data_2JGJ
# 
_entry.id   2JGJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JGJ         
PDBE  EBI-31415    
WWPDB D_1290031415 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JGJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hornberg, A.'    1 
'Tunemalm, A.-K.' 2 
'Ekstrom, F.'     3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structures of Acetylcholinesterase in Complex with Organophosphorus Compounds Suggest that the Acyl Pocket Modulates the Aging Reaction by Precluding the Formation of the Trigonal Bipyramidal Transition State.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                4815 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17402711 
_citation.pdbx_database_id_DOI      10.1021/BI0621361 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hornberg, A.'    1 ? 
primary 'Tunemalm, A.-K.' 2 ? 
primary 'Ekstrom, F.'     3 ? 
# 
_cell.entry_id           2JGJ 
_cell.length_a           79.250 
_cell.length_b           111.200 
_cell.length_c           227.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JGJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                     60312.984 2   3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ?                                   ? 
3 non-polymer syn '2-(2-ETHOXYETHOXY)ETHANOL'              134.174   1   ?       ? ?                                   ? 
4 non-polymer syn 'HEXAETHYLENE GLYCOL'                    282.331   1   ?       ? ?                                   ? 
5 water       nat water                                    18.015    177 ?       ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SVV)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SVV y 
1 203 SVW y 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PCDNA3.1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JGJ A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2JGJ B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JGJ SVV A 203 ? UNP P21836 SER 234 microheterogeneity 203 1  
1 2JGJ SVW A 203 ? UNP P21836 SER 234 microheterogeneity 203 2  
1 2JGJ ALA A 544 ? UNP P21836 ?   ?   'expression tag'   544 3  
1 2JGJ THR A 545 ? UNP P21836 ?   ?   'expression tag'   545 4  
1 2JGJ GLU A 546 ? UNP P21836 ?   ?   'expression tag'   546 5  
1 2JGJ ALA A 547 ? UNP P21836 ?   ?   'expression tag'   547 6  
1 2JGJ PRO A 548 ? UNP P21836 ?   ?   'expression tag'   548 7  
2 2JGJ SVV B 203 ? UNP P21836 SER 234 microheterogeneity 203 8  
2 2JGJ SVW B 203 ? UNP P21836 SER 234 microheterogeneity 203 9  
2 2JGJ ALA B 544 ? UNP P21836 ?   ?   'expression tag'   544 10 
2 2JGJ THR B 545 ? UNP P21836 ?   ?   'expression tag'   545 11 
2 2JGJ GLU B 546 ? UNP P21836 ?   ?   'expression tag'   546 12 
2 2JGJ ALA B 547 ? UNP P21836 ?   ?   'expression tag'   547 13 
2 2JGJ PRO B 548 ? UNP P21836 ?   ?   'expression tag'   548 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AE3 non-polymer                  . '2-(2-ETHOXYETHOXY)ETHANOL'                 ? 'C6 H14 O3'      134.174 
ALA 'L-peptide linking'          y ALANINE                                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                       ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                  ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose    
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                       'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     
282.331 
PHE 'L-peptide linking'          y PHENYLALANINE                               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                      ? 'C3 H7 N O3'     105.093 
SVV 'L-peptide linking'          n 'O-[(S)-AMINO(HYDROXY)PHOSPHORYL]-L-SERINE' ? 'C3 H9 N2 O5 P'  184.088 
SVW 'L-peptide linking'          n 'O-[(R)-AMINO(HYDROXY)PHOSPHORYL]-L-SERINE' ? 'C3 H9 N2 O5 P'  184.088 
THR 'L-peptide linking'          y THREONINE                                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JGJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.9 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '28% PEG 750MME, 0.1 M HEPES PH7.0, pH 7.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-04-04 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07962 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.07962 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JGJ 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.700 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   69923 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.9000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.400 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.37000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.400 
_reflns_shell.pdbx_redundancy        7.50 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JGJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     68354 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.98 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  1398 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.920 
_refine.B_iso_mean                               46.74 
_refine.aniso_B[1][1]                            0.04000 
_refine.aniso_B[2][2]                            0.01000 
_refine.aniso_B[3][3]                            -0.05000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 2 CHAIN(S).
;
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.271 
_refine.pdbx_overall_ESU_R_Free                  0.218 
_refine.overall_SU_ML                            0.158 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.928 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8374 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             177 
_refine_hist.number_atoms_total               8607 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        19.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 8662  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.305  1.963  ? 11823 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.992  5.000  ? 1064  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.934 22.828 ? 396   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.536 15.000 ? 1262  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.396 15.000 ? 73    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.089  0.200  ? 1272  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 6799  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.207  0.200  ? 3935  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.310  0.200  ? 5922  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.127  0.200  ? 317   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.160  0.200  ? 28    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.288  0.200  ? 6     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.703  1.500  ? 5436  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.225  2.000  ? 8590  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.600  3.000  ? 3694  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.586  4.500  ? 3233  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             4926 
_refine_ls_shell.R_factor_R_work                  0.2730 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2920 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             107 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2JGJ 
_struct.title                     'Crystal structure of mouse acetylcholinesterase inhibited by aged methamidophos' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JGJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'AGING, SYNAPSE, MEMBRANE, HYDROLASE, METHAMIDOPHOS, SERINE ESTERASE, NEUROTRANSMITTER DEGRADATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  ALA A 204 ? SER A 215 ? ALA A 204 SER A 215 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? THR A 318 ? THR A 311 THR A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 335 ? GLY A 342 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? ALA A 420 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 ALA B 204 ? LEU B 214 ? ALA B 204 LEU B 214 1 ? 11 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P41 41 GLU B 285 ? LEU B 289 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 50 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P51 51 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P52 52 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P53 53 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P54 54 ARG B 534 ? ALA B 542 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.116 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.102 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.071 ? ?               
covale1 covale one  ? A GLU 202 C   ? ? ? 1_555 A SVV 203 N  A ? A GLU 202 A SVV 203  1_555 ? ? ? ? ? ? ? 1.332 ? ?               
covale2 covale both ? A SVV 203 C   A ? ? 1_555 A ALA 204 N  ? ? A SVV 203 A ALA 204  1_555 ? ? ? ? ? ? ? 1.343 ? ?               
covale3 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 1545 1_555 ? ? ? ? ? ? ? 1.466 ? N-Glycosylation 
covale4 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 1546 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale5 covale one  ? B GLU 202 C   ? ? ? 1_555 B SVV 203 N  A ? B GLU 202 B SVV 203  1_555 ? ? ? ? ? ? ? 1.339 ? ?               
covale6 covale both ? B SVV 203 C   A ? ? 1_555 B ALA 204 N  ? ? B SVV 203 B ALA 204  1_555 ? ? ? ? ? ? ? 1.334 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -4.16 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 2.75  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -5.32 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLY A 201 ? GLY A 192 GLY A 201 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLY B 201 ? GLY B 192 GLY B 201 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
_database_PDB_matrix.entry_id          2JGJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JGJ 
_atom_sites.fract_transf_matrix[1][1]   0.012618 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008993 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004398 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.909  14.693  56.162  1.00 69.90 ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.527  14.956  55.659  1.00 69.70 ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.630  15.361  56.823  1.00 69.50 ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.002  16.226  57.624  1.00 69.87 ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.968  13.748  54.868  1.00 69.73 ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.977  12.388  55.587  1.00 69.64 ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.799  11.193  54.642  1.00 69.45 ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.740  10.518  54.715  1.00 68.29 ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.730  10.922  53.843  1.00 68.82 ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.448  14.763  56.912  1.00 68.87 ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.588  14.990  58.055  1.00 67.76 ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.492  15.961  57.735  1.00 67.29 ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.338  15.722  58.102  1.00 67.19 ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.854  17.042  57.036  1.00 66.80 ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.922  18.137  56.703  1.00 66.30 ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.378  18.146  55.259  1.00 65.52 ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.383  18.815  54.988  1.00 65.58 ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.535  19.508  57.055  1.00 66.53 ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.630  19.824  58.570  1.00 67.51 ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.240  19.850  59.268  1.00 68.80 ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.328  20.055  60.723  1.00 69.07 ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.395  19.687  61.610  1.00 69.60 ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.278  19.065  61.225  1.00 67.99 ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 24.588  19.930  62.901  1.00 69.42 ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.019  17.412  54.350  1.00 64.42 ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.600  17.344  52.946  1.00 63.48 ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.320  16.563  52.721  1.00 62.51 ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.873  15.808  53.587  1.00 61.94 ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.684  16.703  52.088  1.00 64.00 ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.760  17.653  51.639  1.00 65.36 ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.138  17.084  51.876  1.00 66.74 ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 29.304  16.305  52.842  1.00 67.19 ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 30.056  17.425  51.105  1.00 68.31 ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.744  16.753  51.534  1.00 61.28 ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.596  15.980  51.103  1.00 60.23 ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.043  14.519  50.997  1.00 59.75 ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.869  14.176  50.145  1.00 59.96 ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.060  16.522  49.776  1.00 59.55 ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.817  15.785  49.285  1.00 59.33 ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.618  14.593  49.620  1.00 57.25 ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.036  16.408  48.531  1.00 59.28 ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.512  13.652  51.877  1.00 59.20 ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.988  12.265  51.943  1.00 58.40 ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.777  11.486  50.642  1.00 57.39 ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.392  10.451  50.438  1.00 57.42 ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.137  11.664  53.066  1.00 58.60 ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 20.904  12.527  53.118  1.00 58.70 ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.428  13.899  52.849  1.00 59.32 ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.917  11.997  49.773  1.00 56.31 ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.576  11.320  48.533  1.00 55.07 ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.535  11.693  47.384  1.00 53.35 ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.400  11.204  46.262  1.00 52.86 ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.121  11.637  48.187  1.00 55.76 ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.558  10.915  46.950  1.00 58.70 ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.116  9.469   47.204  1.00 61.39 ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.113  8.664   46.278  1.00 64.31 ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.729  9.144   48.446  1.00 61.28 ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.519  12.542  47.670  1.00 51.57 ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.464  12.968  46.638  1.00 49.91 ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.872  12.420  46.851  1.00 49.12 ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.816  12.839  46.166  1.00 49.47 ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.479  14.498  46.493  1.00 49.76 ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.125  15.158  46.169  1.00 48.86 ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.186  16.649  46.428  1.00 48.34 ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.670  14.877  44.740  1.00 46.93 ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.017  11.483  47.783  1.00 47.55 ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.323  10.907  48.051  1.00 46.63 ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.364  9.480   47.550  1.00 45.69 ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.659  8.616   48.073  1.00 45.60 ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.670  10.986  49.537  1.00 46.58 ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.522  12.353  50.218  1.00 47.07 ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.672  12.236  51.752  1.00 46.85 ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.491  13.396  49.653  1.00 45.49 ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.172  9.243   46.518  1.00 44.58 ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.279  7.912   45.902  1.00 43.60 ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.755  7.498   45.833  1.00 42.92 ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.629  8.362   45.693  1.00 42.78 ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.617  7.886   44.497  1.00 43.54 ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.826  6.546   43.795  1.00 43.79 ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.142  8.129   44.623  1.00 42.87 ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.022  6.192   45.958  1.00 41.51 ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.372  5.646   45.785  1.00 40.12 ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.493  4.894   44.470  1.00 40.26 ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.623  4.084   44.132  1.00 40.55 ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.765  4.721   46.951  1.00 40.10 ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.115  4.006   46.724  1.00 39.06 ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.623  3.248   47.930  1.00 38.93 ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.098  4.140   48.997  1.00 37.22 ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.350  4.572   49.132  1.00 35.90 ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.656  5.384   50.142  1.00 36.22 ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.296  4.197   48.268  1.00 33.55 ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.562  5.175   43.724  1.00 40.02 ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.924  4.402   42.534  1.00 39.82 ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.328  3.799   42.734  1.00 40.46 ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.020  4.152   43.704  1.00 40.54 ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.879  5.249   41.237  1.00 39.66 ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.451  5.616   40.878  1.00 39.02 ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.773  6.490   41.363  1.00 38.86 ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.738  2.919   41.817  1.00 40.39 ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.008  2.180   41.909  1.00 41.45 ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.211  3.086   42.218  1.00 41.28 ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.106  2.705   42.948  1.00 41.31 ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.224  1.360   40.626  1.00 41.28 ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.591  0.673   40.438  1.00 43.42 ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.863  -0.554  41.352  1.00 44.15 ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.886  -0.159  42.312  1.00 48.45 ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.130  -0.621  42.349  1.00 47.71 ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.514  -1.578  41.521  1.00 45.78 ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.973  -0.149  43.262  1.00 48.49 ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.190  4.307   41.706  1.00 41.67 ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.279  5.241   41.939  1.00 41.82 ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.212  6.052   43.214  1.00 41.70 ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.188  6.725   43.576  1.00 42.10 ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.066  6.021   43.887  1.00 41.79 ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.900  6.776   45.128  1.00 41.78 ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.517  7.358   45.358  1.00 41.57 ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.550  6.975   44.695  1.00 41.66 ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.439  8.279   46.315  1.00 41.28 ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.178  8.901   46.719  1.00 41.48 ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.794  10.115  45.876  1.00 40.95 ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.669  10.925  45.499  1.00 41.00 ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.235  9.284   48.202  1.00 41.24 ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.704  8.186   49.131  1.00 42.18 ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.836  8.544   50.615  1.00 42.63 ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 32.841  8.546   51.363  1.00 43.07 ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 35.068  8.844   51.047  1.00 41.98 ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.490  10.256  45.601  1.00 40.06 ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.989  11.390  44.802  1.00 39.93 ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.891  12.185  45.476  1.00 40.11 ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.027  11.617  46.146  1.00 39.88 ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.435  10.914  43.460  1.00 39.74 ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.288  10.147  42.473  1.00 38.57 ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.361  9.532   41.448  1.00 37.71 ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.300  11.062  41.831  1.00 37.50 ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.909  13.498  45.260  1.00 40.83 ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.805  14.369  45.651  1.00 41.53 ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.214  15.004  44.403  1.00 41.73 ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.922  15.690  43.659  1.00 41.78 ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.269  15.447  46.626  1.00 41.37 ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.129  16.265  47.268  1.00 42.97 ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.647  17.218  48.340  1.00 43.06 ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.891  17.845  47.910  1.00 47.57 ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.064  17.747  48.532  1.00 48.71 ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.195  17.063  49.674  1.00 46.43 ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.120  18.356  47.995  1.00 49.45 ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.925  14.750  44.171  1.00 41.88 ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.200  15.327  43.052  1.00 42.42 ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.307  16.476  43.484  1.00 43.26 ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.373  16.922  44.634  1.00 43.45 ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.459  16.942  42.570  1.00 43.41 ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.621  18.110  42.820  1.00 44.05 ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.142  17.832  42.515  1.00 44.55 ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.814  17.077  41.597  1.00 45.02 ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.139  19.343  42.028  1.00 44.04 ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.381  20.618  42.418  1.00 43.95 ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.122  19.085  40.504  1.00 43.44 ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.940  21.910  41.779  1.00 44.56 ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.265  18.422  43.320  1.00 45.06 ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.829  18.324  43.128  1.00 46.27 ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.462  19.425  42.139  1.00 46.16 ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.746  20.600  42.375  1.00 45.86 ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.115  18.499  44.475  1.00 45.94 ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.603  18.373  44.459  1.00 47.20 ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.995  18.902  45.774  1.00 48.33 ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.783  19.698  45.518  1.00 55.79 ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.530  19.310  45.788  1.00 57.78 ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.283  18.125  46.344  1.00 59.08 ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.510  20.112  45.496  1.00 57.53 ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.868  19.028  41.019  1.00 46.47 ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.522  19.951  39.951  1.00 47.20 ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.016  20.071  39.777  1.00 48.07 ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.286  19.094  39.921  1.00 48.14 ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.117  19.491  38.621  1.00 46.60 ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.617  19.486  38.324  1.00 45.55 ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.763  19.039  36.878  1.00 44.88 ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.290  20.839  38.528  1.00 42.20 ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.570  21.270  39.423  1.00 49.07 ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.166  21.522  39.124  1.00 49.84 ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.813  21.195  37.669  1.00 49.05 ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.402  21.726  36.737  1.00 48.84 ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.800  22.974  39.473  1.00 50.97 ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.318  23.324  39.271  1.00 53.96 ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.407  22.470  40.166  1.00 58.71 ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 11.908  22.699  39.874  1.00 58.22 ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 11.114  21.560  40.452  1.00 61.16 ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.867  20.283  37.495  1.00 48.48 ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.214  20.069  36.212  1.00 47.82 ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.749  20.493  36.368  1.00 47.42 ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.265  20.607  37.490  1.00 47.58 ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.324  18.612  35.790  1.00 47.38 ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.038  20.742  35.251  1.00 47.17 ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.656  21.232  35.344  1.00 46.85 ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.741   20.426  36.273  1.00 46.62 ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.060   21.009  37.097  1.00 46.73 ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.167  21.155  33.903  1.00 46.94 ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.399  21.314  33.087  1.00 46.80 ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.475  20.610  33.847  1.00 47.08 ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.736   19.102  36.160  1.00 46.59 ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.890   18.273  37.020  1.00 46.39 ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.465   17.939  38.392  1.00 46.41 ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.832   17.206  39.160  1.00 46.26 ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.659  18.452  38.707  1.00 45.90 ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.316  18.149  39.983  1.00 45.21 ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.831  17.976  39.912  1.00 44.91 ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.442  18.204  38.861  1.00 45.21 ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.455  17.553  41.029  1.00 44.08 ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.920  17.500  41.096  1.00 43.29 ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.517  16.237  40.479  1.00 42.56 ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.822  15.213  40.408  1.00 41.90 ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.205  17.533  42.594  1.00 43.39 ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.948  16.981  43.245  1.00 43.91 ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.813  17.074  42.269  1.00 43.84 ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.786  16.336  40.043  1.00 41.29 ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.590  15.196  39.549  1.00 40.28 ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.996  15.168  40.192  1.00 39.82 ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.514  16.204  40.621  1.00 40.14 ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.737  15.164  37.983  1.00 40.33 ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.401  14.980  37.292  1.00 39.88 ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.440  16.408  37.452  1.00 40.06 ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.614  13.995  40.268  1.00 38.87 ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.004  13.925  40.720  1.00 38.65 ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.924  14.001  39.509  1.00 37.61 ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.714  13.286  38.522  1.00 36.83 ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.297  12.639  41.488  1.00 38.83 ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.242  12.273  42.368  1.00 42.36 ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.937  14.861  39.582  1.00 36.28 ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.945  14.894  38.541  1.00 35.63 ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.336  14.720  39.125  1.00 35.21 ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.640  15.254  40.182  1.00 36.18 ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.855  16.183  37.765  1.00 35.74 ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.184  13.969  38.437  1.00 34.46 ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.578  13.816  38.849  1.00 33.13 ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.434  14.225  37.655  1.00 33.09 ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.588  13.478  36.704  1.00 33.58 ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.839  12.376  39.300  1.00 32.33 ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.052  11.978  40.523  1.00 31.97 ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.738  11.511  40.410  1.00 31.67 ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.596  12.112  41.793  1.00 29.95 ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.999  11.171  41.548  1.00 31.21 ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.856  11.779  42.935  1.00 30.12 ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.563  11.299  42.808  1.00 30.29 ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.959  15.439  37.684  1.00 32.92 ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.593  16.004  36.491  1.00 32.66 ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.115  16.009  36.607  1.00 32.44 ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.651  16.195  37.677  1.00 32.50 ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.027  17.402  36.200  1.00 32.35 ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.485  17.491  36.215  1.00 31.85 ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.016  18.944  36.140  1.00 32.16 ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.782  16.629  35.124  1.00 29.26 ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.797  15.757  35.504  1.00 32.71 ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.247  15.716  35.506  1.00 33.86 ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.888  14.645  36.368  1.00 34.23 ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.783  14.939  37.154  1.00 34.09 ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.422  