.905  1.00 41.90 ? 425  VAL A CA  1 
ATOM   3209 C C   . VAL A 1 425 ? 15.004  -0.954  12.898  1.00 41.51 ? 425  VAL A C   1 
ATOM   3210 O O   . VAL A 1 425 ? 14.039  -1.388  12.289  1.00 41.56 ? 425  VAL A O   1 
ATOM   3211 C CB  . VAL A 1 425 ? 16.947  -1.656  11.502  1.00 42.02 ? 425  VAL A CB  1 
ATOM   3212 C CG1 . VAL A 1 425 ? 17.178  -0.208  11.074  1.00 41.48 ? 425  VAL A CG1 1 
ATOM   3213 C CG2 . VAL A 1 425 ? 18.252  -2.471  11.460  1.00 41.45 ? 425  VAL A CG2 1 
ATOM   3214 N N   . TYR A 1 426 ? 14.985  0.184   13.587  1.00 41.20 ? 426  TYR A N   1 
ATOM   3215 C CA  . TYR A 1 426 ? 13.887  1.152   13.492  1.00 40.61 ? 426  TYR A CA  1 
ATOM   3216 C C   . TYR A 1 426 ? 14.426  2.395   12.822  1.00 40.42 ? 426  TYR A C   1 
ATOM   3217 O O   . TYR A 1 426 ? 15.548  2.803   13.108  1.00 41.06 ? 426  TYR A O   1 
ATOM   3218 C CB  . TYR A 1 426 ? 13.341  1.500   14.872  1.00 40.68 ? 426  TYR A CB  1 
ATOM   3219 C CG  . TYR A 1 426 ? 12.617  0.348   15.521  1.00 41.16 ? 426  TYR A CG  1 
ATOM   3220 C CD1 . TYR A 1 426 ? 13.310  -0.576  16.295  1.00 42.03 ? 426  TYR A CD1 1 
ATOM   3221 C CD2 . TYR A 1 426 ? 11.241  0.166   15.338  1.00 41.81 ? 426  TYR A CD2 1 
ATOM   3222 C CE1 . TYR A 1 426 ? 12.664  -1.653  16.882  1.00 43.18 ? 426  TYR A CE1 1 
ATOM   3223 C CE2 . TYR A 1 426 ? 10.574  -0.901  15.919  1.00 42.86 ? 426  TYR A CE2 1 
ATOM   3224 C CZ  . TYR A 1 426 ? 11.292  -1.812  16.697  1.00 43.52 ? 426  TYR A CZ  1 
ATOM   3225 O OH  . TYR A 1 426 ? 10.654  -2.880  17.287  1.00 41.82 ? 426  TYR A OH  1 
ATOM   3226 N N   . ALA A 1 427 ? 13.645  2.992   11.933  1.00 39.56 ? 427  ALA A N   1 
ATOM   3227 C CA  . ALA A 1 427 ? 14.143  4.068   11.096  1.00 39.00 ? 427  ALA A CA  1 
ATOM   3228 C C   . ALA A 1 427 ? 13.252  5.289   11.159  1.00 38.78 ? 427  ALA A C   1 
ATOM   3229 O O   . ALA A 1 427 ? 12.026  5.167   11.162  1.00 39.69 ? 427  ALA A O   1 
ATOM   3230 C CB  . ALA A 1 427 ? 14.271  3.592   9.666   1.00 38.84 ? 427  ALA A CB  1 
ATOM   3231 N N   . TYR A 1 428 ? 13.852  6.471   11.197  1.00 37.85 ? 428  TYR A N   1 
ATOM   3232 C CA  . TYR A 1 428 ? 13.061  7.700   11.230  1.00 37.38 ? 428  TYR A CA  1 
ATOM   3233 C C   . TYR A 1 428 ? 13.630  8.759   10.284  1.00 37.07 ? 428  TYR A C   1 
ATOM   3234 O O   . TYR A 1 428 ? 14.813  8.721   9.912   1.00 36.82 ? 428  TYR A O   1 
ATOM   3235 C CB  . TYR A 1 428 ? 12.960  8.265   12.657  1.00 37.27 ? 428  TYR A CB  1 
ATOM   3236 C CG  . TYR A 1 428 ? 14.267  8.825   13.163  1.00 36.69 ? 428  TYR A CG  1 
ATOM   3237 C CD1 . TYR A 1 428 ? 14.634  10.135  12.888  1.00 37.27 ? 428  TYR A CD1 1 
ATOM   3238 C CD2 . TYR A 1 428 ? 15.148  8.040   13.898  1.00 37.25 ? 428  TYR A CD2 1 
ATOM   3239 C CE1 . TYR A 1 428 ? 15.850  10.660  13.338  1.00 37.03 ? 428  TYR A CE1 1 
ATOM   3240 C CE2 . TYR A 1 428 ? 16.370  8.558   14.360  1.00 37.50 ? 428  TYR A CE2 1 
ATOM   3241 C CZ  . TYR A 1 428 ? 16.707  9.873   14.073  1.00 36.96 ? 428  TYR A CZ  1 
ATOM   3242 O OH  . TYR A 1 428 ? 17.901  10.405  14.502  1.00 37.15 ? 428  TYR A OH  1 
ATOM   3243 N N   . ILE A 1 429 ? 12.754  9.672   9.873   1.00 35.98 ? 429  ILE A N   1 
ATOM   3244 C CA  . ILE A 1 429 ? 13.157  10.923  9.278   1.00 34.89 ? 429  ILE A CA  1 
ATOM   3245 C C   . ILE A 1 429 ? 12.526  11.995  10.159  1.00 34.64 ? 429  ILE A C   1 
ATOM   3246 O O   . ILE A 1 429 ? 11.317  12.025  10.361  1.00 34.64 ? 429  ILE A O   1 
ATOM   3247 C CB  . ILE A 1 429 ? 12.744  11.029  7.791   1.00 35.03 ? 429  ILE A CB  1 
ATOM   3248 C CG1 . ILE A 1 429 ? 13.337  12.285  7.147   1.00 35.01 ? 429  ILE A CG1 1 
ATOM   3249 C CG2 . ILE A 1 429 ? 11.219  11.004  7.621   1.00 35.49 ? 429  ILE A CG2 1 
ATOM   3250 C CD1 . ILE A 1 429 ? 12.958  12.447  5.682   1.00 34.61 ? 429  ILE A CD1 1 
ATOM   3251 N N   . PHE A 1 430 ? 13.367  12.841  10.729  1.00 34.30 ? 430  PHE A N   1 
ATOM   3252 C CA  . PHE A 1 430 ? 12.928  13.894  11.620  1.00 33.62 ? 430  PHE A CA  1 
ATOM   3253 C C   . PHE A 1 430 ? 12.684  15.108  10.754  1.00 34.03 ? 430  PHE A C   1 
ATOM   3254 O O   . PHE A 1 430 ? 13.572  15.517  9.997   1.00 34.20 ? 430  PHE A O   1 
ATOM   3255 C CB  . PHE A 1 430 ? 14.037  14.167  12.625  1.00 33.31 ? 430  PHE A CB  1 
ATOM   3256 C CG  . PHE A 1 430 ? 13.677  15.156  13.674  1.00 31.91 ? 430  PHE A CG  1 
ATOM   3257 C CD1 . PHE A 1 430 ? 13.868  16.502  13.463  1.00 30.50 ? 430  PHE A CD1 1 
ATOM   3258 C CD2 . PHE A 1 430 ? 13.187  14.731  14.896  1.00 31.93 ? 430  PHE A CD2 1 
ATOM   3259 C CE1 . PHE A 1 430 ? 13.553  17.414  14.442  1.00 30.81 ? 430  PHE A CE1 1 
ATOM   3260 C CE2 . PHE A 1 430 ? 12.865  15.641  15.879  1.00 31.79 ? 430  PHE A CE2 1 
ATOM   3261 C CZ  . PHE A 1 430 ? 13.040  16.983  15.649  1.00 31.92 ? 430  PHE A CZ  1 
ATOM   3262 N N   . GLU A 1 431 ? 11.483  15.674  10.821  1.00 34.39 ? 431  GLU A N   1 
ATOM   3263 C CA  . GLU A 1 431 ? 11.148  16.738  9.883   1.00 35.09 ? 431  GLU A CA  1 
ATOM   3264 C C   . GLU A 1 431 ? 10.633  17.994  10.526  1.00 35.15 ? 431  GLU A C   1 
ATOM   3265 O O   . GLU A 1 431 ? 10.162  18.881  9.820   1.00 35.20 ? 431  GLU A O   1 
ATOM   3266 C CB  . GLU A 1 431 ? 10.083  16.305  8.885   1.00 35.33 ? 431  GLU A CB  1 
ATOM   3267 C CG  . GLU A 1 431 ? 10.096  14.888  8.413   1.00 38.00 ? 431  GLU A CG  1 
ATOM   3268 C CD  . GLU A 1 431 ? 9.014   14.692  7.385   1.00 40.70 ? 431  GLU A CD  1 
ATOM   3269 O OE1 . GLU A 1 431 ? 7.860   15.038  7.725   1.00 42.00 ? 431  GLU A OE1 1 
ATOM   3270 O OE2 . GLU A 1 431 ? 9.317   14.242  6.247   1.00 39.98 ? 431  GLU A OE2 1 
ATOM   3271 N N   . HIS A 1 432 ? 10.664  18.071  11.850  1.00 35.51 ? 432  HIS A N   1 
ATOM   3272 C CA  . HIS A 1 432 ? 10.203  19.291  12.480  1.00 35.97 ? 432  HIS A CA  1 
ATOM   3273 C C   . HIS A 1 432 ? 11.327  20.313  12.679  1.00 35.89 ? 432  HIS A C   1 
ATOM   3274 O O   . HIS A 1 432 ? 12.366  20.027  13.281  1.00 35.31 ? 432  HIS A O   1 
ATOM   3275 C CB  . HIS A 1 432 ? 9.478   19.040  13.802  1.00 36.09 ? 432  HIS A CB  1 
ATOM   3276 C CG  . HIS A 1 432 ? 9.154   20.308  14.517  1.00 36.70 ? 432  HIS A CG  1 
ATOM   3277 N ND1 . HIS A 1 432 ? 8.147   21.150  14.103  1.00 37.51 ? 432  HIS A ND1 1 
ATOM   3278 C CD2 . HIS A 1 432 ? 9.767   20.933  15.546  1.00 38.21 ? 432  HIS A CD2 1 
ATOM   3279 C CE1 . HIS A 1 432 ? 8.116   22.213  14.884  1.00 37.38 ? 432  HIS A CE1 1 
ATOM   3280 N NE2 . HIS A 1 432 ? 9.091   22.108  15.766  1.00 37.95 ? 432  HIS A NE2 1 
ATOM   3281 N N   . ARG A 1 433 ? 11.088  21.514  12.178  1.00 36.33 ? 433  ARG A N   1 
ATOM   3282 C CA  . ARG A 1 433 ? 12.047  22.598  12.297  1.00 36.87 ? 433  ARG A CA  1 
ATOM   3283 C C   . ARG A 1 433 ? 11.723  23.364  13.551  1.00 37.57 ? 433  ARG A C   1 
ATOM   3284 O O   . ARG A 1 433 ? 10.586  23.837  13.717  1.00 38.04 ? 433  ARG A O   1 
ATOM   3285 C CB  . ARG A 1 433 ? 11.945  23.507  11.080  1.00 36.63 ? 433  ARG A CB  1 
ATOM   3286 C CG  . ARG A 1 433 ? 12.694  24.797  11.187  1.00 37.00 ? 433  ARG A CG  1 
ATOM   3287 C CD  . ARG A 1 433 ? 12.485  25.588  9.939   1.00 38.41 ? 433  ARG A CD  1 
ATOM   3288 N NE  . ARG A 1 433 ? 13.599  26.483  9.684   1.00 38.69 ? 433  ARG A NE  1 
ATOM   3289 C CZ  . ARG A 1 433 ? 13.745  27.646  10.288  1.00 42.42 ? 433  ARG A CZ  1 
ATOM   3290 N NH1 . ARG A 1 433 ? 12.838  28.040  11.198  1.00 45.53 ? 433  ARG A NH1 1 
ATOM   3291 N NH2 . ARG A 1 433 ? 14.790  28.404  9.993   1.00 41.73 ? 433  ARG A NH2 1 
ATOM   3292 N N   . ALA A 1 434 ? 12.715  23.494  14.430  1.00 37.97 ? 434  ALA A N   1 
ATOM   3293 C CA  . ALA A 1 434 ? 12.539  24.226  15.678  1.00 38.61 ? 434  ALA A CA  1 
ATOM   3294 C C   . ALA A 1 434 ? 12.016  25.628  15.398  1.00 39.08 ? 434  ALA A C   1 
ATOM   3295 O O   . ALA A 1 434 ? 12.552  26.352  14.550  1.00 39.52 ? 434  ALA A O   1 
ATOM   3296 C CB  . ALA A 1 434 ? 13.846  24.290  16.462  1.00 38.36 ? 434  ALA A CB  1 
ATOM   3297 N N   . SER A 1 435 ? 10.962  25.994  16.115  1.00 39.40 ? 435  SER A N   1 
ATOM   3298 C CA  . SER A 1 435 ? 10.397  27.329  16.052  1.00 39.88 ? 435  SER A CA  1 
ATOM   3299 C C   . SER A 1 435 ? 11.435  28.378  16.475  1.00 40.28 ? 435  SER A C   1 
ATOM   3300 O O   . SER A 1 435 ? 11.329  29.553  16.123  1.00 40.12 ? 435  SER A O   1 
ATOM   3301 C CB  . SER A 1 435 ? 9.161   27.404  16.954  1.00 39.76 ? 435  SER A CB  1 
ATOM   3302 O OG  . SER A 1 435 ? 9.534   27.468  18.322  1.00 39.31 ? 435  SER A OG  1 
ATOM   3303 N N   . THR A 1 436 ? 12.435  27.933  17.230  1.00 40.96 ? 436  THR A N   1 
ATOM   3304 C CA  . THR A 1 436 ? 13.501  28.805  17.746  1.00 41.35 ? 436  THR A CA  1 
ATOM   3305 C C   . THR A 1 436 ? 14.756  28.799  16.895  1.00 41.49 ? 436  THR A C   1 
ATOM   3306 O O   . THR A 1 436 ? 15.749  29.414  17.285  1.00 42.23 ? 436  THR A O   1 
ATOM   3307 C CB  . THR A 1 436 ? 13.977  28.352  19.132  1.00 41.20 ? 436  THR A CB  1 
ATOM   3308 O OG1 . THR A 1 436 ? 14.449  26.998  19.051  1.00 41.03 ? 436  THR A OG1 1 
ATOM   3309 C CG2 . THR A 1 436 ? 12.848  28.451  20.146  1.00 42.04 ? 436  THR A CG2 1 
ATOM   3310 N N   . LEU A 1 437 ? 14.740  28.084  15.771  1.00 41.06 ? 437  LEU A N   1 
ATOM   3311 C CA  . LEU A 1 437 ? 15.930  27.976  14.934  1.00 40.91 ? 437  LEU A CA  1 
ATOM   3312 C C   . LEU A 1 437 ? 16.380  29.349  14.443  1.00 41.00 ? 437  LEU A C   1 
ATOM   3313 O O   . LEU A 1 437 ? 15.560  30.192  14.088  1.00 40.89 ? 437  LEU A O   1 
ATOM   3314 C CB  . LEU A 1 437 ? 15.669  27.065  13.741  1.00 40.93 ? 437  LEU A CB  1 
ATOM   3315 C CG  . LEU A 1 437 ? 16.911  26.368  13.198  1.00 40.45 ? 437  LEU A CG  1 
ATOM   3316 C CD1 . LEU A 1 437 ? 17.049  25.071  13.887  1.00 41.13 ? 437  LEU A CD1 1 
ATOM   3317 C CD2 . LEU A 1 437 ? 16.742  26.122  11.741  1.00 41.81 ? 437  LEU A CD2 1 
ATOM   3318 N N   . THR A 1 438 ? 17.685  29.563  14.418  1.00 41.21 ? 438  THR A N   1 
ATOM   3319 C CA  . THR A 1 438 ? 18.230  30.868  14.058  1.00 41.56 ? 438  THR A CA  1 
ATOM   3320 C C   . THR A 1 438 ? 18.830  30.846  12.669  1.00 41.30 ? 438  THR A C   1 
ATOM   3321 O O   . THR A 1 438 ? 19.185  31.892  12.138  1.00 41.81 ? 438  THR A O   1 
ATOM   3322 C CB  . THR A 1 438 ? 19.296  31.344  15.064  1.00 41.75 ? 438  THR A CB  1 
ATOM   3323 O OG1 . THR A 1 438 ? 20.315  30.347  15.187  1.00 42.24 ? 438  THR A OG1 1 
ATOM   3324 C CG2 . THR A 1 438 ? 18.674  31.577  16.441  1.00 42.38 ? 438  THR A CG2 1 
ATOM   3325 N N   . TRP A 1 439 ? 18.951  29.651  12.087  1.00 40.74 ? 439  TRP A N   1 
ATOM   3326 C CA  . TRP A 1 439 ? 19.362  29.504  10.690  1.00 39.46 ? 439  TRP A CA  1 
ATOM   3327 C C   . TRP A 1 439 ? 18.196  29.896  9.783   1.00 39.17 ? 439  TRP A C   1 
ATOM   3328 O O   . TRP A 1 439 ? 17.053  29.768  10.177  1.00 38.98 ? 439  TRP A O   1 
ATOM   3329 C CB  . TRP A 1 439 ? 19.770  28.064  10.409  1.00 38.76 ? 439  TRP A CB  1 
ATOM   3330 C CG  . TRP A 1 439 ? 20.986  27.671  11.123  1.00 37.86 ? 439  TRP A CG  1 
ATOM   3331 C CD1 . TRP A 1 439 ? 21.060  26.967  12.282  1.00 37.06 ? 439  TRP A CD1 1 
ATOM   3332 C CD2 . TRP A 1 439 ? 22.334  27.976  10.749  1.00 37.16 ? 439  TRP A CD2 1 
ATOM   3333 N NE1 . TRP A 1 439 ? 22.372  26.819  12.664  1.00 36.20 ? 439  TRP A NE1 1 
ATOM   3334 C CE2 . TRP A 1 439 ? 23.175  27.425  11.736  1.00 36.12 ? 439  TRP A CE2 1 
ATOM   3335 C CE3 . TRP A 1 439 ? 22.912  28.673  9.682   1.00 35.88 ? 439  TRP A CE3 1 
ATOM   3336 C CZ2 . TRP A 1 439 ? 24.560  27.527  11.678  1.00 38.05 ? 439  TRP A CZ2 1 
ATOM   3337 C CZ3 . TRP A 1 439 ? 24.293  28.778  9.622   1.00 36.90 ? 439  TRP A CZ3 1 
ATOM   3338 C CH2 . TRP A 1 439 ? 25.103  28.210  10.613  1.00 37.79 ? 439  TRP A CH2 1 
ATOM   3339 N N   . PRO A 1 440 ? 18.484  30.360  8.554   1.00 38.97 ? 440  PRO A N   1 
ATOM   3340 C CA  . PRO A 1 440 ? 17.426  30.816  7.677   1.00 38.49 ? 440  PRO A CA  1 
ATOM   3341 C C   . PRO A 1 440 ? 16.472  29.700  7.324   1.00 38.69 ? 440  PRO A C   1 
ATOM   3342 O O   . PRO A 1 440 ? 16.788  28.525  7.540   1.00 39.27 ? 440  PRO A O   1 
ATOM   3343 C CB  . PRO A 1 440 ? 18.181  31.301  6.435   1.00 38.47 ? 440  PRO A CB  1 
ATOM   3344 C CG  . PRO A 1 440 ? 19.468  30.585  6.459   1.00 38.70 ? 440  PRO A CG  1 
ATOM   3345 C CD  . PRO A 1 440 ? 19.808  30.463  7.910   1.00 39.04 ? 440  PRO A CD  1 
ATOM   3346 N N   . LEU A 1 441 ? 15.301  30.074  6.805   1.00 38.72 ? 441  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 441 ? 14.280  29.127  6.411   1.00 38.32 ? 441  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 441 ? 14.759  28.150  5.356   1.00 37.70 ? 441  LEU A C   1 
ATOM   3349 O O   . LEU A 1 441 ? 14.337  27.000  5.351   1.00 37.88 ? 441  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 441 ? 13.068  29.875  5.881   1.00 39.47 ? 441  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 441 ? 12.044  30.290  6.935   1.00 42.08 ? 441  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 441 ? 11.580  31.749  6.700   1.00 43.52 ? 441  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 441 ? 10.873  29.281  6.961   1.00 44.50 ? 441  LEU A CD2 1 
ATOM   3354 N N   . TRP A 1 442 ? 15.641  28.594  4.463   1.00 36.77 ? 442  TRP A N   1 
ATOM   3355 C CA  . TRP A 1 442 ? 16.028  27.748  3.339   1.00 35.93 ? 442  TRP A CA  1 
ATOM   3356 C C   . TRP A 1 442 ? 16.752  26.482  3.775   1.00 35.59 ? 442  TRP A C   1 
ATOM   3357 O O   . TRP A 1 442 ? 16.788  25.504  3.030   1.00 35.13 ? 442  TRP A O   1 
ATOM   3358 C CB  . TRP A 1 442 ? 16.824  28.503  2.260   1.00 34.69 ? 442  TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 442 ? 18.233  28.877  2.609   1.00 34.27 ? 442  TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 442 ? 18.658  30.099  3.036   1.00 34.22 ? 442  TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 442 ? 19.409  28.058  2.507   1.00 32.43 ? 442  TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 442 ? 20.017  30.090  3.234   1.00 33.59 ? 442  TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 442 ? 20.506  28.851  2.916   1.00 32.73 ? 442  TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 442 ? 19.642  26.731  2.125   1.00 32.08 ? 442  TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 442 ? 21.818  28.362  2.964   1.00 31.24 ? 442  TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 442 ? 20.944  26.251  2.155   1.00 33.02 ? 442  TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 442 ? 22.017  27.070  2.577   1.00 33.13 ? 442  TRP A CH2 1 
ATOM   3368 N N   . MET A 1 443 ? 17.323  26.511  4.976   1.00 35.31 ? 443  MET A N   1 
ATOM   3369 C CA  . MET A 1 443 ? 18.118  25.385  5.462   1.00 35.14 ? 443  MET A CA  1 
ATOM   3370 C C   . MET A 1 443 ? 17.247  24.290  6.016   1.00 34.27 ? 443  MET A C   1 
ATOM   3371 O O   . MET A 1 443 ? 17.715  23.175  6.228   1.00 35.21 ? 443  MET A O   1 
ATOM   3372 C CB  . MET A 1 443 ? 19.154  25.828  6.490   1.00 35.26 ? 443  MET A CB  1 
ATOM   3373 C CG  . MET A 1 443 ? 20.181  26.806  5.937   1.00 35.03 ? 443  MET A CG  1 
ATOM   3374 S SD  . MET A 1 443 ? 21.632  26.843  6.985   1.00 36.40 ? 443  MET A SD  1 
ATOM   3375 C CE  . MET A 1 443 ? 22.343  28.396  6.491   1.00 36.05 ? 443  MET A CE  1 
ATOM   3376 N N   . GLY A 1 444 ? 15.976  24.603  6.227   1.00 33.46 ? 444  GLY A N   1 
ATOM   3377 C CA  . GLY A 1 444 ? 14.966  23.605  6.548   1.00 32.10 ? 444  GLY A CA  1 
ATOM   3378 C C   . GLY A 1 444 ? 15.200  23.048  7.924   1.00 31.66 ? 444  GLY A C   1 
ATOM   3379 O O   . GLY A 1 444 ? 15.221  23.790  8.896   1.00 31.29 ? 444  GLY A O   1 
ATOM   3380 N N   . VAL A 1 445 ? 15.389  21.735  8.005   1.00 31.39 ? 445  VAL A N   1 
ATOM   3381 C CA  . VAL A 1 445 ? 15.706  21.086  9.279   1.00 30.88 ? 445  VAL A CA  1 
ATOM   3382 C C   . VAL A 1 445 ? 17.147  20.641  9.169   1.00 31.17 ? 445  VAL A C   1 
ATOM   3383 O O   . VAL A 1 445 ? 17.444  19.514  8.692   1.00 31.50 ? 445  VAL A O   1 
ATOM   3384 C CB  . VAL A 1 445 ? 14.785  19.879  9.581   1.00 30.40 ? 445  VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 445 ? 15.117  19.307  10.934  1.00 30.24 ? 445  VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 445 ? 13.339  20.302  9.555   1.00 29.39 ? 445  VAL A CG2 1 
ATOM   3387 N N   . PRO A 1 446 ? 18.061  21.518  9.585   1.00 30.49 ? 446  PRO A N   1 
ATOM   3388 C CA  . PRO A 1 446 ? 19.455  21.242  9.361   1.00 30.41 ? 446  PRO A CA  1 
ATOM   3389 C C   . PRO A 1 446 ? 19.980  20.122  10.257  1.00 30.52 ? 446  PRO A C   1 
ATOM   3390 O O   . PRO A 1 446 ? 19.379  19.789  11.280  1.00 29.95 ? 446  PRO A O   1 
ATOM   3391 C CB  . PRO A 1 446 ? 20.133  22.572  9.723   1.00 30.32 ? 446  PRO A CB  1 
ATOM   3392 C CG  . PRO A 1 446 ? 19.020  23.575  9.815   1.00 30.29 ? 446  PRO A CG  1 
ATOM   3393 C CD  . PRO A 1 446 ? 17.873  22.784  10.297  1.00 30.73 ? 446  PRO A CD  1 
ATOM   3394 N N   . HIS A 1 447 ? 21.101  19.554  9.831   1.00 30.66 ? 447  HIS A N   1 
ATOM   3395 C CA  . HIS A 1 447 ? 21.910  18.638  10.604  1.00 30.85 ? 447  HIS A CA  1 
ATOM   3396 C C   . HIS A 1 447 ? 22.070  19.110  12.054  1.00 31.13 ? 447  HIS A C   1 
ATOM   3397 O O   . HIS A 1 447 ? 22.493  20.251  12.314  1.00 30.82 ? 447  HIS A O   1 
ATOM   3398 C CB  . HIS A 1 447 ? 23.279  18.608  9.938   1.00 31.54 ? 447  HIS A CB  1 
ATOM   3399 C CG  . HIS A 1 447 ? 24.140  17.475  10.364  1.00 32.23 ? 447  HIS A CG  1 
ATOM   3400 N ND1 . HIS A 1 447 ? 23.886  16.173  9.988   1.00 33.55 ? 447  HIS A ND1 1 
ATOM   3401 C CD2 . HIS A 1 447 ? 25.267  17.442  11.115  1.00 32.91 ? 447  HIS A CD2 1 
ATOM   3402 C CE1 . HIS A 1 447 ? 24.805  15.379  10.514  1.00 32.51 ? 447  HIS A CE1 1 
ATOM   3403 N NE2 . HIS A 1 447 ? 25.656  16.124  11.197  1.00 33.29 ? 447  HIS A NE2 1 
ATOM   3404 N N   . GLY A 1 448 ? 21.725  18.236  12.998  1.00 30.81 ? 448  GLY A N   1 
ATOM   3405 C CA  . GLY A 1 448 ? 21.946  18.516  14.410  1.00 29.98 ? 448  GLY A CA  1 
ATOM   3406 C C   . GLY A 1 448 ? 20.745  19.064  15.147  1.00 29.74 ? 448  GLY A C   1 
ATOM   3407 O O   . GLY A 1 448 ? 20.751  19.118  16.379  1.00 28.97 ? 448  GLY A O   1 
ATOM   3408 N N   . TYR A 1 449 ? 19.706  19.456  14.411  1.00 29.81 ? 449  TYR A N   1 
ATOM   3409 C CA  . TYR A 1 449 ? 18.590  20.178  15.039  1.00 30.23 ? 449  TYR A CA  1 
ATOM   3410 C C   . TYR A 1 449 ? 17.405  19.318  15.523  1.00 30.33 ? 449  TYR A C   1 
ATOM   3411 O O   . TYR A 1 449 ? 16.353  19.834  15.903  1.00 29.96 ? 449  TYR A O   1 
ATOM   3412 C CB  . TYR A 1 449 ? 18.189  21.413  14.216  1.00 30.26 ? 449  TYR A CB  1 
ATOM   3413 C CG  . TYR A 1 449 ? 19.256  22.463  14.380  1.00 31.69 ? 449  TYR A CG  1 
ATOM   3414 C CD1 . TYR A 1 449 ? 20.386  22.488  13.542  1.00 31.18 ? 449  TYR A CD1 1 
ATOM   3415 C CD2 . TYR A 1 449 ? 19.200  23.378  15.430  1.00 32.18 ? 449  TYR A CD2 1 
ATOM   3416 C CE1 . TYR A 1 449 ? 21.388  23.417  13.715  1.00 28.22 ? 449  TYR A CE1 1 
ATOM   3417 C CE2 . TYR A 1 449 ? 20.211  24.325  15.603  1.00 31.31 ? 449  TYR A CE2 1 
ATOM   3418 C CZ  . TYR A 1 449 ? 21.296  24.328  14.744  1.00 30.83 ? 449  TYR A CZ  1 
ATOM   3419 O OH  . TYR A 1 449 ? 22.304  25.249  14.937  1.00 32.08 ? 449  TYR A OH  1 
ATOM   3420 N N   . GLU A 1 450 ? 17.610  18.001  15.549  1.00 30.47 ? 450  GLU A N   1 
ATOM   3421 C CA  . GLU A 1 450 ? 16.725  17.123  16.292  1.00 30.51 ? 450  GLU A CA  1 
ATOM   3422 C C   . GLU A 1 450 ? 17.230  16.948  17.725  1.00 30.95 ? 450  GLU A C   1 
ATOM   3423 O O   . GLU A 1 450 ? 16.460  16.608  18.615  1.00 31.67 ? 450  GLU A O   1 
ATOM   3424 C CB  . GLU A 1 450 ? 16.629  15.778  15.608  1.00 30.20 ? 450  GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 450 ? 17.720  14.800  16.000  1.00 31.45 ? 450  GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 450 ? 19.052  15.065  15.332  1.00 32.53 ? 450  GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 450 ? 19.323  16.200  14.859  1.00 32.66 ? 450  GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 450 ? 19.846  14.113  15.301  1.00 34.03 ? 450  GLU A OE2 1 
ATOM   3429 N N   . ILE A 1 451 ? 18.518  17.192  17.967  1.00 30.94 ? 451  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 451 ? 19.078  16.857  19.278  1.00 30.36 ? 451  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 451 ? 18.323  17.493  20.436  1.00 30.76 ? 451  ILE A C   1 
ATOM   3432 O O   . ILE A 1 451 ? 17.914  16.782  21.375  1.00 31.21 ? 451  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 451 ? 20.567  17.137  19.392  1.00 30.28 ? 451  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 451 ? 21.326  16.444  18.248  1.00 30.16 ? 451  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 451 ? 21.067  16.658  20.751  1.00 29.10 ? 451  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 451 ? 22.798  16.907  18.094  1.00 29.21 ? 451  ILE A CD1 1 
ATOM   3437 N N   . GLU A 1 452 ? 18.123  18.809  20.363  1.00 30.47 ? 452  GLU A N   1 
ATOM   3438 C CA  . GLU A 1 452 ? 17.392  19.551  21.398  1.00 30.93 ? 452  GLU A CA  1 
ATOM   3439 C C   . GLU A 1 452 ? 16.024  18.946  21.727  1.00 31.22 ? 452  GLU A C   1 
ATOM   3440 O O   . GLU A 1 452 ? 15.554  19.063  22.854  1.00 31.60 ? 452  GLU A O   1 
ATOM   3441 C CB  . GLU A 1 452 ? 17.230  21.013  21.005  1.00 31.04 ? 452  GLU A CB  1 
ATOM   3442 C CG  . GLU A 1 452 ? 16.662  21.225  19.597  1.00 32.37 ? 452  GLU A CG  1 
ATOM   3443 C CD  . GLU A 1 452 ? 16.875  22.631  19.109  1.00 34.35 ? 452  GLU A CD  1 
ATOM   3444 O OE1 . GLU A 1 452 ? 15.929  23.433  19.210  1.00 33.11 ? 452  GLU A OE1 1 
ATOM   3445 O OE2 . GLU A 1 452 ? 18.007  22.950  18.657  1.00 38.18 ? 452  GLU A OE2 1 
ATOM   3446 N N   . PHE A 1 453 ? 15.412  18.273  20.756  1.00 31.35 ? 453  PHE A N   1 
ATOM   3447 C CA  . PHE A 1 453 ? 14.139  17.598  20.971  1.00 31.72 ? 453  PHE A CA  1 
ATOM   3448 C C   . PHE A 1 453 ? 14.235  16.261  21.688  1.00 32.16 ? 453  PHE A C   1 
ATOM   3449 O O   . PHE A 1 453 ? 13.526  16.058  22.674  1.00 32.62 ? 453  PHE A O   1 
ATOM   3450 C CB  . PHE A 1 453 ? 13.365  17.493  19.668  1.00 31.68 ? 453  PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 453 ? 12.825  18.826  19.192  1.00 32.20 ? 453  PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 453 ? 11.615  19.304  19.663  1.00 30.99 ? 453  PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 453 ? 13.557  19.616  18.305  1.00 31.46 ? 453  PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 453 ? 11.146  20.536  19.246  1.00 32.40 ? 453  PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 453 ? 13.088  20.835  17.881  1.00 30.82 ? 453  PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 453 ? 11.876  21.296  18.344  1.00 31.92 ? 453  PHE A CZ  1 
ATOM   3457 N N   . ILE A 1 454 ? 15.108  15.367  21.224  1.00 32.71 ? 454  ILE A N   1 
ATOM   3458 C CA  . ILE A 1 454 ? 15.397  14.095  21.924  1.00 33.30 ? 454  ILE A CA  1 
ATOM   3459 C C   . ILE A 1 454 ? 15.750  14.361  23.387  1.00 33.96 ? 454  ILE A C   1 
ATOM   3460 O O   . ILE A 1 454 ? 15.292  13.650  24.267  1.00 34.64 ? 454  ILE A O   1 
ATOM   3461 C CB  . ILE A 1 454 ? 16.610  13.325  21.307  1.00 33.17 ? 454  ILE A CB  1 
ATOM   3462 C CG1 . ILE A 1 454 ? 16.504  13.183  19.783  1.00 34.21 ? 454  ILE A CG1 1 
ATOM   3463 C CG2 . ILE A 1 454 ? 16.801  11.985  21.956  1.00 32.50 ? 454  ILE A CG2 1 
ATOM   3464 C CD1 . ILE A 1 454 ? 15.157  12.851  19.286  1.00 35.11 ? 454  ILE A CD1 1 
ATOM   3465 N N   . PHE A 1 455 ? 16.566  15.385  23.638  1.00 34.39 ? 455  PHE A N   1 
ATOM   3466 C CA  . PHE A 1 455 ? 17.028  15.699  24.987  1.00 34.64 ? 455  PHE A CA  1 
ATOM   3467 C C   . PHE A 1 455 ? 15.983  16.468  25.797  1.00 35.18 ? 455  PHE A C   1 
ATOM   3468 O O   . PHE A 1 455 ? 16.156  16.692  27.001  1.00 35.21 ? 455  PHE A O   1 
ATOM   3469 C CB  . PHE A 1 455 ? 18.344  16.481  24.933  1.00 34.37 ? 455  PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 455 ? 19.543  15.617  24.884  1.00 33.67 ? 455  PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 455 ? 19.991  15.109  23.687  1.00 32.93 ? 455  PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 455 ? 20.219  15.288  26.047  1.00 35.88 ? 455  PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 455 ? 21.101  14.278  23.634  1.00 33.63 ? 455  PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 455 ? 21.345  14.459  26.011  1.00 35.29 ? 455  PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 455 ? 21.780  13.953  24.792  1.00 34.61 ? 455  PHE A CZ  1 
ATOM   3476 N N   . GLY A 1 456 ? 14.911  16.879  25.124  1.00 35.51 ? 456  GLY A N   1 
ATOM   3477 C CA  . GLY A 1 456 ? 13.761  17.469  25.781  1.00 35.59 ? 456  GLY A CA  1 
ATOM   3478 C C   . GLY A 1 456 ? 13.950  18.906  26.212  1.00 36.07 ? 456  GLY A C   1 
ATOM   3479 O O   . GLY A 1 456 ? 13.322  19.337  27.169  1.00 36.48 ? 456  GLY A O   1 
ATOM   3480 N N   . LEU A 1 457 ? 14.785  19.677  25.520  1.00 36.51 ? 457  LEU A N   1 
ATOM   3481 C CA  . LEU A 1 457 ? 14.945  21.074  25.932  1.00 37.34 ? 457  LEU A CA  1 
ATOM   3482 C C   . LEU A 1 457 ? 13.627  21.838  25.914  1.00 37.99 ? 457  LEU A C   1 
ATOM   3483 O O   . LEU A 1 457 ? 13.375  22.602  26.838  1.00 38.45 ? 457  LEU A O   1 
ATOM   3484 C CB  . LEU A 1 457 ? 16.016  21.844  25.151  1.00 37.20 ? 457  LEU A CB  1 
ATOM   3485 C CG  . LEU A 1 457 ? 17.490  21.433  25.044  1.00 36.40 ? 457  LEU A CG  1 
ATOM   3486 C CD1 . LEU A 1 457 ? 18.320  22.702  25.055  1.00 35.95 ? 457  LEU A CD1 1 
ATOM   3487 C CD2 . LEU A 1 457 ? 17.969  20.476  26.108  1.00 34.00 ? 457  LEU A CD2 1 
ATOM   3488 N N   . PRO A 1 458 ? 12.780  21.638  24.883  1.00 38.57 ? 458  PRO A N   1 
ATOM   3489 C CA  . PRO A 1 458 ? 11.500  22.336  24.889  1.00 39.40 ? 458  PRO A CA  1 
ATOM   3490 C C   . PRO A 1 458 ? 10.705  22.272  26.191  1.00 40.48 ? 458  PRO A C   1 
ATOM   3491 O O   . PRO A 1 458 ? 9.842   23.109  26.395  1.00 41.16 ? 458  PRO A O   1 
ATOM   3492 C CB  . PRO A 1 458 ? 10.738  21.665  23.745  1.00 39.16 ? 458  PRO A CB  1 
ATOM   3493 C CG  . PRO A 1 458 ? 11.805  21.315  22.792  1.00 38.54 ? 458  PRO A CG  1 
ATOM   3494 C CD  . PRO A 1 458 ? 12.925  20.829  23.657  1.00 38.57 ? 458  PRO A CD  1 
ATOM   3495 N N   . LEU A 1 459 ? 10.995  21.311  27.062  1.00 41.66 ? 459  LEU A N   1 
ATOM   3496 C CA  . LEU A 1 459 ? 10.331  21.233  28.363  1.00 43.08 ? 459  LEU A CA  1 
ATOM   3497 C C   . LEU A 1 459 ? 10.738  22.371  29.295  1.00 44.01 ? 459  LEU A C   1 
ATOM   3498 O O   . LEU A 1 459 ? 10.119  22.573  30.345  1.00 44.45 ? 459  LEU A O   1 
ATOM   3499 C CB  . LEU A 1 459 ? 10.609  19.886  29.038  1.00 42.92 ? 459  LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 459 ? 9.881   18.678  28.458  1.00 44.08 ? 459  LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 459 ? 10.638  17.441  28.748  1.00 45.31 ? 459  LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 459 ? 8.494   18.561  29.055  1.00 47.52 ? 459  LEU A CD2 1 
ATOM   3503 N N   . ASP A 1 460 ? 11.786  23.099  28.931  1.00 44.94 ? 460  ASP A N   1 
ATOM   3504 C CA  . ASP A 1 460 ? 12.224  24.223  29.739  1.00 46.43 ? 460  ASP A CA  1 
ATOM   3505 C C   . ASP A 1 460 ? 11.476  25.462  29.254  1.00 47.25 ? 460  ASP A C   1 
ATOM   3506 O O   . ASP A 1 460 ? 11.786  26.008  28.189  1.00 47.07 ? 460  ASP A O   1 
ATOM   3507 C CB  . ASP A 1 460 ? 13.751  24.403  29.676  1.00 46.38 ? 460  ASP A CB  1 
ATOM   3508 C CG  . ASP A 1 460 ? 14.268  25.507  30.613  1.00 47.64 ? 460  ASP A CG  1 
ATOM   3509 O OD1 . ASP A 1 460 ? 13.491  26.395  31.029  1.00 46.49 ? 460  ASP A OD1 1 
ATOM   3510 O OD2 . ASP A 1 460 ? 15.481  25.490  30.929  1.00 50.90 ? 460  ASP A OD2 1 
ATOM   3511 N N   . PRO A 1 461 ? 10.494  25.925  30.050  1.00 48.40 ? 461  PRO A N   1 
ATOM   3512 C CA  . PRO A 1 461 ? 9.617   27.000  29.570  1.00 49.23 ? 461  PRO A CA  1 
ATOM   3513 C C   . PRO A 1 461 ? 10.397  28.301  29.290  1.00 49.85 ? 461  PRO A C   1 
ATOM   3514 O O   . PRO A 1 461 ? 9.981   29.097  28.432  1.00 50.34 ? 461  PRO A O   1 
ATOM   3515 C CB  . PRO A 1 461 ? 8.584   27.159  30.697  1.00 49.09 ? 461  PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 461 ? 9.250   26.609  31.913  1.00 48.98 ? 461  PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 461 ? 10.183  25.526  31.438  1.00 48.56 ? 461  PRO A CD  1 
ATOM   3518 N N   . SER A 1 462 ? 11.538  28.483  29.955  1.00 49.79 ? 462  SER A N   1 
ATOM   3519 C CA  . SER A 1 462 ? 12.411  29.616  29.654  1.00 50.36 ? 462  SER A CA  1 
ATOM   3520 C C   . SER A 1 462 ? 13.034  29.594  28.239  1.00 50.51 ? 462  SER A C   1 
ATOM   3521 O O   . SER A 1 462 ? 13.589  30.606  27.789  1.00 50.56 ? 462  SER A O   1 
ATOM   3522 C CB  . SER A 1 462 ? 13.503  29.759  30.723  1.00 50.48 ? 462  SER A CB  1 
ATOM   3523 O OG  . SER A 1 462 ? 14.520  28.787  30.561  1.00 51.55 ? 462  SER A OG  1 
ATOM   3524 N N   . LEU A 1 463 ? 12.948  28.463  27.535  1.00 50.70 ? 463  LEU A N   1 
ATOM   3525 C CA  . LEU A 1 463 ? 13.534  28.389  26.183  1.00 50.66 ? 463  LEU A CA  1 
ATOM   3526 C C   . LEU A 1 463 ? 12.607  28.788  25.011  1.00 50.64 ? 463  LEU A C   1 
ATOM   3527 O O   . LEU A 1 463 ? 13.045  28.819  23.861  1.00 50.96 ? 463  LEU A O   1 
ATOM   3528 C CB  . LEU A 1 463 ? 14.270  27.061  25.937  1.00 50.52 ? 463  LEU A CB  1 
ATOM   3529 C CG  . LEU A 1 463 ? 15.565  26.870  26.749  1.00 50.40 ? 463  LEU A CG  1 
ATOM   3530 C CD1 . LEU A 1 463 ? 16.223  25.542  26.413  1.00 50.07 ? 463  LEU A CD1 1 
ATOM   3531 C CD2 . LEU A 1 463 ? 16.570  28.015  26.591  1.00 48.61 ? 463  LEU A CD2 1 
ATOM   3532 N N   . ASN A 1 464 ? 11.349  29.107  25.307  1.00 50.58 ? 464  ASN A N   1 
ATOM   3533 C CA  . ASN A 1 464 ? 10.413  29.707  24.317  1.00 50.85 ? 464  ASN A CA  1 
ATOM   3534 C C   . ASN A 1 464 ? 9.929   28.795  23.193  1.00 49.29 ? 464  ASN A C   1 
ATOM   3535 O O   . ASN A 1 464 ? 9.440   29.282  22.166  1.00 49.01 ? 464  ASN A O   1 
ATOM   3536 C CB  . ASN A 1 464 ? 10.946  31.034  23.726  1.00 51.96 ? 464  ASN A CB  1 
ATOM   3537 C CG  . ASN A 1 464 ? 11.093  32.126  24.771  1.00 56.91 ? 464  ASN A CG  1 
ATOM   3538 O OD1 . ASN A 1 464 ? 10.494  32.047  25.850  1.00 58.23 ? 464  ASN A OD1 1 
ATOM   3539 N ND2 . ASN A 1 464 ? 11.901  33.151  24.457  1.00 65.63 ? 464  ASN A ND2 1 
ATOM   3540 N N   . TYR A 1 465 ? 10.060  27.483  23.387  1.00 47.66 ? 465  TYR A N   1 
ATOM   3541 C CA  . TYR A 1 465 ? 9.460   26.525  22.470  1.00 46.18 ? 465  TYR A CA  1 
ATOM   3542 C C   . TYR A 1 465 ? 7.951   26.574  22.632  1.00 46.06 ? 465  TYR A C   1 
ATOM   3543 O O   . TYR A 1 465 ? 7.449   26.822  23.734  1.00 46.24 ? 465  TYR A O   1 
ATOM   3544 C CB  . TYR A 1 465 ? 9.960   25.113  22.742  1.00 45.25 ? 465  TYR A CB  1 
ATOM   3545 C CG  . TYR A 1 465 ? 11.413  24.881  22.386  1.00 43.72 ? 465  TYR A CG  1 
ATOM   3546 C CD1 . TYR A 1 465 ? 11.781  24.474  21.107  1.00 42.51 ? 465  TYR A CD1 1 
ATOM   3547 C CD2 . TYR A 1 465 ? 12.416  25.058  23.334  1.00 42.14 ? 465  TYR A CD2 1 
ATOM   3548 C CE1 . TYR A 1 465 ? 13.106  24.255  20.785  1.00 43.02 ? 465  TYR A CE1 1 
ATOM   3549 C CE2 . TYR A 1 465 ? 13.738  24.844  23.025  1.00 42.25 ? 465  TYR A CE2 1 
ATOM   3550 C CZ  . TYR A 1 465 ? 14.082  24.446  21.751  1.00 42.79 ? 465  TYR A CZ  1 
ATOM   3551 O OH  . TYR A 1 465 ? 15.402  24.226  21.452  1.00 42.76 ? 465  TYR A OH  1 
ATOM   3552 N N   . THR A 1 466 ? 7.235   26.354  21.534  1.00 45.61 ? 466  THR A N   1 
ATOM   3553 C CA  . THR A 1 466 ? 5.780   26.236  21.581  1.00 45.13 ? 466  THR A CA  1 
ATOM   3554 C C   . THR A 1 466 ? 5.352   25.003  22.373  1.00 45.08 ? 466  THR A C   1 
ATOM   3555 O O   . THR A 1 466 ? 6.113   24.037  22.522  1.00 45.17 ? 466  THR A O   1 
ATOM   3556 C CB  . THR A 1 466 ? 5.170   26.101  20.183  1.00 45.19 ? 466  THR A CB  1 
ATOM   3557 O OG1 . THR A 1 466 ? 5.326   24.744  19.726  1.00 45.25 ? 466  THR A OG1 1 
ATOM   3558 C CG2 . THR A 1 466 ? 5.812   27.094  19.203  1.00 43.58 ? 466  THR A CG2 1 
ATOM   3559 N N   . THR A 1 467 ? 4.117   25.055  22.861  1.00 44.85 ? 467  THR A N   1 
ATOM   3560 C CA  . THR A 1 467 ? 3.474   23.968  23.582  1.00 44.47 ? 467  THR A CA  1 
ATOM   3561 C C   . THR A 1 467 ? 3.464   22.665  22.775  1.00 44.52 ? 467  THR A C   1 
ATOM   3562 O O   . THR A 1 467 ? 3.679   21.586  23.327  1.00 44.71 ? 467  THR A O   1 
ATOM   3563 C CB  . THR A 1 467 ? 2.041   24.385  23.992  1.00 44.69 ? 467  THR A CB  1 
ATOM   3564 O OG1 . THR A 1 467 ? 2.110   25.482  24.921  1.00 44.41 ? 467  THR A OG1 1 
ATOM   3565 C CG2 . THR A 1 467 ? 1.283   23.234  24.636  1.00 44.58 ? 467  THR A CG2 1 
ATOM   3566 N N   . GLU A 1 468 ? 3.249   22.757  21.469  1.00 44.48 ? 468  GLU A N   1 
ATOM   3567 C CA  . GLU A 1 468 ? 3.235   21.555  20.638  1.00 44.94 ? 468  GLU A CA  1 
ATOM   3568 C C   . GLU A 1 468 ? 4.624   20.903  20.580  1.00 44.32 ? 468  GLU A C   1 
ATOM   3569 O O   . GLU A 1 468 ? 4.743   19.677  20.511  1.00 43.96 ? 468  GLU A O   1 
ATOM   3570 C CB  . GLU A 1 468 ? 2.713   21.860  19.230  1.00 45.26 ? 468  GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 468 ? 1.453   22.719  19.209  1.00 48.96 ? 468  GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 468 ? 1.758   24.195  18.957  1.00 53.03 ? 468  GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 468 ? 1.753   24.991  19.941  1.00 52.90 ? 468  GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 468 ? 2.016   24.541  17.765  1.00 54.66 ? 468  GLU A OE2 1 
ATOM   3575 N N   . GLU A 1 469 ? 5.656   21.749  20.604  1.00 43.67 ? 469  GLU A N   1 
ATOM   3576 C CA  . GLU A 1 469 ? 7.046   21.316  20.648  1.00 42.72 ? 469  GLU A CA  1 
ATOM   3577 C C   . GLU A 1 469 ? 7.364   20.679  21.983  1.00 42.78 ? 469  GLU A C   1 
ATOM   3578 O O   . GLU A 1 469 ? 8.137   19.725  22.035  1.00 42.61 ? 469  GLU A O   1 
ATOM   3579 C CB  . GLU A 1 469 ? 7.995   22.480  20.361  1.00 42.16 ? 469  GLU A CB  1 
ATOM   3580 C CG  . GLU A 1 469 ? 8.265   22.674  18.882  1.00 40.55 ? 469  GLU A CG  1 
ATOM   3581 C CD  . GLU A 1 469 ? 8.949   23.987  18.559  1.00 39.18 ? 469  GLU A CD  1 
ATOM   3582 O OE1 . GLU A 1 469 ? 8.808   24.955  19.334  1.00 39.89 ? 469  GLU A OE1 1 
ATOM   3583 O OE2 . GLU A 1 469 ? 9.622   24.060  17.515  1.00 38.97 ? 469  GLU A OE2 1 
ATOM   3584 N N   . ARG A 1 470 ? 6.761   21.195  23.051  1.00 42.50 ? 470  ARG A N   1 
ATOM   3585 C CA  . ARG A 1 470 ? 6.875   20.553  24.351  1.00 43.54 ? 470  ARG A CA  1 
ATOM   3586 C C   . ARG A 1 470 ? 6.279   19.134  24.308  1.00 42.04 ? 470  ARG A C   1 
ATOM   3587 O O   . ARG A 1 470 ? 6.925   18.186  24.735  1.00 42.30 ? 470  ARG A O   1 
ATOM   3588 C CB  . ARG A 1 470 ? 6.235   21.412  25.442  1.00 43.34 ? 470  ARG A CB  1 
ATOM   3589 C CG  . ARG A 1 470 ? 6.438   20.893  26.868  1.00 46.53 ? 470  ARG A CG  1 
ATOM   3590 C CD  . ARG A 1 470 ? 5.460   21.561  27.899  1.00 47.79 ? 470  ARG A CD  1 
ATOM   3591 N NE  . ARG A 1 470 ? 4.061   21.149  27.698  1.00 55.94 ? 470  ARG A NE  1 
ATOM   3592 C CZ  . ARG A 1 470 ? 3.445   20.181  28.384  1.00 58.75 ? 470  ARG A CZ  1 
ATOM   3593 N NH1 . ARG A 1 470 ? 4.089   19.521  29.348  1.00 60.14 ? 470  ARG A NH1 1 
ATOM   3594 N NH2 . ARG A 1 470 ? 2.172   19.883  28.117  1.00 59.58 ? 470  ARG A NH2 1 
ATOM   3595 N N   . ILE A 1 471 ? 5.076   18.982  23.756  1.00 40.91 ? 471  ILE A N   1 
ATOM   3596 C CA  . ILE A 1 471 ? 4.430   17.663  23.620  1.00 39.87 ? 471  ILE A CA  1 
ATOM   3597 C C   . ILE A 1 471 ? 5.221   16.750  22.684  1.00 39.23 ? 471  ILE A C   1 
ATOM   3598 O O   . ILE A 1 471 ? 5.393   15.543  22.930  1.00 38.68 ? 471  ILE A O   1 
ATOM   3599 C CB  . ILE A 1 471 ? 2.952   17.812  23.132  1.00 40.17 ? 471  ILE A CB  1 
ATOM   3600 C CG1 . ILE A 1 471 ? 2.087   18.406  24.255  1.00 40.94 ? 471  ILE A CG1 1 
ATOM   3601 C CG2 . ILE A 1 471 ? 2.376   16.472  22.660  1.00 38.67 ? 471  ILE A CG2 1 
ATOM   3602 C CD1 . ILE A 1 471 ? 1.008   19.383  23.779  1.00 42.61 ? 471  ILE A CD1 1 
ATOM   3603 N N   . PHE A 1 472 ? 5.715   17.354  21.607  1.00 38.70 ? 472  PHE A N   1 
ATOM   3604 C CA  . PHE A 1 472 ? 6.534   16.659  20.628  1.00 37.56 ? 472  PHE A CA  1 
ATOM   3605 C C   . PHE A 1 472 ? 7.824   16.131  21.257  1.00 37.17 ? 472  PHE A C   1 
ATOM   3606 O O   . PHE A 1 472 ? 8.179   14.971  21.051  1.00 36.90 ? 472  PHE A O   1 
ATOM   3607 C CB  . PHE A 1 472 ? 6.823   17.571  19.447  1.00 36.91 ? 472  PHE A CB  1 
ATOM   3608 C CG  . PHE A 1 472 ? 7.691   16.958  18.412  1.00 36.52 ? 472  PHE A CG  1 
ATOM   3609 C CD1 . PHE A 1 472 ? 7.401   15.702  17.899  1.00 36.06 ? 472  PHE A CD1 1 
ATOM   3610 C CD2 . PHE A 1 472 ? 8.815   17.641  17.943  1.00 36.04 ? 472  PHE A CD2 1 
ATOM   3611 C CE1 . PHE A 1 472 ? 8.229   15.121  16.930  1.00 36.77 ? 472  PHE A CE1 1 
ATOM   3612 C CE2 . PHE A 1 472 ? 9.639   17.079  16.974  1.00 35.66 ? 472  PHE A CE2 1 
ATOM   3613 C CZ  . PHE A 1 472 ? 9.345   15.825  16.457  1.00 35.20 ? 472  PHE A CZ  1 
ATOM   3614 N N   . ALA A 1 473 ? 8.501   16.971  22.042  1.00 36.89 ? 473  ALA A N   1 
ATOM   3615 C CA  . ALA A 1 473 ? 9.761   16.571  22.683  1.00 36.99 ? 473  ALA A CA  1 
ATOM   3616 C C   . ALA A 1 473 ? 9.543   15.367  23.611  1.00 37.35 ? 473  ALA A C   1 
ATOM   3617 O O   . ALA A 1 473 ? 10.273  14.385  23.554  1.00 36.80 ? 473  ALA A O   1 
ATOM   3618 C CB  . ALA A 1 473 ? 10.395  17.742  23.418  1.00 36.45 ? 473  ALA A CB  1 
ATOM   3619 N N   . GLN A 1 474 ? 8.498   15.447  24.426  1.00 38.14 ? 474  GLN A N   1 
ATOM   3620 C CA  . GLN A 1 474 ? 8.100   14.364  25.316  1.00 39.14 ? 474  GLN A CA  1 
ATOM   3621 C C   . GLN A 1 474 ? 7.879   13.066  24.569  1.00 39.46 ? 474  GLN A C   1 
ATOM   3622 O O   . GLN A 1 474 ? 8.351   12.013  25.006  1.00 39.74 ? 474  GLN A O   1 
ATOM   3623 C CB  . GLN A 1 474 ? 6.842   14.754  26.077  1.00 39.51 ? 474  GLN A CB  1 
ATOM   3624 C CG  . GLN A 1 474 ? 7.100   15.830  27.143  1.00 41.37 ? 474  GLN A CG  1 
ATOM   3625 C CD  . GLN A 1 474 ? 5.832   16.278  27.846  1.00 43.90 ? 474  GLN A CD  1 
ATOM   3626 O OE1 . GLN A 1 474 ? 4.884   16.738  27.212  1.00 45.76 ? 474  GLN A OE1 1 
ATOM   3627 N NE2 . GLN A 1 474 ? 5.815   16.153  29.168  1.00 44.60 ? 474  GLN A NE2 1 
ATOM   3628 N N   . ARG A 1 475 ? 7.180   13.151  23.437  1.00 39.82 ? 475  ARG A N   1 
ATOM   3629 C CA  . ARG A 1 475 ? 6.967   12.010  22.553  1.00 40.17 ? 475  ARG A CA  1 
ATOM   3630 C C   . ARG A 1 475 ? 8.298   11.371  22.155  1.00 39.60 ? 475  ARG A C   1 
ATOM   3631 O O   . ARG A 1 475 ? 8.473   10.154  22.270  1.00 39.65 ? 475  ARG A O   1 
ATOM   3632 C CB  . ARG A 1 475 ? 6.201   12.441  21.290  1.00 40.23 ? 475  ARG A CB  1 
ATOM   3633 C CG  . ARG A 1 475 ? 4.822   11.807  21.123  1.00 42.21 ? 475  ARG A CG  1 
ATOM   3634 C CD  . ARG A 1 475 ? 4.092   12.351  19.873  1.00 41.08 ? 475  ARG A CD  1 
ATOM   3635 N NE  . ARG A 1 475 ? 4.592   11.741  18.637  1.00 42.61 ? 475  ARG A NE  1 
ATOM   3636 C CZ  . ARG A 1 475 ? 4.759   12.399  17.495  1.00 40.29 ? 475  ARG A CZ  1 
ATOM   3637 N NH1 . ARG A 1 475 ? 4.466   13.691  17.424  1.00 39.01 ? 475  ARG A NH1 1 
ATOM   3638 N NH2 . ARG A 1 475 ? 5.226   11.765  16.430  1.00 40.41 ? 475  ARG A NH2 1 
ATOM   3639 N N   . LEU A 1 476 ? 9.221   12.202  21.677  1.00 39.17 ? 476  LEU A N   1 
ATOM   3640 C CA  . LEU A 1 476 ? 10.544  11.747  21.247  1.00 38.39 ? 476  LEU A CA  1 
ATOM   3641 C C   . LEU A 1 476 ? 11.338  11.111  22.375  1.00 38.31 ? 476  LEU A C   1 
ATOM   3642 O O   . LEU A 1 476 ? 11.912  10.044  22.188  1.00 38.56 ? 476  LEU A O   1 
ATOM   3643 C CB  . LEU A 1 476 ? 11.327  12.902  20.620  1.00 38.06 ? 476  LEU A CB  1 
ATOM   3644 C CG  . LEU A 1 476 ? 10.693  13.438  19.337  1.00 36.05 ? 476  LEU A CG  1 
ATOM   3645 C CD1 . LEU A 1 476 ? 11.541  14.497  18.780  1.00 34.90 ? 476  LEU A CD1 1 
ATOM   3646 C CD2 . LEU A 1 476 ? 10.529  12.354  18.317  1.00 35.14 ? 476  LEU A CD2 1 
ATOM   3647 N N   . MET A 1 477 ? 11.343  11.753  23.543  1.00 38.13 ? 477  MET A N   1 
ATOM   3648 C CA  . MET A 1 477 ? 12.011  11.230  24.722  1.00 38.85 ? 477  MET A CA  1 
ATOM   3649 C C   . MET A 1 477 ? 11.456  9.855   25.062  1.00 39.01 ? 477  MET A C   1 
ATOM   3650 O O   . MET A 1 477 ? 12.199  8.970   25.501  1.00 39.02 ? 477  MET A O   1 
ATOM   3651 C CB  . MET A 1 477 ? 11.803  12.161  25.913  1.00 38.70 ? 477  MET A CB  1 
ATOM   3652 C CG  . MET A 1 477 ? 12.522  13.488  25.832  1.00 39.24 ? 477  MET A CG  1 
ATOM   3653 S SD  . MET A 1 477 ? 11.996  14.656  27.115  1.00 41.21 ? 477  MET A SD  1 
ATOM   3654 C CE  . MET A 1 477 ? 12.524  13.811  28.588  1.00 40.43 ? 477  MET A CE  1 
ATOM   3655 N N   . LYS A 1 478 ? 10.144  9.694   24.861  1.00 39.00 ? 478  LYS A N   1 
ATOM   3656 C CA  . LYS A 1 478 ? 9.448   8.443   25.075  1.00 39.19 ? 478  LYS A CA  1 
ATOM   3657 C C   . LYS A 1 478 ? 9.912   7.378   24.091  1.00 38.88 ? 478  LYS A C   1 
ATOM   3658 O O   . LYS A 1 478 ? 10.228  6.251   24.493  1.00 38.72 ? 478  LYS A O   1 
ATOM   3659 C CB  . LYS A 1 478 ? 7.935   8.653   24.936  1.00 40.37 ? 478  LYS A CB  1 
ATOM   3660 C CG  . LYS A 1 478 ? 7.202   9.024   26.215  1.00 42.40 ? 478  LYS A CG  1 
ATOM   3661 C CD  . LYS A 1 478 ? 6.680   7.772   26.905  1.00 46.53 ? 478  LYS A CD  1 
ATOM   3662 C CE  . LYS A 1 478 ? 5.897   8.103   28.173  1.00 48.49 ? 478  LYS A CE  1 
ATOM   3663 N NZ  . LYS A 1 478 ? 6.750   8.682   29.261  1.00 49.55 ? 478  LYS A NZ  1 
ATOM   3664 N N   . TYR A 1 479 ? 9.954   7.725   22.804  1.00 38.67 ? 479  TYR A N   1 
ATOM   3665 C CA  . TYR A 1 479 ? 10.432  6.795   21.771  1.00 38.40 ? 479  TYR A CA  1 
ATOM   3666 C C   . TYR A 1 479 ? 11.816  6.277   22.108  1.00 38.15 ? 479  TYR A C   1 
ATOM   3667 O O   . TYR A 1 479 ? 12.046  5.063   22.140  1.00 37.99 ? 479  TYR A O   1 
ATOM   3668 C CB  . TYR A 1 479 ? 10.476  7.459   20.399  1.00 38.43 ? 479  TYR A CB  1 
ATOM   3669 C CG  . TYR A 1 479 ? 9.135   7.707   19.778  1.00 38.30 ? 479  TYR A CG  1 
ATOM   3670 C CD1 . TYR A 1 479 ? 8.106   6.762   19.872  1.00 37.87 ? 479  TYR A CD1 1 
ATOM   3671 C CD2 . TYR A 1 479 ? 8.907   8.861   19.051  1.00 37.58 ? 479  TYR A CD2 1 
ATOM   3672 C CE1 . TYR A 1 479 ? 6.876   6.991   19.281  1.00 37.23 ? 479  TYR A CE1 1 
ATOM   3673 C CE2 . TYR A 1 479 ? 7.696   9.102   18.459  1.00 38.34 ? 479  TYR A CE2 1 
ATOM   3674 C CZ  . TYR A 1 479 ? 6.675   8.169   18.574  1.00 38.92 ? 479  TYR A CZ  1 
ATOM   3675 O OH  . TYR A 1 479 ? 5.459   8.437   17.975  1.00 39.39 ? 479  TYR A OH  1 
ATOM   3676 N N   . TRP A 1 480 ? 12.720  7.216   22.386  1.00 37.77 ? 480  TRP A N   1 
ATOM   3677 C CA  . TRP A 1 480 ? 14.115  6.913   22.665  1.00 37.86 ? 480  TRP A CA  1 
ATOM   3678 C C   . TRP A 1 480 ? 14.317  6.052   23.913  1.00 38.19 ? 480  TRP A C   1 
ATOM   3679 O O   . TRP A 1 480 ? 15.055  5.063   23.873  1.00 38.08 ? 480  TRP A O   1 
ATOM   3680 C CB  . TRP A 1 480 ? 14.914  8.208   22.781  1.00 37.00 ? 480  TRP A CB  1 
ATOM   3681 C CG  . TRP A 1 480 ? 15.689  8.576   21.539  1.00 36.97 ? 480  TRP A CG  1 
ATOM   3682 C CD1 . TRP A 1 480 ? 17.034  8.756   21.448  1.00 36.26 ? 480  TRP A CD1 1 
ATOM   3683 C CD2 . TRP A 1 480 ? 15.167  8.837   20.221  1.00 37.13 ? 480  TRP A CD2 1 
ATOM   3684 N NE1 . TRP A 1 480 ? 17.386  9.101   20.173  1.00 35.33 ? 480  TRP A NE1 1 
ATOM   3685 C CE2 . TRP A 1 480 ? 16.264  9.162   19.399  1.00 35.11 ? 480  TRP A CE2 1 
ATOM   3686 C CE3 . TRP A 1 480 ? 13.881  8.821   19.657  1.00 35.22 ? 480  TRP A CE3 1 
ATOM   3687 C CZ2 . TRP A 1 480 ? 16.122  9.457   18.050  1.00 36.27 ? 480  TRP A CZ2 1 
ATOM   3688 C CZ3 . TRP A 1 480 ? 13.739  9.117   18.323  1.00 35.38 ? 480  TRP A CZ3 1 
ATOM   3689 C CH2 . TRP A 1 480 ? 14.849  9.437   17.530  1.00 37.09 ? 480  TRP A CH2 1 
ATOM   3690 N N   . THR A 1 481 ? 13.687  6.433   25.022  1.00 38.49 ? 481  THR A N   1 
ATOM   3691 C CA  . THR A 1 481 ? 13.896  5.707   26.266  1.00 38.54 ? 481  THR A CA  1 
ATOM   3692 C C   . THR A 1 481 ? 13.161  4.387   26.250  1.00 38.70 ? 481  THR A C   1 
ATOM   3693 O O   . THR A 1 481 ? 13.589  3.452   26.909  1.00 39.04 ? 481  THR A O   1 
ATOM   3694 C CB  . THR A 1 481 ? 13.502  6.514   27.492  1.00 38.64 ? 481  THR A CB  1 
ATOM   3695 O OG1 . THR A 1 481 ? 12.161  7.002   27.328  1.00 39.25 ? 481  THR A OG1 1 
ATOM   3696 C CG2 . THR A 1 481 ? 14.454  7.689   27.671  1.00 38.81 ? 481  THR A CG2 1 
ATOM   3697 N N   . ASN A 1 482 ? 12.071  4.288   25.495  1.00 38.86 ? 482  ASN A N   1 
ATOM   3698 C CA  . ASN A 1 482 ? 11.444  2.980   25.302  1.00 39.10 ? 482  ASN A CA  1 
ATOM   3699 C C   . ASN A 1 482 ? 12.401  2.087   24.552  1.00 39.09 ? 482  ASN A C   1 
ATOM   3700 O O   . ASN A 1 482 ? 12.606  0.918   24.934  1.00 39.72 ? 482  ASN A O   1 
ATOM   3701 C CB  . ASN A 1 482 ? 10.121  3.063   24.544  1.00 39.13 ? 482  ASN A CB  1 
ATOM   3702 C CG  . ASN A 1 482 ? 8.975   3.498   25.422  1.00 40.08 ? 482  ASN A CG  1 
ATOM   3703 O OD1 . ASN A 1 482 ? 9.091   3.543   26.651  1.00 41.66 ? 482  ASN A OD1 1 
ATOM   3704 N ND2 . ASN A 1 482 ? 7.857   3.822   24.797  1.00 40.54 ? 482  ASN A ND2 1 
ATOM   3705 N N   . PHE A 1 483 ? 12.997  2.635   23.494  1.00 38.33 ? 483  PHE A N   1 
ATOM   3706 C CA  . PHE A 1 483 ? 13.961  1.876   22.735  1.00 38.11 ? 483  PHE A CA  1 
ATOM   3707 C C   . PHE A 1 483 ? 15.123  1.441   23.626  1.00 38.78 ? 483  PHE A C   1 
ATOM   3708 O O   . PHE A 1 483 ? 15.555  0.280   23.578  1.00 38.69 ? 483  PHE A O   1 
ATOM   3709 C CB  . PHE A 1 483 ? 14.483  2.647   21.532  1.00 37.61 ? 483  PHE A CB  1 
ATOM   3710 C CG  . PHE A 1 483 ? 15.551  1.923   20.817  1.00 35.75 ? 483  PHE A CG  1 
ATOM   3711 C CD1 . PHE A 1 483 ? 15.227  0.931   19.896  1.00 34.80 ? 483  PHE A CD1 1 
ATOM   3712 C CD2 . PHE A 1 483 ? 16.878  2.172   21.106  1.00 33.05 ? 483  PHE A CD2 1 
ATOM   3713 C CE1 . PHE A 1 483 ? 16.214  0.210   19.247  1.00 34.50 ? 483  PHE A CE1 1 
ATOM   3714 C CE2 . PHE A 1 483 ? 17.877  1.453   20.466  1.00 33.17 ? 483  PHE A CE2 1 
ATOM   3715 C CZ  . PHE A 1 483 ? 17.548  0.475   19.529  1.00 34.55 ? 483  PHE A CZ  1 
ATOM   3716 N N   . ALA A 1 484 ? 15.635  2.365   24.436  1.00 39.45 ? 484  ALA A N   1 
ATOM   3717 C CA  . ALA A 1 484 ? 16.650  2.002   25.416  1.00 40.44 ? 484  ALA A CA  1 
ATOM   3718 C C   . ALA A 1 484 ? 16.139  0.880   26.327  1.00 41.26 ? 484  ALA A C   1 
ATOM   3719 O O   . ALA A 1 484 ? 16.835  -0.106  26.543  1.00 41.03 ? 484  ALA A O   1 
ATOM   3720 C CB  . ALA A 1 484 ? 17.075  3.205   26.235  1.00 40.19 ? 484  ALA A CB  1 
ATOM   3721 N N   . ARG A 1 485 ? 14.920  1.026   26.847  1.00 42.25 ? 485  ARG A N   1 
ATOM   3722 C CA  . ARG A 1 485 ? 14.396  0.053   27.801  1.00 43.60 ? 485  ARG A CA  1 
ATOM   3723 C C   . ARG A 1 485 ? 14.189  -1.323  27.163  1.00 42.96 ? 485  ARG A C   1 
ATOM   3724 O O   . ARG A 1 485 ? 14.515  -2.325  27.767  1.00 42.92 ? 485  ARG A O   1 
ATOM   3725 C CB  . ARG A 1 485 ? 13.097  0.546   28.479  1.00 43.67 ? 485  ARG A CB  1 
ATOM   3726 C CG  . ARG A 1 485 ? 13.295  1.608   29.594  1.00 45.97 ? 485  ARG A CG  1 
ATOM   3727 C CD  . ARG A 1 485 ? 11.954  2.064   30.248  1.00 45.79 ? 485  ARG A CD  1 
ATOM   3728 N NE  . ARG A 1 485 ? 11.169  2.917   29.350  1.00 49.43 ? 485  ARG A NE  1 
ATOM   3729 C CZ  . ARG A 1 485 ? 11.055  4.238   29.468  1.00 50.38 ? 485  ARG A CZ  1 
ATOM   3730 N NH1 . ARG A 1 485 ? 11.657  4.875   30.468  1.00 51.61 ? 485  ARG A NH1 1 
ATOM   3731 N NH2 . ARG A 1 485 ? 10.334  4.929   28.583  1.00 50.57 ? 485  ARG A NH2 1 
ATOM   3732 N N   . THR A 1 486 ? 13.685  -1.374  25.936  1.00 42.87 ? 486  THR A N   1 
ATOM   3733 C CA  . THR A 1 486 ? 13.110  -2.623  25.454  1.00 42.88 ? 486  THR A CA  1 
ATOM   3734 C C   . THR A 1 486 ? 13.636  -3.119  24.125  1.00 43.41 ? 486  THR A C   1 
ATOM   3735 O O   . THR A 1 486 ? 13.420  -4.281  23.768  1.00 43.43 ? 486  THR A O   1 
ATOM   3736 C CB  . THR A 1 486 ? 11.576  -2.500  25.312  1.00 42.64 ? 486  THR A CB  1 
ATOM   3737 O OG1 . THR A 1 486 ? 11.280  -1.619  24.230  1.00 41.34 ? 486  THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 486 ? 10.928  -1.966  26.597  1.00 41.23 ? 486  THR A CG2 1 
ATOM   3739 N N   . GLY A 1 487 ? 14.293  -2.236  23.383  1.00 44.01 ? 487  GLY A N   1 
ATOM   3740 C CA  . GLY A 1 487 ? 14.660  -2.508  21.994  1.00 44.71 ? 487  GLY A CA  1 
ATOM   3741 C C   . GLY A 1 487 ? 13.547  -2.130  21.034  1.00 45.50 ? 487  GLY A C   1 
ATOM   3742 O O   . GLY A 1 487 ? 13.643  -2.392  19.832  1.00 45.09 ? 487  GLY A O   1 
ATOM   3743 N N   . ASP A 1 488 ? 12.504  -1.496  21.573  1.00 46.45 ? 488  ASP A N   1 
ATOM   3744 C CA  . ASP A 1 488 ? 11.305  -1.142  20.833  1.00 47.89 ? 488  ASP A CA  1 
ATOM   3745 C C   . ASP A 1 488 ? 10.888  0.274   21.229  1.00 48.77 ? 488  ASP A C   1 
ATOM   3746 O O   . ASP A 1 488 ? 10.617  0.526   22.403  1.00 49.20 ? 488  ASP A O   1 
ATOM   3747 C CB  . ASP A 1 488 ? 10.178  -2.136  21.162  1.00 47.86 ? 488  ASP A CB  1 
ATOM   3748 C CG  . ASP A 1 488 ? 8.981   -2.032  20.213  1.00 49.00 ? 488  ASP A CG  1 
ATOM   3749 O OD1 . ASP A 1 488 ? 8.717   -0.953  19.648  1.00 48.06 ? 488  ASP A OD1 1 
ATOM   3750 O OD2 . ASP A 1 488 ? 8.273   -3.050  20.040  1.00 51.42 ? 488  ASP A OD2 1 
ATOM   3751 N N   . PRO A 1 489 ? 10.821  1.204   20.251  1.00 49.67 ? 489  PRO A N   1 
ATOM   3752 C CA  . PRO A 1 489 ? 10.432  2.577   20.547  1.00 50.67 ? 489  PRO A CA  1 
ATOM   3753 C C   . PRO A 1 489 ? 8.946   2.724   20.842  1.00 52.03 ? 489  PRO A C   1 
ATOM   3754 O O   . PRO A 1 489 ? 8.507   3.779   21.297  1.00 51.70 ? 489  PRO A O   1 
ATOM   3755 C CB  . PRO A 1 489 ? 10.791  3.325   19.253  1.00 50.61 ? 489  PRO A CB  1 
ATOM   3756 C CG  . PRO A 1 489 ? 10.679  2.323   18.206  1.00 49.95 ? 489  PRO A CG  1 
ATOM   3757 C CD  . PRO A 1 489 ? 11.122  1.023   18.819  1.00 49.39 ? 489  PRO A CD  1 
ATOM   3758 N N   . ASN A 1 490 ? 8.180   1.677   20.572  1.00 54.24 ? 490  ASN A N   1 
ATOM   3759 C CA  . ASN A 1 490 ? 6.741   1.727   20.769  1.00 56.68 ? 490  ASN A CA  1 
ATOM   3760 C C   . ASN A 1 490 ? 6.382   1.648   22.241  1.00 59.20 ? 490  ASN A C   1 
ATOM   3761 O O   . ASN A 1 490 ? 7.084   1.025   23.041  1.00 59.16 ? 490  ASN A O   1 
ATOM   3762 C CB  . ASN A 1 490 ? 6.030   0.622   19.974  1.00 55.98 ? 490  ASN A CB  1 
ATOM   3763 C CG  . ASN A 1 490 ? 6.124   0.825   18.469  1.00 53.98 ? 490  ASN A CG  1 
ATOM   3764 O OD1 . ASN A 1 490 ? 5.494   1.722   17.910  1.00 51.62 ? 490  ASN A OD1 1 
ATOM   3765 N ND2 . ASN A 1 490 ? 6.901   -0.019  17.808  1.00 50.71 ? 490  ASN A ND2 1 
ATOM   3766 N N   . ASP A 1 491 ? 5.298   2.325   22.591  1.00 62.89 ? 491  ASP A N   1 
ATOM   3767 C CA  . ASP A 1 491 ? 4.729   2.229   23.919  1.00 66.42 ? 491  ASP A CA  1 
ATOM   3768 C C   . ASP A 1 491 ? 3.828   0.991   23.945  1.00 68.60 ? 491  ASP A C   1 
ATOM   3769 O O   . ASP A 1 491 ? 2.807   0.960   23.234  1.00 68.74 ? 491  ASP A O   1 
ATOM   3770 C CB  . ASP A 1 491 ? 3.924   3.486   24.225  1.00 66.93 ? 491  ASP A CB  1 
ATOM   3771 C CG  . ASP A 1 491 ? 3.741   3.716   25.716  1.00 69.14 ? 491  ASP A CG  1 
ATOM   3772 O OD1 . ASP A 1 491 ? 3.490   2.732   26.461  1.00 70.23 ? 491  ASP A OD1 1 
ATOM   3773 O OD2 . ASP A 1 491 ? 3.844   4.899   26.132  1.00 71.64 ? 491  ASP A OD2 1 
ATOM   3774 N N   . PRO A 1 492 ? 4.199   -0.030  24.759  1.00 70.64 ? 492  PRO A N   1 
ATOM   3775 C CA  . PRO A 1 492 ? 3.504   -1.335  24.766  1.00 72.24 ? 492  PRO A CA  1 
ATOM   3776 C C   . PRO A 1 492 ? 2.059   -1.254  25.275  1.00 73.59 ? 492  PRO A C   1 
ATOM   3777 O O   . PRO A 1 492 ? 1.278   -2.189  25.074  1.00 73.71 ? 492  PRO A O   1 
ATOM   3778 C CB  . PRO A 1 492 ? 4.359   -2.194  25.714  1.00 72.34 ? 492  PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 492 ? 5.668   -1.449  25.856  1.00 71.81 ? 492  PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 492 ? 5.294   -0.001  25.746  1.00 70.83 ? 492  PRO A CD  1 
ATOM   3781 N N   . ARG A 1 493 ? 1.723   -0.140  25.928  1.00 75.10 ? 493  ARG A N   1 
ATOM   3782 C CA  . ARG A 1 493 ? 0.357   0.150   26.359  1.00 76.54 ? 493  ARG A CA  1 
ATOM   3783 C C   . ARG A 1 493 ? -0.373  0.827   25.212  1.00 76.93 ? 493  ARG A C   1 
ATOM   3784 O O   . ARG A 1 493 ? -1.177  0.198   24.505  1.00 77.12 ? 493  ARG A O   1 
ATOM   3785 C CB  . ARG A 1 493 ? 0.366   1.091   27.568  1.00 76.89 ? 493  ARG A CB  1 
ATOM   3786 C CG  . ARG A 1 493 ? 1.169   0.579   28.750  1.00 79.15 ? 493  ARG A CG  1 
ATOM   3787 C CD  . ARG A 1 493 ? 1.860   1.715   29.475  1.00 82.05 ? 493  ARG A CD  1 
ATOM   3788 N NE  . ARG A 1 493 ? 2.877   1.205   30.393  1.00 84.67 ? 493  ARG A NE  1 
ATOM   3789 C CZ  . ARG A 1 493 ? 3.389   1.898   31.406  1.00 86.05 ? 493  ARG A CZ  1 
ATOM   3790 N NH1 . ARG A 1 493 ? 2.978   3.143   31.648  1.00 86.20 ? 493  ARG A NH1 1 
ATOM   3791 N NH2 . ARG A 1 493 ? 4.307   1.339   32.188  1.00 86.27 ? 493  ARG A NH2 1 
ATOM   3792 N N   . ASP A 1 494 ? -0.052  2.113   25.042  1.00 77.20 ? 494  ASP A N   1 
ATOM   3793 C CA  . ASP A 1 494 ? -0.637  3.013   24.051  1.00 77.19 ? 494  ASP A CA  1 
ATOM   3794 C C   . ASP A 1 494 ? -0.717  2.425   22.639  1.00 77.03 ? 494  ASP A C   1 
ATOM   3795 O O   . ASP A 1 494 ? 0.151   2.683   21.797  1.00 77.39 ? 494  ASP A O   1 
ATOM   3796 C CB  . ASP A 1 494 ? 0.169   4.316   24.034  1.00 77.24 ? 494  ASP A CB  1 
ATOM   3797 C CG  . ASP A 1 494 ? -0.580  5.463   23.386  1.00 77.95 ? 494  ASP A CG  1 
ATOM   3798 O OD1 . ASP A 1 494 ? -1.290  5.236   22.377  1.00 78.44 ? 494  ASP A OD1 1 
ATOM   3799 O OD2 . ASP A 1 494 ? -0.451  6.602   23.887  1.00 78.36 ? 494  ASP A OD2 1 
ATOM   3800 N N   . SER A 1 495 ? -1.772  1.652   22.387  1.00 76.69 ? 495  SER A N   1 
ATOM   3801 C CA  . SER A 1 495 ? -2.001  1.033   21.077  1.00 76.34 ? 495  SER A CA  1 
ATOM   3802 C C   . SER A 1 495 ? -2.818  1.943   20.149  1.00 75.89 ? 495  SER A C   1 
ATOM   3803 O O   . SER A 1 495 ? -2.907  1.690   18.938  1.00 75.86 ? 495  SER A O   1 
ATOM   3804 C CB  . SER A 1 495 ? -2.661  -0.349  21.228  1.00 76.53 ? 495  SER A CB  1 
ATOM   3805 O OG  . SER A 1 495 ? -3.856  -0.275  21.986  1.00 76.50 ? 495  SER A OG  1 
ATOM   3806 N N   . LYS A 1 496 ? -3.408  2.996   20.728  1.00 75.22 ? 496  LYS A N   1 
ATOM   3807 C CA  . LYS A 1 496 ? -4.041  4.096   19.967  1.00 74.41 ? 496  LYS A CA  1 
ATOM   3808 C C   . LYS A 1 496 ? -3.024  4.729   18.993  1.00 73.09 ? 496  LYS A C   1 
ATOM   3809 O O   . LYS A 1 496 ? -3.239  4.731   17.770  1.00 72.97 ? 496  LYS A O   1 
ATOM   3810 C CB  . LYS A 1 496 ? -4.620  5.180   20.908  1.00 74.80 ? 496  LYS A CB  1 
ATOM   3811 C CG  . LYS A 1 496 ? -5.010  4.683   22.303  1.00 76.87 ? 496  LYS A CG  1 
ATOM   3812 C CD  . LYS A 1 496 ? -6.259  5.379   22.867  1.00 80.14 ? 496  LYS A CD  1 
ATOM   3813 C CE  . LYS A 1 496 ? -6.888  4.527   23.992  1.00 81.76 ? 496  LYS A CE  1 
ATOM   3814 N NZ  . LYS A 1 496 ? -8.103  5.146   24.613  1.00 82.82 ? 496  LYS A NZ  1 
ATOM   3815 N N   . SER A 1 497 ? -1.917  5.238   19.551  1.00 71.07 ? 497  SER A N   1 
ATOM   3816 C CA  . SER A 1 497 ? -0.805  5.790   18.773  1.00 69.15 ? 497  SER A CA  1 
ATOM   3817 C C   . SER A 1 497 ? -0.396  4.819   17.665  1.00 67.55 ? 497  SER A C   1 
ATOM   3818 O O   . SER A 1 497 ? -0.356  3.599   17.894  1.00 67.57 ? 497  SER A O   1 
ATOM   3819 C CB  . SER A 1 497 ? 0.401   6.085   19.675  1.00 69.19 ? 497  SER A CB  1 
ATOM   3820 O OG  . SER A 1 497 ? 0.072   7.004   20.707  1.00 68.87 ? 497  SER A OG  1 
ATOM   3821 N N   . PRO A 1 498 ? -0.107  5.351   16.456  1.00 65.70 ? 498  PRO A N   1 
ATOM   3822 C CA  . PRO A 1 498 ? 0.268   4.474   15.336  1.00 63.86 ? 498  PRO A CA  1 
ATOM   3823 C C   . PRO A 1 498 ? 1.600   3.816   15.647  1.00 61.90 ? 498  PRO A C   1 
ATOM   3824 O O   . PRO A 1 498 ? 2.476   4.454   16.237  1.00 61.82 ? 498  PRO A O   1 
ATOM   3825 C CB  . PRO A 1 498 ? 0.399   5.434   14.147  1.00 63.91 ? 498  PRO A CB  1 
ATOM   3826 C CG  . PRO A 1 498 ? -0.249  6.724   14.589  1.00 64.93 ? 498  PRO A CG  1 
ATOM   3827 C CD  . PRO A 1 498 ? -0.106  6.776   16.075  1.00 65.47 ? 498  PRO A CD  1 
ATOM   3828 N N   . GLN A 1 499 ? 1.741   2.544   15.294  1.00 59.36 ? 499  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 499 ? 2.964   1.816   15.624  1.00 56.74 ? 499  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 499 ? 4.115   2.163   14.668  1.00 54.52 ? 499  GLN A C   1 
ATOM   3831 O O   . GLN A 1 499 ? 3.900   2.500   13.503  1.00 54.06 ? 499  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 499 ? 2.711   0.300   15.687  1.00 56.94 ? 499  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 499 ? 1.663   -0.119  16.730  1.00 57.54 ? 499  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 499 ? 2.051   0.236   18.170  1.00 56.74 ? 499  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 499 ? 2.797   -0.498  18.824  1.00 55.78 ? 499  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 499 ? 1.520   1.356   18.672  1.00 56.71 ? 499  GLN A NE2 1 
ATOM   3837 N N   . TRP A 1 500 ? 5.329   2.104   15.198  1.00 51.65 ? 500  TRP A N   1 
ATOM   3838 C CA  . TRP A 1 500 ? 6.531   2.332   14.432  1.00 48.99 ? 500  TRP A CA  1 
ATOM   3839 C C   . TRP A 1 500 ? 7.009   0.938   14.065  1.00 47.80 ? 500  TRP A C   1 
ATOM   3840 O O   . TRP A 1 500 ? 7.481   0.210   14.919  1.00 47.93 ? 500  TRP A O   1 
ATOM   3841 C CB  . TRP A 1 500 ? 7.539   3.082   15.310  1.00 47.74 ? 500  TRP A CB  1 
ATOM   3842 C CG  . TRP A 1 500 ? 8.875   3.465   14.712  1.00 46.91 ? 500  TRP A CG  1 
ATOM   3843 C CD1 . TRP A 1 500 ? 9.503   2.910   13.628  1.00 46.38 ? 500  TRP A CD1 1 
ATOM   3844 C CD2 . TRP A 1 500 ? 9.776   4.452   15.230  1.00 45.56 ? 500  TRP A CD2 1 
ATOM   3845 N NE1 . TRP A 1 500 ? 10.725  3.517   13.423  1.00 45.93 ? 500  TRP A NE1 1 
ATOM   3846 C CE2 . TRP A 1 500 ? 10.914  4.463   14.396  1.00 45.05 ? 500  TRP A CE2 1 
ATOM   3847 C CE3 . TRP A 1 500 ? 9.720   5.344   16.306  1.00 44.82 ? 500  TRP A CE3 1 
ATOM   3848 C CZ2 . TRP A 1 500 ? 11.975  5.325   14.606  1.00 44.78 ? 500  TRP A CZ2 1 
ATOM   3849 C CZ3 . TRP A 1 500 ? 10.774  6.200   16.510  1.00 44.89 ? 500  TRP A CZ3 1 
ATOM   3850 C CH2 . TRP A 1 500 ? 11.891  6.180   15.667  1.00 45.47 ? 500  TRP A CH2 1 
ATOM   3851 N N   . PRO A 1 501 ? 6.832   0.537   12.799  1.00 46.88 ? 501  PRO A N   1 
ATOM   3852 C CA  . PRO A 1 501 ? 7.283   -0.784  12.395  1.00 46.22 ? 501  PRO A CA  1 
ATOM   3853 C C   . PRO A 1 501 ? 8.772   -0.801  12.236  1.00 45.71 ? 501  PRO A C   1 
ATOM   3854 O O   . PRO A 1 501 ? 9.342   0.219   11.868  1.00 45.82 ? 501  PRO A O   1 
ATOM   3855 C CB  . PRO A 1 501 ? 6.639   -0.975  11.019  1.00 46.08 ? 501  PRO A CB  1 
ATOM   3856 C CG  . PRO A 1 501 ? 6.408   0.375   10.504  1.00 46.32 ? 501  PRO A CG  1 
ATOM   3857 C CD  . PRO A 1 501 ? 6.190   1.268   11.691  1.00 46.88 ? 501  PRO A CD  1 
ATOM   3858 N N   . PRO A 1 502 ? 9.414   -1.941  12.532  1.00 45.31 ? 502  PRO A N   1 
ATOM   3859 C CA  . PRO A 1 502 ? 10.826  -2.089  12.161  1.00 45.00 ? 502  PRO A CA  1 
ATOM   3860 C C   . PRO A 1 502 ? 11.087  -1.823  10.671  1.00 44.96 ? 502  PRO A C   1 
ATOM   3861 O O   . PRO A 1 502 ? 10.178  -1.890  9.854   1.00 44.93 ? 502  PRO A O   1 
ATOM   3862 C CB  . PRO A 1 502 ? 11.134  -3.553  12.511  1.00 44.68 ? 502  PRO A CB  1 
ATOM   3863 C CG  . PRO A 1 502 ? 10.172  -3.882  13.600  1.00 44.91 ? 502  PRO A CG  1 
ATOM   3864 C CD  . PRO A 1 502 ? 8.909   -3.112  13.272  1.00 44.98 ? 502  PRO A CD  1 
ATOM   3865 N N   . TYR A 1 503 ? 12.330  -1.490  10.341  1.00 45.06 ? 503  TYR A N   1 
ATOM   3866 C CA  . TYR A 1 503 ? 12.746  -1.337  8.966   1.00 44.74 ? 503  TYR A CA  1 
ATOM   3867 C C   . TYR A 1 503 ? 13.231  -2.686  8.437   1.00 45.28 ? 503  TYR A C   1 
ATOM   3868 O O   . TYR A 1 503 ? 14.040  -3.367  9.068   1.00 44.97 ? 503  TYR A O   1 
ATOM   3869 C CB  . TYR A 1 503 ? 13.834  -0.280  8.877   1.00 44.07 ? 503  TYR A CB  1 
ATOM   3870 C CG  . TYR A 1 503 ? 14.472  -0.132  7.522   1.00 43.41 ? 503  TYR A CG  1 
ATOM   3871 C CD1 . TYR A 1 503 ? 15.596  -0.886  7.172   1.00 41.95 ? 503  TYR A CD1 1 
ATOM   3872 C CD2 . TYR A 1 503 ? 13.979  0.781   6.597   1.00 42.55 ? 503  TYR A CD2 1 
ATOM   3873 C CE1 . TYR A 1 503 ? 16.193  -0.741  5.931   1.00 41.34 ? 503  TYR A CE1 1 
ATOM   3874 C CE2 . TYR A 1 503 ? 14.580  0.932   5.353   1.00 42.27 ? 503  TYR A CE2 1 
ATOM   3875 C CZ  . TYR A 1 503 ? 15.681  0.169   5.033   1.00 42.34 ? 503  TYR A CZ  1 
ATOM   3876 O OH  . TYR A 1 503 ? 16.269  0.310   3.803   1.00 43.60 ? 503  TYR A OH  1 
ATOM   3877 N N   . THR A 1 504 ? 12.721  -3.064  7.273   1.00 45.98 ? 504  THR A N   1 
ATOM   3878 C CA  . THR A 1 504 ? 13.047  -4.346  6.669   1.00 46.66 ? 504  THR A CA  1 
ATOM   3879 C C   . THR A 1 504 ? 13.483  -4.131  5.234   1.00 47.06 ? 504  THR A C   1 
ATOM   3880 O O   . THR A 1 504 ? 13.126  -3.131  4.615   1.00 46.87 ? 504  THR A O   1 
ATOM   3881 C CB  . THR A 1 504 ? 11.827  -5.286  6.662   1.00 46.83 ? 504  THR A CB  1 
ATOM   3882 O OG1 . THR A 1 504 ? 10.713  -4.630  6.033   1.00 46.25 ? 504  THR A OG1 1 
ATOM   3883 C CG2 . THR A 1 504 ? 11.447  -5.676  8.086   1.00 47.37 ? 504  THR A CG2 1 
ATOM   3884 N N   . THR A 1 505 ? 14.254  -5.076  4.708   1.00 47.63 ? 505  THR A N   1 
ATOM   3885 C CA  . THR A 1 505 ? 14.643  -5.037  3.314   1.00 48.34 ? 505  THR A CA  1 
ATOM   3886 C C   . THR A 1 505 ? 13.401  -5.225  2.453   1.00 48.36 ? 505  THR A C   1 
ATOM   3887 O O   . THR A 1 505 ? 13.273  -4.602  1.401   1.00 48.48 ? 505  THR A O   1 
ATOM   3888 C CB  . THR A 1 505 ? 15.661  -6.107  3.008   1.00 48.49 ? 505  THR A CB  1 