13.404  36.235  1.00 34.88 ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.090  12.255  36.852  1.00 34.91 ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.268  11.825  35.954  1.00 35.45 ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.077  11.541  34.779  1.00 35.38 ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.126  11.069  37.016  1.00 34.21 ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.999  11.433  37.980  1.00 34.46 ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.870  9.835   37.518  1.00 34.14 ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.723  10.626  37.791  1.00 31.05 ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.491  11.790  36.497  1.00 35.89 ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.591  11.298  35.652  1.00 36.14 ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.467  9.799   35.429  1.00 36.54 ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.126  9.081   36.355  1.00 36.49 ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.830  11.585  36.498  1.00 35.90 ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.340  11.596  37.905  1.00 35.68 ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.950  12.176  37.842  1.00 35.43 ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.729  9.335   34.210  1.00 37.26 ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.718  7.909   33.920  1.00 37.20 ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.019  7.411   33.307  1.00 38.04 ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.205  6.199   33.138  1.00 39.01 ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.507  7.509   33.063  1.00 36.86 ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.505  8.092   31.696  1.00 36.36 ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.040  7.391   30.635  1.00 35.20 ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.929  9.336   31.453  1.00 36.77 ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.045  7.924   29.351  1.00 35.92 ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.917  9.873   30.168  1.00 36.21 ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.483  9.166   29.118  1.00 36.53 ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.902  8.343   32.970  1.00 38.66 ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.248  8.040   32.496  1.00 39.01 ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.271  8.956   33.152  1.00 39.76 ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.928  10.028  33.683  1.00 40.05 ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.332  8.189   30.993  1.00 39.11 ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.528  8.524   33.114  1.00 40.22 ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.648  9.395   33.401  1.00 41.01 ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.688  10.470  32.316  1.00 41.26 ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.493  10.165  31.133  1.00 41.51 ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.957  8.597   33.398  1.00 41.03 ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.182  7.764   34.658  1.00 41.86 ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.253  8.611   35.912  1.00 43.65 ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.098  9.534   35.955  1.00 47.24 ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.470  8.362   36.852  1.00 42.37 ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.929  11.726  32.705  1.00 41.33 ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 45.017  12.790  31.696  1.00 41.52 ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.969  12.425  30.553  1.00 41.48 ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.141  12.151  30.800  1.00 42.16 ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.567  13.985  32.483  1.00 41.20 ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.225  13.712  33.909  1.00 41.27 ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.139  12.220  34.079  1.00 41.42 ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.474  12.408  29.309  1.00 41.36 ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.315  12.026  28.175  1.00 41.32 ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.287  13.139  27.734  1.00 41.51 ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.352  13.484  26.542  1.00 40.68 ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.296  11.721  27.086  1.00 40.81 ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.172  12.629  27.386  1.00 41.60 ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.101  12.736  28.887  1.00 41.78 ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.049  13.657  28.692  1.00 41.50 ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.946  14.790  28.464  1.00 42.67 ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.425  14.364  28.275  1.00 43.51 ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.782  13.218  28.543  1.00 43.68 ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.799  15.852  29.600  1.00 42.85 ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.358  16.429  29.611  1.00 42.61 ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.133  15.252  30.972  1.00 41.81 ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.263  15.282  27.789  1.00 44.04 ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.709  15.060  27.669  1.00 44.49 ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.117  13.858  26.827  1.00 45.06 ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.816  13.797  25.637  1.00 45.26 ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.815  12.899  27.437  1.00 45.38 ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.188  11.657  26.735  1.00 45.91 ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.975  10.773  26.386  1.00 45.42 ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.113  9.782   25.678  1.00 45.49 ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.214  10.854  27.548  1.00 45.83 ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.704  10.554  28.843  1.00 47.58 ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.792  11.144  26.873  1.00 45.37 ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.573  10.353  26.647  1.00 45.01 ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.760  10.814  25.434  1.00 43.86 ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.816  10.144  25.021  1.00 43.43 ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.699  10.361  27.898  1.00 46.01 ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.407  9.950   29.207  1.00 48.86 ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.986  8.557   29.635  1.00 54.93 ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.543  8.521   31.037  1.00 59.57 ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 50.232  7.977   32.042  1.00 62.21 ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.418  7.399   31.821  1.00 64.10 ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 49.730  7.999   33.274  1.00 62.69 ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.139  11.952  24.856  1.00 42.90 ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.498  12.454  23.635  1.00 41.53 ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.629  11.424  22.517  1.00 41.27 ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.714  10.863  22.316  1.00 41.70 ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.097  13.809  23.231  1.00 41.50 ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.457  14.456  22.004  1.00 41.46 ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.255  15.664  21.522  1.00 40.05 ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.963  16.848  22.304  1.00 38.53 ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.495  18.044  22.076  1.00 38.60 ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.346  18.205  21.087  1.00 38.78 ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.173  19.081  22.835  1.00 37.20 ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.512  11.161  21.829  1.00 40.34 ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.382  10.143  20.770  1.00 39.52 ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.285  8.705   21.266  1.00 40.00 ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.992  7.790   20.480  1.00 40.11 ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.470  10.262  19.691  1.00 39.00 ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.713  11.663  19.218  1.00 38.61 ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.670  12.429  18.682  1.00 37.45 ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.987  12.226  19.306  1.00 36.79 ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.894  13.753  18.254  1.00 37.67 ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.219  13.545  18.873  1.00 36.72 ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.170  14.307  18.352  1.00 36.65 ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.519  8.511   22.560  1.00 40.65 ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.500  7.191   23.196  1.00 41.61 ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.103  6.781   23.674  1.00 41.47 ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.319  7.638   24.082  1.00 41.12 ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.456  7.181   24.398  1.00 41.70 ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.928  7.287   24.034  1.00 44.66 ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.597  5.724   23.421  1.00 48.72 ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 50.937  5.744   21.792  1.00 47.95 ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.806  5.463   23.654  1.00 41.63 ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.581  4.912   24.246  1.00 41.78 ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.392  5.427   25.663  1.00 41.93 ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.368  5.821   26.306  1.00 41.88 ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.852  3.409   24.294  1.00 41.58 ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.813  3.158   23.201  1.00 41.76 ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.652  4.407   23.064  1.00 41.76 ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.142  5.482   26.137  1.00 42.20 ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.923  5.914   27.506  1.00 42.86 ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.245  4.822   28.534  1.00 44.09 ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 43.971  3.626   28.305  1.00 43.35 ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.430  6.209   27.528  1.00 42.81 ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.862  5.251   26.535  1.00 41.85 ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.877  5.191   25.441  1.00 42.09 ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.816  5.251   29.658  1.00 45.49 ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.026  4.390   30.818  1.00 47.63 ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.983  4.801   31.840  1.00 47.04 ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.809  5.995   32.089  1.00 47.37 ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.437  4.573   31.400  1.00 47.57 ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.584  4.194   30.432  1.00 50.79 ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.986  4.410   31.029  1.00 52.03 ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.132  5.275   31.942  1.00 56.72 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.942  3.712   30.574  1.00 56.27 ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.289  3.815   32.443  1.00 46.89 ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.241  4.061   33.449  1.00 46.35 ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.683  5.040   34.545  1.00 45.94 ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.853  5.048   34.924  1.00 45.44 ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.014  2.676   34.056  1.00 46.54 ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.385  1.722   32.960  1.00 47.09 ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.492  2.376   32.184  1.00 46.60 ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.750  5.845   35.047  1.00 45.59 ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.033  6.806   36.108  1.00 46.03 ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.474  6.105   37.393  1.00 46.97 ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.859  5.123   37.804  1.00 46.98 ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.801  7.671   36.373  1.00 45.72 ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.927  8.628   37.542  1.00 45.00 ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.984  9.705   37.314  1.00 43.32 ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.971  10.732  38.439  1.00 42.45 ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.951  11.820  38.180  1.00 42.78 ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.536  6.619   38.013  1.00 47.63 ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.075  6.061   39.250  1.00 48.82 ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.250  6.541   40.431  1.00 47.84 ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.868  7.697   40.467  1.00 47.92 ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.555  6.452   39.443  1.00 48.43 ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.527  5.565   38.665  1.00 50.49 ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.973  6.078   38.750  1.00 52.07 ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.529  6.235   37.401  1.00 60.69 ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.827  6.283   37.095  1.00 64.43 ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 50.760  6.171   38.042  1.00 66.03 ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 50.192  6.432   35.823  1.00 65.98 ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.972  5.653   41.400  1.00 47.63 ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.130  6.046   42.535  1.00 47.35 ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.615  7.310   43.213  1.00 47.21 ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.812  7.565   43.259  1.00 47.36 ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.232  4.850   43.482  1.00 47.26 ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.492  3.682   42.568  1.00 47.51 ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.371  4.233   41.470  1.00 47.33 ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.673  8.108   43.704  1.00 47.05 ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.977  9.351   44.397  1.00 46.93 ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.601  9.195   45.861  1.00 47.78 ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.893  8.246   46.238  1.00 48.24 ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.212  10.532  43.771  1.00 45.90 ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.706  10.324  43.719  1.00 45.36 ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.798  10.657  44.684  1.00 44.38 ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.951  9.737   42.650  1.00 43.26 ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.532  10.320  44.281  1.00 44.25 ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.597  9.745   43.041  1.00 43.31 ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.286  9.209   41.405  1.00 43.60 ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.578  9.239   42.230  1.00 42.70 ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.265  8.702   40.598  1.00 44.28 ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.932  8.723   41.020  1.00 43.17 ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.067  10.119  46.693  1.00 48.42 ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.663  10.096  48.088  1.00 49.14 ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.671  11.228  48.335  1.00 48.91 ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.647  12.215  47.599  1.00 49.04 ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.883  10.184  49.020  1.00 49.48 ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.605  11.383  48.789  1.00 50.57 ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.846  11.068  49.363  1.00 49.00 ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.854  12.074  49.715  1.00 48.76 ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.632  12.036  48.814  1.00 48.28 ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.427  11.081  48.054  1.00 47.87 ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.808  13.075  48.917  1.00 47.91 ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.590  13.152  48.122  1.00 47.62 ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.838  14.082  46.958  1.00 47.27 ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.086  15.273  47.150  1.00 47.18 ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.360  13.665  48.927  1.00 47.88 ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.110  13.535  48.090  1.00 47.03 ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.191  12.900  50.235  1.00 47.77 ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.769  13.520  45.759  1.00 46.74 ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.842  14.288  44.545  1.00 47.07 ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.579  15.131  44.372  1.00 47.20 ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.449  14.624  44.456  1.00 47.30 ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.039  13.360  43.344  1.00 47.47 ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.391  14.085  42.045  1.00 47.98 ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.573  13.441  41.329  1.00 48.24 ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.169  14.170  41.140  1.00 49.62 ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.771  16.425  44.147  1.00 46.99 ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.651  17.269  43.810  1.00 46.71 ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.243  17.058  42.344  1.00 45.94 ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.010  17.350  41.417  1.00 46.03 ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.945  18.732  44.094  1.00 47.11 ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.751  19.611  43.780  1.00 49.05 ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.701  20.161  42.651  1.00 50.10 ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 31.837  19.694  44.637  1.00 50.39 ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.030  16.544  42.159  1.00 44.73 ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.511  16.199  40.837  1.00 43.50 ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.258  17.025  40.545  1.00 42.29 ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.215  16.484  40.151  1.00 41.28 ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.210  14.692  40.755  1.00 43.10 ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.391  18.339  40.743  1.00 41.18 ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.268  19.274  40.655  1.00 39.98 ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.354  20.234  39.458  1.00 40.47 ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.416  21.007  39.208  1.00 41.21 ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.064  20.092  41.994  1.00 40.33 ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.113  21.067  42.172  1.00 37.90 ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.970  19.164  43.234  1.00 37.78 ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.460  20.202  38.710  1.00 39.93 ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.556  21.022  37.506  1.00 39.53 ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.134  20.244  36.343  1.00 39.42 ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.870  19.282  36.536  1.00 39.91 ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.433  22.264  37.716  1.00 39.50 ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.773  21.848  37.998  1.00 39.83 ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.914  23.112  38.870  1.00 39.87 ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.802  20.674  35.130  1.00 39.09 ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.382  20.093  33.936  1.00 38.65 ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.877  20.377  33.936  1.00 39.16 ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.331  21.403  34.468  1.00 40.11 ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.725  20.633  32.665  1.00 37.48 ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.338  20.091  32.423  1.00 37.19 ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.133  18.723  32.198  1.00 35.80 ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.225  20.955  32.430  1.00 36.88 ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.848  18.216  31.989  1.00 36.11 ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.935  20.474  32.208  1.00 35.34 ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.741  19.098  31.992  1.00 36.35 ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.629  19.453  33.360  1.00 38.30 ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.054  19.568  33.296  1.00 38.37 ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.455  20.060  31.928  1.00 38.24 ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.593  20.328  31.070  1.00 38.51 ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.714  18.222  33.599  1.00 38.45 ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 35.963  17.992  35.078  1.00 39.64 ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.159  18.771  35.633  1.00 43.36 ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.404  18.748  36.845  1.00 44.27 ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.910  19.456  34.754  1.00 43.07 ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.765  20.189  31.739  1.00 37.12 ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.321  20.666  30.497  1.00 36.36 ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.723  19.987  29.268  1.00 35.78 ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.244  18.853  29.308  1.00 35.71 ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.845  20.486  30.469  1.00 36.02 ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.560  21.221  31.591  1.00 35.98 ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.145  22.280  32.060  1.00 35.53 ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.672  20.652  32.011  1.00 39.50 ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.761  20.727  28.178  1.00 35.14 ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.460  20.225  26.877  1.00 35.06 ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.794  19.853  26.220  1.00 35.83 ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.820  20.481  26.476  1.00 35.64 ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.719  21.307  26.109  1.00 34.77 ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.502  20.892  24.681  1.00 33.54 ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.389  21.600  26.831  1.00 34.04 ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.771  18.810  25.402  1.00 36.42 ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.947  18.349  24.713  1.00 37.58 ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.412  19.374  23.701  1.00 38.53 ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.593  20.033  23.067  1.00 38.96 ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.664  17.010  24.068  1.00 37.09 ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.481  15.685  25.319  1.00 39.87 ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.730  19.514  23.563  1.00 39.65 ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.301  20.575  22.748  1.00 40.03 ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.804  20.495  21.322  1.00 40.26 ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.869  19.441  20.698  1.00 40.68 ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.843  20.591  22.805  1.00 40.32 ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.352  22.009  22.831  1.00 40.29 ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.672  22.640  24.029  1.00 40.60 ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.433  22.748  21.660  1.00 41.50 ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.102  23.966  24.052  1.00 40.80 ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.849  24.060  21.669  1.00 41.22 ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.185  24.666  22.860  1.00 41.84 ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.608  25.990  22.836  1.00 43.53 ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.288  21.607  20.806  1.00 40.33 ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.630  21.578  19.501  1.00 40.07 ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.577  22.908  18.781  1.00 40.75 ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.664  23.955  19.391  1.00 40.69 ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.207  20.987  19.609  1.00 39.37 ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.236  21.786  20.452  1.00 37.05 ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.021  20.981  20.820  1.00 38.15 ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.926  21.227  20.309  1.00 36.17 ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.207  19.975  21.687  1.00 37.05 ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.420  22.825  17.466  1.00 42.74 ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.067  23.946  16.617  1.00 44.97 ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.753  24.572  17.078  1.00 46.09 ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.795  23.863  17.413  1.00 45.19 ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.963  23.466  15.161  1.00 45.73 ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.599  24.557  14.185  1.00 48.16 ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.252  24.804  13.847  1.00 49.32 ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.588  25.360  13.602  1.00 49.40 ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.911  25.806  12.957  1.00 48.76 ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.251  26.373  12.701  1.00 49.12 ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.912  26.585  12.387  1.00 49.34 ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.571  27.593  11.510  1.00 49.36 ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.732  25.906  17.109  1.00 47.87 ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.550  26.679  17.496  1.00 49.78 ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.009  27.463  16.295  1.00 51.27 ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.755  28.143  15.593  1.00 51.11 ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.838  27.610  18.706  1.00 49.82 ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.585  28.370  19.143  1.00 49.33 ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.386  26.799  19.871  1.00 49.84 ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.705  27.329  16.061  1.00 53.31 ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.047  27.922  14.910  1.00 55.12 ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.894  29.428  15.106  1.00 56.31 ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.335  29.894  16.107  1.00 56.37 ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.680  27.261  14.674  1.00 55.33 ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 31.925  27.864  13.485  1.00 57.04 ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 31.449  29.034  13.572  1.00 57.21 ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.815  27.156  12.459  1.00 58.49 ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.380  30.183  14.127  1.00 58.04 ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.261  31.643  14.153  1.00 59.63 ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.602  32.240  12.898  1.00 60.38 ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.477  33.459  12.800  1.00 60.55 ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.630  32.311  14.394  1.00 59.85 ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.647  31.570  13.700  1.00 59.78 ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 35.936  32.366  15.900  1.00 59.88 ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 33.161  31.388  11.968  1.00 61.24 ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.498  31.847  10.744  1.00 62.36 ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.401  32.897  10.989  1.00 62.43 ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.348  33.905  10.272  1.00 62.65 ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.947  30.676  9.917   1.00 62.45 ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 31.248  31.054  8.590   1.00 64.16 ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.177  31.844  7.624   1.00 64.67 ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.602  29.831  7.876   1.00 63.24 ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.547  32.670  11.992  1.00 62.27 ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.484  33.626  12.324  1.00 62.02 ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.484  34.033  13.797  1.00 62.13 ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.644  33.581  14.577  1.00 62.12 ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.111  33.079  11.939  1.00 61.64 ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.915  32.759  10.476  1.00 61.05 ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.858  33.772  9.525   1.00 60.95 ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.731  31.444  10.051  1.00 60.36 ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.650  33.481  8.174   1.00 61.48 ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.517  31.139  8.713   1.00 60.66 ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.482  32.161  7.773   1.00 61.42 ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.268  31.873  6.436   1.00 60.98 ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.413  34.919  14.180  1.00 62.28 ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.607  35.309  15.587  1.00 62.00 ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.395  35.979  16.242  1.00 61.22 ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.960  37.023  15.783  1.00 61.38 ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.780  36.299  15.517  1.00 62.23 ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.475  35.984  14.213  1.00 62.80 ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.354  35.613  13.282  1.00 62.52 ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.878  35.371  17.311  1.00 60.45 ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.750  35.925  18.086  1.00 59.06 ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.432  35.202  17.837  1.00 57.81 ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.456  35.378  18.580  1.00 57.23 ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.436  34.375  16.791  1.00 56.65 ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.252  33.711  16.249  1.00 55.57 ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.001  32.400  16.968  1.00 55.26 ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.882  31.541  17.003  1.00 55.34 ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.485  33.479  14.756  1.00 55.14 ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.400  32.720  14.056  1.00 54.42 ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.091  33.199  14.025  1.00 54.06 ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.705  31.550  13.360  1.00 54.03 ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.094  32.499  13.339  1.00 53.55 ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.718  30.841  12.674  1.00 53.19 ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.412  31.318  12.660  1.00 53.62 ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.801  32.254  17.533  1.00 54.65 ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.450  31.092  18.351  1.00 54.43 ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.573  29.793  17.556  1.00 53.26 ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.002  28.764  18.085  1.00 53.15 ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.043  31.254  18.955  1.00 54.86 ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.436  29.995  19.627  1.00 58.73 ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.619  29.938  21.163  1.00 64.52 ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.887  31.007  21.781  1.00 66.81 ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.476  28.822  21.750  1.00 64.13 ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.221  29.856  16.279  1.00 51.89 ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.276  28.698  15.409  1.00 50.28 ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.620  27.994  15.406  1.00 49.33 ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.671  26.760  15.345  1.00 49.02 ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.703  28.766  15.457  1.00 48.19 ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 27.031  28.175  15.564  1.00 47.83 ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.527  28.073  17.011  1.00 47.65 ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.170  27.093  17.375  1.00 47.54 ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 28.092  28.869  14.665  1.00 47.35 ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 28.128  30.270  14.945  1.00 48.95 ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.782  28.664  13.206  1.00 46.72 ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.217  29.067  17.837  1.00 47.63 ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.773  29.114  19.185  1.00 47.59 ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.331  27.938  20.035  1.00 46.77 ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 28.109  27.428  20.836  1.00 46.68 ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.446  30.431  19.895  1.00 48.11 ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.090  31.716  19.308  1.00 51.41 ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.631  31.708  19.244  1.00 55.80 ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.283  30.776  19.808  1.00 55.64 ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 30.181  32.659  18.617  1.00 56.82 ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.086  27.502  19.857  1.00 45.98 ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.545  26.378  20.627  1.00 45.08 ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.392  25.086  20.523  1.00 43.79 ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.337  24.237  21.409  1.00 43.85 ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.097  26.108  20.223  1.00 44.84 ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.932  25.531  18.828  1.00 45.12 ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.191  25.390  18.327  1.00 47.12 ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.655  24.028  19.384  1.00 44.98 ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.162  24.951  19.446  1.00 42.09 ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.991  23.789  19.230  1.00 41.27 ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.446  23.974  19.733  1.00 41.09 ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.237  23.021  19.728  1.00 40.90 ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.960  23.379  17.749  1.00 40.98 ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.575  23.161  17.216  1.00 40.83 ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.923  23.928  16.293  1.00 41.04 ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.665  22.110  17.577  1.00 40.25 ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.663  23.424  16.057  1.00 41.39 ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.480  22.309  16.832  1.00 41.31 ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.739  21.019  18.450  1.00 39.48 ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.377  21.450  16.930  1.00 40.93 ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.640  20.170  18.553  1.00 40.71 ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.475  20.395  17.796  1.00 40.67 ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.776  25.183  20.186  1.00 40.42 ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.132  25.538  20.592  1.00 40.20 ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.455  25.137  22.036  1.00 39.69 ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.559  25.078  22.877  1.00 40.05 ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.337  27.052  20.433  1.00 40.48 ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.673  27.474  18.992  1.00 42.14 ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.146  26.679  18.165  1.00 43.21 ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.450  28.750  18.703  1.00 44.50 ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.747  24.903  22.347  1.00 39.02 ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.165  24.570  23.722  1.00 37.96 ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.639  25.560  24.755  1.00 37.84 ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.704  26.764  24.547  1.00 37.32 ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.687  24.651  23.653  1.00 37.57 ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 35.017  24.381  22.237  1.00 37.44 ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.894  24.930  21.411  1.00 38.67 ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.108  25.045  25.860  1.00 37.88 ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.498  25.887  26.886  1.00 37.37 ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.221  25.701  28.209  1.00 37.68 ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.698  26.047  29.259  1.00 37.41 ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.999  25.580  27.033  1.00 36.63 ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.730  24.149  27.525  1.00 36.76 ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.570  23.262  27.365  1.00 34.61 ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.555  23.929  28.138  1.00 33.36 ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.408  25.105  28.144  1.00 37.85 ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.320  25.027  29.291  1.00 38.66 ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.722  25.183  28.720  1.00 38.53 ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.903  25.208  27.496  1.00 38.94 ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.177  23.710  30.087  1.00 38.97 ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.913  23.568  30.939  1.00 40.16 ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.903  24.535  32.118  1.00 45.81 ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.713  24.384  32.949  1.00 50.07 ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.506  24.910  32.680  1.00 52.62 ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.297  25.652  31.591  1.00 51.88 ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.488  24.686  33.508  1.00 53.22 ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.704  25.319  29.594  1.00 38.23 ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.078  25.510  29.163  1.00 38.43 ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.565  24.381  28.243  1.00 38.39 ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.276  23.197  28.468  1.00 38.07 ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.969  25.609  30.393  1.00 38.23 ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.417  25.902  30.085  1.00 40.26 ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.297  25.751  31.322  1.00 44.16 ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.760  25.955  32.443  1.00 42.15 ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.509  25.412  31.172  1.00 44.48 ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.295  24.764  27.204  1.00 38.47 ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.980  23.815  26.339  1.00 38.41 ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.254  23.330  27.002  1.00 38.61 ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.072  24.140  27.465  1.00 39.04 ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.317  24.461  25.003  1.00 38.25 ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.142  24.895  24.117  1.00 38.79 ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.695  25.356  22.781  1.00 38.97 ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.185  23.725  23.904  1.00 37.86 ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.413  22.007  27.057  1.00 38.15 ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.583  21.376  27.658  1.00 37.74 ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.738  19.939  27.155  1.00 37.74 ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.744  19.274  26.825  1.00 38.18 ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.470  21.422  29.182  1.00 37.66 ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.432  20.608  29.813  1.00 38.36 ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.976  19.460  27.071  1.00 37.13 ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.218  18.073  26.667  1.00 37.02 ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.831  17.157  27.811  1.00 36.03 ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.631  15.965  27.610  1.00 35.90 ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.682  17.838  26.285  1.00 37.38 ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 46.020  18.122  24.851  1.00 37.79 ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.499  17.871  24.551  1.00 39.42 ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.823  16.771  24.040  1.00 42.46 ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.332  18.775  24.818  1.00 39.87 ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.730  17.727  29.008  1.00 35.12 ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.236  17.013  30.176  1.00 35.36 ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.707  17.128  30.182  1.00 35.46 ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.148  18.075  30.737  1.00 34.79 ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.839  17.615  31.449  1.00 35.07 ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.365  16.936  32.714  1.00 36.40 ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.606  15.933  32.660  1.00 36.94 ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.757  17.426  33.797  1.00 38.88 ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.049  16.156  29.558  1.00 35.58 ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.630  16.267  29.271  1.00 36.47 ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.821  14.963  29.392  1.00 36.10 ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.601  14.962  29.192  1.00 36.12 ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.455  16.867  27.879  1.00 36.61 ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.129  15.871  26.529  1.00 39.48 ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.491  13.866  29.731  1.00 35.29 ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.820  12.576  29.821  1.00 34.72 ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.925  12.479  31.084  1.00 34.19 ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.308  11.932  32.111  1.00 34.81 ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.836  11.424  29.661  1.00 33.88 ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.542  11.427  28.288  1.00 34.40 ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.481  10.248  28.050  1.00 33.46 ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.559  11.523  27.132  1.00 33.42 ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.738  13.061  31.001  1.00 33.77 ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.805  13.095  32.131  1.00 32.82 ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.441  12.658  31.637  1.00 32.33 ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.154  12.729  30.440  1.00 32.60 ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.751  14.493  32.781  1.00 33.59 ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.082  14.967  33.333  1.00 33.74 ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.458  14.724  34.669  1.00 34.27 ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.980  15.633  32.515  1.00 34.46 ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.714  15.147  35.150  1.00 34.86 ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.224  16.053  32.986  1.00 35.00 ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.590  15.809  34.289  1.00 34.79 ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.846  16.244  34.689  1.00 35.21 ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.606  12.154  32.531  1.00 31.98 ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.270  11.754  32.119  1.00 31.43 ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.195  12.287  33.073  1.00 31.60 ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.513  12.757  34.186  1.00 31.16 ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.188  10.229  31.935  1.00 31.11 ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.426  9.259   33.091  1.00 30.63 ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.297  9.287   34.107  1.00 30.08 ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.552  7.839   32.524  1.00 30.89 ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.936  12.191  32.640  1.00 30.81 ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.810  12.748  33.388  1.00 30.65 ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.680  11.742  33.554  1.00 30.88 ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.347  10.987  32.619  1.00 30.67 ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.249  13.985  32.677  1.00 30.20 ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.327  14.932  32.208  1.00 30.60 ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 29.953  15.613  33.015  1.00 31.95 ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.548  14.990  30.893  1.00 31.17 ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.077  11.754  34.739  1.00 31.17 ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.948  10.891  35.047  1.00 31.53 ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.777  11.695  35.605  1.00 32.04 ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.946  12.466  36.551  1.00 32.19 ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.362  9.838   36.079  1.00 31.78 ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.168  9.021   36.507  1.00 31.19 ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.469  8.951   35.525  1.00 30.74 ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.610  11.546  34.986  1.00 32.92 ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.341  12.011  35.560  1.00 33.74 ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.494  10.818  35.930  1.00 34.52 ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.401  9.846   35.163  1.00 34.41 ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.527  12.812  34.559  1.00 33.70 ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.073  14.156  34.206  1.00 34.05 ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.762  15.357  34.803  1.00 33.18 ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 22.981  14.455  33.150  1.00 32.23 ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.433  16.381  34.178  1.00 33.87 ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.195  15.853  33.165  1.00 33.52 ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.635  13.684  32.194  1.00 33.40 ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.036  16.488  32.256  1.00 32.70 ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.471  14.315  31.282  1.00 32.91 ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.658  15.707  31.319  1.00 33.74 ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.862  10.911  37.093  1.00 35.92 ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.954  9.894   37.596  1.00 37.58 ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.752  10.599  38.219  1.00 38.88 ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.853  11.773  38.597  1.00 38.70 ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.629  9.027   38.682  1.00 37.67 ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.845  9.828   39.850  1.00 38.28 ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 21.974  8.507   38.213  1.00 38.32 ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.603  9.899   38.316  1.00 40.37 ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.453  10.384  39.087  1.00 41.85 ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 16.833  10.774  40.513  1.00 43.44 ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 17.871  10.343  41.002  1.00 44.26 ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.510  9.175   39.094  1.00 41.85 ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.801  8.492   37.795  1.00 40.75 ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.301  8.627   37.634  1.00 40.43 ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.024  11.611  41.160  1.00 44.94 ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.274  11.997  42.551  1.00 46.16 ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.005  11.757  43.366  1.00 47.71 ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 13.946  12.289  43.015  1.00 47.83 ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.714  13.457  42.650  1.00 45.24 ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.031  13.977  44.052  1.00 43.99 ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.339  14.343  44.401  1.00 44.37 ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.024  14.153  45.013  1.00 42.81 ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.643  14.849  45.689  1.00 43.59 ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.317  14.662  46.305  1.00 42.62 ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.623  15.005  46.627  1.00 43.42 ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 17.916  15.499  47.875  1.00 42.48 ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.095  10.933  44.430  1.00 49.21 ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.281  10.159  44.853  1.00 50.21 ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.618  9.112   43.809  1.00 51.00 ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.771  8.817   42.963  1.00 51.07 ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 15.806  9.459   46.137  1.00 50.08 ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.316  9.379   45.990  1.00 50.19 ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 13.943  10.682  45.317  1.00 49.56 ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 17.832  8.559   43.869  1.00 52.21 ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.281  7.526   42.924  1.00 53.33 ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.310  6.367   42.915  1.00 54.00 ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.798  5.998   43.956  1.00 54.73 ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.683  7.026   43.275  1.00 53.28 ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.752  8.109   43.204  1.00 54.31 ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.141  7.516   43.272  1.00 56.22 ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.449  6.851   44.544  1.00 56.50 ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 22.971  7.462   45.602  1.00 57.64 ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.226  8.763   45.559  1.00 58.43 ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.242  6.777   46.710  1.00 59.27 ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.051  5.786   41.736  1.00 54.98 ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.022  4.743   41.581  1.00 55.62 ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.156  3.517   42.497  1.00 56.30 ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.264  3.137   42.893  1.00 56.42 ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.148  4.338   40.105  1.00 55.48 ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.478  4.863   39.667  1.00 55.28 ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.711  6.094   40.457  1.00 54.80 ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.004  2.923   42.809  1.00 56.95 ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 14.884  1.764   43.699  1.00 57.41 ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.444  0.442   43.119  1.00 57.20 ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 16.156  -0.309  43.802  1.00 56.93 ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 13.401  1.580   44.086  1.00 57.85 ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.081  0.156   41.871  1.00 56.75 ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.491  -1.071  41.191  1.00 56.20 ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.364  -0.711  39.989  1.00 55.43 ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.223  0.382   39.439  1.00 55.60 ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.249  -1.832  40.729  1.00 56.39 ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.360  -0.946  40.077  1.00 57.14 ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.267  -1.622  39.575  1.00 54.46 ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.165  -1.370  38.428  1.00 53.42 ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.452  -0.807  37.179  1.00 51.87 ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.492  -1.409  36.668  1.00 52.18 ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 18.766  -2.757  38.141  1.00 53.62 ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.767  -3.428  39.483  1.00 54.29 ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.504  -2.950  40.171  1.00 54.53 ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 17.947  0.331   36.701  1.00 49.33 ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.303  1.120   35.656  1.00 46.63 ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.152  1.128   34.394  1.00 44.90 ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.359  1.314   34.481  1.00 44.66 ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.196  2.564   36.128  1.00 46.55 ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.874  2.565   37.522  1.00 46.55 ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.152  3.335   35.336  1.00 46.46 ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.525  0.932   33.225  1.00 43.33 ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.212  1.013   31.932  1.00 42.53 ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.041  2.288   31.755  1.00 41.38 ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.595  3.391   32.123  1.00 41.82 ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.063  0.973   30.919  1.00 42.27 ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.010  0.167   31.612  1.00 43.11 ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.098  0.587   33.058  1.00 43.49 ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.235  2.115   31.194  1.00 39.43 ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.238  3.169   31.088  1.00 37.54 ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.315  3.659   29.636  1.00 36.52 ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.368  2.851   28.715  1.00 36.14 ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.608  2.616   31.563  1.00 37.86 ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.763  3.587   31.293  1.00 36.96 ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.536  2.217   33.051  1.00 37.10 ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.289  4.975   29.430  1.00 35.20 ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.512  5.534   28.095  1.00 34.19 ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.870  6.190   28.068  1.00 33.31 ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.158  7.033   28.917  1.00 33.92 ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.421  6.542   27.713  1.00 34.08 ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.114  5.988   27.125  1.00 35.04 ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.015  7.022   27.128  1.00 36.34 ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.365  5.557   25.701  1.00 37.84 ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.715  5.793   27.123  1.00 32.42 ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.038  6.429   26.961  1.00 31.51 ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.125  7.265   25.693  1.00 31.03 ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.032  6.727   24.569  1.00 30.66 ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.210  5.412   26.962  1.00 31.67 ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.117  4.511   28.203  1.00 31.77 ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.563  6.166   26.862  1.00 30.24 ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.314  3.649   28.448  1.00 32.09 ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.319  8.572   25.879  1.00 29.91 ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.427  9.518   24.758  1.00 29.48 ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.861  9.765   24.270  1.00 28.76 ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.767  10.056  25.065  1.00 28.18 ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.801  10.864  25.142  1.00 29.93 ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.953  11.937  24.078  1.00 30.61 ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.796  13.002  24.104  1.00 30.12 ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.211  12.039  22.852  1.00 29.92 ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.632  13.765  22.971  1.00 30.36 ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.659  13.199  22.190  1.00 29.84 ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.195  11.269  22.265  1.00 28.10 ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.140  13.608  20.953  1.00 29.82 ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.669  11.675  21.048  1.00 28.92 ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.150  12.832  20.398  1.00 30.27 ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.037  9.691   22.952  1.00 28.53 ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.302  9.996   22.296  1.00 27.31 ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.101  11.142  21.293  1.00 28.47 ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.535  10.927  20.220  1.00 28.24 ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.871  8.779   21.555  1.00 27.52 ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.822  7.514   22.449  1.00 26.51 ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.308  9.092   21.031  1.00 25.39 ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.470  6.256   21.841  1.00 25.18 ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.563  12.346  21.652  1.00 28.62 ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.408  13.543  20.824  1.00 29.30 ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.109  13.461  19.475  1.00 29.82 ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.089  12.717  19.320  1.00 29.57 ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.905  14.796  21.560  1.00 30.03 ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.376  14.767  21.980  1.00 30.22 ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.402  14.931  21.045  1.00 30.09 ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.723  14.653  23.324  1.00 27.86 ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.753  14.914  21.438  1.00 31.64 ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.037  14.656  23.729  1.00 31.36 ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.057  14.786  22.788  1.00 32.26 ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.366  14.767  23.215  1.00 32.60 ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.583  14.223  18.506  1.00 29.27 ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.224  14.387  17.214  1.00 29.37 ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.026  15.675  17.138  1.00 29.81 ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.294  16.324  18.160  1.00 29.85 ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.385  16.057  15.916  1.00 30.30 ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.203  17.250  15.655  1.00 30.42 ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.385  16.872  14.764  1.00 30.85 ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.508  17.411  14.917  1.00 31.46 ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.130  15.921  13.867  1.00 30.16 ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.038  15.550  12.793  1.00 30.83 ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.314  14.825  13.219  1.00 31.02 ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.208  14.643  12.401  1.00 30.39 ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.377  14.403  14.485  1.00 31.39 ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.602  13.882  15.107  1.00 31.72 ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.672  14.970  15.367  1.00 32.64 ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.796  14.645  15.768  1.00 33.05 ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.199  12.725  14.295  1.00 31.25 ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.320  11.500  14.228  1.00 28.57 ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.109  10.719  15.353  1.00 27.25 ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.750  11.109  13.027  1.00 27.93 ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.296  9.584   15.298  1.00 27.56 ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.928  9.964   12.946  1.00 26.16 ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.710  9.206   14.080  1.00 28.03 ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.326  16.246  15.161  1.00 32.77 ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.260  17.364  15.450  1.00 33.20 ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.694  18.304  16.525  1.00 32.97 ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.325  19.266  16.934  1.00 33.60 ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.609  18.158  14.169  1.00 33.42 ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.475  19.053  13.702  1.00 34.19 ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.309  20.325  14.238  1.00 33.74 ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.552  18.614  12.744  1.00 34.16 ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.269  21.144  13.842  1.00 34.58 ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.503  19.427  12.340  1.00 35.30 ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.370  20.691  12.901  1.00 35.76 ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.344  21.526  12.526  1.00 36.97 ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.482  18.044  16.977  1.00 32.80 ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.890  18.911  17.971  1.00 32.19 ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.828  18.154  18.757  1.00 31.93 ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.556  16.982  18.494  1.00 29.86 ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.287  20.164  17.316  1.00 31.76 ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.423  19.802  16.259  1.00 32.77 ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.235  18.860  19.710  1.00 31.99 ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.208  18.296  20.544  1.00 33.16 ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.607  18.321  21.997  1.00 33.36 ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.759  18.594  22.347  1.00 33.75 ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.642  18.019  22.842  1.00 33.41 ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.809  18.090  24.279  1.00 33.99 ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.508  17.569  24.857  1.00 34.04 ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.442  17.793  24.285  1.00 34.95 ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 32.054  19.536  24.710  1.00 33.82 ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.578  16.868  25.975  1.00 34.04 ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.382  16.281  26.551  1.00 33.71 ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.701  17.288  27.452  1.00 33.70 ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.645  17.012  28.000  1.00 34.27 ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.729  15.011  27.320  1.00 33.73 ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.321  18.453  27.607  1.00 33.28 ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.825  19.509  28.497  1.00 32.66 ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.900  20.560  27.827  1.00 32.45 ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.418  21.471  28.498  1.00 32.86 ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 30.027  20.222  29.129  1.00 32.28 ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.875  20.716  28.104  1.00 30.33 ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.688  20.451  26.521  1.00 31.92 ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.813  21.367  25.777  1.00 32.51 ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.333  21.251  26.202  1.00 33.01 ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.844  20.166  26.563  1.00 33.09 ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.956  21.147  24.248  1.00 32.26 ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.348  21.026  23.584  1.00 31.80 ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.251  20.828  22.079  1.00 32.21 ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 29.226  22.233  23.866  1.00 29.62 ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.618  22.371  26.136  1.00 33.82 ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.208  22.451  26.609  1.00 33.75 ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.240  21.483  25.964  1.00 33.14 ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.379  20.961  26.654  1.00 34.26 ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.663  23.874  26.476  1.00 33.96 ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.253  24.809  27.503  1.00 36.33 ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.835  24.324  28.496  1.00 38.87 ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.140  26.036  27.333  1.00 41.51 ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.377  21.240  24.663  1.00 32.04 ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.528  20.277  23.956  1.00 31.26 ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.732  18.835  24.397  1.00 31.47 ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 21.020  17.927  23.932  1.00 30.89 ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.774  20.300  22.432  1.00 30.93 ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 21.183  21.521  21.844  1.00 32.06 ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.278  20.212  22.110  1.00 30.30 ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.726  18.605  25.249  1.00 31.30 ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.982  17.243  25.725  1.00 31.74 ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.585  17.061  27.197  1.00 31.76 ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 22.759  15.997  27.753  1.00 31.78 ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.453  16.831  25.494  1.00 31.09 ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.946  17.006  24.068  1.00 30.60 ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.104  16.752  22.975  1.00 30.06 ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.250  17.433  23.808  1.00 29.64 ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.559  16.909  21.659  1.00 30.11 ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.709  17.601  22.490  1.00 29.75 ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.863  17.326  21.424  1.00 29.41 ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.303  17.475  20.121  1.00 27.85 ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 22.057  18.111  27.810  1.00 32.24 ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.600  18.067  29.193  1.00 33.03 ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.710  16.846  29.456  1.00 33.52 ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.599  16.733  28.922  1.00 33.28 ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.847  19.351  29.520  1.00 33.09 ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.625  19.528  30.999  1.00 34.97 ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.587  18.519  31.729  1.00 37.63 ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.503  20.681  31.445  1.00 36.33 ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.205  15.933  30.283  1.00 34.04 ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.480  14.714  30.571  1.00 34.71 ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.422  14.831  31.654  1.00 35.33 ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.771  13.833  31.986  1.00 35.29 ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.240  16.035  32.200  1.00 35.60 ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.281  16.251  33.293  1.00 36.25 ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.817  15.905  32.963  1.00 36.54 ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.120  15.396  33.831  1.00 37.17 ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.396  17.663  33.903  1.00 35.82 ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.654  18.808  33.177  1.00 36.79 ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.793  20.146  33.943  1.00 36.87 ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.172  20.654  33.891  1.00 39.75 ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.723  21.510  34.756  1.00 39.55 ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.979  21.891  34.577  1.00 40.17 ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 19.042  21.994  35.794  1.00 39.44 ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.369  16.144  31.725  1.00 36.41 ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.967  15.932  31.353  1.00 36.53 ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.619  14.452  31.165  1.00 36.99 ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.565  14.000  31.634  1.00 37.10 ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.604  16.710  30.093  1.00 36.12 ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 15.007  18.145  30.141  1.00 36.74 ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.227  19.074  30.822  1.00 36.63 ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.160  18.578  29.498  1.00 35.99 ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.594  20.412  30.872  1.00 37.20 ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.533  19.920  29.552  1.00 37.01 ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.745  20.839  30.236  1.00 36.13 ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.488  13.715  30.471  1.00 37.01 ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.346  12.268  30.337  1.00 37.82 ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.383  11.548  31.695  1.00 37.89 ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.619  10.615  31.928  1.00 37.96 ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.402  11.694  29.389  1.00 37.39 ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.109  11.860  27.901  1.00 38.41 ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.385  11.874  27.064  1.00 36.95 ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.142  10.778  27.419  1.00 39.60 ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.263  11.997  32.577  1.00 38.45 ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.348  11.474  33.942  1.00 39.52 ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.066  11.742  34.752  1.00 40.38 ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.543  10.845  35.399  1.00 40.72 ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.559  12.056  34.662  1.00 38.53 ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.554  12.971  34.700  1.00 41.41 ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.430  13.359  35.547  1.00 41.83 ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.106  12.848  35.000  1.00 42.08 ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.254  12.407  35.771  1.00 42.64 ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.374  14.875  35.721  1.00 41.82 ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.599  15.318  36.951  1.00 43.42 ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.086  15.089  36.834  1.00 44.95 ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.501  15.226  35.751  1.00 44.91 ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.450  14.751  37.958  1.00 44.69 ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.932  12.906  33.682  1.00 41.64 ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.656  12.573  33.085  1.00 41.28 ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.532  11.088  32.782  1.00 41.30 ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.460   10.498  32.991  1.00 41.54 ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.396  13.401  31.815  1.00 41.73 ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.196   12.865  31.050  1.00 39.82 ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.197  14.865  32.183  1.00 41.41 ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.613  10.481  32.297  1.00 40.44 ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.573  9.062   31.936  1.00 39.70 ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.214  8.136   32.976  1.00 39.46 ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.201  6.921   32.816  1.00 39.28 ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.206  8.834   30.560  1.00 39.87 ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.386  9.341   29.382  1.00 39.50 ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.001  8.729   29.312  1.00 43.78 ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.813   7.549   29.722  1.00 44.66 ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.085   9.438   28.832  1.00 45.63 ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.766  8.709   34.043  1.00 39.26 ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.510  7.932   35.042  1.00 38.81 ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.831  7.337   34.554  1.00 38.44 ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.351  6.379   35.154  1.00 38.88 ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.380  7.874   33.469  1.00 37.48 ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.582  7.267   32.851  1.00 36.86 ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.884  7.533   33.641  1.00 35.91 ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.008  8.554   34.317  1.00 35.56 ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.730  7.752   31.405  1.00 36.45 ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.834  6.606   33.574  1.00 35.27 ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.223  6.920   33.956  1.00 34.68 ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.909  7.283   32.654  1.00 34.49 ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 20.898  6.503   31.679  1.00 34.19 ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.949  5.761   34.682  1.00 34.83 ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.447  6.040   34.834  1.00 35.15 ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.333  5.524   36.054  1.00 34.71 ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.435  8.504   32.604  1.00 33.84 ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.076  8.976   31.389  1.00 32.98 ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.548  9.279   31.644  1.00 32.51 ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.907  9.935   32.633  1.00 32.39 ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.340  10.190  30.807  1.00 32.89 ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.562  10.401  29.304  1.00 33.75 ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.304  10.932  28.672  1.00 35.57 ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.739  11.332  29.022  1.00 36.56 ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.389  8.806   30.735  1.00 31.52 ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.809  8.989   30.861  1.00 30.89 ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.336  9.550   29.574  1.00 30.80 ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.997  9.076   28.485  1.00 31.48 ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.535  7.653   31.152  1.00 31.11 ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.060  7.837   31.158  1.00 30.19 ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.070  7.081   32.478  1.00 30.86 ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.195  10.543  29.700  1.00 29.67 ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.892  11.064  28.546  1.00 29.62 ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.386  11.304  28.885  1.00 28.84 ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.748  11.671  30.009  1.00 28.95 ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.225  12.362  28.102  1.00 29.16 ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.330  13.301  29.148  1.00 30.09 ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.240  11.087  27.910  1.00 28.31 ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.668  11.172  28.133  1.00 28.84 ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.317  12.098  27.132  1.00 28.69 ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.838  12.221  25.989  1.00 28.21 ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.296  9.776   28.025  1.00 28.33 ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.730  9.396   26.610  1.00 29.82 ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.411  8.900   25.486  1.00 32.51 ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.097  7.233   26.035  1.00 30.46 ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.388  12.759  27.572  1.00 29.38 ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.303  13.459  26.659  1.00 30.06 ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.190  12.400  26.051  1.00 30.30 ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.484  11.412  26.702  1.00 30.91 ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.163  14.509  27.381  1.00 29.82 ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.366  15.776  27.800  1.00 31.85 ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.164  15.908  27.523  1.00 31.64 ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 35.056  16.717  28.467  1.00 30.29 ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.575  12.586  24.794  1.00 30.76 ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.578  11.763  24.146  1.00 30.60 ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.411  12.657  23.229  1.00 31.91 ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.895  13.639  22.680  1.00 32.38 ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 35.931  10.645  23.338  1.00 29.70 ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.063  11.095  22.160  1.00 28.58 ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.705  11.367  22.329  1.00 27.61 ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.595  11.196  20.871  1.00 26.54 ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.898  11.763  21.244  1.00 27.05 ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.813  11.597  19.788  1.00 25.67 ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.456  11.876  19.983  1.00 27.76 ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.669  12.267  18.917  1.00 27.47 ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.686  12.320  23.054  1.00 32.54 ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.593  13.165  22.272  1.00 33.53 ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.156  13.284  20.820  1.00 33.64 ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.685  12.313  20.209  1.00 33.54 ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.040  12.653  22.355  1.00 33.36 ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.693  12.896  23.708  1.00 33.54 ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.019  12.202  23.806  1.00 33.89 ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.861  10.792  24.143  1.00 35.18 ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.866  9.923   24.231  1.00 36.02 ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.125  10.311  23.985  1.00 33.41 ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.607  8.659   24.562  1.00 34.23 ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.319  14.488  20.282  1.00 33.86 ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.972  14.780  18.900  1.00 33.96 ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.210  15.306  18.152  1.00 35.04 ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.256  15.584  18.772  1.00 35.26 ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.806  15.785  18.839  1.00 34.43 ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.482  15.138  19.325  1.00 33.71 ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.112  17.024  19.666  1.00 33.59 ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.104  15.427  16.828  1.00 34.83 ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.169  15.998  16.029  1.00 34.19 ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.440  15.179  16.058  1.00 34.45 ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.396  13.948  16.181  1.00 35.23 ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.581  15.854  15.922  1.00 33.57 ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.854  15.169  16.007  1.00 32.69 ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.972  14.412  17.333  1.00 32.77 ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.424  13.273  17.337  1.00 33.27 ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.079  16.106  15.839  1.00 32.12 ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 46.065  17.115  16.854  1.00 29.68 ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.086  16.727  14.489  1.00 30.59 ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.548  15.020  18.436  1.00 32.31 ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.733  14.393  19.767  1.00 32.87 ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.992  13.076  19.872  1.00 32.98 ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.319  12.231  20.694  1.00 33.63 ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.308  15.343  20.890  1.00 32.23 ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.824  16.736  20.697  1.00 32.80 ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.074  17.104  21.201  1.00 33.27 ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 44.103  17.653  19.930  1.00 30.61 ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.583  18.393  20.978  1.00 34.90 ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.586  18.940  19.707  1.00 32.37 ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.832  19.317  20.223  1.00 33.60 ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 43.001  12.888  19.018  1.00 32.64 ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.202  11.703  19.139  1.00 32.29 ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.355  10.735  18.005  1.00 31.63 ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 41.960  9.595   18.159  1.00 31.59 ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.900  11.181  16.869  1.00 30.85 ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.867  10.364  15.668  1.00 31.25 ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.092  10.403  14.761  1.00 32.01 ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.155  9.692   13.766  1.00 31.88 ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.580  10.619  14.878  1.00 30.94 ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.341  10.313  15.667  1.00 31.30 ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.912  9.001   15.827  1.00 29.99 ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.634  11.330  16.296  1.00 30.91 ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.791  8.706   16.582  1.00 30.43 ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.497  11.033  17.067  1.00 32.31 ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.079  9.725   17.202  1.00 30.61 ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.071  11.229  15.099  1.00 33.35 ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.265  11.262  14.290  1.00 34.32 ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.921  9.897   14.427  1.00 34.75 ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.142  9.421   15.522  1.00 34.48 ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.188  12.381  14.746  1.00 34.36 ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.531  12.519  14.038  1.00 34.39 ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.946  14.009  14.026  1.00 33.37 ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.597  11.620  14.731  1.00 33.10 ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.215  9.272   13.303  1.00 36.14 ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.711  7.914   13.314  1.00 37.96 ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 48.907  7.761   12.411  1.00 38.97 ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 48.923  8.267   11.293  1.00 39.17 ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.598  6.940   12.884  1.00 38.22 ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 49.930  7.082   12.913  1.00 40.66 ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 50.943  6.490   12.037  1.00 41.63 ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.737  5.004   12.217  1.00 42.48 ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.305  4.410   13.128  1.00 42.81 ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.351  6.975   12.398  1.00 41.11 ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.391  8.441   11.931  1.00 42.18 ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 52.946  9.377   12.967  1.00 43.37 ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.095  8.624   10.600  1.00 42.45 ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.852  4.411   11.392  1.00 43.34 ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.382  3.033   11.628  1.00 44.52 ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.539  2.023   11.720  1.00 45.96 ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.442  2.052   10.888  1.00 45.94 ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.500  2.746   10.410  1.00 43.95 ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.077  4.104   9.929   1.00 43.79 ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.248  5.000   10.187  1.00 42.99 ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.507  1.159   12.738  1.00 47.40 ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.560  0.166   12.961  1.00 48.71 ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.546  0.605   14.030  1.00 49.76 ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.156  -0.235  14.697  1.00 50.20 ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.698  1.917   14.207  1.00 49.98 ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.573  2.449   15.242  1.00 50.63 ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.053  2.158   16.653  1.00 51.15 ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.927  1.670   16.834  1.00 51.35 ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.751  3.951   15.067  1.00 50.49 ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.613  4.646   15.547  1.00 51.90 ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.888  2.461   17.644  1.00 51.42 ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.545  2.273   19.045  1.00 52.29 ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.093  3.616   19.634  1.00 51.11 ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.247  3.669   20.532  1.00 51.26 ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.773  1.750   19.821  1.00 52.47 ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.471  1.198   21.225  1.00 54.30 ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.704  1.257   22.162  1.00 55.52 ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.598  2.352   23.142  1.00 62.72 ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.465  3.360   23.274  1.00 64.67 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.552  3.433   22.499  1.00 65.80 ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 56.246  4.296   24.196  1.00 64.44 ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.662  4.693   19.111  1.00 49.83 ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.478  6.007   19.687  1.00 48.85 ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.245  6.773   19.132  1.00 47.51 ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.945  7.890   19.571  1.00 46.61 ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.770  6.812   19.543  1.00 49.60 ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.040  6.135   20.138  1.00 52.39 ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.773  5.168   19.160  1.00 55.45 ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.261  4.852   18.050  1.00 55.16 ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 57.882  4.717   19.524  1.00 57.40 ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.525  6.150   18.195  1.00 46.02 ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.348  6.754   17.552  1.00 44.51 ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.584  5.712   16.756  1.00 43.27 ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.570  5.747   15.525  1.00 43.44 ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.741  7.934   16.660  1.00 44.26 ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 48.953  4.767   17.466  1.00 42.25 ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.287  3.632   16.832  1.00 41.65 ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.021  4.009   16.067  1.00 41.53 ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.559  3.239   15.208  1.00 41.86 ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 47.956  2.714   18.006  1.00 41.82 ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 47.987  3.612   19.240  1.00 41.41 ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.879  4.736   18.942  1.00 41.87 ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.480  5.191   16.364  1.00 41.12 ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.235  5.648   15.757  1.00 39.87 ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.050  5.205   16.590  1.00 38.55 ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.212  4.419   17.515  1.00 38.91 ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.871  5.739   16.274  1.00 37.45 ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.608  5.411   16.967  1.00 36.29 ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.570  5.582   18.497  1.00 34.87 ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.746  4.950   19.158  1.00 34.69 ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.129  3.997   16.596  1.00 35.51 ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 40.958  3.816   15.112  1.00 36.49 ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.511  4.733   14.402  1.00 36.24 ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.337  2.635   14.614  1.00 34.36 ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.415  6.439   19.058  1.00 33.41 ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.495  6.517   20.526  1.00 32.59 ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.289  7.212   21.139  1.00 32.49 ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 40.906  6.953   22.306  1.00 32.79 ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.849  7.071   21.049  1.00 32.67 ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.002  6.220   20.520  1.00 31.58 ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.049  8.545   20.685  1.00 33.03 ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.663  8.069   20.333  1.00 32.04 ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.397  8.683   20.695  1.00 31.28 ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.310  7.643   20.844  1.00 30.86 ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.440  7.763   21.694  1.00 30.50 ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.354  6.619   20.002  1.00 31.29 ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.418  5.508   20.126  1.00 31.76 ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.701  4.708   21.400  1.00 32.18 ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.772  4.248   22.070  1.00 31.97 ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.426  4.640   18.866  1.00 31.62 ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.721  5.250   17.630  1.00 31.75 ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 36.987  4.440   16.387  1.00 29.69 ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.201  5.422   17.812  1.00 29.76 ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 38.984  4.622   21.772  1.00 32.55 ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.392  3.916   22.971  1.00 32.85 ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 38.985  4.658   24.243  1.00 32.98 ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.687  4.019   25.259  1.00 32.26 ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 40.900  3.618   22.953  1.00 33.27 ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.409  2.634   21.881  1.00 34.38 ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 42.917  2.585   21.880  1.00 33.26 ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.848  1.232   22.069  1.00 33.94 ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 38.983  5.997   24.191  1.00 33.59 ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.434  6.818   25.285  1.00 33.95 ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 36.968  6.427   25.507  1.00 33.96 ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.541  6.148   26.652  1.00 33.52 ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.515  8.322   24.971  1.00 34.37 ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 39.944  8.822   24.752  1.00 37.14 ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.924  8.131   25.134  1.00 37.85 ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.085  9.941   24.195  1.00 39.37 ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.212  6.386   24.405  1.00 34.11 ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.787  6.038   24.441  1.00 35.27 ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.574  4.660   25.069  1.00 35.66 ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.689  4.495   25.927  1.00 36.13 ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.148  6.101   23.045  1.00 34.86 ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.120  7.489   22.380  1.00 34.67 ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.590  