ATOM   3889 O OG1 . THR A 1 505 ? 15.177  -7.350  3.510   1.00 49.89 ? 505  THR A OG1 1 
ATOM   3890 C CG2 . THR A 1 505 ? 16.987  -5.785  3.705   1.00 49.46 ? 505  THR A CG2 1 
ATOM   3891 N N   . ALA A 1 506 ? 12.474  -6.052  2.935   1.00 48.38 ? 506  ALA A N   1 
ATOM   3892 C CA  . ALA A 1 506 ? 11.192  -6.283  2.254   1.00 48.31 ? 506  ALA A CA  1 
ATOM   3893 C C   . ALA A 1 506 ? 10.348  -5.028  2.118   1.00 47.64 ? 506  ALA A C   1 
ATOM   3894 O O   . ALA A 1 506 ? 9.959   -4.684  1.016   1.00 48.07 ? 506  ALA A O   1 
ATOM   3895 C CB  . ALA A 1 506 ? 10.372  -7.396  2.960   1.00 48.50 ? 506  ALA A CB  1 
ATOM   3896 N N   . ALA A 1 507 ? 10.065  -4.354  3.230   1.00 47.05 ? 507  ALA A N   1 
ATOM   3897 C CA  . ALA A 1 507 ? 9.098   -3.245  3.231   1.00 46.48 ? 507  ALA A CA  1 
ATOM   3898 C C   . ALA A 1 507 ? 9.707   -1.842  3.374   1.00 46.01 ? 507  ALA A C   1 
ATOM   3899 O O   . ALA A 1 507 ? 9.018   -0.836  3.168   1.00 45.70 ? 507  ALA A O   1 
ATOM   3900 C CB  . ALA A 1 507 ? 8.016   -3.474  4.296   1.00 46.15 ? 507  ALA A CB  1 
ATOM   3901 N N   . GLN A 1 508 ? 10.984  -1.784  3.737   1.00 45.65 ? 508  GLN A N   1 
ATOM   3902 C CA  . GLN A 1 508 ? 11.711  -0.511  3.898   1.00 45.72 ? 508  GLN A CA  1 
ATOM   3903 C C   . GLN A 1 508 ? 10.918  0.575   4.630   1.00 45.40 ? 508  GLN A C   1 
ATOM   3904 O O   . GLN A 1 508 ? 10.899  1.734   4.205   1.00 45.53 ? 508  GLN A O   1 
ATOM   3905 C CB  . GLN A 1 508 ? 12.195  0.011   2.543   1.00 45.45 ? 508  GLN A CB  1 
ATOM   3906 C CG  . GLN A 1 508 ? 13.132  -0.942  1.834   1.00 47.56 ? 508  GLN A CG  1 
ATOM   3907 C CD  . GLN A 1 508 ? 13.504  -0.471  0.451   1.00 49.26 ? 508  GLN A CD  1 
ATOM   3908 O OE1 . GLN A 1 508 ? 14.197  0.535   0.295   1.00 51.04 ? 508  GLN A OE1 1 
ATOM   3909 N NE2 . GLN A 1 508 ? 13.055  -1.201  -0.568  1.00 49.44 ? 508  GLN A NE2 1 
ATOM   3910 N N   . GLN A 1 509 ? 10.269  0.202   5.729   1.00 44.88 ? 509  GLN A N   1 
ATOM   3911 C CA  . GLN A 1 509 ? 9.487   1.158   6.503   1.00 44.66 ? 509  GLN A CA  1 
ATOM   3912 C C   . GLN A 1 509 ? 10.292  2.028   7.470   1.00 44.03 ? 509  GLN A C   1 
ATOM   3913 O O   . GLN A 1 509 ? 11.215  1.561   8.147   1.00 43.62 ? 509  GLN A O   1 
ATOM   3914 C CB  . GLN A 1 509 ? 8.365   0.454   7.259   1.00 45.09 ? 509  GLN A CB  1 
ATOM   3915 C CG  . GLN A 1 509 ? 7.130   0.170   6.410   1.00 46.47 ? 509  GLN A CG  1 
ATOM   3916 C CD  . GLN A 1 509 ? 6.191   -0.810  7.070   1.00 47.08 ? 509  GLN A CD  1 
ATOM   3917 O OE1 . GLN A 1 509 ? 6.606   -1.885  7.503   1.00 49.38 ? 509  GLN A OE1 1 
ATOM   3918 N NE2 . GLN A 1 509 ? 4.921   -0.452  7.145   1.00 47.76 ? 509  GLN A NE2 1 
ATOM   3919 N N   . TYR A 1 510 ? 9.905   3.299   7.524   1.00 43.11 ? 510  TYR A N   1 
ATOM   3920 C CA  . TYR A 1 510 ? 10.459  4.259   8.460   1.00 42.50 ? 510  TYR A CA  1 
ATOM   3921 C C   . TYR A 1 510 ? 9.363   5.240   8.811   1.00 42.74 ? 510  TYR A C   1 
ATOM   3922 O O   . TYR A 1 510 ? 8.297   5.247   8.174   1.00 43.03 ? 510  TYR A O   1 
ATOM   3923 C CB  . TYR A 1 510 ? 11.671  4.983   7.871   1.00 42.35 ? 510  TYR A CB  1 
ATOM   3924 C CG  . TYR A 1 510 ? 11.386  5.908   6.708   1.00 41.65 ? 510  TYR A CG  1 
ATOM   3925 C CD1 . TYR A 1 510 ? 11.291  5.419   5.398   1.00 39.74 ? 510  TYR A CD1 1 
ATOM   3926 C CD2 . TYR A 1 510 ? 11.241  7.275   6.914   1.00 41.51 ? 510  TYR A CD2 1 
ATOM   3927 C CE1 . TYR A 1 510 ? 11.038  6.262   4.338   1.00 40.00 ? 510  TYR A CE1 1 
ATOM   3928 C CE2 . TYR A 1 510 ? 10.981  8.130   5.854   1.00 42.44 ? 510  TYR A CE2 1 
ATOM   3929 C CZ  . TYR A 1 510 ? 10.885  7.620   4.566   1.00 42.04 ? 510  TYR A CZ  1 
ATOM   3930 O OH  . TYR A 1 510 ? 10.640  8.491   3.526   1.00 41.76 ? 510  TYR A OH  1 
ATOM   3931 N N   . VAL A 1 511 ? 9.586   6.058   9.831   1.00 42.07 ? 511  VAL A N   1 
ATOM   3932 C CA  . VAL A 1 511 ? 8.520   6.936   10.256  1.00 41.78 ? 511  VAL A CA  1 
ATOM   3933 C C   . VAL A 1 511 ? 8.914   8.387   10.176  1.00 41.67 ? 511  VAL A C   1 
ATOM   3934 O O   . VAL A 1 511 ? 10.082  8.729   10.317  1.00 42.08 ? 511  VAL A O   1 
ATOM   3935 C CB  . VAL A 1 511 ? 7.992   6.585   11.661  1.00 42.00 ? 511  VAL A CB  1 
ATOM   3936 C CG1 . VAL A 1 511 ? 7.275   5.230   11.641  1.00 41.83 ? 511  VAL A CG1 1 
ATOM   3937 C CG2 . VAL A 1 511 ? 9.105   6.596   12.681  1.00 41.29 ? 511  VAL A CG2 1 
ATOM   3938 N N   . SER A 1 512 ? 7.937   9.241   9.920   1.00 41.58 ? 512  SER A N   1 
ATOM   3939 C CA  . SER A 1 512 ? 8.155   10.669  10.011  1.00 41.44 ? 512  SER A CA  1 
ATOM   3940 C C   . SER A 1 512 ? 8.024   11.074  11.468  1.00 41.35 ? 512  SER A C   1 
ATOM   3941 O O   . SER A 1 512 ? 7.151   10.582  12.179  1.00 41.36 ? 512  SER A O   1 
ATOM   3942 C CB  . SER A 1 512 ? 7.132   11.414  9.167   1.00 41.54 ? 512  SER A CB  1 
ATOM   3943 O OG  . SER A 1 512 ? 5.826   10.935  9.441   1.00 42.73 ? 512  SER A OG  1 
ATOM   3944 N N   . LEU A 1 513 ? 8.919   11.948  11.917  1.00 41.20 ? 513  LEU A N   1 
ATOM   3945 C CA  . LEU A 1 513 ? 8.832   12.539  13.232  1.00 40.45 ? 513  LEU A CA  1 
ATOM   3946 C C   . LEU A 1 513 ? 8.631   14.026  13.018  1.00 40.93 ? 513  LEU A C   1 
ATOM   3947 O O   . LEU A 1 513 ? 9.507   14.728  12.471  1.00 40.77 ? 513  LEU A O   1 
ATOM   3948 C CB  . LEU A 1 513 ? 10.099  12.267  14.051  1.00 40.36 ? 513  LEU A CB  1 
ATOM   3949 C CG  . LEU A 1 513 ? 10.509  10.835  14.409  1.00 39.17 ? 513  LEU A CG  1 
ATOM   3950 C CD1 . LEU A 1 513 ? 11.840  10.850  15.081  1.00 38.48 ? 513  LEU A CD1 1 
ATOM   3951 C CD2 . LEU A 1 513 ? 9.516   10.208  15.336  1.00 40.64 ? 513  LEU A CD2 1 
ATOM   3952 N N   . ASN A 1 514 ? 7.453   14.488  13.418  1.00 41.01 ? 514  ASN A N   1 
ATOM   3953 C CA  . ASN A 1 514 ? 7.074   15.896  13.344  1.00 41.46 ? 514  ASN A CA  1 
ATOM   3954 C C   . ASN A 1 514 ? 5.915   16.100  14.303  1.00 41.80 ? 514  ASN A C   1 
ATOM   3955 O O   . ASN A 1 514 ? 5.649   15.223  15.115  1.00 41.55 ? 514  ASN A O   1 
ATOM   3956 C CB  . ASN A 1 514 ? 6.713   16.307  11.910  1.00 41.18 ? 514  ASN A CB  1 
ATOM   3957 C CG  . ASN A 1 514 ? 5.781   15.321  11.239  1.00 41.18 ? 514  ASN A CG  1 
ATOM   3958 O OD1 . ASN A 1 514 ? 4.805   14.859  11.843  1.00 39.86 ? 514  ASN A OD1 1 
ATOM   3959 N ND2 . ASN A 1 514 ? 6.079   14.983  9.985   1.00 40.19 ? 514  ASN A ND2 1 
ATOM   3960 N N   . LEU A 1 515 ? 5.232   17.240  14.232  1.00 42.71 ? 515  LEU A N   1 
ATOM   3961 C CA  . LEU A 1 515 ? 4.183   17.533  15.217  1.00 43.77 ? 515  LEU A CA  1 
ATOM   3962 C C   . LEU A 1 515 ? 2.961   16.630  15.043  1.00 44.44 ? 515  LEU A C   1 
ATOM   3963 O O   . LEU A 1 515 ? 2.281   16.313  16.003  1.00 44.07 ? 515  LEU A O   1 
ATOM   3964 C CB  . LEU A 1 515 ? 3.807   19.019  15.203  1.00 43.51 ? 515  LEU A CB  1 
ATOM   3965 C CG  . LEU A 1 515 ? 4.997   19.994  15.250  1.00 44.06 ? 515  LEU A CG  1 
ATOM   3966 C CD1 . LEU A 1 515 ? 4.539   21.437  15.067  1.00 45.13 ? 515  LEU A CD1 1 
ATOM   3967 C CD2 . LEU A 1 515 ? 5.806   19.862  16.539  1.00 43.05 ? 515  LEU A CD2 1 
ATOM   3968 N N   . LYS A 1 516 ? 2.718   16.201  13.808  1.00 45.85 ? 516  LYS A N   1 
ATOM   3969 C CA  . LYS A 1 516 ? 1.623   15.289  13.480  1.00 47.45 ? 516  LYS A CA  1 
ATOM   3970 C C   . LYS A 1 516 ? 1.936   13.908  14.055  1.00 47.25 ? 516  LYS A C   1 
ATOM   3971 O O   . LYS A 1 516 ? 3.092   13.604  14.321  1.00 47.30 ? 516  LYS A O   1 
ATOM   3972 C CB  . LYS A 1 516 ? 1.417   15.225  11.957  1.00 47.37 ? 516  LYS A CB  1 
ATOM   3973 C CG  . LYS A 1 516 ? 0.896   16.542  11.315  1.00 49.64 ? 516  LYS A CG  1 
ATOM   3974 C CD  . LYS A 1 516 ? 1.306   16.703  9.806   1.00 49.72 ? 516  LYS A CD  1 
ATOM   3975 C CE  . LYS A 1 516 ? 0.437   15.857  8.821   1.00 53.72 ? 516  LYS A CE  1 
ATOM   3976 N NZ  . LYS A 1 516 ? 0.651   16.196  7.341   1.00 52.33 ? 516  LYS A NZ  1 
ATOM   3977 N N   . PRO A 1 517 ? 0.902   13.087  14.313  1.00 47.45 ? 517  PRO A N   1 
ATOM   3978 C CA  . PRO A 1 517 ? 1.169   11.713  14.750  1.00 47.04 ? 517  PRO A CA  1 
ATOM   3979 C C   . PRO A 1 517 ? 2.045   10.996  13.741  1.00 47.05 ? 517  PRO A C   1 
ATOM   3980 O O   . PRO A 1 517 ? 2.101   11.412  12.575  1.00 47.05 ? 517  PRO A O   1 
ATOM   3981 C CB  . PRO A 1 517 ? -0.222  11.069  14.761  1.00 46.82 ? 517  PRO A CB  1 
ATOM   3982 C CG  . PRO A 1 517 ? -1.165  12.205  14.952  1.00 47.33 ? 517  PRO A CG  1 
ATOM   3983 C CD  . PRO A 1 517 ? -0.543  13.394  14.274  1.00 47.35 ? 517  PRO A CD  1 
ATOM   3984 N N   . LEU A 1 518 ? 2.708   9.928   14.189  1.00 46.89 ? 518  LEU A N   1 
ATOM   3985 C CA  . LEU A 1 518 ? 3.531   9.091   13.330  1.00 46.92 ? 518  LEU A CA  1 
ATOM   3986 C C   . LEU A 1 518 ? 2.859   8.736   12.020  1.00 47.35 ? 518  LEU A C   1 
ATOM   3987 O O   . LEU A 1 518 ? 1.722   8.271   12.005  1.00 47.33 ? 518  LEU A O   1 
ATOM   3988 C CB  . LEU A 1 518 ? 3.879   7.780   14.038  1.00 46.67 ? 518  LEU A CB  1 
ATOM   3989 C CG  . LEU A 1 518 ? 5.057   7.696   14.998  1.00 46.57 ? 518  LEU A CG  1 
ATOM   3990 C CD1 . LEU A 1 518 ? 5.409   6.236   15.195  1.00 47.51 ? 518  LEU A CD1 1 
ATOM   3991 C CD2 . LEU A 1 518 ? 6.261   8.443   14.492  1.00 46.36 ? 518  LEU A CD2 1 
ATOM   3992 N N   . GLU A 1 519 ? 3.579   8.945   10.924  1.00 48.02 ? 519  GLU A N   1 
ATOM   3993 C CA  . GLU A 1 519 ? 3.187   8.428   9.620   1.00 48.90 ? 519  GLU A CA  1 
ATOM   3994 C C   . GLU A 1 519 ? 4.251   7.440   9.188   1.00 48.61 ? 519  GLU A C   1 
ATOM   3995 O O   . GLU A 1 519 ? 5.437   7.666   9.429   1.00 48.93 ? 519  GLU A O   1 
ATOM   3996 C CB  . GLU A 1 519 ? 3.065   9.565   8.609   1.00 48.67 ? 519  GLU A CB  1 
ATOM   3997 C CG  . GLU A 1 519 ? 3.106   9.137   7.137   1.00 50.74 ? 519  GLU A CG  1 
ATOM   3998 C CD  . GLU A 1 519 ? 2.881   10.308  6.179   1.00 51.22 ? 519  GLU A CD  1 
ATOM   3999 O OE1 . GLU A 1 519 ? 1.838   10.986  6.316   1.00 53.90 ? 519  GLU A OE1 1 
ATOM   4000 O OE2 . GLU A 1 519 ? 3.741   10.547  5.296   1.00 53.95 ? 519  GLU A OE2 1 
ATOM   4001 N N   . VAL A 1 520 ? 3.831   6.340   8.571   1.00 48.41 ? 520  VAL A N   1 
ATOM   4002 C CA  . VAL A 1 520 ? 4.770   5.335   8.091   1.00 47.69 ? 520  VAL A CA  1 
ATOM   4003 C C   . VAL A 1 520 ? 4.990   5.522   6.602   1.00 47.97 ? 520  VAL A C   1 
ATOM   4004 O O   . VAL A 1 520 ? 4.033   5.622   5.826   1.00 47.80 ? 520  VAL A O   1 
ATOM   4005 C CB  . VAL A 1 520 ? 4.278   3.900   8.364   1.00 47.66 ? 520  VAL A CB  1 
ATOM   4006 C CG1 . VAL A 1 520 ? 5.218   2.882   7.740   1.00 46.80 ? 520  VAL A CG1 1 
ATOM   4007 C CG2 . VAL A 1 520 ? 4.161   3.647   9.856   1.00 46.91 ? 520  VAL A CG2 1 
ATOM   4008 N N   . ARG A 1 521 ? 6.262   5.567   6.213   1.00 47.90 ? 521  ARG A N   1 
ATOM   4009 C CA  . ARG A 1 521 ? 6.646   5.751   4.822   1.00 47.67 ? 521  ARG A CA  1 
ATOM   4010 C C   . ARG A 1 521 ? 7.533   4.605   4.388   1.00 48.01 ? 521  ARG A C   1 
ATOM   4011 O O   . ARG A 1 521 ? 8.118   3.911   5.223   1.00 48.09 ? 521  ARG A O   1 
ATOM   4012 C CB  . ARG A 1 521 ? 7.339   7.099   4.626   1.00 47.59 ? 521  ARG A CB  1 
ATOM   4013 C CG  . ARG A 1 521 ? 6.510   8.269   5.121   1.00 46.50 ? 521  ARG A CG  1 
ATOM   4014 C CD  . ARG A 1 521 ? 7.130   9.601   4.803   1.00 45.65 ? 521  ARG A CD  1 
ATOM   4015 N NE  . ARG A 1 521 ? 6.421   10.693  5.473   1.00 44.42 ? 521  ARG A NE  1 
ATOM   4016 C CZ  . ARG A 1 521 ? 6.966   11.874  5.753   1.00 43.36 ? 521  ARG A CZ  1 
ATOM   4017 N NH1 . ARG A 1 521 ? 8.226   12.117  5.427   1.00 42.78 ? 521  ARG A NH1 1 
ATOM   4018 N NH2 . ARG A 1 521 ? 6.260   12.804  6.377   1.00 43.25 ? 521  ARG A NH2 1 
ATOM   4019 N N   . ARG A 1 522 ? 7.612   4.383   3.084   1.00 48.42 ? 522  ARG A N   1 
ATOM   4020 C CA  . ARG A 1 522 ? 8.393   3.263   2.570   1.00 49.84 ? 522  ARG A CA  1 
ATOM   4021 C C   . ARG A 1 522 ? 9.521   3.770   1.691   1.00 49.26 ? 522  ARG A C   1 
ATOM   4022 O O   . ARG A 1 522 ? 9.335   4.691   0.894   1.00 49.72 ? 522  ARG A O   1 
ATOM   4023 C CB  . ARG A 1 522 ? 7.507   2.254   1.812   1.00 49.69 ? 522  ARG A CB  1 
ATOM   4024 C CG  . ARG A 1 522 ? 6.358   1.635   2.653   1.00 51.73 ? 522  ARG A CG  1 
ATOM   4025 C CD  . ARG A 1 522 ? 5.551   0.566   1.895   1.00 52.70 ? 522  ARG A CD  1 
ATOM   4026 N NE  . ARG A 1 522 ? 6.324   -0.664  1.635   1.00 59.30 ? 522  ARG A NE  1 
ATOM   4027 C CZ  . ARG A 1 522 ? 7.038   -0.905  0.524   1.00 61.69 ? 522  ARG A CZ  1 
ATOM   4028 N NH1 . ARG A 1 522 ? 7.090   0.001   -0.455  1.00 63.27 ? 522  ARG A NH1 1 
ATOM   4029 N NH2 . ARG A 1 522 ? 7.707   -2.055  0.381   1.00 61.04 ? 522  ARG A NH2 1 
ATOM   4030 N N   . GLY A 1 523 ? 10.696  3.182   1.865   1.00 49.10 ? 523  GLY A N   1 
ATOM   4031 C CA  . GLY A 1 523 ? 11.868  3.542   1.081   1.00 49.17 ? 523  GLY A CA  1 
ATOM   4032 C C   . GLY A 1 523 ? 12.558  4.828   1.497   1.00 49.24 ? 523  GLY A C   1 
ATOM   4033 O O   . GLY A 1 523 ? 11.980  5.923   1.444   1.00 49.66 ? 523  GLY A O   1 
ATOM   4034 N N   . LEU A 1 524 ? 13.813  4.688   1.894   1.00 48.94 ? 524  LEU A N   1 
ATOM   4035 C CA  . LEU A 1 524 ? 14.615  5.809   2.314   1.00 48.75 ? 524  LEU A CA  1 
ATOM   4036 C C   . LEU A 1 524 ? 15.420  6.323   1.133   1.00 48.22 ? 524  LEU A C   1 
ATOM   4037 O O   . LEU A 1 524 ? 16.493  5.794   0.830   1.00 48.03 ? 524  LEU A O   1 
ATOM   4038 C CB  . LEU A 1 524 ? 15.528  5.363   3.449   1.00 49.14 ? 524  LEU A CB  1 
ATOM   4039 C CG  . LEU A 1 524 ? 15.996  6.434   4.440   1.00 51.14 ? 524  LEU A CG  1 
ATOM   4040 C CD1 . LEU A 1 524 ? 15.116  7.718   4.417   1.00 51.79 ? 524  LEU A CD1 1 
ATOM   4041 C CD2 . LEU A 1 524 ? 16.064  5.810   5.839   1.00 52.75 ? 524  LEU A CD2 1 
ATOM   4042 N N   . ARG A 1 525 ? 14.893  7.353   0.472   1.00 47.85 ? 525  ARG A N   1 
ATOM   4043 C CA  . ARG A 1 525 ? 15.416  7.821   -0.815  1.00 47.88 ? 525  ARG A CA  1 
ATOM   4044 C C   . ARG A 1 525 ? 15.867  6.620   -1.639  1.00 47.60 ? 525  ARG A C   1 
ATOM   4045 O O   . ARG A 1 525 ? 17.025  6.536   -2.054  1.00 48.31 ? 525  ARG A O   1 
ATOM   4046 C CB  . ARG A 1 525 ? 16.608  8.775   -0.640  1.00 48.01 ? 525  ARG A CB  1 
ATOM   4047 C CG  . ARG A 1 525 ? 16.371  10.004  0.198   1.00 48.67 ? 525  ARG A CG  1 
ATOM   4048 C CD  . ARG A 1 525 ? 15.924  11.177  -0.628  1.00 49.68 ? 525  ARG A CD  1 
ATOM   4049 N NE  . ARG A 1 525 ? 16.582  12.401  -0.185  1.00 51.05 ? 525  ARG A NE  1 
ATOM   4050 C CZ  . ARG A 1 525 ? 16.234  13.129  0.880   1.00 51.10 ? 525  ARG A CZ  1 
ATOM   4051 N NH1 . ARG A 1 525 ? 15.217  12.770  1.660   1.00 50.17 ? 525  ARG A NH1 1 
ATOM   4052 N NH2 . ARG A 1 525 ? 16.922  14.233  1.169   1.00 50.43 ? 525  ARG A NH2 1 
ATOM   4053 N N   . ALA A 1 526 ? 14.967  5.678   -1.862  1.00 47.33 ? 526  ALA A N   1 
ATOM   4054 C CA  . ALA A 1 526 ? 15.358  4.409   -2.473  1.00 46.73 ? 526  ALA A CA  1 
ATOM   4055 C C   . ALA A 1 526 ? 16.041  4.585   -3.846  1.00 46.21 ? 526  ALA A C   1 
ATOM   4056 O O   . ALA A 1 526 ? 17.130  4.051   -4.040  1.00 46.47 ? 526  ALA A O   1 
ATOM   4057 C CB  . ALA A 1 526 ? 14.169  3.448   -2.539  1.00 46.63 ? 526  ALA A CB  1 
ATOM   4058 N N   . GLN A 1 527 ? 15.440  5.361   -4.758  1.00 45.21 ? 527  GLN A N   1 
ATOM   4059 C CA  . GLN A 1 527 ? 15.993  5.536   -6.110  1.00 44.72 ? 527  GLN A CA  1 
ATOM   4060 C C   . GLN A 1 527 ? 17.341  6.191   -6.039  1.00 43.61 ? 527  GLN A C   1 
ATOM   4061 O O   . GLN A 1 527 ? 18.334  5.662   -6.527  1.00 43.60 ? 527  GLN A O   1 
ATOM   4062 C CB  . GLN A 1 527 ? 15.092  6.404   -7.011  1.00 45.06 ? 527  GLN A CB  1 
ATOM   4063 C CG  . GLN A 1 527 ? 13.937  5.678   -7.710  1.00 46.40 ? 527  GLN A CG  1 
ATOM   4064 C CD  . GLN A 1 527 ? 14.314  4.320   -8.295  1.00 47.67 ? 527  GLN A CD  1 
ATOM   4065 O OE1 . GLN A 1 527 ? 13.795  3.291   -7.859  1.00 49.35 ? 527  GLN A OE1 1 
ATOM   4066 N NE2 . GLN A 1 527 ? 15.204  4.312   -9.283  1.00 47.75 ? 527  GLN A NE2 1 
ATOM   4067 N N   . THR A 1 528 ? 17.354  7.358   -5.417  1.00 42.94 ? 528  THR A N   1 
ATOM   4068 C CA  . THR A 1 528 ? 18.548  8.169   -5.282  1.00 41.95 ? 528  THR A CA  1 
ATOM   4069 C C   . THR A 1 528 ? 19.665  7.433   -4.548  1.00 41.72 ? 528  THR A C   1 
ATOM   4070 O O   . THR A 1 528 ? 20.806  7.469   -4.981  1.00 41.54 ? 528  THR A O   1 
ATOM   4071 C CB  . THR A 1 528 ? 18.197  9.476   -4.590  1.00 42.22 ? 528  THR A CB  1 
ATOM   4072 O OG1 . THR A 1 528 ? 17.293  10.195  -5.436  1.00 40.76 ? 528  THR A OG1 1 
ATOM   4073 C CG2 . THR A 1 528 ? 19.445  10.326  -4.310  1.00 41.07 ? 528  THR A CG2 1 
ATOM   4074 N N   . CYS A 1 529 ? 19.346  6.733   -3.466  1.00 41.18 ? 529  CYS A N   1 
ATOM   4075 C CA  . CYS A 1 529 ? 20.408  6.029   -2.752  1.00 40.65 ? 529  CYS A CA  1 
ATOM   4076 C C   . CYS A 1 529 ? 20.942  4.814   -3.511  1.00 40.87 ? 529  CYS A C   1 
ATOM   4077 O O   . CYS A 1 529 ? 22.075  4.387   -3.273  1.00 40.67 ? 529  CYS A O   1 
ATOM   4078 C CB  . CYS A 1 529 ? 20.021  5.687   -1.314  1.00 40.49 ? 529  CYS A CB  1 
ATOM   4079 S SG  . CYS A 1 529 ? 19.918  7.147   -0.239  1.00 37.38 ? 529  CYS A SG  1 
ATOM   4080 N N   . ALA A 1 530 ? 20.157  4.280   -4.445  1.00 40.67 ? 530  ALA A N   1 
ATOM   4081 C CA  . ALA A 1 530 ? 20.688  3.236   -5.321  1.00 40.82 ? 530  ALA A CA  1 
ATOM   4082 C C   . ALA A 1 530 ? 21.783  3.828   -6.204  1.00 40.88 ? 530  ALA A C   1 
ATOM   4083 O O   . ALA A 1 530 ? 22.725  3.148   -6.586  1.00 41.19 ? 530  ALA A O   1 
ATOM   4084 C CB  . ALA A 1 530 ? 19.606  2.648   -6.163  1.00 40.57 ? 530  ALA A CB  1 
ATOM   4085 N N   . PHE A 1 531 ? 21.653  5.108   -6.521  1.00 40.63 ? 531  PHE A N   1 
ATOM   4086 C CA  . PHE A 1 531 ? 22.693  5.792   -7.241  1.00 40.51 ? 531  PHE A CA  1 
ATOM   4087 C C   . PHE A 1 531 ? 23.987  5.897   -6.426  1.00 40.51 ? 531  PHE A C   1 
ATOM   4088 O O   . PHE A 1 531 ? 25.065  5.583   -6.935  1.00 40.53 ? 531  PHE A O   1 
ATOM   4089 C CB  . PHE A 1 531 ? 22.216  7.172   -7.677  1.00 40.56 ? 531  PHE A CB  1 
ATOM   4090 C CG  . PHE A 1 531 ? 23.310  8.039   -8.219  1.00 41.10 ? 531  PHE A CG  1 
ATOM   4091 C CD1 . PHE A 1 531 ? 23.795  7.836   -9.508  1.00 40.34 ? 531  PHE A CD1 1 
ATOM   4092 C CD2 . PHE A 1 531 ? 23.861  9.048   -7.438  1.00 41.40 ? 531  PHE A CD2 1 
ATOM   4093 C CE1 . PHE A 1 531 ? 24.797  8.618   -10.008 1.00 40.79 ? 531  PHE A CE1 1 
ATOM   4094 C CE2 . PHE A 1 531 ? 24.881  9.846   -7.935  1.00 41.65 ? 531  PHE A CE2 1 
ATOM   4095 C CZ  . PHE A 1 531 ? 25.349  9.630   -9.220  1.00 41.56 ? 531  PHE A CZ  1 
ATOM   4096 N N   . TRP A 1 532 ? 23.886  6.342   -5.174  1.00 40.25 ? 532  TRP A N   1 
ATOM   4097 C CA  . TRP A 1 532 ? 25.078  6.534   -4.344  1.00 40.30 ? 532  TRP A CA  1 
ATOM   4098 C C   . TRP A 1 532 ? 25.675  5.227   -3.866  1.00 41.25 ? 532  TRP A C   1 
ATOM   4099 O O   . TRP A 1 532 ? 26.900  5.067   -3.840  1.00 41.58 ? 532  TRP A O   1 
ATOM   4100 C CB  . TRP A 1 532 ? 24.774  7.401   -3.127  1.00 39.14 ? 532  TRP A CB  1 
ATOM   4101 C CG  . TRP A 1 532 ? 24.443  8.809   -3.460  1.00 37.53 ? 532  TRP A CG  1 
ATOM   4102 C CD1 . TRP A 1 532 ? 23.204  9.381   -3.483  1.00 35.59 ? 532  TRP A CD1 1 
ATOM   4103 C CD2 . TRP A 1 532 ? 25.363  9.831   -3.824  1.00 36.78 ? 532  TRP A CD2 1 
ATOM   4104 N NE1 . TRP A 1 532 ? 23.295  10.696  -3.838  1.00 34.44 ? 532  TRP A NE1 1 
ATOM   4105 C CE2 . TRP A 1 532 ? 24.614  11.003  -4.051  1.00 36.39 ? 532  TRP A CE2 1 
ATOM   4106 C CE3 . TRP A 1 532 ? 26.755  9.875   -3.982  1.00 36.27 ? 532  TRP A CE3 1 
ATOM   4107 C CZ2 . TRP A 1 532 ? 25.210  12.203  -4.431  1.00 36.51 ? 532  TRP A CZ2 1 
ATOM   4108 C CZ3 . TRP A 1 532 ? 27.347  11.078  -4.349  1.00 35.54 ? 532  TRP A CZ3 1 
ATOM   4109 C CH2 . TRP A 1 532 ? 26.581  12.218  -4.565  1.00 36.49 ? 532  TRP A CH2 1 
ATOM   4110 N N   . ASN A 1 533 ? 24.805  4.296   -3.489  1.00 42.16 ? 533  ASN A N   1 
ATOM   4111 C CA  . ASN A 1 533 ? 25.230  3.070   -2.828  1.00 43.05 ? 533  ASN A CA  1 
ATOM   4112 C C   . ASN A 1 533 ? 25.562  1.937   -3.780  1.00 43.74 ? 533  ASN A C   1 
ATOM   4113 O O   . ASN A 1 533 ? 26.477  1.167   -3.516  1.00 43.49 ? 533  ASN A O   1 
ATOM   4114 C CB  . ASN A 1 533 ? 24.172  2.623   -1.817  1.00 42.94 ? 533  ASN A CB  1 
ATOM   4115 C CG  . ASN A 1 533 ? 23.936  3.655   -0.745  1.00 42.64 ? 533  ASN A CG  1 
ATOM   4116 O OD1 . ASN A 1 533 ? 24.740  4.574   -0.584  1.00 43.23 ? 533  ASN A OD1 1 
ATOM   4117 N ND2 . ASN A 1 533 ? 22.838  3.517   -0.003  1.00 41.29 ? 533  ASN A ND2 1 
ATOM   4118 N N   . ARG A 1 534 ? 24.824  1.844   -4.883  1.00 44.90 ? 534  ARG A N   1 
ATOM   4119 C CA  . ARG A 1 534 ? 25.029  0.759   -5.849  1.00 46.35 ? 534  ARG A CA  1 
ATOM   4120 C C   . ARG A 1 534 ? 25.777  1.191   -7.111  1.00 47.52 ? 534  ARG A C   1 
ATOM   4121 O O   . ARG A 1 534 ? 26.697  0.490   -7.551  1.00 47.78 ? 534  ARG A O   1 
ATOM   4122 C CB  . ARG A 1 534 ? 23.711  0.090   -6.226  1.00 45.76 ? 534  ARG A CB  1 
ATOM   4123 C CG  . ARG A 1 534 ? 22.975  -0.521  -5.057  1.00 45.90 ? 534  ARG A CG  1 
ATOM   4124 C CD  . ARG A 1 534 ? 21.491  -0.669  -5.372  1.00 46.17 ? 534  ARG A CD  1 
ATOM   4125 N NE  . ARG A 1 534 ? 20.718  -1.215  -4.253  1.00 46.89 ? 534  ARG A NE  1 
ATOM   4126 C CZ  . ARG A 1 534 ? 20.647  -2.514  -3.940  1.00 47.54 ? 534  ARG A CZ  1 
ATOM   4127 N NH1 . ARG A 1 534 ? 21.319  -3.431  -4.640  1.00 45.87 ? 534  ARG A NH1 1 
ATOM   4128 N NH2 . ARG A 1 534 ? 19.910  -2.896  -2.910  1.00 46.22 ? 534  ARG A NH2 1 
ATOM   4129 N N   . PHE A 1 535 ? 25.402  2.331   -7.690  1.00 48.57 ? 535  PHE A N   1 
ATOM   4130 C CA  . PHE A 1 535 ? 26.000  2.729   -8.957  1.00 50.02 ? 535  PHE A CA  1 
ATOM   4131 C C   . PHE A 1 535 ? 27.342  3.401   -8.826  1.00 51.05 ? 535  PHE A C   1 
ATOM   4132 O O   . PHE A 1 535 ? 28.283  2.992   -9.472  1.00 51.06 ? 535  PHE A O   1 
ATOM   4133 C CB  . PHE A 1 535 ? 25.075  3.606   -9.796  1.00 50.07 ? 535  PHE A CB  1 
ATOM   4134 C CG  . PHE A 1 535 ? 25.702  4.076   -11.077 1.00 50.23 ? 535  PHE A CG  1 
ATOM   4135 C CD1 . PHE A 1 535 ? 25.976  3.172   -12.102 1.00 51.23 ? 535  PHE A CD1 1 
ATOM   4136 C CD2 . PHE A 1 535 ? 26.030  5.408   -11.257 1.00 50.06 ? 535  PHE A CD2 1 
ATOM   4137 C CE1 . PHE A 1 535 ? 26.571  3.588   -13.284 1.00 50.22 ? 535  PHE A CE1 1 
ATOM   4138 C CE2 . PHE A 1 535 ? 26.617  5.835   -12.435 1.00 51.18 ? 535  PHE A CE2 1 
ATOM   4139 C CZ  . PHE A 1 535 ? 26.889  4.916   -13.455 1.00 51.09 ? 535  PHE A CZ  1 
ATOM   4140 N N   . LEU A 1 536 ? 27.417  4.445   -8.009  1.00 52.98 ? 536  LEU A N   1 
ATOM   4141 C CA  . LEU A 1 536 ? 28.595  5.304   -7.951  1.00 54.99 ? 536  LEU A CA  1 
ATOM   4142 C C   . LEU A 1 536 ? 29.899  4.560   -7.649  1.00 57.02 ? 536  LEU A C   1 
ATOM   4143 O O   . LEU A 1 536 ? 30.923  4.853   -8.282  1.00 57.29 ? 536  LEU A O   1 
ATOM   4144 C CB  . LEU A 1 536 ? 28.394  6.428   -6.947  1.00 54.95 ? 536  LEU A CB  1 
ATOM   4145 C CG  . LEU A 1 536 ? 29.237  7.677   -7.174  1.00 55.39 ? 536  LEU A CG  1 
ATOM   4146 C CD1 . LEU A 1 536 ? 28.383  8.717   -7.849  1.00 55.81 ? 536  LEU A CD1 1 
ATOM   4147 C CD2 . LEU A 1 536 ? 29.772  8.216   -5.852  1.00 56.82 ? 536  LEU A CD2 1 
ATOM   4148 N N   . PRO A 1 537 ? 29.886  3.609   -6.679  1.00 58.79 ? 537  PRO A N   1 
ATOM   4149 C CA  . PRO A 1 537 ? 31.098  2.816   -6.483  1.00 60.20 ? 537  PRO A CA  1 
ATOM   4150 C C   . PRO A 1 537 ? 31.568  2.177   -7.786  1.00 61.75 ? 537  PRO A C   1 
ATOM   4151 O O   . PRO A 1 537 ? 32.728  2.360   -8.164  1.00 62.11 ? 537  PRO A O   1 
ATOM   4152 C CB  . PRO A 1 537 ? 30.656  1.744   -5.487  1.00 60.13 ? 537  PRO A CB  1 
ATOM   4153 C CG  . PRO A 1 537 ? 29.582  2.397   -4.725  1.00 59.60 ? 537  PRO A CG  1 
ATOM   4154 C CD  . PRO A 1 537 ? 28.836  3.217   -5.722  1.00 58.79 ? 537  PRO A CD  1 
ATOM   4155 N N   . LYS A 1 538 ? 30.666  1.466   -8.469  1.00 63.42 ? 538  LYS A N   1 
ATOM   4156 C CA  . LYS A 1 538 ? 30.970  0.813   -9.752  1.00 65.27 ? 538  LYS A CA  1 
ATOM   4157 C C   . LYS A 1 538 ? 31.538  1.774   -10.792 1.00 66.26 ? 538  LYS A C   1 
ATOM   4158 O O   . LYS A 1 538 ? 32.520  1.455   -11.466 1.00 66.41 ? 538  LYS A O   1 
ATOM   4159 C CB  . LYS A 1 538 ? 29.750  0.074   -10.301 1.00 64.94 ? 538  LYS A CB  1 
ATOM   4160 C CG  . LYS A 1 538 ? 29.519  -1.278  -9.636  1.00 65.94 ? 538  LYS A CG  1 
ATOM   4161 C CD  . LYS A 1 538 ? 28.327  -2.014  -10.229 1.00 66.36 ? 538  LYS A CD  1 
ATOM   4162 C CE  . LYS A 1 538 ? 28.105  -3.348  -9.509  1.00 69.51 ? 538  LYS A CE  1 
ATOM   4163 N NZ  . LYS A 1 538 ? 26.724  -3.889  -9.725  1.00 69.77 ? 538  LYS A NZ  1 
ATOM   4164 N N   . LEU A 1 539 ? 30.941  2.957   -10.907 1.00 67.75 ? 539  LEU A N   1 
ATOM   4165 C CA  . LEU A 1 539 ? 31.511  4.005   -11.742 1.00 69.28 ? 539  LEU A CA  1 
ATOM   4166 C C   . LEU A 1 539 ? 32.966  4.205   -11.361 1.00 70.64 ? 539  LEU A C   1 
ATOM   4167 O O   . LEU A 1 539 ? 33.859  3.964   -12.174 1.00 71.11 ? 539  LEU A O   1 
ATOM   4168 C CB  . LEU A 1 539 ? 30.745  5.319   -11.591 1.00 69.23 ? 539  LEU A CB  1 
ATOM   4169 C CG  . LEU A 1 539 ? 31.159  6.461   -12.515 1.00 68.69 ? 539  LEU A CG  1 
ATOM   4170 C CD1 . LEU A 1 539 ? 31.396  5.931   -13.917 1.00 69.03 ? 539  LEU A CD1 1 
ATOM   4171 C CD2 . LEU A 1 539 ? 30.094  7.531   -12.528 1.00 68.20 ? 539  LEU A CD2 1 
ATOM   4172 N N   . LEU A 1 540 ? 33.193  4.604   -10.110 1.00 72.18 ? 540  LEU A N   1 
ATOM   4173 C CA  . LEU A 1 540 ? 34.541  4.821   -9.573  1.00 73.42 ? 540  LEU A CA  1 
ATOM   4174 C C   . LEU A 1 540 ? 35.447  3.557   -9.518  1.00 74.08 ? 540  LEU A C   1 
ATOM   4175 O O   . LEU A 1 540 ? 36.437  3.531   -8.780  1.00 74.42 ? 540  LEU A O   1 
ATOM   4176 C CB  . LEU A 1 540 ? 34.456  5.508   -8.201  1.00 73.58 ? 540  LEU A CB  1 
ATOM   4177 C CG  . LEU A 1 540 ? 33.728  6.864   -8.134  1.00 73.94 ? 540  LEU A CG  1 
ATOM   4178 C CD1 . LEU A 1 540 ? 33.254  7.159   -6.701  1.00 73.63 ? 540  LEU A CD1 1 
ATOM   4179 C CD2 . LEU A 1 540 ? 34.591  8.011   -8.681  1.00 73.53 ? 540  LEU A CD2 1 
ATOM   4180 N N   . SER A 1 541 ? 35.093  2.520   -10.283 1.00 74.63 ? 541  SER A N   1 
ATOM   4181 C CA  . SER A 1 541 ? 36.042  1.471   -10.701 1.00 75.18 ? 541  SER A CA  1 
ATOM   4182 C C   . SER A 1 541 ? 36.290  1.659   -12.212 1.00 75.61 ? 541  SER A C   1 
ATOM   4183 O O   . SER A 1 541 ? 36.063  0.736   -13.030 1.00 75.70 ? 541  SER A O   1 
ATOM   4184 C CB  . SER A 1 541 ? 35.511  0.056   -10.403 1.00 75.30 ? 541  SER A CB  1 
ATOM   4185 O OG  . SER A 1 541 ? 35.129  -0.094  -9.044  1.00 74.94 ? 541  SER A OG  1 
ATOM   4186 N N   . ALA A 1 542 ? 36.737  2.877   -12.549 1.00 75.65 ? 542  ALA A N   1 
ATOM   4187 C CA  . ALA A 1 542 ? 36.923  3.374   -13.921 1.00 75.60 ? 542  ALA A CA  1 
ATOM   4188 C C   . ALA A 1 542 ? 37.278  4.864   -13.898 1.00 75.44 ? 542  ALA A C   1 
ATOM   4189 O O   . ALA A 1 542 ? 38.148  5.305   -13.143 1.00 75.08 ? 542  ALA A O   1 
ATOM   4190 C CB  . ALA A 1 542 ? 35.664  3.155   -14.765 1.00 75.64 ? 542  ALA A CB  1 
ATOM   4191 N N   . GLU B 1 4   ? -16.894 4.594   -68.362 1.00 70.60 ? 4    GLU B N   1 
ATOM   4192 C CA  . GLU B 1 4   ? -15.631 5.359   -68.137 1.00 70.30 ? 4    GLU B CA  1 
ATOM   4193 C C   . GLU B 1 4   ? -15.895 6.677   -67.383 1.00 69.80 ? 4    GLU B C   1 
ATOM   4194 O O   . GLU B 1 4   ? -16.084 7.742   -67.984 1.00 70.01 ? 4    GLU B O   1 
ATOM   4195 C CB  . GLU B 1 4   ? -14.890 5.589   -69.470 1.00 70.69 ? 4    GLU B CB  1 
ATOM   4196 C CG  . GLU B 1 4   ? -13.470 6.201   -69.361 1.00 71.45 ? 4    GLU B CG  1 
ATOM   4197 C CD  . GLU B 1 4   ? -12.365 5.178   -69.042 1.00 73.83 ? 4    GLU B CD  1 
ATOM   4198 O OE1 . GLU B 1 4   ? -12.434 4.514   -67.979 1.00 74.22 ? 4    GLU B OE1 1 
ATOM   4199 O OE2 . GLU B 1 4   ? -11.408 5.061   -69.848 1.00 73.90 ? 4    GLU B OE2 1 
ATOM   4200 N N   . ASP B 1 5   ? -15.918 6.579   -66.056 1.00 68.89 ? 5    ASP B N   1 
ATOM   4201 C CA  . ASP B 1 5   ? -16.053 7.728   -65.162 1.00 67.80 ? 5    ASP B CA  1 
ATOM   4202 C C   . ASP B 1 5   ? -14.872 8.685   -65.352 1.00 67.37 ? 5    ASP B C   1 
ATOM   4203 O O   . ASP B 1 5   ? -13.728 8.300   -65.098 1.00 67.38 ? 5    ASP B O   1 
ATOM   4204 C CB  . ASP B 1 5   ? -16.097 7.214   -63.720 1.00 67.54 ? 5    ASP B CB  1 
ATOM   4205 C CG  . ASP B 1 5   ? -16.464 8.278   -62.711 1.00 66.34 ? 5    ASP B CG  1 
ATOM   4206 O OD1 . ASP B 1 5   ? -16.919 7.877   -61.623 1.00 64.05 ? 5    ASP B OD1 1 
ATOM   4207 O OD2 . ASP B 1 5   ? -16.293 9.491   -62.983 1.00 65.80 ? 5    ASP B OD2 1 
ATOM   4208 N N   . PRO B 1 6   ? -15.141 9.931   -65.802 1.00 66.84 ? 6    PRO B N   1 
ATOM   4209 C CA  . PRO B 1 6   ? -14.071 10.890  -66.145 1.00 66.38 ? 6    PRO B CA  1 
ATOM   4210 C C   . PRO B 1 6   ? -13.359 11.487  -64.931 1.00 65.80 ? 6    PRO B C   1 
ATOM   4211 O O   . PRO B 1 6   ? -12.336 12.158  -65.084 1.00 65.69 ? 6    PRO B O   1 
ATOM   4212 C CB  . PRO B 1 6   ? -14.811 11.984  -66.923 1.00 66.55 ? 6    PRO B CB  1 
ATOM   4213 C CG  . PRO B 1 6   ? -16.212 11.941  -66.389 1.00 66.77 ? 6    PRO B CG  1 
ATOM   4214 C CD  . PRO B 1 6   ? -16.485 10.502  -66.018 1.00 66.99 ? 6    PRO B CD  1 
ATOM   4215 N N   . GLN B 1 7   ? -13.924 11.256  -63.748 1.00 65.08 ? 7    GLN B N   1 
ATOM   4216 C CA  . GLN B 1 7   ? -13.311 11.629  -62.480 1.00 64.28 ? 7    GLN B CA  1 
ATOM   4217 C C   . GLN B 1 7   ? -12.235 10.638  -62.084 1.00 63.44 ? 7    GLN B C   1 
ATOM   4218 O O   . GLN B 1 7   ? -11.329 10.981  -61.320 1.00 63.49 ? 7    GLN B O   1 
ATOM   4219 C CB  . GLN B 1 7   ? -14.369 11.668  -61.375 1.00 64.53 ? 7    GLN B CB  1 
ATOM   4220 C CG  . GLN B 1 7   ? -15.195 12.940  -61.367 1.00 65.69 ? 7    GLN B CG  1 
ATOM   4221 C CD  . GLN B 1 7   ? -14.414 14.100  -60.817 1.00 66.34 ? 7    GLN B CD  1 
ATOM   4222 O OE1 . GLN B 1 7   ? -14.185 14.175  -59.617 1.00 67.00 ? 7    GLN B OE1 1 
ATOM   4223 N NE2 . GLN B 1 7   ? -13.972 15.000  -61.693 1.00 66.95 ? 7    GLN B NE2 1 
ATOM   4224 N N   . LEU B 1 8   ? -12.357 9.410   -62.590 1.00 62.24 ? 8    LEU B N   1 
ATOM   4225 C CA  . LEU B 1 8   ? -11.415 8.330   -62.296 1.00 61.09 ? 8    LEU B CA  1 
ATOM   4226 C C   . LEU B 1 8   ? -10.334 8.211   -63.362 1.00 60.33 ? 8    LEU B C   1 
ATOM   4227 O O   . LEU B 1 8   ? -9.577  7.246   -63.383 1.00 60.32 ? 8    LEU B O   1 
ATOM   4228 C CB  . LEU B 1 8   ? -12.140 6.989   -62.164 1.00 61.00 ? 8    LEU B CB  1 
ATOM   4229 C CG  . LEU B 1 8   ? -13.191 6.831   -61.066 1.00 60.82 ? 8    LEU B CG  1 
ATOM   4230 C CD1 . LEU B 1 8   ? -13.846 5.463   -61.175 1.00 60.83 ? 8    LEU B CD1 1 
ATOM   4231 C CD2 . LEU B 1 8   ? -12.574 7.025   -59.696 1.00 61.06 ? 8    LEU B CD2 1 
ATOM   4232 N N   . LEU B 1 9   ? -10.255 9.200   -64.239 1.00 59.29 ? 9    LEU B N   1 
ATOM   4233 C CA  . LEU B 1 9   ? -9.314  9.156   -65.333 1.00 58.49 ? 9    LEU B CA  1 
ATOM   4234 C C   . LEU B 1 9   ? -8.448  10.411  -65.264 1.00 57.78 ? 9    LEU B C   1 
ATOM   4235 O O   . LEU B 1 9   ? -8.962  11.521  -65.305 1.00 57.61 ? 9    LEU B O   1 
ATOM   4236 C CB  . LEU B 1 9   ? -10.082 9.030   -66.655 1.00 58.44 ? 9    LEU B CB  1 
ATOM   4237 C CG  . LEU B 1 9   ? -9.389  8.925   -68.013 1.00 59.18 ? 9    LEU B CG  1 
ATOM   4238 C CD1 . LEU B 1 9   ? -8.515  7.683   -68.110 1.00 59.75 ? 9    LEU B CD1 1 
ATOM   4239 C CD2 . LEU B 1 9   ? -10.430 8.938   -69.133 1.00 58.88 ? 9    LEU B CD2 1 
ATOM   4240 N N   . VAL B 1 10  ? -7.136  10.215  -65.129 1.00 57.06 ? 10   VAL B N   1 
ATOM   4241 C CA  . VAL B 1 10  ? -6.188  11.299  -64.862 1.00 56.23 ? 10   VAL B CA  1 
ATOM   4242 C C   . VAL B 1 10  ? -5.006  11.179  -65.810 1.00 56.02 ? 10   VAL B C   1 
ATOM   4243 O O   . VAL B 1 10  ? -4.619  10.069  -66.168 1.00 56.18 ? 10   VAL B O   1 
ATOM   4244 C CB  . VAL B 1 10  ? -5.653  11.213  -63.400 1.00 56.34 ? 10   VAL B CB  1 
ATOM   4245 C CG1 . VAL B 1 10  ? -4.656  12.323  -63.097 1.00 55.52 ? 10   VAL B CG1 1 
ATOM   4246 C CG2 . VAL B 1 10  ? -6.793  11.261  -62.407 1.00 56.06 ? 10   VAL B CG2 1 
ATOM   4247 N N   . ARG B 1 11  ? -4.435  12.312  -66.214 1.00 55.40 ? 11   ARG B N   1 
ATOM   4248 C CA  . ARG B 1 11  ? -3.211  12.313  -66.997 1.00 55.47 ? 11   ARG B CA  1 
ATOM   4249 C C   . ARG B 1 11  ? -2.038  12.881  -66.208 1.00 54.31 ? 11   ARG B C   1 
ATOM   4250 O O   . ARG B 1 11  ? -2.012  14.060  -65.847 1.00 54.23 ? 11   ARG B O   1 
ATOM   4251 C CB  . ARG B 1 11  ? -3.380  13.060  -68.328 1.00 55.34 ? 11   ARG B CB  1 
ATOM   4252 C CG  . ARG B 1 11  ? -2.062  13.223  -69.107 1.00 57.05 ? 11   ARG B CG  1 
ATOM   4253 C CD  . ARG B 1 11  ? -2.253  13.740  -70.540 1.00 58.38 ? 11   ARG B CD  1 
ATOM   4254 N NE  . ARG B 1 11  ? -2.160  12.670  -71.544 1.00 64.11 ? 11   ARG B NE  1 
ATOM   4255 C CZ  . ARG B 1 11  ? -3.212  12.049  -72.081 1.00 67.18 ? 11   ARG B CZ  1 
ATOM   4256 N NH1 . ARG B 1 11  ? -4.453  12.381  -71.707 1.00 68.70 ? 11   ARG B NH1 1 
ATOM   4257 N NH2 . ARG B 1 11  ? -3.028  11.088  -72.987 1.00 67.26 ? 11   ARG B NH2 1 
ATOM   4258 N N   . VAL B 1 12  ? -1.059  12.022  -65.965 1.00 53.47 ? 12   VAL B N   1 
ATOM   4259 C CA  . VAL B 1 12  ? 0.179   12.393  -65.300 1.00 52.35 ? 12   VAL B CA  1 
ATOM   4260 C C   . VAL B 1 12  ? 1.286   12.475  -66.357 1.00 52.27 ? 12   VAL B C   1 
ATOM   4261 O O   . VAL B 1 12  ? 1.062   12.071  -67.498 1.00 52.08 ? 12   VAL B O   1 
ATOM   4262 C CB  . VAL B 1 12  ? 0.505   11.388  -64.174 1.00 52.30 ? 12   VAL B CB  1 
ATOM   4263 C CG1 . VAL B 1 12  ? -0.592  11.419  -63.117 1.00 51.27 ? 12   VAL B CG1 1 
ATOM   4264 C CG2 . VAL B 1 12  ? 0.653   9.978   -64.723 1.00 51.31 ? 12   VAL B CG2 1 
ATOM   4265 N N   . ARG B 1 13  ? 2.462   12.999  -65.997 1.00 51.99 ? 13   ARG B N   1 
ATOM   4266 C CA  . ARG B 1 13  ? 3.565   13.161  -66.961 1.00 52.52 ? 13   ARG B CA  1 
ATOM   4267 C C   . ARG B 1 13  ? 3.861   11.909  -67.798 1.00 51.48 ? 13   ARG B C   1 
ATOM   4268 O O   . ARG B 1 13  ? 4.259   12.025  -68.949 1.00 51.44 ? 13   ARG B O   1 
ATOM   4269 C CB  . ARG B 1 13  ? 4.852   13.665  -66.291 1.00 52.38 ? 13   ARG B CB  1 
ATOM   4270 C CG  . ARG B 1 13  ? 4.886   15.174  -66.003 1.00 54.12 ? 13   ARG B CG  1 
ATOM   4271 C CD  . ARG B 1 13  ? 6.278   15.626  -65.485 1.00 55.37 ? 13   ARG B CD  1 
ATOM   4272 N NE  . ARG B 1 13  ? 6.292   17.028  -65.019 1.00 62.10 ? 13   ARG B NE  1 
ATOM   4273 C CZ  . ARG B 1 13  ? 7.377   17.710  -64.615 1.00 63.94 ? 13   ARG B CZ  1 
ATOM   4274 N NH1 . ARG B 1 13  ? 8.586   17.149  -64.602 1.00 64.64 ? 13   ARG B NH1 1 
ATOM   4275 N NH2 . ARG B 1 13  ? 7.256   18.976  -64.215 1.00 64.12 ? 13   ARG B NH2 1 
ATOM   4276 N N   . GLY B 1 14  ? 3.660   10.723  -67.229 1.00 50.71 ? 14   GLY B N   1 
ATOM   4277 C CA  . GLY B 1 14  ? 3.950   9.483   -67.936 1.00 49.81 ? 14   GLY B CA  1 
ATOM   4278 C C   . GLY B 1 14  ? 2.803   8.916   -68.757 1.00 49.27 ? 14   GLY B C   1 
ATOM   4279 O O   . GLY B 1 14  ? 2.995   7.975   -69.519 1.00 49.08 ? 14   GLY B O   1 
ATOM   4280 N N   . GLY B 1 15  ? 1.607   9.471   -68.586 1.00 48.98 ? 15   GLY B N   1 
ATOM   4281 C CA  . GLY B 1 15  ? 0.439   9.025   -69.335 1.00 48.44 ? 15   GLY B CA  1 
ATOM   4282 C C   . GLY B 1 15  ? -0.851  9.009   -68.539 1.00 48.17 ? 15   GLY B C   1 
ATOM   4283 O O   . GLY B 1 15  ? -0.960  9.662   -67.501 1.00 48.20 ? 15   GLY B O   1 
ATOM   4284 N N   . GLN B 1 16  ? -1.829  8.259   -69.035 1.00 47.68 ? 16   GLN B N   1 
ATOM   4285 C CA  . GLN B 1 16  ? -3.142  8.201   -68.429 1.00 47.70 ? 16   GLN B CA  1 
ATOM   4286 C C   . GLN B 1 16  ? -3.227  7.059   -67.451 1.00 47.07 ? 16   GLN B C   1 
ATOM   4287 O O   . GLN B 1 16  ? -2.582  6.014   -67.626 1.00 47.11 ? 16   GLN B O   1 
ATOM   4288 C CB  . GLN B 1 16  ? -4.231  8.015   -69.481 1.00 47.50 ? 16   GLN B CB  1 
ATOM   4289 C CG  . GLN B 1 16  ? -4.277  9.067   -70.588 1.00 48.96 ? 16   GLN B CG  1 
ATOM   4290 C CD  . GLN B 1 16  ? -5.550  8.946   -71.443 1.00 49.97 ? 16   GLN B CD  1 
ATOM   4291 O OE1 . GLN B 1 16  ? -5.537  8.344   -72.533 1.00 51.58 ? 16   GLN B OE1 1 
ATOM   4292 N NE2 . GLN B 1 16  ? -6.668  9.487   -70.927 1.00 50.62 ? 16   GLN B NE2 1 
ATOM   4293 N N   . LEU B 1 17  ? -4.049  7.275   -66.433 1.00 46.62 ? 17   LEU B N   1 
ATOM   4294 C CA  . LEU B 1 17  ? -4.307  6.325   -65.379 1.00 46.35 ? 17   LEU B CA  1 
ATOM   4295 C C   . LEU B 1 17  ? -5.796  6.255   -65.199 1.00 46.54 ? 17   LEU B C   1 
ATOM   4296 O O   . LEU B 1 17  ? -6.507  7.237   -65.431 1.00 46.56 ? 17   LEU B O   1 
ATOM   4297 C CB  . LEU B 1 17  ? -3.736  6.832   -64.054 1.00 46.53 ? 17   LEU B CB  1 
ATOM   4298 C CG  . LEU B 1 17  ? -2.304  7.323   -63.933 1.00 46.64 ? 17   LEU B CG  1 
ATOM   4299 C CD1 . LEU B 1 17  ? -2.178  8.143   -62.685 1.00 47.47 ? 17   LEU B CD1 1 
ATOM   4300 C CD2 . LEU B 1 17  ? -1.361  6.146   -63.891 1.00 47.59 ? 17   LEU B CD2 1 
ATOM   4301 N N   . ARG B 1 18  ? -6.270  5.109   -64.748 1.00 46.82 ? 18   ARG B N   1 
ATOM   4302 C CA  . ARG B 1 18  ? -7.657  4.969   -64.400 1.00 47.76 ? 18   ARG B CA  1 
ATOM   4303 C C   . ARG B 1 18  ? -7.738  4.369   -63.015 1.00 47.67 ? 18   ARG B C   1 
ATOM   4304 O O   . ARG B 1 18  ? -7.245  3.273   -62.753 1.00 47.04 ? 18   ARG B O   1 
ATOM   4305 C CB  . ARG B 1 18  ? -8.421  4.140   -65.433 1.00 47.47 ? 18   ARG B CB  1 
ATOM   4306 C CG  . ARG B 1 18  ? -9.833  3.740   -64.998 1.00 49.05 ? 18   ARG B CG  1 
ATOM   4307 C CD  . ARG B 1 18  ? -10.513 2.778   -65.976 1.00 50.15 ? 18   ARG B CD  1 
ATOM   4308 N NE  . ARG B 1 18  ? -9.580  1.798   -66.548 1.00 55.60 ? 18   ARG B NE  1 
ATOM   4309 C CZ  . ARG B 1 18  ? -9.232  1.738   -67.836 1.00 56.21 ? 18   ARG B CZ  1 
ATOM   4310 N NH1 . ARG B 1 18  ? -9.746  2.595   -68.723 1.00 54.69 ? 18   ARG B NH1 1 
ATOM   4311 N NH2 . ARG B 1 18  ? -8.349  0.819   -68.229 1.00 57.42 ? 18   ARG B NH2 1 
ATOM   4312 N N   . GLY B 1 19  ? -8.351  5.129   -62.122 1.00 48.45 ? 19   GLY B N   1 
ATOM   4313 C CA  . GLY B 1 19  ? -8.521  4.700   -60.763 1.00 49.35 ? 19   GLY B CA  1 
ATOM   4314 C C   . GLY B 1 19  ? -9.810  3.942   -60.612 1.00 50.14 ? 19   GLY B C   1 
ATOM   4315 O O   . GLY B 1 19  ? -10.456 3.549   -61.591 1.00 50.04 ? 19   GLY B O   1 
ATOM   4316 N N   . ILE B 1 20  ? -10.176 3.744   -59.360 1.00 50.97 ? 20   ILE B N   1 
ATOM   4317 C CA  . ILE B 1 20  ? -11.397 3.079   -59.004 1.00 52.01 ? 20   ILE B CA  1 
ATOM   4318 C C   . ILE B 1 20  ? -12.113 4.008   -58.028 1.00 53.42 ? 20   ILE B C   1 
ATOM   4319 O O   . ILE B 1 20  ? -11.476 4.809   -57.338 1.00 53.79 ? 20   ILE B O   1 
ATOM   4320 C CB  . ILE B 1 20  ? -11.097 1.691   -58.394 1.00 51.59 ? 20   ILE B CB  1 
ATOM   4321 C CG1 . ILE B 1 20  ? -12.383 0.967   -57.998 1.00 51.45 ? 20   ILE B CG1 1 
ATOM   4322 C CG2 . ILE B 1 20  ? -10.110 1.798   -57.233 1.00 51.11 ? 20   ILE B CG2 1 
ATOM   4323 C CD1 . ILE B 1 20  ? -12.252 -0.541  -57.944 1.00 51.02 ? 20   ILE B CD1 1 
ATOM   4324 N N   . ARG B 1 21  ? -13.436 3.946   -58.006 1.00 54.74 ? 21   ARG B N   1 
ATOM   4325 C CA  . ARG B 1 21  ? -14.188 4.695   -57.033 1.00 56.04 ? 21   ARG B CA  1 
ATOM   4326 C C   . ARG B 1 21  ? -14.355 3.746   -55.878 1.00 56.17 ? 21   ARG B C   1 
ATOM   4327 O O   . ARG B 1 21  ? -14.906 2.658   -56.031 1.00 56.19 ? 21   ARG B O   1 
ATOM   4328 C CB  . ARG B 1 21  ? -15.530 5.155   -57.608 1.00 56.01 ? 21   ARG B CB  1 
ATOM   4329 C CG  . ARG B 1 21  ? -16.470 5.842   -56.615 1.00 57.03 ? 21   ARG B CG  1 
ATOM   4330 C CD  . ARG B 1 21  ? -17.795 6.242   -57.284 1.00 58.22 ? 21   ARG B CD  1 
ATOM   4331 N NE  . ARG B 1 21  ? -18.658 5.089   -57.575 1.00 63.28 ? 21   ARG B NE  1 
ATOM   4332 C CZ  . ARG B 1 21  ? -19.756 4.764   -56.888 1.00 65.25 ? 21   ARG B CZ  1 
ATOM   4333 N NH1 . ARG B 1 21  ? -20.160 5.505   -55.848 1.00 65.51 ? 21   ARG B NH1 1 
ATOM   4334 N NH2 . ARG B 1 21  ? -20.463 3.694   -57.251 1.00 65.63 ? 21   ARG B NH2 1 
ATOM   4335 N N   . LEU B 1 22  ? -13.833 4.145   -54.728 1.00 56.87 ? 22   LEU B N   1 
ATOM   4336 C CA  . LEU B 1 22  ? -13.940 3.332   -53.542 1.00 57.82 ? 22   LEU B CA  1 
ATOM   4337 C C   . LEU B 1 22  ? -15.010 3.907   -52.633 1.00 58.33 ? 22   LEU B C   1 
ATOM   4338 O O   . LEU B 1 22  ? -15.309 5.104   -52.678 1.00 58.47 ? 22   LEU B O   1 
ATOM   4339 C CB  . LEU B 1 22  ? -12.589 3.223   -52.820 1.00 58.07 ? 22   LEU B CB  1 
ATOM   4340 C CG  . LEU B 1 22  ? -11.385 2.537   -53.497 1.00 59.14 ? 22   LEU B CG  1 
ATOM   4341 C CD1 . LEU B 1 22  ? -10.159 2.608   -52.591 1.00 60.98 ? 22   LEU B CD1 1 
ATOM   4342 C CD2 . LEU B 1 22  ? -11.658 1.078   -53.868 1.00 60.14 ? 22   LEU B CD2 1 
ATOM   4343 N N   . LYS B 1 23  ? -15.603 3.043   -51.825 1.00 59.03 ? 23   LYS B N   1 
ATOM   4344 C CA  . LYS B 1 23  ? -16.632 3.460   -50.894 1.00 59.97 ? 23   LYS B CA  1 
ATOM   4345 C C   . LYS B 1 23  ? -16.013 3.667   -49.519 1.00 59.32 ? 23   LYS B C   1 
ATOM   4346 O O   . LYS B 1 23  ? -15.384 2.762   -48.960 1.00 59.45 ? 23   LYS B O   1 
ATOM   4347 C CB  . LYS B 1 23  ? -17.764 2.422   -50.839 1.00 59.96 ? 23   LYS B CB  1 
ATOM   4348 C CG  . LYS B 1 23  ? -18.988 2.824   -50.003 1.00 61.56 ? 23   LYS B CG  1 
ATOM   4349 C CD  . LYS B 1 23  ? -19.826 1.578   -49.655 1.00 62.42 ? 23   LYS B CD  1 
ATOM   4350 C CE  . LYS B 1 23  ? -20.806 1.829   -48.498 1.00 65.57 ? 23   LYS B CE  1 
ATOM   4351 N NZ  . LYS B 1 23  ? -21.463 0.549   -48.075 1.00 65.79 ? 23   LYS B NZ  1 
ATOM   4352 N N   . ALA B 1 24  ? -16.174 4.886   -49.009 1.00 58.84 ? 24   ALA B N   1 
ATOM   4353 C CA  . ALA B 1 24  ? -15.914 5.213   -47.614 1.00 58.22 ? 24   ALA B CA  1 
ATOM   4354 C C   . ALA B 1 24  ? -17.275 5.424   -46.910 1.00 58.04 ? 24   ALA B C   1 
ATOM   4355 O O   . ALA B 1 24  ? -18.279 5.703   -47.578 1.00 57.92 ? 24   ALA B O   1 
ATOM   4356 C CB  . ALA B 1 24  ? -15.035 6.451   -47.525 1.00 57.85 ? 24   ALA B CB  1 
ATOM   4357 N N   . PRO B 1 25  ? -17.324 5.263   -45.570 1.00 57.77 ? 25   PRO B N   1 
ATOM   4358 C CA  . PRO B 1 25  ? -18.583 5.342   -44.816 1.00 57.31 ? 25   PRO B CA  1 
ATOM   4359 C C   . PRO B 1 25  ? -19.486 6.521   -45.180 1.00 56.82 ? 25   PRO B C   1 
ATOM   4360 O O   . PRO B 1 25  ? -20.698 6.339   -45.314 1.00 56.90 ? 25   PRO B O   1 
ATOM   4361 C CB  . PRO B 1 25  ? -18.109 5.468   -43.370 1.00 57.46 ? 25   PRO B CB  1 
ATOM   4362 C CG  . PRO B 1 25  ? -16.843 4.701   -43.344 1.00 57.69 ? 25   PRO B CG  1 
ATOM   4363 C CD  . PRO B 1 25  ? -16.186 4.955   -44.681 1.00 57.78 ? 25   PRO B CD  1 
ATOM   4364 N N   . GLY B 1 26  ? -18.901 7.707   -45.347 1.00 55.99 ? 26   GLY B N   1 
ATOM   4365 C CA  . GLY B 1 26  ? -19.676 8.924   -45.591 1.00 54.63 ? 26   GLY B CA  1 
ATOM   4366 C C   . GLY B 1 26  ? -19.702 9.379   -47.040 1.00 54.08 ? 26   GLY B C   1 
ATOM   4367 O O   . GLY B 1 26  ? -20.072 10.525  -47.339 1.00 53.88 ? 26   GLY B O   1 
ATOM   4368 N N   . GLY B 1 27  ? -19.300 8.491   -47.946 1.00 53.27 ? 27   GLY B N   1 
ATOM   4369 C CA  . GLY B 1 27  ? -19.354 8.798   -49.367 1.00 52.25 ? 27   GLY B CA  1 
ATOM   4370 C C   . GLY B 1 27  ? -18.198 8.222   -50.152 1.00 51.56 ? 27   GLY B C   1 
ATOM   4371 O O   . GLY B 1 27  ? -17.304 7.616   -49.574 1.00 51.58 ? 27   GLY B O   1 
ATOM   4372 N N   . PRO B 1 28  ? -18.211 8.418   -51.483 1.00 50.77 ? 28   PRO B N   1 
ATOM   4373 C CA  . PRO B 1 28  ? -17.197 7.893   -52.384 1.00 50.16 ? 28   PRO B CA  1 
ATOM   4374 C C   . PRO B 1 28  ? -15.846 8.637   -52.327 1.00 49.57 ? 28   PRO B C   1 
ATOM   4375 O O   . PRO B 1 28  ? -15.809 9.832   -51.995 1.00 49.10 ? 28   PRO B O   1 
ATOM   4376 C CB  . PRO B 1 28  ? -17.844 8.077   -53.760 1.00 50.25 ? 28   PRO B CB  1 
ATOM   4377 C CG  . PRO B 1 28  ? -18.725 9.259   -53.596 1.00 50.31 ? 28   PRO B CG  1 
ATOM   4378 C CD  . PRO B 1 28  ? -19.250 9.178   -52.206 1.00 50.55 ? 28   PRO B CD  1 
ATOM   4379 N N   . VAL B 1 29  ? -14.763 7.911   -52.650 1.00 48.57 ? 29   VAL B N   1 
ATOM   4380 C CA  . VAL B 1 29  ? -13.406 8.468   -52.813 1.00 47.52 ? 29   VAL B CA  1 
ATOM   4381 C C   . VAL B 1 29  ? -12.797 7.918   -54.113 1.00 47.07 ? 29   VAL B C   1 
ATOM   4382 O O   . VAL B 1 29  ? -13.056 6.765   -54.480 1.00 46.74 ? 29   VAL B O   1 
ATOM   4383 C CB  . VAL B 1 29  ? -12.467 8.151   -51.599 1.00 47.53 ? 29   VAL B CB  1 
ATOM   4384 C CG1 . VAL B 1 29  ? -13.173 8.381   -50.268 1.00 47.30 ? 29   VAL B CG1 1 
ATOM   4385 C CG2 . VAL B 1 29  ? -11.956 6.720   -51.636 1.00 47.12 ? 29   VAL B CG2 1 
ATOM   4386 N N   . SER B 1 30  ? -12.019 8.740   -54.812 1.00 46.08 ? 30   SER B N   1 
ATOM   4387 C CA  . SER B 1 30  ? -11.276 8.290   -55.989 1.00 45.48 ? 30   SER B CA  1 
ATOM   4388 C C   . SER B 1 30  ? -9.936  7.719   -55.544 1.00 44.86 ? 30   SER B C   1 
ATOM   4389 O O   . SER B 1 30  ? -9.161  8.412   -54.897 1.00 45.31 ? 30   SER B O   1 
ATOM   4390 C CB  . SER B 1 30  ? -11.002 9.462   -56.934 1.00 45.59 ? 30   SER B CB  1 
ATOM   4391 O OG  . SER B 1 30  ? -12.139 10.280  -57.137 1.00 46.45 ? 30   SER B OG  1 
ATOM   4392 N N   . ALA B 1 31  ? -9.654  6.463   -55.875 1.00 44.15 ? 31   ALA B N   1 
ATOM   4393 C CA  . ALA B 1 31  ? -8.357  5.864   -55.535 1.00 42.97 ? 31   ALA B CA  1 
ATOM   4394 C C   . ALA B 1 31  ? -7.540  5.522   -56.768 1.00 42.56 ? 31   ALA B C   1 
ATOM   4395 O O   . ALA B 1 31  ? -8.049  4.913   -57.706 1.00 42.35 ? 31   ALA B O   1 
ATOM   4396 C CB  . ALA B 1 31  ? -8.544  4.640   -54.688 1.00 42.94 ? 31   ALA B CB  1 
ATOM   4397 N N   . PHE B 1 32  ? -6.270  5.918   -56.754 1.00 42.05 ? 32   PHE B N   1 
ATOM   4398 C CA  . PHE B 1 32  ? -5.323  5.577   -57.816 1.00 41.14 ? 32   PHE B CA  1 
ATOM   4399 C C   . PHE B 1 32  ? -4.190  4.744   -57.225 1.00 40.66 ? 32   PHE B C   1 
ATOM   4400 O O   . PHE B 1 32  ? -3.250  5.271   -56.614 1.00 40.40 ? 32   PHE B O   1 
ATOM   4401 C CB  . PHE B 1 32  ? -4.802  6.839   -58.481 1.00 41.27 ? 32   PHE B CB  1 
ATOM   4402 C CG  . PHE B 1 32  ? -5.887  7.758   -58.929 1.00 42.39 ? 32   PHE B CG  1 
ATOM   4403 C CD1 . PHE B 1 32  ? -6.415  8.704   -58.060 1.00 42.99 ? 32   PHE B CD1 1 
ATOM   4404 C CD2 . PHE B 1 32  ? -6.412  7.652   -60.206 1.00 43.08 ? 32   PHE B CD2 1 
ATOM   4405 C CE1 . PHE B 1 32  ? -7.429  9.551   -58.467 1.00 43.83 ? 32   PHE B CE1 1 
ATOM   4406 C CE2 . PHE B 1 32  ? -7.434  8.481   -60.622 1.00 44.26 ? 32   PHE B CE2 1 
ATOM   4407 C CZ  . PHE B 1 32  ? -7.946  9.443   -59.748 1.00 43.41 ? 32   PHE B CZ  1 
ATOM   4408 N N   . LEU B 1 33  ? -4.302  3.434   -57.401 1.00 39.59 ? 33   LEU B N   1 
ATOM   4409 C CA  . LEU B 1 33  ? -3.447  2.494   -56.715 1.00 38.99 ? 33   LEU B CA  1 
ATOM   4410 C C   . LEU B 1 33  ? -2.461  1.818   -57.658 1.00 39.35 ? 33   LEU B C   1 
ATOM   4411 O O   . LEU B 1 33  ? -2.837  1.351   -58.732 1.00 40.11 ? 33   LEU B O   1 
ATOM   4412 C CB  . LEU B 1 33  ? -4.301  1.444   -56.014 1.00 38.36 ? 33   LEU B CB  1 
ATOM   4413 C CG  . LEU B 1 33  ? -5.496  1.905   -55.173 1.00 37.30 ? 33   LEU B CG  1 
ATOM   4414 C CD1 . LEU B 1 33  ? -6.261  0.704   -54.621 1.00 35.15 ? 33   LEU B CD1 1 
ATOM   4415 C CD2 . LEU B 1 33  ? -5.059  2.814   -54.034 1.00 34.88 ? 33   LEU B CD2 1 
ATOM   4416 N N   . GLY B 1 34  ? -1.195  1.767   -57.258 1.00 39.15 ? 34   GLY B N   1 
ATOM   4417 C CA  . GLY B 1 34  ? -0.196  1.002   -57.995 1.00 38.26 ? 34   GLY B CA  1 
ATOM   4418 C C   . GLY B 1 34  ? 0.329   1.767   -59.179 1.00 37.84 ? 34   GLY B C   1 
ATOM   4419 O O   . GLY B 1 34  ? 0.680   1.175   -60.194 1.00 38.33 ? 34   GLY B O   1 
ATOM   4420 N N   . ILE B 1 35  ? 0.372   3.093   -59.049 1.00 37.10 ? 35   ILE B N   1 
ATOM   4421 C CA  . ILE B 1 35  ? 0.949   3.954   -60.069 1.00 36.05 ? 35   ILE B CA  1 
ATOM   4422 C C   . ILE B 1 35  ? 2.452   3.824   -59.991 1.00 35.59 ? 35   ILE B C   1 
ATOM   4423 O O   . ILE B 1 35  ? 3.023   4.060   -58.942 1.00 36.61 ? 35   ILE B O   1 
ATOM   4424 C CB  . ILE B 1 35  ? 0.603   5.445   -59.831 1.00 35.98 ? 35   ILE B CB  1 
ATOM   4425 C CG1 . ILE B 1 35  ? -0.910  5.650   -59.731 1.00 35.18 ? 35   ILE B CG1 1 
ATOM   4426 C CG2 . ILE B 1 35  ? 1.241   6.311   -60.920 1.00 35.12 ? 35   ILE B CG2 1 
ATOM   4427 C CD1 . ILE B 1 35  ? -1.303  6.960   -59.149 1.00 35.42 ? 35   ILE B CD1 1 
ATOM   4428 N N   . PRO B 1 36  ? 3.103   3.431   -61.090 1.00 35.26 ? 36   PRO B N   1 
ATOM   4429 C CA  . PRO B 1 36  ? 4.554   3.239   -61.054 1.00 34.60 ? 36   PRO B CA  1 
ATOM   4430 C C   . PRO B 1 36  ? 5.288   4.565   -61.045 1.00 34.16 ? 36   PRO B C   1 
ATOM   4431 O O   . PRO B 1 36  ? 5.015   5.422   -61.892 1.00 33.90 ? 36   PRO B O   1 
ATOM   4432 C CB  . PRO B 1 36  ? 4.832   2.512   -62.371 1.00 34.53 ? 36   PRO B CB  1 
ATOM   4433 C CG  . PRO B 1 36  ? 3.728   2.988   -63.286 1.00 34.46 ? 36   PRO B CG  1 
ATOM   4434 C CD  . PRO B 1 36  ? 2.531   3.125   -62.417 1.00 34.66 ? 36   PRO B CD  1 
ATOM   4435 N N   . PHE B 1 37  ? 6.223   4.736   -60.114 1.00 33.80 ? 37   PHE B N   1 
ATOM   4436 C CA  . PHE B 1 37  ? 7.016   5.973   -60.090 1.00 33.61 ? 37   PHE B CA  1 
ATOM   4437 C C   . PHE B 1 37  ? 8.467   5.774   -60.516 1.00 34.07 ? 37   PHE B C   1 
ATOM   4438 O O   . PHE B 1 37  ? 9.198   6.742   -60.777 1.00 34.35 ? 37   PHE B O   1 
ATOM   4439 C CB  . PHE B 1 37  ? 6.907   6.703   -58.734 1.00 33.04 ? 37   PHE B CB  1 
ATOM   4440 C CG  . PHE B 1 37  ? 7.447   5.934   -57.568 1.00 31.57 ? 37   PHE B CG  1 
ATOM   4441 C CD1 . PHE B 1 37  ? 8.780   6.065   -57.192 1.00 30.69 ? 37   PHE B CD1 1 
ATOM   4442 C CD2 . PHE B 1 37  ? 6.620   5.118   -56.813 1.00 30.50 ? 37   PHE B CD2 1 
ATOM   4443 C CE1 . PHE B 1 37  ? 9.291   5.378   -56.100 1.00 29.29 ? 37   PHE B CE1 1 
ATOM   4444 C CE2 . PHE B 1 37  ? 7.124   4.413   -55.715 1.00 30.43 ? 37   PHE B CE2 1 
ATOM   4445 C CZ  . PHE B 1 37  ? 8.477   4.539   -55.366 1.00 30.49 ? 37   PHE B CZ  1 
ATOM   4446 N N   . ALA B 1 38  ? 8.879   4.515   -60.594 1.00 34.30 ? 38   ALA B N   1 
ATOM   4447 C CA  . ALA B 1 38  ? 10.230  4.193   -61.016 1.00 34.56 ? 38   ALA B CA  1 
ATOM   4448 C C   . ALA B 1 38  ? 10.230  3.006   -61.937 1.00 34.81 ? 38   ALA B C   1 
ATOM   4449 O O   . ALA B 1 38  ? 9.297   2.183   -61.924 1.00 35.29 ? 38   ALA B O   1 
ATOM   4450 C CB  . ALA B 1 38  ? 11.120  3.910   -59.821 1.00 34.23 ? 38   ALA B CB  1 
ATOM   4451 N N   . GLU B 1 39  ? 11.288  2.927   -62.738 1.00 34.69 ? 39   GLU B N   1 
ATOM   4452 C CA  . GLU B 1 39  ? 11.622  1.710   -63.434 1.00 34.66 ? 39   GLU B CA  1 
ATOM   4453 C C   . GLU B 1 39  ? 11.735  0.612   -62.408 1.00 35.05 ? 39   GLU B C   1 
ATOM   4454 O O   . GLU B 1 39  ? 12.245  0.841   -61.323 1.00 35.90 ? 39   GLU B O   1 
ATOM   4455 C CB  . GLU B 1 39  ? 12.927  1.878   -64.173 1.00 33.87 ? 39   GLU B CB  1 
ATOM   4456 C CG  . GLU B 1 39  ? 12.784  2.802   -65.323 1.00 34.87 ? 39   GLU B CG  1 
ATOM   4457 C CD  . GLU B 1 39  ? 11.856  2.240   -66.369 1.00 36.13 ? 39   GLU B CD  1 
ATOM   4458 O OE1 . GLU B 1 39  ? 12.295  1.361   -67.145 1.00 38.07 ? 39   GLU B OE1 1 
ATOM   4459 O OE2 . GLU B 1 39  ? 10.689  2.678   -66.419 1.00 36.91 ? 39   GLU B OE2 1 
ATOM   4460 N N   . PRO B 1 40  ? 11.207  -0.573  -62.710 1.00 35.36 ? 40   PRO B N   1 
ATOM   4461 C CA  . PRO B 1 40  ? 11.409  -1.637  -61.731 1.00 35.93 ? 40   PRO B CA  1 
ATOM   4462 C C   . PRO B 1 40  ? 12.896  -1.788  -61.388 1.00 36.77 ? 40   PRO B C   1 
ATOM   4463 O O   . PRO B 1 40  ? 13.731  -1.905  -62.278 1.00 37.18 ? 40   PRO B O   1 
ATOM   4464 C CB  . PRO B 1 40  ? 10.871  -2.872  -62.441 1.00 35.60 ? 40   PRO B CB  1 
ATOM   4465 C CG  . PRO B 1 40  ? 9.855   -2.321  -63.398 1.00 35.83 ? 40   PRO B CG  1 
ATOM   4466 C CD  . PRO B 1 40  ? 10.400  -1.000  -63.861 1.00 34.72 ? 40   PRO B CD  1 
ATOM   4467 N N   . PRO B 1 41  ? 13.238  -1.747  -60.095 1.00 37.60 ? 41   PRO B N   1 
ATOM   4468 C CA  . PRO B 1 41  ? 14.653  -1.806  -59.703 1.00 37.88 ? 41   PRO B CA  1 
ATOM   4469 C C   . PRO B 1 41  ? 15.187  -3.244  -59.694 1.00 38.30 ? 41   PRO B C   1 
ATOM   4470 O O   . PRO B 1 41  ? 15.703  -3.702  -58.677 1.00 38.48 ? 41   PRO B O   1 
ATOM   4471 C CB  . PRO B 1 41  ? 14.616  -1.251  -58.294 1.00 37.38 ? 41   PRO B CB  1 
ATOM   4472 C CG  . PRO B 1 41  ? 13.285  -1.763  -57.781 1.00 38.15 ? 41   PRO B CG  1 
ATOM   4473 C CD  . PRO B 1 41  ? 12.345  -1.639  -58.928 1.00 37.10 ? 41   PRO B CD  1 
ATOM   4474 N N   . VAL B 1 42  ? 15.078  -3.930  -60.829 1.00 38.89 ? 42   VAL B N   1 
ATOM   4475 C CA  . VAL B 1 42  ? 15.398  -5.367  -60.939 1.00 39.23 ? 42   VAL B CA  1 
ATOM   4476 C C   . VAL B 1 42  ? 16.618  -5.653  -61.831 1.00 39.70 ? 42   VAL B C   1 
ATOM   4477 O O   . VAL B 1 42  ? 17.109  -4.777  -62.535 1.00 39.19 ? 42   VAL B O   1 
ATOM   4478 C CB  . VAL B 1 42  ? 14.203  -6.137  -61.526 1.00 39.61 ? 42   VAL B CB  1 
ATOM   4479 C CG1 . VAL B 1 42  ? 12.991  -6.058  -60.578 1.00 38.79 ? 42   VAL B CG1 1 
ATOM   4480 C CG2 . VAL B 1 42  ? 13.854  -5.591  -62.933 1.00 38.34 ? 42   VAL B CG2 1 
ATOM   4481 N N   . GLY B 1 43  ? 17.099  -6.890  -61.804 1.00 40.31 ? 43   GLY B N   1 
ATOM   4482 C CA  . GLY B 1 43  ? 18.283  -7.241  -62.575 1.00 41.26 ? 43   GLY B CA  1 
ATOM   4483 C C   . GLY B 1 43  ? 19.488  -6.406  -62.176 1.00 41.96 ? 43   GLY B C   1 
ATOM   4484 O O   . GLY B 1 43  ? 19.904  -6.428  -61.017 1.00 42.60 ? 43   GLY B O   1 
ATOM   4485 N N   . SER B 1 44  ? 20.042  -5.657  -63.124 1.00 42.47 ? 44   SER B N   1 
ATOM   4486 C CA  . SER B 1 44  ? 21.274  -4.910  -62.875 1.00 43.04 ? 44   SER B CA  1 
ATOM   4487 C C   . SER B 1 44  ? 20.955  -3.664  -62.053 1.00 43.15 ? 44   SER B C   1 
ATOM   4488 O O   . SER B 1 44  ? 21.847  -2.895  -61.660 1.00 43.22 ? 44   SER B O   1 
ATOM   4489 C CB  . SER B 1 44  ? 21.970  -4.534  -64.194 1.00 42.92 ? 44   SER B CB  1 
ATOM   4490 O OG  . SER B 1 44  ? 21.589  -3.229  -64.632 1.00 43.64 ? 44   SER B OG  1 
ATOM   4491 N N   . ARG B 1 45  ? 19.664  -3.463  -61.814 1.00 43.22 ? 45   ARG B N   1 
ATOM   4492 C CA  . ARG B 1 45  ? 19.197  -2.265  -61.130 1.00 42.65 ? 45   ARG B CA  1 
ATOM   4493 C C   . ARG B 1 45  ? 18.905  -2.516  -59.649 1.00 41.79 ? 45   ARG B C   1 
ATOM   4494 O O   . ARG B 1 45  ? 18.548  -1.596  -58.910 1.00 42.13 ? 45   ARG B O   1 
ATOM   4495 C CB  . ARG B 1 45  ? 18.022  -1.650  -61.883 1.00 42.70 ? 45   ARG B CB  1 
ATOM   4496 C CG  . ARG B 1 45  ? 18.479  -0.613  -62.886 1.00 45.39 ? 45   ARG B CG  1 
ATOM   4497 C CD  . ARG B 1 45  ? 18.948  0.651   -62.145 1.00 51.41 ? 45   ARG B CD  1 
ATOM   4498 N NE  . ARG B 1 45  ? 19.862  1.493   -62.918 1.00 55.90 ? 45   ARG B NE  1 
ATOM   4499 C CZ  . ARG B 1 45  ? 20.310  2.691   -62.524 1.00 59.05 ? 45   ARG B CZ  1 
ATOM   4500 N NH1 . ARG B 1 45  ? 19.935  3.215   -61.355 1.00 59.25 ? 45   ARG B NH1 1 
ATOM   4501 N NH2 . ARG B 1 45  ? 21.141  3.381   -63.306 1.00 60.04 ? 45   ARG B NH2 1 
ATOM   4502 N N   . ARG B 1 46  ? 19.085  -3.767  -59.225 1.00 40.30 ? 46   ARG B N   1 
ATOM   4503 C CA  . ARG B 1 46  ? 19.098  -4.109  -57.810 1.00 39.23 ? 46   ARG B CA  1 
ATOM   4504 C C   . ARG B 1 46  ? 20.245  -3.398  -57.100 1.00 38.81 ? 46   ARG B C   1 
ATOM   4505 O O   . ARG B 1 46  ? 21.369  -3.362  -57.618 1.00 39.08 ? 46   ARG B O   1 
ATOM   4506 C CB  . ARG B 1 46  ? 19.261  -5.609  -57.628 1.00 39.02 ? 46   ARG B CB  1 
ATOM   4507 C CG  . ARG B 1 46  ? 19.302  -6.015  -56.194 1.00 38.11 ? 46   ARG B CG  1 
ATOM   4508 C CD  . ARG B 1 46  ? 19.662  -7.445  -56.081 1.00 38.22 ? 46   ARG B CD  1 
ATOM   4509 N NE  . ARG B 1 46  ? 18.493  -8.311  -56.126 1.00 37.21 ? 46   ARG B NE  1 
ATOM   4510 C CZ  . ARG B 1 46  ? 18.567  -9.633  -56.111 1.00 35.76 ? 46   ARG B CZ  1 
ATOM   4511 N NH1 . ARG B 1 46  ? 19.758  -10.209 -56.079 1.00 37.25 ? 46   ARG B NH1 1 
ATOM   4512 N NH2 . ARG B 1 46  ? 17.462  -10.372 -56.138 1.00 34.51 ? 46   ARG B NH2 1 
ATOM   4513 N N   . PHE B 1 47  ? 19.956  -2.862  -55.909 1.00 37.79 ? 47   PHE B N   1 
ATOM   4514 C CA  . PHE B 1 47  ? 20.912  -2.089  -55.089 1.00 37.27 ? 47   PHE B CA  1 
ATOM   4515 C C   . PHE B 1 47  ? 21.209  -0.727  -55.658 1.00 37.00 ? 47   PHE B C   1 
ATOM   4516 O O   . PHE B 1 47  ? 22.003  0.010   -55.089 1.00 37.04 ? 47   PHE B O   1 
ATOM   4517 C CB  . PHE B 1 47  ? 22.260  -2.815  -54.867 1.00 36.74 ? 47   PHE B CB  1 
ATOM   4518 C CG  . PHE B 1 47  ? 22.122  -4.212  -54.358 1.00 36.13 ? 47   PHE B CG  1 
ATOM   4519 C CD1 . PHE B 1 47  ? 21.288  -4.499  -53.274 1.00 36.01 ? 47   PHE B CD1 1 
ATOM   4520 C CD2 . PHE B 1 47  ? 22.842  -5.251  -54.956 1.00 35.27 ? 47   PHE B CD2 1 
ATOM   4521 C CE1 . PHE B 1 47  ? 21.152  -5.813  -52.804 1.00 36.12 ? 47   PHE B CE1 1 
ATOM   4522 C CE2 . PHE B 1 47  ? 22.735  -6.552  -54.488 1.00 33.80 ? 47   PHE B CE2 1 
ATOM   4523 C CZ  . PHE B 1 47  ? 21.882  -6.838  -53.412 1.00 35.94 ? 47   PHE B CZ  1 
ATOM   4524 N N   . MET B 1 48  ? 20.604  -0.379  -56.782 1.00 37.28 ? 48   MET B N   1 
ATOM   4525 C CA  . MET B 1 48  ? 20.926  0.909   -57.384 1.00 37.97 ? 48   MET B CA  1 
ATOM   4526 C C   . MET B 1 48  ? 19.846  1.975   -57.199 1.00 37.75 ? 48   MET B C   1 
ATOM   4527 O O   . MET B 1 48  ? 18.702  1.647   -56.865 1.00 37.80 ? 48   MET B O   1 
ATOM   4528 C CB  . MET B 1 48  ? 21.341  0.723   -58.837 1.00 38.67 ? 48   MET B CB  1 
ATOM   4529 C CG  . MET B 1 48  ? 22.731  0.095   -58.946 1.00 40.86 ? 48   MET B CG  1 
ATOM   4530 S SD  . MET B 1 48  ? 23.792  1.107   -59.948 1.00 47.93 ? 48   MET B SD  1 
ATOM   4531 C CE  . MET B 1 48  ? 24.369  2.354   -58.821 1.00 47.64 ? 48   MET B CE  1 
ATOM   4532 N N   . PRO B 1 49  ? 20.216  3.266   -57.342 1.00 37.95 ? 49   PRO B N   1 
ATOM   4533 C CA  . PRO B 1 49  ? 19.209  4.328   -57.209 1.00 37.79 ? 49   PRO B CA  1 
ATOM   4534 C C   . PRO B 1 49  ? 18.066  4.122   -58.193 1.00 38.27 ? 49   PRO B C   1 
ATOM   4535 O O   . PRO B 1 49  ? 18.296  3.610   -59.292 1.00 38.33 ? 49   PRO B O   1 
ATOM   4536 C CB  . PRO B 1 49  ? 19.972  5.595   -57.593 1.00 37.43 ? 49   PRO B CB  1 
ATOM   4537 C CG  . PRO B 1 49  ? 21.367  5.302   -57.348 1.00 37.95 ? 49   PRO B CG  1 
ATOM   4538 C CD  . PRO B 1 49  ? 21.559  3.819   -57.587 1.00 37.76 ? 49   PRO B CD  1 
ATOM   4539 N N   . PRO B 1 50  ? 16.837  4.530   -57.814 1.00 38.66 ? 50   PRO B N   1 
ATOM   4540 C CA  . PRO B 1 50  ? 15.706  4.393   -58.715 1.00 38.37 ? 50   PRO B CA  1 
ATOM   4541 C C   . PRO B 1 50  ? 15.845  5.346   -59.879 1.00 38.86 ? 50   PRO B C   1 
ATOM   4542 O O   . PRO B 1 50  ? 16.454  6.400   -59.738 1.00 39.30 ? 50   PRO B O   1 
ATOM   4543 C CB  . PRO B 1 50  ? 14.537  4.843   -57.844 1.00 38.52 ? 50   PRO B CB  1 
ATOM   4544 C CG  . PRO B 1 50  ? 15.145  5.787   -56.869 1.00 37.42 ? 50   PRO B CG  1 
ATOM   4545 C CD  . PRO B 1 50  ? 16.435  5.161   -56.538 1.00 38.38 ? 50   PRO B CD  1 
ATOM   4546 N N   . GLU B 1 51  ? 15.306  4.986   -61.034 1.00 39.65 ? 51   GLU B N   1 
ATOM   4547 C CA  . GLU B 1 51  ? 15.196  5.961   -62.110 1.00 40.26 ? 51   GLU B CA  1 
ATOM   4548 C C   . GLU B 1 51  ? 13.731  6.195   -62.411 1.00 39.55 ? 51   GLU B C   1 
ATOM   4549 O O   . GLU B 1 51  ? 12.918  5.286   -62.233 1.00 39.03 ? 51   GLU B O   1 
ATOM   4550 C CB  . GLU B 1 51  ? 15.937  5.492   -63.351 1.00 41.20 ? 51   GLU B CB  1 
ATOM   4551 C CG  . GLU B 1 51  ? 17.429  5.255   -63.145 1.00 45.26 ? 51   GLU B CG  1 
ATOM   4552 C CD  . GLU B 1 51  ? 18.021  4.395   -64.259 1.00 51.86 ? 51   GLU B CD  1 
ATOM   4553 O OE1 . GLU B 1 51  ? 17.525  3.252   -64.485 1.00 53.22 ? 51   GLU B OE1 1 
ATOM   4554 O OE2 . GLU B 1 51  ? 18.986  4.871   -64.907 1.00 54.61 ? 51   GLU B OE2 1 
ATOM   4555 N N   . PRO B 1 52  ? 13.379  7.423   -62.828 1.00 39.51 ? 52   PRO B N   1 
ATOM   4556 C CA  . PRO B 1 52  ? 12.015  7.741   -63.252 1.00 39.68 ? 52   PRO B CA  1 
ATOM   4557 C C   . PRO B 1 52  ? 11.419  6.697   -64.206 1.00 39.83 ? 52   PRO B C   1 
ATOM   4558 O O   . PRO B 1 52  ? 12.087  6.232   -65.137 1.00 39.73 ? 52   PRO B O   1 
ATOM   4559 C CB  . PRO B 1 52  ? 12.155  9.102   -63.947 1.00 39.76 ? 52   PRO B CB  1 
ATOM   4560 C CG  . PRO B 1 52  ? 13.670  9.414   -63.968 1.00 40.57 ? 52   PRO B CG  1 
ATOM   4561 C CD  . PRO B 1 52  ? 14.256  8.608   -62.869 1.00 39.83 ? 52   PRO B CD  1 
ATOM   4562 N N   . LYS B 1 53  ? 10.172  6.321   -63.935 1.00 40.14 ? 53   LYS B N   1 
ATOM   4563 C CA  . LYS B 1 53  ? 9.411   5.421   -64.788 1.00 40.39 ? 53   LYS B CA  1 
ATOM   4564 C C   . LYS B 1 53  ? 9.304   6.045   -66.169 1.00 40.69 ? 53   LYS B C   1 
ATOM   4565 O O   . LYS B 1 53  ? 9.022   7.250   -66.301 1.00 41.00 ? 53   LYS B O   1 
ATOM   4566 C CB  . LYS B 1 53  ? 8.019   5.205   -64.197 1.00 39.90 ? 53   LYS B CB  1 
ATOM   4567 C CG  . LYS B 1 53  ? 7.056   4.398   -65.058 1.00 39.72 ? 53   LYS B CG  1 
ATOM   4568 C CD  . LYS B 1 53  ? 7.330   2.884   -64.988 1.00 39.90 ? 53   LYS B CD  1 
ATOM   4569 C CE  . LYS B 1 53  ? 6.360   2.085   -65.864 1.00 37.91 ? 53   LYS B CE  1 
ATOM   4570 N NZ  . LYS B 1 53  ? 6.468   2.495   -67.281 1.00 33.86 ? 53   LYS B NZ  1 
ATOM   4571 N N   . ARG B 1 54  ? 9.562   5.235   -67.192 1.00 40.78 ? 54   ARG B N   1 
ATOM   4572 C CA  . ARG B 1 54  ? 9.386   5.670   -68.577 1.00 40.37 ? 54   ARG B CA  1 
ATOM   4573 C C   . ARG B 1 54  ? 7.894   5.808   -68.868 1.00 40.09 ? 54   ARG B C   1 
ATOM   4574 O O   . ARG B 1 54  ? 7.079   5.079   -68.298 1.00 39.44 ? 54   ARG B O   1 
ATOM   4575 C CB  . ARG B 1 54  ? 10.014  4.668   -69.554 1.00 40.47 ? 54   ARG B CB  1 
ATOM   4576 C CG  . ARG B 1 54  ? 11.533  4.537   -69.508 1.00 39.52 ? 54   ARG B CG  1 
ATOM   4577 C CD  . ARG B 1 54  ? 11.991  3.318   -70.319 1.00 40.37 ? 54   ARG B CD  1 
ATOM   4578 N NE  . ARG B 1 54  ? 11.377  2.071   -69.834 1.00 40.58 ? 54   ARG B NE  1 
ATOM   4579 C CZ  . ARG B 1 54  ? 10.478  1.346   -70.507 1.00 41.93 ? 54   ARG B CZ  1 
ATOM   4580 N NH1 . ARG B 1 54  ? 9.980   0.239   -69.955 1.00 40.16 ? 54   ARG B NH1 1 
ATOM   4581 N NH2 . ARG B 1 54  ? 10.084  1.710   -71.733 1.00 40.33 ? 54   ARG B NH2 1 
ATOM   4582 N N   . PRO B 1 55  ? 7.531   6.740   -69.764 1.00 40.56 ? 55   PRO B N   1 
ATOM   4583 C CA  . PRO B 1 55  ? 6.134   6.968   -70.182 1.00 40.62 ? 55   PRO B CA  1 
ATOM   4584 C C   . PRO B 1 55  ? 5.477   5.695   -70.680 1.00 40.65 ? 55   PRO B C   1 
ATOM   4585 O O   . PRO B 1 55  ? 6.169   4.763   -71.105 1.00 40.81 ? 55   PRO B O   1 
ATOM   4586 C CB  . PRO B 1 55  ? 6.277   7.933   -71.347 1.00 40.77 ? 55   PRO B CB  1 
ATOM   4587 C CG  . PRO B 1 55  ? 7.539   8.680   -71.056 1.00 41.83 ? 55   PRO B CG  1 
ATOM   4588 C CD  . PRO B 1 55  ? 8.458   7.658   -70.444 1.00 40.88 ? 55   PRO B CD  1 
ATOM   4589 N N   . TRP B 1 56  ? 4.154   5.651   -70.624 1.00 40.41 ? 56   TRP B N   1 
ATOM   4590 C CA  . TRP B 1 56  ? 3.429   4.484   -71.075 1.00 40.26 ? 56   TRP B CA  1 
ATOM   4591 C C   . TRP B 1 56  ? 2.306   4.870   -72.035 1.00 40.60 ? 56   TRP B C   1 
ATOM   4592 O O   . TRP B 1 56  ? 1.844   6.013   -72.052 1.00 40.61 ? 56   TRP B O   1 
ATOM   4593 C CB  . TRP B 1 56  ? 2.882   3.722   -69.887 1.00 40.28 ? 56   TRP B CB  1 
ATOM   4594 C CG  . TRP B 1 56  ? 2.025   4.565   -69.019 1.00 41.13 ? 56   TRP B CG  1 
ATOM   4595 C CD1 . TRP B 1 56  ? 0.705   4.845   -69.201 1.00 41.54 ? 56   TRP B CD1 1 
ATOM   4596 C CD2 . TRP B 1 56  ? 2.425   5.260   -67.828 1.00 41.47 ? 56   TRP B CD2 1 
ATOM   4597 N NE1 . TRP B 1 56  ? 0.254   5.672   -68.202 1.00 42.92 ? 56   TRP B NE1 1 
ATOM   4598 C CE2 . TRP B 1 56  ? 1.289   5.936   -67.340 1.00 42.43 ? 56   TRP B CE2 1 
ATOM   4599 C CE3 . TRP B 1 56  ? 3.634   5.376   -67.129 1.00 40.95 ? 56   TRP B CE3 1 
ATOM   4600 C CZ2 . TRP B 1 56  ? 1.317   6.704   -66.172 1.00 40.66 ? 56   TRP B CZ2 1 
ATOM   4601 C CZ3 . TRP B 1 56  ? 3.667   6.151   -65.989 1.00 41.42 ? 56   TRP B CZ3 1 
ATOM   4602 C CH2 . TRP B 1 56  ? 2.509   6.803   -65.518 1.00 40.81 ? 56   TRP B CH2 1 
ATOM   4603 N N   . SER B 1 57  ? 1.893   3.901   -72.844 1.00 40.62 ? 57   SER B N   1 
ATOM   4604 C CA  . SER B 1 57  ? 0.873   4.090   -73.856 1.00 40.84 ? 57   SER B CA  1 
ATOM   4605 C C   . SER B 1 57  ? -0.514  3.771   -73.275 1.00 41.09 ? 57   SER B C   1 
ATOM   4606 O O   . SER B 1 57  ? -0.635  2.963   -72.349 1.00 40.84 ? 57   SER B O   1 
ATOM   4607 C CB  . SER B 1 57  ? 1.163   3.156   -75.036 1.00 40.90 ? 57   SER B CB  1 
ATOM   4608 O OG  . SER B 1 57  ? 0.919   1.779   -74.684 1.00 40.30 ? 57   SER B OG  1 
ATOM   4609 N N   . GLY B 1 58  ? -1.550  4.396   -73.828 1.00 41.03 ? 58   GLY B N   1 
ATOM   4610 C CA  . GLY B 1 58  ? -2.921  4.118   -73.408 1.00 41.63 ? 58   GLY B CA  1 
ATOM   4611 C C   . GLY B 1 58  ? -3.250  4.449   -71.961 1.00 42.02 ? 58   GLY B C   1 
ATOM   4612 O O   . GLY B 1 58  ? -2.690  5.388   -71.368 1.00 41.74 ? 58   GLY B O   1 
ATOM   4613 N N   . VAL B 1 59  ? -4.175  3.678   -71.400 1.00 42.08 ? 59   VAL B N   1 
ATOM   4614 C CA  . VAL B 1 59  ? -4.617  3.874   -70.035 1.00 42.47 ? 59   VAL B CA  1 
ATOM   4615 C C   . VAL B 1 59  ? -4.104  2.761   -69.139 1.00 43.10 ? 59   VAL B C   1 
ATOM   4616 O O   . VAL B 1 59  ? -4.522  1.593   -69.261 1.00 43.22 ? 59   VAL B O   1 
ATOM   4617 C CB  . VAL B 1 59  ? -6.160  3.931   -69.924 1.00 42.86 ? 59   VAL B CB  1 
ATOM   4618 C CG1 . VAL B 1 59  ? -6.586  4.141   -68.457 1.00 41.42 ? 59   VAL B CG1 1 
ATOM   4619 C CG2 . VAL B 1 59  ? -6.735  5.042   -70.840 1.00 43.26 ? 59   VAL B CG2 1 
ATOM   4620 N N   . LEU B 1 60  ? -3.210  3.147   -68.228 1.00 43.40 ? 60   LEU B N   1 
ATOM   4621 C CA  . LEU B 1 60  ? -2.656  2.255   -67.216 1.00 42.90 ? 60   LEU B CA  1 
ATOM   4622 C C   . LEU B 1 60  ? -3.684  2.054   -66.124 1.00 42.20 ? 60   LEU B C   1 
ATOM   4623 O O   . LEU B 1 60  ? -4.227  3.015   -65.599 1.00 42.19 ? 60   LEU B O   1 
ATOM   4624 C CB  . LEU B 1 60  ? -1.375  2.856   -66.632 1.00 43.12 ? 60   LEU B CB  1 
ATOM   4625 C CG  . LEU B 1 60  ? -0.450  1.894   -65.867 1.00 44.86 ? 60   LEU B CG  1 
ATOM   4626 C CD1 . LEU B 1 60  ? 0.566   1.172   -66.775 1.00 44.73 ? 60   LEU B CD1 1 
ATOM   4627 C CD2 . LEU B 1 60  ? 0.281   2.661   -64.817 1.00 44.82 ? 60   LEU B CD2 1 
ATOM   4628 N N   . ASP B 1 61  ? -3.950  0.795   -65.806 1.00 41.98 ? 61   ASP B N   1 
ATOM   4629 C CA  . ASP B 1 61  ? -4.906  0.409   -64.792 1.00 41.93 ? 61   ASP B CA  1 
ATOM   4630 C C   . ASP B 1 61  ? -4.373  0.639   -63.356 1.00 42.35 ? 61   ASP B C   1 
ATOM   4631 O O   . ASP B 1 61  ? -3.470  -0.080  -62.877 1.00 42.30 ? 61   ASP B O   1 
ATOM   4632 C CB  . ASP B 1 61  ? -5.278  -1.055  -65.008 1.00 42.36 ? 61   ASP B CB  1 
ATOM   4633 C CG  . ASP B 1 61  ? -5.814  -1.711  -63.757 1.00 43.59 ? 61   ASP B CG  1 
ATOM   4634 O OD1 . ASP B 1 61  ? -5.310  -2.802  -63.401 1.00 43.84 ? 61   ASP B OD1 1 
ATOM   4635 O OD2 . ASP B 1 61  ? -6.706  -1.115  -63.111 1.00 44.36 ? 61   ASP B OD2 1 
ATOM   4636 N N   . ALA B 1 62  ? -4.947  1.632   -62.671 1.00 41.87 ? 62   ALA B N   1 
ATOM   4637 C CA  . ALA B 1 62  ? -4.510  2.002   -61.315 1.00 41.47 ? 62   ALA B CA  1 
ATOM   4638 C C   . ALA B 1 62  ? -5.640  1.805   -60.320 1.00 41.16 ? 62   ALA B C   1 
ATOM   4639 O O   . ALA B 1 62  ? -5.992  2.714   -59.569 1.00 41.24 ? 62   ALA B O   1 
ATOM   4640 C CB  . ALA B 1 62  ? -3.986  3.449   -61.280 1.00 40.95 ? 62   ALA B CB  1 
ATOM   4641 N N   . THR B 1 63  ? -6.213  0.607   -60.332 1.00 41.14 ? 63   THR B N   1 
ATOM   4642 C CA  . THR B 1 63  ? -7.394  0.316   -59.537 1.00 40.94 ? 63   THR B CA  1 
ATOM   4643 C C   . THR B 1 63  ? -7.072  -0.707  -58.472 1.00 41.07 ? 63   THR B C   1 
ATOM   4644 O O   . THR B 1 63  ? -7.934  -1.072  -57.669 1.00 41.31 ? 63   THR B O   1 
ATOM   4645 C CB  . THR B 1 63  ? -8.558  -0.212  -60.422 1.00 41.47 ? 63   THR B CB  1 
ATOM   4646 O OG1 . THR B 1 63  ? -8.263  -1.541  -60.895 1.00 41.29 ? 63   THR B OG1 1 
ATOM   4647 C CG2 . THR B 1 63  ? -8.815  0.726   -61.610 1.00 40.08 ? 63   THR B CG2 1 
ATOM   4648 N N   . THR B 1 64  ? -5.818  -1.146  -58.454 1.00 40.98 ? 64   THR B N   1 
ATOM   4649 C CA  . THR B 1 64  ? -5.379  -2.245  -57.606 1.00 41.11 ? 64   THR B CA  1 
ATOM   4650 C C   . THR B 1 64  ? -3.996  -1.942  -57.021 1.00 40.34 ? 64   THR B C   1 
ATOM   4651 O O   . THR B 1 64  ? -3.154  -1.331  -57.679 1.00 39.98 ? 64   THR B O   1 
ATOM   4652 C CB  . THR B 1 64  ? -5.361  -3.570  -58.429 1.00 41.68 ? 64   THR B CB  1 
ATOM   4653 O OG1 . THR B 1 64  ? -5.258  -4.692  -57.551 1.00 44.20 ? 64   THR B OG1 1 
ATOM   4654 C CG2 . THR B 1 64  ? -4.186  -3.605  -59.426 1.00 42.66 ? 64   THR B CG2 1 
ATOM   4655 N N   . PHE B 1 65  ? -3.768  -2.342  -55.773 1.00 40.03 ? 65   PHE B N   1 
ATOM   4656 C CA  . PHE B 1 65  ? -2.427  -2.249  -55.177 1.00 39.60 ? 65   PHE B CA  1 
ATOM   4657 C C   . PHE B 1 65  ? -1.433  -3.113  -55.908 1.00 39.37 ? 65   PHE B C   1 
ATOM   4658 O O   . PHE B 1 65  ? -1.704  -4.263  -56.230 1.00 39.50 ? 65   PHE B O   1 
ATOM   4659 C CB  . PHE B 1 65  ? -2.415  -2.670  -53.710 1.00 39.47 ? 65   PHE B CB  1 
ATOM   4660 C CG  . PHE B 1 65  ? -2.998  -1.651  -52.784 1.00 40.27 ? 65   PHE B CG  1 
ATOM   4661 C CD1 . PHE B 1 65  ? -2.514  -0.332  -52.774 1.00 38.47 ? 65   PHE B CD1 1 
ATOM   4662 C CD2 . PHE B 1 65  ? -4.031  -2.004  -51.911 1.00 39.44 ? 65   PHE B CD2 1 
ATOM   4663 C CE1 . PHE B 1 65  ? -3.057  0.608   -51.923 1.00 37.44 ? 65   PHE B CE1 1 
ATOM   4664 C CE2 . PHE B 1 65  ? -4.576  -1.066  -51.049 1.00 38.75 ? 65   PHE B CE2 1 
ATOM   4665 C CZ  . PHE B 1 65  ? -4.089  0.244   -51.054 1.00 38.81 ? 65   PHE B CZ  1 
ATOM   4666 N N   . GLN B 1 66  ? -0.266  -2.545  -56.154 1.00 39.55 ? 66   GLN B N   1 
ATOM   4667 C CA  . GLN B 1 66  ? 0.824   -3.265  -56.775 1.00 39.17 ? 66   GLN B CA  1 
ATOM   4668 C C   . GLN B 1 66  ? 1.589   -4.111  -55.773 1.00 38.71 ? 66   GLN B C   1 
ATOM   4669 O O   . GLN B 1 66  ? 1.258   -4.128  -54.584 1.00 38.09 ? 66   GLN B O   1 
ATOM   4670 C CB  . GLN B 1 66  ? 1.748   -2.286  -57.464 1.00 39.14 ? 66   GLN B CB  1 
ATOM   4671 C CG  . GLN B 1 66  ? 1.427   -2.156  -58.913 1.00 41.27 ? 66   GLN B CG  1 
ATOM   4672 C CD  . GLN B 1 66  ? 1.820   -3.399  -59.689 1.00 44.01 ? 66   GLN B CD  1 
ATOM   4673 O OE1 . GLN B 1 66  ? 2.296   -4.397  -59.114 1.00 44.66 ? 66   GLN B OE1 1 
ATOM   4674 N NE2 . GLN B 1 66  ? 1.637   -3.348  -60.999 1.00 43.44 ? 66   GLN B NE2 1 
ATOM   4675 N N   . ASN B 1 67  ? 2.606   -4.819  -56.260 1.00 38.71 ? 67   ASN B N   1 
ATOM   4676 C CA  . ASN B 1 67  ? 3.385   -5.739  -55.424 1.00 38.58 ? 67   ASN B CA  1 
ATOM   4677 C C   . ASN B 1 67  ? 4.055   -5.066  -54.229 1.00 38.16 ? 67   ASN B C   1 
ATOM   4678 O O   . ASN B 1 67  ? 4.476   -3.915  -54.296 1.00 38.69 ? 67   ASN B O   1 
ATOM   4679 C CB  . ASN B 1 67  ? 4.449   -6.435  -56.267 1.00 39.01 ? 67   ASN B CB  1 
ATOM   4680 C CG  . ASN B 1 67  ? 3.854   -7.324  -57.363 1.00 40.83 ? 67   ASN B CG  1 
ATOM   4681 O OD1 . ASN B 1 67  ? 2.899   -8.081  -57.125 1.00 39.02 ? 67   ASN B OD1 1 
ATOM   4682 N ND2 . ASN B 1 67  ? 4.445   -7.249  -58.573 1.00 41.26 ? 67   ASN B ND2 1 
ATOM   4683 N N   . VAL B 1 68  ? 4.140   -5.799  -53.136 1.00 37.61 ? 68   VAL B N   1 
ATOM   4684 C CA  . VAL B 1 68  ? 4.884   -5.402  -51.967 1.00 37.54 ? 68   VAL B CA  1 
ATOM   4685 C C   . VAL B 1 68  ? 6.374   -5.671  -52.234 1.00 38.30 ? 68   VAL B C   1 
ATOM   4686 O O   . VAL B 1 68  ? 6.722   -6.705  -52.829 1.00 38.06 ? 68   VAL B O   1 
ATOM   4687 C CB  . VAL B 1 68  ? 4.371   -6.205  -50.749 1.00 37.36 ? 68   VAL B CB  1 
ATOM   4688 C CG1 . VAL B 1 68  ? 5.195   -5.960  -49.517 1.00 36.87 ? 68   VAL B CG1 1 
ATOM   4689 C CG2 . VAL B 1 68  ? 2.907   -5.877  -50.473 1.00 37.13 ? 68   VAL B CG2 1 
ATOM   4690 N N   . CYS B 1 69  ? 7.249   -4.754  -51.804 1.00 38.94 ? 69   CYS B N   1 
ATOM   4691 C CA  . CYS B 1 69  ? 8.695   -4.907  -52.017 1.00 39.72 ? 69   CYS B CA  1 
ATOM   4692 C C   . CYS B 1 69  ? 9.225   -6.150  -51.326 1.00 40.51 ? 69   CYS B C   1 
ATOM   4693 O O   . CYS B 1 69  ? 8.680   -6.567  -50.306 1.00 41.00 ? 69   CYS B O   1 
ATOM   4694 C CB  . CYS B 1 69  ? 9.447   -3.686  -51.540 1.00 39.40 ? 69   CYS B CB  1 
ATOM   4695 S SG  . CYS B 1 69  ? 9.226   -2.222  -52.596 1.00 41.03 ? 69   CYS B SG  1 
ATOM   4696 N N   . TYR B 1 70  ? 10.272  -6.754  -51.883 1.00 41.34 ? 70   TYR B N   1 
ATOM   4697 C CA  . TYR B 1 70  ? 10.724  -8.043  -51.376 1.00 42.26 ? 70   TYR B CA  1 
ATOM   4698 C C   . TYR B 1 70  ? 11.266  -7.956  -49.967 1.00 43.04 ? 70   TYR B C   1 
ATOM   4699 O O   . TYR B 1 70  ? 12.175  -7.176  -49.684 1.00 43.14 ? 70   TYR B O   1 
ATOM   4700 C CB  . TYR B 1 70  ? 11.730  -8.743  -52.301 1.00 42.07 ? 70   TYR B CB  1 
ATOM   4701 C CG  . TYR B 1 70  ? 11.577  -10.241 -52.160 1.00 42.11 ? 70   TYR B CG  1 
ATOM   4702 C CD1 . TYR B 1 70  ? 10.674  -10.948 -52.951 1.00 41.99 ? 70   TYR B CD1 1 
ATOM   4703 C CD2 . TYR B 1 70  ? 12.268  -10.939 -51.176 1.00 42.69 ? 70   TYR B CD2 1 
ATOM   4704 C CE1 . TYR B 1 70  ? 10.498  -12.320 -52.787 1.00 42.93 ? 70   TYR B CE1 1 
ATOM   4705 C CE2 . TYR B 1 70  ? 12.090  -12.311 -50.999 1.00 42.69 ? 70   TYR B CE2 1 
ATOM   4706 C CZ  . TYR B 1 70  ? 11.215  -12.996 -51.808 1.00 42.18 ? 70   TYR B CZ  1 
ATOM   4707 O OH  . TYR B 1 70  ? 11.054  -14.347 -51.629 1.00 41.39 ? 70   TYR B OH  1 
ATOM   4708 N N   . GLN B 1 71  ? 10.703  -8.772  -49.085 1.00 44.16 ? 71   GLN B N   1 
ATOM   4709 C CA  . GLN B 1 71  ? 10.998  -8.653  -47.667 1.00 45.13 ? 71   GLN B CA  1 
ATOM   4710 C C   . GLN B 1 71  ? 10.767  -9.922  -46.866 1.00 46.25 ? 71   GLN B C   1 
ATOM   4711 O O   . GLN B 1 71  ? 10.019  -10.808 -47.277 1.00 45.93 ? 71   GLN B O   1 
ATOM   4712 C CB  . GLN B 1 71  ? 10.165  -7.525  -47.050 1.00 44.67 ? 71   GLN B CB  1 
ATOM   4713 C CG  . GLN B 1 71  ? 8.675   -7.823  -46.965 1.00 43.98 ? 71   GLN B CG  1 
ATOM   4714 C CD  . GLN B 1 71  ? 7.850   -6.577  -46.710 1.00 42.66 ? 71   GLN B CD  1 
ATOM   4715 O OE1 . GLN B 1 71  ? 7.129   -6.500  -45.723 1.00 43.00 ? 71   GLN B OE1 1 
ATOM   4716 N NE2 . GLN B 1 71  ? 7.966   -5.591  -47.589 1.00 40.13 ? 71   GLN B NE2 1 
ATOM   4717 N N   . TYR B 1 72  ? 11.420  -9.969  -45.707 1.00 47.70 ? 72   TYR B N   1 
ATOM   4718 C CA  . TYR B 1 72  ? 11.167  -10.957 -44.691 1.00 49.38 ? 72   TYR B CA  1 
ATOM   4719 C C   . TYR B 1 72  ? 9.692   -10.927 -44.361 1.00 50.04 ? 72   TYR B C   1 
ATOM   4720 O O   . TYR B 1 72  ? 9.107   -9.858  -44.208 1.00 50.16 ? 72   TYR B O   1 
ATOM   4721 C CB  . TYR B 1 72  ? 12.008  -10.632 -43.449 1.00 50.44 ? 72   TYR B CB  1 
ATOM   4722 C CG  . TYR B 1 72  ? 11.848  -11.611 -42.308 1.00 51.38 ? 72   TYR B CG  1 
ATOM   4723 C CD1 . TYR B 1 72  ? 11.056  -11.295 -41.198 1.00 52.20 ? 72   TYR B CD1 1 
ATOM   4724 C CD2 . TYR B 1 72  ? 12.477  -12.854 -42.340 1.00 52.20 ? 72   TYR B CD2 1 
ATOM   4725 C CE1 . TYR B 1 72  ? 10.895  -12.195 -40.147 1.00 52.62 ? 72   TYR B CE1 1 
ATOM   4726 C CE2 . TYR B 1 72  ? 12.322  -13.766 -41.291 1.00 53.46 ? 72   TYR B CE2 1 
ATOM   4727 C CZ  . TYR B 1 72  ? 11.534  -13.429 -40.198 1.00 52.91 ? 72   TYR B CZ  1 
ATOM   4728 O OH  . TYR B 1 72  ? 11.381  -14.332 -39.158 1.00 53.40 ? 72   TYR B OH  1 
ATOM   4729 N N   . VAL B 1 73  ? 9.081   -12.103 -44.289 1.00 51.23 ? 73   VAL B N   1 
ATOM   4730 C CA  . VAL B 1 73  ? 7.695   -12.218 -43.835 1.00 52.47 ? 73   VAL B CA  1 
ATOM   4731 C C   . VAL B 1 73  ? 7.774   -12.761 -42.420 1.00 53.50 ? 73   VAL B C   1 
ATOM   4732 O O   . VAL B 1 73  ? 8.617   -13.609 -42.139 1.00 53.31 ? 73   VAL B O   1 
ATOM   4733 C CB  . VAL B 1 73  ? 6.843   -13.144 -44.752 1.00 52.23 ? 73   VAL B CB  1 
ATOM   4734 C CG1 . VAL B 1 73  ? 5.437   -13.315 -44.205 1.00 51.97 ? 73   VAL B CG1 1 
ATOM   4735 C CG2 . VAL B 1 73  ? 6.786   -12.588 -46.163 1.00 51.99 ? 73   VAL B CG2 1 
ATOM   4736 N N   . ASP B 1 74  ? 6.923   -12.252 -41.529 1.00 55.08 ? 74   ASP B N   1 
ATOM   4737 C CA  . ASP B 1 74  ? 7.007   -12.599 -40.110 1.00 56.25 ? 74   ASP B CA  1 
ATOM   4738 C C   . ASP B 1 74  ? 6.303   -13.907 -39.790 1.00 57.14 ? 74   ASP B C   1 
ATOM   4739 O O   . ASP B 1 74  ? 5.184   -14.152 -40.239 1.00 57.22 ? 74   ASP B O   1 
ATOM   4740 C CB  . ASP B 1 74  ? 6.450   -11.476 -39.234 1.00 56.39 ? 74   ASP B CB  1 
ATOM   4741 C CG  . ASP B 1 74  ? 6.666   -11.743 -37.758 1.00 56.97 ? 74   ASP B CG  1 
ATOM   4742 O OD1 . ASP B 1 74  ? 5.687   -12.104 -37.062 1.00 56.68 ? 74   ASP B OD1 1 
ATOM   4743 O OD2 . ASP B 1 74  ? 7.832   -11.648 -37.318 1.00 57.28 ? 74   ASP B OD2 1 
ATOM   4744 N N   . THR B 1 75  ? 6.965   -14.740 -38.993 1.00 58.54 ? 75   THR B N   1 
ATOM   4745 C CA  . THR B 1 75  ? 6.474   -16.090 -38.705 1.00 59.89 ? 75   THR B CA  1 
ATOM   4746 C C   . THR B 1 75  ? 6.469   -16.416 -37.222 1.00 60.56 ? 75   THR B C   1 
ATOM   4747 O O   . THR B 1 75  ? 6.185   -17.551 -36.837 1.00 61.06 ? 75   THR B O   1 
ATOM   4748 C CB  . THR B 1 75  ? 7.301   -17.176 -39.447 1.00 60.09 ? 75   THR B CB  1 
ATOM   4749 O OG1 . THR B 1 75  ? 8.704   -16.909 -39.292 1.00 59.35 ? 75   THR B OG1 1 
ATOM   4750 C CG2 . THR B 1 75  ? 6.929   -17.226 -40.946 1.00 60.50 ? 75   THR B CG2 1 
ATOM   4751 N N   . LEU B 1 76  ? 6.765   -15.424 -36.393 1.00 61.31 ? 76   LEU B N   1 
ATOM   4752 C CA  . LEU B 1 76  ? 6.792   -15.631 -34.953 1.00 62.13 ? 76   LEU B CA  1 
ATOM   4753 C C   . LEU B 1 76  ? 5.468   -16.181 -34.424 1.00 62.43 ? 76   LEU B C   1 
ATOM   4754 O O   . LEU B 1 76  ? 5.472   -17.075 -33.581 1.00 62.99 ? 76   LEU B O   1 
ATOM   4755 C CB  . LEU B 1 76  ? 7.173   -14.341 -34.218 1.00 62.25 ? 76   LEU B CB  1 
ATOM   4756 C CG  . LEU B 1 76  ? 7.638   -14.488 -32.761 1.00 63.10 ? 76   LEU B CG  1 
ATOM   4757 C CD1 . LEU B 1 76  ? 9.049   -15.110 -32.668 1.00 63.54 ? 76   LEU B CD1 1 
ATOM   4758 C CD2 . LEU B 1 76  ? 7.594   -13.139 -32.050 1.00 62.50 ? 76   LEU B CD2 1 
ATOM   4759 N N   . TYR B 1 77  ? 4.344   -15.655 -34.913 1.00 62.69 ? 77   TYR B N   1 
ATOM   4760 C CA  . TYR B 1 77  ? 3.029   -16.128 -34.474 1.00 62.77 ? 77   TYR B CA  1 
ATOM   4761 C C   . TYR B 1 77  ? 2.090   -16.338 -35.656 1.00 62.82 ? 77   TYR B C   1 
ATOM   4762 O O   . TYR B 1 77  ? 1.217   -15.503 -35.907 1.00 62.75 ? 77   TYR B O   1 
ATOM   4763 C CB  . TYR B 1 77  ? 2.397   -15.145 -33.492 1.00 63.03 ? 77   TYR B CB  1 
ATOM   4764 C CG  . TYR B 1 77  ? 3.151   -14.962 -32.198 1.00 63.24 ? 77   TYR B CG  1 
ATOM   4765 C CD1 . TYR B 1 77  ? 3.180   -15.968 -31.238 1.00 64.00 ? 77   TYR B CD1 1 
ATOM   4766 C CD2 . TYR B 1 77  ? 3.808   -13.770 -31.920 1.00 63.07 ? 77   TYR B CD2 1 
ATOM   4767 C CE1 . TYR B 1 77  ? 3.865   -15.799 -30.035 1.00 63.94 ? 77   TYR B CE1 1 
ATOM   4768 C CE2 . TYR B 1 77  ? 4.489   -13.588 -30.722 1.00 63.50 ? 77   TYR B CE2 1 
ATOM   4769 C CZ  . TYR B 1 77  ? 4.517   -14.607 -29.786 1.00 63.63 ? 77   TYR B CZ  1 
ATOM   4770 O OH  . TYR B 1 77  ? 5.191   -14.433 -28.600 1.00 63.23 ? 77   TYR B OH  1 
ATOM   4771 N N   . PRO B 1 78  ? 2.241   -17.471 -36.369 1.00 62.80 ? 78   PRO B N   1 
ATOM   4772 C CA  . PRO B 1 78  ? 1.499   -17.676 -37.620 1.00 62.56 ? 78   PRO B CA  1 
ATOM   4773 C C   . PRO B 1 78  ? -0.016  -17.590 -37.424 1.00 62.04 ? 78   PRO B C   1 
ATOM   4774 O O   . PRO B 1 78  ? -0.543  -18.198 -36.496 1.00 61.74 ? 78   PRO B O   1 
ATOM   4775 C CB  . PRO B 1 78  ? 1.917   -19.090 -38.050 1.00 62.68 ? 78   PRO B CB  1 
ATOM   4776 C CG  . PRO B 1 78  ? 3.238   -19.334 -37.357 1.00 63.00 ? 78   PRO B CG  1 
ATOM   4777 C CD  . PRO B 1 78  ? 3.090   -18.632 -36.035 1.00 63.03 ? 78   PRO B CD  1 
ATOM   4778 N N   . GLY B 1 79  ? -0.685  -16.805 -38.274 1.00 61.77 ? 79   GLY B N   1 
ATOM   4779 C CA  . GLY B 1 79  ? -2.153  -16.684 -38.273 1.00 61.32 ? 79   GLY B CA  1 
ATOM   4780 C C   . GLY B 1 79  ? -2.756  -15.783 -37.203 1.00 60.95 ? 79   GLY B C   1 
ATOM   4781 O O   . GLY B 1 79  ? -3.981  -15.668 -37.091 1.00 60.78 ? 79   GLY B O   1 
ATOM   4782 N N   . PHE B 1 80  ? -1.888  -15.158 -36.409 1.00 60.43 ? 80   PHE B N   1 
ATOM   4783 C CA  . PHE B 1 80  ? -2.285  -14.209 -35.374 1.00 59.80 ? 80   PHE B CA  1 
ATOM   4784 C C   . PHE B 1 80  ? -2.401  -12.811 -35.974 1.00 59.22 ? 80   PHE B C   1 
ATOM   4785 O O   . PHE B 1 80  ? -1.464  -12.321 -36.600 1.00 59.16 ? 80   PHE B O   1 
ATOM   4786 C CB  . PHE B 1 80  ? -1.255  -14.245 -34.242 1.00 59.93 ? 80   PHE B CB  1 
ATOM   4787 C CG  . PHE B 1 80  ? -1.410  -13.148 -33.221 1.00 60.06 ? 80   PHE B CG  1 
ATOM   4788 C CD1 . PHE B 1 80  ? -2.591  -13.011 -32.487 1.00 59.84 ? 80   PHE B CD1 1 
ATOM   4789 C CD2 . PHE B 1 80  ? -0.356  -12.276 -32.964 1.00 59.65 ? 80   PHE B CD2 1 
ATOM   4790 C CE1 . PHE B 1 80  ? -2.725  -12.011 -31.532 1.00 58.83 ? 80   PHE B CE1 1 
ATOM   4791 C CE2 . PHE B 1 80  ? -0.483  -11.278 -32.008 1.00 59.81 ? 80   PHE B CE2 1 
ATOM   4792 C CZ  . PHE B 1 80  ? -1.674  -11.148 -31.292 1.00 59.72 ? 80   PHE B CZ  1 
ATOM   4793 N N   . GLU B 1 81  ? -3.550  -12.175 -35.773 1.00 58.66 ? 81   GLU B N   1 
ATOM   4794 C CA  . GLU B 1 81  ? -3.851  -10.888 -36.415 1.00 58.57 ? 81   GLU B CA  1 
ATOM   4795 C C   . GLU B 1 81  ? -2.857  -9.790  -36.030 1.00 57.41 ? 81   GLU B C   1 
ATOM   4796 O O   . GLU B 1 81  ? -2.506  -8.959  -36.858 1.00 57.37 ? 81   GLU B O   1 
ATOM   4797 C CB  . GLU B 1 81  ? -5.309  -10.463 -36.132 1.00 58.93 ? 81   GLU B CB  1 
ATOM   4798 C CG  . GLU B 1 81  ? -5.815  -9.212  -36.886 1.00 62.34 ? 81   GLU B CG  1 
ATOM   4799 C CD  . GLU B 1 81  ? -5.836  -9.355  -38.431 1.00 67.36 ? 81   GLU B CD  1 
ATOM   4800 O OE1 . GLU B 1 81  ? -5.776  -10.507 -38.946 1.00 68.72 ? 81   GLU B OE1 1 
ATOM   4801 O OE2 . GLU B 1 81  ? -5.915  -8.304  -39.133 1.00 67.75 ? 81   GLU B OE2 1 
ATOM   4802 N N   . GLY B 1 82  ? -2.392  -9.818  -34.785 1.00 56.29 ? 82   GLY B N   1 
ATOM   4803 C CA  . GLY B 1 82  ? -1.468  -8.816  -34.270 1.00 54.77 ? 82   GLY B CA  1 
ATOM   4804 C C   . GLY B 1 82  ? -0.156  -8.712  -35.015 1.00 53.88 ? 82   GLY B C   1 
ATOM   4805 O O   . GLY B 1 82  ? 0.417   -7.625  -35.112 1.00 53.68 ? 82   GLY B O   1 
ATOM   4806 N N   . THR B 1 83  ? 0.333   -9.839  -35.525 1.00 52.87 ? 83   THR B N   1 
ATOM   4807 C CA  . THR B 1 83  ? 1.535   -9.839  -36.354 1.00 52.14 ? 83   THR B CA  1 
ATOM   4808 C C   . THR B 1 83  ? 1.199   -9.778  -37.846 1.00 51.45 ? 83   THR B C   1 
ATOM   4809 O O   . THR B 1 83  ? 1.952   -9.196  -38.627 1.00 51.61 ? 83   THR B O   1 
ATOM   4810 C CB  . THR B 1 83  ? 2.475   -11.058 -36.081 1.00 52.14 ? 83   THR B CB  1 
ATOM   4811 O OG1 . THR B 1 83  ? 1.741   -12.286 -36.194 1.00 52.80 ? 83   THR B OG1 1 
ATOM   4812 C CG2 . THR B 1 83  ? 3.098   -10.972 -34.714 1.00 51.64 ? 83   THR B CG2 1 
ATOM   4813 N N   . GLU B 1 84  ? 0.074   -10.366 -38.239 1.00 50.74 ? 84   GLU B N   1 
ATOM   4814 C CA  . GLU B 1 84  ? -0.228  -10.529 -39.664 1.00 50.58 ? 84   GLU B CA  1 
ATOM   4815 C C   . GLU B 1 84  ? -0.654  -9.231  -40.311 1.00 49.56 ? 84   GLU B C   1 
ATOM   4816 O O   . GLU B 1 84  ? -0.609  -9.098  -41.540 1.00 49.80 ? 84   GLU B O   1 
ATOM   4817 C CB  . GLU B 1 84  ? -1.299  -11.597 -39.903 1.00 51.11 ? 84   GLU B CB  1 
ATOM   4818 C CG  . GLU B 1 84  ? -0.890  -13.030 -39.500 1.00 53.89 ? 84   GLU B CG  1 
ATOM   4819 C CD  . GLU B 1 84  ? 0.047   -13.724 -40.492 1.00 58.10 ? 84   GLU B CD  1 
ATOM   4820 O OE1 . GLU B 1 84  ? 0.318   -13.150 -41.587 1.00 59.82 ? 84   GLU B OE1 1 
ATOM   4821 O OE2 . GLU B 1 84  ? 0.500   -14.858 -40.170 1.00 58.84 ? 84   GLU B OE2 1 
ATOM   4822 N N   . MET B 1 85  ? -1.054  -8.266  -39.488 1.00 48.03 ? 85   MET B N   1 
ATOM   4823 C CA  . MET B 1 85  ? -1.550  -6.995  -40.004 1.00 46.49 ? 85   MET B CA  1 
ATOM   4824 C C   . MET B 1 85  ? -0.401  -6.180  -40.566 1.00 45.47 ? 85   MET B C   1 
ATOM   4825 O O   . MET B 1 85  ? -0.614  -5.227  -41.310 1.00 44.97 ? 85   MET B O   1 
ATOM   4826 C CB  . MET B 1 85  ? -2.291  -6.228  -38.924 1.00 46.20 ? 85   MET B CB  1 
ATOM   4827 C CG  . MET B 1 85  ? -1.461  -5.964  -37.707 1.00 46.21 ? 85   MET B CG  1 
ATOM   4828 S SD  . MET B 1 85  ? -2.376  -5.072  -36.466 1.00 47.27 ? 85   MET B SD  1 
ATOM   4829 C CE  . MET B 1 85  ? -2.632  -3.489  -37.291 1.00 43.66 ? 85   MET B CE  1 
ATOM   4830 N N   . TRP B 1 86  ? 0.814   -6.590  -40.212 1.00 44.29 ? 86   TRP B N   1 
ATOM   4831 C CA  . TRP B 1 86  ? 2.029   -5.956  -40.703 1.00 43.62 ? 86   TRP B CA  1 
ATOM   4832 C C   . TRP B 1 86  ? 2.678   -6.755  -41.827 1.00 43.39 ? 86   TRP B C   1 
ATOM   4833 O O   . TRP B 1 86  ? 3.604   -6.268  -42.468 1.00 42.95 ? 86   TRP B O   1 
ATOM   4834 C CB  . TRP B 1 86  ? 3.022   -5.747  -39.559 1.00 42.95 ? 86   TRP B CB  1 
ATOM   4835 C CG  . TRP B 1 86  ? 2.403   -5.079  -38.377 1.00 42.71 ? 86   TRP B CG  1 
ATOM   4836 C CD1 . TRP B 1 86  ? 2.111   -5.651  -37.175 1.00 42.12 ? 86   TRP B CD1 1 
ATOM   4837 C CD2 . TRP B 1 86  ? 1.974   -3.712  -38.287 1.00 41.96 ? 86   TRP B CD2 1 
ATOM   4838 N NE1 . TRP B 1 86  ? 1.540   -4.726  -36.337 1.00 42.22 ? 86   TRP B NE1 1 
ATOM   4839 C CE2 . TRP B 1 86  ? 1.448   -3.526  -36.990 1.00 42.13 ? 86   TRP B CE2 1 
ATOM   4840 C CE3 . TRP B 1 86  ? 1.996   -2.624  -39.169 1.00 41.54 ? 86   TRP B CE3 1 
ATOM   4841 C CZ2 . TRP B 1 86  ? 0.946   -2.290  -36.551 1.00 42.43 ? 86   TRP B CZ2 1 
ATOM   4842 C CZ3 . TRP B 1 86  ? 1.491   -1.395  -38.732 1.00 41.91 ? 86   TRP B CZ3 1 
ATOM   4843 C CH2 . TRP B 1 86  ? 0.979   -1.241  -37.433 1.00 41.84 ? 86   TRP B CH2 1 
ATOM   4844 N N   . ASN B 1 87  ? 2.181   -7.975  -42.050 1.00 43.41 ? 87   ASN B N   1 
ATOM   4845 C CA  . ASN B 1 87  ? 2.697   -8.870  -43.087 1.00 43.11 ? 87   ASN B CA  1 
ATOM   4846 C C   . ASN B 1 87  ? 2.254   -8.481  -44.489 1.00 42.86 ? 87   ASN B C   1 
ATOM   4847 O O   . ASN B 1 87  ? 1.197   -7.874  -44.657 1.00 42.84 ? 87   ASN B O   1 
ATOM   4848 C CB  . ASN B 1 87  ? 2.329   -10.322 -42.779 1.00 43.01 ? 87   ASN B CB  1 
ATOM   4849 C CG  . ASN B 1 87  ? 3.416   -11.042 -41.991 1.00 44.11 ? 87   ASN B CG  1 
ATOM   4850 O OD1 . ASN B 1 87  ? 4.572   -10.594 -41.930 1.00 42.76 ? 87   ASN B OD1 1 
ATOM   4851 N ND2 . ASN B 1 87  ? 3.053   -12.172 -41.386 1.00 45.73 ? 87   ASN B ND2 1 
ATOM   4852 N N   . PRO B 1 88  ? 3.073   -8.811  -45.505 1.00 42.85 ? 88   PRO B N   1 
ATOM   4853 C CA  . PRO B 1 88  ? 2.712   -8.416  -46.865 1.00 43.06 ? 88   PRO B CA  1 
ATOM   4854 C C   . PRO B 1 88  ? 1.329   -8.921  -47.246 1.00 43.25 ? 88   PRO B C   1 
ATOM   4855 O O   . PRO B 1 88  ? 1.001   -10.079 -46.982 1.00 43.81 ? 88   PRO B O   1 
ATOM   4856 C CB  . PRO B 1 88  ? 3.802   -9.067  -47.732 1.00 42.64 ? 88   PRO B CB  1 
ATOM   4857 C CG  . PRO B 1 88  ? 4.943   -9.277  -46.823 1.00 42.46 ? 88   PRO B CG  1 
ATOM   4858 C CD  . PRO B 1 88  ? 4.361   -9.534  -45.465 1.00 42.97 ? 88   PRO B CD  1 
ATOM   4859 N N   . ASN B 1 89  ? 0.522   -8.046  -47.835 1.00 43.36 ? 89   ASN B N   1 
ATOM   4860 C CA  . ASN B 1 89  ? -0.839  -8.399  -48.236 1.00 43.51 ? 89   ASN B CA  1 
ATOM   4861 C C   . ASN B 1 89  ? -1.033  -8.398  -49.752 1.00 43.80 ? 89   ASN B C   1 
ATOM   4862 O O   . ASN B 1 89  ? -2.157  -8.432  -50.236 1.00 44.30 ? 89   ASN B O   1 
ATOM   4863 C CB  . ASN B 1 89  ? -1.876  -7.508  -47.534 1.00 42.93 ? 89   ASN B CB  1 
ATOM   4864 C CG  . ASN B 1 89  ? -1.868  -6.071  -48.029 1.00 42.62 ? 89   ASN B CG  1 
ATOM   4865 O OD1 . ASN B 1 89  ? -2.834  -5.347  -47.803 1.00 45.73 ? 89   ASN B OD1 1 
ATOM   4866 N ND2 . ASN B 1 89  ? -0.802  -5.650  -48.701 1.00 37.77 ? 89   ASN B ND2 1 
ATOM   4867 N N   . ARG B 1 90  ? 0.079   -8.326  -50.478 1.00 44.02 ? 90   ARG B N   1 
ATOM   4868 C CA  . ARG B 1 90  ? 0.127   -8.535  -51.920 1.00 44.11 ? 90   ARG B CA  1 
ATOM   4869 C C   . ARG B 1 90  ? 1.387   -9.356  -52.212 1.00 44.00 ? 90   ARG B C   1 
ATOM   4870 O O   . ARG B 1 90  ? 2.228   -9.538  -51.329 1.00 43.83 ? 90   ARG B O   1 
ATOM   4871 C CB  . ARG B 1 90  ? 0.159   -7.202  -52.683 1.00 44.05 ? 90   ARG B CB  1 
ATOM   4872 C CG  . ARG B 1 90  ? -1.133  -6.375  -52.624 1.00 44.45 ? 90   ARG B CG  1 
ATOM   4873 C CD  . ARG B 1 90  ? -2.332  -7.157  -53.152 1.00 45.58 ? 90   ARG B CD  1 
ATOM   4874 N NE  . ARG B 1 90  ? -3.549  -6.354  -53.123 1.00 45.68 ? 90   ARG B NE  1 
ATOM   4875 C CZ  . ARG B 1 90  ? -4.335  -6.207  -52.056 1.00 45.92 ? 90   ARG B CZ  1 
ATOM   4876 N NH1 . ARG B 1 90  ? -4.050  -6.821  -50.911 1.00 44.27 ? 90   ARG B NH1 1 
ATOM   4877 N NH2 . ARG B 1 90  ? -5.418  -5.437  -52.130 1.00 45.26 ? 90   ARG B NH2 1 
ATOM   4878 N N   . GLU B 1 91  ? 1.503   -9.857  -53.441 1.00 43.99 ? 91   GLU B N   1 
ATOM   4879 C CA  . GLU B 1 91  ? 2.652   -10.664 -53.852 1.00 44.09 ? 91   GLU B CA  1 
ATOM   4880 C C   . GLU B 1 91  ? 3.970   -9.917  -53.621 1.00 42.85 ? 91   GLU B C   1 
ATOM   4881 O O   . GLU B 1 91  ? 4.067   -8.710  -53.866 1.00 42.47 ? 91   GLU B O   1 
ATOM   4882 C CB  . GLU B 1 91  ? 2.526   -11.087 -55.333 1.00 44.89 ? 91   GLU B CB  1 
ATOM   4883 C CG  . GLU B 1 91  ? 1.506   -12.220 -55.626 1.00 48.58 ? 91   GLU B CG  1 
ATOM   4884 C CD  . GLU B 1 91  ? 1.718   -13.461 -54.737 1.00 53.55 ? 91   GLU B CD  1 
ATOM   4885 O OE1 . GLU B 1 91  ? 2.748   -14.164 -54.902 1.00 54.00 ? 91   GLU B OE1 1 
ATOM   4886 O OE2 . GLU B 1 91  ? 0.851   -13.722 -53.864 1.00 55.25 ? 91   GLU B OE2 1 
ATOM   4887 N N   . LEU B 1 92  ? 4.975   -10.637 -53.138 1.00 41.54 ? 92   LEU B N   1 
ATOM   4888 C CA  . LEU B 1 92  ? 6.309   -10.076 -53.017 1.00 39.97 ? 92   LEU B CA  1 
ATOM   4889 C C   . LEU B 1 92  ? 6.936   -10.028 -54.395 1.00 39.75 ? 92   LEU B C   1 
ATOM   4890 O O   . LEU B 1 92  ? 6.665   -10.886 -55.226 1.00 39.84 ? 92   LEU B O   1 
ATOM   4891 C CB  . LEU B 1 92  ? 7.169   -10.932 -52.108 1.00 39.99 ? 92   LEU B CB  1 
ATOM   4892 C CG  . LEU B 1 92  ? 6.830   -11.145 -50.629 1.00 39.59 ? 92   LEU B CG  1 
ATOM   4893 C CD1 . LEU B 1 92  ? 7.906   -12.026 -50.005 1.00 39.11 ? 92   LEU B CD1 1 
ATOM   4894 C CD2 . LEU B 1 92  ? 6.768   -9.839  -49.921 1.00 38.14 ? 92   LEU B CD2 1 
ATOM   4895 N N   . SER B 1 93  ? 7.781   -9.032  -54.631 1.00 38.91 ? 93   SER B N   1 
ATOM   4896 C CA  . SER B 1 93  ? 8.441   -8.842  -55.909 1.00 38.03 ? 93   SER B CA  1 
ATOM   4897 C C   . SER B 1 93  ? 9.434   -7.701  -55.758 1.00 37.72 ? 93   SER B C   1 
ATOM   4898 O O   . SER B 1 93  ? 9.169   -6.736  -55.035 1.00 37.68 ? 93   SER B O   1 
ATOM   4899 C CB  . SER B 1 93  ? 7.419   -8.489  -57.001 1.00 38.22 ? 93   SER B CB  1 
ATOM   4900 O OG  . SER B 1 93  ? 8.043   -7.855  -58.120 1.00 38.32 ? 93   SER B OG  1 
ATOM   4901 N N   . GLU B 1 94  ? 10.572  -7.801  -56.431 1.00 37.12 ? 94   GLU B N   1 
ATOM   4902 C CA  . GLU B 1 94  ? 11.499  -6.682  -56.472 1.00 37.07 ? 94   GLU B CA  1 
ATOM   4903 C C   . GLU B 1 94  ? 10.934  -5.544  -57.321 1.00 36.57 ? 94   GLU B C   1 
ATOM   4904 O O   . GLU B 1 94  ? 11.350  -4.400  -57.198 1.00 36.49 ? 94   GLU B O   1 
ATOM   4905 C CB  . GLU B 1 94  ? 12.860  -7.121  -56.991 1.00 37.10 ? 94   GLU B CB  1 
ATOM   4906 C CG  . GLU B 1 94  ? 13.686  -7.896  -55.984 1.00 39.13 ? 94   GLU B CG  1 
ATOM   4907 C CD  . GLU B 1 94  ? 15.033  -8.296  -56.557 1.00 43.08 ? 94   GLU B CD  1 
ATOM   4908 O OE1 . GLU B 1 94  ? 15.972  -7.465  -56.520 1.00 44.26 ? 94   GLU B OE1 1 
ATOM   4909 O OE2 . GLU B 1 94  ? 15.150  -9.436  -57.066 1.00 44.57 ? 94   GLU B OE2 1 
ATOM   4910 N N   . ASP B 1 95  ? 9.983   -5.876  -58.185 1.00 36.36 ? 95   ASP B N   1 
ATOM   4911 C CA  . ASP B 1 95  ? 9.302   -4.888  -58.999 1.00 35.99 ? 95   ASP B CA  1 
ATOM   4912 C C   . ASP B 1 95  ? 8.143   -4.384  -58.151 1.00 35.62 ? 95   ASP B C   1 
ATOM   4913 O O   . ASP B 1 95  ? 7.062   -4.972  -58.144 1.00 35.57 ? 95   ASP B O   1 
ATOM   4914 C CB  . ASP B 1 95  ? 8.829   -5.540  -60.302 1.00 35.83 ? 95   ASP B CB  1 
ATOM   4915 C CG  . ASP B 1 95  ? 7.971   -4.633  -61.143 1.00 36.06 ? 95   ASP B CG  1 
ATOM   4916 O OD1 . ASP B 1 95  ? 7.590   -3.535  -60.678 1.00 37.61 ? 95   ASP B OD1 1 
ATOM   4917 O OD2 . ASP B 1 95  ? 7.658   -5.031  -62.281 1.00 35.38 ? 95   ASP B OD2 1 
ATOM   4918 N N   . CYS B 1 96  ? 8.395   -3.297  -57.420 1.00 35.24 ? 96   CYS B N   1 
ATOM   4919 C CA  . CYS B 1 96  ? 7.501   -2.841  -56.359 1.00 34.59 ? 96   CYS B CA  1 
ATOM   4920 C C   . CYS B 1 96  ? 7.455   -1.326  -56.201 1.00 33.94 ? 96   CYS B C   1 
ATOM   4921 O O   . CYS B 1 96  ? 6.804   -0.813  -55.287 1.00 34.15 ? 96   CYS B O   1 
ATOM   4922 C CB  . CYS B 1 96  ? 7.922   -3.468  -55.033 1.00 34.97 ? 96   CYS B CB  1 
ATOM   4923 S SG  . CYS B 1 96  ? 9.539   -2.938  -54.478 1.00 36.17 ? 96   CYS B SG  1 
ATOM   4924 N N   . LEU B 1 97  ? 8.137   -0.605  -57.083 1.00 32.85 ? 97   LEU B N   1 
ATOM   4925 C CA  . LEU B 1 97  ? 8.208   0.838   -56.948 1.00 31.80 ? 97   LEU B CA  1 
ATOM   4926 C C   . LEU B 1 97  ? 6.935   1.543   -57.436 1.00 32.00 ? 97   LEU B C   1 
ATOM   4927 O O   . LEU B 1 97  ? 6.865   2.117   -58.524 1.00 31.42 ? 97   LEU B O   1 
ATOM   4928 C CB  . LEU B 1 97  ? 9.515   1.389   -57.531 1.00 30.61 ? 97   LEU B CB  1 
ATOM   4929 C CG  . LEU B 1 97  ? 10.689  0.991   -56.601 1.00 30.50 ? 97   LEU B CG  1 
ATOM   4930 C CD1 . LEU B 1 97  ? 12.014  1.605   -57.020 1.00 27.58 ? 97   LEU B CD1 1 
ATOM   4931 C CD2 . LEU B 1 97  ? 10.400  1.264   -55.101 1.00 26.04 ? 97   LEU B CD2 1 
ATOM   4932 N N   . TYR B 1 98  ? 5.920   1.494   -56.585 1.00 32.72 ? 98   TYR B N   1 
ATOM   4933 C CA  . TYR B 1 98  ? 4.619   2.022   -56.933 1.00 33.57 ? 98   TYR B CA  1 
ATOM   4934 C C   . TYR B 1 98  ? 4.083   2.896   -55.818 1.00 34.03 ? 98   TYR B C   1 
ATOM   4935 O O   . TYR B 1 98  ? 4.390   2.693   -54.637 1.00 33.80 ? 98   TYR B O   1 
ATOM   4936 C CB  . TYR B 1 98  ? 3.642   0.883   -57.226 1.00 33.84 ? 98   TYR B CB  1 
ATOM   4937 C CG  . TYR B 1 98  ? 4.080   0.004   -58.370 1.00 35.25 ? 98   TYR B CG  1 
ATOM   4938 C CD1 . TYR B 1 98  ? 3.786   0.348   -59.691 1.00 36.13 ? 98   TYR B CD1 1 
ATOM   4939 C CD2 . TYR B 1 98  ? 4.823   -1.169  -58.139 1.00 35.70 ? 98   TYR B CD2 1 
ATOM   4940 C CE1 . TYR B 1 98  ? 4.195   -0.457  -60.743 1.00 36.10 ? 98   TYR B CE1 1 
ATOM   4941 C CE2 . TYR B 1 98  ? 5.239   -1.974  -59.181 1.00 34.64 ? 98   TYR B CE2 1 
ATOM   4942 C CZ  . TYR B 1 98  ? 4.923   -1.611  -60.477 1.00 35.44 ? 98   TYR B CZ  1 
ATOM   4943 O OH  . TYR B 1 98  ? 5.332   -2.390  -61.517 1.00 35.76 ? 98   TYR B OH  1 
ATOM   4944 N N   . LEU B 1 99  ? 3.266   3.868   -56.199 1.00 34.16 ? 99   LEU B N   1 
ATOM   4945 C CA  . LEU B 1 99  ? 2.602   4.689   -55.206 1.00 34.34 ? 99   LEU B CA  1 
ATOM   4946 C C   . LEU B 1 99  ? 1.075   4.708   -55.395 1.00 34.71 ? 99   LEU B C   1 
ATOM   4947 O O   . LEU B 1 99  ? 0.567   4.436   -56.479 1.00 34.50 ? 99   LEU B O   1 
ATOM   4948 C CB  . LEU B 1 99  ? 3.211   6.106   -55.159 1.00 33.62 ? 99   LEU B CB  1 
ATOM   4949 C CG  . LEU B 1 99  ? 3.262   6.904   -56.458 1.00 33.75 ? 99   LEU B CG  1 
ATOM   4950 C CD1 . LEU B 1 99  ? 1.879   7.474   -56.773 1.00 33.68 ? 99   LEU B CD1 1 
ATOM   4951 C CD2 . LEU B 1 99  ? 4.300   8.018   -56.383 1.00 33.24 ? 99   LEU B CD2 1 
ATOM   4952 N N   . ASN B 1 100 ? 0.375   5.034   -54.314 1.00 35.39 ? 100  ASN B N   1 
ATOM   4953 C CA  . ASN B 1 100 ? -1.068  5.173   -54.303 1.00 36.26 ? 100  ASN B CA  1 
ATOM   4954 C C   . ASN B 1 100 ? -1.497  6.589   -53.937 1.00 36.62 ? 100  ASN B C   1 
ATOM   4955 O O   . ASN B 1 100 ? -0.846  7.266   -53.150 1.00 36.61 ? 100  ASN B O   1 
ATOM   4956 C CB  . ASN B 1 100 ? -1.654  4.181   -53.318 1.00 36.11 ? 100  ASN B CB  1 
ATOM   4957 C CG  . ASN B 1 100 ? -0.899  2.888   -53.309 1.00 36.23 ? 100  ASN B CG  1 
ATOM   4958 O OD1 . ASN B 1 100 ? -0.303  2.504   -52.305 1.00 36.42 ? 100  ASN B OD1 1 
ATOM   4959 N ND2 . ASN B 1 100 ? -0.882  2.217   -54.448 1.00 37.70 ? 100  ASN B ND2 1 
ATOM   4960 N N   . VAL B 1 101 ? -2.603  7.020   -54.531 1.00 37.39 ? 101  VAL B N   1 
ATOM   4961 C CA  . VAL B 1 101 ? -3.192  8.330   -54.297 1.00 37.31 ? 101  VAL B CA  1 
ATOM   4962 C C   . VAL B 1 101 ? -4.667  8.133   -54.012 1.00 38.38 ? 101  VAL B C   1 
ATOM   4963 O O   . VAL B 1 101 ? -5.359  7.417   -54.734 1.00 38.52 ? 101  VAL B O   1 
ATOM   4964 C CB  . VAL B 1 101 ? -3.039  9.228   -55.523 1.00 37.02 ? 101  VAL B CB  1 
ATOM   4965 C CG1 . VAL B 1 101 ? -3.772  10.547  -55.326 1.00 37.12 ? 101  VAL B CG1 1 
ATOM   4966 C CG2 . VAL B 1 101 ? -1.553  9.487   -55.817 1.00 36.78 ? 101  VAL B CG2 1 
ATOM   4967 N N   . TRP B 1 102 ? -5.136  8.737   -52.928 1.00 39.70 ? 102  TRP B N   1 
ATOM   4968 C CA  . TRP B 1 102 ? -6.556  8.875   -52.673 1.00 40.61 ? 102  TRP B CA  1 
ATOM   4969 C C   . TRP B 1 102 ? -6.886  10.345  -52.722 1.00 42.09 ? 102  TRP B C   1 
ATOM   4970 O O   . TRP B 1 102 ? -6.150  11.167  -52.177 1.00 41.49 ? 102  TRP B O   1 
ATOM   4971 C CB  . TRP B 1 102 ? -6.900  8.370   -51.294 1.00 40.05 ? 102  TRP B CB  1 
ATOM   4972 C CG  . TRP B 1 102 ? -6.816  6.901   -51.098 1.00 39.58 ? 102  TRP B CG  1 
ATOM   4973 C CD1 . TRP B 1 102 ? -7.848  6.013   -51.162 1.00 39.69 ? 102  TRP B CD1 1 
ATOM   4974 C CD2 . TRP B 1 102 ? -5.659  6.146   -50.732 1.00 39.22 ? 102  TRP B CD2 1 
ATOM   4975 N NE1 . TRP B 1 102 ? -7.406  4.742   -50.865 1.00 40.73 ? 102  TRP B NE1 1 
ATOM   4976 C CE2 . TRP B 1 102 ? -6.063  4.794   -50.604 1.00 39.31 ? 102  TRP B CE2 1 
ATOM   4977 C CE3 . TRP B 1 102 ? -4.317  6.476   -50.500 1.00 39.31 ? 102  TRP B CE3 1 
ATOM   4978 C CZ2 . TRP B 1 102 ? -5.176  3.776   -50.261 1.00 38.50 ? 102  TRP B CZ2 1 
ATOM   4979 C CZ3 . TRP B 1 102 ? -3.428  5.453   -50.157 1.00 38.80 ? 102  TRP B CZ3 1 
ATOM   4980 C CH2 . TRP B 1 102 ? -3.866  4.123   -50.045 1.00 39.18 ? 102  TRP B CH2 1 
ATOM   4981 N N   . THR B 1 103 ? -7.990  10.677  -53.383 1.00 44.34 ? 103  THR B N   1 
ATOM   4982 C CA  . THR B 1 103 ? -8.519  12.038  -53.366 1.00 46.76 ? 103  THR B CA  1 
ATOM   4983 C C   . THR B 1 103 ? -9.989  11.951  -53.016 1.00 48.36 ? 103  THR B C   1 
ATOM   4984 O O   . THR B 1 103 ? -10.565 10.875  -53.102 1.00 48.67 ? 103  THR B O   1 
ATOM   4985 C CB  . THR B 1 103 ? -8.412  12.727  -54.722 1.00 46.54 ? 103  THR B CB  1 
ATOM   4986 O OG1 . THR B 1 103 ? -9.188  11.995  -55.676 1.00 47.96 ? 103  THR B OG1 1 
ATOM   4987 C CG2 . THR B 1 103 ? -6.984  12.790  -55.178 1.00 47.15 ? 103  THR B CG2 1 
ATOM   4988 N N   . PRO B 1 104 ? -10.600 13.078  -52.599 1.00 50.33 ? 104  PRO B N   1 
ATOM   4989 C CA  . PRO B 1 104 ? -12.063 13.165  -52.497 1.00 51.83 ? 104  PRO B CA  1 
ATOM   4990 C C   . PRO B 1 104 ? -12.761 12.866  -53.831 1.00 53.57 ? 104  PRO B C   1 
ATOM   4991 O O   . PRO B 1 104 ? -12.183 13.093  -54.902 1.00 53.42 ? 104  PRO B O   1 
ATOM   4992 C CB  . PRO B 1 104 ? -12.298 14.623  -52.117 1.00 51.71 ? 104  PRO B CB  1 
ATOM   4993 C CG  . PRO B 1 104 ? -11.031 15.044  -51.463 1.00 51.30 ? 104  PRO B CG  1 
ATOM   4994 C CD  . PRO B 1 104 ? -9.946  14.328  -52.173 1.00 50.08 ? 104  PRO B CD  1 
ATOM   4995 N N   . TYR B 1 105 ? -13.980 12.332  -53.749 1.00 55.71 ? 105  TYR B N   1 
ATOM   4996 C CA  . TYR B 1 105 ? -14.831 12.111  -54.920 1.00 57.65 ? 105  TYR B CA  1 
ATOM   4997 C C   . TYR B 1 105 ? -16.119 12.946  -54.808 1.00 58.52 ? 105  TYR B C   1 
ATOM   4998 O O   . TYR B 1 105 ? -16.967 12.678  -53.932 1.00 58.57 ? 105  TYR B O   1 
ATOM   4999 C CB  . TYR B 1 105 ? -15.181 10.625  -55.066 1.00 58.40 ? 105  TYR B CB  1 
ATOM   5000 C CG  . TYR B 1 105 ? -15.935 10.294  -56.334 1.00 59.53 ? 105  TYR B CG  1 
ATOM   5001 C CD1 . TYR B 1 105 ? -15.373 9.469   -57.307 1.00 60.36 ? 105  TYR B CD1 1 
ATOM   5002 C CD2 . TYR B 1 105 ? -17.201 10.820  -56.571 1.00 60.17 ? 105  TYR B CD2 1 
ATOM   5003 C CE1 . TYR B 1 105 ? -16.058 9.174   -58.478 1.00 60.82 ? 105  TYR B CE1 1 
ATOM   5004 C CE2 . TYR B 1 105 ? -17.892 10.541  -57.733 1.00 61.12 ? 105  TYR B CE2 1 
ATOM   5005 C CZ  . TYR B 1 105 ? -17.322 9.714   -58.682 1.00 61.11 ? 105  TYR B CZ  1 
ATOM   5006 O OH  . TYR B 1 105 ? -18.022 9.443   -59.837 1.00 61.11 ? 105  TYR B OH  1 
ATOM   5007 N N   . PRO B 1 106 ? -16.296 13.936  -55.707 1.00 59.26 ? 106  PRO B N   1 
ATOM   5008 C CA  . PRO B 1 106 ? -15.429 14.310  -56.828 1.00 59.91 ? 106  PRO B CA  1 
ATOM   5009 C C   . PRO B 1 106 ? -14.080 14.888  -56.405 1.00 60.47 ? 106  PRO B C   1 
ATOM   5010 O O   . PRO B 1 106 ? -13.973 15.509  -55.341 1.00 60.43 ? 106  PRO B O   1 
ATOM   5011 C CB  . PRO B 1 106 ? -16.246 15.388  -57.563 1.00 59.93 ? 106  PRO B CB  1 
ATOM   5012 C CG  . PRO B 1 106 ? -17.142 15.960  -56.525 1.00 59.96 ? 106  PRO B CG  1 
ATOM   5013 C CD  . PRO B 1 106 ? -17.499 14.789  -55.645 1.00 59.52 ? 106  PRO B CD  1 
ATOM   5014 N N   . ARG B 1 107 ? -13.065 14.686  -57.245 1.00 61.05 ? 107  ARG B N   1 
ATOM   5015 C CA  . ARG B 1 107 ? -11.729 15.218  -56.984 1.00 61.78 ? 107  ARG B CA  1 
ATOM   5016 C C   . ARG B 1 107 ? -11.840 16.718  -56.720 1.00 61.57 ? 107  ARG B C   1 
ATOM   5017 O O   . ARG B 1 107 ? -12.641 17.385  -57.361 1.00 61.94 ? 107  ARG B O   1 
ATOM   5018 C CB  . ARG B 1 107 ? -10.743 14.881  -58.121 1.00 61.78 ? 107  ARG B CB  1 
ATOM   5019 C CG  . ARG B 1 107 ? -10.521 15.968  -59.171 1.00 62.05 ? 107  ARG B CG  1 
ATOM   5020 C CD  . ARG B 1 107 ? -9.372  15.583  -60.111 1.00 62.55 ? 107  ARG B CD  1 
ATOM   5021 N NE  . ARG B 1 107 ? -9.624  14.306  -60.790 1.00 63.24 ? 107  ARG B NE  1 
ATOM   5022 C CZ  . ARG B 1 107 ? -9.339  14.061  -62.070 1.00 63.66 ? 107  ARG B CZ  1 
ATOM   5023 N NH1 . ARG B 1 107 ? -9.621  12.873  -62.594 1.00 63.01 ? 107  ARG B NH1 1 
ATOM   5024 N NH2 . ARG B 1 107 ? -8.790  15.004  -62.839 1.00 63.19 ? 107  ARG B NH2 1 
ATOM   5025 N N   . PRO B 1 108 ? -11.058 17.235  -55.754 1.00 61.40 ? 108  PRO B N   1 
ATOM   5026 C CA  . PRO B 1 108 ? -11.208 18.589  -55.229 1.00 61.16 ? 108  PRO B CA  1 
ATOM   5027 C C   . PRO B 1 108 ? -11.251 19.668  -56.300 1.00 60.87 ? 108  PRO B C   1 
ATOM   5028 O O   . PRO B 1 108 ? -10.654 19.516  -57.368 1.00 60.66 ? 108  PRO B O   1 
ATOM   5029 C CB  . PRO B 1 108 ? -9.949  18.771  -54.384 1.00 61.30 ? 108  PRO B CB  1 
ATOM   5030 C CG  . PRO B 1 108 ? -9.601  17.413  -53.947 1.00 61.37 ? 108  PRO B CG  1 
ATOM   5031 C CD  . PRO B 1 108 ? -9.948  16.522  -55.096 1.00 61.50 ? 108  PRO B CD  1 
ATOM   5032 N N   . ALA B 1 109 ? -11.949 20.757  -55.980 1.00 60.45 ? 109  ALA B N   1 
ATOM   5033 C CA  . ALA B 1 109 ? -12.086 21.908  -56.874 1.00 59.51 ? 109  ALA B CA  1 
ATOM   5034 C C   . ALA B 1 109 ? -10.870 22.848  -56.780 1.00 58.58 ? 109  ALA B C   1 
ATOM   5035 O O   . ALA B 1 109 ? -10.400 23.381  -57.797 1.00 58.64 ? 109  ALA B O   1 
ATOM   5036 C CB  . ALA B 1 109 ? -13.394 22.659  -56.563 1.00 59.70 ? 109  ALA B CB  1 
ATOM   5037 N N   . SER B 1 110 ? -10.369 23.051  -55.562 1.00 56.93 ? 110  SER B N   1 
ATOM   5038 C CA  . SER B 1 110 ? -9.159  23.848  -55.350 1.00 55.53 ? 110  SER B CA  1 
ATOM   5039 C C   . SER B 1 110 ? -7.971  22.956  -54.943 1.00 54.30 ? 110  SER B C   1 
ATOM   5040 O O   . SER B 1 110 ? -8.181  21.841  -54.446 1.00 54.25 ? 110  SER B O   1 
ATOM   5041 C CB  . SER B 1 110 ? -9.417  24.937  -54.300 1.00 55.75 ? 110  SER B CB  1 
ATOM   5042 O OG  . SER B 1 110 ? -10.167 24.420  -53.212 1.00 55.32 ? 110  SER B OG  1 
ATOM   5043 N N   . PRO B 1 111 ? -6.724  23.434  -55.173 1.00 52.87 ? 111  PRO B N   1 
ATOM   5044 C CA  . PRO B 1 111 ? -5.491  22.794  -54.676 1.00 51.64 ? 111  PRO B CA  1 
ATOM   5045 C C   . PRO B 1 111 ? -5.568  22.394  -53.199 1.00 50.28 ? 111  PRO B C   1 
ATOM   5046 O O   . PRO B 1 111 ? -5.704  23.249  -52.326 1.00 50.16 ? 111  PRO B O   1 
ATOM   5047 C CB  . PRO B 1 111 ? -4.433  23.884  -54.873 1.00 51.75 ? 111  PRO B CB  1 
ATOM   5048 C CG  . PRO B 1 111 ? -4.898  24.627  -56.076 1.00 52.27 ? 111  PRO B CG  1 
ATOM   5049 C CD  . PRO B 1 111 ? -6.421  24.637  -55.972 1.00 52.96 ? 111  PRO B CD  1 
ATOM   5050 N N   . THR B 1 112 ? -5.464  21.094  -52.942 1.00 48.87 ? 112  THR B N   1 
ATOM   5051 C CA  . THR B 1 112 ? -5.693  20.516  -51.623 1.00 47.53 ? 112  THR B CA  1 
ATOM   5052 C C   . THR B 1 112 ? -4.395  20.059  -50.972 1.00 46.34 ? 112  THR B C   1 
ATOM   5053 O O   . THR B 1 112 ? -3.577  19.426  -51.627 1.00 46.40 ? 112  THR B O   1 
ATOM   5054 C CB  . THR B 1 112 ? -6.594  19.306  -51.765 1.00 47.70 ? 112  THR B CB  1 
ATOM   5055 O OG1 . THR B 1 112 ? -7.707  19.671  -52.588 1.00 49.62 ? 112  THR B OG1 1 
ATOM   5056 C CG2 . THR B 1 112 ? -7.087  18.811  -50.409 1.00 47.40 ? 112  THR B CG2 1 
ATOM   5057 N N   . PRO B 1 113 ? -4.194  20.382  -49.680 1.00 44.86 ? 113  PRO B N   1 
ATOM   5058 C CA  . PRO B 1 113 ? -3.000  19.907  -49.006 1.00 43.41 ? 113  PRO B CA  1 
ATOM   5059 C C   . PRO B 1 113 ? -2.807  18.407  -49.181 1.00 41.81 ? 113  PRO B C   1 
ATOM   5060 O O   . PRO B 1 113 ? -3.775  17.652  -49.150 1.00 41.87 ? 113  PRO B O   1 
ATOM   5061 C CB  . PRO B 1 113 ? -3.264  20.266  -47.541 1.00 43.42 ? 113  PRO B CB  1 
ATOM   5062 C CG  . PRO B 1 113 ? -4.088  21.482  -47.629 1.00 44.40 ? 113  PRO B CG  1 
ATOM   5063 C CD  . PRO B 1 113 ? -5.013  21.227  -48.791 1.00 44.86 ? 113  PRO B CD  1 
ATOM   5064 N N   . VAL B 1 114 ? -1.555  18.003  -49.366 1.00 39.76 ? 114  VAL B N   1 
ATOM   5065 C CA  . VAL B 1 114 ? -1.191  16.622  -49.634 1.00 38.06 ? 114  VAL B CA  1 
ATOM   5066 C C   . VAL B 1 114 ? -0.513  16.004  -48.420 1.00 36.96 ? 114  VAL B C   1 
ATOM   5067 O O   . VAL B 1 114 ? 0.458   16.531  -47.902 1.00 36.23 ? 114  VAL B O   1 
ATOM   5068 C CB  . VAL B 1 114 ? -0.208  16.528  -50.837 1.00 38.16 ? 114  VAL B CB  1 
ATOM   5069 C CG1 . VAL B 1 114 ? 0.132   15.091  -51.138 1.00 37.91 ? 114  VAL B CG1 1 
ATOM   5070 C CG2 . VAL B 1 114 ? -0.779  17.207  -52.069 1.00 37.33 ? 114  VAL B CG2 1 
ATOM   5071 N N   . LEU B 1 115 ? -1.016  14.869  -47.971 1.00 36.12 ? 115  LEU B N   1 
ATOM   5072 C CA  . LEU B 1 115 ? -0.293  14.094  -46.970 1.00 35.17 ? 115  LEU B CA  1 
ATOM   5073 C C   . LEU B 1 115 ? 0.406   12.901  -47.645 1.00 34.46 ? 115  LEU B C   1 
ATOM   5074 O O   . LEU B 1 115 ? -0.239  12.127  -48.360 1.00 34.25 ? 115  LEU B O   1 
ATOM   5075 C CB  . LEU B 1 115 ? -1.241  13.615  -45.880 1.00 35.05 ? 115  LEU B CB  1 
ATOM   5076 C CG  . LEU B 1 115 ? -1.637  14.547  -44.748 1.00 34.78 ? 115  LEU B CG  1 
ATOM   5077 C CD1 . LEU B 1 115 ? -3.100  14.408  -44.483 1.00 36.75 ? 115  LEU B CD1 1 
ATOM   5078 C CD2 . LEU B 1 115 ? -0.896  14.146  -43.526 1.00 36.58 ? 115  LEU B CD2 1 
ATOM   5079 N N   . ILE B 1 116 ? 1.716   12.767  -47.441 1.00 32.99 ? 116  ILE B N   1 
ATOM   5080 C CA  . ILE B 1 116 ? 2.409   11.603  -47.956 1.00 31.71 ? 116  ILE B CA  1 
ATOM   5081 C C   . ILE B 1 116 ? 2.799   10.663  -46.829 1.00 31.24 ? 116  ILE B C   1 
ATOM   5082 O O   . ILE B 1 116 ? 3.505   11.046  -45.909 1.00 31.92 ? 116  ILE B O   1 
ATOM   5083 C CB  . ILE B 1 116 ? 3.632   11.963  -48.793 1.00 32.17 ? 116  ILE B CB  1 
ATOM   5084 C CG1 . ILE B 1 116 ? 3.267   12.976  -49.898 1.00 31.82 ? 116  ILE B CG1 1 
ATOM   5085 C CG2 . ILE B 1 116 ? 4.225   10.702  -49.391 1.00 31.30 ? 116  ILE B CG2 1 
ATOM   5086 C CD1 . ILE B 1 116 ? 4.461   13.408  -50.747 1.00 31.40 ? 116  ILE B CD1 1 
ATOM   5087 N N   . TRP B 1 117 ? 2.306   9.436   -46.895 1.00 29.96 ? 117  TRP B N   1 
ATOM   5088 C CA  . TRP B 1 117 ? 2.602   8.432   -45.890 1.00 29.34 ? 117  TRP B CA  1 
ATOM   5089 C C   . TRP B 1 117 ? 3.833   7.609   -46.280 1.00 28.89 ? 117  TRP B C   1 
ATOM   5090 O O   . TRP B 1 117 ? 4.020   7.277   -47.455 1.00 27.84 ? 117  TRP B O   1 
ATOM   5091 C CB  . TRP B 1 117 ? 1.394   7.512   -45.679 1.00 29.00 ? 117  TRP B CB  1 
ATOM   5092 C CG  . TRP B 1 117 ? 1.684   6.403   -44.747 1.00 28.57 ? 117  TRP B CG  1 
ATOM   5093 C CD1 . TRP B 1 117 ? 1.915   5.102   -45.069 1.00 28.90 ? 117  TRP B CD1 1 
ATOM   5094 C CD2 . TRP B 1 117 ? 1.796   6.492   -43.326 1.00 28.02 ? 117  TRP B CD2 1 
ATOM   5095 N NE1 . TRP B 1 117 ? 2.166   4.371   -43.934 1.00 28.12 ? 117  TRP B NE1 1 
ATOM   5096 C CE2 . TRP B 1 117 ? 2.094   5.197   -42.849 1.00 26.95 ? 117  TRP B CE2 1 
ATOM   5097 C CE3 . TRP B 1 117 ? 1.673   7.542   -42.407 1.00 27.70 ? 117  TRP B CE3 1 
ATOM   5098 C CZ2 . TRP B 1 117 ? 2.276   4.916   -41.484 1.00 28.03 ? 117  TRP B CZ2 1 
ATOM   5099 C CZ3 . TRP B 1 117 ? 1.848   7.265   -41.051 1.00 28.50 ? 117  TRP B CZ3 1 
ATOM   5100 C CH2 . TRP B 1 117 ? 2.160   5.956   -40.607 1.00 28.85 ? 117  TRP B CH2 1 
ATOM   5101 N N   . ILE B 1 118 ? 4.661   7.311   -45.277 1.00 28.83 ? 118  ILE B N   1 
ATOM   5102 C CA  . ILE B 1 118 ? 5.886   6.521   -45.433 1.00 28.99 ? 118  ILE B CA  1 
ATOM   5103 C C   . ILE B 1 118 ? 5.896   5.466   -44.337 1.00 30.00 ? 118  ILE B C   1 
ATOM   5104 O O   . ILE B 1 118 ? 6.215   5.760   -43.183 1.00 30.95 ? 118  ILE B O   1 
ATOM   5105 C CB  . ILE B 1 118 ? 7.170   7.376   -45.320 1.00 28.46 ? 118  ILE B CB  1 
ATOM   5106 C CG1 . ILE B 1 118 ? 7.132   8.567   -46.275 1.00 27.69 ? 118  ILE B CG1 1 
ATOM   5107 C CG2 . ILE B 1 118 ? 8.390   6.531   -45.612 1.00 28.27 ? 118  ILE B CG2 1 
ATOM   5108 C CD1 . ILE B 1 118 ? 8.377   9.466   -46.210 1.00 27.15 ? 118  ILE B CD1 1 
ATOM   5109 N N   . TYR B 1 119 ? 5.535   4.236   -44.685 1.00 30.46 ? 119  TYR B N   1 
ATOM   5110 C CA  . TYR B 1 119 ? 5.405   3.170   -43.677 1.00 30.38 ? 119  TYR B CA  1 
ATOM   5111 C C   . TYR B 1 119 ? 6.695   2.843   -42.950 1.00 30.45 ? 119  TYR B C   1 
ATOM   5112 O O   . TYR B 1 119 ? 7.780   3.090   -43.457 1.00 30.40 ? 119  TYR B O   1 
ATOM   5113 C CB  . TYR B 1 119 ? 4.872   1.883   -44.319 1.00 29.95 ? 119  TYR B CB  1 
ATOM   5114 C CG  . TYR B 1 119 ? 5.680   1.370   -45.487 1.00 29.51 ? 119  TYR B CG  1 
ATOM   5115 C CD1 . TYR B 1 119 ? 6.851   0.613   -45.285 1.00 30.23 ? 119  TYR B CD1 1 
ATOM   5116 C CD2 . TYR B 1 119 ? 5.263   1.607   -46.802 1.00 28.03 ? 119  TYR B CD2 1 
ATOM   5117 C CE1 . TYR B 1 119 ? 7.599   0.119   -46.384 1.00 28.10 ? 119  TYR B CE1 1 
ATOM   5118 C CE2 . TYR B 1 119 ? 5.996   1.127   -47.892 1.00 28.81 ? 119  TYR B CE2 1 
ATOM   5119 C CZ  . TYR B 1 119 ? 7.159   0.376   -47.676 1.00 28.79 ? 119  TYR B CZ  1 
ATOM   5120 O OH  . TYR B 1 119 ? 7.881   -0.088  -48.763 1.00 29.11 ? 119  TYR B OH  1 
ATOM   5121 N N   . GLY B 1 120 ? 6.542   2.259   -41.769 1.00 31.12 ? 120  GLY B N   1 
ATOM   5122 C CA  . GLY B 1 120 ? 7.628   1.666   -41.009 1.00 31.79 ? 120  GLY B CA  1 
ATOM   5123 C C   . GLY B 1 120 ? 7.712   0.181   -41.284 1.00 32.56 ? 120  GLY B C   1 
ATOM   5124 O O   . GLY B 1 120 ? 7.105   -0.311  -42.226 1.00 32.99 ? 120  GLY B O   1 
ATOM   5125 N N   . GLY B 1 121 ? 8.475   -0.537  -40.471 1.00 33.24 ? 121  GLY B N   1 
ATOM   5126 C CA  . GLY B 1 121 ? 8.771   -1.931  -40.744 1.00 34.33 ? 121  GLY B CA  1 
ATOM   5127 C C   . GLY B 1 121 ? 10.248  -2.189  -40.526 1.00 35.30 ? 121  GLY B C   1 
ATOM   5128 O O   . GLY B 1 121 ? 10.812  -3.170  -41.040 1.00 35.91 ? 121  GLY B O   1 
ATOM   5129 N N   . GLY B 1 122 ? 10.881  -1.298  -39.767 1.00 35.50 ? 122  GLY B N   1 
ATOM   5130 C CA  . GLY B 1 122 ? 12.284  -1.444  -39.398 1.00 35.80 ? 122  GLY B CA  1 
ATOM   5131 C C   . GLY B 1 122 ? 13.231  -1.335  -40.570 1.00 36.24 ? 122  GLY B C   1 
ATOM   5132 O O   . GLY B 1 122 ? 14.376  -1.806  -40.500 1.00 36.48 ? 122  GLY B O   1 
ATOM   5133 N N   . PHE B 1 123 ? 12.764  -0.717  -41.654 1.00 36.15 ? 123  PHE B N   1 
ATOM   5134 C CA  . PHE B 1 123 ? 13.554  -0.616  -42.887 1.00 36.17 ? 123  PHE B CA  1 
ATOM   5135 C C   . PHE B 1 123 ? 13.767  -1.975  -43.506 1.00 35.71 ? 123  PHE B C   1 
ATOM   5136 O O   . PHE B 1 123 ? 14.478  -2.081  -44.500 1.00 35.91 ? 123  PHE B O   1 
ATOM   5137 C CB  . PHE B 1 123 ? 14.923  0.059   -42.651 1.00 36.29 ? 123  PHE B CB  1 
ATOM   5138 C CG  . PHE B 1 123 ? 14.838  1.548   -42.387 1.00 36.53 ? 123  PHE B CG  1 
ATOM   5139 C CD1 . PHE B 1 123 ? 14.387  2.422   -43.376 1.00 35.38 ? 123  PHE B CD1 1 
ATOM   5140 C CD2 . PHE B 1 123 ? 15.230  2.071   -41.152 1.00 36.74 ? 123  PHE B CD2 1 
ATOM   5141 C CE1 . PHE B 1 123 ? 14.304  3.790   -43.138 1.00 36.23 ? 123  PHE B CE1 1 
ATOM   5142 C CE2 . PHE B 1 123 ? 15.174  3.440   -40.901 1.00 35.48 ? 123  PHE B CE2 1 
ATOM   5143 C CZ  . PHE B 1 123 ? 14.707  4.305   -41.896 1.00 36.36 ? 123  PHE B CZ  1 
ATOM   5144 N N   . TYR B 1 124 ? 13.146  -3.007  -42.929 1.00 35.29 ? 124  TYR B N   1 
ATOM   5145 C CA  . TYR B 1 124 ? 13.261  -4.367  -43.454 1.00 35.39 ? 124  TYR B CA  1 
ATOM   5146 C C   . TYR B 1 124 ? 11.921  -4.925  -43.975 1.00 35.53 ? 124  TYR B C   1 
ATOM   5147 O O   . TYR B 1 124 ? 11.890  -5.976  -44.628 1.00 36.10 ? 124  TYR B O   1 
ATOM   5148 C CB  . TYR B 1 124 ? 13.877  -5.307  -42.407 1.00 34.91 ? 124  TYR B CB  1 
ATOM   5149 C CG  . TYR B 1 124 ? 12.933  -5.641  -41.280 1.00 35.57 ? 124  TYR B CG  1 
ATOM   5150 C CD1 . TYR B 1 124 ? 11.864  -6.523  -41.487 1.00 34.67 ? 124  TYR B CD1 1 
ATOM   5151 C CD2 . TYR B 1 124 ? 13.094  -5.074  -40.006 1.00 34.34 ? 124  TYR B CD2 1 
ATOM   5152 C CE1 . TYR B 1 124 ? 10.973  -6.826  -40.475 1.00 35.38 ? 124  TYR B CE1 1 
ATOM   5153 C CE2 . TYR B 1 124 ? 12.204  -5.380  -38.972 1.00 35.09 ? 124  TYR B CE2 1 
ATOM   5154 C CZ  . TYR B 1 124 ? 11.138  -6.261  -39.224 1.00 35.84 ? 124  TYR B CZ  1 
ATOM   5155 O OH  . TYR B 1 124 ? 10.233  -6.595  -38.246 1.00 35.52 ? 124  TYR B OH  1 
ATOM   5156 N N   . SER B 1 125 ? 10.822  -4.246  -43.657 1.00 34.88 ? 125  SER B N   1 
ATOM   5157 C CA  . SER B 1 125 ? 9.493   -4.651  -44.113 1.00 34.17 ? 125  SER B CA  1 
ATOM   5158 C C   . SER B 1 125 ? 8.567   -3.445  -44.269 1.00 34.32 ? 125  SER B C   1 
ATOM   5159 O O   . SER B 1 125 ? 8.980   -2.307  -44.102 1.00 34.49 ? 125  SER B O   1 
ATOM   5160 C CB  . SER B 1 125 ? 8.874   -5.664  -43.149 1.00 34.01 ? 125  SER B CB  1 
ATOM   5161 O OG  . SER B 1 125 ? 8.907   -5.193  -41.810 1.00 33.65 ? 125  SER B OG  1 
ATOM   5162 N N   . GLY B 1 126 ? 7.313   -3.719  -44.593 1.00 34.30 ? 126  GLY B N   1 
ATOM   5163 C CA  . GLY B 1 126 ? 6.303   -2.713  -44.726 1.00 34.32 ? 126  GLY B CA  1 
ATOM   5164 C C   . GLY B 1 126 ? 5.799   -2.701  -46.141 1.00 34.80 ? 126  GLY B C   1 
ATOM   5165 O O   . GLY B 1 126 ? 6.412   -3.320  -47.038 1.00 35.18 ? 126  GLY B O   1 
ATOM   5166 N N   . ALA B 1 127 ? 4.693   -1.985  -46.347 1.00 33.97 ? 127  ALA B N   1 
ATOM   5167 C CA  . ALA B 1 127 ? 4.077   -1.850  -47.662 1.00 33.98 ? 127  ALA B CA  1 
ATOM   5168 C C   . ALA B 1 127 ? 2.971   -0.828  -47.560 1.00 33.73 ? 127  ALA B C   1 
ATOM   5169 O O   . ALA B 1 127 ? 2.308   -0.752  -46.543 1.00 33.35 ? 127  ALA B O   1 
ATOM   5170 C CB  . ALA B 1 127 ? 3.498   -3.180  -48.130 1.00 33.86 ? 127  ALA B CB  1 
ATOM   5171 N N   . ALA B 1 128 ? 2.762   -0.059  -48.617 1.00 33.58 ? 128  ALA B N   1 
ATOM   5172 C CA  . ALA B 1 128 ? 1.814   1.036   -48.557 1.00 34.35 ? 128  ALA B CA  1 
ATOM   5173 C C   . ALA B 1 128 ? 0.376   0.521   -48.691 1.00 34.69 ? 128  ALA B C   1 
ATOM   5174 O O   . ALA B 1 128 ? -0.553  1.300   -48.838 1.00 35.37 ? 128  ALA B O   1 
ATOM   5175 C CB  . ALA B 1 128 ? 2.132   2.077   -49.632 1.00 33.28 ? 128  ALA B CB  1 
ATOM   5176 N N   . SER B 1 129 ? 0.203   -0.797  -48.629 1.00 35.07 ? 129  SER B N   1 
ATOM   5177 C CA  . SER B 1 129 ? -1.054  -1.425  -49.032 1.00 34.55 ? 129  SER B CA  1 
ATOM   5178 C C   . SER B 1 129 ? -1.743  -2.120  -47.879 1.00 34.85 ? 129  SER B C   1 
ATOM   5179 O O   . SER B 1 129 ? -2.793  -2.748  -48.055 1.00 35.16 ? 129  SER B O   1 
ATOM   5180 C CB  . SER B 1 129 ? -0.797  -2.414  -50.169 1.00 34.67 ? 129  SER B CB  1 
ATOM   5181 O OG  . SER B 1 129 ? 0.105   -3.425  -49.772 1.00 32.81 ? 129  SER B OG  1 
ATOM   5182 N N   . LEU B 1 130 ? -1.153  -2.012  -46.696 1.00 34.74 ? 130  LEU B N   1 
ATOM   5183 C CA  . LEU B 1 130 ? -1.754  -2.568  -45.512 1.00 35.39 ? 130  LEU B CA  1 
ATOM   5184 C C   . LEU B 1 130 ? -3.066  -1.835  -45.207 1.00 36.28 ? 130  LEU B C   1 
ATOM   5185 O O   . LEU B 1 130 ? -3.224  -0.643  -45.526 1.00 36.13 ? 130  LEU B O   1 
ATOM   5186 C CB  . LEU B 1 130 ? -0.774  -2.474  -44.336 1.00 35.33 ? 130  LEU B CB  1 
ATOM   5187 C CG  . LEU B 1 130 ? 0.623   -3.102  -44.539 1.00 35.43 ? 130  LEU B CG  1 
ATOM   5188 C CD1 . LEU B 1 130 ? 1.474   -2.950  -43.290 1.00 34.50 ? 130  LEU B CD1 1 
ATOM   5189 C CD2 . LEU B 1 130 ? 0.555   -4.589  -44.950 1.00 35.39 ? 130  LEU B CD2 1 
ATOM   5190 N N   . ASP B 1 131 ? -4.008  -2.539  -44.596 1.00 36.98 ? 131  ASP B N   1 
ATOM   5191 C CA  . ASP B 1 131 ? -5.271  -1.919  -44.224 1.00 38.31 ? 131  ASP B CA  1 
ATOM   5192 C C   . ASP B 1 131 ? -5.071  -0.692  -43.333 1.00 38.15 ? 131  ASP B C   1 
ATOM   5193 O O   . ASP B 1 131 ? -5.809  0.296   -43.467 1.00 37.83 ? 131  ASP B O   1 
ATOM   5194 C CB  . ASP B 1 131 ? -6.197  -2.920  -43.525 1.00 39.19 ? 131  ASP B CB  1 
ATOM   5195 C CG  . ASP B 1 131 ? -6.502  -4.138  -44.389 1.00 41.65 ? 131  ASP B CG  1 
ATOM   5196 O OD1 . ASP B 1 131 ? -6.459  -4.005  -45.640 1.00 41.71 ? 131  ASP B OD1 1 
ATOM   5197 O OD2 . ASP B 1 131 ? -6.770  -5.221  -43.800 1.00 43.85 ? 131  ASP B OD2 1 
ATOM   5198 N N   . VAL B 1 132 ? -4.078  -0.748  -42.440 1.00 37.62 ? 132  VAL B N   1 
ATOM   5199 C CA  . VAL B 1 132 ? -3.871  0.352   -41.498 1.00 37.36 ? 132  VAL B CA  1 
ATOM   5200 C C   . VAL B 1 132 ? -3.432  1.646   -42.166 1.00 37.49 ? 132  VAL B C   1 
ATOM   5201 O O   . VAL B 1 132 ? -3.573  2.715   -41.571 1.00 37.75 ? 132  VAL B O   1 
ATOM   5202 C CB  . VAL B 1 132 ? -2.956  -0.016  -40.329 1.00 37.24 ? 132  VAL B CB  1 
ATOM   5203 C CG1 . VAL B 1 132 ? -3.673  -0.959  -39.423 1.00 36.78 ? 132  VAL B CG1 1 
ATOM   5204 C CG2 . VAL B 1 132 ? -1.665  -0.645  -40.818 1.00 37.73 ? 132  VAL B CG2 1 
ATOM   5205 N N   . TYR B 1 133 ? -2.931  1.566   -43.404 1.00 37.11 ? 133  TYR B N   1 
ATOM   5206 C CA  . TYR B 1 133 ? -2.555  2.777   -44.131 1.00 36.17 ? 133  TYR B CA  1 
ATOM   5207 C C   . TYR B 1 133 ? -3.559  3.187   -45.183 1.00 36.17 ? 133  TYR B C   1 
ATOM   5208 O O   . TYR B 1 133 ? -3.207  3.887   -46.117 1.00 35.87 ? 133  TYR B O   1 
ATOM   5209 C CB  . TYR B 1 133 ? -1.178  2.643   -44.780 1.00 36.58 ? 133  TYR B CB  1 
ATOM   5210 C CG  . TYR B 1 133 ? -0.123  1.998   -43.931 1.00 35.98 ? 133  TYR B CG  1 
ATOM   5211 C CD1 . TYR B 1 133 ? -0.003  2.289   -42.574 1.00 34.70 ? 133  TYR B CD1 1 
ATOM   5212 C CD2 . TYR B 1 133 ? 0.768   1.095   -44.492 1.00 36.13 ? 133  TYR B CD2 1 
ATOM   5213 C CE1 . TYR B 1 133 ? 0.984   1.677   -41.795 1.00 35.54 ? 133  TYR B CE1 1 
ATOM   5214 C CE2 . TYR B 1 133 ? 1.757   0.480   -43.723 1.00 36.27 ? 133  TYR B CE2 1 
ATOM   5215 C CZ  . TYR B 1 133 ? 1.865   0.781   -42.375 1.00 36.40 ? 133  TYR B CZ  1 
ATOM   5216 O OH  . TYR B 1 133 ? 2.843   0.167   -41.611 1.00 36.82 ? 133  TYR B OH  1 
ATOM   5217 N N   . ASP B 1 134 ? -4.809  2.752   -45.028 1.00 36.65 ? 134  ASP B N   1 
ATOM   5218 C CA  . ASP B 1 134 ? -5.867  2.996   -46.001 1.00 36.80 ? 134  ASP B CA  1 
ATOM   5219 C C   . ASP B 1 134 ? -6.248  4.465   -45.982 1.00 37.07 ? 134  ASP B C   1 
ATOM   5220 O O   . ASP B 1 134 ? -6.667  4.979   -44.955 1.00 36.69 ? 134  ASP B O   1 
ATOM   5221 C CB  . ASP B 1 134 ? -7.081  2.175   -45.597 1.00 37.54 ? 134  ASP B CB  1 
ATOM   5222 C CG  . ASP B 1 134 ? -8.157  2.140   -46.658 1.00 38.02 ? 134  ASP B CG  1 
ATOM   5223 O OD1 . ASP B 1 134 ? -8.291  3.077   -47.473 1.00 36.94 ? 134  ASP B OD1 1 
ATOM   5224 O OD2 . ASP B 1 134 ? -8.887  1.134   -46.656 1.00 41.65 ? 134  ASP B OD2 1 
ATOM   5225 N N   . GLY B 1 135 ? -6.119  5.132   -47.120 1.00 37.66 ? 135  GLY B N   1 
ATOM   5226 C CA  . GLY B 1 135 ? -6.280  6.580   -47.185 1.00 38.78 ? 135  GLY B CA  1 
ATOM   5227 C C   . GLY B 1 135 ? -7.681  7.089   -47.469 1.00 39.92 ? 135  GLY B C   1 
ATOM   5228 O O   . GLY B 1 135 ? -7.874  8.300   -47.658 1.00 39.55 ? 135  GLY B O   1 
ATOM   5229 N N   . ARG B 1 136 ? -8.660  6.180   -47.496 1.00 40.45 ? 136  ARG B N   1 
ATOM   5230 C CA  . ARG B 1 136 ? -9.993  6.530   -47.963 1.00 41.17 ? 136  ARG B CA  1 
ATOM   5231 C C   . ARG B 1 136 ? -10.686 7.448   -46.952 1.00 40.94 ? 136  ARG B C   1 
ATOM   5232 O O   . ARG B 1 136 ? -11.309 8.445   -47.328 1.00 40.65 ? 136  ARG B O   1 
ATOM   5233 C CB  . ARG B 1 136 ? -10.814 5.275   -48.367 1.00 41.78 ? 136  ARG B CB  1 
ATOM   5234 C CG  . ARG B 1 136 ? -11.666 4.599   -47.301 1.00 44.24 ? 136  ARG B CG  1 
ATOM   5235 C CD  . ARG B 1 136 ? -11.500 3.048   -47.288 1.00 50.21 ? 136  ARG B CD  1 
ATOM   5236 N NE  . ARG B 1 136 ? -12.142 2.360   -48.413 1.00 54.33 ? 136  ARG B NE  1 
ATOM   5237 C CZ  . ARG B 1 136 ? -11.574 1.409   -49.165 1.00 56.53 ? 136  ARG B CZ  1 
ATOM   5238 N NH1 . ARG B 1 136 ? -10.330 0.988   -48.938 1.00 57.72 ? 136  ARG B NH1 1 
ATOM   5239 N NH2 . ARG B 1 136 ? -12.259 0.863   -50.158 1.00 57.26 ? 136  ARG B NH2 1 
ATOM   5240 N N   . PHE B 1 137 ? -10.516 7.150   -45.675 1.00 40.89 ? 137  PHE B N   1 
ATOM   5241 C CA  . PHE B 1 137 ? -11.145 7.946   -44.639 1.00 41.30 ? 137  PHE B CA  1 
ATOM   5242 C C   . PHE B 1 137 ? -10.613 9.373   -44.599 1.00 41.94 ? 137  PHE B C   1 
ATOM   5243 O O   . PHE B 1 137 ? -11.410 10.324  -44.629 1.00 42.29 ? 137  PHE B O   1 
ATOM   5244 C CB  . PHE B 1 137 ? -11.003 7.270   -43.296 1.00 41.27 ? 137  PHE B CB  1 
ATOM   5245 C CG  . PHE B 1 137 ? -11.316 5.815   -43.333 1.00 41.10 ? 137  PHE B CG  1 
ATOM   5246 C CD1 . PHE B 1 137 ? -12.633 5.377   -43.410 1.00 41.15 ? 137  PHE B CD1 1 
ATOM   5247 C CD2 . PHE B 1 137 ? -10.292 4.876   -43.300 1.00 39.94 ? 137  PHE B CD2 1 
ATOM   5248 C CE1 . PHE B 1 137 ? -12.925 4.006   -43.440 1.00 42.25 ? 137  PHE B CE1 1 
ATOM   5249 C CE2 . PHE B 1 137 ? -10.566 3.515   -43.336 1.00 40.83 ? 137  PHE B CE2 1 
ATOM   5250 C CZ  . PHE B 1 137 ? -11.878 3.068   -43.399 1.00 41.59 ? 137  PHE B CZ  1 
ATOM   5251 N N   . LEU B 1 138 ? -9.286  9.534   -44.561 1.00 42.31 ? 138  LEU B N   1 
ATOM   5252 C CA  . LEU B 1 138 ? -8.688  10.872  -44.621 1.00 42.61 ? 138  LEU B CA  1 
ATOM   5253 C C   . LEU B 1 138 ? -9.153  11.615  -45.865 1.00 43.48 ? 138  LEU B C   1 
ATOM   5254 O O   . LEU B 1 138 ? -9.438  12.818  -45.811 1.00 44.22 ? 138  LEU B O   1 
ATOM   5255 C CB  . LEU B 1 138 ? -7.159  10.834  -44.540 1.00 42.36 ? 138  LEU B CB  1 
ATOM   5256 C CG  . LEU B 1 138 ? -6.523  10.574  -43.167 1.00 40.88 ? 138  LEU B CG  1 
ATOM   5257 C CD1 . LEU B 1 138 ? -5.052  10.339  -43.300 1.00 39.35 ? 138  LEU B CD1 1 
ATOM   5258 C CD2 . LEU B 1 138 ? -6.744  11.716  -42.206 1.00 39.82 ? 138  LEU B CD2 1 
ATOM   5259 N N   . ALA B 1 139 ? -9.261  10.899  -46.981 1.00 43.91 ? 139  ALA B N   1 
ATOM   5260 C CA  . ALA B 1 139 ? -9.689  11.518  -48.230 1.00 43.94 ? 139  ALA B CA  1 
ATOM   5261 C C   . ALA B 1 139 ? -11.135 11.987  -48.143 1.00 44.41 ? 139  ALA B C   1 
ATOM   5262 O O   . ALA B 1 139 ? -11.457 13.086  -48.592 1.00 44.51 ? 139  ALA B O   1 
ATOM   5263 C CB  . ALA B 1 139 ? -9.511  10.563  -49.394 1.00 43.62 ? 139  ALA B CB  1 
ATOM   5264 N N   . GLN B 1 140 ? -11.994 11.151  -47.562 1.00 44.64 ? 140  GLN B N   1 
ATOM   5265 C CA  . GLN B 1 140 ? -13.433 11.396  -47.539 1.00 44.96 ? 140  GLN B CA  1 
ATOM   5266 C C   . GLN B 1 140 ? -13.802 12.435  -46.489 1.00 45.29 ? 140  GLN B C   1 
ATOM   5267 O O   . GLN B 1 140 ? -14.369 13.481  -46.804 1.00 45.37 ? 140  GLN B O   1 