7.428   20.955  1.00 36.90 ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.011  6.403   20.529  1.00 37.45 ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.780  8.527   20.194  1.00 35.82 ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.387  3.682   24.656  1.00 35.81 ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.268  2.302   25.174  1.00 35.78 ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.618  2.212   26.654  1.00 35.51 ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 34.962  1.506   27.398  1.00 36.63 ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.145  1.334   24.374  1.00 36.43 ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.205  -0.092  24.941  1.00 35.74 ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.182  -0.925  24.156  1.00 33.67 ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.602  -1.299  22.874  1.00 33.64 ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.302  -1.671  21.806  1.00 32.50 ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.636  -1.702  21.840  1.00 32.15 ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.657  -2.001  20.700  1.00 30.28 ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.627  2.951   27.085  1.00 34.88 ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 36.987  2.990   28.495  1.00 34.49 ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.828  3.479   29.373  1.00 34.31 ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.555  2.909   30.435  1.00 34.75 ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.223  3.869   28.698  1.00 33.78 ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 38.695  4.029   30.132  1.00 34.42 ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.128  2.676   30.729  1.00 35.69 ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 39.830  5.012   30.159  1.00 34.47 ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.156  4.539   28.922  1.00 34.08 ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 33.960  5.055   29.579  1.00 33.10 ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.819  4.043   29.515  1.00 33.04 ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.035  3.960   30.453  1.00 32.71 ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.549  6.391   28.978  1.00 32.84 ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.735  3.258   28.442  1.00 33.34 ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.802  2.128   28.447  1.00 34.85 ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.167  1.096   29.532  1.00 36.14 ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.262  0.528   30.180  1.00 36.46 ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.614  1.472   27.067  1.00 34.45 ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.199  2.319   25.843  1.00 34.64 ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.661  1.472   24.719  1.00 32.12 ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.211  3.426   26.157  1.00 36.15 ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.468  0.886   29.757  1.00 36.56 ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 33.922  -0.086  30.757  1.00 37.65 ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.672  0.459   32.162  1.00 37.91 ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.280  -0.283  33.079  1.00 38.61 ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.402  -0.466  30.562  1.00 37.26 ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.670  -1.159  29.225  1.00 38.38 ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.171  -1.415  28.895  1.00 38.94 ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 37.480  -2.339  28.146  1.00 39.85 ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 38.079  -0.588  29.423  1.00 39.00 ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 33.895  1.758   32.321  1.00 37.29 ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.555  2.450   33.549  1.00 36.60 ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.076  2.279   33.885  1.00 36.62 ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.728  2.157   35.056  1.00 36.75 ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 33.884  3.944   33.430  1.00 36.10 ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.741  4.707   34.711  1.00 35.05 ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.736  5.012   35.595  1.00 34.56 ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.536  5.278   35.246  1.00 33.59 ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.227  5.748   36.642  1.00 34.97 ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 32.879  5.918   36.456  1.00 34.16 ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.201  5.312   34.815  1.00 33.68 ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 31.933  6.580   37.250  1.00 35.57 ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.261  5.968   35.591  1.00 34.77 ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.628  6.589   36.806  1.00 36.44 ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.203  2.282   32.878  1.00 36.53 ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.777  2.140   33.160  1.00 36.38 ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.465  0.714   33.668  1.00 37.23 ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 28.733  0.548   34.661  1.00 37.00 ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 28.891  2.560   31.975  1.00 36.12 ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.447  2.116   32.176  1.00 33.92 ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 28.957  4.080   31.781  1.00 36.54 ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.038  -0.295  33.008  1.00 37.45 ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 29.897  -1.691  33.444  1.00 38.28 ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.293  -1.833  34.898  1.00 38.27 ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.571  -2.441  35.681  1.00 37.54 ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.771  -2.638  32.606  1.00 38.61 ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.273  -2.841  31.218  1.00 39.93 ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.870  -3.387  31.185  1.00 41.51 ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.646  -4.551  31.503  1.00 42.60 ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 27.913  -2.551  30.797  1.00 40.98 ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.437  -1.259  35.264  1.00 38.44 ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 31.919  -1.463  36.608  1.00 39.34 ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.168  -0.653  37.661  1.00 38.80 ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.949  -1.130  38.765  1.00 39.30 ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.436  -1.259  36.743  1.00 38.72 ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 33.900  -1.862  38.075  1.00 40.92 ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.377  -1.718  38.398  1.00 41.91 ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.721  -1.974  39.584  1.00 43.97 ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.186  -1.365  37.497  1.00 45.78 ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.783  0.572   37.320  1.00 38.49 ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.379  1.536   38.331  1.00 37.86 ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 28.920  1.949   38.343  1.00 37.73 ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.457  2.458   39.359  1.00 38.09 ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.228  2.790   38.205  1.00 37.77 ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.688  2.527   38.464  1.00 38.06 ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.099  2.313   39.612  1.00 39.21 ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.493  2.551   37.399  1.00 36.28 ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.204  1.748   37.236  1.00 37.33 ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 26.883  2.365   37.080  1.00 37.25 ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 25.837  1.898   38.096  1.00 37.71 ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 24.859  2.615   38.376  1.00 38.22 ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.330  2.292   35.621  1.00 36.74 ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.432  3.502   35.330  1.00 36.06 ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.608  0.984   35.351  1.00 35.64 ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.148  4.847   35.436  1.00 35.58 ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.053  0.719   38.664  1.00 37.80 ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.112  0.174   39.630  1.00 37.75 ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.112  0.965   40.942  1.00 37.63 ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.101  0.979   41.661  1.00 38.11 ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.355  -1.317  39.858  1.00 37.40 ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.220  1.643   41.238  1.00 36.85 ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.300  2.540   42.400  1.00 36.09 ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.329  3.717   42.284  1.00 36.31 ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.050  4.399   43.269  1.00 36.70 ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 27.713  3.066   42.553  1.00 35.92 ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 24.837  3.978   41.080  1.00 36.21 ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 23.939  5.112   40.845  1.00 36.40 ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.508  4.602   40.625  1.00 37.07 ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.594  5.399   40.365  1.00 37.84 ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.393  5.925   39.614  1.00 35.54 ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.773  6.537   39.740  1.00 34.15 ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 26.907  5.830   39.344  1.00 35.44 ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.936  7.818   40.232  1.00 32.34 ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.211  6.400   39.427  1.00 34.50 ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.214  8.390   40.329  1.00 36.07 ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.361  7.674   39.925  1.00 33.89 ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.316  3.285   40.720  1.00 36.55 ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.026  2.677   40.430  1.00 36.90 ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 20.861  2.304   38.968  1.00 37.81 ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 19.788  1.895   38.549  1.00 37.53 ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 21.929  2.446   38.181  1.00 38.87 ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 21.898  2.061   36.769  1.00 39.47 ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.106  0.572   36.605  1.00 39.73 ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 22.727  -0.048  37.459  1.00 39.88 ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.580  0.012   35.511  1.00 40.24 ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.622  -1.421  35.219  1.00 40.63 ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.621  -1.741  34.123  1.00 41.20 ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.307  -1.603  32.947  1.00 41.07 ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.238  -1.904  34.764  1.00 40.99 ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.160  -3.442  34.548  1.00 41.35 ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.190  -4.159  34.675  1.00 40.84 ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.037  -3.924  34.248  1.00 40.63 ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 23.803  -2.243  34.496  1.00 41.83 ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 24.838  -2.571  33.508  1.00 42.58 ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.419  -3.639  32.494  1.00 43.37 ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.124  -3.865  31.508  1.00 43.68 ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.010  -3.071  34.365  1.00 42.53 ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.396  -3.478  35.657  1.00 42.32 ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.219  -2.565  35.869  1.00 41.68 ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.281  -4.282  32.717  1.00 44.13 ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 22.794  -5.276  31.771  1.00 45.49 ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 21.801  -4.698  30.775  1.00 43.55 ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.357  -5.394  29.863  1.00 43.51 ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.190  -6.456  32.514  1.00 45.72 ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.098  -6.963  33.621  1.00 48.17 ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.108  -8.760  33.708  1.00 51.92 ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 23.804  -9.166  32.072  1.00 51.46 ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.466  -3.423  30.945  1.00 41.91 ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 20.674  -2.701  29.961  1.00 40.45 ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.302  -1.322  29.660  1.00 39.65 ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 20.852  -0.276  30.173  1.00 39.24 ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.218  -2.574  30.431  1.00 40.58 ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.369  -2.257  29.347  1.00 39.88 ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.359  -1.365  28.841  1.00 38.27 ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.099  -0.208  28.336  1.00 36.52 ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.819  -0.007  26.838  1.00 35.92 ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.095  -0.889  26.008  1.00 35.71 ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.629  -0.398  28.518  1.00 36.96 ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.408  0.746   27.830  1.00 36.68 ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.017  -0.524  29.999  1.00 35.85 ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.257  1.154   26.502  1.00 35.12 ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 21.979  1.553   25.116  1.00 34.10 ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 22.881  2.747   24.725  1.00 33.77 ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 22.885  3.793   25.414  1.00 33.53 ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.502  1.959   24.961  1.00 33.97 ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.677  0.833   25.256  1.00 35.44 ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.192  2.424   23.544  1.00 33.88 ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.652  2.583   23.652  1.00 32.50 ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.453  3.678   23.112  1.00 32.46 ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.579  4.530   22.201  1.00 32.27 ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.790  3.995   21.426  1.00 34.21 ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.663  3.161   22.331  1.00 32.11 ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.544  2.033   22.914  1.00 32.42 ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.739  1.733   22.016  1.00 31.36 ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.032  2.340   24.312  1.00 32.48 ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.674  5.846   22.303  1.00 31.06 ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.086  6.697   21.275  1.00 30.33 ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 23.967  7.899   20.997  1.00 30.07 ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.682  8.360   21.880  1.00 29.83 ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.596  7.038   21.550  1.00 29.72 ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.349  8.055   22.641  1.00 28.86 ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 21.875  7.896   23.925  1.00 28.46 ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.505  9.143   22.401  1.00 27.99 ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.610  8.824   24.941  1.00 27.11 ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.228  10.078  23.414  1.00 27.80 ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 20.786  9.919   24.692  1.00 27.93 ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 23.956  8.367   19.755  1.00 30.16 ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.769  9.514   19.375  1.00 30.37 ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.363  10.054  18.029  1.00 30.53 ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.649  9.408   17.279  1.00 31.02 ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.807  11.259  17.716  1.00 30.90 ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.443  11.859  16.452  1.00 30.60 ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.688  12.225  15.656  1.00 31.02 ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.706  12.556  16.232  1.00 30.71 ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.515  13.041  16.706  1.00 30.58 ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.040  13.764  15.461  1.00 30.08 ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 23.963  14.873  15.038  1.00 30.28 ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 24.837  15.300  15.845  1.00 32.42 ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.806  15.335  13.898  1.00 28.69 ? 202  GLU A OE2 1 
HETATM 1569 N N   A SVV A 1 203 ? 25.587  12.148  14.330  0.50 32.16 ? 203  SVV A N   1 
HETATM 1570 C CA  A SVV A 1 203 ? 26.686  12.449  13.390  0.50 32.74 ? 203  SVV A CA  1 
HETATM 1571 C C   A SVV A 1 203 ? 27.940  11.559  13.641  0.50 32.92 ? 203  SVV A C   1 
HETATM 1572 O O   A SVV A 1 203 ? 27.858  10.329  13.438  0.50 32.98 ? 203  SVV A O   1 
HETATM 1573 C CB  A SVV A 1 203 ? 26.990  13.951  13.362  0.50 32.75 ? 203  SVV A CB  1 
HETATM 1574 O OG  A SVV A 1 203 ? 27.744  14.305  12.202  0.50 34.23 ? 203  SVV A OG  1 
HETATM 1575 O O3  A SVV A 1 203 ? 29.568  15.166  13.594  0.50 26.81 ? 203  SVV A O3  1 
HETATM 1576 P P1  A SVV A 1 203 ? 28.946  15.372  12.237  0.50 30.12 ? 203  SVV A P1  1 
HETATM 1577 O O2  A SVV A 1 203 ? 28.830  16.773  11.736  0.50 30.77 ? 203  SVV A O2  1 
HETATM 1578 N N4  A SVV A 1 203 ? 29.889  14.547  11.026  0.50 28.96 ? 203  SVV A N4  1 
HETATM 1579 N N   B SVW A 1 203 ? 25.587  12.148  14.330  0.50 32.16 ? 203  SVW A N   1 
HETATM 1580 C CA  B SVW A 1 203 ? 26.686  12.449  13.390  0.50 32.74 ? 203  SVW A CA  1 
HETATM 1581 C C   B SVW A 1 203 ? 27.940  11.559  13.641  0.50 32.92 ? 203  SVW A C   1 
HETATM 1582 O O   B SVW A 1 203 ? 27.858  10.329  13.438  0.50 32.98 ? 203  SVW A O   1 
HETATM 1583 C CB  B SVW A 1 203 ? 26.990  13.951  13.362  0.50 32.75 ? 203  SVW A CB  1 
HETATM 1584 O OG  B SVW A 1 203 ? 27.744  14.305  12.202  0.50 34.23 ? 203  SVW A OG  1 
HETATM 1585 O O3  B SVW A 1 203 ? 29.573  14.827  11.035  0.50 52.18 ? 203  SVW A O3  1 
HETATM 1586 P P1  B SVW A 1 203 ? 28.867  15.393  12.248  0.50 50.58 ? 203  SVW A P1  1 
HETATM 1587 O O4  B SVW A 1 203 ? 29.498  15.203  13.616  0.50 49.61 ? 203  SVW A O4  1 
HETATM 1588 N N2  B SVW A 1 203 ? 28.865  17.115  11.964  0.50 53.08 ? 203  SVW A N2  1 
ATOM   1589 N N   . ALA A 1 204 ? 29.069  12.146  14.070  1.00 32.05 ? 204  ALA A N   1 
ATOM   1590 C CA  . ALA A 1 204 ? 30.273  11.345  14.368  1.00 32.23 ? 204  ALA A CA  1 
ATOM   1591 C C   . ALA A 1 204 ? 30.030  10.448  15.581  1.00 32.37 ? 204  ALA A C   1 
ATOM   1592 O O   . ALA A 1 204 ? 30.691  9.407   15.732  1.00 31.46 ? 204  ALA A O   1 
ATOM   1593 C CB  . ALA A 1 204 ? 31.515  12.222  14.600  1.00 31.02 ? 204  ALA A CB  1 
ATOM   1594 N N   . GLY A 1 205 ? 29.116  10.903  16.454  1.00 32.36 ? 205  GLY A N   1 
ATOM   1595 C CA  . GLY A 1 205 ? 28.658  10.145  17.610  1.00 32.56 ? 205  GLY A CA  1 
ATOM   1596 C C   . GLY A 1 205 ? 27.962  8.869   17.144  1.00 33.11 ? 205  GLY A C   1 
ATOM   1597 O O   . GLY A 1 205 ? 28.220  7.793   17.664  1.00 33.22 ? 205  GLY A O   1 
ATOM   1598 N N   . ALA A 1 206 ? 27.123  8.991   16.126  1.00 33.15 ? 206  ALA A N   1 
ATOM   1599 C CA  . ALA A 1 206 ? 26.503  7.841   15.488  1.00 34.06 ? 206  ALA A CA  1 
ATOM   1600 C C   . ALA A 1 206 ? 27.524  6.951   14.776  1.00 34.57 ? 206  ALA A C   1 
ATOM   1601 O O   . ALA A 1 206 ? 27.454  5.713   14.886  1.00 35.34 ? 206  ALA A O   1 
ATOM   1602 C CB  . ALA A 1 206 ? 25.408  8.282   14.528  1.00 33.98 ? 206  ALA A CB  1 
ATOM   1603 N N   . ALA A 1 207 ? 28.462  7.556   14.049  1.00 34.02 ? 207  ALA A N   1 
ATOM   1604 C CA  . ALA A 1 207 ? 29.493  6.760   13.423  1.00 34.19 ? 207  ALA A CA  1 
ATOM   1605 C C   . ALA A 1 207 ? 30.216  5.950   14.504  1.00 34.68 ? 207  ALA A C   1 
ATOM   1606 O O   . ALA A 1 207 ? 30.395  4.726   14.356  1.00 34.56 ? 207  ALA A O   1 
ATOM   1607 C CB  . ALA A 1 207 ? 30.470  7.626   12.637  1.00 34.00 ? 207  ALA A CB  1 
ATOM   1608 N N   . SER A 1 208 ? 30.606  6.639   15.587  1.00 34.70 ? 208  SER A N   1 
ATOM   1609 C CA  . SER A 1 208 ? 31.225  6.016   16.751  1.00 35.23 ? 208  SER A CA  1 
ATOM   1610 C C   . SER A 1 208 ? 30.385  4.851   17.274  1.00 35.22 ? 208  SER A C   1 
ATOM   1611 O O   . SER A 1 208 ? 30.930  3.804   17.593  1.00 35.21 ? 208  SER A O   1 
ATOM   1612 C CB  . SER A 1 208 ? 31.452  7.027   17.889  1.00 35.39 ? 208  SER A CB  1 
ATOM   1613 O OG  . SER A 1 208 ? 32.276  8.120   17.494  1.00 38.29 ? 208  SER A OG  1 
ATOM   1614 N N   . VAL A 1 209 ? 29.065  5.037   17.380  1.00 35.25 ? 209  VAL A N   1 
ATOM   1615 C CA  . VAL A 1 209 ? 28.203  3.987   17.906  1.00 34.56 ? 209  VAL A CA  1 
ATOM   1616 C C   . VAL A 1 209 ? 28.314  2.762   16.990  1.00 35.55 ? 209  VAL A C   1 
ATOM   1617 O O   . VAL A 1 209 ? 28.552  1.655   17.461  1.00 35.92 ? 209  VAL A O   1 
ATOM   1618 C CB  . VAL A 1 209 ? 26.734  4.448   18.061  1.00 34.00 ? 209  VAL A CB  1 
ATOM   1619 C CG1 . VAL A 1 209 ? 25.808  3.246   18.144  1.00 32.76 ? 209  VAL A CG1 1 
ATOM   1620 C CG2 . VAL A 1 209 ? 26.569  5.305   19.298  1.00 31.81 ? 209  VAL A CG2 1 
ATOM   1621 N N   . GLY A 1 210 ? 28.185  2.982   15.681  1.00 35.83 ? 210  GLY A N   1 
ATOM   1622 C CA  . GLY A 1 210 ? 28.288  1.922   14.701  1.00 36.30 ? 210  GLY A CA  1 
ATOM   1623 C C   . GLY A 1 210 ? 29.636  1.230   14.734  1.00 37.29 ? 210  GLY A C   1 
ATOM   1624 O O   . GLY A 1 210 ? 29.737  0.034   14.426  1.00 38.04 ? 210  GLY A O   1 
ATOM   1625 N N   . MET A 1 211 ? 30.679  1.945   15.118  1.00 37.00 ? 211  MET A N   1 
ATOM   1626 C CA  . MET A 1 211 ? 31.982  1.309   15.164  1.00 38.37 ? 211  MET A CA  1 
ATOM   1627 C C   . MET A 1 211 ? 32.149  0.434   16.386  1.00 37.72 ? 211  MET A C   1 
ATOM   1628 O O   . MET A 1 211 ? 32.917  -0.538  16.354  1.00 37.87 ? 211  MET A O   1 
ATOM   1629 C CB  . MET A 1 211 ? 33.097  2.340   15.080  1.00 38.40 ? 211  MET A CB  1 
ATOM   1630 C CG  . MET A 1 211 ? 33.141  2.960   13.709  1.00 39.08 ? 211  MET A CG  1 
ATOM   1631 S SD  . MET A 1 211 ? 34.300  4.284   13.700  1.00 41.75 ? 211  MET A SD  1 
ATOM   1632 C CE  . MET A 1 211 ? 33.963  5.014   12.095  1.00 39.86 ? 211  MET A CE  1 
ATOM   1633 N N   . HIS A 1 212 ? 31.429  0.773   17.455  1.00 36.64 ? 212  HIS A N   1 
ATOM   1634 C CA  . HIS A 1 212 ? 31.423  -0.059  18.627  1.00 36.45 ? 212  HIS A CA  1 
ATOM   1635 C C   . HIS A 1 212 ? 30.665  -1.351  18.356  1.00 37.24 ? 212  HIS A C   1 
ATOM   1636 O O   . HIS A 1 212 ? 30.942  -2.361  18.971  1.00 38.02 ? 212  HIS A O   1 
ATOM   1637 C CB  . HIS A 1 212 ? 30.862  0.674   19.846  1.00 35.63 ? 212  HIS A CB  1 
ATOM   1638 C CG  . HIS A 1 212 ? 31.778  1.719   20.397  1.00 33.35 ? 212  HIS A CG  1 
ATOM   1639 N ND1 . HIS A 1 212 ? 33.044  1.433   20.855  1.00 31.69 ? 212  HIS A ND1 1 
ATOM   1640 C CD2 . HIS A 1 212 ? 31.615  3.054   20.552  1.00 32.36 ? 212  HIS A CD2 1 
ATOM   1641 C CE1 . HIS A 1 212 ? 33.620  2.544   21.284  1.00 30.63 ? 212  HIS A CE1 1 
ATOM   1642 N NE2 . HIS A 1 212 ? 32.775  3.544   21.104  1.00 32.21 ? 212  HIS A NE2 1 
ATOM   1643 N N   . ILE A 1 213 ? 29.706  -1.307  17.438  1.00 37.99 ? 213  ILE A N   1 
ATOM   1644 C CA  . ILE A 1 213 ? 28.971  -2.489  17.021  1.00 38.16 ? 213  ILE A CA  1 
ATOM   1645 C C   . ILE A 1 213 ? 29.906  -3.379  16.202  1.00 39.22 ? 213  ILE A C   1 
ATOM   1646 O O   . ILE A 1 213 ? 29.837  -4.590  16.270  1.00 40.11 ? 213  ILE A O   1 
ATOM   1647 C CB  . ILE A 1 213 ? 27.728  -2.091  16.186  1.00 38.25 ? 213  ILE A CB  1 
ATOM   1648 C CG1 . ILE A 1 213 ? 26.704  -1.335  17.047  1.00 38.20 ? 213  ILE A CG1 1 
ATOM   1649 C CG2 . ILE A 1 213 ? 27.089  -3.292  15.514  1.00 36.58 ? 213  ILE A CG2 1 
ATOM   1650 C CD1 . ILE A 1 213 ? 25.512  -0.763  16.255  1.00 36.55 ? 213  ILE A CD1 1 
ATOM   1651 N N   . LEU A 1 214 ? 30.795  -2.766  15.437  1.00 40.08 ? 214  LEU A N   1 
ATOM   1652 C CA  . LEU A 1 214 ? 31.653  -3.493  14.520  1.00 40.51 ? 214  LEU A CA  1 
ATOM   1653 C C   . LEU A 1 214 ? 32.986  -3.888  15.138  1.00 40.86 ? 214  LEU A C   1 
ATOM   1654 O O   . LEU A 1 214 ? 33.788  -4.542  14.480  1.00 41.03 ? 214  LEU A O   1 
ATOM   1655 C CB  . LEU A 1 214 ? 31.885  -2.673  13.245  1.00 40.44 ? 214  LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 214 ? 30.627  -2.337  12.435  1.00 41.71 ? 214  LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 214 ? 30.901  -1.243  11.402  1.00 40.64 ? 214  LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 214 ? 30.077  -3.581  11.776  1.00 41.27 ? 214  LEU A CD2 1 
ATOM   1659 N N   . SER A 1 215 ? 33.217  -3.496  16.388  1.00 41.37 ? 215  SER A N   1 
ATOM   1660 C CA  . SER A 1 215 ? 34.467  -3.810  17.081  1.00 41.90 ? 215  SER A CA  1 
ATOM   1661 C C   . SER A 1 215 ? 34.243  -4.670  18.328  1.00 43.19 ? 215  SER A C   1 
ATOM   1662 O O   . SER A 1 215 ? 33.775  -4.199  19.366  1.00 43.01 ? 215  SER A O   1 
ATOM   1663 C CB  . SER A 1 215 ? 35.205  -2.529  17.441  1.00 41.97 ? 215  SER A CB  1 
ATOM   1664 O OG  . SER A 1 215 ? 36.405  -2.793  18.126  1.00 39.15 ? 215  SER A OG  1 
ATOM   1665 N N   . LEU A 1 216 ? 34.609  -5.940  18.210  1.00 44.80 ? 216  LEU A N   1 
ATOM   1666 C CA  . LEU A 1 216 ? 34.249  -6.979  19.177  1.00 46.22 ? 216  LEU A CA  1 
ATOM   1667 C C   . LEU A 1 216 ? 34.544  -6.644  20.647  1.00 45.70 ? 216  LEU A C   1 
ATOM   1668 O O   . LEU A 1 216 ? 33.696  -6.854  21.508  1.00 45.83 ? 216  LEU A O   1 
ATOM   1669 C CB  . LEU A 1 216 ? 34.901  -8.321  18.767  1.00 46.68 ? 216  LEU A CB  1 
ATOM   1670 C CG  . LEU A 1 216 ? 34.470  -9.597  19.508  1.00 48.50 ? 216  LEU A CG  1 
ATOM   1671 C CD1 . LEU A 1 216 ? 32.980  -9.971  19.251  1.00 49.33 ? 216  LEU A CD1 1 
ATOM   1672 C CD2 . LEU A 1 216 ? 35.413  -10.772 19.142  1.00 48.47 ? 216  LEU A CD2 1 
ATOM   1673 N N   . PRO A 1 217 ? 35.748  -6.129  20.954  1.00 45.64 ? 217  PRO A N   1 
ATOM   1674 C CA  . PRO A 1 217 ? 35.941  -5.777  22.372  1.00 45.46 ? 217  PRO A CA  1 
ATOM   1675 C C   . PRO A 1 217 ? 34.907  -4.793  22.974  1.00 45.22 ? 217  PRO A C   1 
ATOM   1676 O O   . PRO A 1 217 ? 34.810  -4.697  24.203  1.00 45.52 ? 217  PRO A O   1 
ATOM   1677 C CB  . PRO A 1 217 ? 37.355  -5.170  22.400  1.00 45.18 ? 217  PRO A CB  1 
ATOM   1678 C CG  . PRO A 1 217 ? 38.037  -5.760  21.210  1.00 45.78 ? 217  PRO A CG  1 
ATOM   1679 C CD  . PRO A 1 217 ? 36.961  -5.882  20.154  1.00 45.15 ? 217  PRO A CD  1 
ATOM   1680 N N   . SER A 1 218 ? 34.175  -4.063  22.132  1.00 44.47 ? 218  SER A N   1 
ATOM   1681 C CA  . SER A 1 218 ? 33.171  -3.104  22.605  1.00 44.27 ? 218  SER A CA  1 
ATOM   1682 C C   . SER A 1 218 ? 31.813  -3.778  22.754  1.00 44.48 ? 218  SER A C   1 
ATOM   1683 O O   . SER A 1 218 ? 30.896  -3.247  23.402  1.00 43.79 ? 218  SER A O   1 
ATOM   1684 C CB  . SER A 1 218 ? 33.032  -1.923  21.634  1.00 44.05 ? 218  SER A CB  1 
ATOM   1685 O OG  . SER A 1 218 ? 34.129  -1.030  21.727  1.00 43.22 ? 218  SER A OG  1 
ATOM   1686 N N   . ARG A 1 219 ? 31.698  -4.945  22.125  1.00 44.52 ? 219  ARG A N   1 
ATOM   1687 C CA  . ARG A 1 219 ? 30.428  -5.640  21.977  1.00 45.08 ? 219  ARG A CA  1 
ATOM   1688 C C   . ARG A 1 219 ? 29.790  -6.097  23.291  1.00 44.44 ? 219  ARG A C   1 
ATOM   1689 O O   . ARG A 1 219 ? 28.564  -6.065  23.442  1.00 44.75 ? 219  ARG A O   1 
ATOM   1690 C CB  . ARG A 1 219 ? 30.577  -6.824  21.015  1.00 45.42 ? 219  ARG A CB  1 
ATOM   1691 C CG  . ARG A 1 219 ? 30.434  -6.456  19.528  1.00 47.72 ? 219  ARG A CG  1 
ATOM   1692 C CD  . ARG A 1 219 ? 29.337  -5.415  19.285  1.00 50.24 ? 219  ARG A CD  1 
ATOM   1693 N NE  . ARG A 1 219 ? 27.979  -5.850  19.606  1.00 52.86 ? 219  ARG A NE  1 
ATOM   1694 C CZ  . ARG A 1 219 ? 27.181  -6.537  18.781  1.00 56.44 ? 219  ARG A CZ  1 
ATOM   1695 N NH1 . ARG A 1 219 ? 27.608  -6.908  17.570  1.00 56.11 ? 219  ARG A NH1 1 
ATOM   1696 N NH2 . ARG A 1 219 ? 25.947  -6.872  19.178  1.00 57.24 ? 219  ARG A NH2 1 
ATOM   1697 N N   . SER A 1 220 ? 30.634  -6.529  24.217  1.00 43.52 ? 220  SER A N   1 
ATOM   1698 C CA  . SER A 1 220 ? 30.208  -6.995  25.519  1.00 42.89 ? 220  SER A CA  1 
ATOM   1699 C C   . SER A 1 220 ? 29.892  -5.842  26.457  1.00 41.76 ? 220  SER A C   1 
ATOM   1700 O O   . SER A 1 220 ? 29.532  -6.079  27.609  1.00 41.85 ? 220  SER A O   1 
ATOM   1701 C CB  . SER A 1 220 ? 31.320  -7.857  26.140  1.00 43.55 ? 220  SER A CB  1 
ATOM   1702 O OG  . SER A 1 220 ? 32.577  -7.178  26.125  1.00 44.21 ? 220  SER A OG  1 
ATOM   1703 N N   . LEU A 1 221 ? 30.036  -4.602  25.977  1.00 40.34 ? 221  LEU A N   1 
ATOM   1704 C CA  . LEU A 1 221 ? 29.888  -3.423  26.838  1.00 38.67 ? 221  LEU A CA  1 
ATOM   1705 C C   . LEU A 1 221 ? 28.533  -2.739  26.735  1.00 37.62 ? 221  LEU A C   1 
ATOM   1706 O O   . LEU A 1 221 ? 28.246  -1.819  27.519  1.00 37.26 ? 221  LEU A O   1 
ATOM   1707 C CB  . LEU A 1 221 ? 31.024  -2.419  26.603  1.00 38.64 ? 221  LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 221 ? 32.450  -2.982  26.726  1.00 40.01 ? 221  LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 221 ? 33.488  -1.902  26.420  1.00 38.98 ? 221  LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 221 ? 32.703  -3.640  28.101  1.00 39.18 ? 221  LEU A CD2 1 
ATOM   1711 N N   . PHE A 1 222 ? 27.699  -3.191  25.796  1.00 36.49 ? 222  PHE A N   1 
ATOM   1712 C CA  . PHE A 1 222 ? 26.372  -2.580  25.568  1.00 36.08 ? 222  PHE A CA  1 
ATOM   1713 C C   . PHE A 1 222 ? 25.411  -3.546  24.875  1.00 36.42 ? 222  PHE A C   1 
ATOM   1714 O O   . PHE A 1 222 ? 25.846  -4.557  24.307  1.00 36.19 ? 222  PHE A O   1 
ATOM   1715 C CB  . PHE A 1 222 ? 26.498  -1.281  24.746  1.00 35.32 ? 222  PHE A CB  1 
ATOM   1716 C CG  . PHE A 1 222 ? 26.781  -1.505  23.284  1.00 33.62 ? 222  PHE A CG  1 
ATOM   1717 C CD1 . PHE A 1 222 ? 28.071  -1.685  22.832  1.00 32.88 ? 222  PHE A CD1 1 
ATOM   1718 C CD2 . PHE A 1 222 ? 25.746  -1.511  22.354  1.00 34.54 ? 222  PHE A CD2 1 
ATOM   1719 C CE1 . PHE A 1 222 ? 28.346  -1.892  21.478  1.00 32.67 ? 222  PHE A CE1 1 
ATOM   1720 C CE2 . PHE A 1 222 ? 26.006  -1.723  20.993  1.00 34.40 ? 222  PHE A CE2 1 
ATOM   1721 C CZ  . PHE A 1 222 ? 27.325  -1.913  20.564  1.00 34.00 ? 222  PHE A CZ  1 
ATOM   1722 N N   . HIS A 1 223 ? 24.124  -3.194  24.857  1.00 36.72 ? 223  HIS A N   1 
ATOM   1723 C CA  . HIS A 1 223 ? 23.085  -4.123  24.393  1.00 37.55 ? 223  HIS A CA  1 
ATOM   1724 C C   . HIS A 1 223 ? 22.262  -3.621  23.209  1.00 38.05 ? 223  HIS A C   1 
ATOM   1725 O O   . HIS A 1 223 ? 21.802  -4.420  22.369  1.00 38.45 ? 223  HIS A O   1 
ATOM   1726 C CB  . HIS A 1 223 ? 22.209  -4.527  25.583  1.00 37.38 ? 223  HIS A CB  1 
ATOM   1727 C CG  . HIS A 1 223 ? 23.014  -4.768  26.830  1.00 38.18 ? 223  HIS A CG  1 
ATOM   1728 N ND1 . HIS A 1 223 ? 23.668  -5.962  27.080  1.00 36.78 ? 223  HIS A ND1 1 