ATOM   5268 C CB  . GLN B 1 140 ? -14.186 10.089  -47.254 1.00 44.99 ? 140  GLN B CB  1 
ATOM   5269 C CG  . GLN B 1 140 ? -15.621 10.057  -47.786 1.00 45.16 ? 140  GLN B CG  1 
ATOM   5270 C CD  . GLN B 1 140 ? -16.602 10.815  -46.910 1.00 45.14 ? 140  GLN B CD  1 
ATOM   5271 O OE1 . GLN B 1 140 ? -16.677 10.598  -45.699 1.00 45.01 ? 140  GLN B OE1 1 
ATOM   5272 N NE2 . GLN B 1 140 ? -17.367 11.703  -47.524 1.00 44.87 ? 140  GLN B NE2 1 
ATOM   5273 N N   . VAL B 1 141 ? -13.480 12.132  -45.239 1.00 45.56 ? 141  VAL B N   1 
ATOM   5274 C CA  . VAL B 1 141 ? -13.868 12.972  -44.112 1.00 45.72 ? 141  VAL B CA  1 
ATOM   5275 C C   . VAL B 1 141 ? -13.239 14.362  -44.150 1.00 45.92 ? 141  VAL B C   1 
ATOM   5276 O O   . VAL B 1 141 ? -13.928 15.364  -43.904 1.00 46.23 ? 141  VAL B O   1 
ATOM   5277 C CB  . VAL B 1 141 ? -13.529 12.293  -42.796 1.00 45.55 ? 141  VAL B CB  1 
ATOM   5278 C CG1 . VAL B 1 141 ? -14.080 13.094  -41.641 1.00 46.13 ? 141  VAL B CG1 1 
ATOM   5279 C CG2 . VAL B 1 141 ? -14.091 10.872  -42.794 1.00 45.20 ? 141  VAL B CG2 1 
ATOM   5280 N N   . GLU B 1 142 ? -11.950 14.422  -44.489 1.00 45.87 ? 142  GLU B N   1 
ATOM   5281 C CA  . GLU B 1 142 ? -11.176 15.661  -44.380 1.00 45.42 ? 142  GLU B CA  1 
ATOM   5282 C C   . GLU B 1 142 ? -10.854 16.307  -45.715 1.00 45.19 ? 142  GLU B C   1 
ATOM   5283 O O   . GLU B 1 142 ? -10.264 17.398  -45.764 1.00 45.79 ? 142  GLU B O   1 
ATOM   5284 C CB  . GLU B 1 142 ? -9.887  15.415  -43.596 1.00 45.40 ? 142  GLU B CB  1 
ATOM   5285 C CG  . GLU B 1 142 ? -10.108 15.018  -42.140 1.00 45.74 ? 142  GLU B CG  1 
ATOM   5286 C CD  . GLU B 1 142 ? -10.759 16.114  -41.299 1.00 47.18 ? 142  GLU B CD  1 
ATOM   5287 O OE1 . GLU B 1 142 ? -10.774 17.300  -41.717 1.00 46.52 ? 142  GLU B OE1 1 
ATOM   5288 O OE2 . GLU B 1 142 ? -11.253 15.777  -40.198 1.00 49.09 ? 142  GLU B OE2 1 
ATOM   5289 N N   . GLY B 1 143 ? -11.235 15.643  -46.797 1.00 44.50 ? 143  GLY B N   1 
ATOM   5290 C CA  . GLY B 1 143 ? -10.961 16.156  -48.132 1.00 44.01 ? 143  GLY B CA  1 
ATOM   5291 C C   . GLY B 1 143 ? -9.483  16.112  -48.497 1.00 43.73 ? 143  GLY B C   1 
ATOM   5292 O O   . GLY B 1 143 ? -9.038  16.836  -49.397 1.00 43.83 ? 143  GLY B O   1 
ATOM   5293 N N   . ALA B 1 144 ? -8.724  15.258  -47.805 1.00 42.91 ? 144  ALA B N   1 
ATOM   5294 C CA  . ALA B 1 144 ? -7.270  15.186  -47.992 1.00 41.95 ? 144  ALA B CA  1 
ATOM   5295 C C   . ALA B 1 144 ? -6.898  14.394  -49.242 1.00 41.11 ? 144  ALA B C   1 
ATOM   5296 O O   . ALA B 1 144 ? -7.415  13.299  -49.464 1.00 41.06 ? 144  ALA B O   1 
ATOM   5297 C CB  . ALA B 1 144 ? -6.610  14.568  -46.758 1.00 41.60 ? 144  ALA B CB  1 
ATOM   5298 N N   . VAL B 1 145 ? -6.013  14.949  -50.061 1.00 40.13 ? 145  VAL B N   1 
ATOM   5299 C CA  . VAL B 1 145 ? -5.297  14.131  -51.032 1.00 39.64 ? 145  VAL B CA  1 
ATOM   5300 C C   . VAL B 1 145 ? -4.182  13.386  -50.293 1.00 39.17 ? 145  VAL B C   1 
ATOM   5301 O O   . VAL B 1 145 ? -3.243  14.002  -49.792 1.00 39.65 ? 145  VAL B O   1 
ATOM   5302 C CB  . VAL B 1 145 ? -4.732  14.949  -52.203 1.00 39.62 ? 145  VAL B CB  1 
ATOM   5303 C CG1 . VAL B 1 145 ? -3.817  14.093  -53.057 1.00 39.21 ? 145  VAL B CG1 1 
ATOM   5304 C CG2 . VAL B 1 145 ? -5.863  15.495  -53.053 1.00 39.95 ? 145  VAL B CG2 1 
ATOM   5305 N N   . LEU B 1 146 ? -4.312  12.064  -50.215 1.00 38.52 ? 146  LEU B N   1 
ATOM   5306 C CA  . LEU B 1 146 ? -3.349  11.209  -49.526 1.00 37.97 ? 146  LEU B CA  1 
ATOM   5307 C C   . LEU B 1 146 ? -2.502  10.372  -50.494 1.00 37.41 ? 146  LEU B C   1 
ATOM   5308 O O   . LEU B 1 146 ? -3.039  9.665   -51.344 1.00 37.87 ? 146  LEU B O   1 
ATOM   5309 C CB  . LEU B 1 146 ? -4.072  10.271  -48.563 1.00 37.76 ? 146  LEU B CB  1 
ATOM   5310 C CG  . LEU B 1 146 ? -3.070  9.663   -47.579 1.00 38.69 ? 146  LEU B CG  1 
ATOM   5311 C CD1 . LEU B 1 146 ? -3.188  10.282  -46.229 1.00 36.63 ? 146  LEU B CD1 1 
ATOM   5312 C CD2 . LEU B 1 146 ? -3.199  8.148   -47.471 1.00 40.74 ? 146  LEU B CD2 1 
ATOM   5313 N N   . VAL B 1 147 ? -1.181  10.439  -50.353 1.00 36.50 ? 147  VAL B N   1 
ATOM   5314 C CA  . VAL B 1 147 ? -0.273  9.644   -51.185 1.00 35.38 ? 147  VAL B CA  1 
ATOM   5315 C C   . VAL B 1 147 ? 0.516   8.682   -50.306 1.00 34.99 ? 147  VAL B C   1 
ATOM   5316 O O   . VAL B 1 147 ? 1.007   9.098   -49.264 1.00 35.23 ? 147  VAL B O   1 
ATOM   5317 C CB  . VAL B 1 147 ? 0.736   10.530  -51.912 1.00 35.04 ? 147  VAL B CB  1 
ATOM   5318 C CG1 . VAL B 1 147 ? 1.573   9.705   -52.884 1.00 35.90 ? 147  VAL B CG1 1 
ATOM   5319 C CG2 . VAL B 1 147 ? 0.045   11.626  -52.650 1.00 35.18 ? 147  VAL B CG2 1 
ATOM   5320 N N   . SER B 1 148 ? 0.614   7.406   -50.700 1.00 33.85 ? 148  SER B N   1 
ATOM   5321 C CA  . SER B 1 148 ? 1.599   6.495   -50.106 1.00 33.15 ? 148  SER B CA  1 
ATOM   5322 C C   . SER B 1 148 ? 2.433   5.748   -51.162 1.00 32.85 ? 148  SER B C   1 
ATOM   5323 O O   . SER B 1 148 ? 1.938   5.450   -52.244 1.00 32.85 ? 148  SER B O   1 
ATOM   5324 C CB  . SER B 1 148 ? 0.960   5.516   -49.133 1.00 33.16 ? 148  SER B CB  1 
ATOM   5325 O OG  . SER B 1 148 ? 0.080   4.611   -49.775 1.00 34.35 ? 148  SER B OG  1 
ATOM   5326 N N   . MET B 1 149 ? 3.701   5.465   -50.854 1.00 31.78 ? 149  MET B N   1 
ATOM   5327 C CA  . MET B 1 149 ? 4.573   4.813   -51.813 1.00 30.88 ? 149  MET B CA  1 
ATOM   5328 C C   . MET B 1 149 ? 5.217   3.572   -51.225 1.00 30.61 ? 149  MET B C   1 
ATOM   5329 O O   . MET B 1 149 ? 5.407   3.455   -50.012 1.00 30.69 ? 149  MET B O   1 
ATOM   5330 C CB  . MET B 1 149 ? 5.660   5.776   -52.306 1.00 30.92 ? 149  MET B CB  1 
ATOM   5331 C CG  . MET B 1 149 ? 6.933   5.803   -51.449 1.00 31.16 ? 149  MET B CG  1 
ATOM   5332 S SD  . MET B 1 149 ? 6.639   6.541   -49.831 1.00 32.28 ? 149  MET B SD  1 
ATOM   5333 C CE  . MET B 1 149 ? 6.736   8.283   -50.277 1.00 26.84 ? 149  MET B CE  1 
ATOM   5334 N N   . ASN B 1 150 ? 5.549   2.639   -52.094 1.00 30.47 ? 150  ASN B N   1 
ATOM   5335 C CA  . ASN B 1 150 ? 6.396   1.537   -51.709 1.00 30.92 ? 150  ASN B CA  1 
ATOM   5336 C C   . ASN B 1 150 ? 7.818   2.008   -51.868 1.00 30.57 ? 150  ASN B C   1 
ATOM   5337 O O   . ASN B 1 150 ? 8.102   2.833   -52.724 1.00 31.06 ? 150  ASN B O   1 
ATOM   5338 C CB  . ASN B 1 150 ? 6.121   0.320   -52.589 1.00 31.36 ? 150  ASN B CB  1 
ATOM   5339 C CG  . ASN B 1 150 ? 4.860   -0.404  -52.188 1.00 32.08 ? 150  ASN B CG  1 
ATOM   5340 O OD1 . ASN B 1 150 ? 4.246   -0.067  -51.183 1.00 34.06 ? 150  ASN B OD1 1 
ATOM   5341 N ND2 . ASN B 1 150 ? 4.479   -1.423  -52.955 1.00 34.27 ? 150  ASN B ND2 1 
ATOM   5342 N N   . TYR B 1 151 ? 8.699   1.547   -50.995 1.00 30.39 ? 151  TYR B N   1 
ATOM   5343 C CA  . TYR B 1 151 ? 10.120  1.815   -51.153 1.00 30.18 ? 151  TYR B CA  1 
ATOM   5344 C C   . TYR B 1 151 ? 10.878  0.540   -50.808 1.00 30.20 ? 151  TYR B C   1 
ATOM   5345 O O   . TYR B 1 151 ? 10.414  -0.263  -49.991 1.00 30.18 ? 151  TYR B O   1 
ATOM   5346 C CB  . TYR B 1 151 ? 10.562  3.003   -50.288 1.00 30.08 ? 151  TYR B CB  1 
ATOM   5347 C CG  . TYR B 1 151 ? 10.387  2.799   -48.803 1.00 29.40 ? 151  TYR B CG  1 
ATOM   5348 C CD1 . TYR B 1 151 ? 9.188   3.129   -48.149 1.00 28.05 ? 151  TYR B CD1 1 
ATOM   5349 C CD2 . TYR B 1 151 ? 11.432  2.295   -48.041 1.00 28.38 ? 151  TYR B CD2 1 
ATOM   5350 C CE1 . TYR B 1 151 ? 9.053   2.944   -46.757 1.00 28.06 ? 151  TYR B CE1 1 
ATOM   5351 C CE2 . TYR B 1 151 ? 11.303  2.096   -46.673 1.00 27.90 ? 151  TYR B CE2 1 
ATOM   5352 C CZ  . TYR B 1 151 ? 10.126  2.421   -46.039 1.00 29.20 ? 151  TYR B CZ  1 
ATOM   5353 O OH  . TYR B 1 151 ? 10.062  2.190   -44.682 1.00 30.53 ? 151  TYR B OH  1 
ATOM   5354 N N   . ARG B 1 152 ? 12.026  0.333   -51.438 1.00 29.99 ? 152  ARG B N   1 
ATOM   5355 C CA  . ARG B 1 152 ? 12.741  -0.917  -51.206 1.00 30.40 ? 152  ARG B CA  1 
ATOM   5356 C C   . ARG B 1 152 ? 13.177  -1.023  -49.755 1.00 30.43 ? 152  ARG B C   1 
ATOM   5357 O O   . ARG B 1 152 ? 13.505  -0.027  -49.128 1.00 30.44 ? 152  ARG B O   1 
ATOM   5358 C CB  . ARG B 1 152 ? 13.930  -1.051  -52.146 1.00 30.17 ? 152  ARG B CB  1 
ATOM   5359 C CG  . ARG B 1 152 ? 13.558  -1.402  -53.549 1.00 28.26 ? 152  ARG B CG  1 
ATOM   5360 C CD  . ARG B 1 152 ? 14.748  -1.229  -54.447 1.00 27.01 ? 152  ARG B CD  1 
ATOM   5361 N NE  . ARG B 1 152 ? 14.947  0.156   -54.832 1.00 24.88 ? 152  ARG B NE  1 
ATOM   5362 C CZ  . ARG B 1 152 ? 15.998  0.590   -55.511 1.00 28.30 ? 152  ARG B CZ  1 
ATOM   5363 N NH1 . ARG B 1 152 ? 16.979  -0.260  -55.884 1.00 28.89 ? 152  ARG B NH1 1 
ATOM   5364 N NH2 . ARG B 1 152 ? 16.087  1.879   -55.811 1.00 27.17 ? 152  ARG B NH2 1 
ATOM   5365 N N   . VAL B 1 153 ? 13.125  -2.230  -49.219 1.00 30.72 ? 153  VAL B N   1 
ATOM   5366 C CA  . VAL B 1 153 ? 13.529  -2.470  -47.854 1.00 31.15 ? 153  VAL B CA  1 
ATOM   5367 C C   . VAL B 1 153 ? 14.578  -3.575  -47.824 1.00 31.78 ? 153  VAL B C   1 
ATOM   5368 O O   . VAL B 1 153 ? 14.956  -4.117  -48.877 1.00 31.73 ? 153  VAL B O   1 
ATOM   5369 C CB  . VAL B 1 153 ? 12.335  -2.873  -46.971 1.00 31.39 ? 153  VAL B CB  1 
ATOM   5370 C CG1 . VAL B 1 153 ? 11.469  -1.662  -46.649 1.00 31.43 ? 153  VAL B CG1 1 
ATOM   5371 C CG2 . VAL B 1 153 ? 11.528  -3.969  -47.640 1.00 31.57 ? 153  VAL B CG2 1 
ATOM   5372 N N   . GLY B 1 154 ? 15.046  -3.898  -46.617 1.00 31.99 ? 154  GLY B N   1 
ATOM   5373 C CA  . GLY B 1 154 ? 16.063  -4.929  -46.414 1.00 32.53 ? 154  GLY B CA  1 
ATOM   5374 C C   . GLY B 1 154 ? 17.308  -4.686  -47.235 1.00 32.64 ? 154  GLY B C   1 
ATOM   5375 O O   . GLY B 1 154 ? 17.683  -3.531  -47.489 1.00 32.47 ? 154  GLY B O   1 
ATOM   5376 N N   . THR B 1 155 ? 17.935  -5.774  -47.673 1.00 33.22 ? 155  THR B N   1 
ATOM   5377 C CA  . THR B 1 155 ? 19.124  -5.675  -48.513 1.00 33.91 ? 155  THR B CA  1 
ATOM   5378 C C   . THR B 1 155 ? 18.848  -4.867  -49.776 1.00 34.27 ? 155  THR B C   1 
ATOM   5379 O O   . THR B 1 155 ? 19.697  -4.083  -50.216 1.00 35.47 ? 155  THR B O   1 
ATOM   5380 C CB  . THR B 1 155 ? 19.639  -7.044  -48.947 1.00 33.70 ? 155  THR B CB  1 
ATOM   5381 O OG1 . THR B 1 155 ? 18.587  -7.724  -49.621 1.00 33.80 ? 155  THR B OG1 1 
ATOM   5382 C CG2 . THR B 1 155 ? 20.083  -7.870  -47.741 1.00 34.76 ? 155  THR B CG2 1 
ATOM   5383 N N   . PHE B 1 156 ? 17.669  -5.048  -50.356 1.00 33.88 ? 156  PHE B N   1 
ATOM   5384 C CA  . PHE B 1 156 ? 17.356  -4.419  -51.635 1.00 34.26 ? 156  PHE B CA  1 
ATOM   5385 C C   . PHE B 1 156 ? 17.331  -2.904  -51.555 1.00 34.17 ? 156  PHE B C   1 
ATOM   5386 O O   . PHE B 1 156 ? 17.640  -2.230  -52.516 1.00 34.09 ? 156  PHE B O   1 
ATOM   5387 C CB  . PHE B 1 156 ? 16.013  -4.930  -52.157 1.00 34.51 ? 156  PHE B CB  1 
ATOM   5388 C CG  . PHE B 1 156 ? 15.874  -6.401  -52.060 1.00 34.24 ? 156  PHE B CG  1 
ATOM   5389 C CD1 . PHE B 1 156 ? 16.444  -7.223  -53.024 1.00 34.62 ? 156  PHE B CD1 1 
ATOM   5390 C CD2 . PHE B 1 156 ? 15.205  -6.972  -50.983 1.00 34.43 ? 156  PHE B CD2 1 
ATOM   5391 C CE1 . PHE B 1 156 ? 16.336  -8.596  -52.922 1.00 36.07 ? 156  PHE B CE1 1 
ATOM   5392 C CE2 . PHE B 1 156 ? 15.090  -8.341  -50.863 1.00 35.70 ? 156  PHE B CE2 1 
ATOM   5393 C CZ  . PHE B 1 156 ? 15.656  -9.165  -51.832 1.00 35.99 ? 156  PHE B CZ  1 
ATOM   5394 N N   . GLY B 1 157 ? 16.938  -2.372  -50.407 1.00 34.72 ? 157  GLY B N   1 
ATOM   5395 C CA  . GLY B 1 157 ? 16.812  -0.933  -50.254 1.00 35.00 ? 157  GLY B CA  1 
ATOM   5396 C C   . GLY B 1 157 ? 18.018  -0.331  -49.571 1.00 35.41 ? 157  GLY B C   1 
ATOM   5397 O O   . GLY B 1 157 ? 18.325  0.848   -49.760 1.00 35.31 ? 157  GLY B O   1 
ATOM   5398 N N   . PHE B 1 158 ? 18.713  -1.133  -48.774 1.00 35.55 ? 158  PHE B N   1 
ATOM   5399 C CA  . PHE B 1 158 ? 19.669  -0.536  -47.857 1.00 36.40 ? 158  PHE B CA  1 
ATOM   5400 C C   . PHE B 1 158 ? 21.053  -1.153  -47.800 1.00 37.45 ? 158  PHE B C   1 
ATOM   5401 O O   . PHE B 1 158 ? 21.943  -0.567  -47.195 1.00 38.09 ? 158  PHE B O   1 
ATOM   5402 C CB  . PHE B 1 158 ? 19.043  -0.335  -46.467 1.00 35.69 ? 158  PHE B CB  1 
ATOM   5403 C CG  . PHE B 1 158 ? 17.866  0.591   -46.490 1.00 34.58 ? 158  PHE B CG  1 
ATOM   5404 C CD1 . PHE B 1 158 ? 18.052  1.963   -46.609 1.00 32.74 ? 158  PHE B CD1 1 
ATOM   5405 C CD2 . PHE B 1 158 ? 16.570  0.089   -46.475 1.00 33.37 ? 158  PHE B CD2 1 
ATOM   5406 C CE1 . PHE B 1 158 ? 16.961  2.822   -46.678 1.00 33.24 ? 158  PHE B CE1 1 
ATOM   5407 C CE2 . PHE B 1 158 ? 15.475  0.943   -46.543 1.00 33.73 ? 158  PHE B CE2 1 
ATOM   5408 C CZ  . PHE B 1 158 ? 15.671  2.310   -46.638 1.00 34.04 ? 158  PHE B CZ  1 
ATOM   5409 N N   . LEU B 1 159 ? 21.249  -2.300  -48.454 1.00 38.42 ? 159  LEU B N   1 
ATOM   5410 C CA  . LEU B 1 159 ? 22.583  -2.870  -48.557 1.00 39.24 ? 159  LEU B CA  1 
ATOM   5411 C C   . LEU B 1 159 ? 23.484  -1.894  -49.284 1.00 40.27 ? 159  LEU B C   1 
ATOM   5412 O O   . LEU B 1 159 ? 23.252  -1.566  -50.449 1.00 40.67 ? 159  LEU B O   1 
ATOM   5413 C CB  . LEU B 1 159 ? 22.571  -4.219  -49.263 1.00 39.02 ? 159  LEU B CB  1 
ATOM   5414 C CG  . LEU B 1 159 ? 23.908  -4.937  -49.435 1.00 37.79 ? 159  LEU B CG  1 
ATOM   5415 C CD1 . LEU B 1 159 ? 23.695  -6.420  -49.245 1.00 36.73 ? 159  LEU B CD1 1 
ATOM   5416 C CD2 . LEU B 1 159 ? 24.514  -4.629  -50.798 1.00 36.85 ? 159  LEU B CD2 1 
ATOM   5417 N N   . ALA B 1 160 ? 24.504  -1.421  -48.584 1.00 41.26 ? 160  ALA B N   1 
ATOM   5418 C CA  . ALA B 1 160 ? 25.441  -0.490  -49.175 1.00 42.51 ? 160  ALA B CA  1 
ATOM   5419 C C   . ALA B 1 160 ? 26.871  -1.031  -49.125 1.00 43.28 ? 160  ALA B C   1 
ATOM   5420 O O   . ALA B 1 160 ? 27.295  -1.617  -48.127 1.00 44.08 ? 160  ALA B O   1 
ATOM   5421 C CB  . ALA B 1 160 ? 25.357  0.852   -48.465 1.00 42.33 ? 160  ALA B CB  1 
ATOM   5422 N N   . LEU B 1 161 ? 27.601  -0.855  -50.215 1.00 43.77 ? 161  LEU B N   1 
ATOM   5423 C CA  . LEU B 1 161 ? 29.043  -0.857  -50.135 1.00 44.42 ? 161  LEU B CA  1 
ATOM   5424 C C   . LEU B 1 161 ? 29.430  0.593   -50.316 1.00 44.58 ? 161  LEU B C   1 
ATOM   5425 O O   . LEU B 1 161 ? 29.630  1.043   -51.435 1.00 44.36 ? 161  LEU B O   1 
ATOM   5426 C CB  . LEU B 1 161 ? 29.667  -1.762  -51.197 1.00 44.69 ? 161  LEU B CB  1 
ATOM   5427 C CG  . LEU B 1 161 ? 29.446  -3.258  -50.940 1.00 44.82 ? 161  LEU B CG  1 
ATOM   5428 C CD1 . LEU B 1 161 ? 30.218  -4.070  -51.939 1.00 46.88 ? 161  LEU B CD1 1 
ATOM   5429 C CD2 . LEU B 1 161 ? 29.878  -3.633  -49.546 1.00 45.36 ? 161  LEU B CD2 1 
ATOM   5430 N N   . PRO B 1 162 ? 29.492  1.346   -49.204 1.00 45.12 ? 162  PRO B N   1 
ATOM   5431 C CA  . PRO B 1 162 ? 29.638  2.802   -49.300 1.00 45.80 ? 162  PRO B CA  1 
ATOM   5432 C C   . PRO B 1 162 ? 30.806  3.202   -50.183 1.00 46.56 ? 162  PRO B C   1 
ATOM   5433 O O   . PRO B 1 162 ? 31.876  2.604   -50.101 1.00 47.00 ? 162  PRO B O   1 
ATOM   5434 C CB  . PRO B 1 162 ? 29.864  3.223   -47.852 1.00 45.87 ? 162  PRO B CB  1 
ATOM   5435 C CG  . PRO B 1 162 ? 29.160  2.130   -47.056 1.00 45.37 ? 162  PRO B CG  1 
ATOM   5436 C CD  . PRO B 1 162 ? 29.427  0.883   -47.807 1.00 44.71 ? 162  PRO B CD  1 
ATOM   5437 N N   . GLY B 1 163 ? 30.584  4.175   -51.054 1.00 47.26 ? 163  GLY B N   1 
ATOM   5438 C CA  . GLY B 1 163 ? 31.645  4.659   -51.930 1.00 48.02 ? 163  GLY B CA  1 
ATOM   5439 C C   . GLY B 1 163 ? 31.664  3.949   -53.267 1.00 48.79 ? 163  GLY B C   1 
ATOM   5440 O O   . GLY B 1 163 ? 32.182  4.489   -54.252 1.00 48.92 ? 163  GLY B O   1 
ATOM   5441 N N   . SER B 1 164 ? 31.107  2.738   -53.305 1.00 49.22 ? 164  SER B N   1 
ATOM   5442 C CA  . SER B 1 164 ? 30.973  1.988   -54.551 1.00 49.51 ? 164  SER B CA  1 
ATOM   5443 C C   . SER B 1 164 ? 29.959  2.638   -55.498 1.00 49.96 ? 164  SER B C   1 
ATOM   5444 O O   . SER B 1 164 ? 29.149  3.465   -55.073 1.00 49.65 ? 164  SER B O   1 
ATOM   5445 C CB  . SER B 1 164 ? 30.555  0.554   -54.256 1.00 49.51 ? 164  SER B CB  1 
ATOM   5446 O OG  . SER B 1 164 ? 29.166  0.475   -54.006 1.00 49.24 ? 164  SER B OG  1 
ATOM   5447 N N   . ARG B 1 165 ? 30.015  2.251   -56.774 1.00 50.62 ? 165  ARG B N   1 
ATOM   5448 C CA  . ARG B 1 165 ? 29.076  2.735   -57.784 1.00 51.46 ? 165  ARG B CA  1 
ATOM   5449 C C   . ARG B 1 165 ? 27.813  1.890   -57.795 1.00 50.51 ? 165  ARG B C   1 
ATOM   5450 O O   . ARG B 1 165 ? 26.747  2.403   -58.101 1.00 50.91 ? 165  ARG B O   1 
ATOM   5451 C CB  . ARG B 1 165 ? 29.698  2.695   -59.184 1.00 51.68 ? 165  ARG B CB  1 
ATOM   5452 C CG  . ARG B 1 165 ? 29.007  3.600   -60.225 1.00 54.02 ? 165  ARG B CG  1 
ATOM   5453 C CD  . ARG B 1 165 ? 29.095  3.037   -61.678 1.00 54.58 ? 165  ARG B CD  1 
ATOM   5454 N NE  . ARG B 1 165 ? 27.831  2.431   -62.144 1.00 61.30 ? 165  ARG B NE  1 
ATOM   5455 C CZ  . ARG B 1 165 ? 27.673  1.159   -62.536 1.00 62.76 ? 165  ARG B CZ  1 
ATOM   5456 N NH1 . ARG B 1 165 ? 28.701  0.311   -62.551 1.00 62.96 ? 165  ARG B NH1 1 
ATOM   5457 N NH2 . ARG B 1 165 ? 26.476  0.732   -62.932 1.00 62.68 ? 165  ARG B NH2 1 
ATOM   5458 N N   . GLU B 1 166 ? 27.928  0.607   -57.455 1.00 49.57 ? 166  GLU B N   1 
ATOM   5459 C CA  . GLU B 1 166 ? 26.826  -0.345  -57.667 1.00 49.06 ? 166  GLU B CA  1 
ATOM   5460 C C   . GLU B 1 166 ? 25.950  -0.619  -56.463 1.00 47.57 ? 166  GLU B C   1 
ATOM   5461 O O   . GLU B 1 166 ? 24.918  -1.262  -56.593 1.00 47.84 ? 166  GLU B O   1 
ATOM   5462 C CB  . GLU B 1 166 ? 27.313  -1.675  -58.274 1.00 49.72 ? 166  GLU B CB  1 
ATOM   5463 C CG  . GLU B 1 166 ? 28.774  -2.016  -58.022 1.00 52.43 ? 166  GLU B CG  1 
ATOM   5464 C CD  . GLU B 1 166 ? 29.724  -1.145  -58.832 1.00 55.45 ? 166  GLU B CD  1 
ATOM   5465 O OE1 . GLU B 1 166 ? 29.613  -1.159  -60.079 1.00 55.90 ? 166  GLU B OE1 1 
ATOM   5466 O OE2 . GLU B 1 166 ? 30.567  -0.446  -58.210 1.00 57.02 ? 166  GLU B OE2 1 
ATOM   5467 N N   . ALA B 1 167 ? 26.368  -0.141  -55.300 1.00 45.91 ? 167  ALA B N   1 
ATOM   5468 C CA  . ALA B 1 167 ? 25.582  -0.234  -54.085 1.00 44.14 ? 167  ALA B CA  1 
ATOM   5469 C C   . ALA B 1 167 ? 25.934  0.955   -53.197 1.00 43.14 ? 167  ALA B C   1 
ATOM   5470 O O   . ALA B 1 167 ? 26.559  0.791   -52.165 1.00 42.89 ? 167  ALA B O   1 
ATOM   5471 C CB  . ALA B 1 167 ? 25.851  -1.544  -53.370 1.00 43.90 ? 167  ALA B CB  1 
ATOM   5472 N N   . PRO B 1 168 ? 25.547  2.170   -53.614 1.00 42.52 ? 168  PRO B N   1 
ATOM   5473 C CA  . PRO B 1 168 ? 25.846  3.381   -52.841 1.00 41.84 ? 168  PRO B CA  1 
ATOM   5474 C C   . PRO B 1 168 ? 25.119  3.491   -51.489 1.00 41.23 ? 168  PRO B C   1 
ATOM   5475 O O   . PRO B 1 168 ? 25.472  4.343   -50.680 1.00 41.62 ? 168  PRO B O   1 
ATOM   5476 C CB  . PRO B 1 168 ? 25.366  4.499   -53.766 1.00 41.52 ? 168  PRO B CB  1 
ATOM   5477 C CG  . PRO B 1 168 ? 24.306  3.861   -54.578 1.00 42.08 ? 168  PRO B CG  1 
ATOM   5478 C CD  . PRO B 1 168 ? 24.811  2.491   -54.849 1.00 42.19 ? 168  PRO B CD  1 
ATOM   5479 N N   . GLY B 1 169 ? 24.112  2.654   -51.254 1.00 40.19 ? 169  GLY B N   1 
ATOM   5480 C CA  . GLY B 1 169 ? 23.337  2.736   -50.026 1.00 38.71 ? 169  GLY B CA  1 
ATOM   5481 C C   . GLY B 1 169 ? 22.189  3.728   -50.090 1.00 37.60 ? 169  GLY B C   1 
ATOM   5482 O O   . GLY B 1 169 ? 22.103  4.546   -51.012 1.00 37.36 ? 169  GLY B O   1 
ATOM   5483 N N   . ASN B 1 170 ? 21.301  3.640   -49.109 1.00 36.72 ? 170  ASN B N   1 
ATOM   5484 C CA  . ASN B 1 170 ? 20.129  4.520   -49.012 1.00 36.21 ? 170  ASN B CA  1 
ATOM   5485 C C   . ASN B 1 170 ? 19.187  4.552   -50.232 1.00 35.74 ? 170  ASN B C   1 
ATOM   5486 O O   . ASN B 1 170 ? 18.548  5.583   -50.478 1.00 35.89 ? 170  ASN B O   1 
ATOM   5487 C CB  . ASN B 1 170 ? 20.556  5.965   -48.678 1.00 35.60 ? 170  ASN B CB  1 
ATOM   5488 C CG  . ASN B 1 170 ? 21.424  6.058   -47.447 1.00 34.63 ? 170  ASN B CG  1 
ATOM   5489 O OD1 . ASN B 1 170 ? 22.506  6.613   -47.496 1.00 38.20 ? 170  ASN B OD1 1 
ATOM   5490 N ND2 . ASN B 1 170 ? 20.956  5.536   -46.344 1.00 32.17 ? 170  ASN B ND2 1 
ATOM   5491 N N   . VAL B 1 171 ? 19.082  3.461   -50.989 1.00 35.16 ? 171  VAL B N   1 
ATOM   5492 C CA  . VAL B 1 171 ? 18.284  3.529   -52.217 1.00 34.91 ? 171  VAL B CA  1 
ATOM   5493 C C   . VAL B 1 171 ? 16.790  3.520   -51.872 1.00 35.08 ? 171  VAL B C   1 
ATOM   5494 O O   . VAL B 1 171 ? 15.974  4.197   -52.514 1.00 35.30 ? 171  VAL B O   1 
ATOM   5495 C CB  . VAL B 1 171 ? 18.700  2.499   -53.313 1.00 35.02 ? 171  VAL B CB  1 
ATOM   5496 C CG1 . VAL B 1 171 ? 20.157  2.701   -53.720 1.00 34.19 ? 171  VAL B CG1 1 
ATOM   5497 C CG2 . VAL B 1 171 ? 18.475  1.059   -52.876 1.00 35.25 ? 171  VAL B CG2 1 
ATOM   5498 N N   . GLY B 1 172 ? 16.444  2.810   -50.811 1.00 34.86 ? 172  GLY B N   1 
ATOM   5499 C CA  . GLY B 1 172 ? 15.090  2.885   -50.283 1.00 34.92 ? 172  GLY B CA  1 
ATOM   5500 C C   . GLY B 1 172 ? 14.692  4.323   -49.995 1.00 34.62 ? 172  GLY B C   1 
ATOM   5501 O O   . GLY B 1 172 ? 13.548  4.706   -50.165 1.00 34.73 ? 172  GLY B O   1 
ATOM   5502 N N   . LEU B 1 173 ? 15.645  5.128   -49.557 1.00 34.58 ? 173  LEU B N   1 
ATOM   5503 C CA  . LEU B 1 173 ? 15.329  6.495   -49.196 1.00 34.23 ? 173  LEU B CA  1 
ATOM   5504 C C   . LEU B 1 173 ? 15.187  7.294   -50.456 1.00 34.06 ? 173  LEU B C   1 
ATOM   5505 O O   . LEU B 1 173 ? 14.366  8.203   -50.518 1.00 34.95 ? 173  LEU B O   1 
ATOM   5506 C CB  . LEU B 1 173 ? 16.399  7.092   -48.279 1.00 34.53 ? 173  LEU B CB  1 
ATOM   5507 C CG  . LEU B 1 173 ? 16.386  6.651   -46.808 1.00 34.19 ? 173  LEU B CG  1 
ATOM   5508 C CD1 . LEU B 1 173 ? 17.707  6.987   -46.133 1.00 35.46 ? 173  LEU B CD1 1 
ATOM   5509 C CD2 . LEU B 1 173 ? 15.281  7.345   -46.103 1.00 34.11 ? 173  LEU B CD2 1 
ATOM   5510 N N   . LEU B 1 174 ? 15.973  6.948   -51.471 1.00 33.27 ? 174  LEU B N   1 
ATOM   5511 C CA  . LEU B 1 174 ? 15.864  7.600   -52.757 1.00 32.57 ? 174  LEU B CA  1 
ATOM   5512 C C   . LEU B 1 174 ? 14.563  7.221   -53.475 1.00 32.23 ? 174  LEU B C   1 
ATOM   5513 O O   . LEU B 1 174 ? 14.017  8.022   -54.235 1.00 31.43 ? 174  LEU B O   1 
ATOM   5514 C CB  . LEU B 1 174 ? 17.093  7.293   -53.616 1.00 32.97 ? 174  LEU B CB  1 
ATOM   5515 C CG  . LEU B 1 174 ? 18.421  7.970   -53.212 1.00 33.35 ? 174  LEU B CG  1 
ATOM   5516 C CD1 . LEU B 1 174 ? 19.546  7.577   -54.144 1.00 31.66 ? 174  LEU B CD1 1 
ATOM   5517 C CD2 . LEU B 1 174 ? 18.284  9.471   -53.203 1.00 32.56 ? 174  LEU B CD2 1 
ATOM   5518 N N   . ASP B 1 175 ? 14.092  5.989   -53.247 1.00 32.16 ? 175  ASP B N   1 
ATOM   5519 C CA  . ASP B 1 175 ? 12.790  5.537   -53.733 1.00 31.98 ? 175  ASP B CA  1 
ATOM   5520 C C   . ASP B 1 175 ? 11.724  6.496   -53.202 1.00 32.76 ? 175  ASP B C   1 
ATOM   5521 O O   . ASP B 1 175 ? 10.875  6.977   -53.959 1.00 33.33 ? 175  ASP B O   1 
ATOM   5522 C CB  . ASP B 1 175 ? 12.473  4.128   -53.224 1.00 31.36 ? 175  ASP B CB  1 
ATOM   5523 C CG  . ASP B 1 175 ? 13.344  3.049   -53.852 1.00 31.66 ? 175  ASP B CG  1 
ATOM   5524 O OD1 . ASP B 1 175 ? 14.073  3.345   -54.826 1.00 31.75 ? 175  ASP B OD1 1 
ATOM   5525 O OD2 . ASP B 1 175 ? 13.303  1.891   -53.354 1.00 30.02 ? 175  ASP B OD2 1 
ATOM   5526 N N   . GLN B 1 176 ? 11.773  6.764   -51.898 1.00 32.66 ? 176  GLN B N   1 
ATOM   5527 C CA  . GLN B 1 176 ? 10.886  7.719   -51.283 1.00 33.30 ? 176  GLN B CA  1 
ATOM   5528 C C   . GLN B 1 176 ? 11.056  9.095   -51.904 1.00 33.53 ? 176  GLN B C   1 
ATOM   5529 O O   . GLN B 1 176 ? 10.065  9.727   -52.256 1.00 33.59 ? 176  GLN B O   1 
ATOM   5530 C CB  . GLN B 1 176 ? 11.124  7.801   -49.779 1.00 33.56 ? 176  GLN B CB  1 
ATOM   5531 C CG  . GLN B 1 176 ? 10.886  6.489   -49.011 1.00 34.06 ? 176  GLN B CG  1 
ATOM   5532 C CD  . GLN B 1 176 ? 11.512  6.541   -47.618 1.00 33.52 ? 176  GLN B CD  1 
ATOM   5533 O OE1 . GLN B 1 176 ? 11.872  7.617   -47.137 1.00 30.33 ? 176  GLN B OE1 1 
ATOM   5534 N NE2 . GLN B 1 176 ? 11.629  5.382   -46.966 1.00 31.42 ? 176  GLN B NE2 1 
ATOM   5535 N N   . ARG B 1 177 ? 12.296  9.555   -52.052 1.00 33.92 ? 177  ARG B N   1 
ATOM   5536 C CA  . ARG B 1 177 ? 12.533  10.883  -52.624 1.00 34.70 ? 177  ARG B CA  1 
ATOM   5537 C C   . ARG B 1 177 ? 11.923  10.985  -54.010 1.00 35.05 ? 177  ARG B C   1 
ATOM   5538 O O   . ARG B 1 177 ? 11.274  11.990  -54.331 1.00 35.95 ? 177  ARG B O   1 
ATOM   5539 C CB  . ARG B 1 177 ? 14.019  11.231  -52.694 1.00 34.95 ? 177  ARG B CB  1 
ATOM   5540 C CG  . ARG B 1 177 ? 14.281  12.616  -53.255 1.00 35.94 ? 177  ARG B CG  1 
ATOM   5541 C CD  . ARG B 1 177 ? 15.733  12.991  -53.192 1.00 38.77 ? 177  ARG B CD  1 
ATOM   5542 N NE  . ARG B 1 177 ? 16.115  13.337  -51.826 1.00 42.82 ? 177  ARG B NE  1 
ATOM   5543 C CZ  . ARG B 1 177 ? 17.340  13.187  -51.325 1.00 43.25 ? 177  ARG B CZ  1 
ATOM   5544 N NH1 . ARG B 1 177 ? 18.319  12.690  -52.076 1.00 42.52 ? 177  ARG B NH1 1 
ATOM   5545 N NH2 . ARG B 1 177 ? 17.580  13.534  -50.067 1.00 42.80 ? 177  ARG B NH2 1 
ATOM   5546 N N   . LEU B 1 178 ? 12.107  9.948   -54.826 1.00 34.60 ? 178  LEU B N   1 
ATOM   5547 C CA  . LEU B 1 178 ? 11.529  9.942   -56.174 1.00 34.29 ? 178  LEU B CA  1 
ATOM   5548 C C   . LEU B 1 178 ? 9.997   10.030  -56.145 1.00 33.92 ? 178  LEU B C   1 
ATOM   5549 O O   . LEU B 1 178 ? 9.397   10.670  -56.999 1.00 33.86 ? 178  LEU B O   1 
ATOM   5550 C CB  . LEU B 1 178 ? 12.001  8.734   -56.993 1.00 33.92 ? 178  LEU B CB  1 
ATOM   5551 C CG  . LEU B 1 178 ? 11.621  8.647   -58.479 1.00 33.83 ? 178  LEU B CG  1 
ATOM   5552 C CD1 . LEU B 1 178 ? 12.007  9.889   -59.268 1.00 31.15 ? 178  LEU B CD1 1 
ATOM   5553 C CD2 . LEU B 1 178 ? 12.273  7.435   -59.092 1.00 34.05 ? 178  LEU B CD2 1 
ATOM   5554 N N   . ALA B 1 179 ? 9.373   9.387   -55.166 1.00 33.82 ? 179  ALA B N   1 
ATOM   5555 C CA  . ALA B 1 179 ? 7.926   9.463   -55.018 1.00 33.61 ? 179  ALA B CA  1 
ATOM   5556 C C   . ALA B 1 179 ? 7.508   10.887  -54.597 1.00 34.34 ? 179  ALA B C   1 
ATOM   5557 O O   . ALA B 1 179 ? 6.483   11.398  -55.034 1.00 34.24 ? 179  ALA B O   1 
ATOM   5558 C CB  . ALA B 1 179 ? 7.471   8.460   -54.029 1.00 33.18 ? 179  ALA B CB  1 
ATOM   5559 N N   . LEU B 1 180 ? 8.323   11.535  -53.769 1.00 34.71 ? 180  LEU B N   1 
ATOM   5560 C CA  . LEU B 1 180 ? 8.059   12.917  -53.413 1.00 35.53 ? 180  LEU B CA  1 
ATOM   5561 C C   . LEU B 1 180 ? 8.200   13.805  -54.632 1.00 36.26 ? 180  LEU B C   1 
ATOM   5562 O O   . LEU B 1 180 ? 7.366   14.695  -54.824 1.00 36.69 ? 180  LEU B O   1 
ATOM   5563 C CB  . LEU B 1 180 ? 8.948   13.409  -52.259 1.00 34.94 ? 180  LEU B CB  1 
ATOM   5564 C CG  . LEU B 1 180 ? 9.038   12.545  -50.993 1.00 34.41 ? 180  LEU B CG  1 
ATOM   5565 C CD1 . LEU B 1 180 ? 9.726   13.310  -49.885 1.00 35.01 ? 180  LEU B CD1 1 
ATOM   5566 C CD2 . LEU B 1 180 ? 7.708   12.011  -50.503 1.00 32.05 ? 180  LEU B CD2 1 
ATOM   5567 N N   . GLN B 1 181 ? 9.244   13.556  -55.439 1.00 37.14 ? 181  GLN B N   1 
ATOM   5568 C CA  . GLN B 1 181 ? 9.470   14.251  -56.722 1.00 37.93 ? 181  GLN B CA  1 
ATOM   5569 C C   . GLN B 1 181 ? 8.271   14.032  -57.614 1.00 37.73 ? 181  GLN B C   1 
ATOM   5570 O O   . GLN B 1 181 ? 7.762   14.970  -58.222 1.00 37.71 ? 181  GLN B O   1 
ATOM   5571 C CB  . GLN B 1 181 ? 10.717  13.720  -57.443 1.00 38.06 ? 181  GLN B CB  1 
ATOM   5572 C CG  . GLN B 1 181 ? 11.878  14.706  -57.587 1.00 42.07 ? 181  GLN B CG  1 
ATOM   5573 C CD  . GLN B 1 181 ? 13.287  14.039  -57.438 1.00 46.93 ? 181  GLN B CD  1 
ATOM   5574 O OE1 . GLN B 1 181 ? 13.462  12.838  -57.703 1.00 49.25 ? 181  GLN B OE1 1 
ATOM   5575 N NE2 . GLN B 1 181 ? 14.279  14.828  -57.005 1.00 46.21 ? 181  GLN B NE2 1 
ATOM   5576 N N   . TRP B 1 182 ? 7.810   12.786  -57.669 1.00 37.65 ? 182  TRP B N   1 
ATOM   5577 C CA  . TRP B 1 182 ? 6.653   12.445  -58.458 1.00 37.61 ? 182  TRP B CA  1 
ATOM   5578 C C   . TRP B 1 182 ? 5.448   13.267  -58.049 1.00 37.92 ? 182  TRP B C   1 
ATOM   5579 O O   . TRP B 1 182 ? 4.667   13.677  -58.906 1.00 38.15 ? 182  TRP B O   1 
ATOM   5580 C CB  . TRP B 1 182 ? 6.313   10.975  -58.311 1.00 37.26 ? 182  TRP B CB  1 
ATOM   5581 C CG  . TRP B 1 182 ? 5.247   10.548  -59.262 1.00 37.74 ? 182  TRP B CG  1 
ATOM   5582 C CD1 . TRP B 1 182 ? 5.424   10.113  -60.542 1.00 37.62 ? 182  TRP B CD1 1 
ATOM   5583 C CD2 . TRP B 1 182 ? 3.834   10.522  -59.022 1.00 37.72 ? 182  TRP B CD2 1 
ATOM   5584 N NE1 . TRP B 1 182 ? 4.214   9.807   -61.109 1.00 37.63 ? 182  TRP B NE1 1 
ATOM   5585 C CE2 . TRP B 1 182 ? 3.221   10.036  -60.200 1.00 36.55 ? 182  TRP B CE2 1 
ATOM   5586 C CE3 . TRP B 1 182 ? 3.030   10.843  -57.922 1.00 37.84 ? 182  TRP B CE3 1 
ATOM   5587 C CZ2 . TRP B 1 182 ? 1.846   9.881   -60.323 1.00 37.14 ? 182  TRP B CZ2 1 
ATOM   5588 C CZ3 . TRP B 1 182 ? 1.652   10.681  -58.039 1.00 38.35 ? 182  TRP B CZ3 1 
ATOM   5589 C CH2 . TRP B 1 182 ? 1.074   10.202  -59.237 1.00 38.49 ? 182  TRP B CH2 1 
ATOM   5590 N N   . VAL B 1 183 ? 5.297   13.469  -56.740 1.00 38.08 ? 183  VAL B N   1 
ATOM   5591 C CA  . VAL B 1 183 ? 4.200   14.235  -56.185 1.00 38.56 ? 183  VAL B CA  1 
ATOM   5592 C C   . VAL B 1 183 ? 4.282   15.705  -56.643 1.00 39.41 ? 183  VAL B C   1 
ATOM   5593 O O   . VAL B 1 183 ? 3.289   16.253  -57.109 1.00 39.07 ? 183  VAL B O   1 
ATOM   5594 C CB  . VAL B 1 183 ? 4.118   14.071  -54.642 1.00 38.57 ? 183  VAL B CB  1 
ATOM   5595 C CG1 . VAL B 1 183 ? 3.147   15.060  -54.011 1.00 37.30 ? 183  VAL B CG1 1 
ATOM   5596 C CG2 . VAL B 1 183 ? 3.722   12.641  -54.285 1.00 37.83 ? 183  VAL B CG2 1 
ATOM   5597 N N   . GLN B 1 184 ? 5.463   16.317  -56.560 1.00 40.12 ? 184  GLN B N   1 
ATOM   5598 C CA  . GLN B 1 184 ? 5.639   17.694  -57.032 1.00 40.95 ? 184  GLN B CA  1 
ATOM   5599 C C   . GLN B 1 184 ? 5.176   17.869  -58.471 1.00 41.85 ? 184  GLN B C   1 
ATOM   5600 O O   . GLN B 1 184 ? 4.545   18.870  -58.810 1.00 41.64 ? 184  GLN B O   1 
ATOM   5601 C CB  . GLN B 1 184 ? 7.102   18.145  -56.940 1.00 40.83 ? 184  GLN B CB  1 
ATOM   5602 C CG  . GLN B 1 184 ? 7.559   18.631  -55.582 1.00 41.20 ? 184  GLN B CG  1 
ATOM   5603 C CD  . GLN B 1 184 ? 6.542   19.519  -54.882 1.00 42.81 ? 184  GLN B CD  1 
ATOM   5604 O OE1 . GLN B 1 184 ? 6.008   19.150  -53.837 1.00 40.79 ? 184  GLN B OE1 1 
ATOM   5605 N NE2 . GLN B 1 184 ? 6.263   20.693  -55.458 1.00 43.50 ? 184  GLN B NE2 1 
ATOM   5606 N N   . GLU B 1 185 ? 5.511   16.897  -59.313 1.00 42.83 ? 185  GLU B N   1 
ATOM   5607 C CA  . GLU B 1 185 ? 5.265   16.991  -60.751 1.00 44.01 ? 185  GLU B CA  1 
ATOM   5608 C C   . GLU B 1 185 ? 3.853   16.558  -61.151 1.00 43.37 ? 185  GLU B C   1 
ATOM   5609 O O   . GLU B 1 185 ? 3.341   16.999  -62.180 1.00 43.57 ? 185  GLU B O   1 
ATOM   5610 C CB  . GLU B 1 185 ? 6.275   16.146  -61.527 1.00 43.82 ? 185  GLU B CB  1 
ATOM   5611 C CG  . GLU B 1 185 ? 7.752   16.514  -61.321 1.00 46.41 ? 185  GLU B CG  1 
ATOM   5612 C CD  . GLU B 1 185 ? 8.696   15.435  -61.871 1.00 46.85 ? 185  GLU B CD  1 
ATOM   5613 O OE1 . GLU B 1 185 ? 8.219   14.317  -62.175 1.00 50.85 ? 185  GLU B OE1 1 
ATOM   5614 O OE2 . GLU B 1 185 ? 9.915   15.699  -61.991 1.00 51.00 ? 185  GLU B OE2 1 
ATOM   5615 N N   . ASN B 1 186 ? 3.225   15.698  -60.359 1.00 42.78 ? 186  ASN B N   1 
ATOM   5616 C CA  . ASN B 1 186 ? 1.954   15.115  -60.785 1.00 42.46 ? 186  ASN B CA  1 
ATOM   5617 C C   . ASN B 1 186 ? 0.729   15.337  -59.914 1.00 42.17 ? 186  ASN B C   1 
ATOM   5618 O O   . ASN B 1 186 ? -0.392  15.156  -60.385 1.00 42.63 ? 186  ASN B O   1 
ATOM   5619 C CB  . ASN B 1 186 ? 2.127   13.629  -61.055 1.00 42.60 ? 186  ASN B CB  1 
ATOM   5620 C CG  . ASN B 1 186 ? 3.115   13.370  -62.146 1.00 43.32 ? 186  ASN B CG  1 
ATOM   5621 O OD1 . ASN B 1 186 ? 2.801   13.533  -63.321 1.00 45.51 ? 186  ASN B OD1 1 
ATOM   5622 N ND2 . ASN B 1 186 ? 4.329   12.994  -61.772 1.00 43.23 ? 186  ASN B ND2 1 
ATOM   5623 N N   . ILE B 1 187 ? 0.920   15.720  -58.657 1.00 41.77 ? 187  ILE B N   1 
ATOM   5624 C CA  . ILE B 1 187 ? -0.195  15.724  -57.725 1.00 41.25 ? 187  ILE B CA  1 
ATOM   5625 C C   . ILE B 1 187 ? -1.289  16.739  -58.086 1.00 41.14 ? 187  ILE B C   1 
ATOM   5626 O O   . ILE B 1 187 ? -2.462  16.483  -57.841 1.00 40.66 ? 187  ILE B O   1 
ATOM   5627 C CB  . ILE B 1 187 ? 0.260   15.828  -56.241 1.00 41.22 ? 187  ILE B CB  1 
ATOM   5628 C CG1 . ILE B 1 187 ? -0.723  15.101  -55.322 1.00 40.16 ? 187  ILE B CG1 1 
ATOM   5629 C CG2 . ILE B 1 187 ? 0.468   17.291  -55.805 1.00 41.36 ? 187  ILE B CG2 1 
ATOM   5630 C CD1 . ILE B 1 187 ? -0.876  13.626  -55.645 1.00 38.79 ? 187  ILE B CD1 1 
ATOM   5631 N N   . ALA B 1 188 ? -0.908  17.864  -58.690 1.00 41.35 ? 188  ALA B N   1 
ATOM   5632 C CA  . ALA B 1 188 ? -1.892  18.852  -59.156 1.00 41.81 ? 188  ALA B CA  1 
ATOM   5633 C C   . ALA B 1 188 ? -2.968  18.229  -60.064 1.00 42.11 ? 188  ALA B C   1 
ATOM   5634 O O   . ALA B 1 188 ? -4.146  18.590  -59.978 1.00 42.46 ? 188  ALA B O   1 
ATOM   5635 C CB  . ALA B 1 188 ? -1.211  20.006  -59.858 1.00 41.81 ? 188  ALA B CB  1 
ATOM   5636 N N   . ALA B 1 189 ? -2.557  17.277  -60.902 1.00 42.02 ? 189  ALA B N   1 
ATOM   5637 C CA  . ALA B 1 189 ? -3.463  16.550  -61.795 1.00 41.97 ? 189  ALA B CA  1 
ATOM   5638 C C   . ALA B 1 189 ? -4.599  15.895  -61.027 1.00 42.05 ? 189  ALA B C   1 
ATOM   5639 O O   . ALA B 1 189 ? -5.666  15.645  -61.586 1.00 42.29 ? 189  ALA B O   1 
ATOM   5640 C CB  . ALA B 1 189 ? -2.694  15.502  -62.587 1.00 41.84 ? 189  ALA B CB  1 
ATOM   5641 N N   . PHE B 1 190 ? -4.351  15.626  -59.748 1.00 41.89 ? 190  PHE B N   1 
ATOM   5642 C CA  . PHE B 1 190 ? -5.309  15.007  -58.863 1.00 41.86 ? 190  PHE B CA  1 
ATOM   5643 C C   . PHE B 1 190 ? -6.011  16.048  -57.985 1.00 42.41 ? 190  PHE B C   1 
ATOM   5644 O O   . PHE B 1 190 ? -6.910  15.710  -57.208 1.00 42.46 ? 190  PHE B O   1 
ATOM   5645 C CB  . PHE B 1 190 ? -4.587  14.014  -57.965 1.00 41.51 ? 190  PHE B CB  1 
ATOM   5646 C CG  . PHE B 1 190 ? -3.945  12.873  -58.700 1.00 41.43 ? 190  PHE B CG  1 
ATOM   5647 C CD1 . PHE B 1 190 ? -2.697  13.020  -59.291 1.00 40.77 ? 190  PHE B CD1 1 
ATOM   5648 C CD2 . PHE B 1 190 ? -4.569  11.635  -58.770 1.00 41.03 ? 190  PHE B CD2 1 
ATOM   5649 C CE1 . PHE B 1 190 ? -2.094  11.962  -59.952 1.00 39.35 ? 190  PHE B CE1 1 
ATOM   5650 C CE2 . PHE B 1 190 ? -3.964  10.572  -59.440 1.00 40.71 ? 190  PHE B CE2 1 
ATOM   5651 C CZ  . PHE B 1 190 ? -2.727  10.744  -60.030 1.00 39.39 ? 190  PHE B CZ  1 
ATOM   5652 N N   . GLY B 1 191 ? -5.594  17.310  -58.099 1.00 42.84 ? 191  GLY B N   1 
ATOM   5653 C CA  . GLY B 1 191 ? -6.136  18.387  -57.257 1.00 43.20 ? 191  GLY B CA  1 
ATOM   5654 C C   . GLY B 1 191 ? -5.451  18.500  -55.901 1.00 43.46 ? 191  GLY B C   1 
ATOM   5655 O O   . GLY B 1 191 ? -5.938  19.189  -54.991 1.00 43.69 ? 191  GLY B O   1 
ATOM   5656 N N   . GLY B 1 192 ? -4.334  17.797  -55.752 1.00 43.34 ? 192  GLY B N   1 
ATOM   5657 C CA  . GLY B 1 192 ? -3.446  18.005  -54.619 1.00 43.03 ? 192  GLY B CA  1 
ATOM   5658 C C   . GLY B 1 192 ? -2.632  19.259  -54.860 1.00 42.49 ? 192  GLY B C   1 
ATOM   5659 O O   . GLY B 1 192 ? -2.403  19.638  -56.000 1.00 42.44 ? 192  GLY B O   1 
ATOM   5660 N N   . ASP B 1 193 ? -2.209  19.903  -53.778 1.00 42.69 ? 193  ASP B N   1 
ATOM   5661 C CA  . ASP B 1 193 ? -1.427  21.141  -53.827 1.00 42.76 ? 193  ASP B CA  1 
ATOM   5662 C C   . ASP B 1 193 ? 0.042   20.803  -53.620 1.00 42.85 ? 193  ASP B C   1 
ATOM   5663 O O   . ASP B 1 193 ? 0.420   20.448  -52.513 1.00 43.36 ? 193  ASP B O   1 
ATOM   5664 C CB  . ASP B 1 193 ? -1.890  22.052  -52.691 1.00 42.41 ? 193  ASP B CB  1 
ATOM   5665 C CG  . ASP B 1 193 ? -1.345  23.482  -52.788 1.00 42.31 ? 193  ASP B CG  1 
ATOM   5666 O OD1 . ASP B 1 193 ? -0.490  23.790  -53.647 1.00 39.84 ? 193  ASP B OD1 1 
ATOM   5667 O OD2 . ASP B 1 193 ? -1.812  24.310  -51.972 1.00 43.68 ? 193  ASP B OD2 1 
ATOM   5668 N N   . PRO B 1 194 ? 0.877   20.903  -54.670 1.00 42.95 ? 194  PRO B N   1 
ATOM   5669 C CA  . PRO B 1 194 ? 2.298   20.577  -54.460 1.00 43.14 ? 194  PRO B CA  1 
ATOM   5670 C C   . PRO B 1 194 ? 2.983   21.573  -53.533 1.00 43.59 ? 194  PRO B C   1 
ATOM   5671 O O   . PRO B 1 194 ? 4.098   21.330  -53.051 1.00 44.05 ? 194  PRO B O   1 
ATOM   5672 C CB  . PRO B 1 194 ? 2.898   20.656  -55.873 1.00 42.84 ? 194  PRO B CB  1 
ATOM   5673 C CG  . PRO B 1 194 ? 1.959   21.546  -56.637 1.00 42.68 ? 194  PRO B CG  1 
ATOM   5674 C CD  . PRO B 1 194 ? 0.592   21.279  -56.068 1.00 42.83 ? 194  PRO B CD  1 
ATOM   5675 N N   . MET B 1 195 ? 2.327   22.690  -53.273 1.00 43.77 ? 195  MET B N   1 
ATOM   5676 C CA  . MET B 1 195 ? 2.926   23.696  -52.403 1.00 44.88 ? 195  MET B CA  1 
ATOM   5677 C C   . MET B 1 195 ? 2.588   23.499  -50.938 1.00 42.79 ? 195  MET B C   1 
ATOM   5678 O O   . MET B 1 195 ? 3.140   24.174  -50.061 1.00 42.58 ? 195  MET B O   1 
ATOM   5679 C CB  . MET B 1 195 ? 2.614   25.098  -52.889 1.00 44.37 ? 195  MET B CB  1 
ATOM   5680 C CG  . MET B 1 195 ? 3.371   25.390  -54.153 1.00 45.88 ? 195  MET B CG  1 
ATOM   5681 S SD  . MET B 1 195 ? 3.345   27.137  -54.461 1.00 51.36 ? 195  MET B SD  1 
ATOM   5682 C CE  . MET B 1 195 ? 1.600   27.416  -54.863 1.00 53.02 ? 195  MET B CE  1 
ATOM   5683 N N   . SER B 1 196 ? 1.722   22.526  -50.685 1.00 40.96 ? 196  SER B N   1 
ATOM   5684 C CA  . SER B 1 196 ? 1.458   22.096  -49.334 1.00 39.53 ? 196  SER B CA  1 
ATOM   5685 C C   . SER B 1 196 ? 1.522   20.582  -49.234 1.00 38.04 ? 196  SER B C   1 
ATOM   5686 O O   . SER B 1 196 ? 0.502   19.891  -49.290 1.00 37.43 ? 196  SER B O   1 
ATOM   5687 C CB  . SER B 1 196 ? 0.117   22.624  -48.827 1.00 39.58 ? 196  SER B CB  1 
ATOM   5688 O OG  . SER B 1 196 ? -0.155  22.072  -47.552 1.00 39.87 ? 196  SER B OG  1 
ATOM   5689 N N   . VAL B 1 197 ? 2.741   20.082  -49.081 1.00 36.49 ? 197  VAL B N   1 
ATOM   5690 C CA  . VAL B 1 197 ? 2.985   18.654  -48.908 1.00 34.95 ? 197  VAL B CA  1 
ATOM   5691 C C   . VAL B 1 197 ? 3.512   18.401  -47.511 1.00 33.96 ? 197  VAL B C   1 
ATOM   5692 O O   . VAL B 1 197 ? 4.568   18.900  -47.148 1.00 34.35 ? 197  VAL B O   1 
ATOM   5693 C CB  . VAL B 1 197 ? 4.017   18.131  -49.937 1.00 35.05 ? 197  VAL B CB  1 
ATOM   5694 C CG1 . VAL B 1 197 ? 4.348   16.669  -49.668 1.00 34.31 ? 197  VAL B CG1 1 
ATOM   5695 C CG2 . VAL B 1 197 ? 3.505   18.338  -51.368 1.00 33.91 ? 197  VAL B CG2 1 
ATOM   5696 N N   . THR B 1 198 ? 2.761   17.638  -46.732 1.00 32.80 ? 198  THR B N   1 
ATOM   5697 C CA  . THR B 1 198 ? 3.178   17.188  -45.421 1.00 32.02 ? 198  THR B CA  1 
ATOM   5698 C C   . THR B 1 198 ? 3.572   15.723  -45.486 1.00 31.50 ? 198  THR B C   1 
ATOM   5699 O O   . THR B 1 198 ? 2.791   14.899  -45.971 1.00 31.87 ? 198  THR B O   1 
ATOM   5700 C CB  . THR B 1 198 ? 2.006   17.270  -44.435 1.00 32.07 ? 198  THR B CB  1 
ATOM   5701 O OG1 . THR B 1 198 ? 1.440   18.576  -44.502 1.00 33.21 ? 198  THR B OG1 1 
ATOM   5702 C CG2 . THR B 1 198 ? 2.463   16.979  -43.010 1.00 30.65 ? 198  THR B CG2 1 
ATOM   5703 N N   . LEU B 1 199 ? 4.765   15.398  -44.995 1.00 30.49 ? 199  LEU B N   1 
ATOM   5704 C CA  . LEU B 1 199 ? 5.170   14.008  -44.872 1.00 29.63 ? 199  LEU B CA  1 
ATOM   5705 C C   . LEU B 1 199 ? 4.717   13.522  -43.544 1.00 29.68 ? 199  LEU B C   1 
ATOM   5706 O O   . LEU B 1 199 ? 4.779   14.266  -42.560 1.00 30.33 ? 199  LEU B O   1 
ATOM   5707 C CB  . LEU B 1 199 ? 6.692   13.845  -44.927 1.00 29.31 ? 199  LEU B CB  1 
ATOM   5708 C CG  . LEU B 1 199 ? 7.473   14.463  -46.086 1.00 28.47 ? 199  LEU B CG  1 
ATOM   5709 C CD1 . LEU B 1 199 ? 8.939   14.059  -46.004 1.00 27.04 ? 199  LEU B CD1 1 
ATOM   5710 C CD2 . LEU B 1 199 ? 6.867   14.129  -47.443 1.00 27.76 ? 199  LEU B CD2 1 
ATOM   5711 N N   . PHE B 1 200 ? 4.290   12.269  -43.489 1.00 28.98 ? 200  PHE B N   1 
ATOM   5712 C CA  . PHE B 1 200 ? 4.109   11.616  -42.210 1.00 28.68 ? 200  PHE B CA  1 
ATOM   5713 C C   . PHE B 1 200 ? 4.465   10.146  -42.303 1.00 28.93 ? 200  PHE B C   1 
ATOM   5714 O O   . PHE B 1 200 ? 4.454   9.553   -43.384 1.00 29.61 ? 200  PHE B O   1 
ATOM   5715 C CB  . PHE B 1 200 ? 2.708   11.896  -41.614 1.00 28.59 ? 200  PHE B CB  1 
ATOM   5716 C CG  . PHE B 1 200 ? 1.552   11.187  -42.290 1.00 27.29 ? 200  PHE B CG  1 
ATOM   5717 C CD1 . PHE B 1 200 ? 1.337   11.275  -43.652 1.00 26.29 ? 200  PHE B CD1 1 
ATOM   5718 C CD2 . PHE B 1 200 ? 0.608   10.514  -41.513 1.00 27.52 ? 200  PHE B CD2 1 
ATOM   5719 C CE1 . PHE B 1 200 ? 0.215   10.654  -44.244 1.00 26.18 ? 200  PHE B CE1 1 
ATOM   5720 C CE2 . PHE B 1 200 ? -0.497  9.890   -42.083 1.00 23.74 ? 200  PHE B CE2 1 
ATOM   5721 C CZ  . PHE B 1 200 ? -0.688  9.960   -43.454 1.00 25.59 ? 200  PHE B CZ  1 
ATOM   5722 N N   . GLY B 1 201 ? 4.841   9.563   -41.182 1.00 28.78 ? 201  GLY B N   1 
ATOM   5723 C CA  . GLY B 1 201 ? 5.351   8.196   -41.194 1.00 28.82 ? 201  GLY B CA  1 
ATOM   5724 C C   . GLY B 1 201 ? 5.469   7.732   -39.774 1.00 29.18 ? 201  GLY B C   1 
ATOM   5725 O O   . GLY B 1 201 ? 5.439   8.544   -38.851 1.00 29.48 ? 201  GLY B O   1 
ATOM   5726 N N   . GLU B 1 202 ? 5.597   6.428   -39.591 1.00 29.81 ? 202  GLU B N   1 
ATOM   5727 C CA  . GLU B 1 202 ? 5.714   5.854   -38.261 1.00 30.33 ? 202  GLU B CA  1 
ATOM   5728 C C   . GLU B 1 202 ? 6.921   4.917   -38.224 1.00 31.14 ? 202  GLU B C   1 
ATOM   5729 O O   . GLU B 1 202 ? 7.311   4.382   -39.258 1.00 30.87 ? 202  GLU B O   1 
ATOM   5730 C CB  . GLU B 1 202 ? 4.413   5.140   -37.883 1.00 29.66 ? 202  GLU B CB  1 
ATOM   5731 C CG  . GLU B 1 202 ? 4.328   4.635   -36.464 1.00 29.47 ? 202  GLU B CG  1 
ATOM   5732 C CD  . GLU B 1 202 ? 4.736   3.186   -36.359 1.00 31.83 ? 202  GLU B CD  1 
ATOM   5733 O OE1 . GLU B 1 202 ? 4.877   2.542   -37.415 1.00 33.61 ? 202  GLU B OE1 1 
ATOM   5734 O OE2 . GLU B 1 202 ? 4.928   2.681   -35.233 1.00 32.13 ? 202  GLU B OE2 1 
HETATM 5735 N N   . SXE B 1 203 ? 7.516   4.758   -37.034 1.00 32.06 ? 203  SXE B N   1 
HETATM 5736 C CA  . SXE B 1 203 ? 8.717   3.955   -36.818 1.00 33.41 ? 203  SXE B CA  1 
HETATM 5737 C C   . SXE B 1 203 ? 9.778   4.295   -37.888 1.00 32.96 ? 203  SXE B C   1 
HETATM 5738 O O   . SXE B 1 203 ? 10.130  5.466   -38.038 1.00 33.11 ? 203  SXE B O   1 
HETATM 5739 C CB  . SXE B 1 203 ? 8.328   2.475   -36.769 1.00 33.42 ? 203  SXE B CB  1 
HETATM 5740 O OG  . SXE B 1 203 ? 9.379   1.617   -36.339 1.00 40.98 ? 203  SXE B OG  1 
HETATM 5741 O O1  . SXE B 1 203 ? 9.621   0.647   -38.355 1.00 71.19 ? 203  SXE B O1  1 
HETATM 5742 P P1  . SXE B 1 203 ? 9.041   0.156   -36.946 1.00 68.38 ? 203  SXE B P1  1 
HETATM 5743 N N1  . SXE B 1 203 ? 7.264   -0.104  -37.054 1.00 72.14 ? 203  SXE B N1  1 
HETATM 5744 C C1  . SXE B 1 203 ? 6.486   -1.314  -37.394 1.00 72.43 ? 203  SXE B C1  1 
HETATM 5745 C C3  . SXE B 1 203 ? 5.552   -1.761  -36.265 1.00 72.03 ? 203  SXE B C3  1 
HETATM 5746 C C2  . SXE B 1 203 ? 5.629   -1.102  -38.639 1.00 72.31 ? 203  SXE B C2  1 
HETATM 5747 O O2  . SXE B 1 203 ? 9.837   -1.188  -36.499 1.00 71.98 ? 203  SXE B O2  1 
HETATM 5748 C C4  . SXE B 1 203 ? 9.176   -2.374  -36.031 1.00 72.53 ? 203  SXE B C4  1 
HETATM 5749 C C5  . SXE B 1 203 ? 9.396   -3.556  -36.957 1.00 73.15 ? 203  SXE B C5  1 
ATOM   5750 N N   . ALA B 1 204 ? 10.273  3.307   -38.640 1.00 32.67 ? 204  ALA B N   1 
ATOM   5751 C CA  . ALA B 1 204 ? 11.231  3.591   -39.735 1.00 32.18 ? 204  ALA B CA  1 
ATOM   5752 C C   . ALA B 1 204 ? 10.714  4.656   -40.708 1.00 31.71 ? 204  ALA B C   1 
ATOM   5753 O O   . ALA B 1 204 ? 11.495  5.465   -41.222 1.00 31.71 ? 204  ALA B O   1 
ATOM   5754 C CB  . ALA B 1 204 ? 11.601  2.329   -40.488 1.00 31.48 ? 204  ALA B CB  1 
ATOM   5755 N N   . GLY B 1 205 ? 9.405   4.652   -40.957 1.00 31.03 ? 205  GLY B N   1 
ATOM   5756 C CA  . GLY B 1 205 ? 8.776   5.704   -41.767 1.00 30.66 ? 205  GLY B CA  1 
ATOM   5757 C C   . GLY B 1 205 ? 8.998   7.084   -41.153 1.00 30.23 ? 205  GLY B C   1 
ATOM   5758 O O   . GLY B 1 205 ? 9.239   8.067   -41.861 1.00 30.66 ? 205  GLY B O   1 
ATOM   5759 N N   . ALA B 1 206 ? 8.959   7.139   -39.828 1.00 29.27 ? 206  ALA B N   1 
ATOM   5760 C CA  . ALA B 1 206 ? 9.246   8.348   -39.104 1.00 28.79 ? 206  ALA B CA  1 
ATOM   5761 C C   . ALA B 1 206 ? 10.718  8.730   -39.253 1.00 28.72 ? 206  ALA B C   1 
ATOM   5762 O O   . ALA B 1 206 ? 11.014  9.861   -39.638 1.00 28.41 ? 206  ALA B O   1 
ATOM   5763 C CB  . ALA B 1 206 ? 8.848   8.196   -37.647 1.00 28.89 ? 206  ALA B CB  1 
ATOM   5764 N N   . ALA B 1 207 ? 11.630  7.792   -38.969 1.00 28.81 ? 207  ALA B N   1 
ATOM   5765 C CA  . ALA B 1 207 ? 13.062  7.968   -39.288 1.00 28.53 ? 207  ALA B CA  1 
ATOM   5766 C C   . ALA B 1 207 ? 13.285  8.420   -40.724 1.00 28.87 ? 207  ALA B C   1 
ATOM   5767 O O   . ALA B 1 207 ? 14.122  9.302   -40.968 1.00 29.42 ? 207  ALA B O   1 
ATOM   5768 C CB  . ALA B 1 207 ? 13.828  6.697   -39.032 1.00 28.36 ? 207  ALA B CB  1 
ATOM   5769 N N   . SER B 1 208 ? 12.541  7.843   -41.676 1.00 29.01 ? 208  SER B N   1 
ATOM   5770 C CA  . SER B 1 208 ? 12.656  8.277   -43.084 1.00 29.63 ? 208  SER B CA  1 
ATOM   5771 C C   . SER B 1 208 ? 12.214  9.719   -43.258 1.00 30.04 ? 208  SER B C   1 
ATOM   5772 O O   . SER B 1 208 ? 12.910  10.489  -43.883 1.00 30.64 ? 208  SER B O   1 
ATOM   5773 C CB  . SER B 1 208 ? 11.889  7.376   -44.034 1.00 29.39 ? 208  SER B CB  1 
ATOM   5774 O OG  . SER B 1 208 ? 12.176  6.011   -43.795 1.00 30.94 ? 208  SER B OG  1 
ATOM   5775 N N   . VAL B 1 209 ? 11.082  10.102  -42.677 1.00 30.56 ? 209  VAL B N   1 
ATOM   5776 C CA  . VAL B 1 209 ? 10.670  11.512  -42.705 1.00 31.09 ? 209  VAL B CA  1 
ATOM   5777 C C   . VAL B 1 209 ? 11.816  12.380  -42.168 1.00 32.25 ? 209  VAL B C   1 
ATOM   5778 O O   . VAL B 1 209 ? 12.210  13.373  -42.797 1.00 32.84 ? 209  VAL B O   1 
ATOM   5779 C CB  . VAL B 1 209 ? 9.373   11.779  -41.883 1.00 30.83 ? 209  VAL B CB  1 
ATOM   5780 C CG1 . VAL B 1 209 ? 9.039   13.230  -41.905 1.00 29.65 ? 209  VAL B CG1 1 
ATOM   5781 C CG2 . VAL B 1 209 ? 8.205   10.985  -42.436 1.00 29.78 ? 209  VAL B CG2 1 
ATOM   5782 N N   . GLY B 1 210 ? 12.373  11.987  -41.025 1.00 32.86 ? 210  GLY B N   1 
ATOM   5783 C CA  . GLY B 1 210 ? 13.458  12.737  -40.413 1.00 34.24 ? 210  GLY B CA  1 
ATOM   5784 C C   . GLY B 1 210 ? 14.685  12.853  -41.306 1.00 34.82 ? 210  GLY B C   1 
ATOM   5785 O O   . GLY B 1 210 ? 15.360  13.883  -41.337 1.00 34.70 ? 210  GLY B O   1 
ATOM   5786 N N   . MET B 1 211 ? 14.967  11.801  -42.057 1.00 35.10 ? 211  MET B N   1 
ATOM   5787 C CA  . MET B 1 211 ? 16.073  11.884  -42.991 1.00 35.87 ? 211  MET B CA  1 
ATOM   5788 C C   . MET B 1 211 ? 15.774  12.802  -44.162 1.00 35.35 ? 211  MET B C   1 
ATOM   5789 O O   . MET B 1 211 ? 16.673  13.500  -44.652 1.00 35.33 ? 211  MET B O   1 
ATOM   5790 C CB  . MET B 1 211 ? 16.534  10.502  -43.404 1.00 35.59 ? 211  MET B CB  1 
ATOM   5791 C CG  . MET B 1 211 ? 17.240  9.863   -42.237 1.00 36.13 ? 211  MET B CG  1 
ATOM   5792 S SD  . MET B 1 211 ? 17.443  8.123   -42.431 1.00 38.58 ? 211  MET B SD  1 
ATOM   5793 C CE  . MET B 1 211 ? 17.479  7.595   -40.725 1.00 36.10 ? 211  MET B CE  1 
ATOM   5794 N N   . HIS B 1 212 ? 14.515  12.841  -44.592 1.00 34.67 ? 212  HIS B N   1 
ATOM   5795 C CA  . HIS B 1 212 ? 14.175  13.796  -45.614 1.00 34.65 ? 212  HIS B CA  1 
ATOM   5796 C C   . HIS B 1 212 ? 14.329  15.206  -45.092 1.00 35.00 ? 212  HIS B C   1 
ATOM   5797 O O   . HIS B 1 212 ? 14.777  16.073  -45.822 1.00 35.28 ? 212  HIS B O   1 
ATOM   5798 C CB  . HIS B 1 212 ? 12.812  13.529  -46.225 1.00 34.11 ? 212  HIS B CB  1 
ATOM   5799 C CG  . HIS B 1 212 ? 12.774  12.263  -47.003 1.00 33.48 ? 212  HIS B CG  1 
ATOM   5800 N ND1 . HIS B 1 212 ? 13.490  12.095  -48.169 1.00 30.65 ? 212  HIS B ND1 1 
ATOM   5801 C CD2 . HIS B 1 212 ? 12.149  11.083  -46.763 1.00 31.90 ? 212  HIS B CD2 1 
ATOM   5802 C CE1 . HIS B 1 212 ? 13.300  10.867  -48.620 1.00 31.05 ? 212  HIS B CE1 1 
ATOM   5803 N NE2 . HIS B 1 212 ? 12.490  10.234  -47.786 1.00 31.80 ? 212  HIS B NE2 1 
ATOM   5804 N N   . ILE B 1 213 ? 14.014  15.423  -43.816 1.00 35.16 ? 213  ILE B N   1 
ATOM   5805 C CA  . ILE B 1 213 ? 14.277  16.711  -43.195 1.00 35.21 ? 213  ILE B CA  1 
ATOM   5806 C C   . ILE B 1 213 ? 15.774  17.033  -43.237 1.00 35.69 ? 213  ILE B C   1 
ATOM   5807 O O   . ILE B 1 213 ? 16.177  18.174  -43.524 1.00 35.99 ? 213  ILE B O   1 
ATOM   5808 C CB  . ILE B 1 213 ? 13.742  16.767  -41.741 1.00 35.52 ? 213  ILE B CB  1 
ATOM   5809 C CG1 . ILE B 1 213 ? 12.206  16.896  -41.734 1.00 34.14 ? 213  ILE B CG1 1 
ATOM   5810 C CG2 . ILE B 1 213 ? 14.387  17.916  -40.967 1.00 34.60 ? 213  ILE B CG2 1 
ATOM   5811 C CD1 . ILE B 1 213 ? 11.551  16.367  -40.480 1.00 31.03 ? 213  ILE B CD1 1 
ATOM   5812 N N   . LEU B 1 214 ? 16.596  16.025  -42.984 1.00 35.78 ? 214  LEU B N   1 
ATOM   5813 C CA  . LEU B 1 214 ? 18.033  16.242  -42.852 1.00 36.06 ? 214  LEU B CA  1 
ATOM   5814 C C   . LEU B 1 214 ? 18.794  16.154  -44.158 1.00 36.71 ? 214  LEU B C   1 
ATOM   5815 O O   . LEU B 1 214 ? 20.010  16.277  -44.169 1.00 37.32 ? 214  LEU B O   1 
ATOM   5816 C CB  . LEU B 1 214 ? 18.628  15.288  -41.812 1.00 35.79 ? 214  LEU B CB  1 
ATOM   5817 C CG  . LEU B 1 214 ? 18.049  15.433  -40.405 1.00 34.70 ? 214  LEU B CG  1 
ATOM   5818 C CD1 . LEU B 1 214 ? 18.429  14.239  -39.610 1.00 35.17 ? 214  LEU B CD1 1 
ATOM   5819 C CD2 . LEU B 1 214 ? 18.543  16.720  -39.743 1.00 33.76 ? 214  LEU B CD2 1 
ATOM   5820 N N   . SER B 1 215 ? 18.094  15.970  -45.268 1.00 37.68 ? 215  SER B N   1 
ATOM   5821 C CA  . SER B 1 215 ? 18.792  15.835  -46.534 1.00 38.66 ? 215  SER B CA  1 
ATOM   5822 C C   . SER B 1 215 ? 18.330  16.886  -47.505 1.00 39.39 ? 215  SER B C   1 
ATOM   5823 O O   . SER B 1 215 ? 17.174  16.869  -47.930 1.00 39.88 ? 215  SER B O   1 
ATOM   5824 C CB  . SER B 1 215 ? 18.599  14.438  -47.106 1.00 38.74 ? 215  SER B CB  1 
ATOM   5825 O OG  . SER B 1 215 ? 19.399  14.260  -48.252 1.00 38.79 ? 215  SER B OG  1 
ATOM   5826 N N   . LEU B 1 216 ? 19.233  17.805  -47.861 1.00 40.36 ? 216  LEU B N   1 
ATOM   5827 C CA  . LEU B 1 216 ? 18.825  19.026  -48.557 1.00 40.99 ? 216  LEU B CA  1 
ATOM   5828 C C   . LEU B 1 216 ? 17.982  18.791  -49.809 1.00 41.10 ? 216  LEU B C   1 
ATOM   5829 O O   . LEU B 1 216 ? 16.925  19.411  -49.952 1.00 41.65 ? 216  LEU B O   1 
ATOM   5830 C CB  . LEU B 1 216 ? 20.000  19.953  -48.876 1.00 41.53 ? 216  LEU B CB  1 
ATOM   5831 C CG  . LEU B 1 216 ? 19.438  21.297  -49.398 1.00 43.79 ? 216  LEU B CG  1 
ATOM   5832 C CD1 . LEU B 1 216 ? 18.958  22.221  -48.233 1.00 45.27 ? 216  LEU B CD1 1 
ATOM   5833 C CD2 . LEU B 1 216 ? 20.401  22.033  -50.343 1.00 46.08 ? 216  LEU B CD2 1 
ATOM   5834 N N   . PRO B 1 217 ? 18.424  17.890  -50.715 1.00 40.90 ? 217  PRO B N   1 
ATOM   5835 C CA  . PRO B 1 217 ? 17.627  17.729  -51.930 1.00 40.73 ? 217  PRO B CA  1 
ATOM   5836 C C   . PRO B 1 217 ? 16.187  17.256  -51.673 1.00 40.54 ? 217  PRO B C   1 
ATOM   5837 O O   . PRO B 1 217 ? 15.367  17.328  -52.587 1.00 41.04 ? 217  PRO B O   1 
ATOM   5838 C CB  . PRO B 1 217 ? 18.403  16.663  -52.716 1.00 41.12 ? 217  PRO B CB  1 
ATOM   5839 C CG  . PRO B 1 217 ? 19.796  16.724  -52.164 1.00 40.37 ? 217  PRO B CG  1 
ATOM   5840 C CD  . PRO B 1 217 ? 19.590  16.985  -50.717 1.00 40.72 ? 217  PRO B CD  1 
ATOM   5841 N N   . SER B 1 218 ? 15.875  16.788  -50.457 1.00 39.85 ? 218  SER B N   1 
ATOM   5842 C CA  . SER B 1 218 ? 14.494  16.373  -50.132 1.00 39.06 ? 218  SER B CA  1 
ATOM   5843 C C   . SER B 1 218 ? 13.671  17.563  -49.689 1.00 39.42 ? 218  SER B C   1 
ATOM   5844 O O   . SER B 1 218 ? 12.456  17.590  -49.888 1.00 38.98 ? 218  SER B O   1 
ATOM   5845 C CB  . SER B 1 218 ? 14.451  15.283  -49.054 1.00 38.73 ? 218  SER B CB  1 
ATOM   5846 O OG  . SER B 1 218 ? 14.781  14.000  -49.570 1.00 36.36 ? 218  SER B OG  1 
ATOM   5847 N N   . ARG B 1 219 ? 14.353  18.557  -49.115 1.00 39.88 ? 219  ARG B N   1 
ATOM   5848 C CA  . ARG B 1 219 ? 13.702  19.711  -48.512 1.00 40.03 ? 219  ARG B CA  1 
ATOM   5849 C C   . ARG B 1 219 ? 12.850  20.540  -49.461 1.00 40.04 ? 219  ARG B C   1 
ATOM   5850 O O   . ARG B 1 219 ? 11.875  21.140  -49.036 1.00 40.61 ? 219  ARG B O   1 
ATOM   5851 C CB  . ARG B 1 219 ? 14.704  20.588  -47.760 1.00 40.26 ? 219  ARG B CB  1 
ATOM   5852 C CG  . ARG B 1 219 ? 15.212  19.959  -46.469 1.00 41.75 ? 219  ARG B CG  1 
ATOM   5853 C CD  . ARG B 1 219 ? 14.132  19.873  -45.387 1.00 44.53 ? 219  ARG B CD  1 
ATOM   5854 N NE  . ARG B 1 219 ? 13.879  21.171  -44.771 1.00 48.41 ? 219  ARG B NE  1 
ATOM   5855 C CZ  . ARG B 1 219 ? 14.689  21.745  -43.880 1.00 50.58 ? 219  ARG B CZ  1 
ATOM   5856 N NH1 . ARG B 1 219 ? 15.801  21.121  -43.494 1.00 49.65 ? 219  ARG B NH1 1 
ATOM   5857 N NH2 . ARG B 1 219 ? 14.392  22.945  -43.372 1.00 51.34 ? 219  ARG B NH2 1 
ATOM   5858 N N   . SER B 1 220 ? 13.186  20.557  -50.742 1.00 39.99 ? 220  SER B N   1 
ATOM   5859 C CA  . SER B 1 220 ? 12.354  21.260  -51.723 1.00 39.85 ? 220  SER B CA  1 
ATOM   5860 C C   . SER B 1 220 ? 11.054  20.503  -52.083 1.00 39.24 ? 220  SER B C   1 
ATOM   5861 O O   . SER B 1 220 ? 10.306  20.933  -52.962 1.00 39.28 ? 220  SER B O   1 
ATOM   5862 C CB  . SER B 1 220 ? 13.172  21.524  -52.991 1.00 40.45 ? 220  SER B CB  1 
ATOM   5863 O OG  . SER B 1 220 ? 13.722  20.306  -53.503 1.00 41.77 ? 220  SER B OG  1 
ATOM   5864 N N   . LEU B 1 221 ? 10.791  19.380  -51.413 1.00 38.14 ? 221  LEU B N   1 
ATOM   5865 C CA  . LEU B 1 221 ? 9.728   18.469  -51.840 1.00 37.04 ? 221  LEU B CA  1 
ATOM   5866 C C   . LEU B 1 221 ? 8.586   18.335  -50.845 1.00 36.95 ? 221  LEU B C   1 
ATOM   5867 O O   . LEU B 1 221 ? 7.576   17.717  -51.151 1.00 36.97 ? 221  LEU B O   1 
ATOM   5868 C CB  . LEU B 1 221 ? 10.290  17.084  -52.158 1.00 36.07 ? 221  LEU B CB  1 
ATOM   5869 C CG  . LEU B 1 221 ? 11.434  16.994  -53.170 1.00 34.72 ? 221  LEU B CG  1 
ATOM   5870 C CD1 . LEU B 1 221 ? 11.949  15.548  -53.258 1.00 32.06 ? 221  LEU B CD1 1 
ATOM   5871 C CD2 . LEU B 1 221 ? 11.049  17.529  -54.546 1.00 30.46 ? 221  LEU B CD2 1 
ATOM   5872 N N   . PHE B 1 222 ? 8.757   18.899  -49.655 1.00 36.59 ? 222  PHE B N   1 
ATOM   5873 C CA  . PHE B 1 222 ? 7.696   18.948  -48.662 1.00 36.41 ? 222  PHE B CA  1 
ATOM   5874 C C   . PHE B 1 222 ? 7.867   20.203  -47.826 1.00 36.46 ? 222  PHE B C   1 
ATOM   5875 O O   . PHE B 1 222 ? 8.927   20.819  -47.847 1.00 36.59 ? 222  PHE B O   1 
ATOM   5876 C CB  . PHE B 1 222 ? 7.716   17.702  -47.773 1.00 35.87 ? 222  PHE B CB  1 
ATOM   5877 C CG  . PHE B 1 222 ? 8.976   17.543  -46.984 1.00 35.37 ? 222  PHE B CG  1 
ATOM   5878 C CD1 . PHE B 1 222 ? 10.144  17.081  -47.592 1.00 34.59 ? 222  PHE B CD1 1 
ATOM   5879 C CD2 . PHE B 1 222 ? 8.996   17.840  -45.623 1.00 35.64 ? 222  PHE B CD2 1 
ATOM   5880 C CE1 . PHE B 1 222 ? 11.320  16.943  -46.865 1.00 34.31 ? 222  PHE B CE1 1 
ATOM   5881 C CE2 . PHE B 1 222 ? 10.163  17.696  -44.882 1.00 34.92 ? 222  PHE B CE2 1 
ATOM   5882 C CZ  . PHE B 1 222 ? 11.333  17.242  -45.511 1.00 35.02 ? 222  PHE B CZ  1 
ATOM   5883 N N   . HIS B 1 223 ? 6.837   20.553  -47.066 1.00 36.35 ? 223  HIS B N   1 
ATOM   5884 C CA  . HIS B 1 223 ? 6.842   21.777  -46.273 1.00 36.43 ? 223  HIS B CA  1 
ATOM   5885 C C   . HIS B 1 223 ? 6.697   21.489  -44.791 1.00 36.33 ? 223  HIS B C   1 
ATOM   5886 O O   . HIS B 1 223 ? 6.964   22.356  -43.960 1.00 37.14 ? 223  HIS B O   1 
ATOM   5887 C CB  . HIS B 1 223 ? 5.724   22.675  -46.778 1.00 36.60 ? 223  HIS B CB  1 
ATOM   5888 C CG  . HIS B 1 223 ? 5.602   22.643  -48.270 1.00 38.24 ? 223  HIS B CG  1 
ATOM   5889 N ND1 . HIS B 1 223 ? 6.326   23.480  -49.094 1.00 39.36 ? 223  HIS B ND1 1 
ATOM   5890 C CD2 . HIS B 1 223 ? 4.915   21.811  -49.088 1.00 37.63 ? 223  HIS B CD2 1 
ATOM   5891 C CE1 . HIS B 1 223 ? 6.052   23.195  -50.354 1.00 40.01 ? 223  HIS B CE1 1 
ATOM   5892 N NE2 . HIS B 1 223 ? 5.202   22.182  -50.377 1.00 39.19 ? 223  HIS B NE2 1 
ATOM   5893 N N   . ARG B 1 224 ? 6.312   20.257  -44.459 1.00 35.20 ? 224  ARG B N   1 
ATOM   5894 C CA  . ARG B 1 224 ? 5.958   19.898  -43.098 1.00 34.51 ? 224  ARG B CA  1 
ATOM   5895 C C   . ARG B 1 224 ? 6.151   18.418  -42.868 1.00 33.31 ? 224  ARG B C   1 
ATOM   5896 O O   . ARG B 1 224 ? 6.063   17.618  -43.802 1.00 33.13 ? 224  ARG B O   1 
ATOM   5897 C CB  . ARG B 1 224 ? 4.490   20.272  -42.821 1.00 34.71 ? 224  ARG B CB  1 
ATOM   5898 C CG  . ARG B 1 224 ? 4.319   21.687  -42.331 1.00 35.99 ? 224  ARG B CG  1 
ATOM   5899 C CD  . ARG B 1 224 ? 2.868   22.087  -42.127 1.00 35.80 ? 224  ARG B CD  1 
ATOM   5900 N NE  . ARG B 1 224 ? 2.121   22.141  -43.373 1.00 39.41 ? 224  ARG B NE  1 
ATOM   5901 C CZ  . ARG B 1 224 ? 2.256   23.068  -44.321 1.00 41.45 ? 224  ARG B CZ  1 
ATOM   5902 N NH1 . ARG B 1 224 ? 3.149   24.056  -44.214 1.00 38.68 ? 224  ARG B NH1 1 
ATOM   5903 N NH2 . ARG B 1 224 ? 1.497   22.974  -45.413 1.00 43.70 ? 224  ARG B NH2 1 
ATOM   5904 N N   . ALA B 1 225 ? 6.387   18.046  -41.618 1.00 32.06 ? 225  ALA B N   1 
ATOM   5905 C CA  . ALA B 1 225 ? 6.650   16.660  -41.315 1.00 31.23 ? 225  ALA B CA  1 
ATOM   5906 C C   . ALA B 1 225 ? 6.016   16.201  -40.022 1.00 30.94 ? 225  ALA B C   1 
ATOM   5907 O O   . ALA B 1 225 ? 5.872   16.976  -39.082 1.00 30.53 ? 225  ALA B O   1 
ATOM   5908 C CB  . ALA B 1 225 ? 8.144   16.409  -41.290 1.00 31.36 ? 225  ALA B CB  1 
ATOM   5909 N N   . VAL B 1 226 ? 5.637   14.924  -39.999 1.00 30.60 ? 226  VAL B N   1 
ATOM   5910 C CA  . VAL B 1 226 ? 5.102   14.267  -38.813 1.00 30.20 ? 226  VAL B CA  1 
ATOM   5911 C C   . VAL B 1 226 ? 5.905   13.006  -38.604 1.00 30.20 ? 226  VAL B C   1 
ATOM   5912 O O   . VAL B 1 226 ? 5.952   12.170  -39.482 1.00 30.35 ? 226  VAL B O   1 
ATOM   5913 C CB  . VAL B 1 226 ? 3.643   13.845  -39.005 1.00 29.38 ? 226  VAL B CB  1 
ATOM   5914 C CG1 . VAL B 1 226 ? 3.096   13.245  -37.742 1.00 28.91 ? 226  VAL B CG1 1 
ATOM   5915 C CG2 . VAL B 1 226 ? 2.793   15.022  -39.456 1.00 30.77 ? 226  VAL B CG2 1 
ATOM   5916 N N   . LEU B 1 227 ? 6.519   12.872  -37.435 1.00 30.68 ? 227  LEU B N   1 
ATOM   5917 C CA  . LEU B 1 227 ? 7.330   11.710  -37.106 1.00 31.25 ? 227  LEU B CA  1 
ATOM   5918 C C   . LEU B 1 227 ? 6.659   10.994  -35.953 1.00 31.91 ? 227  LEU B C   1 
ATOM   5919 O O   . LEU B 1 227 ? 6.613   11.529  -34.837 1.00 32.58 ? 227  LEU B O   1 
ATOM   5920 C CB  . LEU B 1 227 ? 8.754   12.119  -36.724 1.00 30.66 ? 227  LEU B CB  1 
ATOM   5921 C CG  . LEU B 1 227 ? 9.652   12.640  -37.863 1.00 31.06 ? 227  LEU B CG  1 
ATOM   5922 C CD1 . LEU B 1 227 ? 9.392   14.093  -38.213 1.00 28.50 ? 227  LEU B CD1 1 
ATOM   5923 C CD2 . LEU B 1 227 ? 11.126  12.456  -37.510 1.00 30.79 ? 227  LEU B CD2 1 
ATOM   5924 N N   . GLN B 1 228 ? 6.130   9.799   -36.220 1.00 31.59 ? 228  GLN B N   1 
ATOM   5925 C CA  . GLN B 1 228 ? 5.385   9.071   -35.219 1.00 31.74 ? 228  GLN B CA  1 
ATOM   5926 C C   . GLN B 1 228 ? 6.221   7.904   -34.737 1.00 32.10 ? 228  GLN B C   1 
ATOM   5927 O O   . GLN B 1 228 ? 6.553   6.996   -35.502 1.00 31.90 ? 228  GLN B O   1 
ATOM   5928 C CB  . GLN B 1 228 ? 4.058   8.578   -35.775 1.00 31.63 ? 228  GLN B CB  1 
ATOM   5929 C CG  . GLN B 1 228 ? 3.187   9.665   -36.419 1.00 31.86 ? 228  GLN B CG  1 
ATOM   5930 C CD  . GLN B 1 228 ? 1.938   9.105   -37.095 1.00 32.66 ? 228  GLN B CD  1 
ATOM   5931 O OE1 . GLN B 1 228 ? 1.382   9.734   -37.995 1.00 35.04 ? 228  GLN B OE1 1 
ATOM   5932 N NE2 . GLN B 1 228 ? 1.493   7.921   -36.667 1.00 31.77 ? 228  GLN B NE2 1 
ATOM   5933 N N   . SER B 1 229 ? 6.561   7.927   -33.454 1.00 32.14 ? 229  SER B N   1 
ATOM   5934 C CA  . SER B 1 229 ? 7.331   6.851   -32.846 1.00 32.42 ? 229  SER B CA  1 
ATOM   5935 C C   . SER B 1 229 ? 8.581   6.448   -33.632 1.00 32.48 ? 229  SER B C   1 
ATOM   5936 O O   . SER B 1 229 ? 8.863   5.256   -33.747 1.00 32.63 ? 229  SER B O   1 
ATOM   5937 C CB  . SER B 1 229 ? 6.451   5.612   -32.631 1.00 32.77 ? 229  SER B CB  1 
ATOM   5938 O OG  . SER B 1 229 ? 5.331   5.917   -31.827 1.00 31.36 ? 229  SER B OG  1 
ATOM   5939 N N   . GLY B 1 230 ? 9.318   7.427   -34.155 1.00 31.79 ? 230  GLY B N   1 
ATOM   5940 C CA  . GLY B 1 230 ? 10.572  7.165   -34.839 1.00 32.01 ? 230  GLY B CA  1 
ATOM   5941 C C   . GLY B 1 230 ? 11.316  8.452   -35.159 1.00 32.45 ? 230  GLY B C   1 
ATOM   5942 O O   . GLY B 1 230 ? 10.717  9.533   -35.230 1.00 32.77 ? 230  GLY B O   1 
ATOM   5943 N N   . THR B 1 231 ? 12.626  8.338   -35.342 1.00 32.02 ? 231  THR B N   1 
ATOM   5944 C CA  . THR B 1 231 ? 13.492  9.494   -35.544 1.00 32.35 ? 231  THR B CA  1 
ATOM   5945 C C   . THR B 1 231 ? 14.686  9.075   -36.367 1.00 32.33 ? 231  THR B C   1 
ATOM   5946 O O   . THR B 1 231 ? 15.070  7.907   -36.345 1.00 31.88 ? 231  THR B O   1 
ATOM   5947 C CB  . THR B 1 231 ? 14.104  10.039  -34.197 1.00 33.02 ? 231  THR B CB  1 
ATOM   5948 O OG1 . THR B 1 231 ? 14.828  8.995   -33.525 1.00 32.74 ? 231  THR B OG1 1 
ATOM   5949 C CG2 . THR B 1 231 ? 13.061  10.665  -33.275 1.00 31.09 ? 231  THR B CG2 1 
ATOM   5950 N N   . PRO B 1 232 ? 15.307  10.030  -37.066 1.00 32.53 ? 232  PRO B N   1 
ATOM   5951 C CA  . PRO B 1 232 ? 16.570  9.722   -37.749 1.00 32.96 ? 232  PRO B CA  1 
ATOM   5952 C C   . PRO B 1 232 ? 17.720  9.460   -36.768 1.00 33.54 ? 232  PRO B C   1 
ATOM   5953 O O   . PRO B 1 232 ? 18.578  8.628   -37.037 1.00 34.61 ? 232  PRO B O   1 
ATOM   5954 C CB  . PRO B 1 232 ? 16.835  10.957  -38.612 1.00 32.90 ? 232  PRO B CB  1 
ATOM   5955 C CG  . PRO B 1 232 ? 15.930  12.027  -38.105 1.00 33.05 ? 232  PRO B CG  1 
ATOM   5956 C CD  . PRO B 1 232 ? 14.855  11.415  -37.268 1.00 32.44 ? 232  PRO B CD  1 
ATOM   5957 N N   . ASN B 1 233 ? 17.728  10.145  -35.630 1.00 33.88 ? 233  ASN B N   1 
ATOM   5958 C CA  . ASN B 1 233 ? 18.763  9.931   -34.615 1.00 33.68 ? 233  ASN B CA  1 
ATOM   5959 C C   . ASN B 1 233 ? 18.481  8.646   -33.866 1.00 34.25 ? 233  ASN B C   1 
ATOM   5960 O O   . ASN B 1 233 ? 17.515  7.951   -34.162 1.00 34.16 ? 233  ASN B O   1 
ATOM   5961 C CB  . ASN B 1 233 ? 18.829  11.108  -33.640 1.00 33.08 ? 233  ASN B CB  1 
ATOM   5962 C CG  . ASN B 1 233 ? 17.455  11.543  -33.143 1.00 33.00 ? 233  ASN B CG  1 
ATOM   5963 O OD1 . ASN B 1 233 ? 16.611  11.980  -33.922 1.00 32.19 ? 233  ASN B OD1 1 
ATOM   5964 N ND2 . ASN B 1 233 ? 17.230  11.432  -31.836 1.00 32.81 ? 233  ASN B ND2 1 
ATOM   5965 N N   . GLY B 1 234 ? 19.326  8.316   -32.900 1.00 34.85 ? 234  GLY B N   1 
ATOM   5966 C CA  . GLY B 1 234 ? 19.098  7.123   -32.097 1.00 35.58 ? 234  GLY B CA  1 
ATOM   5967 C C   . GLY B 1 234 ? 19.814  5.876   -32.589 1.00 36.01 ? 234  GLY B C   1 
ATOM   5968 O O   . GLY B 1 234 ? 20.457  5.885   -33.640 1.00 35.68 ? 234  GLY B O   1 
ATOM   5969 N N   . PRO B 1 235 ? 19.692  4.790   -31.824 1.00 36.48 ? 235  PRO B N   1 
ATOM   5970 C CA  . PRO B 1 235 ? 20.524  3.594   -31.958 1.00 36.90 ? 235  PRO B CA  1 
ATOM   5971 C C   . PRO B 1 235 ? 20.295  2.749   -33.207 1.00 37.16 ? 235  PRO B C   1 
ATOM   5972 O O   . PRO B 1 235 ? 21.226  2.049   -33.638 1.00 37.33 ? 235  PRO B O   1 
ATOM   5973 C CB  . PRO B 1 235 ? 20.165  2.788   -30.710 1.00 37.05 ? 235  PRO B CB  1 
ATOM   5974 C CG  . PRO B 1 235 ? 18.790  3.228   -30.358 1.00 36.94 ? 235  PRO B CG  1 
ATOM   5975 C CD  . PRO B 1 235 ? 18.724  4.676   -30.720 1.00 36.66 ? 235  PRO B CD  1 
ATOM   5976 N N   . TRP B 1 236 ? 19.097  2.824   -33.795 1.00 36.73 ? 236  TRP B N   1 
ATOM   5977 C CA  . TRP B 1 236 ? 18.668  1.834   -34.782 1.00 36.38 ? 236  TRP B CA  1 
ATOM   5978 C C   . TRP B 1 236 ? 18.530  2.316   -36.222 1.00 36.77 ? 236  TRP B C   1 
ATOM   5979 O O   . TRP B 1 236 ? 18.604  1.506   -37.143 1.00 37.29 ? 236  TRP B O   1 
ATOM   5980 C CB  . TRP B 1 236 ? 17.353  1.184   -34.337 1.00 36.49 ? 236  TRP B CB  1 
ATOM   5981 C CG  . TRP B 1 236 ? 16.235  2.159   -34.175 1.00 37.17 ? 236  TRP B CG  1 
ATOM   5982 C CD1 . TRP B 1 236 ? 15.902  2.842   -33.039 1.00 37.70 ? 236  TRP B CD1 1 
ATOM   5983 C CD2 . TRP B 1 236 ? 15.308  2.586   -35.184 1.00 38.47 ? 236  TRP B CD2 1 
ATOM   5984 N NE1 . TRP B 1 236 ? 14.823  3.660   -33.275 1.00 38.32 ? 236  TRP B NE1 1 
ATOM   5985 C CE2 . TRP B 1 236 ? 14.440  3.527   -34.581 1.00 38.19 ? 236  TRP B CE2 1 
ATOM   5986 C CE3 . TRP B 1 236 ? 15.118  2.255   -36.537 1.00 38.54 ? 236  TRP B CE3 1 
ATOM   5987 C CZ2 . TRP B 1 236 ? 13.400  4.141   -35.280 1.00 37.85 ? 236  TRP B CZ2 1 
ATOM   5988 C CZ3 . TRP B 1 236 ? 14.086  2.874   -37.239 1.00 37.37 ? 236  TRP B CZ3 1 
ATOM   5989 C CH2 . TRP B 1 236 ? 13.241  3.804   -36.607 1.00 37.89 ? 236  TRP B CH2 1 
ATOM   5990 N N   . ALA B 1 237 ? 18.316  3.613   -36.418 1.00 36.75 ? 237  ALA B N   1 
ATOM   5991 C CA  . ALA B 1 237 ? 17.896  4.140   -37.715 1.00 36.91 ? 237  ALA B CA  1 
ATOM   5992 C C   . ALA B 1 237 ? 19.018  4.285   -38.726 1.00 37.29 ? 237  ALA B C   1 
ATOM   5993 O O   . ALA B 1 237 ? 18.765  4.365   -39.927 1.00 37.69 ? 237  ALA B O   1 
ATOM   5994 C CB  . ALA B 1 237 ? 17.156  5.480   -37.548 1.00 36.70 ? 237  ALA B CB  1 
ATOM   5995 N N   . THR B 1 238 ? 20.255  4.371   -38.262 1.00 37.59 ? 238  THR B N   1 
ATOM   5996 C CA  . THR B 1 238 ? 21.381  4.503   -39.195 1.00 37.80 ? 238  THR B CA  1 
ATOM   5997 C C   . THR B 1 238 ? 22.530  3.617   -38.781 1.00 38.53 ? 238  THR B C   1 
ATOM   5998 O O   . THR B 1 238 ? 22.601  3.170   -37.631 1.00 38.44 ? 238  THR B O   1 
ATOM   5999 C CB  . THR B 1 238 ? 21.918  5.940   -39.319 1.00 36.93 ? 238  THR B CB  1 
ATOM   6000 O OG1 . THR B 1 238 ? 22.456  6.352   -38.062 1.00 36.82 ? 238  THR B OG1 1 
ATOM   6001 C CG2 . THR B 1 238 ? 20.837  6.888   -39.743 1.00 36.61 ? 238  THR B CG2 1 
ATOM   6002 N N   . VAL B 1 239 ? 23.417  3.358   -39.735 1.00 39.18 ? 239  VAL B N   1 
ATOM   6003 C CA  . VAL B 1 239 ? 24.679  2.700   -39.451 1.00 40.22 ? 239  VAL B CA  1 
ATOM   6004 C C   . VAL B 1 239 ? 25.768  3.493   -40.135 1.00 40.92 ? 239  VAL B C   1 
ATOM   6005 O O   . VAL B 1 239 ? 25.487  4.273   -41.059 1.00 41.35 ? 239  VAL B O   1 
ATOM   6006 C CB  . VAL B 1 239 ? 24.700  1.222   -39.910 1.00 40.09 ? 239  VAL B CB  1 
ATOM   6007 C CG1 . VAL B 1 239 ? 23.882  0.363   -38.952 1.00 40.50 ? 239  VAL B CG1 1 
ATOM   6008 C CG2 . VAL B 1 239 ? 24.196  1.081   -41.339 1.00 39.60 ? 239  VAL B CG2 1 
ATOM   6009 N N   . SER B 1 240 ? 27.004  3.313   -39.676 1.00 41.47 ? 240  SER B N   1 
ATOM   6010 C CA  . SER B 1 240 ? 28.149  3.987   -40.296 1.00 42.10 ? 240  SER B CA  1 
ATOM   6011 C C   . SER B 1 240 ? 28.464  3.344   -41.640 1.00 42.25 ? 240  SER B C   1 
ATOM   6012 O O   . SER B 1 240 ? 28.052  2.212   -41.903 1.00 41.73 ? 240  SER B O   1 
ATOM   6013 C CB  . SER B 1 240 ? 29.370  3.892   -39.388 1.00 42.02 ? 240  SER B CB  1 
ATOM   6014 O OG  . SER B 1 240 ? 29.671  2.532   -39.131 1.00 42.28 ? 240  SER B OG  1 
ATOM   6015 N N   . ALA B 1 241 ? 29.187  4.073   -42.487 1.00 43.14 ? 241  ALA B N   1 
ATOM   6016 C CA  . ALA B 1 241 ? 29.729  3.493   -43.719 1.00 44.02 ? 241  ALA B CA  1 
ATOM   6017 C C   . ALA B 1 241 ? 30.432  2.187   -43.401 1.00 44.71 ? 241  ALA B C   1 
ATOM   6018 O O   . ALA B 1 241 ? 30.088  1.138   -43.959 1.00 45.13 ? 241  ALA B O   1 
ATOM   6019 C CB  . ALA B 1 241 ? 30.673  4.452   -44.413 1.00 43.95 ? 241  ALA B CB  1 
ATOM   6020 N N   . GLY B 1 242 ? 31.384  2.256   -42.469 1.00 45.39 ? 242  GLY B N   1 
ATOM   6021 C CA  . GLY B 1 242 ? 32.175  1.104   -42.055 1.00 45.76 ? 242  GLY B CA  1 
ATOM   6022 C C   . GLY B 1 242 ? 31.349  -0.074  -41.600 1.00 46.05 ? 242  GLY B C   1 
ATOM   6023 O O   . GLY B 1 242 ? 31.712  -1.219  -41.843 1.00 46.83 ? 242  GLY B O   1 
ATOM   6024 N N   . GLU B 1 243 ? 30.232  0.203   -40.944 1.00 46.44 ? 243  GLU B N   1 
ATOM   6025 C CA  . GLU B 1 243 ? 29.370  -0.856  -40.423 1.00 46.52 ? 243  GLU B CA  1 
ATOM   6026 C C   . GLU B 1 243 ? 28.479  -1.472  -41.513 1.00 46.65 ? 243  GLU B C   1 
ATOM   6027 O O   . GLU B 1 243 ? 28.176  -2.670  -41.481 1.00 46.85 ? 243  GLU B O   1 
ATOM   6028 C CB  . GLU B 1 243 ? 28.536  -0.326  -39.243 1.00 46.29 ? 243  GLU B CB  1 
ATOM   6029 C CG  . GLU B 1 243 ? 27.524  -1.329  -38.633 1.00 47.18 ? 243  GLU B CG  1 
ATOM   6030 C CD  . GLU B 1 243 ? 28.163  -2.624  -38.153 1.00 47.15 ? 243  GLU B CD  1 
ATOM   6031 O OE1 . GLU B 1 243 ? 27.434  -3.495  -37.638 1.00 46.36 ? 243  GLU B OE1 1 
ATOM   6032 O OE2 . GLU B 1 243 ? 29.397  -2.777  -38.282 1.00 48.67 ? 243  GLU B OE2 1 
ATOM   6033 N N   . ALA B 1 244 ? 28.052  -0.647  -42.465 1.00 46.85 ? 244  ALA B N   1 
ATOM   6034 C CA  . ALA B 1 244 ? 27.207  -1.101  -43.579 1.00 46.92 ? 244  ALA B CA  1 
ATOM   6035 C C   . ALA B 1 244 ? 28.019  -1.981  -44.509 1.00 47.07 ? 244  ALA B C   1 
ATOM   6036 O O   . ALA B 1 244 ? 27.556  -3.029  -44.939 1.00 47.15 ? 244  ALA B O   1 
ATOM   6037 C CB  . ALA B 1 244 ? 26.640  0.076   -44.337 1.00 46.31 ? 244  ALA B CB  1 
ATOM   6038 N N   . ARG B 1 245 ? 29.240  -1.547  -44.798 1.00 47.65 ? 245  ARG B N   1 
ATOM   6039 C CA  . ARG B 1 245 ? 30.178  -2.325  -45.591 1.00 48.35 ? 245  ARG B CA  1 
ATOM   6040 C C   . ARG B 1 245 ? 30.361  -3.718  -44.990 1.00 48.48 ? 245  ARG B C   1 
ATOM   6041 O O   . ARG B 1 245 ? 30.370  -4.715  -45.708 1.00 48.35 ? 245  ARG B O   1 
ATOM   6042 C CB  . ARG B 1 245 ? 31.517  -1.597  -45.660 1.00 48.62 ? 245  ARG B CB  1 
ATOM   6043 C CG  . ARG B 1 245 ? 32.552  -2.274  -46.523 1.00 49.12 ? 245  ARG B CG  1 
ATOM   6044 C CD  . ARG B 1 245 ? 33.734  -1.351  -46.733 1.00 50.49 ? 245  ARG B CD  1 
ATOM   6045 N NE  . ARG B 1 245 ? 33.529  -0.417  -47.839 1.00 51.89 ? 245  ARG B NE  1 
ATOM   6046 C CZ  . ARG B 1 245 ? 33.419  -0.789  -49.111 1.00 53.31 ? 245  ARG B CZ  1 
ATOM   6047 N NH1 . ARG B 1 245 ? 33.251  0.122   -50.061 1.00 53.53 ? 245  ARG B NH1 1 
ATOM   6048 N NH2 . ARG B 1 245 ? 33.459  -2.081  -49.435 1.00 53.53 ? 245  ARG B NH2 1 
ATOM   6049 N N   . ARG B 1 246 ? 30.469  -3.766  -43.668 1.00 48.50 ? 246  ARG B N   1 
ATOM   6050 C CA  . ARG B 1 246 ? 30.778  -4.989  -42.965 1.00 49.03 ? 246  ARG B CA  1 
ATOM   6051 C C   . ARG B 1 246 ? 29.636  -5.989  -43.045 1.00 49.25 ? 246  ARG B C   1 
ATOM   6052 O O   . ARG B 1 246 ? 29.861  -7.193  -43.225 1.00 49.12 ? 246  ARG B O   1 
ATOM   6053 C CB  . ARG B 1 246 ? 31.122  -4.686  -41.503 1.00 49.29 ? 246  ARG B CB  1 
ATOM   6054 C CG  . ARG B 1 246 ? 31.574  -5.914  -40.728 1.00 49.40 ? 246  ARG B CG  1 
ATOM   6055 C CD  . ARG B 1 246 ? 31.275  -5.791  -39.259 1.00 49.04 ? 246  ARG B CD  1 
ATOM   6056 N NE  . ARG B 1 246 ? 30.459  -6.924  -38.866 1.00 49.05 ? 246  ARG B NE  1 
ATOM   6057 C CZ  . ARG B 1 246 ? 29.242  -6.819  -38.355 1.00 49.29 ? 246  ARG B CZ  1 
ATOM   6058 N NH1 . ARG B 1 246 ? 28.722  -5.624  -38.131 1.00 48.83 ? 246  ARG B NH1 1 
ATOM   6059 N NH2 . ARG B 1 246 ? 28.560  -7.912  -38.043 1.00 49.55 ? 246  ARG B NH2 1 
ATOM   6060 N N   . ARG B 1 247 ? 28.411  -5.488  -42.914 1.00 49.49 ? 247  ARG B N   1 
ATOM   6061 C CA  . ARG B 1 247 ? 27.237  -6.349  -42.981 1.00 49.24 ? 247  ARG B CA  1 
ATOM   6062 C C   . ARG B 1 247 ? 27.005  -6.814  -44.420 1.00 49.16 ? 247  ARG B C   1 
ATOM   6063 O O   . ARG B 1 247 ? 26.598  -7.957  -44.658 1.00 49.13 ? 247  ARG B O   1 
ATOM   6064 C CB  . ARG B 1 247 ? 26.006  -5.622  -42.427 1.00 49.52 ? 247  ARG B CB  1 
ATOM   6065 C CG  . ARG B 1 247 ? 26.175  -5.066  -41.019 1.00 48.93 ? 247  ARG B CG  1 
ATOM   6066 C CD  . ARG B 1 247 ? 24.886  -4.444  -40.541 1.00 49.09 ? 247  ARG B CD  1 
ATOM   6067 N NE  . ARG B 1 247 ? 25.011  -3.830  -39.224 1.00 49.99 ? 247  ARG B NE  1 
ATOM   6068 C CZ  . ARG B 1 247 ? 24.003  -3.291  -38.540 1.00 50.25 ? 247  ARG B CZ  1 
ATOM   6069 N NH1 . ARG B 1 247 ? 22.772  -3.294  -39.037 1.00 49.62 ? 247  ARG B NH1 1 
ATOM   6070 N NH2 . ARG B 1 247 ? 24.224  -2.751  -37.347 1.00 49.62 ? 247  ARG B NH2 1 
ATOM   6071 N N   . ALA B 1 248 ? 27.276  -5.924  -45.372 1.00 48.96 ? 248  ALA B N   1 
ATOM   6072 C CA  . ALA B 1 248 ? 27.109  -6.228  -46.787 1.00 49.26 ? 248  ALA B CA  1 
ATOM   6073 C C   . ALA B 1 248 ? 28.116  -7.294  -47.177 1.00 49.93 ? 248  ALA B C   1 
ATOM   6074 O O   . ALA B 1 248 ? 27.750  -8.322  -47.777 1.00 50.10 ? 248  ALA B O   1 
ATOM   6075 C CB  . ALA B 1 248 ? 27.287  -4.976  -47.633 1.00 48.75 ? 248  ALA B CB  1 
ATOM   6076 N N   . THR B 1 249 ? 29.379  -7.051  -46.812 1.00 50.16 ? 249  THR B N   1 
ATOM   6077 C CA  . THR B 1 249 ? 30.443  -8.032  -46.962 1.00 50.22 ? 249  THR B CA  1 
ATOM   6078 C C   . THR B 1 249 ? 30.054  -9.355  -46.303 1.00 50.77 ? 249  THR B C   1 
ATOM   6079 O O   . THR B 1 249 ? 30.188  -10.420 -46.916 1.00 51.18 ? 249  THR B O   1 
ATOM   6080 C CB  . THR B 1 249 ? 31.775  -7.518  -46.392 1.00 50.22 ? 249  THR B CB  1 
ATOM   6081 O OG1 . THR B 1 249 ? 32.126  -6.280  -47.033 1.00 49.69 ? 249  THR B OG1 1 
ATOM   6082 C CG2 . THR B 1 249 ? 32.885  -8.537  -46.625 1.00 50.32 ? 249  THR B CG2 1 
ATOM   6083 N N   . LEU B 1 250 ? 29.546  -9.290  -45.075 1.00 50.84 ? 250  LEU B N   1 
ATOM   6084 C CA  . LEU B 1 250 ? 29.175  -10.501 -44.364 1.00 51.31 ? 250  LEU B CA  1 
ATOM   6085 C C   . LEU B 1 250 ? 28.020  -11.250 -45.031 1.00 51.68 ? 250  LEU B C   1 
ATOM   6086 O O   . LEU B 1 250 ? 28.002  -12.487 -45.047 1.00 51.76 ? 250  LEU B O   1 
ATOM   6087 C CB  . LEU B 1 250 ? 28.873  -10.218 -42.881 1.00 51.18 ? 250  LEU B CB  1 
ATOM   6088 C CG  . LEU B 1 250 ? 28.334  -11.380 -42.030 1.00 51.25 ? 250  LEU B CG  1 
ATOM   6089 C CD1 . LEU B 1 250 ? 29.274  -12.596 -42.027 1.00 50.62 ? 250  LEU B CD1 1 
ATOM   6090 C CD2 . LEU B 1 250 ? 28.049  -10.939 -40.614 1.00 51.55 ? 250  LEU B CD2 1 
ATOM   6091 N N   . LEU B 1 251 ? 27.057  -10.515 -45.577 1.00 52.37 ? 251  LEU B N   1 
ATOM   6092 C CA  . LEU B 1 251 ? 25.898  -11.163 -46.190 1.00 52.77 ? 251  LEU B CA  1 
ATOM   6093 C C   . LEU B 1 251 ? 26.305  -11.837 -47.489 1.00 53.22 ? 251  LEU B C   1 
ATOM   6094 O O   . LEU B 1 251 ? 25.829  -12.933 -47.792 1.00 53.52 ? 251  LEU B O   1 
ATOM   6095 C CB  . LEU B 1 251 ? 24.749  -10.179 -46.430 1.00 52.58 ? 251  LEU B CB  1 
ATOM   6096 C CG  . LEU B 1 251 ? 23.597  -10.819 -47.201 1.00 52.08 ? 251  LEU B CG  1 
ATOM   6097 C CD1 . LEU B 1 251 ? 22.498  -11.258 -46.284 1.00 51.17 ? 251  LEU B CD1 1 
ATOM   6098 C CD2 . LEU B 1 251 ? 23.086  -9.873  -48.248 1.00 52.91 ? 251  LEU B CD2 1 
ATOM   6099 N N   . ALA B 1 252 ? 27.189  -11.176 -48.240 1.00 53.91 ? 252  ALA B N   1 
ATOM   6100 C CA  . ALA B 1 252 ? 27.717  -11.702 -49.497 1.00 54.61 ? 252  ALA B CA  1 
ATOM   6101 C C   . ALA B 1 252 ? 28.377  -13.042 -49.233 1.00 55.60 ? 252  ALA B C   1 
ATOM   6102 O O   . ALA B 1 252 ? 27.945  -14.076 -49.767 1.00 55.84 ? 252  ALA B O   1 
ATOM   6103 C CB  . ALA B 1 252 ? 28.705  -10.738 -50.105 1.00 54.17 ? 252  ALA B CB  1 
ATOM   6104 N N   . ARG B 1 253 ? 29.397  -13.028 -48.379 1.00 56.34 ? 253  ARG B N   1 
ATOM   6105 C CA  . ARG B 1 253 ? 30.077  -14.251 -47.989 1.00 57.24 ? 253  ARG B CA  1 
ATOM   6106 C C   . ARG B 1 253 ? 29.041  -15.310 -47.605 1.00 57.41 ? 253  ARG B C   1 
ATOM   6107 O O   . ARG B 1 253 ? 29.107  -16.445 -48.080 1.00 57.71 ? 253  ARG B O   1 
ATOM   6108 C CB  . ARG B 1 253 ? 31.063  -13.980 -46.849 1.00 57.59 ? 253  ARG B CB  1 
ATOM   6109 C CG  . ARG B 1 253 ? 31.725  -15.212 -46.271 1.00 58.66 ? 253  ARG B CG  1 
ATOM   6110 C CD  . ARG B 1 253 ? 31.839  -15.078 -44.767 1.00 60.34 ? 253  ARG B CD  1 
ATOM   6111 N NE  . ARG B 1 253 ? 31.906  -16.381 -44.110 1.00 62.50 ? 253  ARG B NE  1 
ATOM   6112 C CZ  . ARG B 1 253 ? 31.809  -16.562 -42.794 1.00 64.04 ? 253  ARG B CZ  1 
ATOM   6113 N NH1 . ARG B 1 253 ? 31.642  -15.518 -41.980 1.00 64.70 ? 253  ARG B NH1 1 
ATOM   6114 N NH2 . ARG B 1 253 ? 31.890  -17.787 -42.288 1.00 63.63 ? 253  ARG B NH2 1 
ATOM   6115 N N   . LEU B 1 254 ? 28.060  -14.927 -46.792 1.00 57.52 ? 254  LEU B N   1 
ATOM   6116 C CA  . LEU B 1 254 ? 27.016  -15.863 -46.373 1.00 57.72 ? 254  LEU B CA  1 
ATOM   6117 C C   . LEU B 1 254 ? 26.246  -16.495 -47.538 1.00 57.99 ? 254  LEU B C   1 
ATOM   6118 O O   . LEU B 1 254 ? 25.776  -17.622 -47.424 1.00 58.08 ? 254  LEU B O   1 
ATOM   6119 C CB  . LEU B 1 254 ? 26.051  -15.207 -45.384 1.00 57.66 ? 254  LEU B CB  1 
ATOM   6120 C CG  . LEU B 1 254 ? 26.369  -15.208 -43.883 1.00 57.75 ? 254  LEU B CG  1 
ATOM   6121 C CD1 . LEU B 1 254 ? 25.430  -14.266 -43.155 1.00 57.60 ? 254  LEU B CD1 1 
ATOM   6122 C CD2 . LEU B 1 254 ? 26.272  -16.610 -43.278 1.00 58.08 ? 254  LEU B CD2 1 
ATOM   6123 N N   . VAL B 1 255 ? 26.112  -15.779 -48.652 1.00 58.34 ? 255  VAL B N   1 
ATOM   6124 C CA  . VAL B 1 255 ? 25.427  -16.344 -49.831 1.00 58.57 ? 255  VAL B CA  1 
ATOM   6125 C C   . VAL B 1 255 ? 26.408  -16.801 -50.929 1.00 58.77 ? 255  VAL B C   1 
ATOM   6126 O O   . VAL B 1 255 ? 26.005  -17.077 -52.059 1.00 59.26 ? 255  VAL B O   1 
ATOM   6127 C CB  . VAL B 1 255 ? 24.292  -15.407 -50.412 1.00 58.44 ? 255  VAL B CB  1 
ATOM   6128 C CG1 . VAL B 1 255 ? 23.163  -15.241 -49.411 1.00 58.19 ? 255  VAL B CG1 1 
ATOM   6129 C CG2 . VAL B 1 255 ? 24.835  -14.045 -50.859 1.00 57.79 ? 255  VAL B CG2 1 
ATOM   6130 N N   . GLY B 1 256 ? 27.692  -16.848 -50.587 1.00 58.75 ? 256  GLY B N   1 
ATOM   6131 C CA  . GLY B 1 256 ? 28.718  -17.367 -51.473 1.00 58.77 ? 256  GLY B CA  1 
ATOM   6132 C C   . GLY B 1 256 ? 29.275  -16.409 -52.507 1.00 58.97 ? 256  GLY B C   1 
ATOM   6133 O O   . GLY B 1 256 ? 29.419  -16.792 -53.652 1.00 59.37 ? 256  GLY B O   1 
ATOM   6134 N N   . CYS B 1 257 ? 29.634  -15.185 -52.128 1.00 59.16 ? 257  CYS B N   1 
ATOM   6135 C CA  . CYS B 1 257 ? 30.119  -14.219 -53.133 1.00 59.41 ? 257  CYS B CA  1 
ATOM   6136 C C   . CYS B 1 257 ? 31.550  -13.695 -52.945 1.00 59.54 ? 257  CYS B C   1 
ATOM   6137 O O   . CYS B 1 257 ? 31.879  -13.113 -51.910 1.00 59.68 ? 257  CYS B O   1 
ATOM   6138 C CB  . CYS B 1 257 ? 29.102  -13.083 -53.315 1.00 59.16 ? 257  CYS B CB  1 
ATOM   6139 S SG  . CYS B 1 257 ? 27.564  -13.690 -54.105 1.00 59.18 ? 257  CYS B SG  1 
ATOM   6140 N N   . ASN B 1 265 ? 37.116  -6.494  -54.109 1.00 65.62 ? 265  ASN B N   1 
ATOM   6141 C CA  . ASN B 1 265 ? 36.516  -5.670  -55.163 1.00 65.78 ? 265  ASN B CA  1 
ATOM   6142 C C   . ASN B 1 265 ? 34.982  -5.540  -55.039 1.00 65.34 ? 265  ASN B C   1 
ATOM   6143 O O   . ASN B 1 265 ? 34.246  -6.548  -55.096 1.00 65.00 ? 265  ASN B O   1 
ATOM   6144 C CB  . ASN B 1 265 ? 36.923  -6.205  -56.544 1.00 66.26 ? 265  ASN B CB  1 
ATOM   6145 C CG  . ASN B 1 265 ? 36.361  -5.376  -57.698 1.00 67.36 ? 265  ASN B CG  1 
ATOM   6146 O OD1 . ASN B 1 265 ? 35.202  -5.543  -58.092 1.00 67.62 ? 265  ASN B OD1 1 
ATOM   6147 N ND2 . ASN B 1 265 ? 37.197  -4.503  -58.267 1.00 68.29 ? 265  ASN B ND2 1 
ATOM   6148 N N   . ASP B 1 266 ? 34.522  -4.292  -54.870 1.00 64.72 ? 266  ASP B N   1 
ATOM   6149 C CA  . ASP B 1 266 ? 33.094  -3.962  -54.716 1.00 63.65 ? 266  ASP B CA  1 
ATOM   6150 C C   . ASP B 1 266 ? 32.283  -4.432  -55.923 1.00 63.40 ? 266  ASP B C   1 
ATOM   6151 O O   . ASP B 1 266 ? 31.336  -5.215  -55.779 1.00 63.15 ? 266  ASP B O   1 
ATOM   6152 C CB  . ASP B 1 266 ? 32.898  -2.448  -54.508 1.00 63.50 ? 266  ASP B CB  1 
ATOM   6153 C CG  . ASP B 1 266 ? 33.218  -1.985  -53.076 1.00 62.76 ? 266  ASP B CG  1 
ATOM   6154 O OD1 . ASP B 1 266 ? 33.247  -2.824  -52.141 1.00 60.67 ? 266  ASP B OD1 1 
ATOM   6155 O OD2 . ASP B 1 266 ? 33.433  -0.760  -52.892 1.00 60.92 ? 266  ASP B OD2 1 
ATOM   6156 N N   . THR B 1 267 ? 32.689  -3.970  -57.108 1.00 63.07 ? 267  THR B N   1 
ATOM   6157 C CA  . THR B 1 267 ? 32.015  -4.278  -58.373 1.00 62.81 ? 267  THR B CA  1 
ATOM   6158 C C   . THR B 1 267 ? 31.694  -5.765  -58.526 1.00 62.61 ? 267  THR B C   1 
ATOM   6159 O O   . THR B 1 267 ? 30.575  -6.124  -58.891 1.00 62.80 ? 267  THR B O   1 
ATOM   6160 C CB  . THR B 1 267 ? 32.850  -3.774  -59.580 1.00 63.01 ? 267  THR B CB  1 
ATOM   6161 O OG1 . THR B 1 267 ? 33.155  -2.384  -59.404 1.00 62.97 ? 267  THR B OG1 1 
ATOM   6162 C CG2 . THR B 1 267 ? 32.105  -3.965  -60.914 1.00 63.06 ? 267  THR B CG2 1 
ATOM   6163 N N   . GLU B 1 268 ? 32.673  -6.613  -58.219 1.00 62.55 ? 268  GLU B N   1 
ATOM   6164 C CA  . GLU B 1 268 ? 32.579  -8.059  -58.417 1.00 62.48 ? 268  GLU B CA  1 
ATOM   6165 C C   . GLU B 1 268 ? 31.644  -8.659  -57.384 1.00 61.19 ? 268  GLU B C   1 
ATOM   6166 O O   . GLU B 1 268 ? 30.828  -9.527  -57.696 1.00 61.09 ? 268  GLU B O   1 
ATOM   6167 C CB  . GLU B 1 268 ? 33.981  -8.699  -58.335 1.00 62.64 ? 268  GLU B CB  1 
ATOM   6168 C CG  . GLU B 1 268 ? 34.064  -10.183 -58.784 1.00 64.44 ? 268  GLU B CG  1 
ATOM   6169 C CD  . GLU B 1 268 ? 35.505  -10.754 -58.780 1.00 64.91 ? 268  GLU B CD  1 
ATOM   6170 O OE1 . GLU B 1 268 ? 36.059  -10.981 -59.891 1.00 66.58 ? 268  GLU B OE1 1 
ATOM   6171 O OE2 . GLU B 1 268 ? 36.079  -10.972 -57.673 1.00 67.48 ? 268  GLU B OE2 1 
ATOM   6172 N N   . LEU B 1 269 ? 31.769  -8.178  -56.150 1.00 60.23 ? 269  LEU B N   1 
ATOM   6173 C CA  . LEU B 1 269 ? 30.940  -8.632  -55.036 1.00 58.99 ? 269  LEU B CA  1 
ATOM   6174 C C   . LEU B 1 269 ? 29.462  -8.335  -55.304 1.00 58.07 ? 269  LEU B C   1 
ATOM   6175 O O   . LEU B 1 269 ? 28.599  -9.187  -55.091 1.00 57.74 ? 269  LEU B O   1 
ATOM   6176 C CB  . LEU B 1 269 ? 31.412  -7.966  -53.734 1.00 59.17 ? 269  LEU B CB  1 
ATOM   6177 C CG  . LEU B 1 269 ? 30.926  -8.442  -52.357 1.00 59.50 ? 269  LEU B CG  1 
ATOM   6178 C CD1 . LEU B 1 269 ? 31.988  -8.198  -51.304 1.00 59.85 ? 269  LEU B CD1 1 
ATOM   6179 C CD2 . LEU B 1 269 ? 29.646  -7.740  -51.959 1.00 59.67 ? 269  LEU B CD2 1 
ATOM   6180 N N   . ILE B 1 270 ? 29.180  -7.128  -55.782 1.00 56.95 ? 270  ILE B N   1 
ATOM   6181 C CA  . ILE B 1 270 ? 27.806  -6.729  -56.065 1.00 56.16 ? 270  ILE B CA  1 
ATOM   6182 C C   . ILE B 1 270 ? 27.224  -7.462  -57.278 1.00 55.43 ? 270  ILE B C   1 
ATOM   6183 O O   . ILE B 1 270 ? 26.061  -7.890  -57.241 1.00 55.10 ? 270  ILE B O   1 
ATOM   6184 C CB  . ILE B 1 270 ? 27.673  -5.208  -56.172 1.00 56.14 ? 270  ILE B CB  1 
ATOM   6185 C CG1 . ILE B 1 270 ? 27.981  -4.597  -54.808 1.00 56.60 ? 270  ILE B CG1 1 
ATOM   6186 C CG2 . ILE B 1 270 ? 26.260  -4.809  -56.568 1.00 56.43 ? 270  ILE B CG2 1 
ATOM   6187 C CD1 . ILE B 1 270 ? 28.604  -3.228  -54.883 1.00 57.99 ? 270  ILE B CD1 1 
ATOM   6188 N N   . ALA B 1 271 ? 28.031  -7.641  -58.328 1.00 54.35 ? 271  ALA B N   1 
ATOM   6189 C CA  . ALA B 1 271 ? 27.593  -8.443  -59.470 1.00 53.52 ? 271  ALA B CA  1 
ATOM   6190 C C   . ALA B 1 271 ? 27.075  -9.807  -59.009 1.00 52.97 ? 271  ALA B C   1 
ATOM   6191 O O   . ALA B 1 271 ? 26.017  -10.256 -59.452 1.00 52.83 ? 271  ALA B O   1 
ATOM   6192 C CB  . ALA B 1 271 ? 28.701  -8.595  -60.476 1.00 53.56 ? 271  ALA B CB  1 
ATOM   6193 N N   . CYS B 1 272 ? 27.806  -10.439 -58.092 1.00 52.63 ? 272  CYS B N   1 
ATOM   6194 C CA  . CYS B 1 272 ? 27.428  -11.745 -57.555 1.00 51.95 ? 272  CYS B CA  1 
ATOM   6195 C C   . CYS B 1 272 ? 26.147  -11.712 -56.738 1.00 51.19 ? 272  CYS B C   1 
ATOM   6196 O O   . CYS B 1 272 ? 25.319  -12.633 -56.829 1.00 51.21 ? 272  CYS B O   1 
ATOM   6197 C CB  . CYS B 1 272 ? 28.547  -12.339 -56.700 1.00 52.00 ? 272  CYS B CB  1 
ATOM   6198 S SG  . CYS B 1 272 ? 28.124  -13.993 -56.073 1.00 53.53 ? 272  CYS B SG  1 
ATOM   6199 N N   . LEU B 1 273 ? 25.996  -10.671 -55.921 1.00 50.08 ? 273  LEU B N   1 
ATOM   6200 C CA  . LEU B 1 273 ? 24.789  -10.513 -55.116 1.00 49.03 ? 273  LEU B CA  1 
ATOM   6201 C C   . LEU B 1 273 ? 23.579  -10.349 -56.030 1.00 48.87 ? 273  LEU B C   1 
ATOM   6202 O O   . LEU B 1 273 ? 22.508  -10.898 -55.758 1.00 48.42 ? 273  LEU B O   1 
ATOM   6203 C CB  . LEU B 1 273 ? 24.909  -9.329  -54.154 1.00 48.40 ? 273  LEU B CB  1 
ATOM   6204 C CG  . LEU B 1 273 ? 25.740  -9.524  -52.885 1.00 46.60 ? 273  LEU B CG  1 
ATOM   6205 C CD1 . LEU B 1 273 ? 26.041  -8.185  -52.269 1.00 46.16 ? 273  LEU B CD1 1 
ATOM   6206 C CD2 . LEU B 1 273 ? 25.044  -10.405 -51.889 1.00 43.84 ? 273  LEU B CD2 1 
ATOM   6207 N N   . ARG B 1 274 ? 23.782  -9.629  -57.133 1.00 48.87 ? 274  ARG B N   1 
ATOM   6208 C CA  . ARG B 1 274 ? 22.740  -9.436  -58.150 1.00 49.28 ? 274  ARG B CA  1 
ATOM   6209 C C   . ARG B 1 274 ? 22.290  -10.712 -58.879 1.00 49.31 ? 274  ARG B C   1 
ATOM   6210 O O   . ARG B 1 274 ? 21.250  -10.710 -59.530 1.00 49.50 ? 274  ARG B O   1 
ATOM   6211 C CB  . ARG B 1 274 ? 23.164  -8.380  -59.161 1.00 48.83 ? 274  ARG B CB  1 
ATOM   6212 C CG  . ARG B 1 274 ? 23.160  -6.991  -58.573 1.00 49.93 ? 274  ARG B CG  1 
ATOM   6213 C CD  . ARG B 1 274 ? 23.003  -5.966  -59.638 1.00 50.85 ? 274  ARG B CD  1 
ATOM   6214 N NE  . ARG B 1 274 ? 24.161  -5.994  -60.508 1.00 53.15 ? 274  ARG B NE  1 
ATOM   6215 C CZ  . ARG B 1 274 ? 25.056  -5.018  -60.570 1.00 54.75 ? 274  ARG B CZ  1 
ATOM   6216 N NH1 . ARG B 1 274 ? 24.904  -3.922  -59.815 1.00 53.83 ? 274  ARG B NH1 1 
ATOM   6217 N NH2 . ARG B 1 274 ? 26.088  -5.140  -61.401 1.00 53.89 ? 274  ARG B NH2 1 
ATOM   6218 N N   . THR B 1 275 ? 23.066  -11.787 -58.771 1.00 49.37 ? 275  THR B N   1 
ATOM   6219 C CA  . THR B 1 275 ? 22.747  -13.026 -59.463 1.00 49.59 ? 275  THR B CA  1 
ATOM   6220 C C   . THR B 1 275 ? 21.937  -13.934 -58.571 1.00 49.73 ? 275  THR B C   1 
ATOM   6221 O O   . THR B 1 275 ? 21.462  -14.970 -59.017 1.00 50.22 ? 275  THR B O   1 
ATOM   6222 C CB  . THR B 1 275 ? 24.009  -13.792 -59.936 1.00 50.00 ? 275  THR B CB  1 
ATOM   6223 O OG1 . THR B 1 275 ? 24.701  -14.348 -58.804 1.00 50.40 ? 275  THR B OG1 1 
ATOM   6224 C CG2 . THR B 1 275 ? 24.950  -12.876 -60.751 1.00 49.83 ? 275  THR B CG2 1 
ATOM   6225 N N   . ARG B 1 276 ? 21.771  -13.541 -57.312 1.00 49.75 ? 276  ARG B N   1 
ATOM   6226 C CA  . ARG B 1 276 ? 21.043  -14.362 -56.359 1.00 49.73 ? 276  ARG B CA  1 
ATOM   6227 C C   . ARG B 1 276 ? 19.542  -14.071 -56.331 1.00 49.46 ? 276  ARG B C   1 
ATOM   6228 O O   . ARG B 1 276 ? 19.128  -12.912 -56.314 1.00 49.19 ? 276  ARG B O   1 
ATOM   6229 C CB  . ARG B 1 276 ? 21.648  -14.239 -54.955 1.00 50.00 ? 276  ARG B CB  1 
ATOM   6230 C CG  . ARG B 1 276 ? 23.108  -14.731 -54.840 1.00 52.79 ? 276  ARG B CG  1 
ATOM   6231 C CD  . ARG B 1 276 ? 23.249  -16.275 -54.929 1.00 56.13 ? 276  ARG B CD  1 
ATOM   6232 N NE  . ARG B 1 276 ? 24.619  -16.718 -54.646 1.00 59.33 ? 276  ARG B NE  1 
ATOM   6233 C CZ  . ARG B 1 276 ? 25.641  -16.641 -55.503 1.00 60.50 ? 276  ARG B CZ  1 
ATOM   6234 N NH1 . ARG B 1 276 ? 25.472  -16.134 -56.720 1.00 61.30 ? 276  ARG B NH1 1 
ATOM   6235 N NH2 . ARG B 1 276 ? 26.843  -17.066 -55.143 1.00 59.81 ? 276  ARG B NH2 1 
ATOM   6236 N N   . PRO B 1 277 ? 18.720  -15.135 -56.342 1.00 48.99 ? 277  PRO B N   1 
ATOM   6237 C CA  . PRO B 1 277 ? 17.298  -14.994 -56.063 1.00 48.83 ? 277  PRO B CA  1 
ATOM   6238 C C   . PRO B 1 277 ? 17.047  -14.139 -54.821 1.00 48.76 ? 277  PRO B C   1 
ATOM   6239 O O   . PRO B 1 277 ? 17.775  -14.256 -53.826 1.00 48.88 ? 277  PRO B O   1 
ATOM   6240 C CB  . PRO B 1 277 ? 16.824  -16.442 -55.819 1.00 48.39 ? 277  PRO B CB  1 
ATOM   6241 C CG  . PRO B 1 277 ? 17.943  -17.316 -56.119 1.00 48.47 ? 277  PRO B CG  1 
ATOM   6242 C CD  . PRO B 1 277 ? 19.086  -16.523 -56.657 1.00 48.95 ? 277  PRO B CD  1 
ATOM   6243 N N   . ALA B 1 278 ? 16.023  -13.289 -54.888 1.00 48.48 ? 278  ALA B N   1 
ATOM   6244 C CA  . ALA B 1 278 ? 15.677  -12.393 -53.789 1.00 47.81 ? 278  ALA B CA  1 
ATOM   6245 C C   . ALA B 1 278 ? 15.701  -13.107 -52.442 1.00 47.40 ? 278  ALA B C   1 
ATOM   6246 O O   . ALA B 1 278 ? 16.368  -12.663 -51.516 1.00 47.47 ? 278  ALA B O   1 
ATOM   6247 C CB  . ALA B 1 278 ? 14.314  -11.751 -54.036 1.00 47.68 ? 278  ALA B CB  1 
ATOM   6248 N N   . GLN B 1 279 ? 15.000  -14.231 -52.349 1.00 47.14 ? 279  GLN B N   1 
ATOM   6249 C CA  . GLN B 1 279 ? 14.819  -14.937 -51.073 1.00 46.78 ? 279  GLN B CA  1 
ATOM   6250 C C   . GLN B 1 279 ? 16.140  -15.438 -50.479 1.00 46.58 ? 279  GLN B C   1 
ATOM   6251 O O   . GLN B 1 279 ? 16.259  -15.609 -49.270 1.00 46.40 ? 279  GLN B O   1 
ATOM   6252 C CB  . GLN B 1 279 ? 13.805  -16.079 -51.228 1.00 46.27 ? 279  GLN B CB  1 
ATOM   6253 C CG  . GLN B 1 279 ? 13.356  -16.713 -49.934 1.00 46.34 ? 279  GLN B CG  1 
ATOM   6254 C CD  . GLN B 1 279 ? 12.802  -15.713 -48.936 1.00 47.55 ? 279  GLN B CD  1 
ATOM   6255 O OE1 . GLN B 1 279 ? 11.958  -14.877 -49.269 1.00 49.07 ? 279  GLN B OE1 1 
ATOM   6256 N NE2 . GLN B 1 279 ? 13.263  -15.805 -47.696 1.00 46.67 ? 279  GLN B NE2 1 
ATOM   6257 N N   . ASP B 1 280 ? 17.133  -15.653 -51.332 1.00 46.86 ? 280  ASP B N   1 
ATOM   6258 C CA  . ASP B 1 280 ? 18.479  -15.971 -50.864 1.00 47.14 ? 280  ASP B CA  1 
ATOM   6259 C C   . ASP B 1 280 ? 19.046  -14.872 -49.956 1.00 47.10 ? 280  ASP B C   1 
ATOM   6260 O O   . ASP B 1 280 ? 19.538  -15.172 -48.872 1.00 47.47 ? 280  ASP B O   1 
ATOM   6261 C CB  . ASP B 1 280 ? 19.421  -16.230 -52.039 1.00 47.30 ? 280  ASP B CB  1 
ATOM   6262 C CG  . ASP B 1 280 ? 19.201  -17.588 -52.683 1.00 48.23 ? 280  ASP B CG  1 
ATOM   6263 O OD1 . ASP B 1 280 ? 18.284  -18.326 -52.246 1.00 50.24 ? 280  ASP B OD1 1 
ATOM   6264 O OD2 . ASP B 1 280 ? 19.956  -17.912 -53.628 1.00 48.00 ? 280  ASP B OD2 1 
ATOM   6265 N N   . LEU B 1 281 ? 18.973  -13.612 -50.393 1.00 46.70 ? 281  LEU B N   1 
ATOM   6266 C CA  . LEU B 1 281 ? 19.460  -12.488 -49.594 1.00 46.33 ? 281  LEU B CA  1 
ATOM   6267 C C   . LEU B 1 281 ? 18.658  -12.338 -48.294 1.00 46.66 ? 281  LEU B C   1 
ATOM   6268 O O   . LEU B 1 281 ? 19.221  -12.167 -47.217 1.00 46.11 ? 281  LEU B O   1 
ATOM   6269 C CB  . LEU B 1 281 ? 19.425  -11.202 -50.411 1.00 45.97 ? 281  LEU B CB  1 
ATOM   6270 C CG  . LEU B 1 281 ? 20.123  -11.250 -51.773 1.00 45.70 ? 281  LEU B CG  1 
ATOM   6271 C CD1 . LEU B 1 281 ? 20.147  -9.870  -52.410 1.00 44.28 ? 281  LEU B CD1 1 
ATOM   6272 C CD2 . LEU B 1 281 ? 21.553  -11.829 -51.687 1.00 45.02 ? 281  LEU B CD2 1 
ATOM   6273 N N   . VAL B 1 282 ? 17.339  -12.452 -48.408 1.00 47.05 ? 282  VAL B N   1 
ATOM   6274 C CA  . VAL B 1 282 ? 16.440  -12.398 -47.265 1.00 47.57 ? 282  VAL B CA  1 
ATOM   6275 C C   . VAL B 1 282 ? 16.706  -13.540 -46.267 1.00 48.66 ? 282  VAL B C   1 
ATOM   6276 O O   . VAL B 1 282 ? 16.570  -13.352 -45.052 1.00 48.57 ? 282  VAL B O   1 
ATOM   6277 C CB  . VAL B 1 282 ? 14.969  -12.340 -47.755 1.00 47.25 ? 282  VAL B CB  1 
ATOM   6278 C CG1 . VAL B 1 282 ? 13.966  -12.459 -46.612 1.00 46.64 ? 282  VAL B CG1 1 
ATOM   6279 C CG2 . VAL B 1 282 ? 14.744  -11.039 -48.498 1.00 46.95 ? 282  VAL B CG2 1 
ATOM   6280 N N   . ASP B 1 283 ? 17.101  -14.706 -46.782 1.00 49.84 ? 283  ASP B N   1 
ATOM   6281 C CA  . ASP B 1 283 ? 17.474  -15.878 -45.954 1.00 51.17 ? 283  ASP B CA  1 
ATOM   6282 C C   . ASP B 1 283 ? 18.527  -15.561 -44.865 1.00 51.84 ? 283  ASP B C   1 
ATOM   6283 O O   . ASP B 1 283 ? 18.422  -16.035 -43.727 1.00 51.70 ? 283  ASP B O   1 
ATOM   6284 C CB  . ASP B 1 283 ? 18.021  -17.011 -46.850 1.00 51.05 ? 283  ASP B CB  1 
ATOM   6285 C CG  . ASP B 1 283 ? 16.946  -17.984 -47.329 1.00 51.99 ? 283  ASP B CG  1 
ATOM   6286 O OD1 . ASP B 1 283 ? 15.759  -17.882 -46.918 1.00 51.52 ? 283  ASP B OD1 1 
ATOM   6287 O OD2 . ASP B 1 283 ? 17.314  -18.877 -48.127 1.00 53.09 ? 283  ASP B OD2 1 
ATOM   6288 N N   . HIS B 1 284 ? 19.536  -14.773 -45.245 1.00 52.70 ? 284  HIS B N   1 
ATOM   6289 C CA  . HIS B 1 284 ? 20.684  -14.471 -44.401 1.00 53.90 ? 284  HIS B CA  1 
ATOM   6290 C C   . HIS B 1 284 ? 20.712  -13.023 -43.912 1.00 54.36 ? 284  HIS B C   1 
ATOM   6291 O O   . HIS B 1 284 ? 21.672  -12.597 -43.267 1.00 54.59 ? 284  HIS B O   1 
ATOM   6292 C CB  . HIS B 1 284 ? 21.981  -14.799 -45.147 1.00 54.34 ? 284  HIS B CB  1 
ATOM   6293 C CG  . HIS B 1 284 ? 22.186  -16.262 -45.369 1.00 56.04 ? 284  HIS B CG  1 
ATOM   6294 N ND1 . HIS B 1 284 ? 22.408  -17.145 -44.333 1.00 57.62 ? 284  HIS B ND1 1 
ATOM   6295 C CD2 . HIS B 1 284 ? 22.185  -17.000 -46.504 1.00 57.11 ? 284  HIS B CD2 1 
ATOM   6296 C CE1 . HIS B 1 284 ? 22.539  -18.366 -44.822 1.00 59.05 ? 284  HIS B CE1 1 
ATOM   6297 N NE2 . HIS B 1 284 ? 22.410  -18.305 -46.137 1.00 58.55 ? 284  HIS B NE2 1 
ATOM   6298 N N   . GLU B 1 285 ? 19.660  -12.278 -44.239 1.00 54.75 ? 285  GLU B N   1 
ATOM   6299 C CA  . GLU B 1 285 ? 19.449  -10.913 -43.782 1.00 55.17 ? 285  GLU B CA  1 
ATOM   6300 C C   . GLU B 1 285 ? 19.689  -10.766 -42.276 1.00 55.64 ? 285  GLU B C   1 
ATOM   6301 O O   . GLU B 1 285 ? 20.337  -9.820  -41.824 1.00 54.93 ? 285  GLU B O   1 
ATOM   6302 C CB  . GLU B 1 285 ? 18.006  -10.526 -44.100 1.00 55.24 ? 285  GLU B CB  1 
ATOM   6303 C CG  . GLU B 1 285 ? 17.688  -9.061  -44.027 1.00 55.69 ? 285  GLU B CG  1 
ATOM   6304 C CD  . GLU B 1 285 ? 16.268  -8.786  -44.431 1.00 57.40 ? 285  GLU B CD  1 
ATOM   6305 O OE1 . GLU B 1 285 ? 15.925  -9.042  -45.602 1.00 59.10 ? 285  GLU B OE1 1 
ATOM   6306 O OE2 . GLU B 1 285 ? 15.486  -8.319  -43.582 1.00 58.82 ? 285  GLU B OE2 1 
ATOM   6307 N N   . TRP B 1 286 ? 19.169  -11.718 -41.509 1.00 56.42 ? 286  TRP B N   1 
ATOM   6308 C CA  . TRP B 1 286 ? 19.192  -11.609 -40.061 1.00 57.40 ? 286  TRP B CA  1 
ATOM   6309 C C   . TRP B 1 286 ? 20.438  -12.193 -39.390 1.00 57.57 ? 286  TRP B C   1 
ATOM   6310 O O   . TRP B 1 286 ? 20.537  -12.207 -38.167 1.00 57.90 ? 286  TRP B O   1 
ATOM   6311 C CB  . TRP B 1 286 ? 17.903  -12.176 -39.471 1.00 57.59 ? 286  TRP B CB  1 
ATOM   6312 C CG  . TRP B 1 286 ? 16.724  -11.297 -39.808 1.00 58.97 ? 286  TRP B CG  1 
ATOM   6313 C CD1 . TRP B 1 286 ? 15.782  -11.514 -40.780 1.00 58.63 ? 286  TRP B CD1 1 
ATOM   6314 C CD2 . TRP B 1 286 ? 16.386  -10.041 -39.200 1.00 59.44 ? 286  TRP B CD2 1 
ATOM   6315 N NE1 . TRP B 1 286 ? 14.875  -10.490 -40.796 1.00 57.75 ? 286  TRP B NE1 1 
ATOM   6316 C CE2 . TRP B 1 286 ? 15.221  -9.570  -39.840 1.00 59.22 ? 286  TRP B CE2 1 
ATOM   6317 C CE3 . TRP B 1 286 ? 16.953  -9.271  -38.169 1.00 59.40 ? 286  TRP B CE3 1 
ATOM   6318 C CZ2 . TRP B 1 286 ? 14.609  -8.356  -39.485 1.00 59.20 ? 286  TRP B CZ2 1 
ATOM   6319 C CZ3 . TRP B 1 286 ? 16.344  -8.074  -37.816 1.00 58.66 ? 286  TRP B CZ3 1 
ATOM   6320 C CH2 . TRP B 1 286 ? 15.185  -7.630  -38.473 1.00 58.82 ? 286  TRP B CH2 1 
ATOM   6321 N N   . HIS B 1 287 ? 21.400  -12.646 -40.180 1.00 57.76 ? 287  HIS B N   1 
ATOM   6322 C CA  . HIS B 1 287 ? 22.600  -13.234 -39.602 1.00 57.94 ? 287  HIS B CA  1 
ATOM   6323 C C   . HIS B 1 287 ? 23.787  -12.290 -39.657 1.00 57.95 ? 287  HIS B C   1 
ATOM   6324 O O   . HIS B 1 287 ? 24.925  -12.740 -39.571 1.00 58.19 ? 287  HIS B O   1 
ATOM   6325 C CB  . HIS B 1 287 ? 22.943  -14.569 -40.278 1.00 58.00 ? 287  HIS B CB  1 
ATOM   6326 C CG  . HIS B 1 287 ? 21.822  -15.565 -40.261 1.00 58.23 ? 287  HIS B CG  1 
ATOM   6327 N ND1 . HIS B 1 287 ? 21.684  -16.542 -41.224 1.00 58.08 ? 287  HIS B ND1 1 
ATOM   6328 C CD2 . HIS B 1 287 ? 20.776  -15.721 -39.412 1.00 58.63 ? 287  HIS B CD2 1 
ATOM   6329 C CE1 . HIS B 1 287 ? 20.610  -17.268 -40.960 1.00 59.13 ? 287  HIS B CE1 1 
ATOM   6330 N NE2 . HIS B 1 287 ? 20.039  -16.788 -39.868 1.00 59.42 ? 287  HIS B NE2 1 
ATOM   6331 N N   . VAL B 1 288 ? 23.529  -10.989 -39.794 1.00 58.02 ? 288  VAL B N   1 
ATOM   6332 C CA  . VAL B 1 288 ? 24.618  -10.011 -39.893 1.00 58.22 ? 288  VAL B CA  1 
ATOM   6333 C C   . VAL B 1 288 ? 24.712  -9.027  -38.721 1.00 58.64 ? 288  VAL B C   1 
ATOM   6334 O O   . VAL B 1 288 ? 25.687  -8.278  -38.632 1.00 58.74 ? 288  VAL B O   1 
ATOM   6335 C CB  . VAL B 1 288 ? 24.624  -9.223  -41.245 1.00 57.98 ? 288  VAL B CB  1 
ATOM   6336 C CG1 . VAL B 1 288 ? 24.620  -10.163 -42.423 1.00 58.03 ? 288  VAL B CG1 1 
ATOM   6337 C CG2 . VAL B 1 288 ? 23.457  -8.257  -41.331 1.00 58.08 ? 288  VAL B CG2 1 
ATOM   6338 N N   . LEU B 1 289 ? 23.709  -9.017  -37.839 1.00 59.03 ? 289  LEU B N   1 
ATOM   6339 C CA  . LEU B 1 289 ? 23.721  -8.117  -36.681 1.00 59.46 ? 289  LEU B CA  1 
ATOM   6340 C C   . LEU B 1 289 ? 24.871  -8.489  -35.729 1.00 60.05 ? 289  LEU B C   1 
ATOM   6341 O O   . LEU B 1 289 ? 25.091  -9.679  -35.451 1.00 59.75 ? 289  LEU B O   1 
ATOM   6342 C CB  . LEU B 1 289 ? 22.370  -8.122  -35.944 1.00 59.53 ? 289  LEU B CB  1 
ATOM   6343 C CG  . LEU B 1 289 ? 21.124  -7.503  -36.606 1.00 59.21 ? 289  LEU B CG  1 
ATOM   6344 C CD1 . LEU B 1 289 ? 19.848  -7.897  -35.866 1.00 59.10 ? 289  LEU B CD1 1 
ATOM   6345 C CD2 . LEU B 1 289 ? 21.224  -5.987  -36.723 1.00 58.95 ? 289  LEU B CD2 1 
ATOM   6346 N N   . PRO B 1 290 ? 25.618  -7.473  -35.241 1.00 60.50 ? 290  PRO B N   1 
ATOM   6347 C CA  . PRO B 1 290 ? 26.819  -7.711  -34.426 1.00 60.70 ? 290  PRO B CA  1 
ATOM   6348 C C   . PRO B 1 290 ? 26.538  -8.374  -33.079 1.00 60.74 ? 290  PRO B C   1 
ATOM   6349 O O   . PRO B 1 290 ? 27.418  -9.046  -32.538 1.00 60.87 ? 290  PRO B O   1 
ATOM   6350 C CB  . PRO B 1 290 ? 27.401  -6.300  -34.225 1.00 60.76 ? 290  PRO B CB  1 
ATOM   6351 C CG  . PRO B 1 290 ? 26.242  -5.370  -34.416 1.00 60.44 ? 290  PRO B CG  1 
ATOM   6352 C CD  . PRO B 1 290 ? 25.369  -6.030  -35.445 1.00 60.59 ? 290  PRO B CD  1 
ATOM   6353 N N   . GLN B 1 291 ? 25.333  -8.172  -32.547 1.00 60.94 ? 291  GLN B N   1 
ATOM   6354 C CA  . GLN B 1 291 ? 24.919  -8.750  -31.259 1.00 61.11 ? 291  GLN B CA  1 
ATOM   6355 C C   . GLN B 1 291 ? 23.461  -9.221  -31.301 1.00 60.93 ? 291  GLN B C   1 
ATOM   6356 O O   . GLN B 1 291 ? 22.676  -8.772  -32.142 1.00 60.99 ? 291  GLN B O   1 
ATOM   6357 C CB  . GLN B 1 291 ? 25.085  -7.746  -30.102 1.00 61.20 ? 291  GLN B CB  1 
ATOM   6358 C CG  . GLN B 1 291 ? 26.483  -7.140  -29.916 1.00 61.78 ? 291  GLN B CG  1 
ATOM   6359 C CD  . GLN B 1 291 ? 26.623  -5.787  -30.600 1.00 62.32 ? 291  GLN B CD  1 
ATOM   6360 O OE1 . GLN B 1 291 ? 25.623  -5.143  -30.922 1.00 63.07 ? 291  GLN B OE1 1 
ATOM   6361 N NE2 . GLN B 1 291 ? 27.864  -5.347  -30.822 1.00 60.82 ? 291  GLN B NE2 1 
ATOM   6362 N N   . GLU B 1 292 ? 23.125  -10.141 -30.395 1.00 60.66 ? 292  GLU B N   1 
ATOM   6363 C CA  . GLU B 1 292 ? 21.754  -10.577 -30.161 1.00 60.43 ? 292  GLU B CA  1 
ATOM   6364 C C   . GLU B 1 292 ? 20.991  -9.345  -29.682 1.00 59.67 ? 292  GLU B C   1 
ATOM   6365 O O   . GLU B 1 292 ? 21.387  -8.710  -28.698 1.00 60.11 ? 292  GLU B O   1 
ATOM   6366 C CB  . GLU B 1 292 ? 21.756  -11.659 -29.085 1.00 60.55 ? 292  GLU B CB  1 
ATOM   6367 C CG  . GLU B 1 292 ? 20.435  -12.381 -28.860 1.00 61.14 ? 292  GLU B CG  1 
ATOM   6368 C CD  . GLU B 1 292 ? 20.438  -13.213 -27.568 1.00 61.69 ? 292  GLU B CD  1 
ATOM   6369 O OE1 . GLU B 1 292 ? 21.504  -13.319 -26.901 1.00 61.55 ? 292  GLU B OE1 1 
ATOM   6370 O OE2 . GLU B 1 292 ? 19.364  -13.761 -27.220 1.00 63.52 ? 292  GLU B OE2 1 
ATOM   6371 N N   . SER B 1 293 ? 19.924  -8.976  -30.384 1.00 58.36 ? 293  SER B N   1 
ATOM   6372 C CA  . SER B 1 293 ? 19.314  -7.680  -30.134 1.00 56.85 ? 293  SER B CA  1 
ATOM   6373 C C   . SER B 1 293 ? 17.925  -7.502  -30.682 1.00 55.93 ? 293  SER B C   1 
ATOM   6374 O O   . SER B 1 293 ? 17.650  -7.836  -31.828 1.00 56.54 ? 293  SER B O   1 
ATOM   6375 C CB  . SER B 1 293 ? 20.214  -6.553  -30.664 1.00 56.91 ? 293  SER B CB  1 
ATOM   6376 O OG  . SER B 1 293 ? 20.764  -6.824  -31.942 1.00 56.37 ? 293  SER B OG  1 
ATOM   6377 N N   . ILE B 1 294 ? 17.053  -6.937  -29.861 1.00 54.81 ? 294  ILE B N   1 
ATOM   6378 C CA  . ILE B 1 294 ? 15.757  -6.500  -30.343 1.00 53.61 ? 294  ILE B CA  1 
ATOM   6379 C C   . ILE B 1 294 ? 15.858  -5.025  -30.735 1.00 52.97 ? 294  ILE B C   1 
ATOM   6380 O O   . ILE B 1 294 ? 16.808  -4.353  -30.342 1.00 52.73 ? 294  ILE B O   1 
ATOM   6381 C CB  . ILE B 1 294 ? 14.646  -6.751  -29.318 1.00 53.69 ? 294  ILE B CB  1 
ATOM   6382 C CG1 . ILE B 1 294 ? 14.933  -6.012  -28.005 1.00 53.46 ? 294  ILE B CG1 1 
ATOM   6383 C CG2 . ILE B 1 294 ? 14.453  -8.270  -29.100 1.00 53.64 ? 294  ILE B CG2 1 
ATOM   6384 C CD1 . ILE B 1 294 ? 13.692  -5.847  -27.129 1.00 52.39 ? 294  ILE B CD1 1 
ATOM   6385 N N   . PHE B 1 295 ? 14.886  -4.552  -31.524 1.00 51.93 ? 295  PHE B N   1 
ATOM   6386 C CA  . PHE B 1 295 ? 14.849  -3.196  -32.106 1.00 50.58 ? 295  PHE B CA  1 
ATOM   6387 C C   . PHE B 1 295 ? 16.138  -2.842  -32.812 1.00 50.38 ? 295  PHE B C   1 
ATOM   6388 O O   . PHE B 1 295 ? 16.627  -1.717  -32.721 1.00 50.32 ? 295  PHE B O   1 
ATOM   6389 C CB  . PHE B 1 295 ? 14.510  -2.122  -31.070 1.00 50.19 ? 295  PHE B CB  1 
ATOM   6390 C CG  . PHE B 1 295 ? 13.576  -1.038  -31.588 1.00 49.55 ? 295  PHE B CG  1 
ATOM   6391 C CD1 . PHE B 1 295 ? 13.824  -0.381  -32.801 1.00 48.50 ? 295  PHE B CD1 1 
ATOM   6392 C CD2 . PHE B 1 295 ? 12.452  -0.664  -30.850 1.00 48.42 ? 295  PHE B CD2 1 
ATOM   6393 C CE1 . PHE B 1 295 ? 12.969  0.608   -33.273 1.00 47.45 ? 295  PHE B CE1 1 
ATOM   6394 C CE2 . PHE B 1 295 ? 11.594  0.336   -31.314 1.00 47.28 ? 295  PHE B CE2 1 
ATOM   6395 C CZ  . PHE B 1 295 ? 11.852  0.964   -32.533 1.00 47.66 ? 295  PHE B CZ  1 
ATOM   6396 N N   . ARG B 1 296 ? 16.697  -3.822  -33.501 1.00 49.96 ? 296  ARG B N   1 
ATOM   6397 C CA  . ARG B 1 296 ? 17.888  -3.606  -34.284 1.00 49.46 ? 296  ARG B CA  1 
ATOM   6398 C C   . ARG B 1 296 ? 17.641  -4.319  -35.606 1.00 48.93 ? 296  ARG B C   1 
ATOM   6399 O O   . ARG B 1 296 ? 16.962  -5.365  -35.652 1.00 48.87 ? 296  ARG B O   1 
ATOM   6400 C CB  . ARG B 1 296 ? 19.111  -4.160  -33.565 1.00 49.52 ? 296  ARG B CB  1 
ATOM   6401 C CG  . ARG B 1 296 ? 20.355  -3.286  -33.692 1.00 51.10 ? 296  ARG B CG  1 
ATOM   6402 C CD  . ARG B 1 296 ? 20.633  -2.409  -32.463 1.00 51.42 ? 296  ARG B CD  1 
ATOM   6403 N NE  . ARG B 1 296 ? 19.473  -1.643  -31.999 1.00 52.15 ? 296  ARG B NE  1 
ATOM   6404 C CZ  . ARG B 1 296 ? 19.483  -0.804  -30.964 1.00 51.37 ? 296  ARG B CZ  1 
ATOM   6405 N NH1 . ARG B 1 296 ? 20.593  -0.579  -30.269 1.00 50.80 ? 296  ARG B NH1 1 
ATOM   6406 N NH2 . ARG B 1 296 ? 18.375  -0.177  -30.628 1.00 51.49 ? 296  ARG B NH2 1 
ATOM   6407 N N   . PHE B 1 297 ? 18.163  -3.733  -36.679 1.00 47.52 ? 297  PHE B N   1 
ATOM   6408 C CA  . PHE B 1 297 ? 17.790  -4.124  -38.027 1.00 46.16 ? 297  PHE B CA  1 
ATOM   6409 C C   . PHE B 1 297 ? 19.028  -4.125  -38.913 1.00 45.25 ? 297  PHE B C   1 
ATOM   6410 O O   . PHE B 1 297 ? 19.869  -3.222  -38.833 1.00 45.09 ? 297  PHE B O   1 
ATOM   6411 C CB  . PHE B 1 297 ? 16.714  -3.178  -38.577 1.00 46.17 ? 297  PHE B CB  1 
ATOM   6412 C CG  . PHE B 1 297 ? 15.565  -2.923  -37.613 1.00 46.44 ? 297  PHE B CG  1 
ATOM   6413 C CD1 . PHE B 1 297 ? 14.742  -3.969  -37.180 1.00 47.44 ? 297  PHE B CD1 1 
ATOM   6414 C CD2 . PHE B 1 297 ? 15.302  -1.638  -37.146 1.00 45.88 ? 297  PHE B CD2 1 
ATOM   6415 C CE1 . PHE B 1 297 ? 13.675  -3.735  -36.286 1.00 47.38 ? 297  PHE B CE1 1 
ATOM   6416 C CE2 . PHE B 1 297 ? 14.247  -1.389  -36.245 1.00 44.96 ? 297  PHE B CE2 1 
ATOM   6417 C CZ  . PHE B 1 297 ? 13.429  -2.434  -35.827 1.00 46.20 ? 297  PHE B CZ  1 
ATOM   6418 N N   . SER B 1 298 ? 19.134  -5.148  -39.755 1.00 43.93 ? 298  SER B N   1 
ATOM   6419 C CA  . SER B 1 298 ? 20.362  -5.416  -40.493 1.00 42.64 ? 298  SER B CA  1 
ATOM   6420 C C   . SER B 1 298 ? 20.705  -4.351  -41.521 1.00 41.02 ? 298  SER B C   1 
ATOM   6421 O O   . SER B 1 298 ? 21.837  -3.870  -41.574 1.00 40.70 ? 298  SER B O   1 
ATOM   6422 C CB  . SER B 1 298 ? 20.257  -6.772  -41.174 1.00 43.06 ? 298  SER B CB  1 
ATOM   6423 O OG  . SER B 1 298 ? 20.077  -7.797  -40.214 1.00 45.74 ? 298  SER B OG  1 
ATOM   6424 N N   . PHE B 1 299 ? 19.736  -3.994  -42.356 1.00 39.15 ? 299  PHE B N   1 
ATOM   6425 C CA  . PHE B 1 299 ? 20.026  -3.069  -43.444 1.00 37.54 ? 299  PHE B CA  1 
ATOM   6426 C C   . PHE B 1 299 ? 19.168  -1.825  -43.355 1.00 36.89 ? 299  PHE B C   1 
ATOM   6427 O O   . PHE B 1 299 ? 17.961  -1.847  -43.579 1.00 37.47 ? 299  PHE B O   1 
ATOM   6428 C CB  . PHE B 1 299 ? 19.976  -3.797  -44.795 1.00 36.78 ? 299  PHE B CB  1 
ATOM   6429 C CG  . PHE B 1 299 ? 21.058  -4.839  -44.924 1.00 35.81 ? 299  PHE B CG  1 
ATOM   6430 C CD1 . PHE B 1 299 ? 22.341  -4.475  -45.320 1.00 33.63 ? 299  PHE B CD1 1 
ATOM   6431 C CD2 . PHE B 1 299 ? 20.817  -6.163  -44.554 1.00 33.85 ? 299  PHE B CD2 1 
ATOM   6432 C CE1 . PHE B 1 299 ? 23.358  -5.415  -45.396 1.00 33.75 ? 299  PHE B CE1 1 
ATOM   6433 C CE2 . PHE B 1 299 ? 21.819  -7.108  -44.615 1.00 34.01 ? 299  PHE B CE2 1 
ATOM   6434 C CZ  . PHE B 1 299 ? 23.094  -6.743  -45.038 1.00 34.93 ? 299  PHE B CZ  1 
ATOM   6435 N N   . VAL B 1 300 ? 19.806  -0.745  -42.961 1.00 35.80 ? 300  VAL B N   1 
ATOM   6436 C CA  . VAL B 1 300 ? 19.110  0.488   -42.652 1.00 35.07 ? 300  VAL B CA  1 
ATOM   6437 C C   . VAL B 1 300 ? 19.922  1.568   -43.330 1.00 35.02 ? 300  VAL B C   1 
ATOM   6438 O O   . VAL B 1 300 ? 21.023  1.279   -43.824 1.00 34.74 ? 300  VAL B O   1 
ATOM   6439 C CB  . VAL B 1 300 ? 19.044  0.746   -41.111 1.00 34.70 ? 300  VAL B CB  1 
ATOM   6440 C CG1 . VAL B 1 300 ? 18.413  -0.425  -40.395 1.00 34.20 ? 300  VAL B CG1 1 
ATOM   6441 C CG2 . VAL B 1 300 ? 20.427  1.020   -40.550 1.00 33.99 ? 300  VAL B CG2 1 
ATOM   6442 N N   . PRO B 1 301 ? 19.394  2.804   -43.372 1.00 34.77 ? 301  PRO B N   1 
ATOM   6443 C CA  . PRO B 1 301 ? 20.114  3.905   -43.954 1.00 35.01 ? 301  PRO B CA  1 
ATOM   6444 C C   . PRO B 1 301 ? 21.542  4.007   -43.442 1.00 35.89 ? 301  PRO B C   1 
ATOM   6445 O O   . PRO B 1 301 ? 21.821  3.694   -42.284 1.00 36.22 ? 301  PRO B O   1 
ATOM   6446 C CB  . PRO B 1 301 ? 19.290  5.108   -43.504 1.00 35.25 ? 301  PRO B CB  1 
ATOM   6447 C CG  . PRO B 1 301 ? 17.911  4.600   -43.513 1.00 34.32 ? 301  PRO B CG  1 
ATOM   6448 C CD  . PRO B 1 301 ? 18.059  3.226   -42.917 1.00 34.88 ? 301  PRO B CD  1 
ATOM   6449 N N   . VAL B 1 302 ? 22.437  4.452   -44.314 1.00 36.76 ? 302  VAL B N   1 
ATOM   6450 C CA  . VAL B 1 302 ? 23.863  4.552   -44.018 1.00 37.07 ? 302  VAL B CA  1 
ATOM   6451 C C   . VAL B 1 302 ? 24.324  6.013   -44.044 1.00 37.77 ? 302  VAL B C   1 
ATOM   6452 O O   . VAL B 1 302 ? 23.905  6.797   -44.912 1.00 37.50 ? 302  VAL B O   1 
ATOM   6453 C CB  . VAL B 1 302 ? 24.685  3.708   -45.014 1.00 36.87 ? 302  VAL B CB  1 
ATOM   6454 C CG1 . VAL B 1 302 ? 24.671  4.329   -46.425 1.00 35.91 ? 302  VAL B CG1 1 
ATOM   6455 C CG2 . VAL B 1 302 ? 26.105  3.518   -44.512 1.00 38.05 ? 302  VAL B CG2 1 
ATOM   6456 N N   . VAL B 1 303 ? 25.163  6.379   -43.075 1.00 38.57 ? 303  VAL B N   1 
ATOM   6457 C CA  . VAL B 1 303 ? 25.741  7.718   -43.035 1.00 39.11 ? 303  VAL B CA  1 
ATOM   6458 C C   . VAL B 1 303 ? 26.820  7.722   -44.112 1.00 40.09 ? 303  VAL B C   1 
ATOM   6459 O O   . VAL B 1 303 ? 27.945  7.243   -43.901 1.00 41.02 ? 303  VAL B O   1 
ATOM   6460 C CB  . VAL B 1 303 ? 26.300  8.068   -41.635 1.00 38.73 ? 303  VAL B CB  1 
ATOM   6461 C CG1 . VAL B 1 303 ? 26.914  9.447   -41.614 1.00 37.41 ? 303  VAL B CG1 1 
ATOM   6462 C CG2 . VAL B 1 303 ? 25.212  7.974   -40.604 1.00 38.41 ? 303  VAL B CG2 1 
ATOM   6463 N N   . ASP B 1 304 ? 26.451  8.248   -45.273 1.00 40.57 ? 304  ASP B N   1 
ATOM   6464 C CA  . ASP B 1 304 ? 27.218  8.059   -46.496 1.00 41.15 ? 304  ASP B CA  1 
ATOM   6465 C C   . ASP B 1 304 ? 28.028  9.284   -46.924 1.00 41.59 ? 304  ASP B C   1 
ATOM   6466 O O   . ASP B 1 304 ? 28.785  9.232   -47.899 1.00 41.53 ? 304  ASP B O   1 
ATOM   6467 C CB  . ASP B 1 304 ? 26.273  7.633   -47.623 1.00 41.01 ? 304  ASP B CB  1 
ATOM   6468 C CG  . ASP B 1 304 ? 25.156  8.652   -47.901 1.00 41.80 ? 304  ASP B CG  1 
ATOM   6469 O OD1 . ASP B 1 304 ? 24.946  9.625   -47.128 1.00 42.34 ? 304  ASP B OD1 1 
ATOM   6470 O OD2 . ASP B 1 304 ? 24.468  8.465   -48.927 1.00 42.01 ? 304  ASP B OD2 1 
ATOM   6471 N N   . GLY B 1 305 ? 27.844  10.387  -46.203 1.00 42.02 ? 305  GLY B N   1 
ATOM   6472 C CA  . GLY B 1 305 ? 28.421  11.661  -46.577 1.00 42.14 ? 305  GLY B CA  1 
ATOM   6473 C C   . GLY B 1 305 ? 27.759  12.177  -47.831 1.00 42.82 ? 305  GLY B C   1 
ATOM   6474 O O   . GLY B 1 305 ? 28.158  13.217  -48.361 1.00 43.23 ? 305  GLY B O   1 
ATOM   6475 N N   . ASP B 1 306 ? 26.752  11.453  -48.324 1.00 43.08 ? 306  ASP B N   1 
ATOM   6476 C CA  . ASP B 1 306 ? 25.977  11.924  -49.479 1.00 43.30 ? 306  ASP B CA  1 
ATOM   6477 C C   . ASP B 1 306 ? 24.541  12.314  -49.086 1.00 43.22 ? 306  ASP B C   1 
ATOM   6478 O O   . ASP B 1 306 ? 24.277  13.497  -48.799 1.00 43.14 ? 306  ASP B O   1 
ATOM   6479 C CB  . ASP B 1 306 ? 26.015  10.905  -50.627 1.00 43.59 ? 306  ASP B CB  1 
ATOM   6480 C CG  . ASP B 1 306 ? 25.296  11.395  -51.875 1.00 44.80 ? 306  ASP B CG  1 
ATOM   6481 O OD1 . ASP B 1 306 ? 25.063  12.619  -52.004 1.00 44.58 ? 306  ASP B OD1 1 
ATOM   6482 O OD2 . ASP B 1 306 ? 24.955  10.542  -52.725 1.00 46.69 ? 306  ASP B OD2 1 
ATOM   6483 N N   . PHE B 1 307 ? 23.627  11.333  -49.076 1.00 42.97 ? 307  PHE B N   1 
ATOM   6484 C CA  . PHE B 1 307 ? 22.234  11.567  -48.700 1.00 42.58 ? 307  PHE B CA  1 
ATOM   6485 C C   . PHE B 1 307 ? 22.231  12.164  -47.304 1.00 42.37 ? 307  PHE B C   1 
ATOM   6486 O O   . PHE B 1 307 ? 21.552  13.148  -47.046 1.00 42.07 ? 307  PHE B O   1 
ATOM   6487 C CB  . PHE B 1 307 ? 21.420  10.264  -48.727 1.00 42.77 ? 307  PHE B CB  1 
ATOM   6488 C CG  . PHE B 1 307 ? 19.914  10.468  -48.585 1.00 42.47 ? 307  PHE B CG  1 
ATOM   6489 C CD1 . PHE B 1 307 ? 19.344  10.778  -47.345 1.00 41.57 ? 307  PHE B CD1 1 
ATOM   6490 C CD2 . PHE B 1 307 ? 19.073  10.330  -49.688 1.00 42.25 ? 307  PHE B CD2 1 
ATOM   6491 C CE1 . PHE B 1 307 ? 17.970  10.956  -47.204 1.00 41.17 ? 307  PHE B CE1 1 
ATOM   6492 C CE2 . PHE B 1 307 ? 17.697  10.499  -49.561 1.00 42.16 ? 307  PHE B CE2 1 
ATOM   6493 C CZ  . PHE B 1 307 ? 17.145  10.816  -48.308 1.00 42.58 ? 307  PHE B CZ  1 
ATOM   6494 N N   . LEU B 1 308 ? 23.015  11.556  -46.423 1.00 42.42 ? 308  LEU B N   1 
ATOM   6495 C CA  . LEU B 1 308 ? 23.251  12.077  -45.093 1.00 42.77 ? 308  LEU B CA  1 
ATOM   6496 C C   . LEU B 1 308 ? 24.711  12.537  -44.984 1.00 43.49 ? 308  LEU B C   1 
ATOM   6497 O O   . LEU B 1 308 ? 25.629  11.703  -44.878 1.00 43.42 ? 308  LEU B O   1 
ATOM   6498 C CB  . LEU B 1 308 ? 22.976  10.993  -44.056 1.00 42.26 ? 308  LEU B CB  1 
ATOM   6499 C CG  . LEU B 1 308 ? 21.583  10.383  -43.936 1.00 41.54 ? 308  LEU B CG  1 
ATOM   6500 C CD1 . LEU B 1 308 ? 21.679  9.105   -43.129 1.00 39.99 ? 308  LEU B CD1 1 
ATOM   6501 C CD2 . LEU B 1 308 ? 20.634  11.358  -43.292 1.00 39.85 ? 308  LEU B CD2 1 
ATOM   6502 N N   . SER B 1 309 ? 24.920  13.853  -45.003 1.00 44.04 ? 309  SER B N   1 
ATOM   6503 C CA  . SER B 1 309 ? 26.278  14.432  -44.998 1.00 44.86 ? 309  SER B CA  1 
ATOM   6504 C C   . SER B 1 309 ? 27.084  14.112  -43.737 1.00 45.18 ? 309  SER B C   1 
ATOM   6505 O O   . SER B 1 309 ? 28.309  13.986  -43.785 1.00 45.31 ? 309  SER B O   1 
ATOM   6506 C CB  . SER B 1 309 ? 26.224  15.941  -45.206 1.00 44.68 ? 309  SER B CB  1 
ATOM   6507 O OG  . SER B 1 309 ? 25.587  16.575  -44.118 1.00 45.71 ? 309  SER B OG  1 
ATOM   6508 N N   . ASP B 1 310 ? 26.380  13.960  -42.623 1.00 45.56 ? 310  ASP B N   1 
ATOM   6509 C CA  . ASP B 1 310 ? 26.978  13.602  -41.336 1.00 45.84 ? 310  ASP B CA  1 
ATOM   6510 C C   . ASP B 1 310 ? 25.998  12.644  -40.663 1.00 45.78 ? 310  ASP B C   1 
ATOM   6511 O O   . ASP B 1 310 ? 25.032  12.222  -41.287 1.00 46.00 ? 310  ASP B O   1 
ATOM   6512 C CB  . ASP B 1 310 ? 27.163  14.867  -40.485 1.00 45.69 ? 310  ASP B CB  1 
ATOM   6513 C CG  . ASP B 1 310 ? 28.477  14.884  -39.703 1.00 46.61 ? 310  ASP B CG  1 
ATOM   6514 O OD1 . ASP B 1 310 ? 29.028  13.805  -39.348 1.00 45.38 ? 310  ASP B OD1 1 
ATOM   6515 O OD2 . ASP B 1 310 ? 28.952  16.011  -39.436 1.00 47.21 ? 310  ASP B OD2 1 
ATOM   6516 N N   . THR B 1 311 ? 26.219  12.309  -39.399 1.00 46.18 ? 311  THR B N   1 
ATOM   6517 C CA  . THR B 1 311 ? 25.225  11.537  -38.646 1.00 46.40 ? 311  THR B CA  1 
ATOM   6518 C C   . THR B 1 311 ? 23.964  12.380  -38.401 1.00 46.62 ? 311  THR B C   1 
ATOM   6519 O O   . THR B 1 311 ? 24.032  13.612  -38.354 1.00 46.08 ? 311  THR B O   1 
ATOM   6520 C CB  . THR B 1 311 ? 25.766  11.079  -37.277 1.00 46.39 ? 311  THR B CB  1 
ATOM   6521 O OG1 . THR B 1 311 ? 26.045  12.230  -36.475 1.00 46.69 ? 311  THR B OG1 1 
ATOM   6522 C CG2 . THR B 1 311 ? 27.034  10.237  -37.434 1.00 46.10 ? 311  THR B CG2 1 
ATOM   6523 N N   . PRO B 1 312 ? 22.801  11.724  -38.253 1.00 46.94 ? 312  PRO B N   1 
ATOM   6524 C CA  . PRO B 1 312 ? 21.644  12.512  -37.874 1.00 47.46 ? 312  PRO B CA  1 
ATOM   6525 C C   . PRO B 1 312 ? 21.908  13.333  -36.615 1.00 47.81 ? 312  PRO B C   1 
ATOM   6526 O O   . PRO B 1 312 ? 21.462  14.477  -36.542 1.00 47.70 ? 312  PRO B O   1 
ATOM   6527 C CB  . PRO B 1 312 ? 20.564  11.456  -37.626 1.00 47.48 ? 312  PRO B CB  1 
ATOM   6528 C CG  . PRO B 1 312 ? 20.952  10.335  -38.483 1.00 47.38 ? 312  PRO B CG  1 
ATOM   6529 C CD  . PRO B 1 312 ? 22.456  10.308  -38.447 1.00 47.04 ? 312  PRO B CD  1 
ATOM   6530 N N   . GLU B 1 313 ? 22.633  12.757  -35.652 1.00 48.44 ? 313  GLU B N   1 
ATOM   6531 C CA  . GLU B 1 313 ? 22.984  13.460  -34.410 1.00 49.18 ? 313  GLU B CA  1 
ATOM   6532 C C   . GLU B 1 313 ? 23.682  14.773  -34.719 1.00 49.05 ? 313  GLU B C   1 
ATOM   6533 O O   . GLU B 1 313 ? 23.219  15.840  -34.311 1.00 49.40 ? 313  GLU B O   1 
ATOM   6534 C CB  . GLU B 1 313 ? 23.835  12.582  -33.492 1.00 49.68 ? 313  GLU B CB  1 
ATOM   6535 C CG  . GLU B 1 313 ? 23.008  11.676  -32.530 1.00 52.54 ? 313  GLU B CG  1 
ATOM   6536 C CD  . GLU B 1 313 ? 22.472  10.373  -33.175 1.00 55.13 ? 313  GLU B CD  1 
ATOM   6537 O OE1 . GLU B 1 313 ? 22.743  10.086  -34.376 1.00 56.42 ? 313  GLU B OE1 1 
ATOM   6538 O OE2 . GLU B 1 313 ? 21.772  9.627   -32.458 1.00 55.58 ? 313  GLU B OE2 1 
ATOM   6539 N N   . ALA B 1 314 ? 24.759  14.696  -35.493 1.00 49.00 ? 314  ALA B N   1 
ATOM   6540 C CA  . ALA B 1 314 ? 25.470  15.884  -35.939 1.00 49.04 ? 314  ALA B CA  1 
ATOM   6541 C C   . ALA B 1 314 ? 24.552  16.835  -36.695 1.00 49.32 ? 314  ALA B C   1 
ATOM   6542 O O   . ALA B 1 314 ? 24.613  18.051  -36.485 1.00 49.85 ? 314  ALA B O   1 
ATOM   6543 C CB  . ALA B 1 314 ? 26.669  15.509  -36.794 1.00 48.80 ? 314  ALA B CB  1 
ATOM   6544 N N   . LEU B 1 315 ? 23.690  16.284  -37.549 1.00 49.44 ? 315  LEU B N   1 
ATOM   6545 C CA  . LEU B 1 315 ? 22.845  17.104  -38.421 1.00 49.48 ? 315  LEU B CA  1 
ATOM   6546 C C   . LEU B 1 315 ? 21.715  17.837  -37.700 1.00 49.74 ? 315  LEU B C   1 
ATOM   6547 O O   . LEU B 1 315 ? 21.378  18.955  -38.072 1.00 49.78 ? 315  LEU B O   1 
ATOM   6548 C CB  . LEU B 1 315 ? 22.298  16.283  -39.588 1.00 49.41 ? 315  LEU B CB  1 
ATOM   6549 C CG  . LEU B 1 315 ? 23.288  15.851  -40.667 1.00 48.95 ? 315  LEU B CG  1 
ATOM   6550 C CD1 . LEU B 1 315 ? 22.547  15.156  -41.778 1.00 48.27 ? 315  LEU B CD1 1 
ATOM   6551 C CD2 . LEU B 1 315 ? 24.076  17.045  -41.208 1.00 49.63 ? 315  LEU B CD2 1 
ATOM   6552 N N   . ILE B 1 316 ? 21.140  17.218  -36.674 1.00 50.16 ? 316  ILE B N   1 
ATOM   6553 C CA  . ILE B 1 316 ? 20.092  17.883  -35.902 1.00 50.89 ? 316  ILE B CA  1 
ATOM   6554 C C   . ILE B 1 316 ? 20.686  18.849  -34.873 1.00 51.82 ? 316  ILE B C   1 
ATOM   6555 O O   . ILE B 1 316 ? 20.024  19.806  -34.486 1.00 52.16 ? 316  ILE B O   1 
ATOM   6556 C CB  . ILE B 1 316 ? 19.077  16.900  -35.214 1.00 50.61 ? 316  ILE B CB  1 
ATOM   6557 C CG1 . ILE B 1 316 ? 19.694  16.191  -34.010 1.00 50.74 ? 316  ILE B CG1 1 
ATOM   6558 C CG2 . ILE B 1 316 ? 18.532  15.885  -36.198 1.00 49.96 ? 316  ILE B CG2 1 
ATOM   6559 C CD1 . ILE B 1 316 ? 18.692  15.396  -33.176 1.00 51.03 ? 316  ILE B CD1 1 
ATOM   6560 N N   . ASN B 1 317 ? 21.922  18.602  -34.425 1.00 52.52 ? 317  ASN B N   1 
ATOM   6561 C CA  . ASN B 1 317 ? 22.582  19.528  -33.502 1.00 52.97 ? 317  ASN B CA  1 
ATOM   6562 C C   . ASN B 1 317 ? 22.888  20.872  -34.157 1.00 53.32 ? 317  ASN B C   1 
ATOM   6563 O O   . ASN B 1 317 ? 22.817  21.906  -33.500 1.00 53.34 ? 317  ASN B O   1 
ATOM   6564 C CB  . ASN B 1 317 ? 23.872  18.938  -32.924 1.00 53.06 ? 317  ASN B CB  1 
ATOM   6565 C CG  . ASN B 1 317 ? 23.621  17.818  -31.910 1.00 53.89 ? 317  ASN B CG  1 
ATOM   6566 O OD1 . ASN B 1 317 ? 22.513  17.648  -31.382 1.00 53.93 ? 317  ASN B OD1 1 
ATOM   6567 N ND2 . ASN B 1 317 ? 24.667  17.041  -31.638 1.00 54.51 ? 317  ASN B ND2 1 
ATOM   6568 N N   . THR B 1 318 ? 23.211  20.858  -35.450 1.00 53.52 ? 318  THR B N   1 
ATOM   6569 C CA  . THR B 1 318 ? 23.707  22.057  -36.123 1.00 53.75 ? 318  THR B CA  1 
ATOM   6570 C C   . THR B 1 318 ? 22.757  22.623  -37.161 1.00 53.86 ? 318  THR B C   1 
ATOM   6571 O O   . THR B 1 318 ? 22.952  23.753  -37.626 1.00 54.12 ? 318  THR B O   1 
ATOM   6572 C CB  . THR B 1 318 ? 25.057  21.814  -36.858 1.00 53.97 ? 318  THR B CB  1 
ATOM   6573 O OG1 . THR B 1 318 ? 24.819  21.119  -38.093 1.00 53.59 ? 318  THR B OG1 1 
ATOM   6574 C CG2 . THR B 1 318 ? 26.059  21.036  -35.978 1.00 54.80 ? 318  THR B CG2 1 
ATOM   6575 N N   . GLY B 1 319 ? 21.756  21.843  -37.555 1.00 53.53 ? 319  GLY B N   1 
ATOM   6576 C CA  . GLY B 1 319 ? 20.862  22.265  -38.625 1.00 53.44 ? 319  GLY B CA  1 
ATOM   6577 C C   . GLY B 1 319 ? 20.097  23.534  -38.297 1.00 53.32 ? 319  GLY B C   1 
ATOM   6578 O O   . GLY B 1 319 ? 19.971  23.904  -37.123 1.00 52.76 ? 319  GLY B O   1 
ATOM   6579 N N   . ASP B 1 320 ? 19.600  24.196  -39.344 1.00 53.66 ? 320  ASP B N   1 
ATOM   6580 C CA  . ASP B 1 320 ? 18.725  25.364  -39.204 1.00 54.04 ? 320  ASP B CA  1 
ATOM   6581 C C   . ASP B 1 320 ? 17.318  25.013  -39.679 1.00 54.12 ? 320  ASP B C   1 
ATOM   6582 O O   . ASP B 1 320 ? 17.080  24.806  -40.877 1.00 53.88 ? 320  ASP B O   1 
ATOM   6583 C CB  . ASP B 1 320 ? 19.271  26.578  -39.972 1.00 54.08 ? 320  ASP B CB  1 
ATOM   6584 C CG  . ASP B 1 320 ? 18.304  27.780  -39.956 1.00 54.57 ? 320  ASP B CG  1 
ATOM   6585 O OD1 . ASP B 1 320 ? 17.613  28.009  -38.934 1.00 53.14 ? 320  ASP B OD1 1 
ATOM   6586 O OD2 . ASP B 1 320 ? 18.248  28.508  -40.973 1.00 55.25 ? 320  ASP B OD2 1 
ATOM   6587 N N   . PHE B 1 321 ? 16.386  24.970  -38.729 1.00 54.20 ? 321  PHE B N   1 
ATOM   6588 C CA  . PHE B 1 321 ? 15.068  24.416  -38.987 1.00 54.35 ? 321  PHE B CA  1 
ATOM   6589 C C   . PHE B 1 321 ? 13.953  25.459  -38.961 1.00 54.88 ? 321  PHE B C   1 
ATOM   6590 O O   . PHE B 1 321 ? 12.786  25.131  -38.757 1.00 54.83 ? 321  PHE B O   1 
ATOM   6591 C CB  . PHE B 1 321 ? 14.808  23.271  -38.008 1.00 53.86 ? 321  PHE B CB  1 
ATOM   6592 C CG  . PHE B 1 321 ? 15.826  22.156  -38.096 1.00 53.33 ? 321  PHE B CG  1 
ATOM   6593 C CD1 . PHE B 1 321 ? 15.909  21.351  -39.233 1.00 51.86 ? 321  PHE B CD1 1 
ATOM   6594 C CD2 . PHE B 1 321 ? 16.697  21.906  -37.045 1.00 52.75 ? 321  PHE B CD2 1 
ATOM   6595 C CE1 . PHE B 1 321 ? 16.839  20.320  -39.314 1.00 51.83 ? 321  PHE B CE1 1 
ATOM   6596 C CE2 . PHE B 1 321 ? 17.631  20.866  -37.126 1.00 52.12 ? 321  PHE B CE2 1 
ATOM   6597 C CZ  . PHE B 1 321 ? 17.697  20.076  -38.268 1.00 51.81 ? 321  PHE B CZ  1 
ATOM   6598 N N   . GLN B 1 322 ? 14.321  26.704  -39.248 1.00 55.48 ? 322  GLN B N   1 
ATOM   6599 C CA  . GLN B 1 322 ? 13.468  27.858  -38.965 1.00 55.95 ? 322  GLN B CA  1 
ATOM   6600 C C   . GLN B 1 322 ? 12.098  27.892  -39.645 1.00 55.43 ? 322  GLN B C   1 
ATOM   6601 O O   . GLN B 1 322 ? 11.083  28.153  -38.982 1.00 55.70 ? 322  GLN B O   1 
ATOM   6602 C CB  . GLN B 1 322 ? 14.225  29.172  -39.186 1.00 56.39 ? 322  GLN B CB  1 
ATOM   6603 C CG  . GLN B 1 322 ? 15.213  29.468  -38.051 1.00 59.16 ? 322  GLN B CG  1 
ATOM   6604 C CD  . GLN B 1 322 ? 15.139  30.902  -37.542 1.00 62.63 ? 322  GLN B CD  1 
ATOM   6605 O OE1 . GLN B 1 322 ? 15.043  31.132  -36.330 1.00 63.84 ? 322  GLN B OE1 1 
ATOM   6606 N NE2 . GLN B 1 322 ? 15.179  31.873  -38.461 1.00 62.63 ? 322  GLN B NE2 1 
ATOM   6607 N N   . ASP B 1 323 ? 12.051  27.649  -40.949 1.00 54.43 ? 323  ASP B N   1 
ATOM   6608 C CA  . ASP B 1 323 ? 10.759  27.658  -41.628 1.00 53.71 ? 323  ASP B CA  1 
ATOM   6609 C C   . ASP B 1 323 ? 10.301  26.215  -41.831 1.00 52.19 ? 323  ASP B C   1 
ATOM   6610 O O   . ASP B 1 323 ? 10.204  25.722  -42.959 1.00 52.08 ? 323  ASP B O   1 
ATOM   6611 C CB  . ASP B 1 323 ? 10.788  28.497  -42.930 1.00 54.68 ? 323  ASP B CB  1 
ATOM   6612 C CG  . ASP B 1 323 ? 10.874  30.034  -42.660 1.00 57.09 ? 323  ASP B CG  1 
ATOM   6613 O OD1 . ASP B 1 323 ? 10.332  30.518  -41.627 1.00 58.05 ? 323  ASP B OD1 1 
ATOM   6614 O OD2 . ASP B 1 323 ? 11.495  30.754  -43.486 1.00 59.37 ? 323  ASP B OD2 1 
ATOM   6615 N N   . LEU B 1 324 ? 10.061  25.545  -40.701 1.00 49.89 ? 324  LEU B N   1 
ATOM   6616 C CA  . LEU B 1 324 ? 9.670   24.143  -40.669 1.00 47.37 ? 324  LEU B CA  1 
ATOM   6617 C C   . LEU B 1 324 ? 8.776   23.874  -39.474 1.00 45.28 ? 324  LEU B C   1 
ATOM   6618 O O   . LEU B 1 324 ? 9.102   24.271  -38.357 1.00 45.14 ? 324  LEU B O   1 
ATOM   6619 C CB  . LEU B 1 324 ? 10.894  23.226  -40.602 1.00 47.29 ? 324  LEU B CB  1 
ATOM   6620 C CG  . LEU B 1 324 ? 10.607  21.715  -40.487 1.00 47.22 ? 324  LEU B CG  1 
ATOM   6621 C CD1 . LEU B 1 324 ? 10.153  21.153  -41.820 1.00 47.27 ? 324  LEU B CD1 1 
ATOM   6622 C CD2 . LEU B 1 324 ? 11.827  20.946  -39.991 1.00 47.43 ? 324  LEU B CD2 1 
ATOM   6623 N N   . GLN B 1 325 ? 7.659   23.202  -39.736 1.00 42.70 ? 325  GLN B N   1 
ATOM   6624 C CA  . GLN B 1 325 ? 6.741   22.727  -38.716 1.00 41.09 ? 325  GLN B CA  1 
ATOM   6625 C C   . GLN B 1 325 ? 6.833   21.200  -38.592 1.00 39.67 ? 325  GLN B C   1 
ATOM   6626 O O   . GLN B 1 325 ? 6.827   20.482  -39.592 1.00 38.99 ? 325  GLN B O   1 
ATOM   6627 C CB  . GLN B 1 325 ? 5.302   23.116  -39.055 1.00 41.38 ? 325  GLN B CB  1 
ATOM   6628 C CG  . GLN B 1 325 ? 5.034   24.612  -39.164 1.00 42.47 ? 325  GLN B CG  1 
ATOM   6629 C CD  . GLN B 1 325 ? 5.283   25.184  -40.550 1.00 44.17 ? 325  GLN B CD  1 
ATOM   6630 O OE1 . GLN B 1 325 ? 5.926   26.221  -40.680 1.00 49.34 ? 325  GLN B OE1 1 
ATOM   6631 N NE2 . GLN B 1 325 ? 4.790   24.522  -41.581 1.00 41.90 ? 325  GLN B NE2 1 
ATOM   6632 N N   . VAL B 1 326 ? 6.908   20.710  -37.364 1.00 37.86 ? 326  VAL B N   1 
ATOM   6633 C CA  . VAL B 1 326 ? 7.030   19.295  -37.133 1.00 37.02 ? 326  VAL B CA  1 
ATOM   6634 C C   . VAL B 1 326 ? 6.092   18.884  -36.021 1.00 36.24 ? 326  VAL B C   1 
ATOM   6635 O O   . VAL B 1 326 ? 6.037   19.544  -34.986 1.00 36.42 ? 326  VAL B O   1 
ATOM   6636 C CB  . VAL B 1 326 ? 8.476   18.878  -36.747 1.00 37.16 ? 326  VAL B CB  1 
ATOM   6637 C CG1 . VAL B 1 326 ? 8.554   17.398  -36.559 1.00 37.68 ? 326  VAL B CG1 1 
ATOM   6638 C CG2 . VAL B 1 326 ? 9.468   19.252  -37.819 1.00 37.39 ? 326  VAL B CG2 1 
ATOM   6639 N N   . LEU B 1 327 ? 5.356   17.799  -36.257 1.00 34.88 ? 327  LEU B N   1 
ATOM   6640 C CA  . LEU B 1 327 ? 4.573   17.114  -35.241 1.00 33.92 ? 327  LEU B CA  1 
ATOM   6641 C C   . LEU B 1 327 ? 5.275   15.781  -34.904 1.00 33.79 ? 327  LEU B C   1 
ATOM   6642 O O   . LEU B 1 327 ? 5.576   15.004  -35.804 1.00 33.86 ? 327  LEU B O   1 
ATOM   6643 C CB  . LEU B 1 327 ? 3.160   16.856  -35.775 1.00 33.83 ? 327  LEU B CB  1 
ATOM   6644 C CG  . LEU B 1 327 ? 2.194   15.979  -34.965 1.00 33.27 ? 327  LEU B CG  1 
ATOM   6645 C CD1 . LEU B 1 327 ? 1.875   16.608  -33.621 1.00 30.88 ? 327  LEU B CD1 1 
ATOM   6646 C CD2 . LEU B 1 327 ? 0.913   15.734  -35.737 1.00 33.49 ? 327  LEU B CD2 1 