ATOM   1729 C CD2 . HIS A 1 223 ? 23.350  -3.933  27.841  1.00 35.93 ? 223  HIS A CD2 1 
ATOM   1730 C CE1 . HIS A 1 223 ? 24.322  -5.866  28.223  1.00 37.56 ? 223  HIS A CE1 1 
ATOM   1731 N NE2 . HIS A 1 223 ? 24.153  -4.641  28.700  1.00 37.79 ? 223  HIS A NE2 1 
ATOM   1732 N N   . ARG A 1 224 ? 22.096  -2.303  23.116  1.00 37.95 ? 224  ARG A N   1 
ATOM   1733 C CA  . ARG A 1 224 ? 21.327  -1.725  22.016  1.00 37.71 ? 224  ARG A CA  1 
ATOM   1734 C C   . ARG A 1 224 ? 21.944  -0.421  21.514  1.00 37.02 ? 224  ARG A C   1 
ATOM   1735 O O   . ARG A 1 224 ? 22.725  0.191   22.206  1.00 36.91 ? 224  ARG A O   1 
ATOM   1736 C CB  . ARG A 1 224 ? 19.869  -1.532  22.443  1.00 38.27 ? 224  ARG A CB  1 
ATOM   1737 C CG  . ARG A 1 224 ? 19.066  -2.826  22.435  1.00 40.13 ? 224  ARG A CG  1 
ATOM   1738 C CD  . ARG A 1 224 ? 17.753  -2.732  23.204  1.00 43.53 ? 224  ARG A CD  1 
ATOM   1739 N NE  . ARG A 1 224 ? 17.972  -2.509  24.634  1.00 47.24 ? 224  ARG A NE  1 
ATOM   1740 C CZ  . ARG A 1 224 ? 18.306  -3.445  25.524  1.00 46.89 ? 224  ARG A CZ  1 
ATOM   1741 N NH1 . ARG A 1 224 ? 18.471  -4.718  25.165  1.00 47.98 ? 224  ARG A NH1 1 
ATOM   1742 N NH2 . ARG A 1 224 ? 18.471  -3.098  26.789  1.00 45.98 ? 224  ARG A NH2 1 
ATOM   1743 N N   . ALA A 1 225 ? 21.597  -0.002  20.302  1.00 36.95 ? 225  ALA A N   1 
ATOM   1744 C CA  . ALA A 1 225 ? 22.210  1.180   19.719  1.00 36.32 ? 225  ALA A CA  1 
ATOM   1745 C C   . ALA A 1 225 ? 21.200  2.008   18.939  1.00 35.83 ? 225  ALA A C   1 
ATOM   1746 O O   . ALA A 1 225 ? 20.394  1.450   18.210  1.00 34.78 ? 225  ALA A O   1 
ATOM   1747 C CB  . ALA A 1 225 ? 23.341  0.771   18.816  1.00 36.32 ? 225  ALA A CB  1 
ATOM   1748 N N   . VAL A 1 226 ? 21.266  3.330   19.130  1.00 35.25 ? 226  VAL A N   1 
ATOM   1749 C CA  . VAL A 1 226 ? 20.635  4.317   18.268  1.00 35.04 ? 226  VAL A CA  1 
ATOM   1750 C C   . VAL A 1 226 ? 21.707  5.113   17.494  1.00 35.24 ? 226  VAL A C   1 
ATOM   1751 O O   . VAL A 1 226 ? 22.636  5.646   18.096  1.00 35.97 ? 226  VAL A O   1 
ATOM   1752 C CB  . VAL A 1 226 ? 19.822  5.324   19.092  1.00 35.52 ? 226  VAL A CB  1 
ATOM   1753 C CG1 . VAL A 1 226 ? 19.089  6.296   18.170  1.00 35.65 ? 226  VAL A CG1 1 
ATOM   1754 C CG2 . VAL A 1 226 ? 18.836  4.623   20.047  1.00 33.56 ? 226  VAL A CG2 1 
ATOM   1755 N N   . LEU A 1 227 ? 21.579  5.188   16.168  1.00 34.73 ? 227  LEU A N   1 
ATOM   1756 C CA  . LEU A 1 227 ? 22.467  5.991   15.322  1.00 33.37 ? 227  LEU A CA  1 
ATOM   1757 C C   . LEU A 1 227 ? 21.692  7.122   14.659  1.00 33.44 ? 227  LEU A C   1 
ATOM   1758 O O   . LEU A 1 227 ? 20.821  6.872   13.817  1.00 33.08 ? 227  LEU A O   1 
ATOM   1759 C CB  . LEU A 1 227 ? 23.121  5.120   14.246  1.00 33.34 ? 227  LEU A CB  1 
ATOM   1760 C CG  . LEU A 1 227 ? 24.166  4.054   14.632  1.00 33.09 ? 227  LEU A CG  1 
ATOM   1761 C CD1 . LEU A 1 227 ? 23.511  2.864   15.313  1.00 31.92 ? 227  LEU A CD1 1 
ATOM   1762 C CD2 . LEU A 1 227 ? 24.920  3.599   13.401  1.00 32.41 ? 227  LEU A CD2 1 
ATOM   1763 N N   . GLN A 1 228 ? 22.013  8.364   15.027  1.00 33.24 ? 228  GLN A N   1 
ATOM   1764 C CA  . GLN A 1 228 ? 21.255  9.536   14.556  1.00 33.11 ? 228  GLN A CA  1 
ATOM   1765 C C   . GLN A 1 228 ? 22.044  10.344  13.525  1.00 33.74 ? 228  GLN A C   1 
ATOM   1766 O O   . GLN A 1 228 ? 22.924  11.124  13.897  1.00 34.13 ? 228  GLN A O   1 
ATOM   1767 C CB  . GLN A 1 228 ? 20.857  10.446  15.736  1.00 32.88 ? 228  GLN A CB  1 
ATOM   1768 C CG  . GLN A 1 228 ? 20.033  9.753   16.848  1.00 31.99 ? 228  GLN A CG  1 
ATOM   1769 C CD  . GLN A 1 228 ? 19.786  10.644  18.057  1.00 32.74 ? 228  GLN A CD  1 
ATOM   1770 O OE1 . GLN A 1 228 ? 19.852  11.888  17.968  1.00 35.60 ? 228  GLN A OE1 1 
ATOM   1771 N NE2 . GLN A 1 228 ? 19.508  10.027  19.196  1.00 27.00 ? 228  GLN A NE2 1 
ATOM   1772 N N   . SER A 1 229 ? 21.729  10.170  12.240  1.00 33.71 ? 229  SER A N   1 
ATOM   1773 C CA  . SER A 1 229 ? 22.342  10.966  11.177  1.00 34.06 ? 229  SER A CA  1 
ATOM   1774 C C   . SER A 1 229 ? 23.829  10.674  11.032  1.00 34.52 ? 229  SER A C   1 
ATOM   1775 O O   . SER A 1 229 ? 24.650  11.587  10.896  1.00 34.72 ? 229  SER A O   1 
ATOM   1776 C CB  . SER A 1 229 ? 22.159  12.464  11.414  1.00 33.78 ? 229  SER A CB  1 
ATOM   1777 O OG  . SER A 1 229 ? 20.798  12.828  11.491  1.00 35.80 ? 229  SER A OG  1 
ATOM   1778 N N   . GLY A 1 230 ? 24.179  9.398   11.035  1.00 34.61 ? 230  GLY A N   1 
ATOM   1779 C CA  . GLY A 1 230 ? 25.561  9.030   10.861  1.00 34.74 ? 230  GLY A CA  1 
ATOM   1780 C C   . GLY A 1 230 ? 25.768  7.549   10.929  1.00 34.71 ? 230  GLY A C   1 
ATOM   1781 O O   . GLY A 1 230 ? 25.016  6.834   11.592  1.00 35.33 ? 230  GLY A O   1 
ATOM   1782 N N   . THR A 1 231 ? 26.804  7.092   10.242  1.00 34.80 ? 231  THR A N   1 
ATOM   1783 C CA  . THR A 1 231 ? 27.076  5.668   10.119  1.00 34.98 ? 231  THR A CA  1 
ATOM   1784 C C   . THR A 1 231 ? 28.573  5.443   10.076  1.00 34.87 ? 231  THR A C   1 
ATOM   1785 O O   . THR A 1 231 ? 29.311  6.327   9.665   1.00 35.09 ? 231  THR A O   1 
ATOM   1786 C CB  . THR A 1 231 ? 26.501  5.103   8.818   1.00 34.73 ? 231  THR A CB  1 
ATOM   1787 O OG1 . THR A 1 231 ? 27.145  5.735   7.706   1.00 35.06 ? 231  THR A OG1 1 
ATOM   1788 C CG2 . THR A 1 231 ? 25.015  5.318   8.742   1.00 35.12 ? 231  THR A CG2 1 
ATOM   1789 N N   . PRO A 1 232 ? 29.026  4.243   10.472  1.00 34.74 ? 232  PRO A N   1 
ATOM   1790 C CA  . PRO A 1 232 ? 30.459  3.937   10.395  1.00 33.76 ? 232  PRO A CA  1 
ATOM   1791 C C   . PRO A 1 232 ? 30.918  3.773   8.937   1.00 33.47 ? 232  PRO A C   1 
ATOM   1792 O O   . PRO A 1 232 ? 32.102  3.968   8.617   1.00 33.04 ? 232  PRO A O   1 
ATOM   1793 C CB  . PRO A 1 232 ? 30.561  2.620   11.157  1.00 33.78 ? 232  PRO A CB  1 
ATOM   1794 C CG  . PRO A 1 232 ? 29.199  1.979   11.005  1.00 34.04 ? 232  PRO A CG  1 
ATOM   1795 C CD  . PRO A 1 232 ? 28.230  3.116   11.010  1.00 34.83 ? 232  PRO A CD  1 
ATOM   1796 N N   . ASN A 1 233 ? 29.983  3.403   8.068   1.00 32.46 ? 233  ASN A N   1 
ATOM   1797 C CA  . ASN A 1 233 ? 30.271  3.247   6.659   1.00 32.25 ? 233  ASN A CA  1 
ATOM   1798 C C   . ASN A 1 233 ? 30.031  4.587   5.971   1.00 32.92 ? 233  ASN A C   1 
ATOM   1799 O O   . ASN A 1 233 ? 29.535  5.510   6.596   1.00 33.80 ? 233  ASN A O   1 
ATOM   1800 C CB  . ASN A 1 233 ? 29.359  2.176   6.068   1.00 31.41 ? 233  ASN A CB  1 
ATOM   1801 C CG  . ASN A 1 233 ? 27.895  2.464   6.329   1.00 29.25 ? 233  ASN A CG  1 
ATOM   1802 O OD1 . ASN A 1 233 ? 27.445  2.445   7.477   1.00 27.42 ? 233  ASN A OD1 1 
ATOM   1803 N ND2 . ASN A 1 233 ? 27.140  2.726   5.268   1.00 27.44 ? 233  ASN A ND2 1 
ATOM   1804 N N   . GLY A 1 234 ? 30.355  4.698   4.688   1.00 33.31 ? 234  GLY A N   1 
ATOM   1805 C CA  . GLY A 1 234 ? 30.221  5.973   3.995   1.00 34.08 ? 234  GLY A CA  1 
ATOM   1806 C C   . GLY A 1 234 ? 31.555  6.692   3.833   1.00 34.57 ? 234  GLY A C   1 
ATOM   1807 O O   . GLY A 1 234 ? 32.599  6.165   4.252   1.00 34.85 ? 234  GLY A O   1 
ATOM   1808 N N   . PRO A 1 235 ? 31.530  7.912   3.264   1.00 34.19 ? 235  PRO A N   1 
ATOM   1809 C CA  . PRO A 1 235 ? 32.717  8.538   2.702   1.00 34.19 ? 235  PRO A CA  1 
ATOM   1810 C C   . PRO A 1 235 ? 33.574  9.362   3.660   1.00 34.46 ? 235  PRO A C   1 
ATOM   1811 O O   . PRO A 1 235 ? 34.721  9.720   3.302   1.00 35.44 ? 235  PRO A O   1 
ATOM   1812 C CB  . PRO A 1 235 ? 32.143  9.450   1.607   1.00 34.34 ? 235  PRO A CB  1 
ATOM   1813 C CG  . PRO A 1 235 ? 30.718  9.767   2.056   1.00 34.63 ? 235  PRO A CG  1 
ATOM   1814 C CD  . PRO A 1 235 ? 30.342  8.778   3.146   1.00 34.59 ? 235  PRO A CD  1 
ATOM   1815 N N   . TRP A 1 236 ? 33.066  9.664   4.854   1.00 33.42 ? 236  TRP A N   1 
ATOM   1816 C CA  . TRP A 1 236 ? 33.774  10.582  5.742   1.00 32.60 ? 236  TRP A CA  1 
ATOM   1817 C C   . TRP A 1 236 ? 34.141  9.998   7.110   1.00 32.56 ? 236  TRP A C   1 
ATOM   1818 O O   . TRP A 1 236 ? 34.972  10.571  7.831   1.00 31.40 ? 236  TRP A O   1 
ATOM   1819 C CB  . TRP A 1 236 ? 32.942  11.854  5.939   1.00 32.34 ? 236  TRP A CB  1 
ATOM   1820 C CG  . TRP A 1 236 ? 31.606  11.577  6.520   1.00 31.36 ? 236  TRP A CG  1 
ATOM   1821 C CD1 . TRP A 1 236 ? 30.437  11.415  5.836   1.00 32.59 ? 236  TRP A CD1 1 
ATOM   1822 C CD2 . TRP A 1 236 ? 31.292  11.398  7.903   1.00 31.17 ? 236  TRP A CD2 1 
ATOM   1823 N NE1 . TRP A 1 236 ? 29.396  11.165  6.713   1.00 32.40 ? 236  TRP A NE1 1 
ATOM   1824 C CE2 . TRP A 1 236 ? 29.894  11.144  7.989   1.00 32.48 ? 236  TRP A CE2 1 
ATOM   1825 C CE3 . TRP A 1 236 ? 32.041  11.457  9.083   1.00 30.32 ? 236  TRP A CE3 1 
ATOM   1826 C CZ2 . TRP A 1 236 ? 29.241  10.930  9.208   1.00 31.23 ? 236  TRP A CZ2 1 
ATOM   1827 C CZ3 . TRP A 1 236 ? 31.387  11.241  10.298  1.00 32.09 ? 236  TRP A CZ3 1 
ATOM   1828 C CH2 . TRP A 1 236 ? 30.003  10.976  10.348  1.00 31.68 ? 236  TRP A CH2 1 
ATOM   1829 N N   . ALA A 1 237 ? 33.507  8.894   7.499   1.00 32.07 ? 237  ALA A N   1 
ATOM   1830 C CA  . ALA A 1 237 ? 33.702  8.411   8.887   1.00 32.27 ? 237  ALA A CA  1 
ATOM   1831 C C   . ALA A 1 237 ? 35.067  7.723   9.119   1.00 32.34 ? 237  ALA A C   1 
ATOM   1832 O O   . ALA A 1 237 ? 35.521  7.616   10.261  1.00 31.58 ? 237  ALA A O   1 
ATOM   1833 C CB  . ALA A 1 237 ? 32.557  7.507   9.327   1.00 32.02 ? 237  ALA A CB  1 
ATOM   1834 N N   . THR A 1 238 ? 35.710  7.270   8.044   1.00 32.59 ? 238  THR A N   1 
ATOM   1835 C CA  . THR A 1 238 ? 36.981  6.554   8.175   1.00 33.72 ? 238  THR A CA  1 
ATOM   1836 C C   . THR A 1 238 ? 37.996  6.900   7.094   1.00 34.78 ? 238  THR A C   1 
ATOM   1837 O O   . THR A 1 238 ? 37.641  7.324   5.998   1.00 35.44 ? 238  THR A O   1 
ATOM   1838 C CB  . THR A 1 238 ? 36.785  5.011   8.164   1.00 33.32 ? 238  THR A CB  1 
ATOM   1839 O OG1 . THR A 1 238 ? 36.146  4.604   6.946   1.00 32.91 ? 238  THR A OG1 1 
ATOM   1840 C CG2 . THR A 1 238 ? 35.961  4.571   9.332   1.00 31.35 ? 238  THR A CG2 1 
ATOM   1841 N N   . VAL A 1 239 ? 39.271  6.716   7.403   1.00 35.71 ? 239  VAL A N   1 
ATOM   1842 C CA  . VAL A 1 239 ? 40.303  6.771   6.361   1.00 35.91 ? 239  VAL A CA  1 
ATOM   1843 C C   . VAL A 1 239 ? 41.095  5.466   6.339   1.00 36.81 ? 239  VAL A C   1 
ATOM   1844 O O   . VAL A 1 239 ? 41.141  4.750   7.327   1.00 36.71 ? 239  VAL A O   1 
ATOM   1845 C CB  . VAL A 1 239 ? 41.249  7.986   6.527   1.00 35.90 ? 239  VAL A CB  1 
ATOM   1846 C CG1 . VAL A 1 239 ? 40.536  9.300   6.085   1.00 34.94 ? 239  VAL A CG1 1 
ATOM   1847 C CG2 . VAL A 1 239 ? 41.807  8.072   7.956   1.00 33.67 ? 239  VAL A CG2 1 
ATOM   1848 N N   . SER A 1 240 ? 41.708  5.154   5.203   1.00 37.88 ? 240  SER A N   1 
ATOM   1849 C CA  . SER A 1 240 ? 42.603  4.011   5.117   1.00 38.65 ? 240  SER A CA  1 
ATOM   1850 C C   . SER A 1 240 ? 43.861  4.291   5.927   1.00 39.20 ? 240  SER A C   1 
ATOM   1851 O O   . SER A 1 240 ? 44.143  5.442   6.310   1.00 38.74 ? 240  SER A O   1 
ATOM   1852 C CB  . SER A 1 240 ? 42.969  3.734   3.661   1.00 38.63 ? 240  SER A CB  1 
ATOM   1853 O OG  . SER A 1 240 ? 43.623  4.863   3.108   1.00 40.64 ? 240  SER A OG  1 
ATOM   1854 N N   . ALA A 1 241 ? 44.616  3.234   6.203   1.00 39.91 ? 241  ALA A N   1 
ATOM   1855 C CA  . ALA A 1 241 ? 45.873  3.393   6.910   1.00 40.63 ? 241  ALA A CA  1 
ATOM   1856 C C   . ALA A 1 241 ? 46.792  4.285   6.085   1.00 40.72 ? 241  ALA A C   1 
ATOM   1857 O O   . ALA A 1 241 ? 47.437  5.186   6.617   1.00 40.56 ? 241  ALA A O   1 
ATOM   1858 C CB  . ALA A 1 241 ? 46.512  2.041   7.186   1.00 41.13 ? 241  ALA A CB  1 
ATOM   1859 N N   . GLY A 1 242 ? 46.800  4.069   4.774   1.00 41.22 ? 242  GLY A N   1 
ATOM   1860 C CA  . GLY A 1 242 ? 47.678  4.835   3.883   1.00 41.63 ? 242  GLY A CA  1 
ATOM   1861 C C   . GLY A 1 242 ? 47.402  6.320   3.987   1.00 41.67 ? 242  GLY A C   1 
ATOM   1862 O O   . GLY A 1 242 ? 48.329  7.124   4.154   1.00 41.99 ? 242  GLY A O   1 
ATOM   1863 N N   . GLU A 1 243 ? 46.116  6.671   3.917   1.00 41.33 ? 243  GLU A N   1 
ATOM   1864 C CA  . GLU A 1 243 ? 45.689  8.064   3.917   1.00 41.18 ? 243  GLU A CA  1 
ATOM   1865 C C   . GLU A 1 243 ? 45.939  8.755   5.265   1.00 41.10 ? 243  GLU A C   1 
ATOM   1866 O O   . GLU A 1 243 ? 46.348  9.930   5.303   1.00 41.72 ? 243  GLU A O   1 
ATOM   1867 C CB  . GLU A 1 243 ? 44.227  8.163   3.434   1.00 41.48 ? 243  GLU A CB  1 
ATOM   1868 C CG  . GLU A 1 243 ? 43.560  9.547   3.488   1.00 42.62 ? 243  GLU A CG  1 
ATOM   1869 C CD  . GLU A 1 243 ? 44.223  10.638  2.632   1.00 44.70 ? 243  GLU A CD  1 
ATOM   1870 O OE1 . GLU A 1 243 ? 43.703  11.774  2.670   1.00 44.50 ? 243  GLU A OE1 1 
ATOM   1871 O OE2 . GLU A 1 243 ? 45.249  10.399  1.938   1.00 46.41 ? 243  GLU A OE2 1 
ATOM   1872 N N   . ALA A 1 244 ? 45.732  8.036   6.367   1.00 40.72 ? 244  ALA A N   1 
ATOM   1873 C CA  . ALA A 1 244 ? 46.069  8.568   7.697   1.00 40.53 ? 244  ALA A CA  1 
ATOM   1874 C C   . ALA A 1 244 ? 47.576  8.834   7.868   1.00 40.83 ? 244  ALA A C   1 
ATOM   1875 O O   . ALA A 1 244 ? 47.967  9.849   8.465   1.00 41.02 ? 244  ALA A O   1 
ATOM   1876 C CB  . ALA A 1 244 ? 45.555  7.648   8.793   1.00 39.72 ? 244  ALA A CB  1 
ATOM   1877 N N   . ARG A 1 245 ? 48.417  7.933   7.348   1.00 41.09 ? 245  ARG A N   1 
ATOM   1878 C CA  . ARG A 1 245 ? 49.873  8.132   7.373   1.00 41.39 ? 245  ARG A CA  1 
ATOM   1879 C C   . ARG A 1 245 ? 50.227  9.415   6.620   1.00 41.40 ? 245  ARG A C   1 
ATOM   1880 O O   . ARG A 1 245 ? 50.978  10.266  7.130   1.00 40.63 ? 245  ARG A O   1 
ATOM   1881 C CB  . ARG A 1 245 ? 50.630  6.929   6.788   1.00 41.55 ? 245  ARG A CB  1 
ATOM   1882 C CG  . ARG A 1 245 ? 52.179  7.054   6.847   1.00 41.92 ? 245  ARG A CG  1 
ATOM   1883 C CD  . ARG A 1 245 ? 52.898  5.684   6.704   1.00 41.88 ? 245  ARG A CD  1 
ATOM   1884 N NE  . ARG A 1 245 ? 52.738  4.860   7.907   1.00 41.69 ? 245  ARG A NE  1 
ATOM   1885 C CZ  . ARG A 1 245 ? 53.504  4.947   8.991   1.00 43.30 ? 245  ARG A CZ  1 
ATOM   1886 N NH1 . ARG A 1 245 ? 54.516  5.810   9.052   1.00 43.27 ? 245  ARG A NH1 1 
ATOM   1887 N NH2 . ARG A 1 245 ? 53.257  4.165   10.034  1.00 44.22 ? 245  ARG A NH2 1 
ATOM   1888 N N   . ARG A 1 246 ? 49.644  9.552   5.429   1.00 41.45 ? 246  ARG A N   1 
ATOM   1889 C CA  . ARG A 1 246 ? 49.820  10.729  4.590   1.00 41.99 ? 246  ARG A CA  1 
ATOM   1890 C C   . ARG A 1 246 ? 49.433  12.012  5.330   1.00 41.89 ? 246  ARG A C   1 
ATOM   1891 O O   . ARG A 1 246 ? 50.241  12.950  5.422   1.00 42.20 ? 246  ARG A O   1 
ATOM   1892 C CB  . ARG A 1 246 ? 49.000  10.561  3.324   1.00 42.58 ? 246  ARG A CB  1 
ATOM   1893 C CG  . ARG A 1 246 ? 49.395  11.465  2.178   1.00 44.35 ? 246  ARG A CG  1 
ATOM   1894 C CD  . ARG A 1 246 ? 48.173  11.873  1.339   1.00 45.94 ? 246  ARG A CD  1 
ATOM   1895 N NE  . ARG A 1 246 ? 47.990  13.318  1.428   1.00 48.80 ? 246  ARG A NE  1 
ATOM   1896 C CZ  . ARG A 1 246 ? 46.878  13.935  1.794   1.00 50.16 ? 246  ARG A CZ  1 
ATOM   1897 N NH1 . ARG A 1 246 ? 45.782  13.257  2.095   1.00 49.01 ? 246  ARG A NH1 1 
ATOM   1898 N NH2 . ARG A 1 246 ? 46.861  15.257  1.825   1.00 54.08 ? 246  ARG A NH2 1 
ATOM   1899 N N   . ARG A 1 247 ? 48.227  12.046  5.901   1.00 41.56 ? 247  ARG A N   1 
ATOM   1900 C CA  . ARG A 1 247 ? 47.781  13.234  6.658   1.00 40.69 ? 247  ARG A CA  1 
ATOM   1901 C C   . ARG A 1 247 ? 48.594  13.511  7.920   1.00 40.44 ? 247  ARG A C   1 
ATOM   1902 O O   . ARG A 1 247 ? 48.866  14.664  8.241   1.00 40.64 ? 247  ARG A O   1 
ATOM   1903 C CB  . ARG A 1 247 ? 46.302  13.137  7.024   1.00 40.24 ? 247  ARG A CB  1 
ATOM   1904 C CG  . ARG A 1 247 ? 45.391  13.051  5.835   1.00 39.15 ? 247  ARG A CG  1 
ATOM   1905 C CD  . ARG A 1 247 ? 43.954  12.993  6.287   1.00 37.54 ? 247  ARG A CD  1 
ATOM   1906 N NE  . ARG A 1 247 ? 43.059  12.710  5.179   1.00 36.20 ? 247  ARG A NE  1 
ATOM   1907 C CZ  . ARG A 1 247 ? 41.731  12.631  5.273   1.00 34.74 ? 247  ARG A CZ  1 
ATOM   1908 N NH1 . ARG A 1 247 ? 41.106  12.828  6.435   1.00 30.14 ? 247  ARG A NH1 1 
ATOM   1909 N NH2 . ARG A 1 247 ? 41.028  12.370  4.182   1.00 33.15 ? 247  ARG A NH2 1 
ATOM   1910 N N   . ALA A 1 248 ? 48.963  12.468  8.653   1.00 40.33 ? 248  ALA A N   1 
ATOM   1911 C CA  . ALA A 1 248 ? 49.807  12.661  9.843   1.00 40.31 ? 248  ALA A CA  1 
ATOM   1912 C C   . ALA A 1 248 ? 51.215  13.146  9.487   1.00 40.65 ? 248  ALA A C   1 
ATOM   1913 O O   . ALA A 1 248 ? 51.788  13.967  10.203  1.00 40.89 ? 248  ALA A O   1 
ATOM   1914 C CB  . ALA A 1 248 ? 49.874  11.403  10.663  1.00 39.90 ? 248  ALA A CB  1 
ATOM   1915 N N   . THR A 1 249 ? 51.763  12.652  8.380   1.00 41.21 ? 249  THR A N   1 
ATOM   1916 C CA  . THR A 1 249 ? 53.086  13.080  7.946   1.00 42.11 ? 249  THR A CA  1 
ATOM   1917 C C   . THR A 1 249 ? 53.050  14.539  7.520   1.00 42.20 ? 249  THR A C   1 
ATOM   1918 O O   . THR A 1 249 ? 53.911  15.329  7.935   1.00 42.42 ? 249  THR A O   1 
ATOM   1919 C CB  . THR A 1 249 ? 53.665  12.213  6.794   1.00 42.31 ? 249  THR A CB  1 
ATOM   1920 O OG1 . THR A 1 249 ? 53.654  10.825  7.164   1.00 42.66 ? 249  THR A OG1 1 
ATOM   1921 C CG2 . THR A 1 249 ? 55.091  12.631  6.500   1.00 42.84 ? 249  THR A CG2 1 
ATOM   1922 N N   . LEU A 1 250 ? 52.051  14.891  6.705   1.00 42.20 ? 250  LEU A N   1 
ATOM   1923 C CA  . LEU A 1 250 ? 51.870  16.275  6.266   1.00 41.97 ? 250  LEU A CA  1 
ATOM   1924 C C   . LEU A 1 250 ? 51.690  17.222  7.438   1.00 42.20 ? 250  LEU A C   1 
ATOM   1925 O O   . LEU A 1 250 ? 52.354  18.272  7.503   1.00 42.97 ? 250  LEU A O   1 
ATOM   1926 C CB  . LEU A 1 250 ? 50.722  16.429  5.246   1.00 41.91 ? 250  LEU A CB  1 
ATOM   1927 C CG  . LEU A 1 250 ? 50.548  17.828  4.600   1.00 42.22 ? 250  LEU A CG  1 
ATOM   1928 C CD1 . LEU A 1 250 ? 51.860  18.414  4.036   1.00 41.48 ? 250  LEU A CD1 1 
ATOM   1929 C CD2 . LEU A 1 250 ? 49.474  17.858  3.515   1.00 41.67 ? 250  LEU A CD2 1 
ATOM   1930 N N   . LEU A 1 251 ? 50.820  16.868  8.379   1.00 42.07 ? 251  LEU A N   1 
ATOM   1931 C CA  . LEU A 1 251 ? 50.586  17.774  9.504   1.00 42.33 ? 251  LEU A CA  1 
ATOM   1932 C C   . LEU A 1 251 ? 51.879  17.977  10.314  1.00 42.56 ? 251  LEU A C   1 
ATOM   1933 O O   . LEU A 1 251 ? 52.164  19.092  10.781  1.00 42.34 ? 251  LEU A O   1 
ATOM   1934 C CB  . LEU A 1 251 ? 49.438  17.294  10.407  1.00 41.87 ? 251  LEU A CB  1 
ATOM   1935 C CG  . LEU A 1 251 ? 49.402  18.132  11.680  1.00 41.33 ? 251  LEU A CG  1 
ATOM   1936 C CD1 . LEU A 1 251 ? 48.485  19.330  11.558  1.00 43.10 ? 251  LEU A CD1 1 
ATOM   1937 C CD2 . LEU A 1 251 ? 49.051  17.321  12.870  1.00 43.22 ? 251  LEU A CD2 1 
ATOM   1938 N N   . ALA A 1 252 ? 52.632  16.891  10.488  1.00 42.78 ? 252  ALA A N   1 
ATOM   1939 C CA  . ALA A 1 252 ? 53.971  16.950  11.079  1.00 43.54 ? 252  ALA A CA  1 
ATOM   1940 C C   . ALA A 1 252 ? 54.873  17.974  10.360  1.00 43.88 ? 252  ALA A C   1 
ATOM   1941 O O   . ALA A 1 252 ? 55.356  18.918  10.992  1.00 43.15 ? 252  ALA A O   1 
ATOM   1942 C CB  . ALA A 1 252 ? 54.614  15.556  11.104  1.00 43.44 ? 252  ALA A CB  1 
ATOM   1943 N N   . ARG A 1 253 ? 55.053  17.817  9.045   1.00 44.73 ? 253  ARG A N   1 
ATOM   1944 C CA  . ARG A 1 253 ? 55.835  18.795  8.255   1.00 46.39 ? 253  ARG A CA  1 
ATOM   1945 C C   . ARG A 1 253 ? 55.399  20.253  8.475   1.00 46.83 ? 253  ARG A C   1 
ATOM   1946 O O   . ARG A 1 253 ? 56.250  21.117  8.701   1.00 47.07 ? 253  ARG A O   1 
ATOM   1947 C CB  . ARG A 1 253 ? 55.818  18.477  6.764   1.00 46.30 ? 253  ARG A CB  1 
ATOM   1948 C CG  . ARG A 1 253 ? 56.614  17.267  6.381   1.00 50.11 ? 253  ARG A CG  1 
ATOM   1949 C CD  . ARG A 1 253 ? 56.869  17.213  4.864   1.00 56.56 ? 253  ARG A CD  1 
ATOM   1950 N NE  . ARG A 1 253 ? 57.252  15.860  4.431   1.00 60.23 ? 253  ARG A NE  1 
ATOM   1951 C CZ  . ARG A 1 253 ? 56.411  14.954  3.917   1.00 61.61 ? 253  ARG A CZ  1 
ATOM   1952 N NH1 . ARG A 1 253 ? 55.108  15.235  3.749   1.00 61.65 ? 253  ARG A NH1 1 
ATOM   1953 N NH2 . ARG A 1 253 ? 56.878  13.759  3.562   1.00 60.62 ? 253  ARG A NH2 1 
ATOM   1954 N N   . LEU A 1 254 ? 54.085  20.513  8.443   1.00 47.08 ? 254  LEU A N   1 
ATOM   1955 C CA  . LEU A 1 254 ? 53.557  21.885  8.587   1.00 47.60 ? 254  LEU A CA  1 
ATOM   1956 C C   . LEU A 1 254 ? 53.913  22.575  9.904   1.00 48.30 ? 254  LEU A C   1 
ATOM   1957 O O   . LEU A 1 254 ? 53.976  23.807  9.968   1.00 48.54 ? 254  LEU A O   1 
ATOM   1958 C CB  . LEU A 1 254 ? 52.038  21.945  8.341   1.00 46.82 ? 254  LEU A CB  1 
ATOM   1959 C CG  . LEU A 1 254 ? 51.600  21.503  6.938   1.00 46.80 ? 254  LEU A CG  1 
ATOM   1960 C CD1 . LEU A 1 254 ? 50.084  21.401  6.794   1.00 44.53 ? 254  LEU A CD1 1 
ATOM   1961 C CD2 . LEU A 1 254 ? 52.217  22.372  5.817   1.00 44.85 ? 254  LEU A CD2 1 
ATOM   1962 N N   . VAL A 1 255 ? 54.124  21.782  10.948  1.00 49.21 ? 255  VAL A N   1 
ATOM   1963 C CA  . VAL A 1 255 ? 54.534  22.304  12.257  1.00 49.98 ? 255  VAL A CA  1 
ATOM   1964 C C   . VAL A 1 255 ? 56.041  22.053  12.472  1.00 51.23 ? 255  VAL A C   1 
ATOM   1965 O O   . VAL A 1 255 ? 56.570  22.241  13.570  1.00 51.82 ? 255  VAL A O   1 
ATOM   1966 C CB  . VAL A 1 255 ? 53.668  21.725  13.435  1.00 49.60 ? 255  VAL A CB  1 
ATOM   1967 C CG1 . VAL A 1 255 ? 52.203  22.119  13.270  1.00 49.15 ? 255  VAL A CG1 1 
ATOM   1968 C CG2 . VAL A 1 255 ? 53.803  20.219  13.545  1.00 48.24 ? 255  VAL A CG2 1 
ATOM   1969 N N   . GLY A 1 256 ? 56.713  21.622  11.405  1.00 52.19 ? 256  GLY A N   1 
ATOM   1970 C CA  . GLY A 1 256 ? 58.172  21.515  11.382  1.00 53.39 ? 256  GLY A CA  1 
ATOM   1971 C C   . GLY A 1 256 ? 58.686  20.376  12.225  1.00 54.07 ? 256  GLY A C   1 
ATOM   1972 O O   . GLY A 1 256 ? 59.202  20.602  13.320  1.00 54.41 ? 256  GLY A O   1 
ATOM   1973 N N   . CYS A 1 257 ? 58.531  19.158  11.708  1.00 54.52 ? 257  CYS A N   1 
ATOM   1974 C CA  . CYS A 1 257 ? 58.868  17.948  12.435  1.00 55.00 ? 257  CYS A CA  1 
ATOM   1975 C C   . CYS A 1 257 ? 59.436  16.902  11.473  1.00 55.75 ? 257  CYS A C   1 
ATOM   1976 O O   . CYS A 1 257 ? 58.772  16.523  10.508  1.00 56.44 ? 257  CYS A O   1 
ATOM   1977 C CB  . CYS A 1 257 ? 57.635  17.400  13.180  1.00 54.51 ? 257  CYS A CB  1 
ATOM   1978 S SG  . CYS A 1 257 ? 57.323  18.105  14.846  1.00 53.51 ? 257  CYS A SG  1 
ATOM   1979 N N   . ASN A 1 265 ? 61.337  6.949   10.123  1.00 62.40 ? 265  ASN A N   1 
ATOM   1980 C CA  . ASN A 1 265 ? 61.224  6.543   11.532  1.00 62.07 ? 265  ASN A CA  1 
ATOM   1981 C C   . ASN A 1 265 ? 60.066  7.261   12.265  1.00 61.23 ? 265  ASN A C   1 
ATOM   1982 O O   . ASN A 1 265 ? 60.085  8.489   12.443  1.00 61.31 ? 265  ASN A O   1 
ATOM   1983 C CB  . ASN A 1 265 ? 62.571  6.762   12.246  1.00 62.31 ? 265  ASN A CB  1 
ATOM   1984 C CG  . ASN A 1 265 ? 62.535  6.391   13.730  1.00 62.93 ? 265  ASN A CG  1 
ATOM   1985 O OD1 . ASN A 1 265 ? 62.476  7.271   14.600  1.00 62.97 ? 265  ASN A OD1 1 
ATOM   1986 N ND2 . ASN A 1 265 ? 62.596  5.088   14.024  1.00 63.50 ? 265  ASN A ND2 1 
ATOM   1987 N N   . ASP A 1 266 ? 59.069  6.480   12.688  1.00 60.22 ? 266  ASP A N   1 
ATOM   1988 C CA  . ASP A 1 266 ? 57.852  7.013   13.319  1.00 58.82 ? 266  ASP A CA  1 
ATOM   1989 C C   . ASP A 1 266 ? 58.079  7.591   14.718  1.00 58.50 ? 266  ASP A C   1 
ATOM   1990 O O   . ASP A 1 266 ? 57.425  8.562   15.097  1.00 58.64 ? 266  ASP A O   1 
ATOM   1991 C CB  . ASP A 1 266 ? 56.765  5.941   13.391  1.00 58.45 ? 266  ASP A CB  1 
ATOM   1992 C CG  . ASP A 1 266 ? 56.123  5.648   12.046  1.00 57.36 ? 266  ASP A CG  1 
ATOM   1993 O OD1 . ASP A 1 266 ? 56.325  6.398   11.067  1.00 57.17 ? 266  ASP A OD1 1 
ATOM   1994 O OD2 . ASP A 1 266 ? 55.387  4.650   11.970  1.00 56.43 ? 266  ASP A OD2 1 
ATOM   1995 N N   . THR A 1 267 ? 59.000  6.999   15.479  1.00 57.70 ? 267  THR A N   1 
ATOM   1996 C CA  . THR A 1 267 ? 59.248  7.429   16.856  1.00 56.60 ? 267  THR A CA  1 
ATOM   1997 C C   . THR A 1 267 ? 59.664  8.885   16.968  1.00 56.61 ? 267  THR A C   1 
ATOM   1998 O O   . THR A 1 267 ? 59.167  9.581   17.840  1.00 56.49 ? 267  THR A O   1 
ATOM   1999 C CB  . THR A 1 267 ? 60.255  6.500   17.575  1.00 56.47 ? 267  THR A CB  1 
ATOM   2000 O OG1 . THR A 1 267 ? 59.715  5.178   17.619  1.00 55.69 ? 267  THR A OG1 1 
ATOM   2001 C CG2 . THR A 1 267 ? 60.521  6.953   19.011  1.00 55.78 ? 267  THR A CG2 1 
ATOM   2002 N N   . GLU A 1 268 ? 60.560  9.342   16.087  1.00 56.80 ? 268  GLU A N   1 
ATOM   2003 C CA  . GLU A 1 268 ? 61.066  10.740  16.097  1.00 57.00 ? 268  GLU A CA  1 
ATOM   2004 C C   . GLU A 1 268 ? 59.990  11.757  15.736  1.00 55.38 ? 268  GLU A C   1 
ATOM   2005 O O   . GLU A 1 268 ? 59.900  12.828  16.340  1.00 55.17 ? 268  GLU A O   1 
ATOM   2006 C CB  . GLU A 1 268 ? 62.236  10.914  15.115  1.00 56.95 ? 268  GLU A CB  1 
ATOM   2007 C CG  . GLU A 1 268 ? 63.620  10.771  15.708  1.00 58.92 ? 268  GLU A CG  1 
ATOM   2008 C CD  . GLU A 1 268 ? 64.706  10.733  14.625  1.00 59.99 ? 268  GLU A CD  1 
ATOM   2009 O OE1 . GLU A 1 268 ? 64.992  11.795  14.000  1.00 61.99 ? 268  GLU A OE1 1 
ATOM   2010 O OE2 . GLU A 1 268 ? 65.264  9.626   14.396  1.00 63.73 ? 268  GLU A OE2 1 
ATOM   2011 N N   . LEU A 1 269 ? 59.198  11.410  14.726  1.00 54.23 ? 269  LEU A N   1 
ATOM   2012 C CA  . LEU A 1 269 ? 58.107  12.243  14.260  1.00 52.86 ? 269  LEU A CA  1 
ATOM   2013 C C   . LEU A 1 269 ? 57.143  12.508  15.410  1.00 51.75 ? 269  LEU A C   1 
ATOM   2014 O O   . LEU A 1 269 ? 56.829  13.661  15.716  1.00 51.34 ? 269  LEU A O   1 
ATOM   2015 C CB  . LEU A 1 269 ? 57.389  11.538  13.116  1.00 53.13 ? 269  LEU A CB  1 
ATOM   2016 C CG  . LEU A 1 269 ? 56.712  12.411  12.070  1.00 53.91 ? 269  LEU A CG  1 
ATOM   2017 C CD1 . LEU A 1 269 ? 57.773  13.010  11.157  1.00 56.48 ? 269  LEU A CD1 1 
ATOM   2018 C CD2 . LEU A 1 269 ? 55.759  11.574  11.261  1.00 53.75 ? 269  LEU A CD2 1 
ATOM   2019 N N   . ILE A 1 270 ? 56.717  11.431  16.069  1.00 50.24 ? 270  ILE A N   1 
ATOM   2020 C CA  . ILE A 1 270 ? 55.723  11.520  17.113  1.00 49.13 ? 270  ILE A CA  1 
ATOM   2021 C C   . ILE A 1 270 ? 56.274  12.240  18.325  1.00 48.66 ? 270  ILE A C   1 
ATOM   2022 O O   . ILE A 1 270 ? 55.566  13.032  18.959  1.00 48.26 ? 270  ILE A O   1 
ATOM   2023 C CB  . ILE A 1 270 ? 55.164  10.144  17.464  1.00 49.04 ? 270  ILE A CB  1 
ATOM   2024 C CG1 . ILE A 1 270 ? 54.414  9.600   16.253  1.00 49.75 ? 270  ILE A CG1 1 
ATOM   2025 C CG2 . ILE A 1 270 ? 54.208  10.245  18.634  1.00 48.16 ? 270  ILE A CG2 1 
ATOM   2026 C CD1 . ILE A 1 270 ? 54.459  8.092   16.110  1.00 52.04 ? 270  ILE A CD1 1 
ATOM   2027 N N   . ALA A 1 271 ? 57.545  11.991  18.620  1.00 48.16 ? 271  ALA A N   1 
ATOM   2028 C CA  . ALA A 1 271 ? 58.219  12.662  19.722  1.00 48.40 ? 271  ALA A CA  1 
ATOM   2029 C C   . ALA A 1 271 ? 58.324  14.160  19.468  1.00 48.44 ? 271  ALA A C   1 
ATOM   2030 O O   . ALA A 1 271 ? 58.210  14.954  20.398  1.00 48.77 ? 271  ALA A O   1 
ATOM   2031 C CB  . ALA A 1 271 ? 59.599  12.051  19.979  1.00 48.13 ? 271  ALA A CB  1 
ATOM   2032 N N   . CYS A 1 272 ? 58.538  14.545  18.214  1.00 49.14 ? 272  CYS A N   1 
ATOM   2033 C CA  . CYS A 1 272 ? 58.579  15.959  17.856  1.00 48.78 ? 272  CYS A CA  1 
ATOM   2034 C C   . CYS A 1 272 ? 57.177  16.554  17.979  1.00 47.97 ? 272  CYS A C   1 
ATOM   2035 O O   . CYS A 1 272 ? 57.002  17.594  18.628  1.00 48.15 ? 272  CYS A O   1 
ATOM   2036 C CB  . CYS A 1 272 ? 59.170  16.166  16.450  1.00 49.02 ? 272  CYS A CB  1 
ATOM   2037 S SG  . CYS A 1 272 ? 59.158  17.907  15.881  1.00 52.13 ? 272  CYS A SG  1 
ATOM   2038 N N   . LEU A 1 273 ? 56.183  15.885  17.390  1.00 46.94 ? 273  LEU A N   1 
ATOM   2039 C CA  . LEU A 1 273 ? 54.777  16.304  17.531  1.00 46.45 ? 273  LEU A CA  1 
ATOM   2040 C C   . LEU A 1 273 ? 54.369  16.482  18.998  1.00 46.53 ? 273  LEU A C   1 
ATOM   2041 O O   . LEU A 1 273 ? 53.592  17.384  19.315  1.00 46.51 ? 273  LEU A O   1 
ATOM   2042 C CB  . LEU A 1 273 ? 53.811  15.343  16.819  1.00 46.05 ? 273  LEU A CB  1 
ATOM   2043 C CG  . LEU A 1 273 ? 53.674  15.467  15.298  1.00 45.31 ? 273  LEU A CG  1 
ATOM   2044 C CD1 . LEU A 1 273 ? 52.885  14.322  14.685  1.00 43.69 ? 273  LEU A CD1 1 
ATOM   2045 C CD2 . LEU A 1 273 ? 53.052  16.792  14.917  1.00 45.10 ? 273  LEU A CD2 1 
ATOM   2046 N N   . ARG A 1 274 ? 54.911  15.645  19.889  1.00 46.17 ? 274  ARG A N   1 
ATOM   2047 C CA  . ARG A 1 274 ? 54.612  15.757  21.320  1.00 45.88 ? 274  ARG A CA  1 
ATOM   2048 C C   . ARG A 1 274 ? 55.158  17.012  21.967  1.00 45.47 ? 274  ARG A C   1 
ATOM   2049 O O   . ARG A 1 274 ? 54.666  17.431  23.019  1.00 45.48 ? 274  ARG A O   1 
ATOM   2050 C CB  . ARG A 1 274 ? 55.119  14.550  22.084  1.00 46.07 ? 274  ARG A CB  1 
ATOM   2051 C CG  . ARG A 1 274 ? 54.110  13.463  22.204  1.00 48.12 ? 274  ARG A CG  1 
ATOM   2052 C CD  . ARG A 1 274 ? 54.741  12.110  22.514  1.00 53.57 ? 274  ARG A CD  1 
ATOM   2053 N NE  . ARG A 1 274 ? 53.764  11.113  22.093  1.00 59.65 ? 274  ARG A NE  1 
ATOM   2054 C CZ  . ARG A 1 274 ? 53.858  9.798   22.251  1.00 60.97 ? 274  ARG A CZ  1 
ATOM   2055 N NH1 . ARG A 1 274 ? 54.916  9.263   22.848  1.00 63.28 ? 274  ARG A NH1 1 
ATOM   2056 N NH2 . ARG A 1 274 ? 52.869  9.025   21.807  1.00 59.89 ? 274  ARG A NH2 1 
ATOM   2057 N N   . THR A 1 275 ? 56.172  17.617  21.360  1.00 44.52 ? 275  THR A N   1 
ATOM   2058 C CA  . THR A 1 275 ? 56.736  18.832  21.940  1.00 44.06 ? 275  THR A CA  1 
ATOM   2059 C C   . THR A 1 275 ? 55.958  20.063  21.469  1.00 43.64 ? 275  THR A C   1 
ATOM   2060 O O   . THR A 1 275 ? 56.096  21.136  22.036  1.00 43.60 ? 275  THR A O   1 
ATOM   2061 C CB  . THR A 1 275 ? 58.248  18.998  21.609  1.00 44.17 ? 275  THR A CB  1 
ATOM   2062 O OG1 . THR A 1 275 ? 58.404  19.308  20.223  1.00 42.94 ? 275  THR A OG1 1 
ATOM   2063 C CG2 . THR A 1 275 ? 59.025  17.728  21.926  1.00 43.74 ? 275  THR A CG2 1 
ATOM   2064 N N   . ARG A 1 276 ? 55.152  19.901  20.423  1.00 43.44 ? 276  ARG A N   1 
ATOM   2065 C CA  . ARG A 1 276 ? 54.364  21.002  19.876  1.00 43.13 ? 276  ARG A CA  1 
ATOM   2066 C C   . ARG A 1 276 ? 53.196  21.358  20.780  1.00 42.66 ? 276  ARG A C   1 
ATOM   2067 O O   . ARG A 1 276 ? 52.564  20.474  21.370  1.00 42.32 ? 276  ARG A O   1 
ATOM   2068 C CB  . ARG A 1 276 ? 53.856  20.667  18.480  1.00 43.60 ? 276  ARG A CB  1 
ATOM   2069 C CG  . ARG A 1 276 ? 54.955  20.496  17.453  1.00 45.45 ? 276  ARG A CG  1 
ATOM   2070 C CD  . ARG A 1 276 ? 55.710  21.801  17.222  1.00 50.74 ? 276  ARG A CD  1 
ATOM   2071 N NE  . ARG A 1 276 ? 56.894  21.587  16.392  1.00 54.60 ? 276  ARG A NE  1 
ATOM   2072 C CZ  . ARG A 1 276 ? 58.130  21.437  16.870  1.00 57.53 ? 276  ARG A CZ  1 
ATOM   2073 N NH1 . ARG A 1 276 ? 58.355  21.491  18.188  1.00 56.94 ? 276  ARG A NH1 1 
ATOM   2074 N NH2 . ARG A 1 276 ? 59.145  21.237  16.028  1.00 56.56 ? 276  ARG A NH2 1 
ATOM   2075 N N   . PRO A 1 277 ? 52.919  22.666  20.914  1.00 42.13 ? 277  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 277 ? 51.787  23.055  21.740  1.00 41.50 ? 277  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 277 ? 50.509  22.612  21.049  1.00 41.13 ? 277  PRO A C   1 
ATOM   2078 O O   . PRO A 1 277 ? 50.493  22.491  19.818  1.00 41.04 ? 277  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 277 ? 51.882  24.584  21.782  1.00 41.54 ? 277  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 277 ? 53.278  24.914  21.281  1.00 41.78 ? 277  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 277 ? 53.616  23.829  20.328  1.00 41.52 ? 277  PRO A CD  1 
ATOM   2082 N N   . ALA A 1 278 ? 49.458  22.369  21.828  1.00 40.43 ? 278  ALA A N   1 
ATOM   2083 C CA  . ALA A 1 278 ? 48.184  21.877  21.299  1.00 40.07 ? 278  ALA A CA  1 
ATOM   2084 C C   . ALA A 1 278 ? 47.630  22.783  20.202  1.00 40.00 ? 278  ALA A C   1 
ATOM   2085 O O   . ALA A 1 278 ? 47.169  22.299  19.163  1.00 39.87 ? 278  ALA A O   1 
ATOM   2086 C CB  . ALA A 1 278 ? 47.145  21.676  22.447  1.00 39.58 ? 278  ALA A CB  1 