ATOM   6647 N N   . VAL B 1 328 ? 5.566   15.533  -33.631 1.00 32.98 ? 328  VAL B N   1 
ATOM   6648 C CA  . VAL B 1 328 ? 6.261   14.315  -33.233 1.00 33.18 ? 328  VAL B CA  1 
ATOM   6649 C C   . VAL B 1 328 ? 5.578   13.727  -32.032 1.00 33.40 ? 328  VAL B C   1 
ATOM   6650 O O   . VAL B 1 328 ? 4.984   14.454  -31.222 1.00 33.94 ? 328  VAL B O   1 
ATOM   6651 C CB  . VAL B 1 328 ? 7.745   14.547  -32.841 1.00 33.17 ? 328  VAL B CB  1 
ATOM   6652 C CG1 . VAL B 1 328 ? 8.578   14.820  -34.043 1.00 34.04 ? 328  VAL B CG1 1 
ATOM   6653 C CG2 . VAL B 1 328 ? 7.872   15.691  -31.871 1.00 33.89 ? 328  VAL B CG2 1 
ATOM   6654 N N   . GLY B 1 329 ? 5.654   12.411  -31.899 1.00 33.07 ? 329  GLY B N   1 
ATOM   6655 C CA  . GLY B 1 329 ? 5.128   11.793  -30.715 1.00 32.92 ? 329  GLY B CA  1 
ATOM   6656 C C   . GLY B 1 329 ? 5.467   10.339  -30.605 1.00 33.47 ? 329  GLY B C   1 
ATOM   6657 O O   . GLY B 1 329 ? 6.181   9.792   -31.449 1.00 33.69 ? 329  GLY B O   1 
ATOM   6658 N N   . VAL B 1 330 ? 4.936   9.727   -29.550 1.00 33.40 ? 330  VAL B N   1 
ATOM   6659 C CA  . VAL B 1 330 ? 5.223   8.359   -29.185 1.00 33.62 ? 330  VAL B CA  1 
ATOM   6660 C C   . VAL B 1 330 ? 3.910   7.763   -28.683 1.00 34.28 ? 330  VAL B C   1 
ATOM   6661 O O   . VAL B 1 330 ? 2.915   8.484   -28.536 1.00 34.87 ? 330  VAL B O   1 
ATOM   6662 C CB  . VAL B 1 330 ? 6.282   8.279   -28.040 1.00 33.47 ? 330  VAL B CB  1 
ATOM   6663 C CG1 . VAL B 1 330 ? 7.591   8.897   -28.470 1.00 34.36 ? 330  VAL B CG1 1 
ATOM   6664 C CG2 . VAL B 1 330 ? 5.772   8.969   -26.774 1.00 32.20 ? 330  VAL B CG2 1 
ATOM   6665 N N   . VAL B 1 331 ? 3.909   6.457   -28.432 1.00 34.04 ? 331  VAL B N   1 
ATOM   6666 C CA  . VAL B 1 331 ? 2.770   5.786   -27.849 1.00 33.87 ? 331  VAL B CA  1 
ATOM   6667 C C   . VAL B 1 331 ? 3.160   5.414   -26.432 1.00 35.07 ? 331  VAL B C   1 
ATOM   6668 O O   . VAL B 1 331 ? 4.350   5.440   -26.083 1.00 35.11 ? 331  VAL B O   1 
ATOM   6669 C CB  . VAL B 1 331 ? 2.306   4.543   -28.686 1.00 34.05 ? 331  VAL B CB  1 
ATOM   6670 C CG1 . VAL B 1 331 ? 1.801   4.982   -30.049 1.00 33.24 ? 331  VAL B CG1 1 
ATOM   6671 C CG2 . VAL B 1 331 ? 3.410   3.466   -28.828 1.00 31.02 ? 331  VAL B CG2 1 
ATOM   6672 N N   . LYS B 1 332 ? 2.168   5.075   -25.610 1.00 36.05 ? 332  LYS B N   1 
ATOM   6673 C CA  . LYS B 1 332 ? 2.405   4.864   -24.192 1.00 37.41 ? 332  LYS B CA  1 
ATOM   6674 C C   . LYS B 1 332 ? 3.387   3.732   -23.943 1.00 37.36 ? 332  LYS B C   1 
ATOM   6675 O O   . LYS B 1 332 ? 4.144   3.768   -22.982 1.00 37.44 ? 332  LYS B O   1 
ATOM   6676 C CB  . LYS B 1 332 ? 1.091   4.656   -23.430 1.00 37.69 ? 332  LYS B CB  1 
ATOM   6677 C CG  . LYS B 1 332 ? 1.207   4.615   -21.898 1.00 38.04 ? 332  LYS B CG  1 
ATOM   6678 C CD  . LYS B 1 332 ? -0.160  4.325   -21.255 1.00 39.68 ? 332  LYS B CD  1 
ATOM   6679 C CE  . LYS B 1 332 ? -0.092  3.162   -20.219 1.00 45.45 ? 332  LYS B CE  1 
ATOM   6680 N NZ  . LYS B 1 332 ? -0.059  1.761   -20.831 1.00 45.86 ? 332  LYS B NZ  1 
ATOM   6681 N N   . ASP B 1 333 ? 3.416   2.743   -24.827 1.00 38.01 ? 333  ASP B N   1 
ATOM   6682 C CA  . ASP B 1 333 ? 4.269   1.592   -24.588 1.00 38.20 ? 333  ASP B CA  1 
ATOM   6683 C C   . ASP B 1 333 ? 5.109   1.232   -25.798 1.00 38.36 ? 333  ASP B C   1 
ATOM   6684 O O   . ASP B 1 333 ? 4.936   0.181   -26.397 1.00 38.98 ? 333  ASP B O   1 
ATOM   6685 C CB  . ASP B 1 333 ? 3.416   0.419   -24.137 1.00 38.21 ? 333  ASP B CB  1 
ATOM   6686 C CG  . ASP B 1 333 ? 2.688   0.693   -22.838 1.00 38.62 ? 333  ASP B CG  1 
ATOM   6687 O OD1 . ASP B 1 333 ? 1.480   1.001   -22.889 1.00 38.75 ? 333  ASP B OD1 1 
ATOM   6688 O OD2 . ASP B 1 333 ? 3.327   0.597   -21.769 1.00 39.44 ? 333  ASP B OD2 1 
ATOM   6689 N N   . GLU B 1 334 ? 6.042   2.106   -26.145 1.00 38.47 ? 334  GLU B N   1 
ATOM   6690 C CA  . GLU B 1 334 ? 6.878   1.905   -27.326 1.00 38.29 ? 334  GLU B CA  1 
ATOM   6691 C C   . GLU B 1 334 ? 7.623   0.564   -27.375 1.00 38.34 ? 334  GLU B C   1 
ATOM   6692 O O   . GLU B 1 334 ? 7.825   0.005   -28.449 1.00 38.23 ? 334  GLU B O   1 
ATOM   6693 C CB  . GLU B 1 334 ? 7.867   3.058   -27.468 1.00 38.07 ? 334  GLU B CB  1 
ATOM   6694 C CG  . GLU B 1 334 ? 7.210   4.375   -27.831 1.00 38.30 ? 334  GLU B CG  1 
ATOM   6695 C CD  . GLU B 1 334 ? 6.725   4.419   -29.276 1.00 38.19 ? 334  GLU B CD  1 
ATOM   6696 O OE1 . GLU B 1 334 ? 7.102   3.527   -30.066 1.00 37.46 ? 334  GLU B OE1 1 
ATOM   6697 O OE2 . GLU B 1 334 ? 5.972   5.354   -29.619 1.00 35.97 ? 334  GLU B OE2 1 
ATOM   6698 N N   . GLY B 1 335 ? 8.015   0.039   -26.224 1.00 38.71 ? 335  GLY B N   1 
ATOM   6699 C CA  . GLY B 1 335 ? 8.921   -1.107  -26.207 1.00 39.75 ? 335  GLY B CA  1 
ATOM   6700 C C   . GLY B 1 335 ? 8.320   -2.492  -26.026 1.00 40.65 ? 335  GLY B C   1 
ATOM   6701 O O   . GLY B 1 335 ? 9.024   -3.485  -26.153 1.00 40.59 ? 335  GLY B O   1 
ATOM   6702 N N   . SER B 1 336 ? 7.029   -2.572  -25.728 1.00 41.57 ? 336  SER B N   1 
ATOM   6703 C CA  . SER B 1 336 ? 6.445   -3.837  -25.326 1.00 42.80 ? 336  SER B CA  1 
ATOM   6704 C C   . SER B 1 336 ? 6.534   -4.841  -26.478 1.00 43.88 ? 336  SER B C   1 
ATOM   6705 O O   . SER B 1 336 ? 7.120   -5.919  -26.335 1.00 44.42 ? 336  SER B O   1 
ATOM   6706 C CB  . SER B 1 336 ? 5.011   -3.629  -24.853 1.00 42.41 ? 336  SER B CB  1 
ATOM   6707 O OG  . SER B 1 336 ? 4.194   -3.197  -25.919 1.00 42.81 ? 336  SER B OG  1 
ATOM   6708 N N   . TYR B 1 337 ? 5.996   -4.441  -27.627 1.00 44.88 ? 337  TYR B N   1 
ATOM   6709 C CA  . TYR B 1 337 ? 6.043   -5.200  -28.874 1.00 45.58 ? 337  TYR B CA  1 
ATOM   6710 C C   . TYR B 1 337 ? 7.342   -5.957  -29.112 1.00 45.69 ? 337  TYR B C   1 
ATOM   6711 O O   . TYR B 1 337 ? 7.322   -7.125  -29.469 1.00 45.79 ? 337  TYR B O   1 
ATOM   6712 C CB  . TYR B 1 337 ? 5.826   -4.238  -30.039 1.00 46.30 ? 337  TYR B CB  1 
ATOM   6713 C CG  . TYR B 1 337 ? 5.362   -4.875  -31.319 1.00 46.95 ? 337  TYR B CG  1 
ATOM   6714 C CD1 . TYR B 1 337 ? 4.024   -4.776  -31.714 1.00 48.75 ? 337  TYR B CD1 1 
ATOM   6715 C CD2 . TYR B 1 337 ? 6.254   -5.550  -32.152 1.00 46.74 ? 337  TYR B CD2 1 
ATOM   6716 C CE1 . TYR B 1 337 ? 3.575   -5.346  -32.909 1.00 48.93 ? 337  TYR B CE1 1 
ATOM   6717 C CE2 . TYR B 1 337 ? 5.824   -6.129  -33.343 1.00 48.15 ? 337  TYR B CE2 1 
ATOM   6718 C CZ  . TYR B 1 337 ? 4.478   -6.031  -33.716 1.00 48.61 ? 337  TYR B CZ  1 
ATOM   6719 O OH  . TYR B 1 337 ? 4.042   -6.594  -34.902 1.00 48.74 ? 337  TYR B OH  1 
ATOM   6720 N N   . PHE B 1 338 ? 8.460   -5.277  -28.920 1.00 46.07 ? 338  PHE B N   1 
ATOM   6721 C CA  . PHE B 1 338 ? 9.762   -5.777  -29.334 1.00 46.67 ? 338  PHE B CA  1 
ATOM   6722 C C   . PHE B 1 338 ? 10.294  -6.871  -28.441 1.00 47.43 ? 338  PHE B C   1 
ATOM   6723 O O   . PHE B 1 338 ? 11.008  -7.758  -28.897 1.00 47.74 ? 338  PHE B O   1 
ATOM   6724 C CB  . PHE B 1 338 ? 10.755  -4.617  -29.422 1.00 46.55 ? 338  PHE B CB  1 
ATOM   6725 C CG  . PHE B 1 338 ? 10.414  -3.637  -30.502 1.00 46.85 ? 338  PHE B CG  1 
ATOM   6726 C CD1 . PHE B 1 338 ? 9.534   -2.584  -30.249 1.00 46.29 ? 338  PHE B CD1 1 
ATOM   6727 C CD2 . PHE B 1 338 ? 10.917  -3.805  -31.789 1.00 45.31 ? 338  PHE B CD2 1 
ATOM   6728 C CE1 . PHE B 1 338 ? 9.179   -1.699  -31.258 1.00 45.48 ? 338  PHE B CE1 1 
ATOM   6729 C CE2 . PHE B 1 338 ? 10.577  -2.931  -32.795 1.00 45.55 ? 338  PHE B CE2 1 
ATOM   6730 C CZ  . PHE B 1 338 ? 9.695   -1.871  -32.531 1.00 45.79 ? 338  PHE B CZ  1 
ATOM   6731 N N   . LEU B 1 339 ? 9.932   -6.811  -27.170 1.00 48.48 ? 339  LEU B N   1 
ATOM   6732 C CA  . LEU B 1 339 ? 10.402  -7.784  -26.198 1.00 49.47 ? 339  LEU B CA  1 
ATOM   6733 C C   . LEU B 1 339 ? 10.095  -9.234  -26.603 1.00 50.36 ? 339  LEU B C   1 
ATOM   6734 O O   . LEU B 1 339 ? 10.933  -10.114 -26.422 1.00 50.93 ? 339  LEU B O   1 
ATOM   6735 C CB  . LEU B 1 339 ? 9.808   -7.474  -24.821 1.00 49.26 ? 339  LEU B CB  1 
ATOM   6736 C CG  . LEU B 1 339 ? 10.026  -6.075  -24.253 1.00 48.31 ? 339  LEU B CG  1 
ATOM   6737 C CD1 . LEU B 1 339 ? 9.214   -5.894  -22.997 1.00 46.97 ? 339  LEU B CD1 1 
ATOM   6738 C CD2 . LEU B 1 339 ? 11.497  -5.830  -23.968 1.00 48.66 ? 339  LEU B CD2 1 
ATOM   6739 N N   . VAL B 1 340 ? 8.908   -9.482  -27.155 1.00 51.40 ? 340  VAL B N   1 
ATOM   6740 C CA  . VAL B 1 340 ? 8.510   -10.849 -27.532 1.00 52.56 ? 340  VAL B CA  1 
ATOM   6741 C C   . VAL B 1 340 ? 9.293   -11.379 -28.731 1.00 53.42 ? 340  VAL B C   1 
ATOM   6742 O O   . VAL B 1 340 ? 9.152   -12.545 -29.106 1.00 53.72 ? 340  VAL B O   1 
ATOM   6743 C CB  . VAL B 1 340 ? 6.982   -11.000 -27.821 1.00 52.29 ? 340  VAL B CB  1 
ATOM   6744 C CG1 . VAL B 1 340 ? 6.149   -10.436 -26.684 1.00 52.26 ? 340  VAL B CG1 1 
ATOM   6745 C CG2 . VAL B 1 340 ? 6.608   -10.356 -29.130 1.00 52.34 ? 340  VAL B CG2 1 
ATOM   6746 N N   . TYR B 1 341 ? 10.113  -10.524 -29.331 1.00 54.50 ? 341  TYR B N   1 
ATOM   6747 C CA  . TYR B 1 341 ? 10.953  -10.945 -30.449 1.00 55.47 ? 341  TYR B CA  1 
ATOM   6748 C C   . TYR B 1 341 ? 12.390  -11.286 -30.036 1.00 56.10 ? 341  TYR B C   1 
ATOM   6749 O O   . TYR B 1 341 ? 13.354  -10.928 -30.730 1.00 56.57 ? 341  TYR B O   1 
ATOM   6750 C CB  . TYR B 1 341 ? 10.932  -9.907  -31.570 1.00 55.19 ? 341  TYR B CB  1 
ATOM   6751 C CG  . TYR B 1 341 ? 9.697   -9.978  -32.432 1.00 55.37 ? 341  TYR B CG  1 
ATOM   6752 C CD1 . TYR B 1 341 ? 8.485   -9.403  -32.010 1.00 55.27 ? 341  TYR B CD1 1 
ATOM   6753 C CD2 . TYR B 1 341 ? 9.733   -10.604 -33.677 1.00 54.36 ? 341  TYR B CD2 1 
ATOM   6754 C CE1 . TYR B 1 341 ? 7.346   -9.459  -32.803 1.00 53.88 ? 341  TYR B CE1 1 
ATOM   6755 C CE2 . TYR B 1 341 ? 8.602   -10.662 -34.475 1.00 54.36 ? 341  TYR B CE2 1 
ATOM   6756 C CZ  . TYR B 1 341 ? 7.414   -10.092 -34.036 1.00 54.72 ? 341  TYR B CZ  1 
ATOM   6757 O OH  . TYR B 1 341 ? 6.298   -10.157 -34.841 1.00 55.19 ? 341  TYR B OH  1 
ATOM   6758 N N   . GLY B 1 342 ? 12.529  -11.989 -28.912 1.00 56.74 ? 342  GLY B N   1 
ATOM   6759 C CA  . GLY B 1 342 ? 13.843  -12.499 -28.492 1.00 56.88 ? 342  GLY B CA  1 
ATOM   6760 C C   . GLY B 1 342 ? 14.339  -12.090 -27.115 1.00 56.80 ? 342  GLY B C   1 
ATOM   6761 O O   . GLY B 1 342 ? 15.529  -12.213 -26.832 1.00 56.67 ? 342  GLY B O   1 
ATOM   6762 N N   . VAL B 1 343 ? 13.450  -11.588 -26.262 1.00 56.72 ? 343  VAL B N   1 
ATOM   6763 C CA  . VAL B 1 343 ? 13.822  -11.395 -24.874 1.00 56.93 ? 343  VAL B CA  1 
ATOM   6764 C C   . VAL B 1 343 ? 13.224  -12.528 -24.060 1.00 56.93 ? 343  VAL B C   1 
ATOM   6765 O O   . VAL B 1 343 ? 12.003  -12.593 -23.899 1.00 57.30 ? 343  VAL B O   1 
ATOM   6766 C CB  . VAL B 1 343 ? 13.394  -10.027 -24.293 1.00 57.26 ? 343  VAL B CB  1 
ATOM   6767 C CG1 . VAL B 1 343 ? 13.980  -9.849  -22.879 1.00 57.57 ? 343  VAL B CG1 1 
ATOM   6768 C CG2 . VAL B 1 343 ? 13.865  -8.887  -25.181 1.00 57.05 ? 343  VAL B CG2 1 
ATOM   6769 N N   . PRO B 1 344 ? 14.079  -13.436 -23.553 1.00 56.78 ? 344  PRO B N   1 
ATOM   6770 C CA  . PRO B 1 344 ? 13.566  -14.565 -22.787 1.00 56.86 ? 344  PRO B CA  1 
ATOM   6771 C C   . PRO B 1 344 ? 12.631  -14.102 -21.676 1.00 56.91 ? 344  PRO B C   1 
ATOM   6772 O O   . PRO B 1 344 ? 12.957  -13.166 -20.947 1.00 57.27 ? 344  PRO B O   1 
ATOM   6773 C CB  . PRO B 1 344 ? 14.834  -15.200 -22.202 1.00 56.89 ? 344  PRO B CB  1 
ATOM   6774 C CG  . PRO B 1 344 ? 15.900  -14.855 -23.178 1.00 56.91 ? 344  PRO B CG  1 
ATOM   6775 C CD  . PRO B 1 344 ? 15.550  -13.471 -23.663 1.00 56.73 ? 344  PRO B CD  1 
ATOM   6776 N N   . GLY B 1 345 ? 11.470  -14.743 -21.579 1.00 56.84 ? 345  GLY B N   1 
ATOM   6777 C CA  . GLY B 1 345 ? 10.499  -14.450 -20.537 1.00 56.58 ? 345  GLY B CA  1 
ATOM   6778 C C   . GLY B 1 345 ? 9.311   -13.692 -21.083 1.00 56.54 ? 345  GLY B C   1 
ATOM   6779 O O   . GLY B 1 345 ? 8.291   -13.540 -20.404 1.00 56.48 ? 345  GLY B O   1 
ATOM   6780 N N   . PHE B 1 346 ? 9.439   -13.220 -22.317 1.00 56.51 ? 346  PHE B N   1 
ATOM   6781 C CA  . PHE B 1 346 ? 8.391   -12.414 -22.921 1.00 56.46 ? 346  PHE B CA  1 
ATOM   6782 C C   . PHE B 1 346 ? 7.665   -13.146 -24.034 1.00 57.01 ? 346  PHE B C   1 
ATOM   6783 O O   . PHE B 1 346 ? 8.279   -13.737 -24.931 1.00 56.96 ? 346  PHE B O   1 
ATOM   6784 C CB  . PHE B 1 346 ? 8.951   -11.069 -23.384 1.00 55.93 ? 346  PHE B CB  1 
ATOM   6785 C CG  . PHE B 1 346 ? 9.384   -10.183 -22.247 1.00 54.98 ? 346  PHE B CG  1 
ATOM   6786 C CD1 . PHE B 1 346 ? 10.652  -10.311 -21.693 1.00 53.16 ? 346  PHE B CD1 1 
ATOM   6787 C CD2 . PHE B 1 346 ? 8.508   -9.243  -21.707 1.00 53.61 ? 346  PHE B CD2 1 
ATOM   6788 C CE1 . PHE B 1 346 ? 11.042  -9.504  -20.639 1.00 53.25 ? 346  PHE B CE1 1 
ATOM   6789 C CE2 . PHE B 1 346 ? 8.893   -8.438  -20.650 1.00 52.76 ? 346  PHE B CE2 1 
ATOM   6790 C CZ  . PHE B 1 346 ? 10.161  -8.566  -20.116 1.00 53.36 ? 346  PHE B CZ  1 
ATOM   6791 N N   . SER B 1 347 ? 6.342   -13.111 -23.944 1.00 57.64 ? 347  SER B N   1 
ATOM   6792 C CA  . SER B 1 347 ? 5.475   -13.793 -24.885 1.00 58.21 ? 347  SER B CA  1 
ATOM   6793 C C   . SER B 1 347 ? 4.129   -13.112 -24.860 1.00 58.41 ? 347  SER B C   1 
ATOM   6794 O O   . SER B 1 347 ? 3.706   -12.607 -23.822 1.00 58.07 ? 347  SER B O   1 
ATOM   6795 C CB  . SER B 1 347 ? 5.317   -15.268 -24.496 1.00 58.34 ? 347  SER B CB  1 
ATOM   6796 O OG  . SER B 1 347 ? 4.230   -15.865 -25.183 1.00 58.88 ? 347  SER B OG  1 
ATOM   6797 N N   . LYS B 1 348 ? 3.456   -13.116 -26.006 1.00 59.15 ? 348  LYS B N   1 
ATOM   6798 C CA  . LYS B 1 348 ? 2.106   -12.576 -26.117 1.00 60.15 ? 348  LYS B CA  1 
ATOM   6799 C C   . LYS B 1 348 ? 1.086   -13.448 -25.388 1.00 60.88 ? 348  LYS B C   1 
ATOM   6800 O O   . LYS B 1 348 ? -0.001  -12.990 -25.028 1.00 60.88 ? 348  LYS B O   1 
ATOM   6801 C CB  . LYS B 1 348 ? 1.710   -12.447 -27.589 1.00 59.99 ? 348  LYS B CB  1 
ATOM   6802 C CG  . LYS B 1 348 ? 1.543   -13.776 -28.317 1.00 60.55 ? 348  LYS B CG  1 
ATOM   6803 C CD  . LYS B 1 348 ? 0.907   -13.584 -29.687 1.00 61.32 ? 348  LYS B CD  1 
ATOM   6804 C CE  . LYS B 1 348 ? -0.068  -14.699 -30.004 1.00 61.00 ? 348  LYS B CE  1 
ATOM   6805 N NZ  . LYS B 1 348 ? -1.282  -14.568 -29.149 1.00 60.73 ? 348  LYS B NZ  1 
ATOM   6806 N N   . ASP B 1 349 ? 1.453   -14.708 -25.171 1.00 61.81 ? 349  ASP B N   1 
ATOM   6807 C CA  . ASP B 1 349 ? 0.492   -15.726 -24.769 1.00 62.80 ? 349  ASP B CA  1 
ATOM   6808 C C   . ASP B 1 349 ? 0.242   -15.782 -23.254 1.00 63.23 ? 349  ASP B C   1 
ATOM   6809 O O   . ASP B 1 349 ? -0.868  -16.108 -22.827 1.00 63.71 ? 349  ASP B O   1 
ATOM   6810 C CB  . ASP B 1 349 ? 0.875   -17.095 -25.368 1.00 62.92 ? 349  ASP B CB  1 
ATOM   6811 C CG  . ASP B 1 349 ? 0.732   -17.130 -26.906 1.00 63.44 ? 349  ASP B CG  1 
ATOM   6812 O OD1 . ASP B 1 349 ? -0.282  -16.617 -27.428 1.00 63.09 ? 349  ASP B OD1 1 
ATOM   6813 O OD2 . ASP B 1 349 ? 1.636   -17.665 -27.593 1.00 63.78 ? 349  ASP B OD2 1 
ATOM   6814 N N   . ASN B 1 350 ? 1.253   -15.449 -22.451 1.00 63.35 ? 350  ASN B N   1 
ATOM   6815 C CA  . ASN B 1 350 ? 1.059   -15.270 -21.004 1.00 63.41 ? 350  ASN B CA  1 
ATOM   6816 C C   . ASN B 1 350 ? 1.216   -13.793 -20.566 1.00 63.26 ? 350  ASN B C   1 
ATOM   6817 O O   . ASN B 1 350 ? 1.222   -12.892 -21.407 1.00 63.34 ? 350  ASN B O   1 
ATOM   6818 C CB  . ASN B 1 350 ? 1.978   -16.220 -20.208 1.00 63.54 ? 350  ASN B CB  1 
ATOM   6819 C CG  . ASN B 1 350 ? 3.463   -15.991 -20.490 1.00 63.94 ? 350  ASN B CG  1 
ATOM   6820 O OD1 . ASN B 1 350 ? 3.944   -14.859 -20.473 1.00 63.78 ? 350  ASN B OD1 1 
ATOM   6821 N ND2 . ASN B 1 350 ? 4.194   -17.073 -20.734 1.00 64.07 ? 350  ASN B ND2 1 
ATOM   6822 N N   . GLU B 1 351 ? 1.346   -13.552 -19.259 1.00 62.87 ? 351  GLU B N   1 
ATOM   6823 C CA  . GLU B 1 351 ? 1.499   -12.194 -18.714 1.00 62.34 ? 351  GLU B CA  1 
ATOM   6824 C C   . GLU B 1 351 ? 2.954   -11.688 -18.684 1.00 61.51 ? 351  GLU B C   1 
ATOM   6825 O O   . GLU B 1 351 ? 3.201   -10.526 -18.365 1.00 61.10 ? 351  GLU B O   1 
ATOM   6826 C CB  . GLU B 1 351 ? 0.884   -12.110 -17.320 1.00 61.96 ? 351  GLU B CB  1 
ATOM   6827 C CG  . GLU B 1 351 ? -0.564  -11.672 -17.300 1.00 62.96 ? 351  GLU B CG  1 
ATOM   6828 C CD  . GLU B 1 351 ? -1.199  -11.768 -15.903 1.00 64.01 ? 351  GLU B CD  1 
ATOM   6829 O OE1 . GLU B 1 351 ? -0.675  -12.513 -15.037 1.00 65.75 ? 351  GLU B OE1 1 
ATOM   6830 O OE2 . GLU B 1 351 ? -2.239  -11.106 -15.671 1.00 66.00 ? 351  GLU B OE2 1 
ATOM   6831 N N   . SER B 1 352 ? 3.898   -12.570 -19.015 1.00 60.84 ? 352  SER B N   1 
ATOM   6832 C CA  . SER B 1 352 ? 5.330   -12.245 -19.097 1.00 60.34 ? 352  SER B CA  1 
ATOM   6833 C C   . SER B 1 352 ? 5.905   -11.575 -17.845 1.00 60.16 ? 352  SER B C   1 
ATOM   6834 O O   . SER B 1 352 ? 6.699   -10.638 -17.941 1.00 60.15 ? 352  SER B O   1 
ATOM   6835 C CB  . SER B 1 352 ? 5.637   -11.402 -20.340 1.00 60.33 ? 352  SER B CB  1 
ATOM   6836 O OG  . SER B 1 352 ? 4.981   -11.914 -21.482 1.00 60.69 ? 352  SER B OG  1 
ATOM   6837 N N   . LEU B 1 353 ? 5.509   -12.065 -16.674 1.00 59.76 ? 353  LEU B N   1 
ATOM   6838 C CA  . LEU B 1 353 ? 6.085   -11.606 -15.419 1.00 59.25 ? 353  LEU B CA  1 
ATOM   6839 C C   . LEU B 1 353 ? 7.491   -12.181 -15.317 1.00 59.05 ? 353  LEU B C   1 
ATOM   6840 O O   . LEU B 1 353 ? 7.650   -13.387 -15.167 1.00 59.17 ? 353  LEU B O   1 
ATOM   6841 C CB  . LEU B 1 353 ? 5.221   -12.051 -14.233 1.00 59.05 ? 353  LEU B CB  1 
ATOM   6842 C CG  . LEU B 1 353 ? 3.754   -11.581 -14.184 1.00 59.34 ? 353  LEU B CG  1 
ATOM   6843 C CD1 . LEU B 1 353 ? 2.993   -12.319 -13.098 1.00 59.93 ? 353  LEU B CD1 1 
ATOM   6844 C CD2 . LEU B 1 353 ? 3.597   -10.075 -13.996 1.00 58.44 ? 353  LEU B CD2 1 
ATOM   6845 N N   . ILE B 1 354 ? 8.505   -11.325 -15.432 1.00 58.62 ? 354  ILE B N   1 
ATOM   6846 C CA  . ILE B 1 354 ? 9.905   -11.768 -15.384 1.00 58.31 ? 354  ILE B CA  1 
ATOM   6847 C C   . ILE B 1 354 ? 10.532  -11.698 -13.993 1.00 58.39 ? 354  ILE B C   1 
ATOM   6848 O O   . ILE B 1 354 ? 9.971   -11.118 -13.067 1.00 58.59 ? 354  ILE B O   1 
ATOM   6849 C CB  . ILE B 1 354 ? 10.821  -10.980 -16.354 1.00 58.20 ? 354  ILE B CB  1 
ATOM   6850 C CG1 . ILE B 1 354 ? 10.530  -9.473  -16.289 1.00 58.00 ? 354  ILE B CG1 1 
ATOM   6851 C CG2 . ILE B 1 354 ? 10.696  -11.518 -17.766 1.00 57.83 ? 354  ILE B CG2 1 
ATOM   6852 C CD1 . ILE B 1 354 ? 11.690  -8.609  -16.728 1.00 57.30 ? 354  ILE B CD1 1 
ATOM   6853 N N   . SER B 1 355 ? 11.706  -12.304 -13.876 1.00 58.29 ? 355  SER B N   1 
ATOM   6854 C CA  . SER B 1 355 ? 12.498  -12.297 -12.667 1.00 58.30 ? 355  SER B CA  1 
ATOM   6855 C C   . SER B 1 355 ? 13.543  -11.192 -12.794 1.00 58.55 ? 355  SER B C   1 
ATOM   6856 O O   . SER B 1 355 ? 13.684  -10.585 -13.864 1.00 58.65 ? 355  SER B O   1 
ATOM   6857 C CB  . SER B 1 355 ? 13.201  -13.649 -12.513 1.00 58.41 ? 355  SER B CB  1 
ATOM   6858 O OG  . SER B 1 355 ? 14.312  -13.751 -13.397 1.00 58.28 ? 355  SER B OG  1 
ATOM   6859 N N   . ARG B 1 356 ? 14.296  -10.952 -11.723 1.00 58.55 ? 356  ARG B N   1 
ATOM   6860 C CA  . ARG B 1 356 ? 15.393  -9.997  -11.787 1.00 58.59 ? 356  ARG B CA  1 
ATOM   6861 C C   . ARG B 1 356 ? 16.450  -10.433 -12.800 1.00 58.65 ? 356  ARG B C   1 
ATOM   6862 O O   . ARG B 1 356 ? 16.917  -9.623  -13.604 1.00 58.74 ? 356  ARG B O   1 
ATOM   6863 C CB  . ARG B 1 356 ? 16.015  -9.761  -10.407 1.00 58.56 ? 356  ARG B CB  1 
ATOM   6864 C CG  . ARG B 1 356 ? 17.183  -8.782  -10.436 1.00 58.26 ? 356  ARG B CG  1 
ATOM   6865 C CD  . ARG B 1 356 ? 17.118  -7.755  -9.313  1.00 58.02 ? 356  ARG B CD  1 
ATOM   6866 N NE  . ARG B 1 356 ? 17.992  -6.614  -9.602  1.00 58.15 ? 356  ARG B NE  1 
ATOM   6867 C CZ  . ARG B 1 356 ? 17.568  -5.426  -10.041 1.00 57.03 ? 356  ARG B CZ  1 
ATOM   6868 N NH1 . ARG B 1 356 ? 16.275  -5.198  -10.228 1.00 56.12 ? 356  ARG B NH1 1 
ATOM   6869 N NH2 . ARG B 1 356 ? 18.439  -4.457  -10.281 1.00 55.53 ? 356  ARG B NH2 1 
ATOM   6870 N N   . ALA B 1 357 ? 16.812  -11.713 -12.772 1.00 58.83 ? 357  ALA B N   1 
ATOM   6871 C CA  . ALA B 1 357 ? 17.884  -12.228 -13.636 1.00 58.46 ? 357  ALA B CA  1 
ATOM   6872 C C   . ALA B 1 357 ? 17.518  -12.080 -15.111 1.00 58.00 ? 357  ALA B C   1 
ATOM   6873 O O   . ALA B 1 357 ? 18.334  -11.644 -15.927 1.00 57.52 ? 357  ALA B O   1 
ATOM   6874 C CB  . ALA B 1 357 ? 18.221  -13.691 -13.282 1.00 58.75 ? 357  ALA B CB  1 
ATOM   6875 N N   . GLN B 1 358 ? 16.272  -12.420 -15.428 1.00 57.73 ? 358  GLN B N   1 
ATOM   6876 C CA  . GLN B 1 358 ? 15.733  -12.274 -16.780 1.00 57.77 ? 358  GLN B CA  1 
ATOM   6877 C C   . GLN B 1 358 ? 15.828  -10.817 -17.247 1.00 57.25 ? 358  GLN B C   1 
ATOM   6878 O O   . GLN B 1 358 ? 16.032  -10.542 -18.436 1.00 56.78 ? 358  GLN B O   1 
ATOM   6879 C CB  . GLN B 1 358 ? 14.280  -12.760 -16.825 1.00 57.50 ? 358  GLN B CB  1 
ATOM   6880 C CG  . GLN B 1 358 ? 14.128  -14.273 -16.747 1.00 58.05 ? 358  GLN B CG  1 
ATOM   6881 C CD  . GLN B 1 358 ? 12.673  -14.718 -16.680 1.00 58.80 ? 358  GLN B CD  1 
ATOM   6882 O OE1 . GLN B 1 358 ? 11.938  -14.354 -15.753 1.00 60.57 ? 358  GLN B OE1 1 
ATOM   6883 N NE2 . GLN B 1 358 ? 12.250  -15.522 -17.658 1.00 59.72 ? 358  GLN B NE2 1 
ATOM   6884 N N   . PHE B 1 359 ? 15.694  -9.899  -16.288 1.00 56.98 ? 359  PHE B N   1 
ATOM   6885 C CA  . PHE B 1 359 ? 15.735  -8.464  -16.553 1.00 56.54 ? 359  PHE B CA  1 
ATOM   6886 C C   . PHE B 1 359 ? 17.142  -7.986  -16.903 1.00 56.17 ? 359  PHE B C   1 
ATOM   6887 O O   . PHE B 1 359 ? 17.302  -7.189  -17.815 1.00 55.99 ? 359  PHE B O   1 
ATOM   6888 C CB  . PHE B 1 359 ? 15.138  -7.682  -15.377 1.00 56.34 ? 359  PHE B CB  1 
ATOM   6889 C CG  . PHE B 1 359 ? 15.238  -6.189  -15.512 1.00 56.61 ? 359  PHE B CG  1 
ATOM   6890 C CD1 . PHE B 1 359 ? 16.065  -5.456  -14.667 1.00 56.75 ? 359  PHE B CD1 1 
ATOM   6891 C CD2 . PHE B 1 359 ? 14.505  -5.508  -16.476 1.00 57.06 ? 359  PHE B CD2 1 
ATOM   6892 C CE1 . PHE B 1 359 ? 16.162  -4.074  -14.782 1.00 55.67 ? 359  PHE B CE1 1 
ATOM   6893 C CE2 . PHE B 1 359 ? 14.605  -4.124  -16.595 1.00 56.51 ? 359  PHE B CE2 1 
ATOM   6894 C CZ  . PHE B 1 359 ? 15.433  -3.412  -15.743 1.00 55.82 ? 359  PHE B CZ  1 
ATOM   6895 N N   . LEU B 1 360 ? 18.157  -8.484  -16.205 1.00 56.04 ? 360  LEU B N   1 
ATOM   6896 C CA  . LEU B 1 360 ? 19.527  -8.037  -16.468 1.00 56.25 ? 360  LEU B CA  1 
ATOM   6897 C C   . LEU B 1 360 ? 19.980  -8.558  -17.828 1.00 56.17 ? 360  LEU B C   1 
ATOM   6898 O O   . LEU B 1 360 ? 20.620  -7.842  -18.603 1.00 56.42 ? 360  LEU B O   1 
ATOM   6899 C CB  . LEU B 1 360 ? 20.513  -8.464  -15.360 1.00 56.24 ? 360  LEU B CB  1 
ATOM   6900 C CG  . LEU B 1 360 ? 20.210  -8.414  -13.843 1.00 56.99 ? 360  LEU B CG  1 
ATOM   6901 C CD1 . LEU B 1 360 ? 21.500  -8.606  -13.030 1.00 58.49 ? 360  LEU B CD1 1 
ATOM   6902 C CD2 . LEU B 1 360 ? 19.471  -7.170  -13.336 1.00 56.58 ? 360  LEU B CD2 1 
ATOM   6903 N N   . ALA B 1 361 ? 19.623  -9.807  -18.115 1.00 55.97 ? 361  ALA B N   1 
ATOM   6904 C CA  . ALA B 1 361 ? 19.905  -10.418 -19.409 1.00 55.57 ? 361  ALA B CA  1 
ATOM   6905 C C   . ALA B 1 361 ? 19.104  -9.729  -20.508 1.00 55.03 ? 361  ALA B C   1 
ATOM   6906 O O   . ALA B 1 361 ? 19.623  -9.501  -21.607 1.00 55.30 ? 361  ALA B O   1 
ATOM   6907 C CB  . ALA B 1 361 ? 19.601  -11.919 -19.374 1.00 55.59 ? 361  ALA B CB  1 
ATOM   6908 N N   . GLY B 1 362 ? 17.850  -9.404  -20.196 1.00 54.23 ? 362  GLY B N   1 
ATOM   6909 C CA  . GLY B 1 362 ? 16.971  -8.654  -21.092 1.00 53.68 ? 362  GLY B CA  1 
ATOM   6910 C C   . GLY B 1 362 ? 17.530  -7.310  -21.520 1.00 53.47 ? 362  GLY B C   1 
ATOM   6911 O O   . GLY B 1 362 ? 17.363  -6.902  -22.675 1.00 53.45 ? 362  GLY B O   1 
ATOM   6912 N N   . VAL B 1 363 ? 18.209  -6.631  -20.592 1.00 53.23 ? 363  VAL B N   1 
ATOM   6913 C CA  . VAL B 1 363 ? 18.827  -5.327  -20.852 1.00 52.62 ? 363  VAL B CA  1 
ATOM   6914 C C   . VAL B 1 363 ? 20.043  -5.436  -21.784 1.00 52.78 ? 363  VAL B C   1 
ATOM   6915 O O   . VAL B 1 363 ? 20.327  -4.507  -22.542 1.00 52.88 ? 363  VAL B O   1 
ATOM   6916 C CB  . VAL B 1 363 ? 19.184  -4.581  -19.526 1.00 52.53 ? 363  VAL B CB  1 
ATOM   6917 C CG1 . VAL B 1 363 ? 20.028  -3.337  -19.788 1.00 51.30 ? 363  VAL B CG1 1 
ATOM   6918 C CG2 . VAL B 1 363 ? 17.914  -4.201  -18.767 1.00 51.75 ? 363  VAL B CG2 1 
ATOM   6919 N N   . ARG B 1 364 ? 20.751  -6.564  -21.747 1.00 52.65 ? 364  ARG B N   1 
ATOM   6920 C CA  . ARG B 1 364 ? 21.908  -6.740  -22.625 1.00 52.78 ? 364  ARG B CA  1 
ATOM   6921 C C   . ARG B 1 364 ? 21.463  -6.943  -24.060 1.00 52.66 ? 364  ARG B C   1 
ATOM   6922 O O   . ARG B 1 364 ? 22.250  -6.775  -24.986 1.00 52.61 ? 364  ARG B O   1 
ATOM   6923 C CB  . ARG B 1 364 ? 22.792  -7.902  -22.176 1.00 53.01 ? 364  ARG B CB  1 
ATOM   6924 C CG  . ARG B 1 364 ? 23.284  -7.828  -20.710 1.00 54.27 ? 364  ARG B CG  1 
ATOM   6925 C CD  . ARG B 1 364 ? 23.830  -6.456  -20.320 1.00 54.91 ? 364  ARG B CD  1 
ATOM   6926 N NE  . ARG B 1 364 ? 25.004  -6.069  -21.100 1.00 56.46 ? 364  ARG B NE  1 
ATOM   6927 C CZ  . ARG B 1 364 ? 26.264  -6.275  -20.715 1.00 57.92 ? 364  ARG B CZ  1 
ATOM   6928 N NH1 . ARG B 1 364 ? 26.520  -6.866  -19.549 1.00 57.62 ? 364  ARG B NH1 1 
ATOM   6929 N NH2 . ARG B 1 364 ? 27.274  -5.886  -21.494 1.00 57.05 ? 364  ARG B NH2 1 
ATOM   6930 N N   . ILE B 1 365 ? 20.189  -7.291  -24.227 1.00 52.47 ? 365  ILE B N   1 
ATOM   6931 C CA  . ILE B 1 365 ? 19.584  -7.519  -25.535 1.00 52.00 ? 365  ILE B CA  1 
ATOM   6932 C C   . ILE B 1 365 ? 18.898  -6.240  -26.038 1.00 52.10 ? 365  ILE B C   1 
ATOM   6933 O O   . ILE B 1 365 ? 18.975  -5.904  -27.232 1.00 51.66 ? 365  ILE B O   1 
ATOM   6934 C CB  . ILE B 1 365 ? 18.600  -8.715  -25.467 1.00 52.06 ? 365  ILE B CB  1 
ATOM   6935 C CG1 . ILE B 1 365 ? 19.387  -10.014 -25.261 1.00 52.15 ? 365  ILE B CG1 1 
ATOM   6936 C CG2 . ILE B 1 365 ? 17.708  -8.796  -26.716 1.00 51.67 ? 365  ILE B CG2 1 
ATOM   6937 C CD1 . ILE B 1 365 ? 18.533  -11.191 -24.867 1.00 53.04 ? 365  ILE B CD1 1 
ATOM   6938 N N   . GLY B 1 366 ? 18.251  -5.528  -25.112 1.00 51.98 ? 366  GLY B N   1 
ATOM   6939 C CA  . GLY B 1 366 ? 17.537  -4.284  -25.417 1.00 52.04 ? 366  GLY B CA  1 
ATOM   6940 C C   . GLY B 1 366 ? 18.470  -3.125  -25.694 1.00 51.81 ? 366  GLY B C   1 
ATOM   6941 O O   . GLY B 1 366 ? 18.174  -2.240  -26.500 1.00 51.55 ? 366  GLY B O   1 
ATOM   6942 N N   . VAL B 1 367 ? 19.609  -3.142  -25.014 1.00 52.14 ? 367  VAL B N   1 
ATOM   6943 C CA  . VAL B 1 367 ? 20.643  -2.142  -25.200 1.00 52.31 ? 367  VAL B CA  1 
ATOM   6944 C C   . VAL B 1 367 ? 21.883  -2.929  -25.546 1.00 52.79 ? 367  VAL B C   1 
ATOM   6945 O O   . VAL B 1 367 ? 22.802  -3.042  -24.740 1.00 52.78 ? 367  VAL B O   1 
ATOM   6946 C CB  . VAL B 1 367 ? 20.870  -1.281  -23.931 1.00 52.24 ? 367  VAL B CB  1 
ATOM   6947 C CG1 . VAL B 1 367 ? 21.627  -0.004  -24.285 1.00 51.40 ? 367  VAL B CG1 1 
ATOM   6948 C CG2 . VAL B 1 367 ? 19.541  -0.948  -23.264 1.00 51.33 ? 367  VAL B CG2 1 
ATOM   6949 N N   . PRO B 1 368 ? 21.914  -3.477  -26.765 1.00 53.46 ? 368  PRO B N   1 
ATOM   6950 C CA  . PRO B 1 368 ? 22.956  -4.415  -27.145 1.00 53.86 ? 368  PRO B CA  1 
ATOM   6951 C C   . PRO B 1 368 ? 24.309  -3.726  -27.317 1.00 54.45 ? 368  PRO B C   1 
ATOM   6952 O O   . PRO B 1 368 ? 25.352  -4.380  -27.264 1.00 54.61 ? 368  PRO B O   1 
ATOM   6953 C CB  . PRO B 1 368 ? 22.455  -4.944  -28.485 1.00 53.79 ? 368  PRO B CB  1 
ATOM   6954 C CG  . PRO B 1 368 ? 21.679  -3.808  -29.060 1.00 53.64 ? 368  PRO B CG  1 
ATOM   6955 C CD  . PRO B 1 368 ? 20.991  -3.196  -27.883 1.00 53.61 ? 368  PRO B CD  1 
ATOM   6956 N N   . GLN B 1 369 ? 24.277  -2.416  -27.521 1.00 55.10 ? 369  GLN B N   1 
ATOM   6957 C CA  . GLN B 1 369 ? 25.480  -1.638  -27.721 1.00 56.11 ? 369  GLN B CA  1 
ATOM   6958 C C   . GLN B 1 369 ? 26.172  -1.330  -26.400 1.00 56.29 ? 369  GLN B C   1 
ATOM   6959 O O   . GLN B 1 369 ? 27.308  -0.859  -26.394 1.00 56.49 ? 369  GLN B O   1 
ATOM   6960 C CB  . GLN B 1 369 ? 25.157  -0.349  -28.490 1.00 56.29 ? 369  GLN B CB  1 
ATOM   6961 C CG  . GLN B 1 369 ? 25.342  -0.473  -30.028 1.00 58.40 ? 369  GLN B CG  1 
ATOM   6962 C CD  . GLN B 1 369 ? 24.320  -1.411  -30.722 1.00 59.99 ? 369  GLN B CD  1 
ATOM   6963 O OE1 . GLN B 1 369 ? 23.176  -1.022  -30.993 1.00 61.11 ? 369  GLN B OE1 1 
ATOM   6964 N NE2 . GLN B 1 369 ? 24.748  -2.637  -31.023 1.00 58.45 ? 369  GLN B NE2 1 
ATOM   6965 N N   . ALA B 1 370 ? 25.495  -1.627  -25.291 1.00 56.54 ? 370  ALA B N   1 
ATOM   6966 C CA  . ALA B 1 370 ? 25.957  -1.241  -23.950 1.00 56.95 ? 370  ALA B CA  1 
ATOM   6967 C C   . ALA B 1 370 ? 27.060  -2.113  -23.383 1.00 57.17 ? 370  ALA B C   1 
ATOM   6968 O O   . ALA B 1 370 ? 27.005  -3.341  -23.481 1.00 57.32 ? 370  ALA B O   1 
ATOM   6969 C CB  . ALA B 1 370 ? 24.786  -1.199  -22.969 1.00 56.86 ? 370  ALA B CB  1 
ATOM   6970 N N   . SER B 1 371 ? 28.043  -1.458  -22.763 1.00 57.55 ? 371  SER B N   1 
ATOM   6971 C CA  . SER B 1 371 ? 29.070  -2.128  -21.964 1.00 57.84 ? 371  SER B CA  1 
ATOM   6972 C C   . SER B 1 371 ? 28.458  -2.676  -20.685 1.00 57.76 ? 371  SER B C   1 
ATOM   6973 O O   . SER B 1 371 ? 27.297  -2.406  -20.395 1.00 57.64 ? 371  SER B O   1 
ATOM   6974 C CB  . SER B 1 371 ? 30.178  -1.142  -21.609 1.00 57.88 ? 371  SER B CB  1 
ATOM   6975 O OG  . SER B 1 371 ? 29.652  -0.056  -20.863 1.00 59.45 ? 371  SER B OG  1 
ATOM   6976 N N   . ASP B 1 372 ? 29.242  -3.429  -19.911 1.00 58.00 ? 372  ASP B N   1 
ATOM   6977 C CA  . ASP B 1 372 ? 28.761  -3.960  -18.633 1.00 58.09 ? 372  ASP B CA  1 
ATOM   6978 C C   . ASP B 1 372 ? 28.354  -2.828  -17.708 1.00 57.17 ? 372  ASP B C   1 
ATOM   6979 O O   . ASP B 1 372 ? 27.288  -2.879  -17.082 1.00 56.97 ? 372  ASP B O   1 
ATOM   6980 C CB  . ASP B 1 372 ? 29.816  -4.842  -17.962 1.00 58.78 ? 372  ASP B CB  1 
ATOM   6981 C CG  . ASP B 1 372 ? 30.146  -6.069  -18.785 1.00 61.35 ? 372  ASP B CG  1 
ATOM   6982 O OD1 . ASP B 1 372 ? 29.218  -6.596  -19.453 1.00 63.00 ? 372  ASP B OD1 1 
ATOM   6983 O OD2 . ASP B 1 372 ? 31.331  -6.493  -18.773 1.00 63.17 ? 372  ASP B OD2 1 
ATOM   6984 N N   . LEU B 1 373 ? 29.198  -1.801  -17.656 1.00 56.01 ? 373  LEU B N   1 
ATOM   6985 C CA  . LEU B 1 373 ? 28.924  -0.633  -16.843 1.00 55.10 ? 373  LEU B CA  1 
ATOM   6986 C C   . LEU B 1 373 ? 27.650  0.086   -17.267 1.00 54.39 ? 373  LEU B C   1 
ATOM   6987 O O   . LEU B 1 373 ? 26.810  0.404   -16.426 1.00 54.29 ? 373  LEU B O   1 
ATOM   6988 C CB  . LEU B 1 373 ? 30.115  0.330   -16.847 1.00 55.15 ? 373  LEU B CB  1 
ATOM   6989 C CG  . LEU B 1 373 ? 29.998  1.589   -15.976 1.00 54.98 ? 373  LEU B CG  1 
ATOM   6990 C CD1 . LEU B 1 373 ? 29.440  1.294   -14.576 1.00 54.77 ? 373  LEU B CD1 1 
ATOM   6991 C CD2 . LEU B 1 373 ? 31.349  2.249   -15.874 1.00 54.95 ? 373  LEU B CD2 1 
ATOM   6992 N N   . ALA B 1 374 ? 27.512  0.337   -18.567 1.00 53.76 ? 374  ALA B N   1 
ATOM   6993 C CA  . ALA B 1 374 ? 26.352  1.059   -19.091 1.00 52.72 ? 374  ALA B CA  1 
ATOM   6994 C C   . ALA B 1 374 ? 25.079  0.282   -18.828 1.00 52.20 ? 374  ALA B C   1 
ATOM   6995 O O   . ALA B 1 374 ? 24.063  0.861   -18.452 1.00 52.27 ? 374  ALA B O   1 
ATOM   6996 C CB  . ALA B 1 374 ? 26.515  1.335   -20.565 1.00 52.82 ? 374  ALA B CB  1 
ATOM   6997 N N   . ALA B 1 375 ? 25.153  -1.035  -19.009 1.00 51.45 ? 375  ALA B N   1 
ATOM   6998 C CA  . ALA B 1 375 ? 24.031  -1.925  -18.758 1.00 50.71 ? 375  ALA B CA  1 
ATOM   6999 C C   . ALA B 1 375 ? 23.643  -1.838  -17.304 1.00 50.28 ? 375  ALA B C   1 
ATOM   7000 O O   . ALA B 1 375 ? 22.469  -1.888  -16.961 1.00 50.67 ? 375  ALA B O   1 
ATOM   7001 C CB  . ALA B 1 375 ? 24.406  -3.342  -19.098 1.00 50.74 ? 375  ALA B CB  1 
ATOM   7002 N N   . GLU B 1 376 ? 24.645  -1.712  -16.448 1.00 49.57 ? 376  GLU B N   1 
ATOM   7003 C CA  . GLU B 1 376 ? 24.411  -1.639  -15.016 1.00 49.12 ? 376  GLU B CA  1 
ATOM   7004 C C   . GLU B 1 376 ? 23.733  -0.310  -14.689 1.00 47.58 ? 376  GLU B C   1 
ATOM   7005 O O   . GLU B 1 376 ? 22.769  -0.267  -13.928 1.00 46.93 ? 376  GLU B O   1 
ATOM   7006 C CB  . GLU B 1 376 ? 25.725  -1.829  -14.236 1.00 49.21 ? 376  GLU B CB  1 
ATOM   7007 C CG  . GLU B 1 376 ? 25.536  -2.244  -12.785 1.00 52.59 ? 376  GLU B CG  1 
ATOM   7008 C CD  . GLU B 1 376 ? 24.727  -3.537  -12.623 1.00 57.63 ? 376  GLU B CD  1 
ATOM   7009 O OE1 . GLU B 1 376 ? 24.841  -4.434  -13.498 1.00 60.14 ? 376  GLU B OE1 1 
ATOM   7010 O OE2 . GLU B 1 376 ? 23.976  -3.657  -11.620 1.00 58.60 ? 376  GLU B OE2 1 
ATOM   7011 N N   . ALA B 1 377 ? 24.231  0.763   -15.294 1.00 46.28 ? 377  ALA B N   1 
ATOM   7012 C CA  . ALA B 1 377 ? 23.601  2.062   -15.151 1.00 45.54 ? 377  ALA B CA  1 
ATOM   7013 C C   . ALA B 1 377 ? 22.117  1.969   -15.523 1.00 44.99 ? 377  ALA B C   1 
ATOM   7014 O O   . ALA B 1 377 ? 21.268  2.506   -14.811 1.00 44.95 ? 377  ALA B O   1 
ATOM   7015 C CB  . ALA B 1 377 ? 24.313  3.101   -15.988 1.00 45.31 ? 377  ALA B CB  1 
ATOM   7016 N N   . VAL B 1 378 ? 21.813  1.258   -16.611 1.00 44.31 ? 378  VAL B N   1 
ATOM   7017 C CA  . VAL B 1 378 ? 20.438  1.099   -17.066 1.00 43.84 ? 378  VAL B CA  1 
ATOM   7018 C C   . VAL B 1 378 ? 19.618  0.338   -16.043 1.00 43.95 ? 378  VAL B C   1 
ATOM   7019 O O   . VAL B 1 378 ? 18.561  0.822   -15.614 1.00 44.04 ? 378  VAL B O   1 
ATOM   7020 C CB  . VAL B 1 378 ? 20.327  0.399   -18.452 1.00 43.86 ? 378  VAL B CB  1 
ATOM   7021 C CG1 . VAL B 1 378 ? 18.875  0.000   -18.744 1.00 43.21 ? 378  VAL B CG1 1 
ATOM   7022 C CG2 . VAL B 1 378 ? 20.847  1.306   -19.552 1.00 42.76 ? 378  VAL B CG2 1 
ATOM   7023 N N   . VAL B 1 379 ? 20.107  -0.837  -15.647 1.00 43.66 ? 379  VAL B N   1 
ATOM   7024 C CA  . VAL B 1 379 ? 19.390  -1.677  -14.701 1.00 43.69 ? 379  VAL B CA  1 
ATOM   7025 C C   . VAL B 1 379 ? 19.080  -0.904  -13.426 1.00 44.22 ? 379  VAL B C   1 
ATOM   7026 O O   . VAL B 1 379 ? 17.950  -0.951  -12.904 1.00 44.41 ? 379  VAL B O   1 
ATOM   7027 C CB  . VAL B 1 379 ? 20.170  -2.957  -14.350 1.00 43.75 ? 379  VAL B CB  1 
ATOM   7028 C CG1 . VAL B 1 379 ? 19.532  -3.653  -13.164 1.00 42.12 ? 379  VAL B CG1 1 
ATOM   7029 C CG2 . VAL B 1 379 ? 20.230  -3.900  -15.554 1.00 43.37 ? 379  VAL B CG2 1 
ATOM   7030 N N   . LEU B 1 380 ? 20.076  -0.175  -12.937 1.00 44.42 ? 380  LEU B N   1 
ATOM   7031 C CA  . LEU B 1 380 ? 19.929  0.513   -11.669 1.00 44.94 ? 380  LEU B CA  1 
ATOM   7032 C C   . LEU B 1 380 ? 18.980  1.708   -11.761 1.00 44.98 ? 380  LEU B C   1 
ATOM   7033 O O   . LEU B 1 380 ? 18.334  2.069   -10.772 1.00 45.11 ? 380  LEU B O   1 
ATOM   7034 C CB  . LEU B 1 380 ? 21.295  0.875   -11.087 1.00 45.37 ? 380  LEU B CB  1 
ATOM   7035 C CG  . LEU B 1 380 ? 22.213  -0.321  -10.762 1.00 46.78 ? 380  LEU B CG  1 
ATOM   7036 C CD1 . LEU B 1 380 ? 23.514  0.121   -10.110 1.00 47.00 ? 380  LEU B CD1 1 
ATOM   7037 C CD2 . LEU B 1 380 ? 21.525  -1.422  -9.902  1.00 47.65 ? 380  LEU B CD2 1 
ATOM   7038 N N   . HIS B 1 381 ? 18.872  2.290   -12.955 1.00 44.58 ? 381  HIS B N   1 
ATOM   7039 C CA  . HIS B 1 381 ? 17.932  3.375   -13.210 1.00 44.11 ? 381  HIS B CA  1 
ATOM   7040 C C   . HIS B 1 381 ? 16.510  2.849   -13.296 1.00 44.20 ? 381  HIS B C   1 
ATOM   7041 O O   . HIS B 1 381 ? 15.569  3.478   -12.816 1.00 44.48 ? 381  HIS B O   1 
ATOM   7042 C CB  . HIS B 1 381 ? 18.300  4.096   -14.507 1.00 44.21 ? 381  HIS B CB  1 
ATOM   7043 C CG  . HIS B 1 381 ? 17.399  5.246   -14.837 1.00 43.95 ? 381  HIS B CG  1 
ATOM   7044 N ND1 . HIS B 1 381 ? 17.552  6.498   -14.278 1.00 43.07 ? 381  HIS B ND1 1 
ATOM   7045 C CD2 . HIS B 1 381 ? 16.333  5.332   -15.668 1.00 43.82 ? 381  HIS B CD2 1 
ATOM   7046 C CE1 . HIS B 1 381 ? 16.610  7.299   -14.741 1.00 43.75 ? 381  HIS B CE1 1 
ATOM   7047 N NE2 . HIS B 1 381 ? 15.857  6.618   -15.587 1.00 43.38 ? 381  HIS B NE2 1 
ATOM   7048 N N   . TYR B 1 382 ? 16.348  1.681   -13.898 1.00 44.12 ? 382  TYR B N   1 
ATOM   7049 C CA  . TYR B 1 382 ? 15.010  1.188   -14.168 1.00 43.90 ? 382  TYR B CA  1 
ATOM   7050 C C   . TYR B 1 382 ? 14.452  0.279   -13.095 1.00 44.79 ? 382  TYR B C   1 
ATOM   7051 O O   . TYR B 1 382 ? 13.229  0.087   -13.015 1.00 45.26 ? 382  TYR B O   1 
ATOM   7052 C CB  . TYR B 1 382 ? 14.941  0.536   -15.541 1.00 42.83 ? 382  TYR B CB  1 
ATOM   7053 C CG  . TYR B 1 382 ? 14.823  1.535   -16.664 1.00 40.95 ? 382  TYR B CG  1 
ATOM   7054 C CD1 . TYR B 1 382 ? 15.951  2.050   -17.269 1.00 39.14 ? 382  TYR B CD1 1 
ATOM   7055 C CD2 . TYR B 1 382 ? 13.575  1.970   -17.109 1.00 39.51 ? 382  TYR B CD2 1 
ATOM   7056 C CE1 . TYR B 1 382 ? 15.852  2.959   -18.293 1.00 39.48 ? 382  TYR B CE1 1 
ATOM   7057 C CE2 . TYR B 1 382 ? 13.460  2.885   -18.139 1.00 39.11 ? 382  TYR B CE2 1 
ATOM   7058 C CZ  . TYR B 1 382 ? 14.609  3.375   -18.733 1.00 40.51 ? 382  TYR B CZ  1 
ATOM   7059 O OH  . TYR B 1 382 ? 14.532  4.283   -19.772 1.00 40.90 ? 382  TYR B OH  1 
ATOM   7060 N N   . THR B 1 383 ? 15.326  -0.279  -12.267 1.00 45.42 ? 383  THR B N   1 
ATOM   7061 C CA  . THR B 1 383 ? 14.859  -0.959  -11.078 1.00 46.39 ? 383  THR B CA  1 
ATOM   7062 C C   . THR B 1 383 ? 14.111  0.044   -10.208 1.00 47.17 ? 383  THR B C   1 
ATOM   7063 O O   . THR B 1 383 ? 14.656  1.084   -9.846  1.00 47.19 ? 383  THR B O   1 
ATOM   7064 C CB  . THR B 1 383 ? 16.017  -1.536  -10.280 1.00 46.41 ? 383  THR B CB  1 
ATOM   7065 O OG1 . THR B 1 383 ? 16.758  -2.439  -11.110 1.00 47.29 ? 383  THR B OG1 1 
ATOM   7066 C CG2 . THR B 1 383 ? 15.513  -2.265  -9.053  1.00 46.25 ? 383  THR B CG2 1 
ATOM   7067 N N   . ASP B 1 384 ? 12.844  -0.246  -9.920  1.00 48.54 ? 384  ASP B N   1 
ATOM   7068 C CA  . ASP B 1 384 ? 12.142  0.473   -8.868  1.00 50.08 ? 384  ASP B CA  1 
ATOM   7069 C C   . ASP B 1 384 ? 12.629  -0.065  -7.517  1.00 50.59 ? 384  ASP B C   1 
ATOM   7070 O O   . ASP B 1 384 ? 12.267  -1.172  -7.109  1.00 50.79 ? 384  ASP B O   1 
ATOM   7071 C CB  . ASP B 1 384 ? 10.624  0.335   -8.990  1.00 50.41 ? 384  ASP B CB  1 
ATOM   7072 C CG  . ASP B 1 384 ? 9.881   1.093   -7.897  1.00 51.75 ? 384  ASP B CG  1 
ATOM   7073 O OD1 . ASP B 1 384 ? 10.430  1.217   -6.775  1.00 53.11 ? 384  ASP B OD1 1 
ATOM   7074 O OD2 . ASP B 1 384 ? 8.750   1.568   -8.156  1.00 53.21 ? 384  ASP B OD2 1 
ATOM   7075 N N   . TRP B 1 385 ? 13.431  0.734   -6.822  1.00 50.98 ? 385  TRP B N   1 
ATOM   7076 C CA  . TRP B 1 385 ? 14.095  0.266   -5.617  1.00 51.85 ? 385  TRP B CA  1 
ATOM   7077 C C   . TRP B 1 385 ? 13.208  -0.042  -4.386  1.00 52.98 ? 385  TRP B C   1 
ATOM   7078 O O   . TRP B 1 385 ? 13.679  -0.640  -3.411  1.00 53.38 ? 385  TRP B O   1 
ATOM   7079 C CB  . TRP B 1 385 ? 15.314  1.142   -5.315  1.00 50.82 ? 385  TRP B CB  1 
ATOM   7080 C CG  . TRP B 1 385 ? 16.357  0.869   -6.343  1.00 49.90 ? 385  TRP B CG  1 
ATOM   7081 C CD1 . TRP B 1 385 ? 16.702  1.659   -7.406  1.00 48.75 ? 385  TRP B CD1 1 
ATOM   7082 C CD2 . TRP B 1 385 ? 17.136  -0.323  -6.462  1.00 48.42 ? 385  TRP B CD2 1 
ATOM   7083 N NE1 . TRP B 1 385 ? 17.678  1.043   -8.159  1.00 47.64 ? 385  TRP B NE1 1 
ATOM   7084 C CE2 . TRP B 1 385 ? 17.955  -0.178  -7.605  1.00 48.17 ? 385  TRP B CE2 1 
ATOM   7085 C CE3 . TRP B 1 385 ? 17.230  -1.498  -5.708  1.00 48.12 ? 385  TRP B CE3 1 
ATOM   7086 C CZ2 . TRP B 1 385 ? 18.861  -1.163  -8.005  1.00 49.11 ? 385  TRP B CZ2 1 
ATOM   7087 C CZ3 . TRP B 1 385 ? 18.132  -2.482  -6.112  1.00 48.32 ? 385  TRP B CZ3 1 
ATOM   7088 C CH2 . TRP B 1 385 ? 18.931  -2.307  -7.248  1.00 48.88 ? 385  TRP B CH2 1 
ATOM   7089 N N   . LEU B 1 386 ? 11.926  0.310   -4.462  1.00 54.17 ? 386  LEU B N   1 
ATOM   7090 C CA  . LEU B 1 386 ? 10.954  -0.068  -3.430  1.00 55.55 ? 386  LEU B CA  1 
ATOM   7091 C C   . LEU B 1 386 ? 10.400  -1.470  -3.699  1.00 56.05 ? 386  LEU B C   1 
ATOM   7092 O O   . LEU B 1 386 ? 9.903   -2.145  -2.795  1.00 56.40 ? 386  LEU B O   1 
ATOM   7093 C CB  . LEU B 1 386 ? 9.800   0.943   -3.379  1.00 55.94 ? 386  LEU B CB  1 
ATOM   7094 C CG  . LEU B 1 386 ? 10.162  2.432   -3.241  1.00 57.25 ? 386  LEU B CG  1 
ATOM   7095 C CD1 . LEU B 1 386 ? 9.250   3.375   -4.061  1.00 58.34 ? 386  LEU B CD1 1 
ATOM   7096 C CD2 . LEU B 1 386 ? 10.200  2.834   -1.774  1.00 57.66 ? 386  LEU B CD2 1 
ATOM   7097 N N   . HIS B 1 387 ? 10.463  -1.891  -4.957  1.00 56.57 ? 387  HIS B N   1 
ATOM   7098 C CA  . HIS B 1 387 ? 9.991   -3.214  -5.346  1.00 57.08 ? 387  HIS B CA  1 
ATOM   7099 C C   . HIS B 1 387 ? 11.033  -3.852  -6.284  1.00 57.29 ? 387  HIS B C   1 
ATOM   7100 O O   . HIS B 1 387 ? 10.717  -4.208  -7.422  1.00 57.60 ? 387  HIS B O   1 
ATOM   7101 C CB  . HIS B 1 387 ? 8.599   -3.132  -6.000  1.00 56.93 ? 387  HIS B CB  1 
ATOM   7102 C CG  . HIS B 1 387 ? 7.636   -2.224  -5.286  1.00 57.62 ? 387  HIS B CG  1 
ATOM   7103 N ND1 . HIS B 1 387 ? 7.391   -0.927  -5.694  1.00 57.88 ? 387  HIS B ND1 1 
ATOM   7104 C CD2 . HIS B 1 387 ? 6.861   -2.425  -4.191  1.00 57.94 ? 387  HIS B CD2 1 
ATOM   7105 C CE1 . HIS B 1 387 ? 6.511   -0.368  -4.879  1.00 57.24 ? 387  HIS B CE1 1 
ATOM   7106 N NE2 . HIS B 1 387 ? 6.173   -1.255  -3.960  1.00 57.52 ? 387  HIS B NE2 1 
ATOM   7107 N N   . PRO B 1 388 ? 12.287  -4.001  -5.802  1.00 57.43 ? 388  PRO B N   1 
ATOM   7108 C CA  . PRO B 1 388 ? 13.404  -4.444  -6.635  1.00 57.65 ? 388  PRO B CA  1 
ATOM   7109 C C   . PRO B 1 388 ? 13.151  -5.698  -7.470  1.00 57.89 ? 388  PRO B C   1 
ATOM   7110 O O   . PRO B 1 388 ? 13.623  -5.778  -8.604  1.00 57.93 ? 388  PRO B O   1 
ATOM   7111 C CB  . PRO B 1 388 ? 14.530  -4.706  -5.615  1.00 57.42 ? 388  PRO B CB  1 
ATOM   7112 C CG  . PRO B 1 388 ? 13.886  -4.686  -4.285  1.00 57.50 ? 388  PRO B CG  1 
ATOM   7113 C CD  . PRO B 1 388 ? 12.729  -3.762  -4.418  1.00 57.33 ? 388  PRO B CD  1 
ATOM   7114 N N   . GLU B 1 389 ? 12.420  -6.665  -6.926  1.00 58.46 ? 389  GLU B N   1 
ATOM   7115 C CA  . GLU B 1 389 ? 12.278  -7.968  -7.594  1.00 59.00 ? 389  GLU B CA  1 
ATOM   7116 C C   . GLU B 1 389 ? 10.840  -8.311  -7.968  1.00 58.56 ? 389  GLU B C   1 
ATOM   7117 O O   . GLU B 1 389 ? 10.549  -9.445  -8.363  1.00 58.95 ? 389  GLU B O   1 
ATOM   7118 C CB  . GLU B 1 389 ? 12.968  -9.087  -6.784  1.00 58.84 ? 389  GLU B CB  1 
ATOM   7119 C CG  . GLU B 1 389 ? 14.449  -8.742  -6.478  1.00 60.31 ? 389  GLU B CG  1 
ATOM   7120 C CD  . GLU B 1 389 ? 15.303  -9.924  -6.051  1.00 60.46 ? 389  GLU B CD  1 
ATOM   7121 O OE1 . GLU B 1 389 ? 15.668  -10.768 -6.915  1.00 62.51 ? 389  GLU B OE1 1 
ATOM   7122 O OE2 . GLU B 1 389 ? 15.638  -9.982  -4.848  1.00 62.11 ? 389  GLU B OE2 1 
ATOM   7123 N N   . ASP B 1 390 ? 9.949   -7.325  -7.870  1.00 58.13 ? 390  ASP B N   1 
ATOM   7124 C CA  . ASP B 1 390 ? 8.574   -7.488  -8.332  1.00 57.91 ? 390  ASP B CA  1 
ATOM   7125 C C   . ASP B 1 390 ? 8.564   -7.792  -9.837  1.00 57.64 ? 390  ASP B C   1 
ATOM   7126 O O   . ASP B 1 390 ? 9.167   -7.059  -10.627 1.00 57.47 ? 390  ASP B O   1 
ATOM   7127 C CB  . ASP B 1 390 ? 7.742   -6.242  -8.028  1.00 57.81 ? 390  ASP B CB  1 
ATOM   7128 C CG  . ASP B 1 390 ? 6.292   -6.379  -8.486  1.00 59.17 ? 390  ASP B CG  1 
ATOM   7129 O OD1 . ASP B 1 390 ? 5.541   -7.170  -7.864  1.00 60.15 ? 390  ASP B OD1 1 
ATOM   7130 O OD2 . ASP B 1 390 ? 5.905   -5.699  -9.467  1.00 58.80 ? 390  ASP B OD2 1 
ATOM   7131 N N   . PRO B 1 391 ? 7.890   -8.885  -10.233 1.00 57.38 ? 391  PRO B N   1 
ATOM   7132 C CA  . PRO B 1 391 ? 7.874   -9.314  -11.636 1.00 56.83 ? 391  PRO B CA  1 
ATOM   7133 C C   . PRO B 1 391 ? 7.133   -8.345  -12.571 1.00 56.23 ? 391  PRO B C   1 
ATOM   7134 O O   . PRO B 1 391 ? 7.621   -8.091  -13.669 1.00 56.07 ? 391  PRO B O   1 
ATOM   7135 C CB  . PRO B 1 391 ? 7.179   -10.687 -11.593 1.00 56.91 ? 391  PRO B CB  1 
ATOM   7136 C CG  . PRO B 1 391 ? 7.075   -11.068 -10.133 1.00 57.42 ? 391  PRO B CG  1 
ATOM   7137 C CD  . PRO B 1 391 ? 7.090   -9.776  -9.368  1.00 57.71 ? 391  PRO B CD  1 
ATOM   7138 N N   . THR B 1 392 ? 5.984   -7.812  -12.141 1.00 55.70 ? 392  THR B N   1 
ATOM   7139 C CA  . THR B 1 392 ? 5.265   -6.775  -12.902 1.00 55.09 ? 392  THR B CA  1 
ATOM   7140 C C   . THR B 1 392 ? 6.164   -5.571  -13.171 1.00 55.13 ? 392  THR B C   1 
ATOM   7141 O O   . THR B 1 392 ? 6.282   -5.128  -14.312 1.00 55.20 ? 392  THR B O   1 
ATOM   7142 C CB  . THR B 1 392 ? 3.978   -6.286  -12.183 1.00 55.02 ? 392  THR B CB  1 
ATOM   7143 O OG1 . THR B 1 392 ? 3.144   -7.402  -11.841 1.00 54.69 ? 392  THR B OG1 1 
ATOM   7144 C CG2 . THR B 1 392 ? 3.196   -5.330  -13.068 1.00 54.38 ? 392  THR B CG2 1 
ATOM   7145 N N   . HIS B 1 393 ? 6.803   -5.050  -12.122 1.00 55.24 ? 393  HIS B N   1 
ATOM   7146 C CA  . HIS B 1 393 ? 7.699   -3.892  -12.263 1.00 55.20 ? 393  HIS B CA  1 
ATOM   7147 C C   . HIS B 1 393 ? 8.817   -4.165  -13.246 1.00 54.24 ? 393  HIS B C   1 
ATOM   7148 O O   . HIS B 1 393 ? 9.060   -3.356  -14.145 1.00 54.49 ? 393  HIS B O   1 
ATOM   7149 C CB  . HIS B 1 393 ? 8.276   -3.422  -10.919 1.00 55.47 ? 393  HIS B CB  1 
ATOM   7150 C CG  . HIS B 1 393 ? 7.376   -2.485  -10.179 1.00 57.43 ? 393  HIS B CG  1 
ATOM   7151 N ND1 . HIS B 1 393 ? 6.452   -2.915  -9.248  1.00 59.36 ? 393  HIS B ND1 1 
ATOM   7152 C CD2 . HIS B 1 393 ? 7.238   -1.139  -10.252 1.00 59.26 ? 393  HIS B CD2 1 
ATOM   7153 C CE1 . HIS B 1 393 ? 5.792   -1.874  -8.771  1.00 60.16 ? 393  HIS B CE1 1 
ATOM   7154 N NE2 . HIS B 1 393 ? 6.249   -0.784  -9.363  1.00 60.16 ? 393  HIS B NE2 1 
ATOM   7155 N N   . LEU B 1 394 ? 9.473   -5.308  -13.083 1.00 53.03 ? 394  LEU B N   1 
ATOM   7156 C CA  . LEU B 1 394 ? 10.593  -5.681  -13.937 1.00 52.22 ? 394  LEU B CA  1 
ATOM   7157 C C   . LEU B 1 394 ? 10.171  -5.825  -15.403 1.00 51.70 ? 394  LEU B C   1 
ATOM   7158 O O   . LEU B 1 394 ? 10.881  -5.367  -16.309 1.00 51.60 ? 394  LEU B O   1 
ATOM   7159 C CB  . LEU B 1 394 ? 11.266  -6.956  -13.419 1.00 52.22 ? 394  LEU B CB  1 
ATOM   7160 C CG  . LEU B 1 394 ? 12.004  -6.834  -12.080 1.00 52.17 ? 394  LEU B CG  1 
ATOM   7161 C CD1 . LEU B 1 394 ? 12.134  -8.187  -11.428 1.00 52.10 ? 394  LEU B CD1 1 
ATOM   7162 C CD2 . LEU B 1 394 ? 13.373  -6.189  -12.248 1.00 51.75 ? 394  LEU B CD2 1 
ATOM   7163 N N   . ARG B 1 395 ? 9.016   -6.452  -15.621 1.00 50.92 ? 395  ARG B N   1 
ATOM   7164 C CA  . ARG B 1 395 ? 8.436   -6.603  -16.952 1.00 50.20 ? 395  ARG B CA  1 
ATOM   7165 C C   . ARG B 1 395 ? 8.191   -5.219  -17.571 1.00 49.41 ? 395  ARG B C   1 
ATOM   7166 O O   . ARG B 1 395 ? 8.746   -4.912  -18.628 1.00 49.23 ? 395  ARG B O   1 
ATOM   7167 C CB  . ARG B 1 395 ? 7.160   -7.473  -16.889 1.00 50.35 ? 395  ARG B CB  1 
ATOM   7168 C CG  . ARG B 1 395 ? 6.296   -7.521  -18.160 1.00 50.86 ? 395  ARG B CG  1 
ATOM   7169 C CD  . ARG B 1 395 ? 5.085   -6.613  -18.035 1.00 52.12 ? 395  ARG B CD  1 
ATOM   7170 N NE  . ARG B 1 395 ? 3.916   -7.296  -17.496 1.00 52.48 ? 395  ARG B NE  1 
ATOM   7171 C CZ  . ARG B 1 395 ? 2.844   -6.686  -16.985 1.00 54.66 ? 395  ARG B CZ  1 
ATOM   7172 N NH1 . ARG B 1 395 ? 2.771   -5.365  -16.914 1.00 54.26 ? 395  ARG B NH1 1 
ATOM   7173 N NH2 . ARG B 1 395 ? 1.830   -7.409  -16.534 1.00 56.89 ? 395  ARG B NH2 1 
ATOM   7174 N N   . ASP B 1 396 ? 7.396   -4.386  -16.893 1.00 48.17 ? 396  ASP B N   1 
ATOM   7175 C CA  . ASP B 1 396 ? 7.105   -3.021  -17.350 1.00 47.13 ? 396  ASP B CA  1 
ATOM   7176 C C   . ASP B 1 396 ? 8.355   -2.159  -17.576 1.00 46.05 ? 396  ASP B C   1 
ATOM   7177 O O   . ASP B 1 396 ? 8.374   -1.301  -18.471 1.00 45.76 ? 396  ASP B O   1 
ATOM   7178 C CB  . ASP B 1 396 ? 6.156   -2.317  -16.381 1.00 47.06 ? 396  ASP B CB  1 
ATOM   7179 C CG  . ASP B 1 396 ? 4.725   -2.790  -16.519 1.00 48.26 ? 396  ASP B CG  1 
ATOM   7180 O OD1 . ASP B 1 396 ? 4.370   -3.303  -17.603 1.00 49.09 ? 396  ASP B OD1 1 
ATOM   7181 O OD2 . ASP B 1 396 ? 3.944   -2.640  -15.546 1.00 49.12 ? 396  ASP B OD2 1 
ATOM   7182 N N   . ALA B 1 397 ? 9.383   -2.402  -16.769 1.00 44.75 ? 397  ALA B N   1 
ATOM   7183 C CA  . ALA B 1 397 ? 10.641  -1.664  -16.851 1.00 44.00 ? 397  ALA B CA  1 
ATOM   7184 C C   . ALA B 1 397 ? 11.433  -2.055  -18.101 1.00 43.32 ? 397  ALA B C   1 
ATOM   7185 O O   . ALA B 1 397 ? 11.999  -1.196  -18.792 1.00 43.18 ? 397  ALA B O   1 
ATOM   7186 C CB  . ALA B 1 397 ? 11.472  -1.877  -15.588 1.00 43.33 ? 397  ALA B CB  1 
ATOM   7187 N N   . MET B 1 398 ? 11.468  -3.357  -18.378 1.00 42.53 ? 398  MET B N   1 
ATOM   7188 C CA  . MET B 1 398 ? 12.072  -3.884  -19.597 1.00 41.61 ? 398  MET B CA  1 
ATOM   7189 C C   . MET B 1 398 ? 11.422  -3.238  -20.818 1.00 40.99 ? 398  MET B C   1 
ATOM   7190 O O   . MET B 1 398 ? 12.116  -2.758  -21.719 1.00 41.22 ? 398  MET B O   1 
ATOM   7191 C CB  . MET B 1 398 ? 11.931  -5.411  -19.648 1.00 41.62 ? 398  MET B CB  1 
ATOM   7192 C CG  . MET B 1 398 ? 12.790  -6.089  -20.685 1.00 41.45 ? 398  MET B CG  1 
ATOM   7193 S SD  . MET B 1 398 ? 14.552  -5.797  -20.435 1.00 43.10 ? 398  MET B SD  1 
ATOM   7194 C CE  . MET B 1 398 ? 14.861  -4.468  -21.585 1.00 43.38 ? 398  MET B CE  1 
ATOM   7195 N N   . SER B 1 399 ? 10.092  -3.212  -20.831 1.00 39.79 ? 399  SER B N   1 
ATOM   7196 C CA  . SER B 1 399 ? 9.358   -2.545  -21.878 1.00 39.30 ? 399  SER B CA  1 
ATOM   7197 C C   . SER B 1 399 ? 9.849   -1.116  -22.006 1.00 39.11 ? 399  SER B C   1 
ATOM   7198 O O   . SER B 1 399 ? 10.219  -0.675  -23.097 1.00 39.39 ? 399  SER B O   1 
ATOM   7199 C CB  . SER B 1 399 ? 7.866   -2.570  -21.572 1.00 39.42 ? 399  SER B CB  1 
ATOM   7200 O OG  . SER B 1 399 ? 7.165   -1.665  -22.400 1.00 38.63 ? 399  SER B OG  1 
ATOM   7201 N N   . ALA B 1 400 ? 9.888   -0.422  -20.871 1.00 38.79 ? 400  ALA B N   1 
ATOM   7202 C CA  . ALA B 1 400 ? 10.318  0.975   -20.793 1.00 37.76 ? 400  ALA B CA  1 
ATOM   7203 C C   . ALA B 1 400 ? 11.748  1.177   -21.263 1.00 37.16 ? 400  ALA B C   1 
ATOM   7204 O O   . ALA B 1 400 ? 12.008  2.093   -22.027 1.00 36.98 ? 400  ALA B O   1 
ATOM   7205 C CB  . ALA B 1 400 ? 10.128  1.509   -19.392 1.00 37.74 ? 400  ALA B CB  1 
ATOM   7206 N N   . VAL B 1 401 ? 12.667  0.313   -20.841 1.00 36.87 ? 401  VAL B N   1 
ATOM   7207 C CA  . VAL B 1 401 ? 14.072  0.423   -21.277 1.00 36.70 ? 401  VAL B CA  1 
ATOM   7208 C C   . VAL B 1 401 ? 14.150  0.480   -22.802 1.00 37.17 ? 401  VAL B C   1 
ATOM   7209 O O   . VAL B 1 401 ? 14.793  1.365   -23.370 1.00 37.26 ? 401  VAL B O   1 
ATOM   7210 C CB  . VAL B 1 401 ? 14.931  -0.753  -20.768 1.00 36.56 ? 401  VAL B CB  1 
ATOM   7211 C CG1 . VAL B 1 401 ? 16.208  -0.911  -21.594 1.00 36.61 ? 401  VAL B CG1 1 
ATOM   7212 C CG2 . VAL B 1 401 ? 15.258  -0.588  -19.299 1.00 35.96 ? 401  VAL B CG2 1 
ATOM   7213 N N   . VAL B 1 402 ? 13.457  -0.449  -23.461 1.00 37.21 ? 402  VAL B N   1 
ATOM   7214 C CA  . VAL B 1 402 ? 13.527  -0.569  -24.907 1.00 37.09 ? 402  VAL B CA  1 
ATOM   7215 C C   . VAL B 1 402 ? 12.824  0.578   -25.617 1.00 36.94 ? 402  VAL B C   1 
ATOM   7216 O O   . VAL B 1 402 ? 13.331  1.084   -26.619 1.00 37.03 ? 402  VAL B O   1 
ATOM   7217 C CB  . VAL B 1 402 ? 12.991  -1.936  -25.398 1.00 37.35 ? 402  VAL B CB  1 
ATOM   7218 C CG1 . VAL B 1 402 ? 13.115  -2.046  -26.918 1.00 36.47 ? 402  VAL B CG1 1 
ATOM   7219 C CG2 . VAL B 1 402 ? 13.772  -3.055  -24.727 1.00 37.86 ? 402  VAL B CG2 1 
ATOM   7220 N N   . GLY B 1 403 ? 11.667  0.985   -25.096 1.00 36.82 ? 403  GLY B N   1 
ATOM   7221 C CA  . GLY B 1 403 ? 10.901  2.076   -25.690 1.00 36.39 ? 403  GLY B CA  1 
ATOM   7222 C C   . GLY B 1 403 ? 11.621  3.410   -25.557 1.00 36.44 ? 403  GLY B C   1 
ATOM   7223 O O   . GLY B 1 403 ? 11.612  4.231   -26.486 1.00 36.19 ? 403  GLY B O   1 
ATOM   7224 N N   . ASP B 1 404 ? 12.247  3.620   -24.401 1.00 35.87 ? 404  ASP B N   1 
ATOM   7225 C CA  . ASP B 1 404 ? 12.938  4.866   -24.121 1.00 35.74 ? 404  ASP B CA  1 
ATOM   7226 C C   . ASP B 1 404 ? 14.188  4.954   -24.975 1.00 35.34 ? 404  ASP B C   1 
ATOM   7227 O O   . ASP B 1 404 ? 14.398  5.930   -25.680 1.00 35.44 ? 404  ASP B O   1 
ATOM   7228 C CB  . ASP B 1 404 ? 13.301  4.985   -22.626 1.00 35.78 ? 404  ASP B CB  1 
ATOM   7229 C CG  . ASP B 1 404 ? 12.075  5.050   -21.714 1.00 35.50 ? 404  ASP B CG  1 
ATOM   7230 O OD1 . ASP B 1 404 ? 10.958  5.282   -22.218 1.00 36.42 ? 404  ASP B OD1 1 
ATOM   7231 O OD2 . ASP B 1 404 ? 12.234  4.886   -20.479 1.00 36.50 ? 404  ASP B OD2 1 
ATOM   7232 N N   . HIS B 1 405 ? 15.008  3.917   -24.911 1.00 35.33 ? 405  HIS B N   1 
ATOM   7233 C CA  . HIS B 1 405 ? 16.265  3.870   -25.636 1.00 35.59 ? 405  HIS B CA  1 
ATOM   7234 C C   . HIS B 1 405 ? 16.010  4.096   -27.128 1.00 35.81 ? 405  HIS B C   1 
ATOM   7235 O O   . HIS B 1 405 ? 16.681  4.910   -27.757 1.00 36.73 ? 405  HIS B O   1 
ATOM   7236 C CB  . HIS B 1 405 ? 16.938  2.521   -25.366 1.00 35.33 ? 405  HIS B CB  1 
ATOM   7237 C CG  . HIS B 1 405 ? 18.183  2.259   -26.161 1.00 35.77 ? 405  HIS B CG  1 
ATOM   7238 N ND1 . HIS B 1 405 ? 19.219  3.167   -26.263 1.00 36.55 ? 405  HIS B ND1 1 
ATOM   7239 C CD2 . HIS B 1 405 ? 18.584  1.152   -26.837 1.00 35.56 ? 405  HIS B CD2 1 
ATOM   7240 C CE1 . HIS B 1 405 ? 20.192  2.643   -26.991 1.00 36.90 ? 405  HIS B CE1 1 
ATOM   7241 N NE2 . HIS B 1 405 ? 19.829  1.421   -27.353 1.00 37.73 ? 405  HIS B NE2 1 
ATOM   7242 N N   . ASN B 1 406 ? 15.015  3.409   -27.674 1.00 35.23 ? 406  ASN B N   1 
ATOM   7243 C CA  . ASN B 1 406 ? 14.792  3.404   -29.110 1.00 34.82 ? 406  ASN B CA  1 
ATOM   7244 C C   . ASN B 1 406 ? 13.849  4.479   -29.610 1.00 34.44 ? 406  ASN B C   1 
ATOM   7245 O O   . ASN B 1 406 ? 14.014  4.968   -30.717 1.00 34.69 ? 406  ASN B O   1 
ATOM   7246 C CB  . ASN B 1 406 ? 14.300  2.029   -29.563 1.00 34.72 ? 406  ASN B CB  1 
ATOM   7247 C CG  . ASN B 1 406 ? 15.367  0.968   -29.424 1.00 34.09 ? 406  ASN B CG  1 
ATOM   7248 O OD1 . ASN B 1 406 ? 16.314  0.926   -30.199 1.00 33.22 ? 406  ASN B OD1 1 
ATOM   7249 N ND2 . ASN B 1 406 ? 15.226  0.115   -28.426 1.00 34.57 ? 406  ASN B ND2 1 
ATOM   7250 N N   . VAL B 1 407 ? 12.854  4.852   -28.819 1.00 33.77 ? 407  VAL B N   1 
ATOM   7251 C CA  . VAL B 1 407 ? 11.890  5.826   -29.331 1.00 33.52 ? 407  VAL B CA  1 
ATOM   7252 C C   . VAL B 1 407 ? 11.762  7.128   -28.517 1.00 33.30 ? 407  VAL B C   1 
ATOM   7253 O O   . VAL B 1 407 ? 12.182  8.194   -28.983 1.00 33.50 ? 407  VAL B O   1 
ATOM   7254 C CB  . VAL B 1 407 ? 10.500  5.191   -29.594 1.00 33.45 ? 407  VAL B CB  1 
ATOM   7255 C CG1 . VAL B 1 407 ? 9.558   6.238   -30.168 1.00 33.41 ? 407  VAL B CG1 1 
ATOM   7256 C CG2 . VAL B 1 407 ? 10.626  3.995   -30.534 1.00 32.03 ? 407  VAL B CG2 1 
ATOM   7257 N N   . VAL B 1 408 ? 11.197  7.032   -27.316 1.00 32.69 ? 408  VAL B N   1 
ATOM   7258 C CA  . VAL B 1 408 ? 10.819  8.197   -26.534 1.00 32.22 ? 408  VAL B CA  1 
ATOM   7259 C C   . VAL B 1 408 ? 11.997  9.164   -26.385 1.00 32.33 ? 408  VAL B C   1 
ATOM   7260 O O   . VAL B 1 408 ? 11.870  10.349  -26.672 1.00 31.99 ? 408  VAL B O   1 
ATOM   7261 C CB  . VAL B 1 408 ? 10.254  7.809   -25.143 1.00 32.19 ? 408  VAL B CB  1 
ATOM   7262 C CG1 . VAL B 1 408 ? 9.547   8.995   -24.514 1.00 31.80 ? 408  VAL B CG1 1 
ATOM   7263 C CG2 . VAL B 1 408 ? 9.290   6.649   -25.257 1.00 30.83 ? 408  VAL B CG2 1 
ATOM   7264 N N   . CYS B 1 409 ? 13.153  8.661   -25.986 1.00 32.51 ? 409  CYS B N   1 
ATOM   7265 C CA  . CYS B 1 409 ? 14.269  9.558   -25.795 1.00 33.28 ? 409  CYS B CA  1 
ATOM   7266 C C   . CYS B 1 409 ? 14.889  10.093  -27.109 1.00 33.56 ? 409  CYS B C   1 
ATOM   7267 O O   . CYS B 1 409 ? 15.183  11.271  -27.194 1.00 33.81 ? 409  CYS B O   1 
ATOM   7268 C CB  . CYS B 1 409 ? 15.271  8.997   -24.793 1.00 33.26 ? 409  CYS B CB  1 
ATOM   7269 S SG  . CYS B 1 409 ? 14.540  8.758   -23.128 1.00 35.90 ? 409  CYS B SG  1 
ATOM   7270 N N   . PRO B 1 410 ? 15.085  9.250   -28.136 1.00 33.72 ? 410  PRO B N   1 
ATOM   7271 C CA  . PRO B 1 410 ? 15.391  9.893   -29.410 1.00 33.70 ? 410  PRO B CA  1 
ATOM   7272 C C   . PRO B 1 410 ? 14.372  10.933  -29.854 1.00 34.22 ? 410  PRO B C   1 
ATOM   7273 O O   . PRO B 1 410 ? 14.775  11.971  -30.403 1.00 34.75 ? 410  PRO B O   1 
ATOM   7274 C CB  . PRO B 1 410 ? 15.427  8.733   -30.394 1.00 32.97 ? 410  PRO B CB  1 
ATOM   7275 C CG  . PRO B 1 410 ? 15.842  7.600   -29.584 1.00 33.71 ? 410  PRO B CG  1 
ATOM   7276 C CD  . PRO B 1 410 ? 15.174  7.786   -28.241 1.00 33.69 ? 410  PRO B CD  1 
ATOM   7277 N N   . VAL B 1 411 ? 13.079  10.666  -29.642 1.00 34.24 ? 411  VAL B N   1 
ATOM   7278 C CA  . VAL B 1 411 ? 12.035  11.642  -29.994 1.00 34.29 ? 411  VAL B CA  1 
ATOM   7279 C C   . VAL B 1 411 ? 12.147  12.939  -29.174 1.00 34.32 ? 411  VAL B C   1 
ATOM   7280 O O   . VAL B 1 411 ? 12.002  14.014  -29.718 1.00 34.09 ? 411  VAL B O   1 
ATOM   7281 C CB  . VAL B 1 411 ? 10.611  11.053  -29.894 1.00 34.19 ? 411  VAL B CB  1 
ATOM   7282 C CG1 . VAL B 1 411 ? 9.567   12.148  -29.854 1.00 33.04 ? 411  VAL B CG1 1 
ATOM   7283 C CG2 . VAL B 1 411 ? 10.340  10.137  -31.062 1.00 34.44 ? 411  VAL B CG2 1 
ATOM   7284 N N   . ALA B 1 412 ? 12.401  12.816  -27.875 1.00 34.60 ? 412  ALA B N   1 
ATOM   7285 C CA  . ALA B 1 412 ? 12.582  13.966  -26.985 1.00 35.15 ? 412  ALA B CA  1 
ATOM   7286 C C   . ALA B 1 412 ? 13.812  14.773  -27.437 1.00 35.69 ? 412  ALA B C   1 
ATOM   7287 O O   . ALA B 1 412 ? 13.772  16.002  -27.549 1.00 35.40 ? 412  ALA B O   1 
ATOM   7288 C CB  . ALA B 1 412 ? 12.753  13.485  -25.543 1.00 34.65 ? 412  ALA B CB  1 
ATOM   7289 N N   . GLN B 1 413 ? 14.885  14.042  -27.713 1.00 35.79 ? 413  GLN B N   1 
ATOM   7290 C CA  . GLN B 1 413 ? 16.115  14.583  -28.255 1.00 36.91 ? 413  GLN B CA  1 
ATOM   7291 C C   . GLN B 1 413 ? 15.885  15.378  -29.542 1.00 36.43 ? 413  GLN B C   1 
ATOM   7292 O O   . GLN B 1 413 ? 16.353  16.516  -29.652 1.00 36.62 ? 413  GLN B O   1 
ATOM   7293 C CB  . GLN B 1 413 ? 17.101  13.438  -28.476 1.00 37.24 ? 413  GLN B CB  1 
ATOM   7294 C CG  . GLN B 1 413 ? 18.154  13.709  -29.498 1.00 41.57 ? 413  GLN B CG  1 
ATOM   7295 C CD  . GLN B 1 413 ? 19.493  13.898  -28.876 1.00 46.63 ? 413  GLN B CD  1 
ATOM   7296 O OE1 . GLN B 1 413 ? 19.670  14.744  -27.986 1.00 49.64 ? 413  GLN B OE1 1 
ATOM   7297 N NE2 . GLN B 1 413 ? 20.463  13.101  -29.328 1.00 47.67 ? 413  GLN B NE2 1 
ATOM   7298 N N   . LEU B 1 414 ? 15.155  14.789  -30.493 1.00 35.98 ? 414  LEU B N   1 
ATOM   7299 C CA  . LEU B 1 414 ? 14.787  15.470  -31.735 1.00 35.40 ? 414  LEU B CA  1 
ATOM   7300 C C   . LEU B 1 414 ? 13.910  16.699  -31.501 1.00 35.42 ? 414  LEU B C   1 
ATOM   7301 O O   . LEU B 1 414 ? 14.178  17.775  -32.040 1.00 35.25 ? 414  LEU B O   1 
ATOM   7302 C CB  . LEU B 1 414 ? 14.052  14.517  -32.679 1.00 35.84 ? 414  LEU B CB  1 
ATOM   7303 C CG  . LEU B 1 414 ? 13.799  15.062  -34.090 1.00 35.07 ? 414  LEU B CG  1 
ATOM   7304 C CD1 . LEU B 1 414 ? 15.107  15.107  -34.851 1.00 35.85 ? 414  LEU B CD1 1 
ATOM   7305 C CD2 . LEU B 1 414 ? 12.801  14.245  -34.820 1.00 33.63 ? 414  LEU B CD2 1 
ATOM   7306 N N   . ALA B 1 415 ? 12.855  16.531  -30.708 1.00 35.37 ? 415  ALA B N   1 
ATOM   7307 C CA  . ALA B 1 415 ? 11.941  17.620  -30.406 1.00 35.78 ? 415  ALA B CA  1 
ATOM   7308 C C   . ALA B 1 415 ? 12.707  18.819  -29.841 1.00 36.45 ? 415  ALA B C   1 
ATOM   7309 O O   . ALA B 1 415 ? 12.515  19.945  -30.279 1.00 36.44 ? 415  ALA B O   1 
ATOM   7310 C CB  . ALA B 1 415 ? 10.887  17.161  -29.443 1.00 35.56 ? 415  ALA B CB  1 
ATOM   7311 N N   . GLY B 1 416 ? 13.594  18.551  -28.889 1.00 37.40 ? 416  GLY B N   1 
ATOM   7312 C CA  . GLY B 1 416 ? 14.435  19.565  -28.280 1.00 38.89 ? 416  GLY B CA  1 
ATOM   7313 C C   . GLY B 1 416 ? 15.296  20.295  -29.287 1.00 40.02 ? 416  GLY B C   1 
ATOM   7314 O O   . GLY B 1 416 ? 15.250  21.534  -29.369 1.00 40.29 ? 416  GLY B O   1 
ATOM   7315 N N   . ARG B 1 417 ? 16.067  19.540  -30.071 1.00 40.30 ? 417  ARG B N   1 
ATOM   7316 C CA  . ARG B 1 417 ? 16.971  20.162  -31.023 1.00 40.59 ? 417  ARG B CA  1 
ATOM   7317 C C   . ARG B 1 417 ? 16.201  20.974  -32.059 1.00 40.27 ? 417  ARG B C   1 
ATOM   7318 O O   . ARG B 1 417 ? 16.556  22.117  -32.336 1.00 40.07 ? 417  ARG B O   1 
ATOM   7319 C CB  . ARG B 1 417 ? 17.895  19.141  -31.687 1.00 41.46 ? 417  ARG B CB  1 
ATOM   7320 C CG  . ARG B 1 417 ? 18.943  18.474  -30.773 1.00 44.07 ? 417  ARG B CG  1 
ATOM   7321 C CD  . ARG B 1 417 ? 19.498  19.389  -29.666 1.00 51.44 ? 417  ARG B CD  1 
ATOM   7322 N NE  . ARG B 1 417 ? 20.217  20.568  -30.167 1.00 56.89 ? 417  ARG B NE  1 
ATOM   7323 C CZ  . ARG B 1 417 ? 21.516  20.815  -29.958 1.00 60.09 ? 417  ARG B CZ  1 
ATOM   7324 N NH1 . ARG B 1 417 ? 22.269  19.971  -29.249 1.00 60.12 ? 417  ARG B NH1 1 
ATOM   7325 N NH2 . ARG B 1 417 ? 22.069  21.917  -30.460 1.00 60.66 ? 417  ARG B NH2 1 
ATOM   7326 N N   . LEU B 1 418 ? 15.131  20.399  -32.603 1.00 40.05 ? 418  LEU B N   1 
ATOM   7327 C CA  . LEU B 1 418 ? 14.327  21.091  -33.616 1.00 39.66 ? 418  LEU B CA  1 
ATOM   7328 C C   . LEU B 1 418 ? 13.777  22.418  -33.089 1.00 40.05 ? 418  LEU B C   1 
ATOM   7329 O O   . LEU B 1 418 ? 13.841  23.444  -33.777 1.00 39.99 ? 418  LEU B O   1 
ATOM   7330 C CB  . LEU B 1 418 ? 13.181  20.206  -34.112 1.00 39.45 ? 418  LEU B CB  1 
ATOM   7331 C CG  . LEU B 1 418 ? 13.442  18.954  -34.952 1.00 38.60 ? 418  LEU B CG  1 
ATOM   7332 C CD1 . LEU B 1 418 ? 12.118  18.342  -35.321 1.00 38.44 ? 418  LEU B CD1 1 
ATOM   7333 C CD2 . LEU B 1 418 ? 14.216  19.269  -36.201 1.00 37.32 ? 418  LEU B CD2 1 
ATOM   7334 N N   . ALA B 1 419 ? 13.252  22.392  -31.861 1.00 40.37 ? 419  ALA B N   1 
ATOM   7335 C CA  . ALA B 1 419 ? 12.660  23.574  -31.236 1.00 40.85 ? 419  ALA B CA  1 
ATOM   7336 C C   . ALA B 1 419 ? 13.697  24.674  -30.944 1.00 41.34 ? 419  ALA B C   1 