ATOM   2087 N N   . GLN A 1 279 ? 47.721  24.095  20.415  1.00 40.57 ? 279  GLN A N   1 
ATOM   2088 C CA  . GLN A 1 279 ? 47.139  25.072  19.487  1.00 40.90 ? 279  GLN A CA  1 
ATOM   2089 C C   . GLN A 1 279 ? 47.797  25.032  18.116  1.00 41.50 ? 279  GLN A C   1 
ATOM   2090 O O   . GLN A 1 279 ? 47.119  25.185  17.088  1.00 41.99 ? 279  GLN A O   1 
ATOM   2091 C CB  . GLN A 1 279 ? 47.147  26.480  20.084  1.00 40.68 ? 279  GLN A CB  1 
ATOM   2092 C CG  . GLN A 1 279 ? 46.221  27.469  19.371  1.00 41.65 ? 279  GLN A CG  1 
ATOM   2093 C CD  . GLN A 1 279 ? 44.729  27.116  19.470  1.00 41.11 ? 279  GLN A CD  1 
ATOM   2094 O OE1 . GLN A 1 279 ? 44.176  26.934  20.565  1.00 40.13 ? 279  GLN A OE1 1 
ATOM   2095 N NE2 . GLN A 1 279 ? 44.076  27.046  18.322  1.00 38.48 ? 279  GLN A NE2 1 
ATOM   2096 N N   . ASP A 1 280 ? 49.107  24.797  18.093  1.00 42.12 ? 280  ASP A N   1 
ATOM   2097 C CA  . ASP A 1 280 ? 49.837  24.625  16.836  1.00 42.72 ? 280  ASP A CA  1 
ATOM   2098 C C   . ASP A 1 280 ? 49.186  23.552  15.964  1.00 42.03 ? 280  ASP A C   1 
ATOM   2099 O O   . ASP A 1 280 ? 49.083  23.714  14.745  1.00 42.32 ? 280  ASP A O   1 
ATOM   2100 C CB  . ASP A 1 280 ? 51.279  24.178  17.107  1.00 43.49 ? 280  ASP A CB  1 
ATOM   2101 C CG  . ASP A 1 280 ? 52.254  25.323  17.224  1.00 47.00 ? 280  ASP A CG  1 
ATOM   2102 O OD1 . ASP A 1 280 ? 51.952  26.359  17.879  1.00 49.91 ? 280  ASP A OD1 1 
ATOM   2103 O OD2 . ASP A 1 280 ? 53.375  25.142  16.689  1.00 52.14 ? 280  ASP A OD2 1 
ATOM   2104 N N   . LEU A 1 281 ? 48.774  22.451  16.587  1.00 41.30 ? 281  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 281 ? 48.237  21.327  15.837  1.00 41.28 ? 281  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 281 ? 46.865  21.716  15.316  1.00 41.34 ? 281  LEU A C   1 
ATOM   2107 O O   . LEU A 1 281 ? 46.558  21.530  14.143  1.00 41.64 ? 281  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 281 ? 48.191  20.030  16.679  1.00 41.14 ? 281  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 281 ? 49.470  19.495  17.355  1.00 40.26 ? 281  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 281 ? 49.318  18.023  17.622  1.00 39.51 ? 281  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 281 ? 50.756  19.731  16.512  1.00 40.38 ? 281  LEU A CD2 1 
ATOM   2112 N N   . VAL A 1 282 ? 46.055  22.307  16.180  1.00 41.46 ? 282  VAL A N   1 
ATOM   2113 C CA  . VAL A 1 282 ? 44.749  22.761  15.757  1.00 41.63 ? 282  VAL A CA  1 
ATOM   2114 C C   . VAL A 1 282 ? 44.860  23.779  14.595  1.00 42.05 ? 282  VAL A C   1 
ATOM   2115 O O   . VAL A 1 282 ? 44.117  23.665  13.614  1.00 41.21 ? 282  VAL A O   1 
ATOM   2116 C CB  . VAL A 1 282 ? 43.914  23.275  16.960  1.00 42.11 ? 282  VAL A CB  1 
ATOM   2117 C CG1 . VAL A 1 282 ? 42.629  23.960  16.494  1.00 40.55 ? 282  VAL A CG1 1 
ATOM   2118 C CG2 . VAL A 1 282 ? 43.598  22.094  17.899  1.00 41.10 ? 282  VAL A CG2 1 
ATOM   2119 N N   . ASP A 1 283 ? 45.810  24.722  14.693  1.00 41.98 ? 283  ASP A N   1 
ATOM   2120 C CA  . ASP A 1 283 ? 46.059  25.710  13.626  1.00 42.23 ? 283  ASP A CA  1 
ATOM   2121 C C   . ASP A 1 283 ? 46.309  25.099  12.244  1.00 42.13 ? 283  ASP A C   1 
ATOM   2122 O O   . ASP A 1 283 ? 46.063  25.751  11.245  1.00 42.51 ? 283  ASP A O   1 
ATOM   2123 C CB  . ASP A 1 283 ? 47.237  26.650  13.961  1.00 42.47 ? 283  ASP A CB  1 
ATOM   2124 C CG  . ASP A 1 283 ? 46.931  27.627  15.105  1.00 43.62 ? 283  ASP A CG  1 
ATOM   2125 O OD1 . ASP A 1 283 ? 45.755  27.956  15.362  1.00 41.13 ? 283  ASP A OD1 1 
ATOM   2126 O OD2 . ASP A 1 283 ? 47.901  28.080  15.756  1.00 47.56 ? 283  ASP A OD2 1 
ATOM   2127 N N   . HIS A 1 284 ? 46.800  23.864  12.173  1.00 42.01 ? 284  HIS A N   1 
ATOM   2128 C CA  . HIS A 1 284 ? 47.094  23.276  10.867  1.00 41.89 ? 284  HIS A CA  1 
ATOM   2129 C C   . HIS A 1 284 ? 46.261  22.071  10.498  1.00 41.72 ? 284  HIS A C   1 
ATOM   2130 O O   . HIS A 1 284 ? 46.442  21.522  9.409   1.00 41.05 ? 284  HIS A O   1 
ATOM   2131 C CB  . HIS A 1 284 ? 48.583  22.927  10.728  1.00 42.00 ? 284  HIS A CB  1 
ATOM   2132 C CG  . HIS A 1 284 ? 49.469  24.123  10.695  1.00 42.88 ? 284  HIS A CG  1 
ATOM   2133 N ND1 . HIS A 1 284 ? 49.986  24.691  11.840  1.00 43.42 ? 284  HIS A ND1 1 
ATOM   2134 C CD2 . HIS A 1 284 ? 49.901  24.886  9.663   1.00 43.74 ? 284  HIS A CD2 1 
ATOM   2135 C CE1 . HIS A 1 284 ? 50.715  25.742  11.511  1.00 44.68 ? 284  HIS A CE1 1 
ATOM   2136 N NE2 . HIS A 1 284 ? 50.673  25.886  10.198  1.00 44.14 ? 284  HIS A NE2 1 
ATOM   2137 N N   . GLU A 1 285 ? 45.347  21.655  11.369  1.00 42.06 ? 285  GLU A N   1 
ATOM   2138 C CA  . GLU A 1 285 ? 44.599  20.426  11.079  1.00 42.96 ? 285  GLU A CA  1 
ATOM   2139 C C   . GLU A 1 285 ? 43.759  20.471  9.806   1.00 42.78 ? 285  GLU A C   1 
ATOM   2140 O O   . GLU A 1 285 ? 43.546  19.438  9.197   1.00 42.97 ? 285  GLU A O   1 
ATOM   2141 C CB  . GLU A 1 285 ? 43.812  19.894  12.281  1.00 42.56 ? 285  GLU A CB  1 
ATOM   2142 C CG  . GLU A 1 285 ? 42.520  20.616  12.601  1.00 44.09 ? 285  GLU A CG  1 
ATOM   2143 C CD  . GLU A 1 285 ? 41.743  19.911  13.706  1.00 44.30 ? 285  GLU A CD  1 
ATOM   2144 O OE1 . GLU A 1 285 ? 41.453  18.690  13.567  1.00 46.04 ? 285  GLU A OE1 1 
ATOM   2145 O OE2 . GLU A 1 285 ? 41.428  20.576  14.714  1.00 45.43 ? 285  GLU A OE2 1 
ATOM   2146 N N   . TRP A 1 286 ? 43.328  21.656  9.379   1.00 43.43 ? 286  TRP A N   1 
ATOM   2147 C CA  . TRP A 1 286 ? 42.553  21.771  8.132   1.00 44.09 ? 286  TRP A CA  1 
ATOM   2148 C C   . TRP A 1 286 ? 43.388  21.801  6.853   1.00 44.52 ? 286  TRP A C   1 
ATOM   2149 O O   . TRP A 1 286 ? 42.859  21.634  5.756   1.00 45.11 ? 286  TRP A O   1 
ATOM   2150 C CB  . TRP A 1 286 ? 41.542  22.915  8.208   1.00 44.21 ? 286  TRP A CB  1 
ATOM   2151 C CG  . TRP A 1 286 ? 40.555  22.618  9.278   1.00 44.73 ? 286  TRP A CG  1 
ATOM   2152 C CD1 . TRP A 1 286 ? 40.543  23.111  10.560  1.00 44.75 ? 286  TRP A CD1 1 
ATOM   2153 C CD2 . TRP A 1 286 ? 39.481  21.685  9.199   1.00 44.99 ? 286  TRP A CD2 1 
ATOM   2154 N NE1 . TRP A 1 286 ? 39.505  22.562  11.267  1.00 44.85 ? 286  TRP A NE1 1 
ATOM   2155 C CE2 . TRP A 1 286 ? 38.832  21.688  10.456  1.00 44.72 ? 286  TRP A CE2 1 
ATOM   2156 C CE3 . TRP A 1 286 ? 38.987  20.862  8.178   1.00 44.64 ? 286  TRP A CE3 1 
ATOM   2157 C CZ2 . TRP A 1 286 ? 37.724  20.898  10.722  1.00 45.04 ? 286  TRP A CZ2 1 
ATOM   2158 C CZ3 . TRP A 1 286 ? 37.886  20.080  8.437   1.00 45.34 ? 286  TRP A CZ3 1 
ATOM   2159 C CH2 . TRP A 1 286 ? 37.266  20.096  9.709   1.00 45.77 ? 286  TRP A CH2 1 
ATOM   2160 N N   . HIS A 1 287 ? 44.696  21.973  6.997   1.00 45.06 ? 287  HIS A N   1 
ATOM   2161 C CA  . HIS A 1 287 ? 45.581  22.062  5.843   1.00 45.17 ? 287  HIS A CA  1 
ATOM   2162 C C   . HIS A 1 287 ? 45.986  20.717  5.241   1.00 44.46 ? 287  HIS A C   1 
ATOM   2163 O O   . HIS A 1 287 ? 46.821  20.691  4.349   1.00 44.97 ? 287  HIS A O   1 
ATOM   2164 C CB  . HIS A 1 287 ? 46.848  22.855  6.196   1.00 45.84 ? 287  HIS A CB  1 
ATOM   2165 C CG  . HIS A 1 287 ? 46.591  24.235  6.714   1.00 47.52 ? 287  HIS A CG  1 
ATOM   2166 N ND1 . HIS A 1 287 ? 45.516  25.001  6.310   1.00 50.71 ? 287  HIS A ND1 1 
ATOM   2167 C CD2 . HIS A 1 287 ? 47.294  25.001  7.580   1.00 50.28 ? 287  HIS A CD2 1 
ATOM   2168 C CE1 . HIS A 1 287 ? 45.555  26.171  6.923   1.00 51.56 ? 287  HIS A CE1 1 
ATOM   2169 N NE2 . HIS A 1 287 ? 46.626  26.198  7.700   1.00 51.47 ? 287  HIS A NE2 1 
ATOM   2170 N N   . VAL A 1 288 ? 45.408  19.608  5.703   1.00 43.78 ? 288  VAL A N   1 
ATOM   2171 C CA  . VAL A 1 288 ? 45.877  18.275  5.271   1.00 42.84 ? 288  VAL A CA  1 
ATOM   2172 C C   . VAL A 1 288 ? 44.935  17.502  4.353   1.00 43.02 ? 288  VAL A C   1 
ATOM   2173 O O   . VAL A 1 288 ? 45.280  16.416  3.882   1.00 43.21 ? 288  VAL A O   1 
ATOM   2174 C CB  . VAL A 1 288 ? 46.353  17.358  6.472   1.00 42.96 ? 288  VAL A CB  1 
ATOM   2175 C CG1 . VAL A 1 288 ? 47.281  18.127  7.450   1.00 40.34 ? 288  VAL A CG1 1 
ATOM   2176 C CG2 . VAL A 1 288 ? 45.172  16.691  7.196   1.00 41.97 ? 288  VAL A CG2 1 
ATOM   2177 N N   . LEU A 1 289 ? 43.758  18.053  4.081   1.00 43.16 ? 289  LEU A N   1 
ATOM   2178 C CA  . LEU A 1 289 ? 42.775  17.362  3.242   1.00 43.11 ? 289  LEU A CA  1 
ATOM   2179 C C   . LEU A 1 289 ? 43.187  17.349  1.780   1.00 43.52 ? 289  LEU A C   1 
ATOM   2180 O O   . LEU A 1 289 ? 43.688  18.351  1.279   1.00 43.06 ? 289  LEU A O   1 
ATOM   2181 C CB  . LEU A 1 289 ? 41.384  17.980  3.397   1.00 42.83 ? 289  LEU A CB  1 
ATOM   2182 C CG  . LEU A 1 289 ? 40.609  17.663  4.683   1.00 42.67 ? 289  LEU A CG  1 
ATOM   2183 C CD1 . LEU A 1 289 ? 39.409  18.611  4.799   1.00 42.31 ? 289  LEU A CD1 1 
ATOM   2184 C CD2 . LEU A 1 289 ? 40.174  16.184  4.772   1.00 40.05 ? 289  LEU A CD2 1 
ATOM   2185 N N   . PRO A 1 290 ? 42.969  16.213  1.087   1.00 44.31 ? 290  PRO A N   1 
ATOM   2186 C CA  . PRO A 1 290 ? 43.446  16.044  -0.293  1.00 45.15 ? 290  PRO A CA  1 
ATOM   2187 C C   . PRO A 1 290 ? 42.780  16.948  -1.338  1.00 46.34 ? 290  PRO A C   1 
ATOM   2188 O O   . PRO A 1 290 ? 43.409  17.261  -2.367  1.00 46.74 ? 290  PRO A O   1 
ATOM   2189 C CB  . PRO A 1 290 ? 43.168  14.566  -0.590  1.00 45.61 ? 290  PRO A CB  1 
ATOM   2190 C CG  . PRO A 1 290 ? 42.094  14.149  0.393   1.00 44.61 ? 290  PRO A CG  1 
ATOM   2191 C CD  . PRO A 1 290 ? 42.258  15.020  1.592   1.00 44.12 ? 290  PRO A CD  1 
ATOM   2192 N N   . GLN A 1 291 ? 41.529  17.351  -1.095  1.00 46.90 ? 291  GLN A N   1 
ATOM   2193 C CA  . GLN A 1 291 ? 40.840  18.313  -1.968  1.00 47.63 ? 291  GLN A CA  1 
ATOM   2194 C C   . GLN A 1 291 ? 40.032  19.344  -1.184  1.00 47.66 ? 291  GLN A C   1 
ATOM   2195 O O   . GLN A 1 291 ? 39.736  19.162  0.000   1.00 47.70 ? 291  GLN A O   1 
ATOM   2196 C CB  . GLN A 1 291 ? 39.879  17.629  -2.953  1.00 47.76 ? 291  GLN A CB  1 
ATOM   2197 C CG  . GLN A 1 291 ? 40.421  16.458  -3.735  1.00 49.75 ? 291  GLN A CG  1 
ATOM   2198 C CD  . GLN A 1 291 ? 40.314  15.158  -2.972  1.00 52.61 ? 291  GLN A CD  1 
ATOM   2199 O OE1 . GLN A 1 291 ? 40.858  14.129  -3.395  1.00 51.79 ? 291  GLN A OE1 1 
ATOM   2200 N NE2 . GLN A 1 291 ? 39.607  15.191  -1.829  1.00 53.75 ? 291  GLN A NE2 1 
ATOM   2201 N N   . GLU A 1 292 ? 39.688  20.429  -1.875  1.00 47.56 ? 292  GLU A N   1 
ATOM   2202 C CA  . GLU A 1 292 ? 38.691  21.372  -1.422  1.00 47.80 ? 292  GLU A CA  1 
ATOM   2203 C C   . GLU A 1 292 ? 37.398  20.576  -1.185  1.00 46.13 ? 292  GLU A C   1 
ATOM   2204 O O   . GLU A 1 292 ? 36.894  19.897  -2.094  1.00 45.71 ? 292  GLU A O   1 
ATOM   2205 C CB  . GLU A 1 292 ? 38.473  22.434  -2.499  1.00 47.86 ? 292  GLU A CB  1 
ATOM   2206 C CG  . GLU A 1 292 ? 37.953  23.765  -1.943  1.00 50.95 ? 292  GLU A CG  1 
ATOM   2207 C CD  . GLU A 1 292 ? 37.289  24.656  -3.002  1.00 50.79 ? 292  GLU A CD  1 
ATOM   2208 O OE1 . GLU A 1 292 ? 37.406  24.364  -4.220  1.00 53.66 ? 292  GLU A OE1 1 
ATOM   2209 O OE2 . GLU A 1 292 ? 36.639  25.653  -2.598  1.00 54.44 ? 292  GLU A OE2 1 
ATOM   2210 N N   . SER A 1 293 ? 36.882  20.622  0.036   1.00 44.20 ? 293  SER A N   1 
ATOM   2211 C CA  . SER A 1 293 ? 35.693  19.837  0.322   1.00 43.09 ? 293  SER A CA  1 
ATOM   2212 C C   . SER A 1 293 ? 34.844  20.371  1.452   1.00 41.69 ? 293  SER A C   1 
ATOM   2213 O O   . SER A 1 293 ? 35.231  21.295  2.157   1.00 41.36 ? 293  SER A O   1 
ATOM   2214 C CB  . SER A 1 293 ? 36.060  18.378  0.597   1.00 43.07 ? 293  SER A CB  1 
ATOM   2215 O OG  . SER A 1 293 ? 36.943  18.293  1.680   1.00 43.76 ? 293  SER A OG  1 
ATOM   2216 N N   . ILE A 1 294 ? 33.655  19.797  1.564   1.00 40.25 ? 294  ILE A N   1 
ATOM   2217 C CA  . ILE A 1 294 ? 32.807  19.968  2.724   1.00 38.42 ? 294  ILE A CA  1 
ATOM   2218 C C   . ILE A 1 294 ? 32.440  18.568  3.184   1.00 37.57 ? 294  ILE A C   1 
ATOM   2219 O O   . ILE A 1 294 ? 32.552  17.614  2.415   1.00 37.00 ? 294  ILE A O   1 
ATOM   2220 C CB  . ILE A 1 294 ? 31.548  20.793  2.409   1.00 38.66 ? 294  ILE A CB  1 
ATOM   2221 C CG1 . ILE A 1 294 ? 30.837  20.242  1.162   1.00 38.04 ? 294  ILE A CG1 1 
ATOM   2222 C CG2 . ILE A 1 294 ? 31.910  22.289  2.281   1.00 36.70 ? 294  ILE A CG2 1 
ATOM   2223 C CD1 . ILE A 1 294 ? 29.424  20.737  1.022   1.00 37.97 ? 294  ILE A CD1 1 
ATOM   2224 N N   . PHE A 1 295 ? 32.057  18.450  4.452   1.00 36.81 ? 295  PHE A N   1 
ATOM   2225 C CA  . PHE A 1 295 ? 31.718  17.173  5.063   1.00 36.27 ? 295  PHE A CA  1 
ATOM   2226 C C   . PHE A 1 295 ? 32.887  16.194  4.960   1.00 35.81 ? 295  PHE A C   1 
ATOM   2227 O O   . PHE A 1 295 ? 32.683  14.985  4.790   1.00 35.77 ? 295  PHE A O   1 
ATOM   2228 C CB  . PHE A 1 295 ? 30.453  16.574  4.439   1.00 35.86 ? 295  PHE A CB  1 
ATOM   2229 C CG  . PHE A 1 295 ? 29.559  15.895  5.432   1.00 37.33 ? 295  PHE A CG  1 
ATOM   2230 C CD1 . PHE A 1 295 ? 30.081  14.987  6.372   1.00 36.99 ? 295  PHE A CD1 1 
ATOM   2231 C CD2 . PHE A 1 295 ? 28.185  16.157  5.443   1.00 36.88 ? 295  PHE A CD2 1 
ATOM   2232 C CE1 . PHE A 1 295 ? 29.257  14.378  7.298   1.00 35.57 ? 295  PHE A CE1 1 
ATOM   2233 C CE2 . PHE A 1 295 ? 27.345  15.534  6.369   1.00 35.85 ? 295  PHE A CE2 1 
ATOM   2234 C CZ  . PHE A 1 295 ? 27.870  14.651  7.290   1.00 36.16 ? 295  PHE A CZ  1 
ATOM   2235 N N   . ARG A 1 296 ? 34.103  16.735  5.035   1.00 34.80 ? 296  ARG A N   1 
ATOM   2236 C CA  . ARG A 1 296 ? 35.311  15.936  5.214   1.00 34.69 ? 296  ARG A CA  1 
ATOM   2237 C C   . ARG A 1 296 ? 36.108  16.467  6.387   1.00 34.86 ? 296  ARG A C   1 
ATOM   2238 O O   . ARG A 1 296 ? 36.244  17.684  6.589   1.00 34.96 ? 296  ARG A O   1 
ATOM   2239 C CB  . ARG A 1 296 ? 36.202  15.925  3.973   1.00 34.48 ? 296  ARG A CB  1 
ATOM   2240 C CG  . ARG A 1 296 ? 35.590  15.293  2.755   1.00 33.45 ? 296  ARG A CG  1 
ATOM   2241 C CD  . ARG A 1 296 ? 35.413  13.798  2.909   1.00 32.19 ? 296  ARG A CD  1 
ATOM   2242 N NE  . ARG A 1 296 ? 34.815  13.211  1.709   1.00 33.17 ? 296  ARG A NE  1 
ATOM   2243 C CZ  . ARG A 1 296 ? 33.503  13.107  1.483   1.00 31.47 ? 296  ARG A CZ  1 
ATOM   2244 N NH1 . ARG A 1 296 ? 32.612  13.550  2.374   1.00 31.36 ? 296  ARG A NH1 1 
ATOM   2245 N NH2 . ARG A 1 296 ? 33.084  12.548  0.366   1.00 30.07 ? 296  ARG A NH2 1 
ATOM   2246 N N   . PHE A 1 297 ? 36.659  15.539  7.156   1.00 34.67 ? 297  PHE A N   1 
ATOM   2247 C CA  . PHE A 1 297 ? 37.373  15.901  8.355   1.00 34.16 ? 297  PHE A CA  1 
ATOM   2248 C C   . PHE A 1 297 ? 38.737  15.211  8.356   1.00 34.01 ? 297  PHE A C   1 
ATOM   2249 O O   . PHE A 1 297 ? 38.868  14.093  7.886   1.00 33.84 ? 297  PHE A O   1 
ATOM   2250 C CB  . PHE A 1 297 ? 36.509  15.563  9.566   1.00 34.22 ? 297  PHE A CB  1 
ATOM   2251 C CG  . PHE A 1 297 ? 35.034  15.791  9.333   1.00 34.53 ? 297  PHE A CG  1 
ATOM   2252 C CD1 . PHE A 1 297 ? 34.491  17.077  9.395   1.00 33.03 ? 297  PHE A CD1 1 
ATOM   2253 C CD2 . PHE A 1 297 ? 34.188  14.724  9.045   1.00 34.31 ? 297  PHE A CD2 1 
ATOM   2254 C CE1 . PHE A 1 297 ? 33.131  17.287  9.188   1.00 33.08 ? 297  PHE A CE1 1 
ATOM   2255 C CE2 . PHE A 1 297 ? 32.818  14.931  8.834   1.00 32.63 ? 297  PHE A CE2 1 
ATOM   2256 C CZ  . PHE A 1 297 ? 32.293  16.217  8.908   1.00 32.68 ? 297  PHE A CZ  1 
ATOM   2257 N N   . SER A 1 298 ? 39.749  15.916  8.854   1.00 34.62 ? 298  SER A N   1 
ATOM   2258 C CA  . SER A 1 298 ? 41.154  15.556  8.674   1.00 34.95 ? 298  SER A CA  1 
ATOM   2259 C C   . SER A 1 298 ? 41.561  14.292  9.410   1.00 34.99 ? 298  SER A C   1 
ATOM   2260 O O   . SER A 1 298 ? 42.203  13.403  8.842   1.00 34.84 ? 298  SER A O   1 
ATOM   2261 C CB  . SER A 1 298 ? 42.029  16.699  9.157   1.00 35.03 ? 298  SER A CB  1 
ATOM   2262 O OG  . SER A 1 298 ? 42.061  17.706  8.173   1.00 36.68 ? 298  SER A OG  1 
ATOM   2263 N N   . PHE A 1 299 ? 41.169  14.224  10.676  1.00 34.81 ? 299  PHE A N   1 
ATOM   2264 C CA  . PHE A 1 299 ? 41.571  13.141  11.536  1.00 34.10 ? 299  PHE A CA  1 
ATOM   2265 C C   . PHE A 1 299 ? 40.394  12.408  12.088  1.00 33.41 ? 299  PHE A C   1 
ATOM   2266 O O   . PHE A 1 299 ? 39.714  12.906  12.963  1.00 34.50 ? 299  PHE A O   1 
ATOM   2267 C CB  . PHE A 1 299 ? 42.484  13.685  12.620  1.00 33.81 ? 299  PHE A CB  1 
ATOM   2268 C CG  . PHE A 1 299 ? 43.738  14.225  12.066  1.00 34.21 ? 299  PHE A CG  1 
ATOM   2269 C CD1 . PHE A 1 299 ? 44.742  13.369  11.667  1.00 33.49 ? 299  PHE A CD1 1 
ATOM   2270 C CD2 . PHE A 1 299 ? 43.894  15.591  11.859  1.00 34.51 ? 299  PHE A CD2 1 
ATOM   2271 C CE1 . PHE A 1 299 ? 45.920  13.860  11.100  1.00 34.65 ? 299  PHE A CE1 1 
ATOM   2272 C CE2 . PHE A 1 299 ? 45.069  16.089  11.291  1.00 36.32 ? 299  PHE A CE2 1 
ATOM   2273 C CZ  . PHE A 1 299 ? 46.089  15.221  10.926  1.00 34.27 ? 299  PHE A CZ  1 
ATOM   2274 N N   . VAL A 1 300 ? 40.158  11.221  11.551  1.00 33.08 ? 300  VAL A N   1 
ATOM   2275 C CA  . VAL A 1 300 ? 38.975  10.416  11.878  1.00 32.66 ? 300  VAL A CA  1 
ATOM   2276 C C   . VAL A 1 300 ? 39.370  8.941   12.140  1.00 33.49 ? 300  VAL A C   1 
ATOM   2277 O O   . VAL A 1 300 ? 40.525  8.563   11.979  1.00 33.44 ? 300  VAL A O   1 
ATOM   2278 C CB  . VAL A 1 300 ? 37.879  10.558  10.772  1.00 32.07 ? 300  VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 300 ? 37.555  12.041  10.515  1.00 31.71 ? 300  VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 300 ? 38.301  9.932   9.485   1.00 31.23 ? 300  VAL A CG2 1 
ATOM   2281 N N   . PRO A 1 301 ? 38.420  8.104   12.586  1.00 34.38 ? 301  PRO A N   1 
ATOM   2282 C CA  . PRO A 1 301 ? 38.775  6.700   12.715  1.00 34.35 ? 301  PRO A CA  1 
ATOM   2283 C C   . PRO A 1 301 ? 39.478  6.105   11.488  1.00 35.30 ? 301  PRO A C   1 
ATOM   2284 O O   . PRO A 1 301 ? 39.100  6.369   10.334  1.00 34.71 ? 301  PRO A O   1 
ATOM   2285 C CB  . PRO A 1 301 ? 37.431  6.045   12.971  1.00 33.91 ? 301  PRO A CB  1 
ATOM   2286 C CG  . PRO A 1 301 ? 36.740  7.095   13.827  1.00 33.83 ? 301  PRO A CG  1 
ATOM   2287 C CD  . PRO A 1 301 ? 37.036  8.346   13.046  1.00 33.94 ? 301  PRO A CD  1 
ATOM   2288 N N   . VAL A 1 302 ? 40.517  5.324   11.769  1.00 35.90 ? 302  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 302 ? 41.313  4.686   10.733  1.00 37.15 ? 302  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 302 ? 41.055  3.160   10.716  1.00 38.30 ? 302  VAL A C   1 
ATOM   2291 O O   . VAL A 1 302 ? 40.871  2.542   11.772  1.00 38.60 ? 302  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 302 ? 42.848  5.027   10.908  1.00 36.83 ? 302  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 302 ? 43.387  4.560   12.264  1.00 34.69 ? 302  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 302 ? 43.660  4.433   9.792   1.00 37.33 ? 302  VAL A CG2 1 
ATOM   2295 N N   . VAL A 1 303 ? 41.017  2.575   9.519   1.00 39.28 ? 303  VAL A N   1 
ATOM   2296 C CA  . VAL A 1 303 ? 40.942  1.124   9.350   1.00 40.09 ? 303  VAL A CA  1 
ATOM   2297 C C   . VAL A 1 303 ? 42.343  0.557   9.640   1.00 40.81 ? 303  VAL A C   1 
ATOM   2298 O O   . VAL A 1 303 ? 43.190  0.442   8.753   1.00 40.42 ? 303  VAL A O   1 
ATOM   2299 C CB  . VAL A 1 303 ? 40.473  0.744   7.929   1.00 40.03 ? 303  VAL A CB  1 
ATOM   2300 C CG1 . VAL A 1 303 ? 40.340  -0.765  7.788   1.00 41.04 ? 303  VAL A CG1 1 
ATOM   2301 C CG2 . VAL A 1 303 ? 39.137  1.393   7.609   1.00 40.24 ? 303  VAL A CG2 1 
ATOM   2302 N N   . ASP A 1 304 ? 42.573  0.250   10.912  1.00 41.44 ? 304  ASP A N   1 
ATOM   2303 C CA  . ASP A 1 304 ? 43.865  -0.200  11.395  1.00 42.27 ? 304  ASP A CA  1 
ATOM   2304 C C   . ASP A 1 304 ? 44.054  -1.723  11.339  1.00 42.73 ? 304  ASP A C   1 
ATOM   2305 O O   . ASP A 1 304 ? 45.162  -2.200  11.484  1.00 43.10 ? 304  ASP A O   1 
ATOM   2306 C CB  . ASP A 1 304 ? 44.113  0.313   12.826  1.00 41.62 ? 304  ASP A CB  1 
ATOM   2307 C CG  . ASP A 1 304 ? 43.002  -0.083  13.816  1.00 41.79 ? 304  ASP A CG  1 
ATOM   2308 O OD1 . ASP A 1 304 ? 41.906  -0.536  13.386  1.00 41.06 ? 304  ASP A OD1 1 
ATOM   2309 O OD2 . ASP A 1 304 ? 43.232  0.075   15.046  1.00 40.22 ? 304  ASP A OD2 1 
ATOM   2310 N N   . GLY A 1 305 ? 42.976  -2.472  11.136  1.00 43.38 ? 305  GLY A N   1 
ATOM   2311 C CA  . GLY A 1 305 ? 43.023  -3.940  11.258  1.00 43.90 ? 305  GLY A CA  1 
ATOM   2312 C C   . GLY A 1 305 ? 43.104  -4.416  12.708  1.00 44.31 ? 305  GLY A C   1 
ATOM   2313 O O   . GLY A 1 305 ? 43.541  -5.542  12.960  1.00 44.43 ? 305  GLY A O   1 
ATOM   2314 N N   . ASP A 1 306 ? 42.702  -3.550  13.652  1.00 44.25 ? 306  ASP A N   1 
ATOM   2315 C CA  . ASP A 1 306 ? 42.713  -3.828  15.099  1.00 44.29 ? 306  ASP A CA  1 
ATOM   2316 C C   . ASP A 1 306 ? 41.344  -3.444  15.688  1.00 44.09 ? 306  ASP A C   1 
ATOM   2317 O O   . ASP A 1 306 ? 40.455  -4.305  15.784  1.00 44.44 ? 306  ASP A O   1 
ATOM   2318 C CB  . ASP A 1 306 ? 43.883  -3.107  15.798  1.00 44.24 ? 306  ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 306 ? 43.986  -3.421  17.311  1.00 46.99 ? 306  ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 306 ? 43.271  -4.325  17.828  1.00 48.32 ? 306  ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 306 ? 44.801  -2.747  17.998  1.00 47.96 ? 306  ASP A OD2 1 
ATOM   2322 N N   . PHE A 1 307 ? 41.157  -2.174  16.071  1.00 43.46 ? 307  PHE A N   1 
ATOM   2323 C CA  . PHE A 1 307 ? 39.818  -1.696  16.449  1.00 42.52 ? 307  PHE A CA  1 
ATOM   2324 C C   . PHE A 1 307 ? 38.847  -2.003  15.330  1.00 42.75 ? 307  PHE A C   1 
ATOM   2325 O O   . PHE A 1 307 ? 37.760  -2.533  15.571  1.00 43.10 ? 307  PHE A O   1 
ATOM   2326 C CB  . PHE A 1 307 ? 39.783  -0.190  16.765  1.00 41.81 ? 307  PHE A CB  1 
ATOM   2327 C CG  . PHE A 1 307 ? 38.501  0.255   17.450  1.00 40.02 ? 307  PHE A CG  1 
ATOM   2328 C CD1 . PHE A 1 307 ? 37.319  0.383   16.736  1.00 36.66 ? 307  PHE A CD1 1 
ATOM   2329 C CD2 . PHE A 1 307 ? 38.485  0.530   18.815  1.00 38.66 ? 307  PHE A CD2 1 
ATOM   2330 C CE1 . PHE A 1 307 ? 36.157  0.767   17.365  1.00 35.04 ? 307  PHE A CE1 1 
ATOM   2331 C CE2 . PHE A 1 307 ? 37.319  0.929   19.451  1.00 36.62 ? 307  PHE A CE2 1 
ATOM   2332 C CZ  . PHE A 1 307 ? 36.153  1.046   18.728  1.00 36.27 ? 307  PHE A CZ  1 
ATOM   2333 N N   . LEU A 1 308 ? 39.244  -1.665  14.109  1.00 43.25 ? 308  LEU A N   1 
ATOM   2334 C CA  . LEU A 1 308 ? 38.450  -1.967  12.931  1.00 43.97 ? 308  LEU A CA  1 
ATOM   2335 C C   . LEU A 1 308 ? 39.233  -2.960  12.109  1.00 45.07 ? 308  LEU A C   1 
ATOM   2336 O O   . LEU A 1 308 ? 40.246  -2.601  11.507  1.00 45.05 ? 308  LEU A O   1 
ATOM   2337 C CB  . LEU A 1 308 ? 38.151  -0.699  12.121  1.00 43.31 ? 308  LEU A CB  1 
ATOM   2338 C CG  . LEU A 1 308 ? 37.106  0.261   12.693  1.00 42.18 ? 308  LEU A CG  1 
ATOM   2339 C CD1 . LEU A 1 308 ? 36.967  1.452   11.772  1.00 38.99 ? 308  LEU A CD1 1 
ATOM   2340 C CD2 . LEU A 1 308 ? 35.713  -0.431  12.928  1.00 40.82 ? 308  LEU A CD2 1 
ATOM   2341 N N   . SER A 1 309 ? 38.780  -4.216  12.120  1.00 46.31 ? 309  SER A N   1 
ATOM   2342 C CA  . SER A 1 309 ? 39.546  -5.328  11.544  1.00 47.63 ? 309  SER A CA  1 
ATOM   2343 C C   . SER A 1 309 ? 39.523  -5.320  10.009  1.00 48.14 ? 309  SER A C   1 
ATOM   2344 O O   . SER A 1 309 ? 40.396  -5.897  9.361   1.00 48.26 ? 309  SER A O   1 
ATOM   2345 C CB  . SER A 1 309 ? 39.071  -6.675  12.116  1.00 47.63 ? 309  SER A CB  1 
ATOM   2346 O OG  . SER A 1 309 ? 37.749  -6.975  11.698  1.00 49.06 ? 309  SER A OG  1 
ATOM   2347 N N   . ASP A 1 310 ? 38.528  -4.645  9.445   1.00 48.59 ? 310  ASP A N   1 
ATOM   2348 C CA  . ASP A 1 310 ? 38.406  -4.438  8.003   1.00 48.90 ? 310  ASP A CA  1 
ATOM   2349 C C   . ASP A 1 310 ? 37.577  -3.154  7.799   1.00 48.50 ? 310  ASP A C   1 
ATOM   2350 O O   . ASP A 1 310 ? 37.182  -2.514  8.765   1.00 48.37 ? 310  ASP A O   1 
ATOM   2351 C CB  . ASP A 1 310 ? 37.700  -5.651  7.383   1.00 49.13 ? 310  ASP A CB  1 
ATOM   2352 C CG  . ASP A 1 310 ? 38.025  -5.847  5.901   1.00 51.30 ? 310  ASP A CG  1 
ATOM   2353 O OD1 . ASP A 1 310 ? 38.412  -4.870  5.201   1.00 52.43 ? 310  ASP A OD1 1 
ATOM   2354 O OD2 . ASP A 1 310 ? 37.873  -7.003  5.433   1.00 52.13 ? 310  ASP A OD2 1 
ATOM   2355 N N   . THR A 1 311 ? 37.299  -2.778  6.558   1.00 48.60 ? 311  THR A N   1 
ATOM   2356 C CA  . THR A 1 311 ? 36.456  -1.611  6.306   1.00 48.84 ? 311  THR A CA  1 
ATOM   2357 C C   . THR A 1 311 ? 35.039  -1.816  6.860   1.00 49.36 ? 311  THR A C   1 
ATOM   2358 O O   . THR A 1 311 ? 34.511  -2.935  6.814   1.00 49.17 ? 311  THR A O   1 
ATOM   2359 C CB  . THR A 1 311 ? 36.339  -1.284  4.805   1.00 48.92 ? 311  THR A CB  1 
ATOM   2360 O OG1 . THR A 1 311 ? 35.437  -2.208  4.185   1.00 48.53 ? 311  THR A OG1 1 
ATOM   2361 C CG2 . THR A 1 311 ? 37.721  -1.299  4.099   1.00 47.46 ? 311  THR A CG2 1 
ATOM   2362 N N   . PRO A 1 312 ? 34.420  -0.739  7.390   1.00 49.63 ? 312  PRO A N   1 
ATOM   2363 C CA  . PRO A 1 312 ? 33.026  -0.790  7.845   1.00 49.77 ? 312  PRO A CA  1 
ATOM   2364 C C   . PRO A 1 312 ? 32.099  -1.445  6.830   1.00 50.16 ? 312  PRO A C   1 
ATOM   2365 O O   . PRO A 1 312 ? 31.262  -2.256  7.199   1.00 49.90 ? 312  PRO A O   1 
ATOM   2366 C CB  . PRO A 1 312 ? 32.668  0.689   8.019   1.00 49.37 ? 312  PRO A CB  1 
ATOM   2367 C CG  . PRO A 1 312 ? 33.938  1.310   8.427   1.00 49.63 ? 312  PRO A CG  1 
ATOM   2368 C CD  . PRO A 1 312 ? 35.006  0.597   7.612   1.00 49.56 ? 312  PRO A CD  1 
ATOM   2369 N N   . GLU A 1 313 ? 32.263  -1.091  5.561   1.00 51.25 ? 313  GLU A N   1 
ATOM   2370 C CA  . GLU A 1 313 ? 31.494  -1.676  4.467   1.00 52.55 ? 313  GLU A CA  1 
ATOM   2371 C C   . GLU A 1 313 ? 31.647  -3.215  4.402   1.00 52.91 ? 313  GLU A C   1 
ATOM   2372 O O   . GLU A 1 313 ? 30.662  -3.933  4.225   1.00 53.01 ? 313  GLU A O   1 
ATOM   2373 C CB  . GLU A 1 313 ? 31.881  -1.014  3.132   1.00 52.97 ? 313  GLU A CB  1 
ATOM   2374 C CG  . GLU A 1 313 ? 31.323  0.432   2.933   1.00 55.78 ? 313  GLU A CG  1 
ATOM   2375 C CD  . GLU A 1 313 ? 32.251  1.594   3.421   1.00 57.93 ? 313  GLU A CD  1 
ATOM   2376 O OE1 . GLU A 1 313 ? 33.160  1.397   4.273   1.00 58.04 ? 313  GLU A OE1 1 
ATOM   2377 O OE2 . GLU A 1 313 ? 32.049  2.731   2.932   1.00 58.65 ? 313  GLU A OE2 1 
ATOM   2378 N N   . ALA A 1 314 ? 32.869  -3.716  4.574   1.00 52.92 ? 314  ALA A N   1 
ATOM   2379 C CA  . ALA A 1 314 ? 33.098  -5.152  4.590   1.00 53.45 ? 314  ALA A CA  1 
ATOM   2380 C C   . ALA A 1 314 ? 32.455  -5.800  5.806   1.00 53.95 ? 314  ALA A C   1 
ATOM   2381 O O   . ALA A 1 314 ? 31.851  -6.865  5.691   1.00 54.27 ? 314  ALA A O   1 
ATOM   2382 C CB  . ALA A 1 314 ? 34.588  -5.467  4.544   1.00 53.58 ? 314  ALA A CB  1 
ATOM   2383 N N   . LEU A 1 315 ? 32.580  -5.144  6.960   1.00 54.47 ? 315  LEU A N   1 
ATOM   2384 C CA  . LEU A 1 315 ? 32.117  -5.689  8.240   1.00 54.89 ? 315  LEU A CA  1 
ATOM   2385 C C   . LEU A 1 315 ? 30.596  -5.745  8.380   1.00 55.67 ? 315  LEU A C   1 
ATOM   2386 O O   . LEU A 1 315 ? 30.078  -6.592  9.112   1.00 55.98 ? 315  LEU A O   1 
ATOM   2387 C CB  . LEU A 1 315 ? 32.720  -4.921  9.424   1.00 54.47 ? 315  LEU A CB  1 
ATOM   2388 C CG  . LEU A 1 315 ? 34.234  -4.943  9.630   1.00 53.68 ? 315  LEU A CG  1 
ATOM   2389 C CD1 . LEU A 1 315 ? 34.608  -4.082  10.811  1.00 51.26 ? 315  LEU A CD1 1 
ATOM   2390 C CD2 . LEU A 1 315 ? 34.764  -6.368  9.795   1.00 53.50 ? 315  LEU A CD2 1 
ATOM   2391 N N   . ILE A 1 316 ? 29.887  -4.853  7.698   1.00 56.50 ? 316  ILE A N   1 
ATOM   2392 C CA  . ILE A 1 316 ? 28.420  -4.870  7.730   1.00 57.75 ? 316  ILE A CA  1 
ATOM   2393 C C   . ILE A 1 316 ? 27.848  -5.868  6.724   1.00 58.91 ? 316  ILE A C   1 
ATOM   2394 O O   . ILE A 1 316 ? 26.734  -6.363  6.905   1.00 59.21 ? 316  ILE A O   1 
ATOM   2395 C CB  . ILE A 1 316 ? 27.773  -3.460  7.522   1.00 57.08 ? 316  ILE A CB  1 
ATOM   2396 C CG1 . ILE A 1 316 ? 28.131  -2.879  6.149   1.00 57.54 ? 316  ILE A CG1 1 
ATOM   2397 C CG2 . ILE A 1 316 ? 28.160  -2.530  8.650   1.00 56.76 ? 316  ILE A CG2 1 
ATOM   2398 C CD1 . ILE A 1 316 ? 27.327  -1.642  5.715   1.00 57.88 ? 316  ILE A CD1 1 
ATOM   2399 N N   . ASN A 1 317 ? 28.619  -6.155  5.674   1.00 60.40 ? 317  ASN A N   1 
ATOM   2400 C CA  . ASN A 1 317 ? 28.204  -7.073  4.617   1.00 61.92 ? 317  ASN A CA  1 
ATOM   2401 C C   . ASN A 1 317 ? 28.359  -8.538  5.007   1.00 62.79 ? 317  ASN A C   1 
ATOM   2402 O O   . ASN A 1 317 ? 27.783  -9.416  4.368   1.00 63.39 ? 317  ASN A O   1 
ATOM   2403 C CB  . ASN A 1 317 ? 28.994  -6.825  3.326   1.00 61.98 ? 317  ASN A CB  1 
ATOM   2404 C CG  . ASN A 1 317 ? 28.625  -5.516  2.628   1.00 63.38 ? 317  ASN A CG  1 
ATOM   2405 O OD1 . ASN A 1 317 ? 29.277  -5.126  1.650   1.00 64.11 ? 317  ASN A OD1 1 
ATOM   2406 N ND2 . ASN A 1 317 ? 27.589  -4.827  3.123   1.00 65.00 ? 317  ASN A ND2 1 
ATOM   2407 N N   . THR A 1 318 ? 29.151  -8.809  6.039   1.00 63.81 ? 318  THR A N   1 
ATOM   2408 C CA  . THR A 1 318 ? 29.477  -10.193 6.396   1.00 64.67 ? 318  THR A CA  1 
ATOM   2409 C C   . THR A 1 318 ? 29.378  -10.456 7.896   1.00 64.99 ? 318  THR A C   1 
ATOM   2410 O O   . THR A 1 318 ? 29.812  -11.499 8.378   1.00 65.20 ? 318  THR A O   1 
ATOM   2411 C CB  . THR A 1 318 ? 30.907  -10.594 5.920   1.00 64.83 ? 318  THR A CB  1 
ATOM   2412 O OG1 . THR A 1 318 ? 31.887  -10.108 6.852   1.00 65.11 ? 318  THR A OG1 1 
ATOM   2413 C CG2 . THR A 1 318 ? 31.207  -10.057 4.511   1.00 65.12 ? 318  THR A CG2 1 
ATOM   2414 N N   . GLY A 1 319 ? 28.831  -9.503  8.638   1.00 65.44 ? 319  GLY A N   1 
ATOM   2415 C CA  . GLY A 1 319 ? 28.686  -9.667  10.077  1.00 66.19 ? 319  GLY A CA  1 
ATOM   2416 C C   . GLY A 1 319 ? 27.445  -10.452 10.461  1.00 66.66 ? 319  GLY A C   1 
ATOM   2417 O O   . GLY A 1 319 ? 26.493  -10.573 9.682   1.00 66.47 ? 319  GLY A O   1 
ATOM   2418 N N   . ASP A 1 320 ? 27.463  -10.988 11.674  1.00 67.28 ? 320  ASP A N   1 
ATOM   2419 C CA  . ASP A 1 320 ? 26.297  -11.648 12.243  1.00 67.88 ? 320  ASP A CA  1 
ATOM   2420 C C   . ASP A 1 320 ? 25.632  -10.671 13.224  1.00 67.62 ? 320  ASP A C   1 
ATOM   2421 O O   . ASP A 1 320 ? 26.230  -10.305 14.241  1.00 67.63 ? 320  ASP A O   1 
ATOM   2422 C CB  . ASP A 1 320 ? 26.744  -12.941 12.936  1.00 68.31 ? 320  ASP A CB  1 
ATOM   2423 C CG  . ASP A 1 320 ? 25.582  -13.787 13.442  1.00 69.80 ? 320  ASP A CG  1 
ATOM   2424 O OD1 . ASP A 1 320 ? 24.422  -13.593 13.005  1.00 71.94 ? 320  ASP A OD1 1 
ATOM   2425 O OD2 . ASP A 1 320 ? 25.845  -14.674 14.284  1.00 71.61 ? 320  ASP A OD2 1 
ATOM   2426 N N   . PHE A 1 321 ? 24.413  -10.228 12.909  1.00 67.43 ? 321  PHE A N   1 
ATOM   2427 C CA  . PHE A 1 321 ? 23.718  -9.236  13.755  1.00 67.53 ? 321  PHE A CA  1 
ATOM   2428 C C   . PHE A 1 321 ? 22.368  -9.723  14.273  1.00 67.98 ? 321  PHE A C   1 
ATOM   2429 O O   . PHE A 1 321 ? 21.417  -8.952  14.415  1.00 68.05 ? 321  PHE A O   1 
ATOM   2430 C CB  . PHE A 1 321 ? 23.597  -7.886  13.029  1.00 66.98 ? 321  PHE A CB  1 
ATOM   2431 C CG  . PHE A 1 321 ? 24.914  -7.359  12.528  1.00 65.89 ? 321  PHE A CG  1 
ATOM   2432 C CD1 . PHE A 1 321 ? 25.895  -6.941  13.423  1.00 63.91 ? 321  PHE A CD1 1 
ATOM   2433 C CD2 . PHE A 1 321 ? 25.184  -7.313  11.169  1.00 64.92 ? 321  PHE A CD2 1 
ATOM   2434 C CE1 . PHE A 1 321 ? 27.114  -6.479  12.976  1.00 63.95 ? 321  PHE A CE1 1 
ATOM   2435 C CE2 . PHE A 1 321 ? 26.405  -6.843  10.710  1.00 64.95 ? 321  PHE A CE2 1 
ATOM   2436 C CZ  . PHE A 1 321 ? 27.373  -6.429  11.619  1.00 64.95 ? 321  PHE A CZ  1 
ATOM   2437 N N   . GLN A 1 322 ? 22.324  -11.018 14.578  1.00 68.43 ? 322  GLN A N   1 
ATOM   2438 C CA  . GLN A 1 322 ? 21.125  -11.726 15.017  1.00 68.96 ? 322  GLN A CA  1 
ATOM   2439 C C   . GLN A 1 322 ? 20.546  -11.084 16.287  1.00 68.00 ? 322  GLN A C   1 
ATOM   2440 O O   . GLN A 1 322 ? 19.350  -10.790 16.375  1.00 68.09 ? 322  GLN A O   1 
ATOM   2441 C CB  . GLN A 1 322 ? 21.523  -13.178 15.299  1.00 69.08 ? 322  GLN A CB  1 
ATOM   2442 C CG  . GLN A 1 322 ? 20.590  -14.266 14.763  1.00 71.23 ? 322  GLN A CG  1 
ATOM   2443 C CD  . GLN A 1 322 ? 21.305  -15.625 14.664  1.00 71.13 ? 322  GLN A CD  1 