ATOM   7337 O O   . ALA B 1 419 ? 13.458  25.859  -31.222 1.00 41.62 ? 419  ALA B O   1 
ATOM   7338 C CB  . ALA B 1 419 ? 11.919  23.182  -29.970 1.00 40.76 ? 419  ALA B CB  1 
ATOM   7339 N N   . ALA B 1 420 ? 14.840  24.266  -30.390 1.00 41.65 ? 420  ALA B N   1 
ATOM   7340 C CA  . ALA B 1 420 ? 15.968  25.148  -30.161 1.00 42.17 ? 420  ALA B CA  1 
ATOM   7341 C C   . ALA B 1 420 ? 16.388  25.826  -31.461 1.00 42.67 ? 420  ALA B C   1 
ATOM   7342 O O   . ALA B 1 420 ? 16.710  27.020  -31.465 1.00 43.68 ? 420  ALA B O   1 
ATOM   7343 C CB  . ALA B 1 420 ? 17.140  24.367  -29.581 1.00 42.14 ? 420  ALA B CB  1 
ATOM   7344 N N   . GLN B 1 421 ? 16.354  25.078  -32.563 1.00 42.21 ? 421  GLN B N   1 
ATOM   7345 C CA  . GLN B 1 421 ? 16.956  25.531  -33.800 1.00 41.78 ? 421  GLN B CA  1 
ATOM   7346 C C   . GLN B 1 421 ? 15.954  26.042  -34.813 1.00 41.74 ? 421  GLN B C   1 
ATOM   7347 O O   . GLN B 1 421 ? 16.182  25.986  -36.021 1.00 41.94 ? 421  GLN B O   1 
ATOM   7348 C CB  . GLN B 1 421 ? 17.907  24.464  -34.351 1.00 42.29 ? 421  GLN B CB  1 
ATOM   7349 C CG  . GLN B 1 421 ? 19.190  24.392  -33.501 1.00 42.45 ? 421  GLN B CG  1 
ATOM   7350 C CD  . GLN B 1 421 ? 19.780  23.009  -33.410 1.00 43.67 ? 421  GLN B CD  1 
ATOM   7351 O OE1 . GLN B 1 421 ? 20.026  22.489  -32.314 1.00 45.38 ? 421  GLN B OE1 1 
ATOM   7352 N NE2 . GLN B 1 421 ? 20.025  22.403  -34.555 1.00 44.35 ? 421  GLN B NE2 1 
ATOM   7353 N N   . GLY B 1 422 ? 14.834  26.543  -34.297 1.00 42.03 ? 422  GLY B N   1 
ATOM   7354 C CA  . GLY B 1 422 ? 13.928  27.380  -35.062 1.00 41.67 ? 422  GLY B CA  1 
ATOM   7355 C C   . GLY B 1 422 ? 12.659  26.735  -35.572 1.00 41.86 ? 422  GLY B C   1 
ATOM   7356 O O   . GLY B 1 422 ? 11.772  27.448  -36.070 1.00 41.92 ? 422  GLY B O   1 
ATOM   7357 N N   . ALA B 1 423 ? 12.555  25.405  -35.475 1.00 40.94 ? 423  ALA B N   1 
ATOM   7358 C CA  . ALA B 1 423 ? 11.337  24.740  -35.930 1.00 40.34 ? 423  ALA B CA  1 
ATOM   7359 C C   . ALA B 1 423 ? 10.143  25.082  -35.045 1.00 40.32 ? 423  ALA B C   1 
ATOM   7360 O O   . ALA B 1 423 ? 10.289  25.514  -33.908 1.00 40.04 ? 423  ALA B O   1 
ATOM   7361 C CB  . ALA B 1 423 ? 11.525  23.246  -36.003 1.00 40.20 ? 423  ALA B CB  1 
ATOM   7362 N N   . ARG B 1 424 ? 8.954   24.890  -35.586 1.00 40.29 ? 424  ARG B N   1 
ATOM   7363 C CA  . ARG B 1 424 ? 7.750   24.886  -34.784 1.00 40.31 ? 424  ARG B CA  1 
ATOM   7364 C C   . ARG B 1 424 ? 7.455   23.406  -34.530 1.00 39.40 ? 424  ARG B C   1 
ATOM   7365 O O   . ARG B 1 424 ? 7.354   22.634  -35.471 1.00 39.47 ? 424  ARG B O   1 
ATOM   7366 C CB  . ARG B 1 424 ? 6.649   25.538  -35.600 1.00 41.07 ? 424  ARG B CB  1 
ATOM   7367 C CG  . ARG B 1 424 ? 5.292   25.544  -34.974 1.00 44.59 ? 424  ARG B CG  1 
ATOM   7368 C CD  . ARG B 1 424 ? 4.339   26.398  -35.835 1.00 50.19 ? 424  ARG B CD  1 
ATOM   7369 N NE  . ARG B 1 424 ? 3.511   27.235  -34.976 1.00 52.12 ? 424  ARG B NE  1 
ATOM   7370 C CZ  . ARG B 1 424 ? 4.006   28.123  -34.130 1.00 52.16 ? 424  ARG B CZ  1 
ATOM   7371 N NH1 . ARG B 1 424 ? 5.319   28.293  -34.018 1.00 53.66 ? 424  ARG B NH1 1 
ATOM   7372 N NH2 . ARG B 1 424 ? 3.189   28.831  -33.393 1.00 52.74 ? 424  ARG B NH2 1 
ATOM   7373 N N   . VAL B 1 425 ? 7.361   23.004  -33.269 1.00 38.42 ? 425  VAL B N   1 
ATOM   7374 C CA  . VAL B 1 425 ? 7.250   21.583  -32.927 1.00 37.28 ? 425  VAL B CA  1 
ATOM   7375 C C   . VAL B 1 425 ? 6.037   21.349  -32.055 1.00 37.07 ? 425  VAL B C   1 
ATOM   7376 O O   . VAL B 1 425 ? 5.799   22.088  -31.116 1.00 37.37 ? 425  VAL B O   1 
ATOM   7377 C CB  . VAL B 1 425 ? 8.521   21.041  -32.187 1.00 37.08 ? 425  VAL B CB  1 
ATOM   7378 C CG1 . VAL B 1 425 ? 8.417   19.540  -31.914 1.00 35.60 ? 425  VAL B CG1 1 
ATOM   7379 C CG2 . VAL B 1 425 ? 9.772   21.324  -32.991 1.00 36.33 ? 425  VAL B CG2 1 
ATOM   7380 N N   . TYR B 1 426 ? 5.282   20.306  -32.369 1.00 36.20 ? 426  TYR B N   1 
ATOM   7381 C CA  . TYR B 1 426 ? 4.176   19.881  -31.546 1.00 35.05 ? 426  TYR B CA  1 
ATOM   7382 C C   . TYR B 1 426 ? 4.410   18.442  -31.165 1.00 34.70 ? 426  TYR B C   1 
ATOM   7383 O O   . TYR B 1 426 ? 4.755   17.629  -32.006 1.00 34.94 ? 426  TYR B O   1 
ATOM   7384 C CB  . TYR B 1 426 ? 2.884   19.996  -32.328 1.00 34.82 ? 426  TYR B CB  1 
ATOM   7385 C CG  . TYR B 1 426 ? 2.500   21.415  -32.646 1.00 34.05 ? 426  TYR B CG  1 
ATOM   7386 C CD1 . TYR B 1 426 ? 2.870   21.992  -33.846 1.00 31.96 ? 426  TYR B CD1 1 
ATOM   7387 C CD2 . TYR B 1 426 ? 1.756   22.178  -31.736 1.00 32.31 ? 426  TYR B CD2 1 
ATOM   7388 C CE1 . TYR B 1 426 ? 2.513   23.284  -34.144 1.00 32.35 ? 426  TYR B CE1 1 
ATOM   7389 C CE2 . TYR B 1 426 ? 1.402   23.470  -32.023 1.00 31.58 ? 426  TYR B CE2 1 
ATOM   7390 C CZ  . TYR B 1 426 ? 1.782   24.014  -33.227 1.00 33.20 ? 426  TYR B CZ  1 
ATOM   7391 O OH  . TYR B 1 426 ? 1.440   25.308  -33.527 1.00 35.39 ? 426  TYR B OH  1 
ATOM   7392 N N   . ALA B 1 427 ? 4.236   18.125  -29.896 1.00 34.28 ? 427  ALA B N   1 
ATOM   7393 C CA  . ALA B 1 427 ? 4.543   16.796  -29.440 1.00 34.37 ? 427  ALA B CA  1 
ATOM   7394 C C   . ALA B 1 427 ? 3.340   16.127  -28.780 1.00 34.52 ? 427  ALA B C   1 
ATOM   7395 O O   . ALA B 1 427 ? 2.452   16.795  -28.243 1.00 34.43 ? 427  ALA B O   1 
ATOM   7396 C CB  . ALA B 1 427 ? 5.750   16.820  -28.519 1.00 34.09 ? 427  ALA B CB  1 
ATOM   7397 N N   . TYR B 1 428 ? 3.303   14.799  -28.837 1.00 34.23 ? 428  TYR B N   1 
ATOM   7398 C CA  . TYR B 1 428 ? 2.191   14.069  -28.259 1.00 33.70 ? 428  TYR B CA  1 
ATOM   7399 C C   . TYR B 1 428 ? 2.670   12.769  -27.638 1.00 34.32 ? 428  TYR B C   1 
ATOM   7400 O O   . TYR B 1 428 ? 3.795   12.325  -27.876 1.00 33.46 ? 428  TYR B O   1 
ATOM   7401 C CB  . TYR B 1 428 ? 1.098   13.805  -29.306 1.00 33.33 ? 428  TYR B CB  1 
ATOM   7402 C CG  . TYR B 1 428 ? 1.517   12.838  -30.391 1.00 33.16 ? 428  TYR B CG  1 
ATOM   7403 C CD1 . TYR B 1 428 ? 1.558   11.459  -30.146 1.00 32.43 ? 428  TYR B CD1 1 
ATOM   7404 C CD2 . TYR B 1 428 ? 1.904   13.298  -31.649 1.00 31.92 ? 428  TYR B CD2 1 
ATOM   7405 C CE1 . TYR B 1 428 ? 1.960   10.566  -31.118 1.00 31.98 ? 428  TYR B CE1 1 
ATOM   7406 C CE2 . TYR B 1 428 ? 2.304   12.413  -32.637 1.00 32.67 ? 428  TYR B CE2 1 
ATOM   7407 C CZ  . TYR B 1 428 ? 2.332   11.046  -32.356 1.00 33.88 ? 428  TYR B CZ  1 
ATOM   7408 O OH  . TYR B 1 428 ? 2.745   10.157  -33.316 1.00 34.85 ? 428  TYR B OH  1 
ATOM   7409 N N   . ILE B 1 429 ? 1.807   12.190  -26.805 1.00 35.03 ? 429  ILE B N   1 
ATOM   7410 C CA  . ILE B 1 429 ? 1.922   10.815  -26.393 1.00 35.80 ? 429  ILE B CA  1 
ATOM   7411 C C   . ILE B 1 429 ? 0.554   10.190  -26.623 1.00 36.52 ? 429  ILE B C   1 
ATOM   7412 O O   . ILE B 1 429 ? -0.480  10.775  -26.272 1.00 36.98 ? 429  ILE B O   1 
ATOM   7413 C CB  . ILE B 1 429 ? 2.388   10.671  -24.936 1.00 36.11 ? 429  ILE B CB  1 
ATOM   7414 C CG1 . ILE B 1 429 ? 2.565   9.197   -24.576 1.00 36.70 ? 429  ILE B CG1 1 
ATOM   7415 C CG2 . ILE B 1 429 ? 1.425   11.340  -23.978 1.00 36.91 ? 429  ILE B CG2 1 
ATOM   7416 C CD1 . ILE B 1 429 ? 3.170   8.973   -23.201 1.00 38.50 ? 429  ILE B CD1 1 
ATOM   7417 N N   . PHE B 1 430 ? 0.545   9.014   -27.241 1.00 36.70 ? 430  PHE B N   1 
ATOM   7418 C CA  . PHE B 1 430 ? -0.696  8.356   -27.585 1.00 36.97 ? 430  PHE B CA  1 
ATOM   7419 C C   . PHE B 1 430 ? -0.951  7.275   -26.556 1.00 37.33 ? 430  PHE B C   1 
ATOM   7420 O O   . PHE B 1 430 ? -0.088  6.435   -26.326 1.00 37.26 ? 430  PHE B O   1 
ATOM   7421 C CB  . PHE B 1 430 ? -0.582  7.776   -28.985 1.00 36.74 ? 430  PHE B CB  1 
ATOM   7422 C CG  . PHE B 1 430 ? -1.846  7.208   -29.497 1.00 36.24 ? 430  PHE B CG  1 
ATOM   7423 C CD1 . PHE B 1 430 ? -2.177  5.874   -29.245 1.00 36.47 ? 430  PHE B CD1 1 
ATOM   7424 C CD2 . PHE B 1 430 ? -2.713  7.988   -30.246 1.00 35.33 ? 430  PHE B CD2 1 
ATOM   7425 C CE1 . PHE B 1 430 ? -3.363  5.344   -29.732 1.00 35.92 ? 430  PHE B CE1 1 
ATOM   7426 C CE2 . PHE B 1 430 ? -3.902  7.461   -30.737 1.00 33.81 ? 430  PHE B CE2 1 
ATOM   7427 C CZ  . PHE B 1 430 ? -4.228  6.148   -30.473 1.00 35.08 ? 430  PHE B CZ  1 
ATOM   7428 N N   . GLU B 1 431 ? -2.126  7.299   -25.929 1.00 38.09 ? 431  GLU B N   1 
ATOM   7429 C CA  . GLU B 1 431 ? -2.352  6.492   -24.716 1.00 39.31 ? 431  GLU B CA  1 
ATOM   7430 C C   . GLU B 1 431 ? -3.642  5.671   -24.745 1.00 39.99 ? 431  GLU B C   1 
ATOM   7431 O O   . GLU B 1 431 ? -3.997  5.031   -23.751 1.00 39.97 ? 431  GLU B O   1 
ATOM   7432 C CB  . GLU B 1 431 ? -2.391  7.382   -23.471 1.00 38.87 ? 431  GLU B CB  1 
ATOM   7433 C CG  . GLU B 1 431 ? -1.138  8.146   -23.160 1.00 39.47 ? 431  GLU B CG  1 
ATOM   7434 C CD  . GLU B 1 431 ? -1.214  8.851   -21.815 1.00 40.24 ? 431  GLU B CD  1 
ATOM   7435 O OE1 . GLU B 1 431 ? -2.223  9.574   -21.573 1.00 40.46 ? 431  GLU B OE1 1 
ATOM   7436 O OE2 . GLU B 1 431 ? -0.254  8.682   -21.014 1.00 41.52 ? 431  GLU B OE2 1 
ATOM   7437 N N   . HIS B 1 432 ? -4.358  5.715   -25.858 1.00 40.61 ? 432  HIS B N   1 
ATOM   7438 C CA  . HIS B 1 432 ? -5.515  4.867   -25.999 1.00 41.69 ? 432  HIS B CA  1 
ATOM   7439 C C   . HIS B 1 432 ? -5.170  3.497   -26.600 1.00 42.12 ? 432  HIS B C   1 
ATOM   7440 O O   . HIS B 1 432 ? -4.740  3.396   -27.749 1.00 41.87 ? 432  HIS B O   1 
ATOM   7441 C CB  . HIS B 1 432 ? -6.577  5.541   -26.845 1.00 41.73 ? 432  HIS B CB  1 
ATOM   7442 C CG  . HIS B 1 432 ? -7.735  4.648   -27.137 1.00 43.01 ? 432  HIS B CG  1 
ATOM   7443 N ND1 . HIS B 1 432 ? -8.617  4.239   -26.161 1.00 44.18 ? 432  HIS B ND1 1 
ATOM   7444 C CD2 . HIS B 1 432 ? -8.132  4.048   -28.285 1.00 43.64 ? 432  HIS B CD2 1 
ATOM   7445 C CE1 . HIS B 1 432 ? -9.529  3.450   -26.703 1.00 43.87 ? 432  HIS B CE1 1 
ATOM   7446 N NE2 . HIS B 1 432 ? -9.257  3.320   -27.990 1.00 43.97 ? 432  HIS B NE2 1 
ATOM   7447 N N   . ARG B 1 433 ? -5.375  2.446   -25.814 1.00 42.80 ? 433  ARG B N   1 
ATOM   7448 C CA  . ARG B 1 433 ? -5.305  1.090   -26.333 1.00 43.58 ? 433  ARG B CA  1 
ATOM   7449 C C   . ARG B 1 433 ? -6.584  0.785   -27.107 1.00 43.90 ? 433  ARG B C   1 
ATOM   7450 O O   . ARG B 1 433 ? -7.670  0.790   -26.538 1.00 44.03 ? 433  ARG B O   1 
ATOM   7451 C CB  . ARG B 1 433 ? -5.132  0.092   -25.200 1.00 43.41 ? 433  ARG B CB  1 
ATOM   7452 C CG  . ARG B 1 433 ? -4.806  -1.311  -25.668 1.00 44.67 ? 433  ARG B CG  1 
ATOM   7453 C CD  . ARG B 1 433 ? -4.692  -2.232  -24.483 1.00 44.95 ? 433  ARG B CD  1 
ATOM   7454 N NE  . ARG B 1 433 ? -5.043  -3.619  -24.789 1.00 45.04 ? 433  ARG B NE  1 
ATOM   7455 C CZ  . ARG B 1 433 ? -4.151  -4.593  -24.934 1.00 46.30 ? 433  ARG B CZ  1 
ATOM   7456 N NH1 . ARG B 1 433 ? -2.845  -4.342  -24.837 1.00 45.74 ? 433  ARG B NH1 1 
ATOM   7457 N NH2 . ARG B 1 433 ? -4.562  -5.825  -25.180 1.00 46.35 ? 433  ARG B NH2 1 
ATOM   7458 N N   . ALA B 1 434 ? -6.438  0.548   -28.408 1.00 44.64 ? 434  ALA B N   1 
ATOM   7459 C CA  . ALA B 1 434 ? -7.527  0.110   -29.273 1.00 45.19 ? 434  ALA B CA  1 
ATOM   7460 C C   . ALA B 1 434 ? -8.223  -1.077  -28.636 1.00 45.67 ? 434  ALA B C   1 
ATOM   7461 O O   . ALA B 1 434 ? -7.568  -2.019  -28.182 1.00 45.70 ? 434  ALA B O   1 
ATOM   7462 C CB  . ALA B 1 434 ? -6.986  -0.283  -30.633 1.00 45.17 ? 434  ALA B CB  1 
ATOM   7463 N N   . SER B 1 435 ? -9.550  -1.013  -28.600 1.00 46.15 ? 435  SER B N   1 
ATOM   7464 C CA  . SER B 1 435 ? -10.381 -2.054  -28.005 1.00 46.58 ? 435  SER B CA  1 
ATOM   7465 C C   . SER B 1 435 ? -10.232 -3.389  -28.737 1.00 46.90 ? 435  SER B C   1 
ATOM   7466 O O   . SER B 1 435 ? -10.341 -4.457  -28.127 1.00 46.32 ? 435  SER B O   1 
ATOM   7467 C CB  . SER B 1 435 ? -11.840 -1.614  -28.025 1.00 46.31 ? 435  SER B CB  1 
ATOM   7468 O OG  . SER B 1 435 ? -12.236 -1.348  -29.356 1.00 46.47 ? 435  SER B OG  1 
ATOM   7469 N N   . THR B 1 436 ? -9.958  -3.301  -30.039 1.00 47.61 ? 436  THR B N   1 
ATOM   7470 C CA  . THR B 1 436 ? -9.795  -4.469  -30.913 1.00 48.62 ? 436  THR B CA  1 
ATOM   7471 C C   . THR B 1 436 ? -8.387  -5.098  -30.895 1.00 48.99 ? 436  THR B C   1 
ATOM   7472 O O   . THR B 1 436 ? -8.115  -6.041  -31.658 1.00 49.65 ? 436  THR B O   1 
ATOM   7473 C CB  . THR B 1 436 ? -10.138 -4.115  -32.360 1.00 48.39 ? 436  THR B CB  1 
ATOM   7474 O OG1 . THR B 1 436 ? -9.224  -3.116  -32.834 1.00 49.37 ? 436  THR B OG1 1 
ATOM   7475 C CG2 . THR B 1 436 ? -11.556 -3.574  -32.452 1.00 49.50 ? 436  THR B CG2 1 
ATOM   7476 N N   . LEU B 1 437 ? -7.505  -4.592  -30.031 1.00 48.79 ? 437  LEU B N   1 
ATOM   7477 C CA  . LEU B 1 437 ? -6.127  -5.061  -29.981 1.00 48.49 ? 437  LEU B CA  1 
ATOM   7478 C C   . LEU B 1 437 ? -6.078  -6.527  -29.637 1.00 48.37 ? 437  LEU B C   1 
ATOM   7479 O O   . LEU B 1 437 ? -6.686  -6.964  -28.666 1.00 48.59 ? 437  LEU B O   1 
ATOM   7480 C CB  . LEU B 1 437 ? -5.293  -4.278  -28.964 1.00 48.45 ? 437  LEU B CB  1 
ATOM   7481 C CG  . LEU B 1 437 ? -3.856  -4.051  -29.439 1.00 48.18 ? 437  LEU B CG  1 
ATOM   7482 C CD1 . LEU B 1 437 ? -3.758  -2.657  -30.016 1.00 48.09 ? 437  LEU B CD1 1 
ATOM   7483 C CD2 . LEU B 1 437 ? -2.875  -4.211  -28.309 1.00 48.36 ? 437  LEU B CD2 1 
ATOM   7484 N N   . THR B 1 438 ? -5.335  -7.282  -30.431 1.00 48.07 ? 438  THR B N   1 
ATOM   7485 C CA  . THR B 1 438 ? -5.243  -8.715  -30.232 1.00 47.73 ? 438  THR B CA  1 
ATOM   7486 C C   . THR B 1 438 ? -4.030  -9.074  -29.380 1.00 46.98 ? 438  THR B C   1 
ATOM   7487 O O   . THR B 1 438 ? -3.871  -10.236 -28.982 1.00 47.18 ? 438  THR B O   1 
ATOM   7488 C CB  . THR B 1 438 ? -5.210  -9.458  -31.588 1.00 48.21 ? 438  THR B CB  1 
ATOM   7489 O OG1 . THR B 1 438 ? -3.973  -9.184  -32.260 1.00 48.89 ? 438  THR B OG1 1 
ATOM   7490 C CG2 . THR B 1 438 ? -6.375  -8.993  -32.482 1.00 48.04 ? 438  THR B CG2 1 
ATOM   7491 N N   . TRP B 1 439 ? -3.176  -8.083  -29.104 1.00 45.80 ? 439  TRP B N   1 
ATOM   7492 C CA  . TRP B 1 439 ? -2.022  -8.281  -28.216 1.00 44.95 ? 439  TRP B CA  1 
ATOM   7493 C C   . TRP B 1 439 ? -2.501  -8.255  -26.770 1.00 45.15 ? 439  TRP B C   1 
ATOM   7494 O O   . TRP B 1 439 ? -3.470  -7.566  -26.465 1.00 45.29 ? 439  TRP B O   1 
ATOM   7495 C CB  . TRP B 1 439 ? -0.965  -7.195  -28.422 1.00 43.90 ? 439  TRP B CB  1 
ATOM   7496 C CG  . TRP B 1 439 ? -0.287  -7.223  -29.755 1.00 42.57 ? 439  TRP B CG  1 
ATOM   7497 C CD1 . TRP B 1 439 ? -0.593  -6.465  -30.848 1.00 40.67 ? 439  TRP B CD1 1 
ATOM   7498 C CD2 . TRP B 1 439 ? 0.828   -8.049  -30.133 1.00 41.04 ? 439  TRP B CD2 1 
ATOM   7499 N NE1 . TRP B 1 439 ? 0.259   -6.775  -31.884 1.00 40.99 ? 439  TRP B NE1 1 
ATOM   7500 C CE2 . TRP B 1 439 ? 1.140   -7.741  -31.470 1.00 40.46 ? 439  TRP B CE2 1 
ATOM   7501 C CE3 . TRP B 1 439 ? 1.582   -9.024  -29.471 1.00 40.19 ? 439  TRP B CE3 1 
ATOM   7502 C CZ2 . TRP B 1 439 ? 2.177   -8.371  -32.158 1.00 41.79 ? 439  TRP B CZ2 1 
ATOM   7503 C CZ3 . TRP B 1 439 ? 2.618   -9.645  -30.151 1.00 41.00 ? 439  TRP B CZ3 1 
ATOM   7504 C CH2 . TRP B 1 439 ? 2.903   -9.318  -31.483 1.00 41.80 ? 439  TRP B CH2 1 
ATOM   7505 N N   . PRO B 1 440 ? -1.812  -8.972  -25.864 1.00 45.25 ? 440  PRO B N   1 
ATOM   7506 C CA  . PRO B 1 440 ? -2.290  -9.040  -24.486 1.00 45.62 ? 440  PRO B CA  1 
ATOM   7507 C C   . PRO B 1 440 ? -2.249  -7.678  -23.790 1.00 46.25 ? 440  PRO B C   1 
ATOM   7508 O O   . PRO B 1 440 ? -1.623  -6.738  -24.292 1.00 46.55 ? 440  PRO B O   1 
ATOM   7509 C CB  . PRO B 1 440 ? -1.302  -9.995  -23.824 1.00 45.28 ? 440  PRO B CB  1 
ATOM   7510 C CG  . PRO B 1 440 ? -0.079  -9.854  -24.629 1.00 45.10 ? 440  PRO B CG  1 
ATOM   7511 C CD  . PRO B 1 440 ? -0.554  -9.711  -26.035 1.00 45.14 ? 440  PRO B CD  1 
ATOM   7512 N N   . LEU B 1 441 ? -2.887  -7.595  -22.628 1.00 46.74 ? 441  LEU B N   1 
ATOM   7513 C CA  . LEU B 1 441 ? -3.029  -6.343  -21.912 1.00 47.51 ? 441  LEU B CA  1 
ATOM   7514 C C   . LEU B 1 441 ? -1.703  -5.708  -21.479 1.00 47.36 ? 441  LEU B C   1 
ATOM   7515 O O   . LEU B 1 441 ? -1.583  -4.477  -21.455 1.00 47.22 ? 441  LEU B O   1 
ATOM   7516 C CB  . LEU B 1 441 ? -3.947  -6.527  -20.705 1.00 48.06 ? 441  LEU B CB  1 
ATOM   7517 C CG  . LEU B 1 441 ? -5.457  -6.601  -20.982 1.00 50.23 ? 441  LEU B CG  1 
ATOM   7518 C CD1 . LEU B 1 441 ? -6.207  -7.228  -19.784 1.00 52.53 ? 441  LEU B CD1 1 
ATOM   7519 C CD2 . LEU B 1 441 ? -6.045  -5.219  -21.342 1.00 51.66 ? 441  LEU B CD2 1 
ATOM   7520 N N   . TRP B 1 442 ? -0.711  -6.537  -21.161 1.00 46.85 ? 442  TRP B N   1 
ATOM   7521 C CA  . TRP B 1 442 ? 0.532   -6.036  -20.567 1.00 46.49 ? 442  TRP B CA  1 
ATOM   7522 C C   . TRP B 1 442 ? 1.393   -5.234  -21.540 1.00 46.17 ? 442  TRP B C   1 
ATOM   7523 O O   . TRP B 1 442 ? 2.321   -4.526  -21.130 1.00 45.96 ? 442  TRP B O   1 
ATOM   7524 C CB  . TRP B 1 442 ? 1.354   -7.177  -19.972 1.00 46.52 ? 442  TRP B CB  1 
ATOM   7525 C CG  . TRP B 1 442 ? 1.981   -8.099  -20.988 1.00 46.94 ? 442  TRP B CG  1 
ATOM   7526 C CD1 . TRP B 1 442 ? 1.489   -9.304  -21.415 1.00 46.97 ? 442  TRP B CD1 1 
ATOM   7527 C CD2 . TRP B 1 442 ? 3.220   -7.901  -21.691 1.00 47.00 ? 442  TRP B CD2 1 
ATOM   7528 N NE1 . TRP B 1 442 ? 2.345   -9.864  -22.335 1.00 47.03 ? 442  TRP B NE1 1 
ATOM   7529 C CE2 . TRP B 1 442 ? 3.413   -9.028  -22.522 1.00 46.85 ? 442  TRP B CE2 1 
ATOM   7530 C CE3 . TRP B 1 442 ? 4.184   -6.882  -21.701 1.00 46.71 ? 442  TRP B CE3 1 
ATOM   7531 C CZ2 . TRP B 1 442 ? 4.533   -9.163  -23.355 1.00 46.83 ? 442  TRP B CZ2 1 
ATOM   7532 C CZ3 . TRP B 1 442 ? 5.292   -7.013  -22.531 1.00 46.29 ? 442  TRP B CZ3 1 
ATOM   7533 C CH2 . TRP B 1 442 ? 5.456   -8.146  -23.347 1.00 46.58 ? 442  TRP B CH2 1 
ATOM   7534 N N   . MET B 1 443 ? 1.103   -5.380  -22.827 1.00 45.61 ? 443  MET B N   1 
ATOM   7535 C CA  . MET B 1 443 ? 1.827   -4.658  -23.866 1.00 45.00 ? 443  MET B CA  1 
ATOM   7536 C C   . MET B 1 443 ? 1.293   -3.226  -23.997 1.00 44.37 ? 443  MET B C   1 
ATOM   7537 O O   . MET B 1 443 ? 1.900   -2.381  -24.649 1.00 44.27 ? 443  MET B O   1 
ATOM   7538 C CB  . MET B 1 443 ? 1.734   -5.404  -25.200 1.00 44.91 ? 443  MET B CB  1 
ATOM   7539 C CG  . MET B 1 443 ? 2.476   -6.730  -25.242 1.00 44.49 ? 443  MET B CG  1 
ATOM   7540 S SD  . MET B 1 443 ? 2.577   -7.288  -26.954 1.00 45.80 ? 443  MET B SD  1 
ATOM   7541 C CE  . MET B 1 443 ? 3.962   -8.405  -26.837 1.00 46.66 ? 443  MET B CE  1 
ATOM   7542 N N   . GLY B 1 444 ? 0.154   -2.974  -23.363 1.00 43.72 ? 444  GLY B N   1 
ATOM   7543 C CA  . GLY B 1 444 ? -0.417  -1.644  -23.288 1.00 43.40 ? 444  GLY B CA  1 
ATOM   7544 C C   . GLY B 1 444 ? -0.758  -1.102  -24.654 1.00 43.18 ? 444  GLY B C   1 
ATOM   7545 O O   . GLY B 1 444 ? -1.464  -1.761  -25.425 1.00 43.51 ? 444  GLY B O   1 
ATOM   7546 N N   . VAL B 1 445 ? -0.274  0.108   -24.939 1.00 42.27 ? 445  VAL B N   1 
ATOM   7547 C CA  . VAL B 1 445 ? -0.410  0.705   -26.251 1.00 41.26 ? 445  VAL B CA  1 
ATOM   7548 C C   . VAL B 1 445 ? 0.909   0.449   -26.940 1.00 40.99 ? 445  VAL B C   1 
ATOM   7549 O O   . VAL B 1 445 ? 1.891   1.154   -26.693 1.00 41.19 ? 445  VAL B O   1 
ATOM   7550 C CB  . VAL B 1 445 ? -0.647  2.211   -26.181 1.00 41.29 ? 445  VAL B CB  1 
ATOM   7551 C CG1 . VAL B 1 445 ? -0.871  2.776   -27.583 1.00 40.80 ? 445  VAL B CG1 1 
ATOM   7552 C CG2 . VAL B 1 445 ? -1.821  2.523   -25.275 1.00 41.19 ? 445  VAL B CG2 1 
ATOM   7553 N N   . PRO B 1 446 ? 0.959   -0.595  -27.775 1.00 40.57 ? 446  PRO B N   1 
ATOM   7554 C CA  . PRO B 1 446 ? 2.234   -0.960  -28.360 1.00 40.06 ? 446  PRO B CA  1 
ATOM   7555 C C   . PRO B 1 446 ? 2.613   -0.082  -29.551 1.00 39.57 ? 446  PRO B C   1 
ATOM   7556 O O   . PRO B 1 446 ? 1.781   0.640   -30.104 1.00 39.10 ? 446  PRO B O   1 
ATOM   7557 C CB  . PRO B 1 446 ? 2.009   -2.412  -28.811 1.00 40.01 ? 446  PRO B CB  1 
ATOM   7558 C CG  . PRO B 1 446 ? 0.635   -2.808  -28.237 1.00 40.67 ? 446  PRO B CG  1 
ATOM   7559 C CD  . PRO B 1 446 ? -0.103  -1.522  -28.189 1.00 40.35 ? 446  PRO B CD  1 
ATOM   7560 N N   . HIS B 1 447 ? 3.887   -0.159  -29.908 1.00 39.12 ? 447  HIS B N   1 
ATOM   7561 C CA  . HIS B 1 447 ? 4.436   0.441   -31.100 1.00 38.84 ? 447  HIS B CA  1 
ATOM   7562 C C   . HIS B 1 447 ? 3.542   0.144   -32.289 1.00 38.51 ? 447  HIS B C   1 
ATOM   7563 O O   . HIS B 1 447 ? 3.357   -1.015  -32.662 1.00 38.81 ? 447  HIS B O   1 
ATOM   7564 C CB  . HIS B 1 447 ? 5.806   -0.178  -31.333 1.00 38.85 ? 447  HIS B CB  1 
ATOM   7565 C CG  . HIS B 1 447 ? 6.641   0.530   -32.346 1.00 39.73 ? 447  HIS B CG  1 
ATOM   7566 N ND1 . HIS B 1 447 ? 7.240   1.747   -32.097 1.00 41.39 ? 447  HIS B ND1 1 
ATOM   7567 C CD2 . HIS B 1 447 ? 7.026   0.170   -33.591 1.00 39.53 ? 447  HIS B CD2 1 
ATOM   7568 C CE1 . HIS B 1 447 ? 7.941   2.119   -33.152 1.00 39.49 ? 447  HIS B CE1 1 
ATOM   7569 N NE2 . HIS B 1 447 ? 7.829   1.180   -34.072 1.00 40.29 ? 447  HIS B NE2 1 
ATOM   7570 N N   . GLY B 1 448 ? 2.988   1.196   -32.877 1.00 37.87 ? 448  GLY B N   1 
ATOM   7571 C CA  . GLY B 1 448 ? 2.284   1.077   -34.144 1.00 37.35 ? 448  GLY B CA  1 
ATOM   7572 C C   . GLY B 1 448 ? 0.772   1.111   -34.033 1.00 37.28 ? 448  GLY B C   1 
ATOM   7573 O O   . GLY B 1 448 ? 0.086   1.254   -35.044 1.00 37.51 ? 448  GLY B O   1 
ATOM   7574 N N   . TYR B 1 449 ? 0.237   0.982   -32.823 1.00 36.72 ? 449  TYR B N   1 
ATOM   7575 C CA  . TYR B 1 449 ? -1.223  0.898   -32.670 1.00 36.41 ? 449  TYR B CA  1 
ATOM   7576 C C   . TYR B 1 449 ? -1.949  2.226   -32.526 1.00 36.03 ? 449  TYR B C   1 
ATOM   7577 O O   . TYR B 1 449 ? -3.065  2.276   -32.028 1.00 36.29 ? 449  TYR B O   1 
ATOM   7578 C CB  . TYR B 1 449 ? -1.609  -0.153  -31.627 1.00 36.00 ? 449  TYR B CB  1 
ATOM   7579 C CG  . TYR B 1 449 ? -1.205  -1.487  -32.183 1.00 36.05 ? 449  TYR B CG  1 
ATOM   7580 C CD1 . TYR B 1 449 ? 0.041   -2.044  -31.888 1.00 35.66 ? 449  TYR B CD1 1 
ATOM   7581 C CD2 . TYR B 1 449 ? -2.024  -2.138  -33.103 1.00 34.68 ? 449  TYR B CD2 1 
ATOM   7582 C CE1 . TYR B 1 449 ? 0.431   -3.248  -32.457 1.00 36.51 ? 449  TYR B CE1 1 
ATOM   7583 C CE2 . TYR B 1 449 ? -1.653  -3.328  -33.668 1.00 34.62 ? 449  TYR B CE2 1 
ATOM   7584 C CZ  . TYR B 1 449 ? -0.434  -3.877  -33.352 1.00 36.06 ? 449  TYR B CZ  1 
ATOM   7585 O OH  . TYR B 1 449 ? -0.089  -5.057  -33.935 1.00 36.70 ? 449  TYR B OH  1 
ATOM   7586 N N   . GLU B 1 450 ? -1.312  3.288   -33.016 1.00 35.33 ? 450  GLU B N   1 
ATOM   7587 C CA  . GLU B 1 450 ? -1.964  4.580   -33.145 1.00 34.71 ? 450  GLU B CA  1 
ATOM   7588 C C   . GLU B 1 450 ? -2.337  4.808   -34.603 1.00 35.06 ? 450  GLU B C   1 
ATOM   7589 O O   . GLU B 1 450 ? -3.218  5.620   -34.915 1.00 35.38 ? 450  GLU B O   1 
ATOM   7590 C CB  . GLU B 1 450 ? -1.046  5.700   -32.644 1.00 34.43 ? 450  GLU B CB  1 
ATOM   7591 C CG  . GLU B 1 450 ? -0.174  6.337   -33.705 1.00 32.75 ? 450  GLU B CG  1 
ATOM   7592 C CD  . GLU B 1 450 ? 1.109   5.576   -33.978 1.00 31.26 ? 450  GLU B CD  1 
ATOM   7593 O OE1 . GLU B 1 450 ? 1.299   4.447   -33.471 1.00 27.89 ? 450  GLU B OE1 1 
ATOM   7594 O OE2 . GLU B 1 450 ? 1.947   6.130   -34.715 1.00 33.41 ? 450  GLU B OE2 1 
ATOM   7595 N N   . ILE B 1 451 ? -1.677  4.077   -35.502 1.00 34.86 ? 451  ILE B N   1 
ATOM   7596 C CA  . ILE B 1 451 ? -1.854  4.317   -36.921 1.00 34.79 ? 451  ILE B CA  1 
ATOM   7597 C C   . ILE B 1 451 ? -3.306  4.164   -37.338 1.00 35.24 ? 451  ILE B C   1 
ATOM   7598 O O   . ILE B 1 451 ? -3.881  5.066   -37.948 1.00 35.05 ? 451  ILE B O   1 
ATOM   7599 C CB  . ILE B 1 451 ? -0.970  3.420   -37.776 1.00 34.79 ? 451  ILE B CB  1 
ATOM   7600 C CG1 . ILE B 1 451 ? 0.516   3.715   -37.495 1.00 35.48 ? 451  ILE B CG1 1 
ATOM   7601 C CG2 . ILE B 1 451 ? -1.303  3.621   -39.258 1.00 33.50 ? 451  ILE B CG2 1 
ATOM   7602 C CD1 . ILE B 1 451 ? 1.451   2.562   -37.834 1.00 34.92 ? 451  ILE B CD1 1 
ATOM   7603 N N   . GLU B 1 452 ? -3.899  3.022   -37.003 1.00 35.53 ? 452  GLU B N   1 
ATOM   7604 C CA  . GLU B 1 452 ? -5.283  2.745   -37.392 1.00 35.99 ? 452  GLU B CA  1 
ATOM   7605 C C   . GLU B 1 452 ? -6.202  3.908   -37.054 1.00 35.76 ? 452  GLU B C   1 
ATOM   7606 O O   . GLU B 1 452 ? -7.110  4.193   -37.819 1.00 35.93 ? 452  GLU B O   1 
ATOM   7607 C CB  . GLU B 1 452 ? -5.794  1.451   -36.756 1.00 36.60 ? 452  GLU B CB  1 
ATOM   7608 C CG  . GLU B 1 452 ? -5.726  1.405   -35.240 1.00 38.03 ? 452  GLU B CG  1 
ATOM   7609 C CD  . GLU B 1 452 ? -5.534  -0.008  -34.728 1.00 40.92 ? 452  GLU B CD  1 
ATOM   7610 O OE1 . GLU B 1 452 ? -6.385  -0.472  -33.937 1.00 41.97 ? 452  GLU B OE1 1 
ATOM   7611 O OE2 . GLU B 1 452 ? -4.539  -0.660  -35.128 1.00 41.55 ? 452  GLU B OE2 1 
ATOM   7612 N N   . PHE B 1 453 ? -5.927  4.591   -35.934 1.00 35.39 ? 453  PHE B N   1 
ATOM   7613 C CA  . PHE B 1 453 ? -6.696  5.767   -35.485 1.00 34.66 ? 453  PHE B CA  1 
ATOM   7614 C C   . PHE B 1 453 ? -6.474  7.048   -36.282 1.00 34.74 ? 453  PHE B C   1 
ATOM   7615 O O   . PHE B 1 453 ? -7.437  7.726   -36.623 1.00 35.19 ? 453  PHE B O   1 
ATOM   7616 C CB  . PHE B 1 453 ? -6.456  6.032   -34.007 1.00 34.20 ? 453  PHE B CB  1 
ATOM   7617 C CG  . PHE B 1 453 ? -7.038  5.001   -33.125 1.00 33.43 ? 453  PHE B CG  1 
ATOM   7618 C CD1 . PHE B 1 453 ? -8.383  5.031   -32.804 1.00 33.80 ? 453  PHE B CD1 1 
ATOM   7619 C CD2 . PHE B 1 453 ? -6.254  3.980   -32.627 1.00 35.36 ? 453  PHE B CD2 1 
ATOM   7620 C CE1 . PHE B 1 453 ? -8.945  4.071   -31.977 1.00 34.56 ? 453  PHE B CE1 1 
ATOM   7621 C CE2 . PHE B 1 453 ? -6.802  2.996   -31.800 1.00 35.81 ? 453  PHE B CE2 1 
ATOM   7622 C CZ  . PHE B 1 453 ? -8.154  3.046   -31.469 1.00 35.54 ? 453  PHE B CZ  1 
ATOM   7623 N N   . ILE B 1 454 ? -5.211  7.391   -36.550 1.00 35.14 ? 454  ILE B N   1 
ATOM   7624 C CA  . ILE B 1 454 ? -4.855  8.517   -37.431 1.00 34.74 ? 454  ILE B CA  1 
ATOM   7625 C C   . ILE B 1 454 ? -5.449  8.307   -38.817 1.00 34.81 ? 454  ILE B C   1 
ATOM   7626 O O   . ILE B 1 454 ? -5.871  9.256   -39.461 1.00 34.67 ? 454  ILE B O   1 
ATOM   7627 C CB  . ILE B 1 454 ? -3.322  8.655   -37.609 1.00 34.70 ? 454  ILE B CB  1 
ATOM   7628 C CG1 . ILE B 1 454 ? -2.574  8.680   -36.260 1.00 35.98 ? 454  ILE B CG1 1 
ATOM   7629 C CG2 . ILE B 1 454 ? -2.969  9.847   -38.499 1.00 34.32 ? 454  ILE B CG2 1 
ATOM   7630 C CD1 . ILE B 1 454 ? -3.040  9.717   -35.276 1.00 37.55 ? 454  ILE B CD1 1 
ATOM   7631 N N   . PHE B 1 455 ? -5.469  7.064   -39.287 1.00 35.51 ? 455  PHE B N   1 
ATOM   7632 C CA  . PHE B 1 455 ? -5.969  6.778   -40.641 1.00 36.27 ? 455  PHE B CA  1 
ATOM   7633 C C   . PHE B 1 455 ? -7.500  6.724   -40.690 1.00 37.32 ? 455  PHE B C   1 
ATOM   7634 O O   . PHE B 1 455 ? -8.106  6.805   -41.758 1.00 37.32 ? 455  PHE B O   1 
ATOM   7635 C CB  . PHE B 1 455 ? -5.304  5.532   -41.227 1.00 35.29 ? 455  PHE B CB  1 
ATOM   7636 C CG  . PHE B 1 455 ? -4.063  5.837   -41.998 1.00 34.43 ? 455  PHE B CG  1 
ATOM   7637 C CD1 . PHE B 1 455 ? -2.828  5.875   -41.369 1.00 34.31 ? 455  PHE B CD1 1 
ATOM   7638 C CD2 . PHE B 1 455 ? -4.130  6.147   -43.339 1.00 32.96 ? 455  PHE B CD2 1 
ATOM   7639 C CE1 . PHE B 1 455 ? -1.686  6.182   -42.073 1.00 31.79 ? 455  PHE B CE1 1 
ATOM   7640 C CE2 . PHE B 1 455 ? -2.991  6.463   -44.048 1.00 32.08 ? 455  PHE B CE2 1 
ATOM   7641 C CZ  . PHE B 1 455 ? -1.770  6.475   -43.413 1.00 32.11 ? 455  PHE B CZ  1 
ATOM   7642 N N   . GLY B 1 456 ? -8.108  6.626   -39.513 1.00 38.87 ? 456  GLY B N   1 
ATOM   7643 C CA  . GLY B 1 456 ? -9.548  6.775   -39.377 1.00 40.94 ? 456  GLY B CA  1 
ATOM   7644 C C   . GLY B 1 456 ? -10.302 5.469   -39.501 1.00 42.22 ? 456  GLY B C   1 
ATOM   7645 O O   . GLY B 1 456 ? -11.497 5.476   -39.778 1.00 42.70 ? 456  GLY B O   1 
ATOM   7646 N N   . LEU B 1 457 ? -9.608  4.353   -39.281 1.00 43.00 ? 457  LEU B N   1 
ATOM   7647 C CA  . LEU B 1 457 ? -10.208 3.037   -39.432 1.00 44.16 ? 457  LEU B CA  1 
ATOM   7648 C C   . LEU B 1 457 ? -11.439 2.831   -38.555 1.00 45.45 ? 457  LEU B C   1 
ATOM   7649 O O   . LEU B 1 457 ? -12.345 2.113   -38.951 1.00 45.85 ? 457  LEU B O   1 
ATOM   7650 C CB  . LEU B 1 457 ? -9.204  1.905   -39.177 1.00 43.29 ? 457  LEU B CB  1 
ATOM   7651 C CG  . LEU B 1 457 ? -8.096  1.554   -40.168 1.00 43.32 ? 457  LEU B CG  1 
ATOM   7652 C CD1 . LEU B 1 457 ? -7.865  0.057   -40.129 1.00 43.61 ? 457  LEU B CD1 1 
ATOM   7653 C CD2 . LEU B 1 457 ? -8.369  1.985   -41.582 1.00 41.59 ? 457  LEU B CD2 1 
ATOM   7654 N N   . PRO B 1 458 ? -11.461 3.398   -37.340 1.00 46.48 ? 458  PRO B N   1 
ATOM   7655 C CA  . PRO B 1 458 ? -12.690 3.189   -36.581 1.00 47.71 ? 458  PRO B CA  1 
ATOM   7656 C C   . PRO B 1 458 ? -13.979 3.698   -37.256 1.00 48.90 ? 458  PRO B C   1 
ATOM   7657 O O   . PRO B 1 458 ? -15.065 3.266   -36.877 1.00 49.10 ? 458  PRO B O   1 
ATOM   7658 C CB  . PRO B 1 458 ? -12.411 3.915   -35.264 1.00 47.47 ? 458  PRO B CB  1 
ATOM   7659 C CG  . PRO B 1 458 ? -10.928 3.881   -35.146 1.00 47.14 ? 458  PRO B CG  1 
ATOM   7660 C CD  . PRO B 1 458 ? -10.454 4.117   -36.547 1.00 46.37 ? 458  PRO B CD  1 
ATOM   7661 N N   . LEU B 1 459 ? -13.861 4.561   -38.261 1.00 50.05 ? 459  LEU B N   1 
ATOM   7662 C CA  . LEU B 1 459 ? -15.039 5.062   -38.961 1.00 51.68 ? 459  LEU B CA  1 
ATOM   7663 C C   . LEU B 1 459 ? -15.727 3.989   -39.810 1.00 52.85 ? 459  LEU B C   1 
ATOM   7664 O O   . LEU B 1 459 ? -16.878 4.162   -40.234 1.00 52.90 ? 459  LEU B O   1 
ATOM   7665 C CB  . LEU B 1 459 ? -14.703 6.283   -39.824 1.00 51.79 ? 459  LEU B CB  1 
ATOM   7666 C CG  . LEU B 1 459 ? -14.042 7.527   -39.216 1.00 52.44 ? 459  LEU B CG  1 
ATOM   7667 C CD1 . LEU B 1 459 ? -14.524 8.764   -39.939 1.00 52.57 ? 459  LEU B CD1 1 
ATOM   7668 C CD2 . LEU B 1 459 ? -14.294 7.676   -37.729 1.00 53.23 ? 459  LEU B CD2 1 
ATOM   7669 N N   . ASP B 1 460 ? -15.011 2.893   -40.056 1.00 54.17 ? 460  ASP B N   1 
ATOM   7670 C CA  . ASP B 1 460 ? -15.559 1.715   -40.717 1.00 55.42 ? 460  ASP B CA  1 
ATOM   7671 C C   . ASP B 1 460 ? -16.316 0.928   -39.664 1.00 56.34 ? 460  ASP B C   1 
ATOM   7672 O O   . ASP B 1 460 ? -15.698 0.290   -38.800 1.00 56.54 ? 460  ASP B O   1 
ATOM   7673 C CB  . ASP B 1 460 ? -14.437 0.858   -41.299 1.00 55.54 ? 460  ASP B CB  1 
ATOM   7674 C CG  . ASP B 1 460 ? -14.923 -0.125  -42.353 1.00 56.64 ? 460  ASP B CG  1 
ATOM   7675 O OD1 . ASP B 1 460 ? -16.037 -0.678  -42.207 1.00 57.27 ? 460  ASP B OD1 1 
ATOM   7676 O OD2 . ASP B 1 460 ? -14.170 -0.360  -43.329 1.00 57.28 ? 460  ASP B OD2 1 
ATOM   7677 N N   . PRO B 1 461 ? -17.661 0.957   -39.736 1.00 57.28 ? 461  PRO B N   1 
ATOM   7678 C CA  . PRO B 1 461 ? -18.476 0.431   -38.631 1.00 57.82 ? 461  PRO B CA  1 
ATOM   7679 C C   . PRO B 1 461 ? -18.360 -1.085  -38.513 1.00 58.25 ? 461  PRO B C   1 
ATOM   7680 O O   . PRO B 1 461 ? -18.678 -1.647  -37.460 1.00 58.62 ? 461  PRO B O   1 
ATOM   7681 C CB  . PRO B 1 461 ? -19.910 0.849   -39.009 1.00 57.85 ? 461  PRO B CB  1 
ATOM   7682 C CG  . PRO B 1 461 ? -19.754 1.867   -40.145 1.00 57.73 ? 461  PRO B CG  1 
ATOM   7683 C CD  . PRO B 1 461 ? -18.497 1.447   -40.849 1.00 57.30 ? 461  PRO B CD  1 
ATOM   7684 N N   . SER B 1 462 ? -17.874 -1.721  -39.581 1.00 58.36 ? 462  SER B N   1 
ATOM   7685 C CA  . SER B 1 462 ? -17.705 -3.164  -39.641 1.00 58.46 ? 462  SER B CA  1 
ATOM   7686 C C   . SER B 1 462 ? -16.440 -3.649  -38.933 1.00 58.78 ? 462  SER B C   1 
ATOM   7687 O O   . SER B 1 462 ? -16.175 -4.865  -38.880 1.00 58.82 ? 462  SER B O   1 
ATOM   7688 C CB  . SER B 1 462 ? -17.703 -3.629  -41.103 1.00 58.77 ? 462  SER B CB  1 
ATOM   7689 O OG  . SER B 1 462 ? -16.491 -3.287  -41.771 1.00 59.16 ? 462  SER B OG  1 
ATOM   7690 N N   . LEU B 1 463 ? -15.652 -2.719  -38.392 1.00 58.68 ? 463  LEU B N   1 
ATOM   7691 C CA  . LEU B 1 463 ? -14.441 -3.115  -37.679 1.00 58.60 ? 463  LEU B CA  1 
ATOM   7692 C C   . LEU B 1 463 ? -14.641 -3.247  -36.170 1.00 58.55 ? 463  LEU B C   1 
ATOM   7693 O O   . LEU B 1 463 ? -13.732 -3.685  -35.454 1.00 58.92 ? 463  LEU B O   1 
ATOM   7694 C CB  . LEU B 1 463 ? -13.254 -2.215  -38.033 1.00 58.67 ? 463  LEU B CB  1 
ATOM   7695 C CG  . LEU B 1 463 ? -12.646 -2.474  -39.422 1.00 58.98 ? 463  LEU B CG  1 
ATOM   7696 C CD1 . LEU B 1 463 ? -11.885 -1.269  -39.917 1.00 58.56 ? 463  LEU B CD1 1 
ATOM   7697 C CD2 . LEU B 1 463 ? -11.756 -3.716  -39.446 1.00 59.38 ? 463  LEU B CD2 1 
ATOM   7698 N N   . ASN B 1 464 ? -15.837 -2.895  -35.700 1.00 58.27 ? 464  ASN B N   1 
ATOM   7699 C CA  . ASN B 1 464 ? -16.236 -3.076  -34.290 1.00 58.28 ? 464  ASN B CA  1 
ATOM   7700 C C   . ASN B 1 464 ? -15.433 -2.236  -33.276 1.00 57.62 ? 464  ASN B C   1 
ATOM   7701 O O   . ASN B 1 464 ? -15.201 -2.654  -32.123 1.00 57.59 ? 464  ASN B O   1 
ATOM   7702 C CB  . ASN B 1 464 ? -16.268 -4.577  -33.890 1.00 58.51 ? 464  ASN B CB  1 
ATOM   7703 C CG  . ASN B 1 464 ? -17.009 -5.450  -34.915 1.00 59.91 ? 464  ASN B CG  1 
ATOM   7704 O OD1 . ASN B 1 464 ? -18.115 -5.115  -35.366 1.00 60.46 ? 464  ASN B OD1 1 
ATOM   7705 N ND2 . ASN B 1 464 ? -16.389 -6.570  -35.290 1.00 60.56 ? 464  ASN B ND2 1 
ATOM   7706 N N   . TYR B 1 465 ? -15.011 -1.051  -33.713 1.00 56.37 ? 465  TYR B N   1 
ATOM   7707 C CA  . TYR B 1 465 ? -14.445 -0.082  -32.799 1.00 55.12 ? 465  TYR B CA  1 
ATOM   7708 C C   . TYR B 1 465 ? -15.605 0.622   -32.126 1.00 54.45 ? 465  TYR B C   1 
ATOM   7709 O O   . TYR B 1 465 ? -16.623 0.874   -32.755 1.00 53.84 ? 465  TYR B O   1 
ATOM   7710 C CB  . TYR B 1 465 ? -13.626 0.952   -33.551 1.00 55.22 ? 465  TYR B CB  1 
ATOM   7711 C CG  . TYR B 1 465 ? -12.271 0.528   -34.068 1.00 54.81 ? 465  TYR B CG  1 
ATOM   7712 C CD1 . TYR B 1 465 ? -11.154 0.525   -33.237 1.00 54.64 ? 465  TYR B CD1 1 
ATOM   7713 C CD2 . TYR B 1 465 ? -12.091 0.197   -35.408 1.00 55.28 ? 465  TYR B CD2 1 
ATOM   7714 C CE1 . TYR B 1 465 ? -9.896  0.171   -33.720 1.00 54.91 ? 465  TYR B CE1 1 
ATOM   7715 C CE2 . TYR B 1 465 ? -10.839 -0.154  -35.902 1.00 55.25 ? 465  TYR B CE2 1 
ATOM   7716 C CZ  . TYR B 1 465 ? -9.745  -0.165  -35.054 1.00 55.25 ? 465  TYR B CZ  1 
ATOM   7717 O OH  . TYR B 1 465 ? -8.503  -0.504  -35.544 1.00 55.15 ? 465  TYR B OH  1 
ATOM   7718 N N   . THR B 1 466 ? -15.434 0.952   -30.852 1.00 54.16 ? 466  THR B N   1 
ATOM   7719 C CA  . THR B 1 466 ? -16.453 1.643   -30.074 1.00 53.93 ? 466  THR B CA  1 
ATOM   7720 C C   . THR B 1 466 ? -16.758 3.024   -30.645 1.00 54.13 ? 466  THR B C   1 
ATOM   7721 O O   . THR B 1 466 ? -15.909 3.624   -31.288 1.00 54.41 ? 466  THR B O   1 
ATOM   7722 C CB  . THR B 1 466 ? -16.021 1.806   -28.596 1.00 54.06 ? 466  THR B CB  1 
ATOM   7723 O OG1 . THR B 1 466 ? -15.152 2.942   -28.451 1.00 53.19 ? 466  THR B OG1 1 
ATOM   7724 C CG2 . THR B 1 466 ? -15.336 0.541   -28.082 1.00 53.37 ? 466  THR B CG2 1 
ATOM   7725 N N   . THR B 1 467 ? -17.977 3.509   -30.410 1.00 54.30 ? 467  THR B N   1 
ATOM   7726 C CA  . THR B 1 467 ? -18.401 4.873   -30.764 1.00 54.33 ? 467  THR B CA  1 
ATOM   7727 C C   . THR B 1 467 ? -17.384 5.903   -30.305 1.00 54.01 ? 467  THR B C   1 
ATOM   7728 O O   . THR B 1 467 ? -17.052 6.843   -31.041 1.00 54.33 ? 467  THR B O   1 
ATOM   7729 C CB  . THR B 1 467 ? -19.745 5.201   -30.084 1.00 54.52 ? 467  THR B CB  1 
ATOM   7730 O OG1 . THR B 1 467 ? -20.762 4.380   -30.653 1.00 55.91 ? 467  THR B OG1 1 
ATOM   7731 C CG2 . THR B 1 467 ? -20.139 6.663   -30.258 1.00 55.21 ? 467  THR B CG2 1 
ATOM   7732 N N   . GLU B 1 468 ? -16.900 5.720   -29.078 1.00 53.38 ? 468  GLU B N   1 
ATOM   7733 C CA  . GLU B 1 468 ? -15.915 6.606   -28.487 1.00 52.95 ? 468  GLU B CA  1 
ATOM   7734 C C   . GLU B 1 468 ? -14.647 6.643   -29.368 1.00 52.08 ? 468  GLU B C   1 
ATOM   7735 O O   . GLU B 1 468 ? -14.161 7.721   -29.740 1.00 51.58 ? 468  GLU B O   1 
ATOM   7736 C CB  . GLU B 1 468 ? -15.625 6.174   -27.042 1.00 53.22 ? 468  GLU B CB  1 
ATOM   7737 C CG  . GLU B 1 468 ? -16.861 6.227   -26.100 1.00 55.82 ? 468  GLU B CG  1 
ATOM   7738 C CD  . GLU B 1 468 ? -17.615 4.867   -25.918 1.00 58.56 ? 468  GLU B CD  1 
ATOM   7739 O OE1 . GLU B 1 468 ? -17.986 4.190   -26.918 1.00 57.92 ? 468  GLU B OE1 1 
ATOM   7740 O OE2 . GLU B 1 468 ? -17.855 4.486   -24.744 1.00 59.68 ? 468  GLU B OE2 1 
ATOM   7741 N N   . GLU B 1 469 ? -14.171 5.454   -29.740 1.00 51.27 ? 469  GLU B N   1 
ATOM   7742 C CA  . GLU B 1 469 ? -12.988 5.269   -30.574 1.00 50.28 ? 469  GLU B CA  1 
ATOM   7743 C C   . GLU B 1 469 ? -13.153 5.883   -31.958 1.00 50.39 ? 469  GLU B C   1 
ATOM   7744 O O   . GLU B 1 469 ? -12.173 6.274   -32.592 1.00 50.46 ? 469  GLU B O   1 
ATOM   7745 C CB  . GLU B 1 469 ? -12.677 3.786   -30.701 1.00 49.85 ? 469  GLU B CB  1 
ATOM   7746 C CG  . GLU B 1 469 ? -12.028 3.197   -29.473 1.00 49.12 ? 469  GLU B CG  1 
ATOM   7747 C CD  . GLU B 1 469 ? -11.699 1.720   -29.634 1.00 49.78 ? 469  GLU B CD  1 
ATOM   7748 O OE1 . GLU B 1 469 ? -12.461 1.004   -30.322 1.00 49.75 ? 469  GLU B OE1 1 
ATOM   7749 O OE2 . GLU B 1 469 ? -10.685 1.262   -29.057 1.00 49.43 ? 469  GLU B OE2 1 
ATOM   7750 N N   . ARG B 1 470 ? -14.397 5.984   -32.409 1.00 50.10 ? 470  ARG B N   1 
ATOM   7751 C CA  . ARG B 1 470 ? -14.720 6.572   -33.694 1.00 50.10 ? 470  ARG B CA  1 
ATOM   7752 C C   . ARG B 1 470 ? -14.592 8.084   -33.619 1.00 49.19 ? 470  ARG B C   1 
ATOM   7753 O O   . ARG B 1 470 ? -14.172 8.728   -34.574 1.00 49.18 ? 470  ARG B O   1 
ATOM   7754 C CB  . ARG B 1 470 ? -16.139 6.163   -34.096 1.00 50.55 ? 470  ARG B CB  1 
ATOM   7755 C CG  . ARG B 1 470 ? -16.511 6.431   -35.542 1.00 54.55 ? 470  ARG B CG  1 
ATOM   7756 C CD  . ARG B 1 470 ? -17.424 7.654   -35.697 1.00 60.57 ? 470  ARG B CD  1 
ATOM   7757 N NE  . ARG B 1 470 ? -18.717 7.439   -35.031 1.00 65.58 ? 470  ARG B NE  1 
ATOM   7758 C CZ  . ARG B 1 470 ? -19.658 8.371   -34.861 1.00 67.89 ? 470  ARG B CZ  1 
ATOM   7759 N NH1 . ARG B 1 470 ? -19.482 9.618   -35.313 1.00 68.39 ? 470  ARG B NH1 1 
ATOM   7760 N NH2 . ARG B 1 470 ? -20.783 8.053   -34.228 1.00 68.56 ? 470  ARG B NH2 1 
ATOM   7761 N N   . ILE B 1 471 ? -14.970 8.646   -32.477 1.00 48.62 ? 471  ILE B N   1 
ATOM   7762 C CA  . ILE B 1 471 ? -14.913 10.095  -32.256 1.00 47.89 ? 471  ILE B CA  1 
ATOM   7763 C C   . ILE B 1 471 ? -13.463 10.507  -32.028 1.00 46.61 ? 471  ILE B C   1 
ATOM   7764 O O   . ILE B 1 471 ? -13.009 11.533  -32.539 1.00 46.24 ? 471  ILE B O   1 
ATOM   7765 C CB  . ILE B 1 471 ? -15.843 10.537  -31.079 1.00 48.07 ? 471  ILE B CB  1 
ATOM   7766 C CG1 . ILE B 1 471 ? -17.274 10.731  -31.596 1.00 49.14 ? 471  ILE B CG1 1 
ATOM   7767 C CG2 . ILE B 1 471 ? -15.336 11.826  -30.402 1.00 47.29 ? 471  ILE B CG2 1 
ATOM   7768 C CD1 . ILE B 1 471 ? -18.296 11.143  -30.514 1.00 49.34 ? 471  ILE B CD1 1 
ATOM   7769 N N   . PHE B 1 472 ? -12.749 9.676   -31.270 1.00 45.45 ? 472  PHE B N   1 
ATOM   7770 C CA  . PHE B 1 472 ? -11.311 9.801   -31.090 1.00 44.33 ? 472  PHE B CA  1 
ATOM   7771 C C   . PHE B 1 472 ? -10.587 9.867   -32.448 1.00 43.99 ? 472  PHE B C   1 
ATOM   7772 O O   . PHE B 1 472 ? -9.751  10.752  -32.674 1.00 43.47 ? 472  PHE B O   1 
ATOM   7773 C CB  . PHE B 1 472 ? -10.812 8.613   -30.274 1.00 43.97 ? 472  PHE B CB  1 
ATOM   7774 C CG  . PHE B 1 472 ? -9.356  8.672   -29.915 1.00 42.91 ? 472  PHE B CG  1 
ATOM   7775 C CD1 . PHE B 1 472 ? -8.742  9.880   -29.613 1.00 42.25 ? 472  PHE B CD1 1 
ATOM   7776 C CD2 . PHE B 1 472 ? -8.612  7.498   -29.840 1.00 41.71 ? 472  PHE B CD2 1 
ATOM   7777 C CE1 . PHE B 1 472 ? -7.407  9.929   -29.264 1.00 42.73 ? 472  PHE B CE1 1 
ATOM   7778 C CE2 . PHE B 1 472 ? -7.290  7.525   -29.489 1.00 42.63 ? 472  PHE B CE2 1 
ATOM   7779 C CZ  . PHE B 1 472 ? -6.673  8.751   -29.193 1.00 43.57 ? 472  PHE B CZ  1 
ATOM   7780 N N   . ALA B 1 473 ? -10.929 8.938   -33.343 1.00 43.00 ? 473  ALA B N   1 
ATOM   7781 C CA  . ALA B 1 473 ? -10.284 8.866   -34.639 1.00 42.48 ? 473  ALA B CA  1 
ATOM   7782 C C   . ALA B 1 473 ? -10.585 10.125  -35.427 1.00 42.39 ? 473  ALA B C   1 
ATOM   7783 O O   . ALA B 1 473 ? -9.729  10.641  -36.152 1.00 42.39 ? 473  ALA B O   1 
ATOM   7784 C CB  . ALA B 1 473 ? -10.733 7.633   -35.398 1.00 42.26 ? 473  ALA B CB  1 
ATOM   7785 N N   . GLN B 1 474 ? -11.806 10.629  -35.294 1.00 42.20 ? 474  GLN B N   1 
ATOM   7786 C CA  . GLN B 1 474 ? -12.157 11.855  -35.997 1.00 42.29 ? 474  GLN B CA  1 
ATOM   7787 C C   . GLN B 1 474 ? -11.332 13.010  -35.468 1.00 41.53 ? 474  GLN B C   1 
ATOM   7788 O O   . GLN B 1 474 ? -10.855 13.833  -36.246 1.00 41.71 ? 474  GLN B O   1 
ATOM   7789 C CB  . GLN B 1 474 ? -13.650 12.150  -35.890 1.00 42.85 ? 474  GLN B CB  1 
ATOM   7790 C CG  . GLN B 1 474 ? -14.488 11.310  -36.829 1.00 44.97 ? 474  GLN B CG  1 
ATOM   7791 C CD  . GLN B 1 474 ? -15.964 11.449  -36.552 1.00 49.27 ? 474  GLN B CD  1 
ATOM   7792 O OE1 . GLN B 1 474 ? -16.465 10.968  -35.527 1.00 51.24 ? 474  GLN B OE1 1 
ATOM   7793 N NE2 . GLN B 1 474 ? -16.681 12.107  -37.469 1.00 50.91 ? 474  GLN B NE2 1 
ATOM   7794 N N   . ARG B 1 475 ? -11.151 13.049  -34.148 1.00 40.90 ? 475  ARG B N   1 
ATOM   7795 C CA  . ARG B 1 475 ? -10.317 14.063  -33.511 1.00 40.62 ? 475  ARG B CA  1 
ATOM   7796 C C   . ARG B 1 475 ? -8.904  14.037  -34.097 1.00 40.12 ? 475  ARG B C   1 
ATOM   7797 O O   . ARG B 1 475 ? -8.371  15.078  -34.485 1.00 39.71 ? 475  ARG B O   1 
ATOM   7798 C CB  . ARG B 1 475 ? -10.248 13.853  -31.992 1.00 40.70 ? 475  ARG B CB  1 
ATOM   7799 C CG  . ARG B 1 475 ? -11.498 14.267  -31.190 1.00 41.17 ? 475  ARG B CG  1 
ATOM   7800 C CD  . ARG B 1 475 ? -11.265 14.129  -29.657 1.00 40.54 ? 475  ARG B CD  1 
ATOM   7801 N NE  . ARG B 1 475 ? -10.021 14.801  -29.256 1.00 38.54 ? 475  ARG B NE  1 
ATOM   7802 C CZ  . ARG B 1 475 ? -9.212  14.365  -28.297 1.00 36.74 ? 475  ARG B CZ  1 
ATOM   7803 N NH1 . ARG B 1 475 ? -9.491  13.259  -27.618 1.00 36.18 ? 475  ARG B NH1 1 
ATOM   7804 N NH2 . ARG B 1 475 ? -8.104  15.028  -28.030 1.00 35.97 ? 475  ARG B NH2 1 
ATOM   7805 N N   . LEU B 1 476 ? -8.322  12.841  -34.183 1.00 39.46 ? 476  LEU B N   1 
ATOM   7806 C CA  . LEU B 1 476 ? -6.942  12.691  -34.617 1.00 39.11 ? 476  LEU B CA  1 
ATOM   7807 C C   . LEU B 1 476 ? -6.758  13.069  -36.071 1.00 39.12 ? 476  LEU B C   1 
ATOM   7808 O O   . LEU B 1 476 ? -5.788  13.755  -36.427 1.00 38.76 ? 476  LEU B O   1 
ATOM   7809 C CB  . LEU B 1 476 ? -6.443  11.280  -34.356 1.00 38.93 ? 476  LEU B CB  1 
ATOM   7810 C CG  . LEU B 1 476 ? -6.491  10.887  -32.889 1.00 39.02 ? 476  LEU B CG  1 
ATOM   7811 C CD1 . LEU B 1 476 ? -6.077  9.440   -32.713 1.00 40.09 ? 476  LEU B CD1 1 
ATOM   7812 C CD2 . LEU B 1 476 ? -5.606  11.802  -32.067 1.00 39.18 ? 476  LEU B CD2 1 
ATOM   7813 N N   . MET B 1 477 ? -7.702  12.647  -36.907 1.00 39.19 ? 477  MET B N   1 
ATOM   7814 C CA  . MET B 1 477 ? -7.635  12.961  -38.322 1.00 39.72 ? 477  MET B CA  1 
ATOM   7815 C C   . MET B 1 477 ? -7.690  14.469  -38.485 1.00 39.31 ? 477  MET B C   1 
ATOM   7816 O O   . MET B 1 477 ? -7.094  15.024  -39.403 1.00 39.80 ? 477  MET B O   1 
ATOM   7817 C CB  . MET B 1 477 ? -8.790  12.316  -39.100 1.00 39.83 ? 477  MET B CB  1 
ATOM   7818 C CG  . MET B 1 477 ? -8.876  10.776  -39.071 1.00 40.26 ? 477  MET B CG  1 
ATOM   7819 S SD  . MET B 1 477 ? -10.446 10.145  -39.769 1.00 41.65 ? 477  MET B SD  1 
ATOM   7820 C CE  . MET B 1 477 ? -10.287 10.574  -41.476 1.00 38.38 ? 477  MET B CE  1 
ATOM   7821 N N   . LYS B 1 478 ? -8.409  15.129  -37.586 1.00 39.21 ? 478  LYS B N   1 
ATOM   7822 C CA  . LYS B 1 478 ? -8.522  16.587  -37.613 1.00 39.06 ? 478  LYS B CA  1 
ATOM   7823 C C   . LYS B 1 478 ? -7.196  17.253  -37.207 1.00 37.83 ? 478  LYS B C   1 
ATOM   7824 O O   . LYS B 1 478 ? -6.751  18.182  -37.874 1.00 37.19 ? 478  LYS B O   1 
ATOM   7825 C CB  . LYS B 1 478 ? -9.695  17.057  -36.738 1.00 40.21 ? 478  LYS B CB  1 
ATOM   7826 C CG  . LYS B 1 478 ? -10.221 18.471  -37.039 1.00 42.47 ? 478  LYS B CG  1 
ATOM   7827 C CD  . LYS B 1 478 ? -11.230 18.483  -38.199 1.00 47.08 ? 478  LYS B CD  1 
ATOM   7828 C CE  . LYS B 1 478 ? -11.523 19.912  -38.703 1.00 46.93 ? 478  LYS B CE  1 
ATOM   7829 N NZ  . LYS B 1 478 ? -11.934 19.927  -40.159 1.00 47.16 ? 478  LYS B NZ  1 
ATOM   7830 N N   . TYR B 1 479 ? -6.554  16.755  -36.146 1.00 36.83 ? 479  TYR B N   1 
ATOM   7831 C CA  . TYR B 1 479 ? -5.259  17.283  -35.720 1.00 36.08 ? 479  TYR B CA  1 
ATOM   7832 C C   . TYR B 1 479 ? -4.235  17.139  -36.832 1.00 36.24 ? 479  TYR B C   1 
ATOM   7833 O O   . TYR B 1 479 ? -3.583  18.124  -37.226 1.00 36.73 ? 479  TYR B O   1 
ATOM   7834 C CB  . TYR B 1 479 ? -4.715  16.530  -34.523 1.00 36.04 ? 479  TYR B CB  1 
ATOM   7835 C CG  . TYR B 1 479 ? -5.429  16.717  -33.221 1.00 35.61 ? 479  TYR B CG  1 
ATOM   7836 C CD1 . TYR B 1 479 ? -5.890  17.966  -32.805 1.00 35.97 ? 479  TYR B CD1 1 
ATOM   7837 C CD2 . TYR B 1 479 ? -5.599  15.638  -32.368 1.00 35.36 ? 479  TYR B CD2 1 
ATOM   7838 C CE1 . TYR B 1 479 ? -6.544  18.110  -31.575 1.00 35.51 ? 479  TYR B CE1 1 
ATOM   7839 C CE2 . TYR B 1 479 ? -6.236  15.775  -31.158 1.00 34.80 ? 479  TYR B CE2 1 
ATOM   7840 C CZ  . TYR B 1 479 ? -6.705  17.000  -30.764 1.00 35.19 ? 479  TYR B CZ  1 
ATOM   7841 O OH  . TYR B 1 479 ? -7.335  17.079  -29.542 1.00 36.11 ? 479  TYR B OH  1 
ATOM   7842 N N   . TRP B 1 480 ? -4.093  15.912  -37.338 1.00 35.49 ? 480  TRP B N   1 
ATOM   7843 C CA  . TRP B 1 480 ? -3.131  15.638  -38.406 1.00 35.27 ? 480  TRP B CA  1 
ATOM   7844 C C   . TRP B 1 480 ? -3.383  16.489  -39.647 1.00 35.46 ? 480  TRP B C   1 
ATOM   7845 O O   . TRP B 1 480 ? -2.447  17.050  -40.211 1.00 34.98 ? 480  TRP B O   1 
ATOM   7846 C CB  . TRP B 1 480 ? -3.107  14.150  -38.776 1.00 34.45 ? 480  TRP B CB  1 
ATOM   7847 C CG  . TRP B 1 480 ? -2.017  13.353  -38.129 1.00 33.51 ? 480  TRP B CG  1 
ATOM   7848 C CD1 . TRP B 1 480 ? -1.034  12.658  -38.765 1.00 32.98 ? 480  TRP B CD1 1 
ATOM   7849 C CD2 . TRP B 1 480 ? -1.812  13.138  -36.724 1.00 33.69 ? 480  TRP B CD2 1 
ATOM   7850 N NE1 . TRP B 1 480 ? -0.213  12.041  -37.849 1.00 32.92 ? 480  TRP B NE1 1 
ATOM   7851 C CE2 . TRP B 1 480 ? -0.678  12.311  -36.589 1.00 33.62 ? 480  TRP B CE2 1 
ATOM   7852 C CE3 . TRP B 1 480 ? -2.475  13.563  -35.568 1.00 33.45 ? 480  TRP B CE3 1 
ATOM   7853 C CZ2 . TRP B 1 480 ? -0.198  11.901  -35.345 1.00 33.76 ? 480  TRP B CZ2 1 
ATOM   7854 C CZ3 . TRP B 1 480 ? -1.995  13.164  -34.341 1.00 33.22 ? 480  TRP B CZ3 1 
ATOM   7855 C CH2 . TRP B 1 480 ? -0.863  12.340  -34.237 1.00 33.93 ? 480  TRP B CH2 1 
ATOM   7856 N N   . THR B 1 481 ? -4.640  16.575  -40.081 1.00 36.07 ? 481  THR B N   1 
ATOM   7857 C CA  . THR B 1 481 ? -4.938  17.310  -41.319 1.00 36.86 ? 481  THR B CA  1 
ATOM   7858 C C   . THR B 1 481 ? -4.877  18.817  -41.089 1.00 37.12 ? 481  THR B C   1 
ATOM   7859 O O   . THR B 1 481 ? -4.434  19.555  -41.962 1.00 37.72 ? 481  THR B O   1 
ATOM   7860 C CB  . THR B 1 481 ? -6.294  16.909  -41.942 1.00 36.86 ? 481  THR B CB  1 
ATOM   7861 O OG1 . THR B 1 481 ? -7.308  16.961  -40.933 1.00 37.74 ? 481  THR B OG1 1 
ATOM   7862 C CG2 . THR B 1 481 ? -6.235  15.500  -42.499 1.00 36.45 ? 481  THR B CG2 1 
ATOM   7863 N N   . ASN B 1 482 ? -5.292  19.278  -39.912 1.00 37.46 ? 482  ASN B N   1 
ATOM   7864 C CA  . ASN B 1 482 ? -5.074  20.689  -39.559 1.00 37.65 ? 482  ASN B CA  1 
ATOM   7865 C C   . ASN B 1 482 ? -3.614  21.023  -39.564 1.00 37.44 ? 482  ASN B C   1 
ATOM   7866 O O   . ASN B 1 482 ? -3.231  22.108  -40.026 1.00 37.48 ? 482  ASN B O   1 
ATOM   7867 C CB  . ASN B 1 482 ? -5.679  21.055  -38.209 1.00 37.87 ? 482  ASN B CB  1 
ATOM   7868 C CG  . ASN B 1 482 ? -7.175  21.219  -38.288 1.00 38.38 ? 482  ASN B CG  1 
ATOM   7869 O OD1 . ASN B 1 482 ? -7.699  21.678  -39.305 1.00 39.97 ? 482  ASN B OD1 1 
ATOM   7870 N ND2 . ASN B 1 482 ? -7.876  20.821  -37.228 1.00 39.40 ? 482  ASN B ND2 1 
ATOM   7871 N N   . PHE B 1 483 ? -2.801  20.092  -39.060 1.00 36.85 ? 483  PHE B N   1 
ATOM   7872 C CA  . PHE B 1 483 ? -1.373  20.253  -39.167 1.00 36.82 ? 483  PHE B CA  1 
ATOM   7873 C C   . PHE B 1 483 ? -0.939  20.320  -40.639 1.00 37.47 ? 483  PHE B C   1 
ATOM   7874 O O   . PHE B 1 483 ? -0.243  21.267  -41.046 1.00 37.92 ? 483  PHE B O   1 
ATOM   7875 C CB  . PHE B 1 483 ? -0.627  19.168  -38.400 1.00 36.78 ? 483  PHE B CB  1 
ATOM   7876 C CG  . PHE B 1 483 ? 0.865   19.299  -38.488 1.00 36.11 ? 483  PHE B CG  1 
ATOM   7877 C CD1 . PHE B 1 483 ? 1.537   20.255  -37.724 1.00 34.88 ? 483  PHE B CD1 1 
ATOM   7878 C CD2 . PHE B 1 483 ? 1.593   18.486  -39.343 1.00 33.87 ? 483  PHE B CD2 1 
ATOM   7879 C CE1 . PHE B 1 483 ? 2.896   20.389  -37.801 1.00 32.84 ? 483  PHE B CE1 1 
ATOM   7880 C CE2 . PHE B 1 483 ? 2.966   18.601  -39.422 1.00 34.31 ? 483  PHE B CE2 1 
ATOM   7881 C CZ  . PHE B 1 483 ? 3.622   19.561  -38.646 1.00 34.85 ? 483  PHE B CZ  1 
ATOM   7882 N N   . ALA B 1 484 ? -1.365  19.350  -41.449 1.00 37.37 ? 484  ALA B N   1 
ATOM   7883 C CA  . ALA B 1 484 ? -1.046  19.384  -42.877 1.00 37.54 ? 484  ALA B CA  1 
ATOM   7884 C C   . ALA B 1 484 ? -1.440  20.723  -43.493 1.00 38.02 ? 484  ALA B C   1 
ATOM   7885 O O   . ALA B 1 484 ? -0.644  21.345  -44.201 1.00 37.19 ? 484  ALA B O   1 
ATOM   7886 C CB  . ALA B 1 484 ? -1.720  18.246  -43.613 1.00 37.46 ? 484  ALA B CB  1 
ATOM   7887 N N   . ARG B 1 485 ? -2.674  21.150  -43.217 1.00 39.05 ? 485  ARG B N   1 
ATOM   7888 C CA  . ARG B 1 485 ? -3.207  22.406  -43.754 1.00 40.45 ? 485  ARG B CA  1 
ATOM   7889 C C   . ARG B 1 485 ? -2.400  23.635  -43.346 1.00 40.56 ? 485  ARG B C   1 
ATOM   7890 O O   . ARG B 1 485 ? -2.132  24.491  -44.182 1.00 40.55 ? 485  ARG B O   1 
ATOM   7891 C CB  . ARG B 1 485 ? -4.662  22.612  -43.329 1.00 40.56 ? 485  ARG B CB  1 
ATOM   7892 C CG  . ARG B 1 485 ? -5.692  22.041  -44.273 1.00 43.90 ? 485  ARG B CG  1 
ATOM   7893 C CD  . ARG B 1 485 ? -7.104  22.253  -43.737 1.00 46.47 ? 485  ARG B CD  1 
ATOM   7894 N NE  . ARG B 1 485 ? -7.359  21.372  -42.602 1.00 49.55 ? 485  ARG B NE  1 
ATOM   7895 C CZ  . ARG B 1 485 ? -8.001  20.207  -42.676 1.00 51.01 ? 485  ARG B CZ  1 
ATOM   7896 N NH1 . ARG B 1 485 ? -8.490  19.775  -43.842 1.00 51.53 ? 485  ARG B NH1 1 
ATOM   7897 N NH2 . ARG B 1 485 ? -8.173  19.483  -41.571 1.00 50.34 ? 485  ARG B NH2 1 
ATOM   7898 N N   . THR B 1 486 ? -2.004  23.712  -42.073 1.00 40.86 ? 486  THR B N   1 
ATOM   7899 C CA  . THR B 1 486 ? -1.565  24.993  -41.504 1.00 41.59 ? 486  THR B CA  1 
ATOM   7900 C C   . THR B 1 486 ? -0.199  24.990  -40.793 1.00 41.71 ? 486  THR B C   1 
ATOM   7901 O O   . THR B 1 486 ? 0.372   26.059  -40.538 1.00 41.92 ? 486  THR B O   1 
ATOM   7902 C CB  . THR B 1 486 ? -2.646  25.576  -40.521 1.00 41.60 ? 486  THR B CB  1 
ATOM   7903 O OG1 . THR B 1 486 ? -2.751  24.739  -39.365 1.00 42.30 ? 486  THR B OG1 1 
ATOM   7904 C CG2 . THR B 1 486 ? -4.026  25.674  -41.181 1.00 40.43 ? 486  THR B CG2 1 
ATOM   7905 N N   . GLY B 1 487 ? 0.317   23.805  -40.474 1.00 41.63 ? 487  GLY B N   1 
ATOM   7906 C CA  . GLY B 1 487 ? 1.540   23.678  -39.673 1.00 41.62 ? 487  GLY B CA  1 
ATOM   7907 C C   . GLY B 1 487 ? 1.237   23.671  -38.189 1.00 42.12 ? 487  GLY B C   1 
ATOM   7908 O O   . GLY B 1 487 ? 2.147   23.609  -37.363 1.00 41.70 ? 487  GLY B O   1 
ATOM   7909 N N   . ASP B 1 488 ? -0.062  23.710  -37.871 1.00 42.97 ? 488  ASP B N   1 
ATOM   7910 C CA  . ASP B 1 488 ? -0.590  23.877  -36.525 1.00 43.53 ? 488  ASP B CA  1 
ATOM   7911 C C   . ASP B 1 488 ? -1.768  22.910  -36.404 1.00 44.54 ? 488  ASP B C   1 
ATOM   7912 O O   . ASP B 1 488 ? -2.729  23.020  -37.161 1.00 44.34 ? 488  ASP B O   1 
ATOM   7913 C CB  . ASP B 1 488 ? -1.051  25.333  -36.349 1.00 43.51 ? 488  ASP B CB  1 
ATOM   7914 C CG  . ASP B 1 488 ? -1.550  25.653  -34.936 1.00 43.22 ? 488  ASP B CG  1 
ATOM   7915 O OD1 . ASP B 1 488 ? -1.929  24.731  -34.184 1.00 42.83 ? 488  ASP B OD1 1 
ATOM   7916 O OD2 . ASP B 1 488 ? -1.574  26.855  -34.586 1.00 42.23 ? 488  ASP B OD2 1 
ATOM   7917 N N   . PRO B 1 489 ? -1.701  21.960  -35.451 1.00 45.50 ? 489  PRO B N   1 
ATOM   7918 C CA  . PRO B 1 489 ? -2.722  20.934  -35.353 1.00 46.73 ? 489  PRO B CA  1 
ATOM   7919 C C   . PRO B 1 489 ? -4.040  21.395  -34.738 1.00 48.46 ? 489  PRO B C   1 
ATOM   7920 O O   . PRO B 1 489 ? -4.971  20.605  -34.637 1.00 48.81 ? 489  PRO B O   1 
ATOM   7921 C CB  . PRO B 1 489 ? -2.068  19.890  -34.448 1.00 46.57 ? 489  PRO B CB  1 
ATOM   7922 C CG  . PRO B 1 489 ? -1.145  20.670  -33.594 1.00 45.48 ? 489  PRO B CG  1 
ATOM   7923 C CD  . PRO B 1 489 ? -0.655  21.792  -34.428 1.00 45.26 ? 489  PRO B CD  1 
ATOM   7924 N N   . ASN B 1 490 ? -4.120  22.649  -34.317 1.00 50.75 ? 490  ASN B N   1 
ATOM   7925 C CA  . ASN B 1 490 ? -5.304  23.128  -33.609 1.00 52.85 ? 490  ASN B CA  1 
ATOM   7926 C C   . ASN B 1 490 ? -6.434  23.493  -34.548 1.00 55.17 ? 490  ASN B C   1 
ATOM   7927 O O   . ASN B 1 490 ? -6.202  24.086  -35.605 1.00 55.53 ? 490  ASN B O   1 
ATOM   7928 C CB  . ASN B 1 490 ? -4.956  24.317  -32.717 1.00 52.10 ? 490  ASN B CB  1 
ATOM   7929 C CG  . ASN B 1 490 ? -4.237  23.905  -31.464 1.00 50.76 ? 490  ASN B CG  1 
ATOM   7930 O OD1 . ASN B 1 490 ? -4.834  23.345  -30.541 1.00 50.48 ? 490  ASN B OD1 1 
ATOM   7931 N ND2 . ASN B 1 490 ? -2.947  24.176  -31.417 1.00 48.34 ? 490  ASN B ND2 1 
ATOM   7932 N N   . ASP B 1 491 ? -7.654  23.129  -34.153 1.00 58.31 ? 491  ASP B N   1 
ATOM   7933 C CA  . ASP B 1 491 ? -8.857  23.446  -34.917 1.00 61.33 ? 491  ASP B CA  1 
ATOM   7934 C C   . ASP B 1 491 ? -9.073  24.963  -34.869 1.00 63.44 ? 491  ASP B C   1 
ATOM   7935 O O   . ASP B 1 491 ? -9.446  25.503  -33.814 1.00 63.63 ? 491  ASP B O   1 
ATOM   7936 C CB  . ASP B 1 491 ? -10.067 22.686  -34.348 1.00 61.47 ? 491  ASP B CB  1 
ATOM   7937 C CG  . ASP B 1 491 ? -11.144 22.379  -35.404 1.00 62.70 ? 491  ASP B CG  1 
ATOM   7938 O OD1 . ASP B 1 491 ? -11.175 23.031  -36.475 1.00 63.32 ? 491  ASP B OD1 1 
ATOM   7939 O OD2 . ASP B 1 491 ? -11.977 21.471  -35.151 1.00 64.25 ? 491  ASP B OD2 1 
ATOM   7940 N N   . PRO B 1 492 ? -8.859  25.656  -36.011 1.00 65.42 ? 492  PRO B N   1 
ATOM   7941 C CA  . PRO B 1 492 ? -8.854  27.119  -36.009 1.00 67.16 ? 492  PRO B CA  1 
ATOM   7942 C C   . PRO B 1 492 ? -10.275 27.673  -35.875 1.00 68.81 ? 492  PRO B C   1 
ATOM   7943 O O   . PRO B 1 492 ? -10.496 28.875  -36.079 1.00 69.06 ? 492  PRO B O   1 
ATOM   7944 C CB  . PRO B 1 492 ? -8.251  27.477  -37.375 1.00 67.34 ? 492  PRO B CB  1 
ATOM   7945 C CG  . PRO B 1 492 ? -8.646  26.334  -38.272 1.00 66.76 ? 492  PRO B CG  1 
ATOM   7946 C CD  . PRO B 1 492 ? -8.698  25.104  -37.374 1.00 65.87 ? 492  PRO B CD  1 
ATOM   7947 N N   . ARG B 1 493 ? -11.216 26.778  -35.561 1.00 70.34 ? 493  ARG B N   1 
ATOM   7948 C CA  . ARG B 1 493 ? -12.575 27.123  -35.151 1.00 72.16 ? 493  ARG B CA  1 
ATOM   7949 C C   . ARG B 1 493 ? -12.934 26.234  -33.953 1.00 72.80 ? 493  ARG B C   1 
ATOM   7950 O O   . ARG B 1 493 ? -13.472 25.128  -34.113 1.00 73.05 ? 493  ARG B O   1 
ATOM   7951 C CB  . ARG B 1 493 ? -13.575 26.923  -36.307 1.00 72.61 ? 493  ARG B CB  1 
ATOM   7952 C CG  . ARG B 1 493 ? -13.382 27.880  -37.498 1.00 74.38 ? 493  ARG B CG  1 
ATOM   7953 C CD  . ARG B 1 493 ? -13.913 29.285  -37.195 1.00 76.73 ? 493  ARG B CD  1 
ATOM   7954 N NE  . ARG B 1 493 ? -12.926 30.326  -37.487 1.00 76.65 ? 493  ARG B NE  1 
ATOM   7955 C CZ  . ARG B 1 493 ? -13.224 31.566  -37.870 1.00 77.35 ? 493  ARG B CZ  1 
ATOM   7956 N NH1 . ARG B 1 493 ? -14.488 31.942  -38.043 1.00 77.52 ? 493  ARG B NH1 1 
ATOM   7957 N NH2 . ARG B 1 493 ? -12.250 32.432  -38.095 1.00 77.30 ? 493  ARG B NH2 1 
ATOM   7958 N N   . ASP B 1 494 ? -12.603 26.715  -32.758 1.00 73.46 ? 494  ASP B N   1 
ATOM   7959 C CA  . ASP B 1 494 ? -12.792 25.961  -31.519 1.00 74.01 ? 494  ASP B CA  1 
ATOM   7960 C C   . ASP B 1 494 ? -12.164 26.710  -30.332 1.00 73.99 ? 494  ASP B C   1 
ATOM   7961 O O   . ASP B 1 494 ? -11.254 27.527  -30.518 1.00 74.07 ? 494  ASP B O   1 
ATOM   7962 C CB  . ASP B 1 494 ? -12.187 24.553  -31.643 1.00 74.23 ? 494  ASP B CB  1 
ATOM   7963 C CG  . ASP B 1 494 ? -12.180 23.803  -30.324 1.00 75.78 ? 494  ASP B CG  1 
ATOM   7964 O OD1 . ASP B 1 494 ? -13.278 23.619  -29.739 1.00 76.71 ? 494  ASP B OD1 1 
ATOM   7965 O OD2 . ASP B 1 494 ? -11.075 23.418  -29.869 1.00 76.43 ? 494  ASP B OD2 1 
ATOM   7966 N N   . SER B 1 495 ? -12.665 26.424  -29.124 1.00 73.68 ? 495  SER B N   1 
ATOM   7967 C CA  . SER B 1 495 ? -12.141 26.981  -27.867 1.00 73.23 ? 495  SER B CA  1 
ATOM   7968 C C   . SER B 1 495 ? -12.296 25.958  -26.734 1.00 72.89 ? 495  SER B C   1 
ATOM   7969 O O   . SER B 1 495 ? -11.460 25.889  -25.821 1.00 72.81 ? 495  SER B O   1 
ATOM   7970 C CB  . SER B 1 495 ? -12.869 28.277  -27.503 1.00 73.21 ? 495  SER B CB  1 
ATOM   7971 O OG  . SER B 1 495 ? -13.025 29.114  -28.639 1.00 73.49 ? 495  SER B OG  1 
ATOM   7972 N N   . LYS B 1 496 ? -13.387 25.189  -26.819 1.00 72.22 ? 496  LYS B N   1 
ATOM   7973 C CA  . LYS B 1 496 ? -13.718 24.073  -25.923 1.00 71.32 ? 496  LYS B CA  1 
ATOM   7974 C C   . LYS B 1 496 ? -12.843 22.834  -26.240 1.00 70.19 ? 496  LYS B C   1 
ATOM   7975 O O   . LYS B 1 496 ? -12.921 22.250  -27.344 1.00 70.10 ? 496  LYS B O   1 
ATOM   7976 C CB  . LYS B 1 496 ? -15.227 23.753  -26.048 1.00 71.91 ? 496  LYS B CB  1 
ATOM   7977 C CG  . LYS B 1 496 ? -15.704 22.353  -25.544 1.00 72.67 ? 496  LYS B CG  1 
ATOM   7978 C CD  . LYS B 1 496 ? -16.024 22.329  -24.046 1.00 73.46 ? 496  LYS B CD  1 
ATOM   7979 C CE  . LYS B 1 496 ? -16.901 23.523  -23.628 1.00 74.32 ? 496  LYS B CE  1 
ATOM   7980 N NZ  . LYS B 1 496 ? -18.141 23.707  -24.450 1.00 73.78 ? 496  LYS B NZ  1 
ATOM   7981 N N   . SER B 1 497 ? -12.059 22.426  -25.236 1.00 68.37 ? 497  SER B N   1 
ATOM   7982 C CA  . SER B 1 497 ? -10.856 21.569  -25.387 1.00 66.46 ? 497  SER B CA  1 
ATOM   7983 C C   . SER B 1 497 ? -9.635  22.495  -25.502 1.00 64.13 ? 497  SER B C   1 
ATOM   7984 O O   . SER B 1 497 ? -9.601  23.379  -26.379 1.00 64.11 ? 497  SER B O   1 
ATOM   7985 C CB  . SER B 1 497 ? -10.936 20.596  -26.583 1.00 66.93 ? 497  SER B CB  1 
ATOM   7986 O OG  . SER B 1 497 ? -9.854  19.666  -26.582 1.00 67.96 ? 497  SER B OG  1 
ATOM   7987 N N   . PRO B 1 498 ? -8.633  22.300  -24.617 1.00 61.50 ? 498  PRO B N   1 
ATOM   7988 C CA  . PRO B 1 498 ? -7.553  23.283  -24.506 1.00 59.25 ? 498  PRO B CA  1 
ATOM   7989 C C   . PRO B 1 498 ? -6.736  23.324  -25.788 1.00 56.49 ? 498  PRO B C   1 
ATOM   7990 O O   . PRO B 1 498 ? -6.853  22.428  -26.616 1.00 55.88 ? 498  PRO B O   1 
ATOM   7991 C CB  . PRO B 1 498 ? -6.704  22.757  -23.336 1.00 59.55 ? 498  PRO B CB  1 
ATOM   7992 C CG  . PRO B 1 498 ? -7.571  21.725  -22.641 1.00 60.31 ? 498  PRO B CG  1 
ATOM   7993 C CD  . PRO B 1 498 ? -8.426  21.150  -23.718 1.00 61.22 ? 498  PRO B CD  1 
ATOM   7994 N N   . GLN B 1 499 ? -5.935  24.365  -25.966 1.00 53.44 ? 499  GLN B N   1 
ATOM   7995 C CA  . GLN B 1 499 ? -5.102  24.433  -27.157 1.00 50.39 ? 499  GLN B CA  1 
ATOM   7996 C C   . GLN B 1 499 ? -3.867  23.526  -27.020 1.00 47.48 ? 499  GLN B C   1 
ATOM   7997 O O   . GLN B 1 499 ? -3.371  23.299  -25.935 1.00 46.86 ? 499  GLN B O   1 
ATOM   7998 C CB  . GLN B 1 499 ? -4.739  25.887  -27.497 1.00 51.13 ? 499  GLN B CB  1 
ATOM   7999 C CG  . GLN B 1 499 ? -5.944  26.765  -27.879 1.00 51.97 ? 499  GLN B CG  1 
ATOM   8000 C CD  . GLN B 1 499 ? -6.427  26.569  -29.319 1.00 55.27 ? 499  GLN B CD  1 
ATOM   8001 O OE1 . GLN B 1 499 ? -5.663  26.765  -30.275 1.00 56.65 ? 499  GLN B OE1 1 
ATOM   8002 N NE2 . GLN B 1 499 ? -7.716  26.219  -29.481 1.00 55.77 ? 499  GLN B NE2 1 
ATOM   8003 N N   . TRP B 1 500 ? -3.415  22.981  -28.140 1.00 44.29 ? 500  TRP B N   1 
ATOM   8004 C CA  . TRP B 1 500 ? -2.211  22.176  -28.194 1.00 41.14 ? 500  TRP B CA  1 
ATOM   8005 C C   . TRP B 1 500 ? -1.007  23.137  -28.311 1.00 39.45 ? 500  TRP B C   1 
ATOM   8006 O O   . TRP B 1 500 ? -0.793  23.765  -29.347 1.00 38.51 ? 500  TRP B O   1 
ATOM   8007 C CB  . TRP B 1 500 ? -2.294  21.234  -29.402 1.00 40.33 ? 500  TRP B CB  1 
ATOM   8008 C CG  . TRP B 1 500 ? -1.219  20.187  -29.488 1.00 39.41 ? 500  TRP B CG  1 
ATOM   8009 C CD1 . TRP B 1 500 ? 0.013   20.225  -28.920 1.00 38.97 ? 500  TRP B CD1 1 
ATOM   8010 C CD2 . TRP B 1 500 ? -1.272  18.966  -30.238 1.00 39.24 ? 500  TRP B CD2 1 
ATOM   8011 N NE1 . TRP B 1 500 ? 0.724   19.103  -29.250 1.00 38.69 ? 500  TRP B NE1 1 
ATOM   8012 C CE2 . TRP B 1 500 ? -0.042  18.313  -30.058 1.00 38.36 ? 500  TRP B CE2 1 
ATOM   8013 C CE3 . TRP B 1 500 ? -2.249  18.355  -31.034 1.00 39.11 ? 500  TRP B CE3 1 
ATOM   8014 C CZ2 . TRP B 1 500 ? 0.239   17.079  -30.633 1.00 38.94 ? 500  TRP B CZ2 1 
ATOM   8015 C CZ3 . TRP B 1 500 ? -1.967  17.128  -31.602 1.00 39.29 ? 500  TRP B CZ3 1 
ATOM   8016 C CH2 . TRP B 1 500 ? -0.731  16.505  -31.403 1.00 38.47 ? 500  TRP B CH2 1 
ATOM   8017 N N   . PRO B 1 501 ? -0.223  23.274  -27.238 1.00 38.10 ? 501  PRO B N   1 
ATOM   8018 C CA  . PRO B 1 501 ? 0.832   24.265  -27.364 1.00 37.56 ? 501  PRO B CA  1 
ATOM   8019 C C   . PRO B 1 501 ? 2.059   23.684  -28.070 1.00 37.14 ? 501  PRO B C   1 
ATOM   8020 O O   . PRO B 1 501 ? 2.293   22.467  -28.010 1.00 36.71 ? 501  PRO B O   1 
ATOM   8021 C CB  . PRO B 1 501 ? 1.148   24.613  -25.912 1.00 36.87 ? 501  PRO B CB  1 
ATOM   8022 C CG  . PRO B 1 501 ? 0.864   23.356  -25.177 1.00 37.28 ? 501  PRO B CG  1 
ATOM   8023 C CD  . PRO B 1 501 ? -0.214  22.625  -25.918 1.00 37.60 ? 501  PRO B CD  1 
ATOM   8024 N N   . PRO B 1 502 ? 2.819   24.545  -28.761 1.00 36.57 ? 502  PRO B N   1 
ATOM   8025 C CA  . PRO B 1 502 ? 4.085   24.130  -29.346 1.00 36.31 ? 502  PRO B CA  1 
ATOM   8026 C C   . PRO B 1 502 ? 5.040   23.559  -28.295 1.00 36.30 ? 502  PRO B C   1 
ATOM   8027 O O   . PRO B 1 502 ? 5.036   23.975  -27.144 1.00 35.99 ? 502  PRO B O   1 
ATOM   8028 C CB  . PRO B 1 502 ? 4.651   25.422  -29.925 1.00 36.34 ? 502  PRO B CB  1 
ATOM   8029 C CG  . PRO B 1 502 ? 3.467   26.323  -30.119 1.00 36.87 ? 502  PRO B CG  1 
ATOM   8030 C CD  . PRO B 1 502 ? 2.491   25.954  -29.047 1.00 36.35 ? 502  PRO B CD  1 
ATOM   8031 N N   . TYR B 1 503 ? 5.836   22.583  -28.692 1.00 36.60 ? 503  TYR B N   1 
ATOM   8032 C CA  . TYR B 1 503 ? 6.875   22.074  -27.834 1.00 36.94 ? 503  TYR B CA  1 
ATOM   8033 C C   . TYR B 1 503 ? 8.051   23.038  -27.878 1.00 37.62 ? 503  TYR B C   1 
ATOM   8034 O O   . TYR B 1 503 ? 8.408   23.535  -28.949 1.00 37.75 ? 503  TYR B O   1 
ATOM   8035 C CB  . TYR B 1 503 ? 7.294   20.687  -28.289 1.00 36.31 ? 503  TYR B CB  1 
ATOM   8036 C CG  . TYR B 1 503 ? 8.379   20.090  -27.443 1.00 36.04 ? 503  TYR B CG  1 
ATOM   8037 C CD1 . TYR B 1 503 ? 9.719   20.317  -27.741 1.00 35.20 ? 503  TYR B CD1 1 
ATOM   8038 C CD2 . TYR B 1 503 ? 8.070   19.295  -26.350 1.00 34.19 ? 503  TYR B CD2 1 
ATOM   8039 C CE1 . TYR B 1 503 ? 10.702  19.776  -26.971 1.00 35.92 ? 503  TYR B CE1 1 
ATOM   8040 C CE2 . TYR B 1 503 ? 9.048   18.752  -25.581 1.00 35.04 ? 503  TYR B CE2 1 
ATOM   8041 C CZ  . TYR B 1 503 ? 10.366  18.993  -25.892 1.00 36.17 ? 503  TYR B CZ  1 
ATOM   8042 O OH  . TYR B 1 503 ? 11.365  18.441  -25.122 1.00 37.57 ? 503  TYR B OH  1 
ATOM   8043 N N   . THR B 1 504 ? 8.636   23.308  -26.708 1.00 38.44 ? 504  THR B N   1 
ATOM   8044 C CA  . THR B 1 504 ? 9.761   24.244  -26.572 1.00 39.15 ? 504  THR B CA  1 
ATOM   8045 C C   . THR B 1 504 ? 10.766  23.648  -25.603 1.00 39.74 ? 504  THR B C   1 
ATOM   8046 O O   . THR B 1 504 ? 10.414  22.791  -24.801 1.00 40.05 ? 504  THR B O   1 
ATOM   8047 C CB  . THR B 1 504 ? 9.311   25.619  -26.035 1.00 39.28 ? 504  THR B CB  1 
ATOM   8048 O OG1 . THR B 1 504 ? 8.811   25.474  -24.697 1.00 39.79 ? 504  THR B OG1 1 
ATOM   8049 C CG2 . THR B 1 504 ? 8.226   26.248  -26.929 1.00 38.62 ? 504  THR B CG2 1 
ATOM   8050 N N   . THR B 1 505 ? 12.016  24.086  -25.670 1.00 40.52 ? 505  THR B N   1 
ATOM   8051 C CA  . THR B 1 505 ? 13.050  23.524  -24.788 1.00 41.28 ? 505  THR B CA  1 
ATOM   8052 C C   . THR B 1 505 ? 12.865  24.015  -23.352 1.00 41.41 ? 505  THR B C   1 
ATOM   8053 O O   . THR B 1 505 ? 13.216  23.309  -22.394 1.00 41.66 ? 505  THR B O   1 
ATOM   8054 C CB  . THR B 1 505 ? 14.505  23.821  -25.287 1.00 41.25 ? 505  THR B CB  1 
ATOM   8055 O OG1 . THR B 1 505 ? 14.828  25.193  -25.063 1.00 42.77 ? 505  THR B OG1 1 
ATOM   8056 C CG2 . THR B 1 505 ? 14.635  23.548  -26.762 1.00 41.03 ? 505  THR B CG2 1 
ATOM   8057 N N   . ALA B 1 506 ? 12.311  25.223  -23.224 1.00 41.37 ? 506  ALA B N   1 
ATOM   8058 C CA  . ALA B 1 506 ? 11.972  25.813  -21.937 1.00 41.86 ? 506  ALA B CA  1 
ATOM   8059 C C   . ALA B 1 506 ? 10.835  25.045  -21.259 1.00 42.11 ? 506  ALA B C   1 
ATOM   8060 O O   . ALA B 1 506 ? 11.042  24.398  -20.227 1.00 42.65 ? 506  ALA B O   1 
ATOM   8061 C CB  . ALA B 1 506 ? 11.568  27.287  -22.126 1.00 42.17 ? 506  ALA B CB  1 
ATOM   8062 N N   . ALA B 1 507 ? 9.642   25.110  -21.859 1.00 41.79 ? 507  ALA B N   1 
ATOM   8063 C CA  . ALA B 1 507 ? 8.427   24.582  -21.250 1.00 41.11 ? 507  ALA B CA  1 
ATOM   8064 C C   . ALA B 1 507 ? 8.204   23.085  -21.469 1.00 40.96 ? 507  ALA B C   1 
ATOM   8065 O O   . ALA B 1 507 ? 7.523   22.453  -20.674 1.00 40.95 ? 507  ALA B O   1 
ATOM   8066 C CB  . ALA B 1 507 ? 7.234   25.363  -21.734 1.00 41.28 ? 507  ALA B CB  1 
ATOM   8067 N N   . GLN B 1 508 ? 8.758   22.530  -22.548 1.00 40.50 ? 508  GLN B N   1 
ATOM   8068 C CA  . GLN B 1 508 ? 8.641   21.084  -22.875 1.00 40.23 ? 508  GLN B CA  1 
ATOM   8069 C C   . GLN B 1 508 ? 7.220   20.541  -22.840 1.00 39.47 ? 508  GLN B C   1 
ATOM   8070 O O   . GLN B 1 508 ? 6.951   19.450  -22.330 1.00 39.74 ? 508  GLN B O   1 
ATOM   8071 C CB  . GLN B 1 508 ? 9.568   20.234  -22.008 1.00 40.09 ? 508  GLN B CB  1 
ATOM   8072 C CG  . GLN B 1 508 ? 11.030  20.520  -22.261 1.00 41.49 ? 508  GLN B CG  1 
ATOM   8073 C CD  . GLN B 1 508 ? 11.911  20.026  -21.143 1.00 41.78 ? 508  GLN B CD  1 
ATOM   8074 O OE1 . GLN B 1 508 ? 12.409  20.813  -20.339 1.00 42.23 ? 508  GLN B OE1 1 
ATOM   8075 N NE2 . GLN B 1 508 ? 12.099  18.714  -21.072 1.00 42.11 ? 508  GLN B NE2 1 
ATOM   8076 N N   . GLN B 1 509 ? 6.313   21.311  -23.412 1.00 38.71 ? 509  GLN B N   1 
ATOM   8077 C CA  . GLN B 1 509 ? 4.912   20.967  -23.390 1.00 37.64 ? 509  GLN B CA  1 
ATOM   8078 C C   . GLN B 1 509 ? 4.507   20.035  -24.519 1.00 37.56 ? 509  GLN B C   1 
ATOM   8079 O O   . GLN B 1 509 ? 4.806   20.269  -25.692 1.00 37.19 ? 509  GLN B O   1 
ATOM   8080 C CB  . GLN B 1 509 ? 4.075   22.228  -23.444 1.00 37.56 ? 509  GLN B CB  1 
ATOM   8081 C CG  . GLN B 1 509 ? 4.195   23.117  -22.228 1.00 36.26 ? 509  GLN B CG  1 
ATOM   8082 C CD  . GLN B 1 509 ? 3.368   24.362  -22.392 1.00 34.83 ? 509  GLN B CD  1 
ATOM   8083 O OE1 . GLN B 1 509 ? 3.613   25.166  -23.292 1.00 35.19 ? 509  GLN B OE1 1 
ATOM   8084 N NE2 . GLN B 1 509 ? 2.360   24.519  -21.543 1.00 34.69 ? 509  GLN B NE2 1 
ATOM   8085 N N   . TYR B 1 510 ? 3.800   18.981  -24.143 1.00 37.32 ? 510  TYR B N   1 
ATOM   8086 C CA  . TYR B 1 510 ? 3.228   18.049  -25.097 1.00 37.26 ? 510  TYR B CA  1 
ATOM   8087 C C   . TYR B 1 510 ? 1.821   17.672  -24.634 1.00 36.96 ? 510  TYR B C   1 
ATOM   8088 O O   . TYR B 1 510 ? 1.429   17.970  -23.505 1.00 37.50 ? 510  TYR B O   1 
ATOM   8089 C CB  . TYR B 1 510 ? 4.119   16.809  -25.234 1.00 36.81 ? 510  TYR B CB  1 
ATOM   8090 C CG  . TYR B 1 510 ? 4.199   15.981  -23.982 1.00 36.38 ? 510  TYR B CG  1 
ATOM   8091 C CD1 . TYR B 1 510 ? 5.130   16.279  -22.996 1.00 36.10 ? 510  TYR B CD1 1 
ATOM   8092 C CD2 . TYR B 1 510 ? 3.339   14.901  -23.776 1.00 37.13 ? 510  TYR B CD2 1 
ATOM   8093 C CE1 . TYR B 1 510 ? 5.220   15.528  -21.853 1.00 37.34 ? 510  TYR B CE1 1 
ATOM   8094 C CE2 . TYR B 1 510 ? 3.414   14.129  -22.609 1.00 36.57 ? 510  TYR B CE2 1 
ATOM   8095 C CZ  . TYR B 1 510 ? 4.360   14.456  -21.657 1.00 37.49 ? 510  TYR B CZ  1 
ATOM   8096 O OH  . TYR B 1 510 ? 4.470   13.725  -20.498 1.00 37.97 ? 510  TYR B OH  1 
ATOM   8097 N N   . VAL B 1 511 ? 1.053   17.017  -25.491 1.00 36.46 ? 511  VAL B N   1 
ATOM   8098 C CA  . VAL B 1 511 ? -0.310  16.677  -25.123 1.00 35.91 ? 511  VAL B CA  1 
ATOM   8099 C C   . VAL B 1 511 ? -0.500  15.178  -25.115 1.00 36.64 ? 511  VAL B C   1 
ATOM   8100 O O   . VAL B 1 511 ? 0.132   14.458  -25.880 1.00 36.60 ? 511  VAL B O   1 
ATOM   8101 C CB  . VAL B 1 511 ? -1.311  17.299  -26.087 1.00 35.65 ? 511  VAL B CB  1 
ATOM   8102 C CG1 . VAL B 1 511 ? -1.154  18.810  -26.126 1.00 33.74 ? 511  VAL B CG1 1 
ATOM   8103 C CG2 . VAL B 1 511 ? -1.142  16.695  -27.473 1.00 34.83 ? 511  VAL B CG2 1 
ATOM   8104 N N   . SER B 1 512 ? -1.373  14.698  -24.246 1.00 37.67 ? 512  SER B N   1 
ATOM   8105 C CA  . SER B 1 512 ? -1.766  13.293  -24.289 1.00 38.81 ? 512  SER B CA  1 
ATOM   8106 C C   . SER B 1 512 ? -2.903  13.114  -25.286 1.00 39.62 ? 512  SER B C   1 
ATOM   8107 O O   . SER B 1 512 ? -3.894  13.861  -25.259 1.00 39.49 ? 512  SER B O   1 
ATOM   8108 C CB  . SER B 1 512 ? -2.234  12.830  -22.924 1.00 38.62 ? 512  SER B CB  1 
ATOM   8109 O OG  . SER B 1 512 ? -3.335  13.614  -22.523 1.00 39.47 ? 512  SER B OG  1 
ATOM   8110 N N   . LEU B 1 513 ? -2.747  12.142  -26.180 1.00 40.60 ? 513  LEU B N   1 
ATOM   8111 C CA  . LEU B 1 513 ? -3.814  11.790  -27.103 1.00 41.37 ? 513  LEU B CA  1 
ATOM   8112 C C   . LEU B 1 513 ? -4.432  10.516  -26.589 1.00 42.35 ? 513  LEU B C   1 
ATOM   8113 O O   . LEU B 1 513 ? -3.770  9.471   -26.524 1.00 42.45 ? 513  LEU B O   1 
ATOM   8114 C CB  . LEU B 1 513 ? -3.289  11.625  -28.530 1.00 41.43 ? 513  LEU B CB  1 
ATOM   8115 C CG  . LEU B 1 513 ? -2.707  12.875  -29.195 1.00 40.66 ? 513  LEU B CG  1 
ATOM   8116 C CD1 . LEU B 1 513 ? -2.062  12.550  -30.530 1.00 39.29 ? 513  LEU B CD1 1 
ATOM   8117 C CD2 . LEU B 1 513 ? -3.789  13.909  -29.376 1.00 39.56 ? 513  LEU B CD2 1 
ATOM   8118 N N   . ASN B 1 514 ? -5.687  10.641  -26.160 1.00 43.51 ? 514  ASN B N   1 
ATOM   8119 C CA  . ASN B 1 514 ? -6.486  9.534   -25.638 1.00 44.50 ? 514  ASN B CA  1 
ATOM   8120 C C   . ASN B 1 514 ? -7.946  9.952   -25.652 1.00 45.33 ? 514  ASN B C   1 
ATOM   8121 O O   . ASN B 1 514 ? -8.285  10.986  -26.242 1.00 45.55 ? 514  ASN B O   1 
ATOM   8122 C CB  . ASN B 1 514 ? -6.037  9.127   -24.234 1.00 44.48 ? 514  ASN B CB  1 
ATOM   8123 C CG  . ASN B 1 514 ? -6.160  10.255  -23.232 1.00 45.40 ? 514  ASN B CG  1 
ATOM   8124 O OD1 . ASN B 1 514 ? -7.094  11.063  -23.295 1.00 47.29 ? 514  ASN B OD1 1 
ATOM   8125 N ND2 . ASN B 1 514 ? -5.214  10.321  -22.295 1.00 45.28 ? 514  ASN B ND2 1 
ATOM   8126 N N   . LEU B 1 515 ? -8.810  9.173   -25.003 1.00 46.31 ? 515  LEU B N   1 
ATOM   8127 C CA  . LEU B 1 515 ? -10.254 9.394   -25.130 1.00 47.28 ? 515  LEU B CA  1 
ATOM   8128 C C   . LEU B 1 515 ? -10.731 10.669  -24.446 1.00 47.86 ? 515  LEU B C   1 
ATOM   8129 O O   . LEU B 1 515 ? -11.711 11.271  -24.886 1.00 47.82 ? 515  LEU B O   1 
ATOM   8130 C CB  . LEU B 1 515 ? -11.057 8.198   -24.631 1.00 47.21 ? 515  LEU B CB  1 
ATOM   8131 C CG  . LEU B 1 515 ? -10.820 6.844   -25.301 1.00 47.70 ? 515  LEU B CG  1 
ATOM   8132 C CD1 . LEU B 1 515 ? -11.714 5.802   -24.631 1.00 47.94 ? 515  LEU B CD1 1 
ATOM   8133 C CD2 . LEU B 1 515 ? -11.042 6.883   -26.821 1.00 47.22 ? 515  LEU B CD2 1 
ATOM   8134 N N   . LYS B 1 516 ? -10.041 11.075  -23.381 1.00 48.35 ? 516  LYS B N   1 
ATOM   8135 C CA  . LYS B 1 516 ? -10.338 12.346  -22.712 1.00 49.31 ? 516  LYS B CA  1 
ATOM   8136 C C   . LYS B 1 516 ? -9.866  13.502  -23.597 1.00 48.56 ? 516  LYS B C   1 
ATOM   8137 O O   . LYS B 1 516 ? -9.030  13.293  -24.472 1.00 48.97 ? 516  LYS B O   1 
ATOM   8138 C CB  . LYS B 1 516 ? -9.661  12.410  -21.337 1.00 49.23 ? 516  LYS B CB  1 
ATOM   8139 C CG  . LYS B 1 516 ? -10.039 11.266  -20.382 1.00 50.80 ? 516  LYS B CG  1 
ATOM   8140 C CD  . LYS B 1 516 ? -9.258  11.338  -19.042 1.00 51.46 ? 516  LYS B CD  1 
ATOM   8141 C CE  . LYS B 1 516 ? -7.777  10.908  -19.195 1.00 53.19 ? 516  LYS B CE  1 
ATOM   8142 N NZ  . LYS B 1 516 ? -7.075  10.734  -17.873 1.00 53.33 ? 516  LYS B NZ  1 
ATOM   8143 N N   . PRO B 1 517 ? -10.402 14.717  -23.386 1.00 48.04 ? 517  PRO B N   1 
ATOM   8144 C CA  . PRO B 1 517 ? -9.871  15.904  -24.088 1.00 47.41 ? 517  PRO B CA  1 
ATOM   8145 C C   . PRO B 1 517 ? -8.361  16.090  -23.859 1.00 46.25 ? 517  PRO B C   1 
ATOM   8146 O O   . PRO B 1 517 ? -7.824  15.569  -22.870 1.00 45.63 ? 517  PRO B O   1 
ATOM   8147 C CB  . PRO B 1 517 ? -10.634 17.070  -23.433 1.00 47.49 ? 517  PRO B CB  1 
ATOM   8148 C CG  . PRO B 1 517 ? -11.901 16.461  -22.935 1.00 47.57 ? 517  PRO B CG  1 
ATOM   8149 C CD  . PRO B 1 517 ? -11.521 15.066  -22.488 1.00 48.24 ? 517  PRO B CD  1 
ATOM   8150 N N   . LEU B 1 518 ? -7.692  16.816  -24.762 1.00 45.05 ? 518  LEU B N   1 
ATOM   8151 C CA  . LEU B 1 518 ? -6.255  17.084  -24.627 1.00 44.28 ? 518  LEU B CA  1 
ATOM   8152 C C   . LEU B 1 518 ? -5.910  17.517  -23.220 1.00 43.96 ? 518  LEU B C   1 
ATOM   8153 O O   . LEU B 1 518 ? -6.568  18.378  -22.647 1.00 44.06 ? 518  LEU B O   1 
ATOM   8154 C CB  . LEU B 1 518 ? -5.784  18.201  -25.557 1.00 44.24 ? 518  LEU B CB  1 
ATOM   8155 C CG  . LEU B 1 518 ? -5.614  17.993  -27.053 1.00 44.58 ? 518  LEU B CG  1 
ATOM   8156 C CD1 . LEU B 1 518 ? -5.008  19.244  -27.689 1.00 44.30 ? 518  LEU B CD1 1 
ATOM   8157 C CD2 . LEU B 1 518 ? -4.792  16.766  -27.369 1.00 43.40 ? 518  LEU B CD2 1 
ATOM   8158 N N   . GLU B 1 519 ? -4.873  16.913  -22.670 1.00 43.19 ? 519  GLU B N   1 
ATOM   8159 C CA  . GLU B 1 519 ? -4.294  17.376  -21.436 1.00 43.26 ? 519  GLU B CA  1 
ATOM   8160 C C   . GLU B 1 519 ? -2.844  17.797  -21.768 1.00 42.31 ? 519  GLU B C   1 
ATOM   8161 O O   . GLU B 1 519 ? -2.121  17.043  -22.424 1.00 42.79 ? 519  GLU B O   1 
ATOM   8162 C CB  . GLU B 1 519 ? -4.371  16.242  -20.414 1.00 42.85 ? 519  GLU B CB  1 
ATOM   8163 C CG  . GLU B 1 519 ? -3.341  16.272  -19.298 1.00 44.86 ? 519  GLU B CG  1 
ATOM   8164 C CD  . GLU B 1 519 ? -3.520  15.121  -18.317 1.00 45.22 ? 519  GLU B CD  1 
ATOM   8165 O OE1 . GLU B 1 519 ? -4.700  14.865  -17.938 1.00 50.42 ? 519  GLU B OE1 1 
ATOM   8166 O OE2 . GLU B 1 519 ? -2.502  14.482  -17.932 1.00 43.85 ? 519  GLU B OE2 1 
ATOM   8167 N N   . VAL B 1 520 ? -2.432  18.995  -21.360 1.00 40.91 ? 520  VAL B N   1 
ATOM   8168 C CA  . VAL B 1 520 ? -1.059  19.446  -21.591 1.00 39.88 ? 520  VAL B CA  1 
ATOM   8169 C C   . VAL B 1 520 ? -0.163  18.961  -20.459 1.00 39.41 ? 520  VAL B C   1 
ATOM   8170 O O   . VAL B 1 520 ? -0.482  19.138  -19.295 1.00 39.70 ? 520  VAL B O   1 
ATOM   8171 C CB  . VAL B 1 520 ? -0.953  20.990  -21.743 1.00 39.76 ? 520  VAL B CB  1 
ATOM   8172 C CG1 . VAL B 1 520 ? 0.503   21.422  -21.902 1.00 39.08 ? 520  VAL B CG1 1 
ATOM   8173 C CG2 . VAL B 1 520 ? -1.771  21.472  -22.934 1.00 39.22 ? 520  VAL B CG2 1 
ATOM   8174 N N   . ARG B 1 521 ? 0.939   18.318  -20.816 1.00 38.93 ? 521  ARG B N   1 
ATOM   8175 C CA  . ARG B 1 521 ? 1.943   17.879  -19.852 1.00 38.67 ? 521  ARG B CA  1 
ATOM   8176 C C   . ARG B 1 521 ? 3.281   18.496  -20.218 1.00 38.34 ? 521  ARG B C   1 
ATOM   8177 O O   . ARG B 1 521 ? 3.481   18.948  -21.341 1.00 38.19 ? 521  ARG B O   1 
ATOM   8178 C CB  . ARG B 1 521 ? 2.061   16.360  -19.858 1.00 38.79 ? 521  ARG B CB  1 
ATOM   8179 C CG  . ARG B 1 521 ? 0.763   15.654  -19.505 1.00 39.07 ? 521  ARG B CG  1 
ATOM   8180 C CD  . ARG B 1 521 ? 0.876   14.150  -19.579 1.00 39.35 ? 521  ARG B CD  1 
ATOM   8181 N NE  . ARG B 1 521 ? -0.466  13.591  -19.588 1.00 42.33 ? 521  ARG B NE  1 
ATOM   8182 C CZ  . ARG B 1 521 ? -0.778  12.311  -19.780 1.00 43.00 ? 521  ARG B CZ  1 
ATOM   8183 N NH1 . ARG B 1 521 ? 0.168   11.395  -19.992 1.00 41.26 ? 521  ARG B NH1 1 
ATOM   8184 N NH2 . ARG B 1 521 ? -2.060  11.957  -19.769 1.00 42.36 ? 521  ARG B NH2 1 
ATOM   8185 N N   . ARG B 1 522 ? 4.200   18.511  -19.266 1.00 38.52 ? 522  ARG B N   1 
ATOM   8186 C CA  . ARG B 1 522 ? 5.496   19.126  -19.472 1.00 38.78 ? 522  ARG B CA  1 
ATOM   8187 C C   . ARG B 1 522 ? 6.581   18.094  -19.239 1.00 39.09 ? 522  ARG B C   1 
ATOM   8188 O O   . ARG B 1 522 ? 6.513   17.322  -18.281 1.00 38.96 ? 522  ARG B O   1 
ATOM   8189 C CB  . ARG B 1 522 ? 5.671   20.320  -18.537 1.00 38.49 ? 522  ARG B CB  1 
ATOM   8190 C CG  . ARG B 1 522 ? 4.783   21.505  -18.898 1.00 39.43 ? 522  ARG B CG  1 
ATOM   8191 C CD  . ARG B 1 522 ? 4.909   22.657  -17.922 1.00 40.75 ? 522  ARG B CD  1 
ATOM   8192 N NE  . ARG B 1 522 ? 6.289   23.128  -17.800 1.00 41.87 ? 522  ARG B NE  1 
ATOM   8193 C CZ  . ARG B 1 522 ? 6.639   24.345  -17.380 1.00 42.49 ? 522  ARG B CZ  1 
ATOM   8194 N NH1 . ARG B 1 522 ? 5.703   25.241  -17.060 1.00 40.40 ? 522  ARG B NH1 1 
ATOM   8195 N NH2 . ARG B 1 522 ? 7.934   24.667  -17.293 1.00 41.43 ? 522  ARG B NH2 1 
ATOM   8196 N N   . GLY B 1 523 ? 7.564   18.072  -20.131 1.00 39.32 ? 523  GLY B N   1 
ATOM   8197 C CA  . GLY B 1 523 ? 8.732   17.207  -19.982 1.00 39.71 ? 523  GLY B CA  1 
ATOM   8198 C C   . GLY B 1 523 ? 8.403   15.785  -20.352 1.00 40.12 ? 523  GLY B C   1 
ATOM   8199 O O   . GLY B 1 523 ? 7.617   15.135  -19.676 1.00 40.02 ? 523  GLY B O   1 
ATOM   8200 N N   . LEU B 1 524 ? 9.000   15.312  -21.440 1.00 40.56 ? 524  LEU B N   1 
ATOM   8201 C CA  . LEU B 1 524 ? 8.688   14.008  -21.995 1.00 41.43 ? 524  LEU B CA  1 
ATOM   8202 C C   . LEU B 1 524 ? 9.706   13.000  -21.483 1.00 41.58 ? 524  LEU B C   1 
ATOM   8203 O O   . LEU B 1 524 ? 10.739  12.780  -22.115 1.00 42.23 ? 524  LEU B O   1 
ATOM   8204 C CB  . LEU B 1 524 ? 8.720   14.088  -23.525 1.00 41.50 ? 524  LEU B CB  1 
ATOM   8205 C CG  . LEU B 1 524 ? 8.435   12.810  -24.328 1.00 43.33 ? 524  LEU B CG  1 
ATOM   8206 C CD1 . LEU B 1 524 ? 6.941   12.612  -24.515 1.00 45.24 ? 524  LEU B CD1 1 
ATOM   8207 C CD2 . LEU B 1 524 ? 9.145   12.810  -25.698 1.00 42.30 ? 524  LEU B CD2 1 
ATOM   8208 N N   . ARG B 1 525 ? 9.428   12.391  -20.335 1.00 41.71 ? 525  ARG B N   1 
ATOM   8209 C CA  . ARG B 1 525 ? 10.407  11.535  -19.657 1.00 41.95 ? 525  ARG B CA  1 
ATOM   8210 C C   . ARG B 1 525 ? 11.678  12.331  -19.367 1.00 41.50 ? 525  ARG B C   1 
ATOM   8211 O O   . ARG B 1 525 ? 12.785  11.804  -19.497 1.00 41.82 ? 525  ARG B O   1 
ATOM   8212 C CB  . ARG B 1 525 ? 10.753  10.306  -20.507 1.00 42.11 ? 525  ARG B CB  1 
ATOM   8213 C CG  . ARG B 1 525 ? 9.625   9.362   -20.729 1.00 44.31 ? 525  ARG B CG  1 
ATOM   8214 C CD  . ARG B 1 525 ? 9.658   8.189   -19.756 1.00 49.85 ? 525  ARG B CD  1 
ATOM   8215 N NE  . ARG B 1 525 ? 9.226   6.949   -20.414 1.00 53.10 ? 525  ARG B NE  1 
ATOM   8216 C CZ  . ARG B 1 525 ? 7.970   6.665   -20.774 1.00 53.62 ? 525  ARG B CZ  1 
ATOM   8217 N NH1 . ARG B 1 525 ? 6.974   7.522   -20.547 1.00 52.94 ? 525  ARG B NH1 1 
ATOM   8218 N NH2 . ARG B 1 525 ? 7.711   5.507   -21.371 1.00 54.85 ? 525  ARG B NH2 1 
ATOM   8219 N N   . ALA B 1 526 ? 11.517  13.594  -18.974 1.00 41.00 ? 526  ALA B N   1 
ATOM   8220 C CA  . ALA B 1 526 ? 12.651  14.504  -18.834 1.00 40.35 ? 526  ALA B CA  1 
ATOM   8221 C C   . ALA B 1 526 ? 13.852  13.941  -18.058 1.00 40.07 ? 526  ALA B C   1 
ATOM   8222 O O   . ALA B 1 526 ? 14.970  14.018  -18.557 1.00 40.44 ? 526  ALA B O   1 
ATOM   8223 C CB  . ALA B 1 526 ? 12.204  15.833  -18.279 1.00 40.51 ? 526  ALA B CB  1 
ATOM   8224 N N   . GLN B 1 527 ? 13.639  13.366  -16.872 1.00 39.87 ? 527  GLN B N   1 
ATOM   8225 C CA  . GLN B 1 527 ? 14.762  12.792  -16.086 1.00 40.19 ? 527  GLN B CA  1 
ATOM   8226 C C   . GLN B 1 527 ? 15.389  11.562  -16.749 1.00 39.87 ? 527  GLN B C   1 
ATOM   8227 O O   . GLN B 1 527 ? 16.617  11.462  -16.864 1.00 39.42 ? 527  GLN B O   1 
ATOM   8228 C CB  . GLN B 1 527 ? 14.368  12.439  -14.635 1.00 40.02 ? 527  GLN B CB  1 
ATOM   8229 C CG  . GLN B 1 527 ? 13.836  13.591  -13.788 1.00 42.08 ? 527  GLN B CG  1 
ATOM   8230 C CD  . GLN B 1 527 ? 14.716  14.851  -13.844 1.00 44.67 ? 527  GLN B CD  1 
ATOM   8231 O OE1 . GLN B 1 527 ? 14.267  15.918  -14.290 1.00 46.68 ? 527  GLN B OE1 1 
ATOM   8232 N NE2 . GLN B 1 527 ? 15.965  14.732  -13.387 1.00 43.43 ? 527  GLN B NE2 1 
ATOM   8233 N N   . THR B 1 528 ? 14.540  10.628  -17.171 1.00 39.86 ? 528  THR B N   1 
ATOM   8234 C CA  . THR B 1 528 ? 15.001  9.392   -17.794 1.00 40.30 ? 528  THR B CA  1 
ATOM   8235 C C   . THR B 1 528 ? 15.681  9.631   -19.146 1.00 40.29 ? 528  THR B C   1 
ATOM   8236 O O   . THR B 1 528 ? 16.677  8.964   -19.464 1.00 41.04 ? 528  THR B O   1 
ATOM   8237 C CB  . THR B 1 528 ? 13.857  8.355   -17.903 1.00 40.49 ? 528  THR B CB  1 
ATOM   8238 O OG1 . THR B 1 528 ? 13.490  7.929   -16.581 1.00 41.72 ? 528  THR B OG1 1 
ATOM   8239 C CG2 . THR B 1 528 ? 14.277  7.130   -18.714 1.00 39.52 ? 528  THR B CG2 1 
ATOM   8240 N N   . CYS B 1 529 ? 15.167  10.577  -19.929 1.00 39.62 ? 529  CYS B N   1 
ATOM   8241 C CA  . CYS B 1 529 ? 15.800  10.919  -21.200 1.00 39.41 ? 529  CYS B CA  1 
ATOM   8242 C C   . CYS B 1 529 ? 17.071  11.738  -21.017 1.00 39.70 ? 529  CYS B C   1 
ATOM   8243 O O   . CYS B 1 529 ? 17.939  11.737  -21.881 1.00 39.70 ? 529  CYS B O   1 
ATOM   8244 C CB  . CYS B 1 529 ? 14.817  11.610  -22.145 1.00 39.47 ? 529  CYS B CB  1 
ATOM   8245 S SG  . CYS B 1 529 ? 13.531  10.470  -22.742 1.00 38.18 ? 529  CYS B SG  1 
ATOM   8246 N N   . ALA B 1 530 ? 17.191  12.429  -19.889 1.00 39.71 ? 530  ALA B N   1 
ATOM   8247 C CA  . ALA B 1 530 ? 18.481  13.012  -19.527 1.00 40.21 ? 530  ALA B CA  1 
ATOM   8248 C C   . ALA B 1 530 ? 19.528  11.904  -19.326 1.00 40.13 ? 530  ALA B C   1 
ATOM   8249 O O   . ALA B 1 530 ? 20.686  12.055  -19.724 1.00 39.95 ? 530  ALA B O   1 
ATOM   8250 C CB  . ALA B 1 530 ? 18.360  13.858  -18.289 1.00 40.14 ? 530  ALA B CB  1 
ATOM   8251 N N   . PHE B 1 531 ? 19.104  10.794  -18.722 1.00 40.10 ? 531  PHE B N   1 
ATOM   8252 C CA  . PHE B 1 531 ? 19.969  9.631   -18.556 1.00 40.16 ? 531  PHE B CA  1 
ATOM   8253 C C   . PHE B 1 531 ? 20.452  9.103   -19.906 1.00 40.14 ? 531  PHE B C   1 
ATOM   8254 O O   . PHE B 1 531 ? 21.663  8.942   -20.113 1.00 39.52 ? 531  PHE B O   1 
ATOM   8255 C CB  . PHE B 1 531 ? 19.270  8.525   -17.765 1.00 39.90 ? 531  PHE B CB  1 
ATOM   8256 C CG  . PHE B 1 531 ? 20.065  7.249   -17.688 1.00 40.93 ? 531  PHE B CG  1 
ATOM   8257 C CD1 . PHE B 1 531 ? 21.279  7.206   -17.004 1.00 41.29 ? 531  PHE B CD1 1 
ATOM   8258 C CD2 . PHE B 1 531 ? 19.610  6.091   -18.306 1.00 41.02 ? 531  PHE B CD2 1 
ATOM   8259 C CE1 . PHE B 1 531 ? 22.011  6.024   -16.935 1.00 42.02 ? 531  PHE B CE1 1 
ATOM   8260 C CE2 . PHE B 1 531 ? 20.342  4.897   -18.238 1.00 41.28 ? 531  PHE B CE2 1 
ATOM   8261 C CZ  . PHE B 1 531 ? 21.538  4.864   -17.558 1.00 41.01 ? 531  PHE B CZ  1 
ATOM   8262 N N   . TRP B 1 532 ? 19.508  8.860   -20.824 1.00 40.25 ? 532  TRP B N   1 
ATOM   8263 C CA  . TRP B 1 532 ? 19.848  8.374   -22.174 1.00 40.39 ? 532  TRP B CA  1 
ATOM   8264 C C   . TRP B 1 532 ? 20.579  9.383   -23.056 1.00 41.03 ? 532  TRP B C   1 
ATOM   8265 O O   . TRP B 1 532 ? 21.531  9.015   -23.733 1.00 41.03 ? 532  TRP B O   1 
ATOM   8266 C CB  . TRP B 1 532 ? 18.617  7.872   -22.919 1.00 39.67 ? 532  TRP B CB  1 
ATOM   8267 C CG  . TRP B 1 532 ? 18.020  6.641   -22.342 1.00 39.09 ? 532  TRP B CG  1 
ATOM   8268 C CD1 . TRP B 1 532 ? 16.897  6.563   -21.587 1.00 38.02 ? 532  TRP B CD1 1 
ATOM   8269 C CD2 . TRP B 1 532 ? 18.506  5.297   -22.487 1.00 37.79 ? 532  TRP B CD2 1 
ATOM   8270 N NE1 . TRP B 1 532 ? 16.642  5.249   -21.258 1.00 38.14 ? 532  TRP B NE1 1 
ATOM   8271 C CE2 . TRP B 1 532 ? 17.619  4.456   -21.794 1.00 36.60 ? 532  TRP B CE2 1 
ATOM   8272 C CE3 . TRP B 1 532 ? 19.603  4.726   -23.146 1.00 38.74 ? 532  TRP B CE3 1 
ATOM   8273 C CZ2 . TRP B 1 532 ? 17.798  3.075   -21.720 1.00 37.77 ? 532  TRP B CZ2 1 
ATOM   8274 C CZ3 . TRP B 1 532 ? 19.775  3.343   -23.079 1.00 38.30 ? 532  TRP B CZ3 1 
ATOM   8275 C CH2 . TRP B 1 532 ? 18.876  2.539   -22.370 1.00 38.52 ? 532  TRP B CH2 1 
ATOM   8276 N N   . ASN B 1 533 ? 20.135  10.638  -23.055 1.00 41.76 ? 533  ASN B N   1 
ATOM   8277 C CA  . ASN B 1 533 ? 20.644  11.620  -24.015 1.00 42.81 ? 533  ASN B CA  1 
ATOM   8278 C C   . ASN B 1 533 ? 21.869  12.390  -23.558 1.00 44.06 ? 533  ASN B C   1 
ATOM   8279 O O   . ASN B 1 533 ? 22.628  12.926  -24.380 1.00 44.08 ? 533  ASN B O   1 
ATOM   8280 C CB  . ASN B 1 533 ? 19.558  12.608  -24.407 1.00 42.68 ? 533  ASN B CB  1 
ATOM   8281 C CG  . ASN B 1 533 ? 18.386  11.944  -25.102 1.00 42.52 ? 533  ASN B CG  1 
ATOM   8282 O OD1 . ASN B 1 533 ? 18.447  10.770  -25.490 1.00 41.25 ? 533  ASN B OD1 1 
ATOM   8283 N ND2 . ASN B 1 533 ? 17.305  12.693  -25.257 1.00 41.47 ? 533  ASN B ND2 1 
ATOM   8284 N N   . ARG B 1 534 ? 22.067  12.450  -22.247 1.00 45.51 ? 534  ARG B N   1 
ATOM   8285 C CA  . ARG B 1 534 ? 23.200  13.177  -21.707 1.00 46.50 ? 534  ARG B CA  1 
ATOM   8286 C C   . ARG B 1 534 ? 24.220  12.281  -21.022 1.00 46.79 ? 534  ARG B C   1 
ATOM   8287 O O   . ARG B 1 534 ? 25.418  12.441  -21.243 1.00 47.05 ? 534  ARG B O   1 
ATOM   8288 C CB  . ARG B 1 534 ? 22.731  14.302  -20.792 1.00 46.70 ? 534  ARG B CB  1 
ATOM   8289 C CG  . ARG B 1 534 ? 22.099  15.474  -21.537 1.00 48.25 ? 534  ARG B CG  1 
ATOM   8290 C CD  . ARG B 1 534 ? 21.467  16.468  -20.570 1.00 50.36 ? 534  ARG B CD  1 
ATOM   8291 N NE  . ARG B 1 534 ? 20.215  17.008  -21.102 1.00 52.93 ? 534  ARG B NE  1 
ATOM   8292 C CZ  . ARG B 1 534 ? 20.060  18.235  -21.609 1.00 52.56 ? 534  ARG B CZ  1 
ATOM   8293 N NH1 . ARG B 1 534 ? 21.083  19.094  -21.645 1.00 49.47 ? 534  ARG B NH1 1 
ATOM   8294 N NH2 . ARG B 1 534 ? 18.863  18.602  -22.067 1.00 51.08 ? 534  ARG B NH2 1 
ATOM   8295 N N   . PHE B 1 535 ? 23.762  11.330  -20.213 1.00 47.39 ? 535  PHE B N   1 
ATOM   8296 C CA  . PHE B 1 535 ? 24.705  10.537  -19.435 1.00 48.00 ? 535  PHE B CA  1 
ATOM   8297 C C   . PHE B 1 535 ? 25.327  9.373   -20.172 1.00 49.64 ? 535  PHE B C   1 
ATOM   8298 O O   . PHE B 1 535 ? 26.551  9.315   -20.264 1.00 49.96 ? 535  PHE B O   1 
ATOM   8299 C CB  . PHE B 1 535 ? 24.154  10.084  -18.087 1.00 46.77 ? 535  PHE B CB  1 
ATOM   8300 C CG  . PHE B 1 535 ? 25.169  9.371   -17.250 1.00 44.98 ? 535  PHE B CG  1 
ATOM   8301 C CD1 . PHE B 1 535 ? 26.255  10.064  -16.715 1.00 42.76 ? 535  PHE B CD1 1 
ATOM   8302 C CD2 . PHE B 1 535 ? 25.072  8.006   -17.027 1.00 43.27 ? 535  PHE B CD2 1 
ATOM   8303 C CE1 . PHE B 1 535 ? 27.209  9.416   -15.960 1.00 41.63 ? 535  PHE B CE1 1 
ATOM   8304 C CE2 . PHE B 1 535 ? 26.027  7.347   -16.256 1.00 43.51 ? 535  PHE B CE2 1 
ATOM   8305 C CZ  . PHE B 1 535 ? 27.103  8.058   -15.725 1.00 42.82 ? 535  PHE B CZ  1 
ATOM   8306 N N   . LEU B 1 536 ? 24.517  8.449   -20.685 1.00 51.78 ? 536  LEU B N   1 
ATOM   8307 C CA  . LEU B 1 536 ? 25.071  7.252   -21.342 1.00 54.46 ? 536  LEU B CA  1 
ATOM   8308 C C   . LEU B 1 536 ? 26.139  7.496   -22.425 1.00 56.46 ? 536  LEU B C   1 
ATOM   8309 O O   . LEU B 1 536 ? 27.139  6.781   -22.448 1.00 56.56 ? 536  LEU B O   1 
ATOM   8310 C CB  . LEU B 1 536 ? 23.987  6.319   -21.877 1.00 54.31 ? 536  LEU B CB  1 
ATOM   8311 C CG  . LEU B 1 536 ? 23.442  5.232   -20.952 1.00 54.68 ? 536  LEU B CG  1 
ATOM   8312 C CD1 . LEU B 1 536 ? 22.901  4.143   -21.826 1.00 55.28 ? 536  LEU B CD1 1 
ATOM   8313 C CD2 . LEU B 1 536 ? 24.495  4.653   -20.015 1.00 54.71 ? 536  LEU B CD2 1 
ATOM   8314 N N   . PRO B 1 537 ? 25.928  8.476   -23.332 1.00 58.44 ? 537  PRO B N   1 
ATOM   8315 C CA  . PRO B 1 537 ? 27.028  8.862   -24.222 1.00 60.42 ? 537  PRO B CA  1 
ATOM   8316 C C   . PRO B 1 537 ? 28.383  9.042   -23.515 1.00 62.51 ? 537  PRO B C   1 
ATOM   8317 O O   . PRO B 1 537 ? 29.394  8.511   -23.990 1.00 62.73 ? 537  PRO B O   1 
ATOM   8318 C CB  . PRO B 1 537 ? 26.544  10.191  -24.816 1.00 60.28 ? 537  PRO B CB  1 
ATOM   8319 C CG  . PRO B 1 537 ? 25.059  10.031  -24.861 1.00 59.58 ? 537  PRO B CG  1 
ATOM   8320 C CD  . PRO B 1 537 ? 24.697  9.233   -23.634 1.00 58.46 ? 537  PRO B CD  1 
ATOM   8321 N N   . LYS B 1 538 ? 28.399  9.769   -22.394 1.00 65.04 ? 538  LYS B N   1 
ATOM   8322 C CA  . LYS B 1 538 ? 29.635  10.028  -21.642 1.00 67.35 ? 538  LYS B CA  1 
ATOM   8323 C C   . LYS B 1 538 ? 30.209  8.754   -21.059 1.00 68.81 ? 538  LYS B C   1 
ATOM   8324 O O   . LYS B 1 538 ? 31.428  8.592   -20.968 1.00 69.19 ? 538  LYS B O   1 
ATOM   8325 C CB  . LYS B 1 538 ? 29.404  11.057  -20.538 1.00 67.26 ? 538  LYS B CB  1 
ATOM   8326 C CG  . LYS B 1 538 ? 29.522  12.486  -21.020 1.00 69.02 ? 538  LYS B CG  1 
ATOM   8327 C CD  . LYS B 1 538 ? 28.968  13.471  -19.996 1.00 71.91 ? 538  LYS B CD  1 
ATOM   8328 C CE  . LYS B 1 538 ? 29.003  14.899  -20.543 1.00 73.64 ? 538  LYS B CE  1 
ATOM   8329 N NZ  . LYS B 1 538 ? 30.416  15.398  -20.728 1.00 75.00 ? 538  LYS B NZ  1 
ATOM   8330 N N   . LEU B 1 539 ? 29.320  7.846   -20.683 1.00 70.83 ? 539  LEU B N   1 
ATOM   8331 C CA  . LEU B 1 539 ? 29.714  6.553   -20.157 1.00 73.11 ? 539  LEU B CA  1 
ATOM   8332 C C   . LEU B 1 539 ? 30.459  5.723   -21.197 1.00 74.95 ? 539  LEU B C   1 
ATOM   8333 O O   . LEU B 1 539 ? 31.229  4.826   -20.857 1.00 75.24 ? 539  LEU B O   1 
ATOM   8334 C CB  . LEU B 1 539 ? 28.479  5.799   -19.674 1.00 72.87 ? 539  LEU B CB  1 
ATOM   8335 C CG  . LEU B 1 539 ? 28.690  4.608   -18.757 1.00 72.39 ? 539  LEU B CG  1 
ATOM   8336 C CD1 . LEU B 1 539 ? 29.879  4.871   -17.866 1.00 72.36 ? 539  LEU B CD1 1 
ATOM   8337 C CD2 . LEU B 1 539 ? 27.438  4.384   -17.933 1.00 72.14 ? 539  LEU B CD2 1 
ATOM   8338 N N   . LEU B 1 540 ? 30.222  6.023   -22.467 1.00 77.39 ? 540  LEU B N   1 
ATOM   8339 C CA  . LEU B 1 540 ? 30.849  5.271   -23.545 1.00 79.61 ? 540  LEU B CA  1 
ATOM   8340 C C   . LEU B 1 540 ? 31.982  6.063   -24.209 1.00 81.01 ? 540  LEU B C   1 
ATOM   8341 O O   . LEU B 1 540 ? 32.937  5.469   -24.700 1.00 81.32 ? 540  LEU B O   1 
ATOM   8342 C CB  . LEU B 1 540 ? 29.794  4.769   -24.548 1.00 79.66 ? 540  LEU B CB  1 
ATOM   8343 C CG  . LEU B 1 540 ? 28.607  3.974   -23.953 1.00 80.09 ? 540  LEU B CG  1 
ATOM   8344 C CD1 . LEU B 1 540 ? 27.647  3.501   -25.044 1.00 80.50 ? 540  LEU B CD1 1 
ATOM   8345 C CD2 . LEU B 1 540 ? 29.044  2.785   -23.084 1.00 80.12 ? 540  LEU B CD2 1 
ATOM   8346 N N   . SER B 1 541 ? 31.892  7.394   -24.184 1.00 82.80 ? 541  SER B N   1 
ATOM   8347 C CA  . SER B 1 541 ? 32.946  8.263   -24.742 1.00 84.72 ? 541  SER B CA  1 
ATOM   8348 C C   . SER B 1 541 ? 34.163  8.469   -23.807 1.00 85.91 ? 541  SER B C   1 
ATOM   8349 O O   . SER B 1 541 ? 35.180  9.062   -24.210 1.00 86.15 ? 541  SER B O   1 
ATOM   8350 C CB  . SER B 1 541 ? 32.371  9.610   -25.224 1.00 84.76 ? 541  SER B CB  1 
ATOM   8351 O OG  . SER B 1 541 ? 32.055  10.470  -24.144 1.00 85.25 ? 541  SER B OG  1 
ATOM   8352 N N   . ALA B 1 542 ? 34.049  7.989   -22.566 1.00 87.18 ? 542  ALA B N   1 
ATOM   8353 C CA  . ALA B 1 542 ? 35.192  7.897   -21.646 1.00 88.18 ? 542  ALA B CA  1 
ATOM   8354 C C   . ALA B 1 542 ? 35.367  6.444   -21.157 1.00 88.89 ? 542  ALA B C   1 
ATOM   8355 O O   . ALA B 1 542 ? 36.262  5.729   -21.628 1.00 89.08 ? 542  ALA B O   1 
ATOM   8356 C CB  . ALA B 1 542 ? 35.040  8.878   -20.471 1.00 87.97 ? 542  ALA B CB  1 
ATOM   8357 N N   . THR B 1 543 ? 34.488  6.019   -20.243 1.00 89.63 ? 543  THR B N   1 
ATOM   8358 C CA  . THR B 1 543 ? 34.457  4.658   -19.664 1.00 90.27 ? 543  THR B CA  1 
ATOM   8359 C C   . THR B 1 543 ? 35.691  4.333   -18.786 1.00 90.57 ? 543  THR B C   1 
ATOM   8360 O O   . THR B 1 543 ? 36.044  3.176   -18.515 1.00 90.60 ? 543  THR B O   1 
ATOM   8361 C CB  . THR B 1 543 ? 34.191  3.541   -20.740 1.00 90.39 ? 543  THR B CB  1 
ATOM   8362 O OG1 . THR B 1 543 ? 33.570  4.105   -21.906 1.00 90.58 ? 543  THR B OG1 1 
ATOM   8363 C CG2 . THR B 1 543 ? 33.290  2.425   -20.169 1.00 90.61 ? 543  THR B CG2 1 
ATOM   8364 N N   . ALA B 1 544 ? 36.370  5.244   -18.293 1.00 90.81 ? 544  ALA B N   1 
HETATM 8365 C C1  . NAG C 2 .   ? 11.981  34.153  25.510  1.00 76.83 ? 1544 NAG A C1  1 
HETATM 8366 C C2  . NAG C 2 .   ? 13.276  34.964  25.317  1.00 82.62 ? 1544 NAG A C2  1 
HETATM 8367 C C3  . NAG C 2 .   ? 13.338  36.187  26.248  1.00 83.93 ? 1544 NAG A C3  1 
HETATM 8368 C C4  . NAG C 2 .   ? 12.025  36.993  26.242  1.00 84.35 ? 1544 NAG A C4  1 
HETATM 8369 C C5  . NAG C 2 .   ? 10.809  36.073  26.460  1.00 83.60 ? 1544 NAG A C5  1 
HETATM 8370 C C6  . NAG C 2 .   ? 9.481   36.826  26.284  1.00 84.70 ? 1544 NAG A C6  1 
HETATM 8371 C C7  . NAG C 2 .   ? 15.022  33.412  24.538  1.00 84.67 ? 1544 NAG A C7  1 
HETATM 8372 C C8  . NAG C 2 .   ? 15.553  32.054  24.905  1.00 84.51 ? 1544 NAG A C8  1 
HETATM 8373 N N2  . NAG C 2 .   ? 14.454  34.124  25.519  1.00 83.50 ? 1544 NAG A N2  1 
HETATM 8374 O O3  . NAG C 2 .   ? 14.432  37.017  25.893  1.00 84.39 ? 1544 NAG A O3  1 
HETATM 8375 O O4  . NAG C 2 .   ? 12.068  38.011  27.231  1.00 84.87 ? 1544 NAG A O4  1 
HETATM 8376 O O5  . NAG C 2 .   ? 10.827  34.994  25.530  1.00 80.32 ? 1544 NAG A O5  1 
HETATM 8377 O O6  . NAG C 2 .   ? 9.219   37.682  27.381  1.00 85.43 ? 1544 NAG A O6  1 
HETATM 8378 O O7  . NAG C 2 .   ? 15.123  33.818  23.378  1.00 85.15 ? 1544 NAG A O7  1 
HETATM 8379 O O1  . P6G D 3 .   ? 17.669  10.470  -12.217 1.00 61.11 ? 1545 P6G A O1  1 
HETATM 8380 C C2  . P6G D 3 .   ? 18.680  10.114  -13.014 1.00 60.29 ? 1545 P6G A C2  1 
HETATM 8381 C C3  . P6G D 3 .   ? 19.008  10.832  -14.094 1.00 59.81 ? 1545 P6G A C3  1 
HETATM 8382 O O4  . P6G D 3 .   ? 20.123  10.411  -14.941 1.00 59.56 ? 1545 P6G A O4  1 
HETATM 8383 C C5  . P6G D 3 .   ? 21.495  10.854  -14.701 1.00 58.94 ? 1545 P6G A C5  1 
HETATM 8384 C C6  . P6G D 3 .   ? 22.470  10.093  -14.171 1.00 57.06 ? 1545 P6G A C6  1 
HETATM 8385 O O7  . P6G D 3 .   ? 22.304  8.702   -13.757 1.00 55.71 ? 1545 P6G A O7  1 
HETATM 8386 C C8  . P6G D 3 .   ? 23.368  7.733   -14.014 1.00 53.73 ? 1545 P6G A C8  1 
HETATM 8387 C C9  . P6G D 3 .   ? 23.392  6.518   -13.465 1.00 52.59 ? 1545 P6G A C9  1 
HETATM 8388 O O10 . P6G D 3 .   ? 22.348  6.085   -12.556 1.00 52.11 ? 1545 P6G A O10 1 
HETATM 8389 C C11 . P6G D 3 .   ? 22.181  4.700   -12.236 1.00 54.23 ? 1545 P6G A C11 1 
HETATM 8390 C C12 . P6G D 3 .   ? 21.401  4.528   -10.925 1.00 54.71 ? 1545 P6G A C12 1 
HETATM 8391 O O13 . P6G D 3 .   ? 20.265  5.405   -10.864 1.00 56.08 ? 1545 P6G A O13 1 
HETATM 8392 C C14 . P6G D 3 .   ? 19.347  5.372   -9.727  1.00 57.22 ? 1545 P6G A C14 1 
HETATM 8393 C C15 . P6G D 3 .   ? 18.149  5.959   -9.753  1.00 58.33 ? 1545 P6G A C15 1 
HETATM 8394 O O16 . P6G D 3 .   ? 17.676  6.667   -10.933 1.00 60.44 ? 1545 P6G A O16 1 
HETATM 8395 C C17 . P6G D 3 .   ? 16.263  6.665   -11.302 1.00 62.53 ? 1545 P6G A C17 1 
HETATM 8396 C C18 . P6G D 3 .   ? 15.641  7.822   -11.558 1.00 64.47 ? 1545 P6G A C18 1 
HETATM 8397 O O19 . P6G D 3 .   ? 14.351  7.855   -11.901 1.00 66.14 ? 1545 P6G A O19 1 
HETATM 8398 C C1  . PGE E 4 .   ? 38.463  27.675  7.695   1.00 83.55 ? 1546 PGE A C1  1 
HETATM 8399 C C2  . PGE E 4 .   ? 37.963  26.238  7.480   1.00 83.30 ? 1546 PGE A C2  1 
HETATM 8400 O O2  . PGE E 4 .   ? 37.152  25.856  8.605   1.00 83.16 ? 1546 PGE A O2  1 
HETATM 8401 C C3  . PGE E 4 .   ? 36.636  24.534  8.462   1.00 83.20 ? 1546 PGE A C3  1 
HETATM 8402 C C4  . PGE E 4 .   ? 35.218  24.435  9.090   1.00 83.40 ? 1546 PGE A C4  1 
HETATM 8403 O O4  . PGE E 4 .   ? 32.319  21.483  7.173   1.00 80.72 ? 1546 PGE A O4  1 
HETATM 8404 C C6  . PGE E 4 .   ? 32.745  21.633  8.541   1.00 81.58 ? 1546 PGE A C6  1 
HETATM 8405 C C5  . PGE E 4 .   ? 33.235  23.057  8.837   1.00 82.50 ? 1546 PGE A C5  1 
HETATM 8406 O O3  . PGE E 4 .   ? 34.660  23.152  8.676   1.00 83.45 ? 1546 PGE A O3  1 
HETATM 8407 O O   . HOH F 5 .   ? 31.401  10.928  48.456  1.00 38.14 ? 2001 HOH A O   1 
HETATM 8408 O O   . HOH F 5 .   ? 9.079   21.757  40.319  1.00 40.35 ? 2002 HOH A O   1 
HETATM 8409 O O   . HOH F 5 .   ? 19.688  24.183  38.447  1.00 46.92 ? 2003 HOH A O   1 
HETATM 8410 O O   . HOH F 5 .   ? 11.327  18.106  33.829  1.00 39.38 ? 2004 HOH A O   1 
HETATM 8411 O O   . HOH F 5 .   ? 40.758  12.907  33.273  1.00 45.82 ? 2005 HOH A O   1 
HETATM 8412 O O   . HOH F 5 .   ? 46.774  8.855   26.830  1.00 35.67 ? 2006 HOH A O   1 
HETATM 8413 O O   . HOH F 5 .   ? 49.549  6.089   27.443  1.00 51.04 ? 2007 HOH A O   1 
HETATM 8414 O O   . HOH F 5 .   ? 40.172  15.353  39.109  1.00 39.11 ? 2008 HOH A O   1 
HETATM 8415 O O   . HOH F 5 .   ? 40.430  15.424  44.578  1.00 40.71 ? 2009 HOH A O   1 
HETATM 8416 O O   . HOH F 5 .   ? 38.126  9.212   47.047  1.00 44.89 ? 2010 HOH A O   1 
HETATM 8417 O O   . HOH F 5 .   ? 39.280  16.044  46.585  1.00 47.10 ? 2011 HOH A O   1 
HETATM 8418 O O   . HOH F 5 .   ? 33.124  19.576  28.840  1.00 36.53 ? 2012 HOH A O   1 
HETATM 8419 O O   . HOH F 5 .   ? 42.227  17.527  23.350  1.00 25.97 ? 2013 HOH A O   1 
HETATM 8420 O O   . HOH F 5 .   ? 41.160  17.094  21.382  1.00 23.75 ? 2014 HOH A O   1 
HETATM 8421 O O   . HOH F 5 .   ? 41.647  19.258  17.911  1.00 23.73 ? 2015 HOH A O   1 
HETATM 8422 O O   . HOH F 5 .   ? 40.449  27.503  16.829  1.00 41.34 ? 2016 HOH A O   1 
HETATM 8423 O O   . HOH F 5 .   ? 24.016  24.161  23.125  1.00 35.46 ? 2017 HOH A O   1 
HETATM 8424 O O   . HOH F 5 .   ? 29.866  20.793  18.897  1.00 32.78 ? 2018 HOH A O   1 
HETATM 8425 O O   . HOH F 5 .   ? 46.374  15.213  23.990  1.00 31.24 ? 2019 HOH A O   1 
HETATM 8426 O O   . HOH F 5 .   ? 43.749  15.987  24.733  1.00 30.01 ? 2020 HOH A O   1 
HETATM 8427 O O   . HOH F 5 .   ? 56.280  15.981  25.780  1.00 41.52 ? 2021 HOH A O   1 
HETATM 8428 O O   . HOH F 5 .   ? 32.698  17.204  32.301  1.00 31.07 ? 2022 HOH A O   1 
HETATM 8429 O O   . HOH F 5 .   ? 43.600  -3.062  7.199   1.00 31.00 ? 2023 HOH A O   1 
HETATM 8430 O O   . HOH F 5 .   ? 29.379  12.426  24.399  1.00 28.36 ? 2024 HOH A O   1 
HETATM 8431 O O   . HOH F 5 .   ? 33.224  14.982  17.071  1.00 27.78 ? 2025 HOH A O   1 
HETATM 8432 O O   . HOH F 5 .   ? 30.733  21.296  16.198  1.00 34.77 ? 2026 HOH A O   1 
HETATM 8433 O O   . HOH F 5 .   ? 35.452  17.679  24.235  1.00 24.78 ? 2027 HOH A O   1 
HETATM 8434 O O   . HOH F 5 .   ? 25.677  22.936  29.775  1.00 27.17 ? 2028 HOH A O   1 
HETATM 8435 O O   . HOH F 5 .   ? 25.340  19.086  28.458  1.00 25.44 ? 2029 HOH A O   1 
HETATM 8436 O O   . HOH F 5 .   ? 20.457  22.609  28.885  1.00 36.82 ? 2030 HOH A O   1 
HETATM 8437 O O   . HOH F 5 .   ? 26.307  25.233  25.103  1.00 44.34 ? 2031 HOH A O   1 
HETATM 8438 O O   . HOH F 5 .   ? 25.998  15.969  18.259  1.00 18.07 ? 2032 HOH A O   1 
HETATM 8439 O O   . HOH F 5 .   ? 29.104  18.501  19.903  1.00 25.26 ? 2033 HOH A O   1 
HETATM 8440 O O   . HOH F 5 .   ? 25.264  22.378  34.263  1.00 33.20 ? 2034 HOH A O   1 
HETATM 8441 O O   . HOH F 5 .   ? 32.214  17.181  29.480  1.00 30.09 ? 2035 HOH A O   1 
HETATM 8442 O O   . HOH F 5 .   ? 43.502  19.008  15.943  1.00 39.92 ? 2036 HOH A O   1 
HETATM 8443 O O   . HOH F 5 .   ? 45.936  12.972  22.355  1.00 30.10 ? 2037 HOH A O   1 
HETATM 8444 O O   . HOH F 5 .   ? 42.475  8.085   13.796  1.00 36.50 ? 2038 HOH A O   1 
HETATM 8445 O O   . HOH F 5 .   ? 43.017  9.858   11.310  1.00 21.77 ? 2039 HOH A O   1 
HETATM 8446 O O   . HOH F 5 .   ? 50.076  0.531   16.067  1.00 42.88 ? 2040 HOH A O   1 
HETATM 8447 O O   . HOH F 5 .   ? 52.586  9.741   21.462  1.00 35.77 ? 2041 HOH A O   1 
HETATM 8448 O O   . HOH F 5 .   ? 47.110  7.835   17.751  1.00 28.87 ? 2042 HOH A O   1 
HETATM 8449 O O   . HOH F 5 .   ? 40.021  2.300   25.824  1.00 32.51 ? 2043 HOH A O   1 
HETATM 8450 O O   . HOH F 5 .   ? 31.917  -5.018  30.888  1.00 29.81 ? 2044 HOH A O   1 
HETATM 8451 O O   . HOH F 5 .   ? 27.992  -0.918  37.146  1.00 35.56 ? 2045 HOH A O   1 
HETATM 8452 O O   . HOH F 5 .   ? 17.204  -2.260  34.118  1.00 32.85 ? 2046 HOH A O   1 
HETATM 8453 O O   . HOH F 5 .   ? 33.079  -6.648  13.727  1.00 41.56 ? 2047 HOH A O   1 
HETATM 8454 O O   . HOH F 5 .   ? 36.966  -5.961  16.076  1.00 33.82 ? 2048 HOH A O   1 
HETATM 8455 O O   . HOH F 5 .   ? 26.754  -4.923  21.541  1.00 49.53 ? 2049 HOH A O   1 
HETATM 8456 O O   . HOH F 5 .   ? 33.564  -6.411  29.143  1.00 49.04 ? 2050 HOH A O   1 
HETATM 8457 O O   . HOH F 5 .   ? 28.840  0.367   29.377  1.00 28.24 ? 2051 HOH A O   1 
HETATM 8458 O O   . HOH F 5 .   ? 33.425  5.611   6.543   1.00 42.12 ? 2052 HOH A O   1 
HETATM 8459 O O   . HOH F 5 .   ? 35.432  9.648   0.807   1.00 33.74 ? 2053 HOH A O   1 
HETATM 8460 O O   . HOH F 5 .   ? 30.726  8.680   6.708   1.00 38.92 ? 2054 HOH A O   1 
HETATM 8461 O O   . HOH F 5 .   ? 40.742  7.316   2.869   1.00 35.43 ? 2055 HOH A O   1 
HETATM 8462 O O   . HOH F 5 .   ? 45.620  2.292   2.852   1.00 36.21 ? 2056 HOH A O   1 
HETATM 8463 O O   . HOH F 5 .   ? 46.529  10.765  10.762  1.00 28.43 ? 2057 HOH A O   1 
HETATM 8464 O O   . HOH F 5 .   ? 52.041  13.459  3.498   1.00 47.00 ? 2058 HOH A O   1 
HETATM 8465 O O   . HOH F 5 .   ? 55.423  15.040  3.700   1.00 54.95 ? 2059 HOH A O   1 
HETATM 8466 O O   . HOH F 5 .   ? 53.214  25.940  8.256   1.00 35.60 ? 2060 HOH A O   1 
HETATM 8467 O O   . HOH F 5 .   ? 56.252  13.867  24.848  1.00 43.88 ? 2061 HOH A O   1 
HETATM 8468 O O   . HOH F 5 .   ? 52.311  16.530  23.942  1.00 34.39 ? 2062 HOH A O   1 
HETATM 8469 O O   . HOH F 5 .   ? 49.565  22.787  24.796  1.00 46.80 ? 2063 HOH A O   1 
HETATM 8470 O O   . HOH F 5 .   ? 40.199  16.939  12.313  1.00 35.81 ? 2064 HOH A O   1 
HETATM 8471 O O   . HOH F 5 .   ? 38.668  15.745  1.206   1.00 46.91 ? 2065 HOH A O   1 
HETATM 8472 O O   . HOH F 5 .   ? 35.851  19.696  4.434   1.00 30.20 ? 2066 HOH A O   1 
HETATM 8473 O O   . HOH F 5 .   ? 44.014  11.291  9.259   1.00 33.80 ? 2067 HOH A O   1 
HETATM 8474 O O   . HOH F 5 .   ? 43.061  0.888   5.706   1.00 40.86 ? 2068 HOH A O   1 
HETATM 8475 O O   . HOH F 5 .   ? 45.566  -2.290  8.125   1.00 30.95 ? 2069 HOH A O   1 
HETATM 8476 O O   . HOH F 5 .   ? 46.379  -0.806  16.861  1.00 30.93 ? 2070 HOH A O   1 
HETATM 8477 O O   . HOH F 5 .   ? 22.086  20.675  7.314   1.00 24.98 ? 2071 HOH A O   1 
HETATM 8478 O O   . HOH F 5 .   ? 29.571  27.397  -6.117  1.00 35.07 ? 2072 HOH A O   1 
HETATM 8479 O O   . HOH F 5 .   ? 25.210  34.993  -1.076  1.00 51.53 ? 2073 HOH A O   1 
HETATM 8480 O O   . HOH F 5 .   ? 22.681  39.076  0.283   1.00 40.85 ? 2074 HOH A O   1 
HETATM 8481 O O   . HOH F 5 .   ? 25.397  22.250  -16.366 1.00 62.53 ? 2075 HOH A O   1 
HETATM 8482 O O   . HOH F 5 .   ? 17.837  23.976  0.815   1.00 37.45 ? 2076 HOH A O   1 
HETATM 8483 O O   . HOH F 5 .   ? 19.844  18.019  2.526   1.00 36.04 ? 2077 HOH A O   1 
HETATM 8484 O O   . HOH F 5 .   ? 19.913  15.010  1.756   1.00 31.01 ? 2078 HOH A O   1 
HETATM 8485 O O   . HOH F 5 .   ? 23.514  -2.363  -0.814  1.00 46.82 ? 2079 HOH A O   1 
HETATM 8486 O O   . HOH F 5 .   ? 18.849  12.494  13.275  1.00 21.02 ? 2080 HOH A O   1 
HETATM 8487 O O   . HOH F 5 .   ? 9.308   29.618  19.566  1.00 50.97 ? 2081 HOH A O   1 
HETATM 8488 O O   . HOH F 5 .   ? 13.603  23.918  2.083   1.00 39.04 ? 2082 HOH A O   1 
HETATM 8489 O O   . HOH F 5 .   ? 14.671  21.432  14.305  1.00 29.23 ? 2083 HOH A O   1 
HETATM 8490 O O   . HOH F 5 .   ? 21.087  15.624  13.045  1.00 26.18 ? 2084 HOH A O   1 
HETATM 8491 O O   . HOH F 5 .   ? 19.375  20.406  18.450  1.00 31.09 ? 2085 HOH A O   1 
HETATM 8492 O O   . HOH F 5 .   ? 16.685  25.682  17.766  1.00 43.87 ? 2086 HOH A O   1 
HETATM 8493 O O   . HOH F 5 .   ? 17.601  15.429  28.750  1.00 29.63 ? 2087 HOH A O   1 
HETATM 8494 O O   . HOH F 5 .   ? 7.738   21.473  31.345  1.00 44.52 ? 2088 HOH A O   1 
HETATM 8495 O O   . HOH F 5 .   ? 6.726   25.427  26.555  1.00 41.88 ? 2089 HOH A O   1 
HETATM 8496 O O   . HOH F 5 .   ? 8.509   12.132  27.707  1.00 34.43 ? 2090 HOH A O   1 
HETATM 8497 O O   . HOH F 5 .   ? 14.987  -6.633  24.029  1.00 39.75 ? 2091 HOH A O   1 
HETATM 8498 O O   . HOH F 5 .   ? -1.405  -1.129  18.466  1.00 49.53 ? 2092 HOH A O   1 
HETATM 8499 O O   . HOH F 5 .   ? 14.995  2.193   2.037   1.00 39.71 ? 2093 HOH A O   1 
HETATM 8500 O O   . HOH F 5 .   ? 9.316   -2.264  6.980   1.00 40.04 ? 2094 HOH A O   1 
HETATM 8501 O O   . HOH F 5 .   ? 11.560  1.603   10.693  1.00 37.38 ? 2095 HOH A O   1 
HETATM 8502 O O   . HOH F 5 .   ? 4.041   13.156  8.524   1.00 36.46 ? 2096 HOH A O   1 
HETATM 8503 O O   . HOH F 5 .   ? 3.429   16.393  18.579  1.00 39.77 ? 2097 HOH A O   1 
HETATM 8504 O O   . HOH F 5 .   ? 5.916   19.549  12.039  1.00 41.50 ? 2098 HOH A O   1 
HETATM 8505 O O   . HOH F 5 .   ? 2.148   9.117   17.142  1.00 33.35 ? 2099 HOH A O   1 
HETATM 8506 O O   . HOH F 5 .   ? 12.119  12.886  2.557   1.00 44.18 ? 2100 HOH A O   1 
HETATM 8507 O O   . HOH F 5 .   ? 14.932  8.594   -4.013  1.00 39.61 ? 2101 HOH A O   1 
HETATM 8508 O O   . HOH F 5 .   ? 19.935  7.343   -12.637 1.00 46.79 ? 2102 HOH A O   1 
HETATM 8509 O O   . HOH G 5 .   ? -3.669  15.981  -66.453 1.00 44.71 ? 2001 HOH B O   1 
HETATM 8510 O O   . HOH G 5 .   ? 0.885   16.403  -64.868 1.00 47.22 ? 2002 HOH B O   1 
HETATM 8511 O O   . HOH G 5 .   ? 1.188   16.416  -68.682 1.00 41.12 ? 2003 HOH B O   1 
HETATM 8512 O O   . HOH G 5 .   ? 8.060   -1.506  -66.026 1.00 41.44 ? 2004 HOH B O   1 
HETATM 8513 O O   . HOH G 5 .   ? 3.865   10.452  -64.493 1.00 47.55 ? 2005 HOH B O   1 
HETATM 8514 O O   . HOH G 5 .   ? 13.202  -10.108 -37.514 1.00 55.57 ? 2006 HOH B O   1 
HETATM 8515 O O   . HOH G 5 .   ? 8.977   0.709   -67.201 1.00 29.75 ? 2007 HOH B O   1 
HETATM 8516 O O   . HOH G 5 .   ? 10.163  9.868   -67.414 1.00 38.54 ? 2008 HOH B O   1 
HETATM 8517 O O   . HOH G 5 .   ? -0.764  6.736   -71.907 1.00 30.78 ? 2009 HOH B O   1 
HETATM 8518 O O   . HOH G 5 .   ? -1.336  6.504   -75.864 1.00 43.48 ? 2010 HOH B O   1 
HETATM 8519 O O   . HOH G 5 .   ? -5.221  1.248   -72.439 1.00 40.04 ? 2011 HOH B O   1 
HETATM 8520 O O   . HOH G 5 .   ? 1.657   -3.054  -52.156 1.00 33.22 ? 2012 HOH B O   1 
HETATM 8521 O O   . HOH G 5 .   ? 14.384  -7.536  -47.805 1.00 42.67 ? 2013 HOH B O   1 
HETATM 8522 O O   . HOH G 5 .   ? 12.527  -4.853  -50.731 1.00 33.51 ? 2014 HOH B O   1 
HETATM 8523 O O   . HOH G 5 .   ? 7.092   -8.256  -43.845 1.00 40.43 ? 2015 HOH B O   1 
HETATM 8524 O O   . HOH G 5 .   ? 13.635  -12.872 -36.912 1.00 53.25 ? 2016 HOH B O   1 
HETATM 8525 O O   . HOH G 5 .   ? -2.933  -4.028  -41.566 1.00 55.05 ? 2017 HOH B O   1 
HETATM 8526 O O   . HOH G 5 .   ? -1.574  -7.354  -43.951 1.00 38.01 ? 2018 HOH B O   1 
HETATM 8527 O O   . HOH G 5 .   ? 29.913  1.243   -35.655 1.00 34.50 ? 2019 HOH B O   1 
HETATM 8528 O O   . HOH G 5 .   ? -0.636  -9.429  -55.043 1.00 40.09 ? 2020 HOH B O   1 
HETATM 8529 O O   . HOH G 5 .   ? 15.605  -4.930  -56.154 1.00 41.20 ? 2021 HOH B O   1 
HETATM 8530 O O   . HOH G 5 .   ? 8.721   -1.420  -59.850 1.00 36.17 ? 2022 HOH B O   1 
HETATM 8531 O O   . HOH G 5 .   ? 9.972   -6.279  -63.400 1.00 35.67 ? 2023 HOH B O   1 
HETATM 8532 O O   . HOH G 5 .   ? 6.329   -0.572  -63.712 1.00 40.57 ? 2024 HOH B O   1 
HETATM 8533 O O   . HOH G 5 .   ? 4.491   4.584   -47.527 1.00 34.71 ? 2025 HOH B O   1 
HETATM 8534 O O   . HOH G 5 .   ? 6.842   -2.433  -49.812 1.00 39.55 ? 2026 HOH B O   1 
HETATM 8535 O O   . HOH G 5 .   ? 4.385   2.210   -40.163 1.00 24.19 ? 2027 HOH B O   1 
HETATM 8536 O O   . HOH G 5 .   ? 13.271  -7.892  -45.545 1.00 34.41 ? 2028 HOH B O   1 
HETATM 8537 O O   . HOH G 5 .   ? -5.431  -2.772  -47.828 1.00 34.72 ? 2029 HOH B O   1 
HETATM 8538 O O   . HOH G 5 .   ? -3.148  0.746   -47.501 1.00 33.89 ? 2030 HOH B O   1 
HETATM 8539 O O   . HOH G 5 .   ? 1.777   -0.277  -52.324 1.00 28.96 ? 2031 HOH B O   1 
HETATM 8540 O O   . HOH G 5 .   ? 17.235  -2.723  -55.074 1.00 37.03 ? 2032 HOH B O   1 
HETATM 8541 O O   . HOH G 5 .   ? 15.536  9.594   -55.954 1.00 44.51 ? 2033 HOH B O   1 
HETATM 8542 O O   . HOH G 5 .   ? 13.567  15.615  -22.806 1.00 33.06 ? 2034 HOH B O   1 
HETATM 8543 O O   . HOH G 5 .   ? 1.648   18.676  -59.082 1.00 42.96 ? 2035 HOH B O   1 
HETATM 8544 O O   . HOH G 5 .   ? 0.134   19.306  -46.503 1.00 29.83 ? 2036 HOH B O   1 
HETATM 8545 O O   . HOH G 5 .   ? 21.924  17.165  -47.269 1.00 30.36 ? 2037 HOH B O   1 
HETATM 8546 O O   . HOH G 5 .   ? 10.120  23.328  -49.148 1.00 34.94 ? 2038 HOH B O   1 
HETATM 8547 O O   . HOH G 5 .   ? 6.053   16.426  -52.829 1.00 28.03 ? 2039 HOH B O   1 
HETATM 8548 O O   . HOH G 5 .   ? 3.269   7.565   -32.548 1.00 26.90 ? 2040 HOH B O   1 
HETATM 8549 O O   . HOH G 5 .   ? 13.547  6.653   -32.968 1.00 35.41 ? 2041 HOH B O   1 
HETATM 8550 O O   . HOH G 5 .   ? 17.096  5.451   -34.316 1.00 31.52 ? 2042 HOH B O   1 
HETATM 8551 O O   . HOH G 5 .   ? 22.316  1.086   -35.686 1.00 28.12 ? 2043 HOH B O   1 
HETATM 8552 O O   . HOH G 5 .   ? 27.175  2.153   -37.174 1.00 31.73 ? 2044 HOH B O   1 
HETATM 8553 O O   . HOH G 5 .   ? 25.125  -2.965  -46.061 1.00 42.49 ? 2045 HOH B O   1 
HETATM 8554 O O   . HOH G 5 .   ? 16.963  -8.453  -47.819 1.00 40.17 ? 2046 HOH B O   1 
HETATM 8555 O O   . HOH G 5 .   ? 16.939  -5.956  -42.746 1.00 33.39 ? 2047 HOH B O   1 
HETATM 8556 O O   . HOH G 5 .   ? 12.925  -6.603  -32.658 1.00 50.17 ? 2048 HOH B O   1 
HETATM 8557 O O   . HOH G 5 .   ? 16.628  -3.377  -42.225 1.00 30.83 ? 2049 HOH B O   1 
HETATM 8558 O O   . HOH G 5 .   ? 8.677   27.417  -38.582 1.00 48.89 ? 2050 HOH B O   1 
HETATM 8559 O O   . HOH G 5 .   ? -2.702  0.383   -21.773 1.00 38.54 ? 2051 HOH B O   1 
HETATM 8560 O O   . HOH G 5 .   ? 7.194   4.232   -24.209 1.00 37.31 ? 2052 HOH B O   1 
HETATM 8561 O O   . HOH G 5 .   ? 21.004  -4.807  -10.077 1.00 34.43 ? 2053 HOH B O   1 
HETATM 8562 O O   . HOH G 5 .   ? 31.978  -4.408  -20.848 1.00 61.13 ? 2054 HOH B O   1 
HETATM 8563 O O   . HOH G 5 .   ? 10.771  -6.524  -4.640  1.00 38.84 ? 2055 HOH B O   1 
HETATM 8564 O O   . HOH G 5 .   ? 7.548   0.897   -23.459 1.00 34.23 ? 2056 HOH B O   1 
HETATM 8565 O O   . HOH G 5 .   ? 3.692   4.018   -33.142 1.00 29.83 ? 2057 HOH B O   1 
HETATM 8566 O O   . HOH G 5 .   ? -2.591  1.007   -35.945 1.00 41.48 ? 2058 HOH B O   1 
HETATM 8567 O O   . HOH G 5 .   ? -6.182  -3.027  -33.242 1.00 38.32 ? 2059 HOH B O   1 
HETATM 8568 O O   . HOH G 5 .   ? -18.251 -8.228  -36.281 1.00 51.11 ? 2060 HOH B O   1 
HETATM 8569 O O   . HOH G 5 .   ? -8.030  19.731  -47.013 1.00 41.32 ? 2061 HOH B O   1 
HETATM 8570 O O   . HOH G 5 .   ? -0.444  26.896  -32.159 1.00 35.80 ? 2062 HOH B O   1 
HETATM 8571 O O   . HOH G 5 .   ? 6.212   24.145  -24.800 1.00 32.66 ? 2063 HOH B O   1 
HETATM 8572 O O   . HOH G 5 .   ? 8.059   24.877  -31.188 1.00 27.39 ? 2064 HOH B O   1 
HETATM 8573 O O   . HOH G 5 .   ? 12.172  26.578  -27.930 1.00 37.89 ? 2065 HOH B O   1 
HETATM 8574 O O   . HOH G 5 .   ? 11.977  27.513  -25.222 1.00 57.42 ? 2066 HOH B O   1 
HETATM 8575 O O   . HOH G 5 .   ? 11.132  16.939  -22.734 1.00 30.70 ? 2067 HOH B O   1 
HETATM 8576 O O   . HOH G 5 .   ? -4.034  21.133  -20.261 1.00 31.41 ? 2068 HOH B O   1 
HETATM 8577 O O   . HOH G 5 .   ? 3.164   16.877  -16.532 1.00 44.97 ? 2069 HOH B O   1 
HETATM 8578 O O   . HOH G 5 .   ? 5.495   14.719  -18.290 1.00 22.63 ? 2070 HOH B O   1 
HETATM 8579 O O   . HOH G 5 .   ? 11.768  11.046  -16.395 1.00 39.97 ? 2071 HOH B O   1 
HETATM 8580 O O   . HOH G 5 .   ? 34.137  1.647   -23.328 1.00 41.22 ? 2072 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SXE 203 203 203 SXE SXE A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SXE 203 203 203 SXE SXE B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
B 1 544 ALA 544 544 544 ALA ALA B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLU 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   1544 1544 NAG NAG A . 
D 3 P6G 1   1545 1545 P6G P6G A . 
E 4 PGE 1   1546 1546 PGE PGE A . 
F 5 HOH 1   2001 2001 HOH HOH A . 
F 5 HOH 2   2002 2002 HOH HOH A . 
F 5 HOH 3   2003 2003 HOH HOH A . 
F 5 HOH 4   2004 2004 HOH HOH A . 
F 5 HOH 5   2005 2005 HOH HOH A . 
F 5 HOH 6   2006 2006 HOH HOH A . 
F 5 HOH 7   2007 2007 HOH HOH A . 
F 5 HOH 8   2008 2008 HOH HOH A . 
F 5 HOH 9   2009 2009 HOH HOH A . 
F 5 HOH 10  2010 2010 HOH HOH A . 
F 5 HOH 11  2011 2011 HOH HOH A . 
F 5 HOH 12  2012 2012 HOH HOH A . 
F 5 HOH 13  2013 2013 HOH HOH A . 
F 5 HOH 14  2014 2014 HOH HOH A . 
F 5 HOH 15  2015 2015 HOH HOH A . 
F 5 HOH 16  2016 2016 HOH HOH A . 
F 5 HOH 17  2017 2017 HOH HOH A . 
F 5 HOH 18  2018 2018 HOH HOH A . 
F 5 HOH 19  2019 2019 HOH HOH A . 
F 5 HOH 20  2020 2020 HOH HOH A . 
F 5 HOH 21  2021 2021 HOH HOH A . 
F 5 HOH 22  2022 2022 HOH HOH A . 
F 5 HOH 23  2023 2023 HOH HOH A . 
F 5 HOH 24  2024 2024 HOH HOH A . 
F 5 HOH 25  2025 2025 HOH HOH A . 
F 5 HOH 26  2026 2026 HOH HOH A . 
F 5 HOH 27  2027 2027 HOH HOH A . 
F 5 HOH 28  2028 2028 HOH HOH A . 
F 5 HOH 29  2029 2029 HOH HOH A . 
F 5 HOH 30  2030 2030 HOH HOH A . 
F 5 HOH 31  2031 2031 HOH HOH A . 
F 5 HOH 32  2032 2032 HOH HOH A . 
F 5 HOH 33  2033 2033 HOH HOH A . 
F 5 HOH 34  2034 2034 HOH HOH A . 
F 5 HOH 35  2035 2035 HOH HOH A . 
F 5 HOH 36  2036 2036 HOH HOH A . 
F 5 HOH 37  2037 2037 HOH HOH A . 
F 5 HOH 38  2038 2038 HOH HOH A . 
F 5 HOH 39  2039 2039 HOH HOH A . 
F 5 HOH 40  2040 2040 HOH HOH A . 
F 5 HOH 41  2041 2041 HOH HOH A . 
F 5 HOH 42  2042 2042 HOH HOH A . 
F 5 HOH 43  2043 2043 HOH HOH A . 
F 5 HOH 44  2044 2044 HOH HOH A . 
F 5 HOH 45  2045 2045 HOH HOH A . 
F 5 HOH 46  2046 2046 HOH HOH A . 
F 5 HOH 47  2047 2047 HOH HOH A . 
F 5 HOH 48  2048 2048 HOH HOH A . 
F 5 HOH 49  2049 2049 HOH HOH A . 
F 5 HOH 50  2050 2050 HOH HOH A . 
F 5 HOH 51  2051 2051 HOH HOH A . 
F 5 HOH 52  2052 2052 HOH HOH A . 
F 5 HOH 53  2053 2053 HOH HOH A . 
F 5 HOH 54  2054 2054 HOH HOH A . 
F 5 HOH 55  2055 2055 HOH HOH A . 
F 5 HOH 56  2056 2056 HOH HOH A . 
F 5 HOH 57  2057 2057 HOH HOH A . 
F 5 HOH 58  2058 2058 HOH HOH A . 
F 5 HOH 59  2059 2059 HOH HOH A . 
F 5 HOH 60  2060 2060 HOH HOH A . 
F 5 HOH 61  2061 2061 HOH HOH A . 
F 5 HOH 62  2062 2062 HOH HOH A . 
F 5 HOH 63  2063 2063 HOH HOH A . 
F 5 HOH 64  2064 2064 HOH HOH A . 
F 5 HOH 65  2065 2065 HOH HOH A . 
F 5 HOH 66  2066 2066 HOH HOH A . 
F 5 HOH 67  2067 2067 HOH HOH A . 
F 5 HOH 68  2068 2068 HOH HOH A . 
F 5 HOH 69  2069 2069 HOH HOH A . 
F 5 HOH 70  2070 2070 HOH HOH A . 
F 5 HOH 71  2071 2071 HOH HOH A . 
F 5 HOH 72  2072 2072 HOH HOH A . 
F 5 HOH 73  2073 2073 HOH HOH A . 
F 5 HOH 74  2074 2074 HOH HOH A . 
F 5 HOH 75  2075 2075 HOH HOH A . 
F 5 HOH 76  2076 2076 HOH HOH A . 
F 5 HOH 77  2077 2077 HOH HOH A . 
F 5 HOH 78  2078 2078 HOH HOH A . 
F 5 HOH 79  2079 2079 HOH HOH A . 
F 5 HOH 80  2080 2080 HOH HOH A . 
F 5 HOH 81  2081 2081 HOH HOH A . 
F 5 HOH 82  2082 2082 HOH HOH A . 
F 5 HOH 83  2083 2083 HOH HOH A . 
F 5 HOH 84  2084 2084 HOH HOH A . 
F 5 HOH 85  2085 2085 HOH HOH A . 
F 5 HOH 86  2086 2086 HOH HOH A . 
F 5 HOH 87  2087 2087 HOH HOH A . 
F 5 HOH 88  2088 2088 HOH HOH A . 
F 5 HOH 89  2089 2089 HOH HOH A . 
F 5 HOH 90  2090 2090 HOH HOH A . 
F 5 HOH 91  2091 2091 HOH HOH A . 
F 5 HOH 92  2092 2092 HOH HOH A . 
F 5 HOH 93  2093 2093 HOH HOH A . 
F 5 HOH 94  2094 2094 HOH HOH A . 
F 5 HOH 95  2095 2095 HOH HOH A . 
F 5 HOH 96  2096 2096 HOH HOH A . 
F 5 HOH 97  2097 2097 HOH HOH A . 
F 5 HOH 98  2098 2098 HOH HOH A . 
F 5 HOH 99  2099 2099 HOH HOH A . 
F 5 HOH 100 2100 2100 HOH HOH A . 
F 5 HOH 101 2101 2101 HOH HOH A . 
F 5 HOH 102 2102 2102 HOH HOH A . 
G 5 HOH 1   2001 2001 HOH HOH B . 
G 5 HOH 2   2002 2002 HOH HOH B . 
G 5 HOH 3   2003 2003 HOH HOH B . 
G 5 HOH 4   2004 2004 HOH HOH B . 
G 5 HOH 5   2005 2005 HOH HOH B . 
G 5 HOH 6   2006 2006 HOH HOH B . 
G 5 HOH 7   2007 2007 HOH HOH B . 
G 5 HOH 8   2008 2008 HOH HOH B . 
G 5 HOH 9   2009 2009 HOH HOH B . 
G 5 HOH 10  2010 2010 HOH HOH B . 
G 5 HOH 11  2011 2011 HOH HOH B . 
G 5 HOH 12  2012 2012 HOH HOH B . 
G 5 HOH 13  2013 2013 HOH HOH B . 
G 5 HOH 14  2014 2014 HOH HOH B . 
G 5 HOH 15  2015 2015 HOH HOH B . 
G 5 HOH 16  2016 2016 HOH HOH B . 
G 5 HOH 17  2017 2017 HOH HOH B . 
G 5 HOH 18  2018 2018 HOH HOH B . 
G 5 HOH 19  2019 2019 HOH HOH B . 
G 5 HOH 20  2020 2020 HOH HOH B . 
G 5 HOH 21  2021 2021 HOH HOH B . 
G 5 HOH 22  2022 2022 HOH HOH B . 
G 5 HOH 23  2023 2023 HOH HOH B . 
G 5 HOH 24  2024 2024 HOH HOH B . 
G 5 HOH 25  2025 2025 HOH HOH B . 
G 5 HOH 26  2026 2026 HOH HOH B . 
G 5 HOH 27  2027 2027 HOH HOH B . 
G 5 HOH 28  2028 2028 HOH HOH B . 
G 5 HOH 29  2029 2029 HOH HOH B . 
G 5 HOH 30  2030 2030 HOH HOH B . 
G 5 HOH 31  2031 2031 HOH HOH B . 
G 5 HOH 32  2032 2032 HOH HOH B . 
G 5 HOH 33  2033 2033 HOH HOH B . 
G 5 HOH 34  2034 2034 HOH HOH B . 
G 5 HOH 35  2035 2035 HOH HOH B . 
G 5 HOH 36  2036 2036 HOH HOH B . 
G 5 HOH 37  2037 2037 HOH HOH B . 
G 5 HOH 38  2038 2038 HOH HOH B . 
G 5 HOH 39  2039 2039 HOH HOH B . 
G 5 HOH 40  2040 2040 HOH HOH B . 
G 5 HOH 41  2041 2041 HOH HOH B . 
G 5 HOH 42  2042 2042 HOH HOH B . 
G 5 HOH 43  2043 2043 HOH HOH B . 
G 5 HOH 44  2044 2044 HOH HOH B . 
G 5 HOH 45  2045 2045 HOH HOH B . 
G 5 HOH 46  2046 2046 HOH HOH B . 
G 5 HOH 47  2047 2047 HOH HOH B . 
G 5 HOH 48  2048 2048 HOH HOH B . 
G 5 HOH 49  2049 2049 HOH HOH B . 
G 5 HOH 50  2050 2050 HOH HOH B . 
G 5 HOH 51  2051 2051 HOH HOH B . 
G 5 HOH 52  2052 2052 HOH HOH B . 
G 5 HOH 53  2053 2053 HOH HOH B . 
G 5 HOH 54  2054 2054 HOH HOH B . 
G 5 HOH 55  2055 2055 HOH HOH B . 
G 5 HOH 56  2056 2056 HOH HOH B . 
G 5 HOH 57  2057 2057 HOH HOH B . 
G 5 HOH 58  2058 2058 HOH HOH B . 
G 5 HOH 59  2059 2059 HOH HOH B . 
G 5 HOH 60  2060 2060 HOH HOH B . 
G 5 HOH 61  2061 2061 HOH HOH B . 
G 5 HOH 62  2062 2062 HOH HOH B . 
G 5 HOH 63  2063 2063 HOH HOH B . 
G 5 HOH 64  2064 2064 HOH HOH B . 
G 5 HOH 65  2065 2065 HOH HOH B . 
G 5 HOH 66  2066 2066 HOH HOH B . 
G 5 HOH 67  2067 2067 HOH HOH B . 
G 5 HOH 68  2068 2068 HOH HOH B . 
G 5 HOH 69  2069 2069 HOH HOH B . 
G 5 HOH 70  2070 2070 HOH HOH B . 
G 5 HOH 71  2071 2071 HOH HOH B . 
G 5 HOH 72  2072 2072 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
2 A SXE 203 A SXE 203 ? SER ?                    
3 B SXE 203 B SXE 203 ? SER ?                    
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3320  ? 
1 MORE         -0    ? 
1 'SSA (A^2)'  37410 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-17 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-17 
5 'Structure model' 2 0 2019-05-15 
6 'Structure model' 2 1 2020-07-29 
7 'Structure model' 2 2 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 6 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  5 'Structure model' 'Data collection'           
5  5 'Structure model' 'Derived calculations'      
6  5 'Structure model' 'Polymer sequence'          
7  6 'Structure model' 'Data collection'           
8  6 'Structure model' 'Derived calculations'      
9  6 'Structure model' Other                       
10 6 'Structure model' 'Structure summary'         
11 7 'Structure model' 'Derived calculations'      
12 7 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_source               
2  5 'Structure model' entity_poly                 
3  5 'Structure model' pdbx_seq_map_depositor_info 
4  5 'Structure model' struct_conn                 
5  6 'Structure model' chem_comp                   
6  6 'Structure model' entity                      
7  6 'Structure model' pdbx_chem_comp_identifier   
8  6 'Structure model' pdbx_database_status        
9  6 'Structure model' pdbx_entity_nonpoly         
10 6 'Structure model' struct_conn                 
11 6 'Structure model' struct_site                 
12 6 'Structure model' struct_site_gen             
13 7 'Structure model' chem_comp                   
14 7 'Structure model' pdbx_struct_assembly        
15 7 'Structure model' pdbx_struct_assembly_gen    
16 7 'Structure model' pdbx_struct_assembly_prop   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'         
2  5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can'    
3  5 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code' 
4  5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'          
5  6 'Structure model' '_chem_comp.name'                              
6  6 'Structure model' '_chem_comp.type'                              
7  6 'Structure model' '_entity.pdbx_description'                     
8  6 'Structure model' '_pdbx_database_status.status_code_sf'         
9  6 'Structure model' '_pdbx_entity_nonpoly.name'                    
10 6 'Structure model' '_struct_conn.pdbx_role'                       
11 7 'Structure model' '_chem_comp.pdbx_synonyms'                     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
CCP4   phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id                 2JGF 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'GAP BETWEEN RESIDUES 257 AND 265 (MONOMER A AND B)' 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              161 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              161 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              161 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                100.95 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -14.35 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 78.96   -14.18  
2  1 PRO A 104 ? ? -45.54  165.92  
3  1 PHE A 158 ? ? -140.81 -14.04  
4  1 ALA A 167 ? ? -163.85 72.48   
5  1 ASN A 170 ? ? 49.22   20.36   
6  1 SXE A 203 ? ? 57.39   -112.47 
7  1 ASP A 306 ? ? -121.31 -87.45  
8  1 TYR A 341 ? ? -93.96  32.22   
9  1 SER A 371 ? ? -66.88  -178.18 
10 1 VAL A 407 ? ? -129.82 -61.00  
11 1 PRO A 458 ? ? -47.93  -19.47  
12 1 ARG A 493 ? ? -86.53  -76.64  
13 1 ASP A 494 ? ? -47.20  83.57   
14 1 ASN A 514 ? ? -160.60 -167.65 
15 1 ARG A 525 ? ? 36.85   56.07   
16 1 LEU A 540 ? ? -63.04  18.57   
17 1 SER A 541 ? ? -109.18 56.48   
18 1 ALA B 62  ? ? -118.06 52.48   
19 1 SER B 93  ? ? -174.10 144.23  
20 1 ALA B 127 ? ? -172.26 145.67  
21 1 ALA B 167 ? ? -150.59 68.78   
22 1 SXE B 203 ? ? 47.24   -124.22 
23 1 ASP B 306 ? ? -110.63 -86.57  
24 1 ASP B 323 ? ? -100.98 64.48   
25 1 TYR B 341 ? ? -97.98  42.30   
26 1 ASN B 350 ? ? -111.30 -166.02 
27 1 VAL B 407 ? ? -121.17 -69.70  
28 1 ASP B 494 ? ? 173.28  156.07  
29 1 SER B 495 ? ? -147.19 -34.17  
30 1 SER B 497 ? ? 93.77   124.42  
31 1 ASN B 514 ? ? -163.05 -168.72 
32 1 ALA B 542 ? ? -123.57 -75.15  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B ALA 544  ? CA ? B ALA 544 CA 
2 1 Y 1 B ALA 544  ? C  ? B ALA 544 C  
3 1 Y 1 B ALA 544  ? O  ? B ALA 544 O  
4 1 Y 1 B ALA 544  ? CB ? B ALA 544 CB 
5 1 N 1 A PGE 1546 ? O1 ? E PGE 1   O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 A ALA 544 ? A ALA 544 
10 1 Y 1 A THR 545 ? A THR 545 
11 1 Y 1 A GLU 546 ? A GLU 546 
12 1 Y 1 A ALA 547 ? A ALA 547 
13 1 Y 1 A PRO 548 ? A PRO 548 
14 1 Y 1 B GLU 1   ? B GLU 1   
15 1 Y 1 B GLY 2   ? B GLY 2   
16 1 Y 1 B ARG 3   ? B ARG 3   
17 1 Y 1 B PRO 258 ? B PRO 258 
18 1 Y 1 B PRO 259 ? B PRO 259 
19 1 Y 1 B GLY 260 ? B GLY 260 
20 1 Y 1 B GLY 261 ? B GLY 261 
21 1 Y 1 B ALA 262 ? B ALA 262 
22 1 Y 1 B GLY 263 ? B GLY 263 
23 1 Y 1 B GLY 264 ? B GLY 264 
24 1 Y 1 B THR 545 ? B THR 545 
25 1 Y 1 B GLU 546 ? B GLU 546 
26 1 Y 1 B ALA 547 ? B ALA 547 
27 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'HEXAETHYLENE GLYCOL'                    P6G 
4 'TRIETHYLENE GLYCOL'                     PGE 
5 water                                    HOH 
#