ATOM   2444 O OE1 . GLN A 1 322 ? 22.257  -15.781 13.885  1.00 73.17 ? 322  GLN A OE1 1 
ATOM   2445 N NE2 . GLN A 1 322 ? 20.856  -16.604 15.461  1.00 73.27 ? 322  GLN A NE2 1 
ATOM   2446 N N   . ASP A 1 323 ? 21.426  -10.845 17.252  1.00 66.91 ? 323  ASP A N   1 
ATOM   2447 C CA  . ASP A 1 323 ? 21.049  -10.415 18.594  1.00 66.17 ? 323  ASP A CA  1 
ATOM   2448 C C   . ASP A 1 323 ? 20.898  -8.884  18.753  1.00 64.89 ? 323  ASP A C   1 
ATOM   2449 O O   . ASP A 1 323 ? 20.658  -8.391  19.864  1.00 64.87 ? 323  ASP A O   1 
ATOM   2450 C CB  . ASP A 1 323 ? 22.112  -10.929 19.580  1.00 66.79 ? 323  ASP A CB  1 
ATOM   2451 C CG  . ASP A 1 323 ? 23.520  -10.393 19.262  1.00 68.58 ? 323  ASP A CG  1 
ATOM   2452 O OD1 . ASP A 1 323 ? 23.910  -10.346 18.064  1.00 70.15 ? 323  ASP A OD1 1 
ATOM   2453 O OD2 . ASP A 1 323 ? 24.235  -10.016 20.219  1.00 70.40 ? 323  ASP A OD2 1 
ATOM   2454 N N   . LEU A 1 324 ? 21.026  -8.141  17.653  1.00 62.84 ? 324  LEU A N   1 
ATOM   2455 C CA  . LEU A 1 324 ? 21.152  -6.687  17.730  1.00 60.69 ? 324  LEU A CA  1 
ATOM   2456 C C   . LEU A 1 324 ? 19.851  -5.942  17.486  1.00 58.96 ? 324  LEU A C   1 
ATOM   2457 O O   . LEU A 1 324 ? 19.104  -6.263  16.562  1.00 58.82 ? 324  LEU A O   1 
ATOM   2458 C CB  . LEU A 1 324 ? 22.228  -6.193  16.754  1.00 60.86 ? 324  LEU A CB  1 
ATOM   2459 C CG  . LEU A 1 324 ? 22.785  -4.782  16.957  1.00 60.66 ? 324  LEU A CG  1 
ATOM   2460 C CD1 . LEU A 1 324 ? 23.693  -4.719  18.176  1.00 60.32 ? 324  LEU A CD1 1 
ATOM   2461 C CD2 . LEU A 1 324 ? 23.521  -4.335  15.708  1.00 60.65 ? 324  LEU A CD2 1 
ATOM   2462 N N   . GLN A 1 325 ? 19.593  -4.946  18.324  1.00 56.74 ? 325  GLN A N   1 
ATOM   2463 C CA  . GLN A 1 325 ? 18.501  -4.009  18.085  1.00 55.01 ? 325  GLN A CA  1 
ATOM   2464 C C   . GLN A 1 325 ? 19.045  -2.594  17.882  1.00 53.26 ? 325  GLN A C   1 
ATOM   2465 O O   . GLN A 1 325 ? 19.797  -2.077  18.711  1.00 52.92 ? 325  GLN A O   1 
ATOM   2466 C CB  . GLN A 1 325 ? 17.466  -4.031  19.212  1.00 55.13 ? 325  GLN A CB  1 
ATOM   2467 C CG  . GLN A 1 325 ? 16.757  -5.365  19.403  1.00 56.30 ? 325  GLN A CG  1 
ATOM   2468 C CD  . GLN A 1 325 ? 17.313  -6.147  20.575  1.00 57.99 ? 325  GLN A CD  1 
ATOM   2469 O OE1 . GLN A 1 325 ? 17.419  -5.630  21.693  1.00 57.44 ? 325  GLN A OE1 1 
ATOM   2470 N NE2 . GLN A 1 325 ? 17.678  -7.405  20.327  1.00 59.39 ? 325  GLN A NE2 1 
ATOM   2471 N N   . VAL A 1 326 ? 18.646  -1.990  16.768  1.00 51.07 ? 326  VAL A N   1 
ATOM   2472 C CA  . VAL A 1 326 ? 19.149  -0.707  16.327  1.00 48.93 ? 326  VAL A CA  1 
ATOM   2473 C C   . VAL A 1 326 ? 18.011  0.221   15.926  1.00 47.51 ? 326  VAL A C   1 
ATOM   2474 O O   . VAL A 1 326 ? 17.082  -0.172  15.210  1.00 46.99 ? 326  VAL A O   1 
ATOM   2475 C CB  . VAL A 1 326 ? 20.075  -0.848  15.094  1.00 49.28 ? 326  VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 326 ? 21.002  0.319   15.017  1.00 49.29 ? 326  VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 326 ? 20.907  -2.097  15.165  1.00 49.84 ? 326  VAL A CG2 1 
ATOM   2478 N N   . LEU A 1 327 ? 18.106  1.461   16.388  1.00 45.68 ? 327  LEU A N   1 
ATOM   2479 C CA  . LEU A 1 327 ? 17.275  2.549   15.911  1.00 44.00 ? 327  LEU A CA  1 
ATOM   2480 C C   . LEU A 1 327 ? 18.160  3.497   15.075  1.00 43.22 ? 327  LEU A C   1 
ATOM   2481 O O   . LEU A 1 327 ? 19.245  3.901   15.515  1.00 42.86 ? 327  LEU A O   1 
ATOM   2482 C CB  . LEU A 1 327 ? 16.624  3.255   17.101  1.00 43.99 ? 327  LEU A CB  1 
ATOM   2483 C CG  . LEU A 1 327 ? 15.833  4.559   16.893  1.00 44.13 ? 327  LEU A CG  1 
ATOM   2484 C CD1 . LEU A 1 327 ? 14.595  4.329   16.088  1.00 43.71 ? 327  LEU A CD1 1 
ATOM   2485 C CD2 . LEU A 1 327 ? 15.463  5.141   18.225  1.00 43.93 ? 327  LEU A CD2 1 
ATOM   2486 N N   . VAL A 1 328 ? 17.716  3.815   13.857  1.00 41.94 ? 328  VAL A N   1 
ATOM   2487 C CA  . VAL A 1 328 ? 18.512  4.598   12.907  1.00 40.80 ? 328  VAL A CA  1 
ATOM   2488 C C   . VAL A 1 328 ? 17.643  5.598   12.187  1.00 40.43 ? 328  VAL A C   1 
ATOM   2489 O O   . VAL A 1 328 ? 16.473  5.325   11.915  1.00 40.76 ? 328  VAL A O   1 
ATOM   2490 C CB  . VAL A 1 328 ? 19.267  3.718   11.838  1.00 40.80 ? 328  VAL A CB  1 
ATOM   2491 C CG1 . VAL A 1 328 ? 19.953  2.559   12.478  1.00 41.15 ? 328  VAL A CG1 1 
ATOM   2492 C CG2 . VAL A 1 328 ? 18.342  3.207   10.753  1.00 39.60 ? 328  VAL A CG2 1 
ATOM   2493 N N   . GLY A 1 329 ? 18.206  6.753   11.852  1.00 39.74 ? 329  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 329 ? 17.438  7.727   11.095  1.00 38.71 ? 329  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 329 ? 18.165  8.980   10.696  1.00 38.08 ? 329  GLY A C   1 
ATOM   2496 O O   . GLY A 1 329 ? 19.362  9.122   10.949  1.00 38.13 ? 329  GLY A O   1 
ATOM   2497 N N   . VAL A 1 330 ? 17.418  9.892   10.076  1.00 37.51 ? 330  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 330 ? 17.975  11.062  9.426   1.00 37.21 ? 330  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 330 ? 17.033  12.248  9.620   1.00 38.05 ? 330  VAL A C   1 
ATOM   2500 O O   . VAL A 1 330 ? 15.854  12.067  9.923   1.00 38.21 ? 330  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 330 ? 18.205  10.819  7.892   1.00 37.34 ? 330  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 330 ? 19.220  9.684   7.624   1.00 36.39 ? 330  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 330 ? 16.885  10.563  7.159   1.00 35.86 ? 330  VAL A CG2 1 
ATOM   2504 N N   . VAL A 1 331 ? 17.546  13.464  9.440   1.00 38.41 ? 331  VAL A N   1 
ATOM   2505 C CA  . VAL A 1 331 ? 16.688  14.646  9.443   1.00 38.32 ? 331  VAL A CA  1 
ATOM   2506 C C   . VAL A 1 331 ? 16.319  14.950  7.998   1.00 39.12 ? 331  VAL A C   1 
ATOM   2507 O O   . VAL A 1 331 ? 16.867  14.339  7.068   1.00 39.05 ? 331  VAL A O   1 
ATOM   2508 C CB  . VAL A 1 331 ? 17.337  15.882  10.143  1.00 38.34 ? 331  VAL A CB  1 
ATOM   2509 C CG1 . VAL A 1 331 ? 17.585  15.598  11.604  1.00 37.34 ? 331  VAL A CG1 1 
ATOM   2510 C CG2 . VAL A 1 331 ? 18.621  16.308  9.464   1.00 36.99 ? 331  VAL A CG2 1 
ATOM   2511 N N   . LYS A 1 332 ? 15.379  15.868  7.808   1.00 39.04 ? 332  LYS A N   1 
ATOM   2512 C CA  . LYS A 1 332 ? 14.869  16.141  6.482   1.00 39.39 ? 332  LYS A CA  1 
ATOM   2513 C C   . LYS A 1 332 ? 15.914  16.773  5.574   1.00 38.23 ? 332  LYS A C   1 
ATOM   2514 O O   . LYS A 1 332 ? 15.949  16.489  4.379   1.00 37.44 ? 332  LYS A O   1 
ATOM   2515 C CB  . LYS A 1 332 ? 13.606  17.029  6.543   1.00 40.00 ? 332  LYS A CB  1 
ATOM   2516 C CG  . LYS A 1 332 ? 12.790  17.000  5.236   1.00 40.16 ? 332  LYS A CG  1 
ATOM   2517 C CD  . LYS A 1 332 ? 11.578  17.933  5.281   1.00 41.92 ? 332  LYS A CD  1 
ATOM   2518 C CE  . LYS A 1 332 ? 10.744  17.778  3.995   1.00 45.27 ? 332  LYS A CE  1 
ATOM   2519 N NZ  . LYS A 1 332 ? 10.434  19.104  3.346   1.00 48.79 ? 332  LYS A NZ  1 
ATOM   2520 N N   . ASP A 1 333 ? 16.753  17.645  6.137   1.00 37.76 ? 333  ASP A N   1 
ATOM   2521 C CA  . ASP A 1 333 ? 17.730  18.383  5.327   1.00 37.09 ? 333  ASP A CA  1 
ATOM   2522 C C   . ASP A 1 333 ? 19.169  18.202  5.845   1.00 37.04 ? 333  ASP A C   1 
ATOM   2523 O O   . ASP A 1 333 ? 19.775  19.115  6.422   1.00 36.97 ? 333  ASP A O   1 
ATOM   2524 C CB  . ASP A 1 333 ? 17.318  19.848  5.239   1.00 36.87 ? 333  ASP A CB  1 
ATOM   2525 C CG  . ASP A 1 333 ? 15.925  20.023  4.657   1.00 35.98 ? 333  ASP A CG  1 
ATOM   2526 O OD1 . ASP A 1 333 ? 14.960  20.145  5.427   1.00 37.24 ? 333  ASP A OD1 1 
ATOM   2527 O OD2 . ASP A 1 333 ? 15.787  20.015  3.429   1.00 34.27 ? 333  ASP A OD2 1 
ATOM   2528 N N   . GLU A 1 334 ? 19.705  17.003  5.657   1.00 36.83 ? 334  GLU A N   1 
ATOM   2529 C CA  . GLU A 1 334 ? 21.025  16.682  6.192   1.00 36.81 ? 334  GLU A CA  1 
ATOM   2530 C C   . GLU A 1 334 ? 22.146  17.597  5.664   1.00 36.71 ? 334  GLU A C   1 
ATOM   2531 O O   . GLU A 1 334 ? 23.061  17.931  6.405   1.00 36.30 ? 334  GLU A O   1 
ATOM   2532 C CB  . GLU A 1 334 ? 21.369  15.212  5.923   1.00 36.70 ? 334  GLU A CB  1 
ATOM   2533 C CG  . GLU A 1 334 ? 20.549  14.219  6.708   1.00 36.26 ? 334  GLU A CG  1 
ATOM   2534 C CD  . GLU A 1 334 ? 20.896  14.187  8.176   1.00 37.06 ? 334  GLU A CD  1 
ATOM   2535 O OE1 . GLU A 1 334 ? 21.939  14.739  8.557   1.00 36.28 ? 334  GLU A OE1 1 
ATOM   2536 O OE2 . GLU A 1 334 ? 20.118  13.594  8.965   1.00 39.13 ? 334  GLU A OE2 1 
ATOM   2537 N N   . GLY A 1 335 ? 22.050  18.021  4.407   1.00 36.69 ? 335  GLY A N   1 
ATOM   2538 C CA  . GLY A 1 335 ? 23.158  18.704  3.750   1.00 37.82 ? 335  GLY A CA  1 
ATOM   2539 C C   . GLY A 1 335 ? 23.216  20.218  3.828   1.00 38.51 ? 335  GLY A C   1 
ATOM   2540 O O   . GLY A 1 335 ? 24.291  20.798  3.690   1.00 38.42 ? 335  GLY A O   1 
ATOM   2541 N N   . SER A 1 336 ? 22.076  20.865  4.060   1.00 38.98 ? 336  SER A N   1 
ATOM   2542 C CA  . SER A 1 336 ? 21.993  22.322  3.952   1.00 39.87 ? 336  SER A CA  1 
ATOM   2543 C C   . SER A 1 336 ? 23.056  23.076  4.772   1.00 40.83 ? 336  SER A C   1 
ATOM   2544 O O   . SER A 1 336 ? 23.668  24.015  4.276   1.00 40.76 ? 336  SER A O   1 
ATOM   2545 C CB  . SER A 1 336 ? 20.584  22.811  4.302   1.00 39.87 ? 336  SER A CB  1 
ATOM   2546 O OG  . SER A 1 336 ? 20.337  22.713  5.698   1.00 38.89 ? 336  SER A OG  1 
ATOM   2547 N N   . TYR A 1 337 ? 23.253  22.647  6.017   1.00 42.23 ? 337  TYR A N   1 
ATOM   2548 C CA  . TYR A 1 337 ? 24.208  23.227  6.979   1.00 43.60 ? 337  TYR A CA  1 
ATOM   2549 C C   . TYR A 1 337 ? 25.630  23.315  6.405   1.00 42.91 ? 337  TYR A C   1 
ATOM   2550 O O   . TYR A 1 337 ? 26.314  24.334  6.510   1.00 42.26 ? 337  TYR A O   1 
ATOM   2551 C CB  . TYR A 1 337 ? 24.200  22.349  8.239   1.00 45.58 ? 337  TYR A CB  1 
ATOM   2552 C CG  . TYR A 1 337 ? 25.053  22.800  9.391   1.00 48.02 ? 337  TYR A CG  1 
ATOM   2553 C CD1 . TYR A 1 337 ? 24.491  23.509  10.457  1.00 51.12 ? 337  TYR A CD1 1 
ATOM   2554 C CD2 . TYR A 1 337 ? 26.404  22.471  9.452   1.00 51.17 ? 337  TYR A CD2 1 
ATOM   2555 C CE1 . TYR A 1 337 ? 25.273  23.930  11.555  1.00 52.24 ? 337  TYR A CE1 1 
ATOM   2556 C CE2 . TYR A 1 337 ? 27.211  22.883  10.538  1.00 53.23 ? 337  TYR A CE2 1 
ATOM   2557 C CZ  . TYR A 1 337 ? 26.635  23.619  11.585  1.00 52.44 ? 337  TYR A CZ  1 
ATOM   2558 O OH  . TYR A 1 337 ? 27.412  24.020  12.664  1.00 52.10 ? 337  TYR A OH  1 
ATOM   2559 N N   . PHE A 1 338 ? 26.041  22.231  5.765   1.00 42.17 ? 338  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 338 ? 27.388  22.082  5.260   1.00 41.22 ? 338  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 338 ? 27.745  23.026  4.099   1.00 41.60 ? 338  PHE A C   1 
ATOM   2562 O O   . PHE A 1 338 ? 28.929  23.316  3.876   1.00 41.84 ? 338  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 338 ? 27.621  20.608  4.930   1.00 40.38 ? 338  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 338 ? 27.582  19.731  6.149   1.00 39.12 ? 338  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 338 ? 26.372  19.174  6.590   1.00 37.25 ? 338  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 338 ? 28.739  19.512  6.899   1.00 36.92 ? 338  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 338 ? 26.323  18.391  7.736   1.00 36.76 ? 338  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 338 ? 28.707  18.736  8.050   1.00 35.53 ? 338  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 338 ? 27.498  18.167  8.473   1.00 37.72 ? 338  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 339 ? 26.726  23.546  3.417   1.00 41.23 ? 339  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 339 ? 26.921  24.330  2.210   1.00 41.60 ? 339  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 339 ? 27.501  25.731  2.433   1.00 42.17 ? 339  LEU A C   1 
ATOM   2573 O O   . LEU A 1 339 ? 28.148  26.282  1.543   1.00 41.97 ? 339  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 339 ? 25.611  24.419  1.426   1.00 41.59 ? 339  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 339 ? 24.972  23.092  1.026   1.00 41.69 ? 339  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 339 ? 23.769  23.357  0.160   1.00 40.02 ? 339  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 339 ? 25.997  22.166  0.308   1.00 40.37 ? 339  LEU A CD2 1 
ATOM   2578 N N   . VAL A 1 340 ? 27.262  26.301  3.609   1.00 42.59 ? 340  VAL A N   1 
ATOM   2579 C CA  . VAL A 1 340 ? 27.742  27.645  3.924   1.00 43.39 ? 340  VAL A CA  1 
ATOM   2580 C C   . VAL A 1 340 ? 29.201  27.639  4.403   1.00 44.15 ? 340  VAL A C   1 
ATOM   2581 O O   . VAL A 1 340 ? 29.829  28.689  4.529   1.00 44.58 ? 340  VAL A O   1 
ATOM   2582 C CB  . VAL A 1 340 ? 26.838  28.349  4.958   1.00 43.38 ? 340  VAL A CB  1 
ATOM   2583 C CG1 . VAL A 1 340 ? 25.391  28.327  4.491   1.00 43.76 ? 340  VAL A CG1 1 
ATOM   2584 C CG2 . VAL A 1 340 ? 26.942  27.682  6.331   1.00 43.69 ? 340  VAL A CG2 1 
ATOM   2585 N N   . TYR A 1 341 ? 29.743  26.457  4.658   1.00 44.20 ? 341  TYR A N   1 
ATOM   2586 C CA  . TYR A 1 341 ? 31.122  26.371  5.077   1.00 44.96 ? 341  TYR A CA  1 
ATOM   2587 C C   . TYR A 1 341 ? 32.072  26.010  3.934   1.00 45.38 ? 341  TYR A C   1 
ATOM   2588 O O   . TYR A 1 341 ? 33.090  25.340  4.173   1.00 45.77 ? 341  TYR A O   1 
ATOM   2589 C CB  . TYR A 1 341 ? 31.281  25.329  6.188   1.00 45.21 ? 341  TYR A CB  1 
ATOM   2590 C CG  . TYR A 1 341 ? 30.763  25.769  7.519   1.00 45.40 ? 341  TYR A CG  1 
ATOM   2591 C CD1 . TYR A 1 341 ? 29.425  25.569  7.868   1.00 45.11 ? 341  TYR A CD1 1 
ATOM   2592 C CD2 . TYR A 1 341 ? 31.609  26.374  8.441   1.00 45.16 ? 341  TYR A CD2 1 
ATOM   2593 C CE1 . TYR A 1 341 ? 28.945  25.973  9.096   1.00 45.33 ? 341  TYR A CE1 1 
ATOM   2594 C CE2 . TYR A 1 341 ? 31.143  26.775  9.669   1.00 46.25 ? 341  TYR A CE2 1 
ATOM   2595 C CZ  . TYR A 1 341 ? 29.807  26.569  9.997   1.00 45.92 ? 341  TYR A CZ  1 
ATOM   2596 O OH  . TYR A 1 341 ? 29.336  26.966  11.229  1.00 46.11 ? 341  TYR A OH  1 
ATOM   2597 N N   . GLY A 1 342 ? 31.757  26.413  2.705   1.00 45.09 ? 342  GLY A N   1 
ATOM   2598 C CA  . GLY A 1 342 ? 32.696  26.158  1.628   1.00 45.00 ? 342  GLY A CA  1 
ATOM   2599 C C   . GLY A 1 342 ? 32.227  26.043  0.198   1.00 44.97 ? 342  GLY A C   1 
ATOM   2600 O O   . GLY A 1 342 ? 33.064  25.875  -0.700  1.00 45.16 ? 342  GLY A O   1 
ATOM   2601 N N   . VAL A 1 343 ? 30.919  26.110  -0.043  1.00 44.27 ? 343  VAL A N   1 
ATOM   2602 C CA  . VAL A 1 343 ? 30.460  26.116  -1.424  1.00 44.01 ? 343  VAL A CA  1 
ATOM   2603 C C   . VAL A 1 343 ? 30.129  27.554  -1.832  1.00 44.26 ? 343  VAL A C   1 
ATOM   2604 O O   . VAL A 1 343 ? 29.254  28.181  -1.241  1.00 43.81 ? 343  VAL A O   1 
ATOM   2605 C CB  . VAL A 1 343 ? 29.267  25.170  -1.672  1.00 43.93 ? 343  VAL A CB  1 
ATOM   2606 C CG1 . VAL A 1 343 ? 28.880  25.173  -3.140  1.00 42.50 ? 343  VAL A CG1 1 
ATOM   2607 C CG2 . VAL A 1 343 ? 29.602  23.765  -1.236  1.00 44.01 ? 343  VAL A CG2 1 
ATOM   2608 N N   . PRO A 1 344 ? 30.822  28.083  -2.858  1.00 44.70 ? 344  PRO A N   1 
ATOM   2609 C CA  . PRO A 1 344 ? 30.532  29.489  -3.187  1.00 44.82 ? 344  PRO A CA  1 
ATOM   2610 C C   . PRO A 1 344 ? 29.082  29.617  -3.686  1.00 44.83 ? 344  PRO A C   1 
ATOM   2611 O O   . PRO A 1 344 ? 28.591  28.734  -4.408  1.00 43.84 ? 344  PRO A O   1 
ATOM   2612 C CB  . PRO A 1 344 ? 31.527  29.822  -4.313  1.00 44.65 ? 344  PRO A CB  1 
ATOM   2613 C CG  . PRO A 1 344 ? 32.533  28.671  -4.328  1.00 45.15 ? 344  PRO A CG  1 
ATOM   2614 C CD  . PRO A 1 344 ? 31.807  27.478  -3.775  1.00 44.61 ? 344  PRO A CD  1 
ATOM   2615 N N   . GLY A 1 345 ? 28.417  30.694  -3.267  1.00 44.52 ? 345  GLY A N   1 
ATOM   2616 C CA  . GLY A 1 345 ? 27.036  30.949  -3.636  1.00 44.58 ? 345  GLY A CA  1 
ATOM   2617 C C   . GLY A 1 345 ? 26.132  30.867  -2.433  1.00 44.80 ? 345  GLY A C   1 
ATOM   2618 O O   . GLY A 1 345 ? 25.085  31.501  -2.407  1.00 44.72 ? 345  GLY A O   1 
ATOM   2619 N N   . PHE A 1 346 ? 26.563  30.110  -1.420  1.00 44.99 ? 346  PHE A N   1 
ATOM   2620 C CA  . PHE A 1 346 ? 25.756  29.846  -0.225  1.00 44.64 ? 346  PHE A CA  1 
ATOM   2621 C C   . PHE A 1 346 ? 26.102  30.708  0.990   1.00 45.52 ? 346  PHE A C   1 
ATOM   2622 O O   . PHE A 1 346 ? 27.276  31.007  1.253   1.00 45.28 ? 346  PHE A O   1 
ATOM   2623 C CB  . PHE A 1 346 ? 25.821  28.359  0.124   1.00 43.97 ? 346  PHE A CB  1 
ATOM   2624 C CG  . PHE A 1 346 ? 25.181  27.467  -0.921  1.00 41.95 ? 346  PHE A CG  1 
ATOM   2625 C CD1 . PHE A 1 346 ? 25.928  26.979  -1.993  1.00 39.10 ? 346  PHE A CD1 1 
ATOM   2626 C CD2 . PHE A 1 346 ? 23.828  27.133  -0.831  1.00 38.85 ? 346  PHE A CD2 1 
ATOM   2627 C CE1 . PHE A 1 346 ? 25.340  26.167  -2.957  1.00 38.67 ? 346  PHE A CE1 1 
ATOM   2628 C CE2 . PHE A 1 346 ? 23.224  26.336  -1.788  1.00 38.01 ? 346  PHE A CE2 1 
ATOM   2629 C CZ  . PHE A 1 346 ? 23.973  25.847  -2.854  1.00 39.91 ? 346  PHE A CZ  1 
ATOM   2630 N N   . SER A 1 347 ? 25.057  31.131  1.705   1.00 46.02 ? 347  SER A N   1 
ATOM   2631 C CA  . SER A 1 347 ? 25.199  31.910  2.935   1.00 46.79 ? 347  SER A CA  1 
ATOM   2632 C C   . SER A 1 347 ? 23.986  31.725  3.847   1.00 47.44 ? 347  SER A C   1 
ATOM   2633 O O   . SER A 1 347 ? 22.906  31.325  3.386   1.00 48.20 ? 347  SER A O   1 
ATOM   2634 C CB  . SER A 1 347 ? 25.400  33.400  2.622   1.00 46.85 ? 347  SER A CB  1 
ATOM   2635 O OG  . SER A 1 347 ? 25.453  34.167  3.809   1.00 46.64 ? 347  SER A OG  1 
ATOM   2636 N N   . LYS A 1 348 ? 24.159  32.013  5.134   1.00 47.53 ? 348  LYS A N   1 
ATOM   2637 C CA  . LYS A 1 348 ? 23.046  31.948  6.066   1.00 48.12 ? 348  LYS A CA  1 
ATOM   2638 C C   . LYS A 1 348 ? 22.204  33.221  6.003   1.00 48.76 ? 348  LYS A C   1 
ATOM   2639 O O   . LYS A 1 348 ? 21.082  33.254  6.498   1.00 48.15 ? 348  LYS A O   1 
ATOM   2640 C CB  . LYS A 1 348 ? 23.541  31.693  7.496   1.00 47.78 ? 348  LYS A CB  1 
ATOM   2641 C CG  . LYS A 1 348 ? 24.149  32.883  8.197   1.00 47.59 ? 348  LYS A CG  1 
ATOM   2642 C CD  . LYS A 1 348 ? 24.328  32.610  9.677   1.00 47.84 ? 348  LYS A CD  1 
ATOM   2643 C CE  . LYS A 1 348 ? 24.556  33.896  10.472  1.00 48.02 ? 348  LYS A CE  1 
ATOM   2644 N NZ  . LYS A 1 348 ? 23.317  34.718  10.629  1.00 48.81 ? 348  LYS A NZ  1 
ATOM   2645 N N   . ASP A 1 349 ? 22.769  34.257  5.380   1.00 50.26 ? 349  ASP A N   1 
ATOM   2646 C CA  . ASP A 1 349 ? 22.218  35.620  5.416   1.00 51.33 ? 349  ASP A CA  1 
ATOM   2647 C C   . ASP A 1 349 ? 21.405  35.999  4.171   1.00 51.71 ? 349  ASP A C   1 
ATOM   2648 O O   . ASP A 1 349 ? 20.837  37.087  4.127   1.00 51.11 ? 349  ASP A O   1 
ATOM   2649 C CB  . ASP A 1 349 ? 23.339  36.644  5.654   1.00 51.42 ? 349  ASP A CB  1 
ATOM   2650 C CG  . ASP A 1 349 ? 23.973  36.516  7.037   1.00 52.52 ? 349  ASP A CG  1 
ATOM   2651 O OD1 . ASP A 1 349 ? 23.244  36.310  8.036   1.00 51.99 ? 349  ASP A OD1 1 
ATOM   2652 O OD2 . ASP A 1 349 ? 25.219  36.625  7.121   1.00 55.56 ? 349  ASP A OD2 1 
ATOM   2653 N N   . ASN A 1 350 ? 21.376  35.108  3.171   1.00 52.54 ? 350  ASN A N   1 
ATOM   2654 C CA  . ASN A 1 350 ? 20.472  35.227  2.018   1.00 53.41 ? 350  ASN A CA  1 
ATOM   2655 C C   . ASN A 1 350 ? 19.903  33.871  1.577   1.00 52.85 ? 350  ASN A C   1 
ATOM   2656 O O   . ASN A 1 350 ? 20.307  32.831  2.119   1.00 52.83 ? 350  ASN A O   1 
ATOM   2657 C CB  . ASN A 1 350 ? 21.094  36.039  0.850   1.00 54.10 ? 350  ASN A CB  1 
ATOM   2658 C CG  . ASN A 1 350 ? 22.256  35.329  0.149   1.00 58.30 ? 350  ASN A CG  1 
ATOM   2659 O OD1 . ASN A 1 350 ? 22.255  34.100  0.003   1.00 60.76 ? 350  ASN A OD1 1 
ATOM   2660 N ND2 . ASN A 1 350 ? 23.240  36.128  -0.333  1.00 63.76 ? 350  ASN A ND2 1 
ATOM   2661 N N   . GLU A 1 351 ? 18.959  33.890  0.622   1.00 52.18 ? 351  GLU A N   1 
ATOM   2662 C CA  . GLU A 1 351 ? 18.275  32.673  0.138   1.00 51.36 ? 351  GLU A CA  1 
ATOM   2663 C C   . GLU A 1 351 ? 19.191  31.683  -0.584  1.00 49.88 ? 351  GLU A C   1 
ATOM   2664 O O   . GLU A 1 351 ? 18.764  30.577  -0.931  1.00 49.14 ? 351  GLU A O   1 
ATOM   2665 C CB  . GLU A 1 351 ? 17.104  33.002  -0.806  1.00 52.29 ? 351  GLU A CB  1 
ATOM   2666 C CG  . GLU A 1 351 ? 16.051  33.986  -0.311  1.00 55.41 ? 351  GLU A CG  1 
ATOM   2667 C CD  . GLU A 1 351 ? 15.646  33.750  1.127   1.00 60.26 ? 351  GLU A CD  1 
ATOM   2668 O OE1 . GLU A 1 351 ? 15.255  32.599  1.473   1.00 60.88 ? 351  GLU A OE1 1 
ATOM   2669 O OE2 . GLU A 1 351 ? 15.719  34.736  1.905   1.00 62.67 ? 351  GLU A OE2 1 
ATOM   2670 N N   . SER A 1 352 ? 20.430  32.100  -0.837  1.00 48.66 ? 352  SER A N   1 
ATOM   2671 C CA  . SER A 1 352 ? 21.434  31.259  -1.494  1.00 47.78 ? 352  SER A CA  1 
ATOM   2672 C C   . SER A 1 352 ? 20.911  30.664  -2.819  1.00 47.57 ? 352  SER A C   1 
ATOM   2673 O O   . SER A 1 352 ? 21.129  29.488  -3.132  1.00 47.25 ? 352  SER A O   1 
ATOM   2674 C CB  . SER A 1 352 ? 21.957  30.162  -0.532  1.00 47.75 ? 352  SER A CB  1 
ATOM   2675 O OG  . SER A 1 352 ? 22.143  30.654  0.794   1.00 45.86 ? 352  SER A OG  1 
ATOM   2676 N N   . LEU A 1 353 ? 20.217  31.491  -3.596  1.00 46.93 ? 353  LEU A N   1 
ATOM   2677 C CA  . LEU A 1 353 ? 19.769  31.082  -4.909  1.00 46.55 ? 353  LEU A CA  1 
ATOM   2678 C C   . LEU A 1 353 ? 20.975  31.091  -5.830  1.00 45.98 ? 353  LEU A C   1 
ATOM   2679 O O   . LEU A 1 353 ? 21.584  32.141  -6.064  1.00 46.77 ? 353  LEU A O   1 
ATOM   2680 C CB  . LEU A 1 353 ? 18.665  32.008  -5.421  1.00 46.69 ? 353  LEU A CB  1 
ATOM   2681 C CG  . LEU A 1 353 ? 17.348  32.008  -4.623  1.00 48.10 ? 353  LEU A CG  1 
ATOM   2682 C CD1 . LEU A 1 353 ? 16.407  33.131  -5.075  1.00 48.38 ? 353  LEU A CD1 1 
ATOM   2683 C CD2 . LEU A 1 353 ? 16.650  30.680  -4.708  1.00 47.39 ? 353  LEU A CD2 1 
ATOM   2684 N N   . ILE A 1 354 ? 21.338  29.916  -6.327  1.00 44.91 ? 354  ILE A N   1 
ATOM   2685 C CA  . ILE A 1 354 ? 22.585  29.749  -7.070  1.00 44.03 ? 354  ILE A CA  1 
ATOM   2686 C C   . ILE A 1 354 ? 22.333  29.523  -8.550  1.00 44.28 ? 354  ILE A C   1 
ATOM   2687 O O   . ILE A 1 354 ? 21.203  29.245  -8.960  1.00 44.41 ? 354  ILE A O   1 
ATOM   2688 C CB  . ILE A 1 354 ? 23.460  28.591  -6.505  1.00 43.49 ? 354  ILE A CB  1 
ATOM   2689 C CG1 . ILE A 1 354 ? 22.661  27.287  -6.401  1.00 41.81 ? 354  ILE A CG1 1 
ATOM   2690 C CG2 . ILE A 1 354 ? 24.047  28.987  -5.172  1.00 43.02 ? 354  ILE A CG2 1 
ATOM   2691 C CD1 . ILE A 1 354 ? 23.491  26.056  -6.530  1.00 42.85 ? 354  ILE A CD1 1 
ATOM   2692 N N   . SER A 1 355 ? 23.395  29.647  -9.340  1.00 44.37 ? 355  SER A N   1 
ATOM   2693 C CA  . SER A 1 355 ? 23.352  29.374  -10.773 1.00 44.80 ? 355  SER A CA  1 
ATOM   2694 C C   . SER A 1 355 ? 23.761  27.926  -11.072 1.00 44.83 ? 355  SER A C   1 
ATOM   2695 O O   . SER A 1 355 ? 24.261  27.195  -10.203 1.00 44.84 ? 355  SER A O   1 
ATOM   2696 C CB  . SER A 1 355 ? 24.309  30.312  -11.502 1.00 45.17 ? 355  SER A CB  1 
ATOM   2697 O OG  . SER A 1 355 ? 25.672  29.931  -11.247 1.00 46.13 ? 355  SER A OG  1 
ATOM   2698 N N   . ARG A 1 356 ? 23.575  27.524  -12.318 1.00 44.94 ? 356  ARG A N   1 
ATOM   2699 C CA  . ARG A 1 356 ? 23.971  26.198  -12.733 1.00 45.32 ? 356  ARG A CA  1 
ATOM   2700 C C   . ARG A 1 356 ? 25.480  26.004  -12.613 1.00 45.12 ? 356  ARG A C   1 
ATOM   2701 O O   . ARG A 1 356 ? 25.937  24.924  -12.218 1.00 45.65 ? 356  ARG A O   1 
ATOM   2702 C CB  . ARG A 1 356 ? 23.499  25.910  -14.157 1.00 45.66 ? 356  ARG A CB  1 
ATOM   2703 C CG  . ARG A 1 356 ? 23.818  24.502  -14.601 1.00 46.70 ? 356  ARG A CG  1 
ATOM   2704 C CD  . ARG A 1 356 ? 22.699  23.894  -15.404 1.00 48.35 ? 356  ARG A CD  1 
ATOM   2705 N NE  . ARG A 1 356 ? 23.007  22.496  -15.677 1.00 47.23 ? 356  ARG A NE  1 
ATOM   2706 C CZ  . ARG A 1 356 ? 22.482  21.463  -15.028 1.00 45.85 ? 356  ARG A CZ  1 
ATOM   2707 N NH1 . ARG A 1 356 ? 21.577  21.646  -14.060 1.00 45.74 ? 356  ARG A NH1 1 
ATOM   2708 N NH2 . ARG A 1 356 ? 22.854  20.242  -15.371 1.00 44.31 ? 356  ARG A NH2 1 
ATOM   2709 N N   . ALA A 1 357 ? 26.250  27.042  -12.939 1.00 44.47 ? 357  ALA A N   1 
ATOM   2710 C CA  . ALA A 1 357 ? 27.710  26.963  -12.807 1.00 43.92 ? 357  ALA A CA  1 
ATOM   2711 C C   . ALA A 1 357 ? 28.105  26.702  -11.354 1.00 43.15 ? 357  ALA A C   1 
ATOM   2712 O O   . ALA A 1 357 ? 28.932  25.834  -11.080 1.00 43.64 ? 357  ALA A O   1 
ATOM   2713 C CB  . ALA A 1 357 ? 28.403  28.244  -13.352 1.00 43.73 ? 357  ALA A CB  1 
ATOM   2714 N N   . GLN A 1 358 ? 27.499  27.450  -10.437 1.00 42.12 ? 358  GLN A N   1 
ATOM   2715 C CA  . GLN A 1 358 ? 27.751  27.309  -9.017  1.00 41.56 ? 358  GLN A CA  1 
ATOM   2716 C C   . GLN A 1 358 ? 27.312  25.934  -8.510  1.00 41.34 ? 358  GLN A C   1 
ATOM   2717 O O   . GLN A 1 358 ? 27.845  25.435  -7.511  1.00 41.47 ? 358  GLN A O   1 
ATOM   2718 C CB  . GLN A 1 358 ? 27.044  28.414  -8.226  1.00 41.41 ? 358  GLN A CB  1 
ATOM   2719 C CG  . GLN A 1 358 ? 27.486  29.831  -8.558  1.00 41.66 ? 358  GLN A CG  1 
ATOM   2720 C CD  . GLN A 1 358 ? 26.783  30.882  -7.703  1.00 42.50 ? 358  GLN A CD  1 
ATOM   2721 O OE1 . GLN A 1 358 ? 25.554  30.942  -7.639  1.00 44.78 ? 358  GLN A OE1 1 
ATOM   2722 N NE2 . GLN A 1 358 ? 27.565  31.717  -7.046  1.00 43.53 ? 358  GLN A NE2 1 
ATOM   2723 N N   . PHE A 1 359 ? 26.354  25.320  -9.204  1.00 40.46 ? 359  PHE A N   1 
ATOM   2724 C CA  . PHE A 1 359 ? 25.948  23.946  -8.898  1.00 39.80 ? 359  PHE A CA  1 
ATOM   2725 C C   . PHE A 1 359 ? 27.012  22.924  -9.291  1.00 39.88 ? 359  PHE A C   1 
ATOM   2726 O O   . PHE A 1 359 ? 27.411  22.117  -8.464  1.00 39.91 ? 359  PHE A O   1 
ATOM   2727 C CB  . PHE A 1 359 ? 24.577  23.634  -9.522  1.00 39.08 ? 359  PHE A CB  1 
ATOM   2728 C CG  . PHE A 1 359 ? 24.111  22.226  -9.331  1.00 37.23 ? 359  PHE A CG  1 
ATOM   2729 C CD1 . PHE A 1 359 ? 24.080  21.345  -10.404 1.00 36.39 ? 359  PHE A CD1 1 
ATOM   2730 C CD2 . PHE A 1 359 ? 23.659  21.787  -8.100  1.00 36.94 ? 359  PHE A CD2 1 
ATOM   2731 C CE1 . PHE A 1 359 ? 23.633  20.037  -10.247 1.00 35.97 ? 359  PHE A CE1 1 
ATOM   2732 C CE2 . PHE A 1 359 ? 23.203  20.482  -7.934  1.00 37.17 ? 359  PHE A CE2 1 
ATOM   2733 C CZ  . PHE A 1 359 ? 23.185  19.609  -9.011  1.00 37.11 ? 359  PHE A CZ  1 
ATOM   2734 N N   . LEU A 1 360 ? 27.485  22.967  -10.535 1.00 40.38 ? 360  LEU A N   1 
ATOM   2735 C CA  . LEU A 1 360 ? 28.525  22.035  -10.981 1.00 40.92 ? 360  LEU A CA  1 
ATOM   2736 C C   . LEU A 1 360 ? 29.817  22.134  -10.156 1.00 40.60 ? 360  LEU A C   1 
ATOM   2737 O O   . LEU A 1 360 ? 30.466  21.121  -9.901  1.00 40.47 ? 360  LEU A O   1 
ATOM   2738 C CB  . LEU A 1 360 ? 28.848  22.209  -12.466 1.00 41.48 ? 360  LEU A CB  1 
ATOM   2739 C CG  . LEU A 1 360 ? 27.787  22.385  -13.568 1.00 44.07 ? 360  LEU A CG  1 
ATOM   2740 C CD1 . LEU A 1 360 ? 28.466  22.345  -14.966 1.00 45.54 ? 360  LEU A CD1 1 
ATOM   2741 C CD2 . LEU A 1 360 ? 26.627  21.391  -13.511 1.00 44.55 ? 360  LEU A CD2 1 
ATOM   2742 N N   . ALA A 1 361 ? 30.179  23.350  -9.752  1.00 40.51 ? 361  ALA A N   1 
ATOM   2743 C CA  . ALA A 1 361 ? 31.329  23.577  -8.875  1.00 40.39 ? 361  ALA A CA  1 
ATOM   2744 C C   . ALA A 1 361 ? 31.076  23.039  -7.469  1.00 40.65 ? 361  ALA A C   1 
ATOM   2745 O O   . ALA A 1 361 ? 31.986  22.468  -6.841  1.00 41.42 ? 361  ALA A O   1 
ATOM   2746 C CB  . ALA A 1 361 ? 31.685  25.059  -8.825  1.00 40.09 ? 361  ALA A CB  1 
ATOM   2747 N N   . GLY A 1 362 ? 29.842  23.225  -6.982  1.00 40.26 ? 362  GLY A N   1 
ATOM   2748 C CA  . GLY A 1 362 ? 29.422  22.744  -5.674  1.00 39.41 ? 362  GLY A CA  1 
ATOM   2749 C C   . GLY A 1 362 ? 29.441  21.229  -5.578  1.00 39.45 ? 362  GLY A C   1 
ATOM   2750 O O   . GLY A 1 362 ? 29.745  20.672  -4.528  1.00 39.65 ? 362  GLY A O   1 
ATOM   2751 N N   . VAL A 1 363 ? 29.112  20.561  -6.674  1.00 39.37 ? 363  VAL A N   1 
ATOM   2752 C CA  . VAL A 1 363 ? 29.192  19.111  -6.729  1.00 39.83 ? 363  VAL A CA  1 
ATOM   2753 C C   . VAL A 1 363 ? 30.640  18.608  -6.606  1.00 40.74 ? 363  VAL A C   1 
ATOM   2754 O O   . VAL A 1 363 ? 30.863  17.595  -5.949  1.00 41.42 ? 363  VAL A O   1 
ATOM   2755 C CB  . VAL A 1 363 ? 28.550  18.545  -8.008  1.00 39.66 ? 363  VAL A CB  1 
ATOM   2756 C CG1 . VAL A 1 363 ? 28.924  17.079  -8.195  1.00 40.02 ? 363  VAL A CG1 1 
ATOM   2757 C CG2 . VAL A 1 363 ? 27.045  18.721  -7.969  1.00 38.46 ? 363  VAL A CG2 1 
ATOM   2758 N N   . ARG A 1 364 ? 31.613  19.295  -7.222  1.00 40.99 ? 364  ARG A N   1 
ATOM   2759 C CA  . ARG A 1 364 ? 33.026  18.870  -7.120  1.00 41.49 ? 364  ARG A CA  1 
ATOM   2760 C C   . ARG A 1 364 ? 33.516  18.949  -5.685  1.00 41.26 ? 364  ARG A C   1 
ATOM   2761 O O   . ARG A 1 364 ? 34.278  18.097  -5.240  1.00 41.15 ? 364  ARG A O   1 
ATOM   2762 C CB  . ARG A 1 364 ? 33.971  19.701  -8.006  1.00 41.68 ? 364  ARG A CB  1 
ATOM   2763 C CG  . ARG A 1 364 ? 33.661  19.697  -9.488  1.00 43.32 ? 364  ARG A CG  1 
ATOM   2764 C CD  . ARG A 1 364 ? 33.174  18.326  -9.959  1.00 47.76 ? 364  ARG A CD  1 
ATOM   2765 N NE  . ARG A 1 364 ? 34.206  17.297  -9.854  1.00 51.04 ? 364  ARG A NE  1 
ATOM   2766 C CZ  . ARG A 1 364 ? 35.061  17.002  -10.831 1.00 53.03 ? 364  ARG A CZ  1 
ATOM   2767 N NH1 . ARG A 1 364 ? 35.009  17.663  -11.993 1.00 52.34 ? 364  ARG A NH1 1 
ATOM   2768 N NH2 . ARG A 1 364 ? 35.969  16.050  -10.644 1.00 53.11 ? 364  ARG A NH2 1 
ATOM   2769 N N   . ILE A 1 365 ? 33.072  19.982  -4.974  1.00 40.95 ? 365  ILE A N   1 
ATOM   2770 C CA  . ILE A 1 365 ? 33.481  20.203  -3.598  1.00 40.59 ? 365  ILE A CA  1 
ATOM   2771 C C   . ILE A 1 365 ? 32.752  19.265  -2.631  1.00 41.05 ? 365  ILE A C   1 
ATOM   2772 O O   . ILE A 1 365 ? 33.335  18.791  -1.647  1.00 41.12 ? 365  ILE A O   1 
ATOM   2773 C CB  . ILE A 1 365 ? 33.241  21.665  -3.194  1.00 40.49 ? 365  ILE A CB  1 
ATOM   2774 C CG1 . ILE A 1 365 ? 34.087  22.597  -4.082  1.00 40.33 ? 365  ILE A CG1 1 
ATOM   2775 C CG2 . ILE A 1 365 ? 33.508  21.876  -1.690  1.00 39.23 ? 365  ILE A CG2 1 
ATOM   2776 C CD1 . ILE A 1 365 ? 33.767  24.108  -3.912  1.00 39.96 ? 365  ILE A CD1 1 
ATOM   2777 N N   . GLY A 1 366 ? 31.475  19.019  -2.913  1.00 41.14 ? 366  GLY A N   1 
ATOM   2778 C CA  . GLY A 1 366 ? 30.645  18.172  -2.078  1.00 41.39 ? 366  GLY A CA  1 
ATOM   2779 C C   . GLY A 1 366 ? 30.874  16.687  -2.311  1.00 41.64 ? 366  GLY A C   1 
ATOM   2780 O O   . GLY A 1 366 ? 30.602  15.867  -1.429  1.00 42.27 ? 366  GLY A O   1 
ATOM   2781 N N   . VAL A 1 367 ? 31.336  16.335  -3.505  1.00 41.22 ? 367  VAL A N   1 
ATOM   2782 C CA  . VAL A 1 367 ? 31.710  14.963  -3.801  1.00 41.32 ? 367  VAL A CA  1 
ATOM   2783 C C   . VAL A 1 367 ? 33.183  15.001  -4.194  1.00 42.18 ? 367  VAL A C   1 
ATOM   2784 O O   . VAL A 1 367 ? 33.521  14.733  -5.344  1.00 42.16 ? 367  VAL A O   1 
ATOM   2785 C CB  . VAL A 1 367 ? 30.851  14.363  -4.952  1.00 41.04 ? 367  VAL A CB  1 
ATOM   2786 C CG1 . VAL A 1 367 ? 31.009  12.855  -5.005  1.00 39.23 ? 367  VAL A CG1 1 
ATOM   2787 C CG2 . VAL A 1 367 ? 29.375  14.733  -4.788  1.00 39.64 ? 367  VAL A CG2 1 
ATOM   2788 N N   . PRO A 1 368 ? 34.070  15.354  -3.242  1.00 43.21 ? 368  PRO A N   1 
ATOM   2789 C CA  . PRO A 1 368 ? 35.476  15.594  -3.594  1.00 44.07 ? 368  PRO A CA  1 
ATOM   2790 C C   . PRO A 1 368 ? 36.214  14.400  -4.174  1.00 45.10 ? 368  PRO A C   1 
ATOM   2791 O O   . PRO A 1 368 ? 37.160  14.582  -4.913  1.00 45.71 ? 368  PRO A O   1 
ATOM   2792 C CB  . PRO A 1 368 ? 36.110  16.019  -2.269  1.00 43.97 ? 368  PRO A CB  1 
ATOM   2793 C CG  . PRO A 1 368 ? 35.225  15.478  -1.226  1.00 43.55 ? 368  PRO A CG  1 
ATOM   2794 C CD  . PRO A 1 368 ? 33.835  15.559  -1.801  1.00 43.04 ? 368  PRO A CD  1 
ATOM   2795 N N   . GLN A 1 369 ? 35.771  13.189  -3.879  1.00 46.45 ? 369  GLN A N   1 
ATOM   2796 C CA  . GLN A 1 369 ? 36.475  12.017  -4.374  1.00 47.91 ? 369  GLN A CA  1 
ATOM   2797 C C   . GLN A 1 369 ? 36.012  11.605  -5.781  1.00 48.84 ? 369  GLN A C   1 
ATOM   2798 O O   . GLN A 1 369 ? 36.549  10.657  -6.359  1.00 49.05 ? 369  GLN A O   1 
ATOM   2799 C CB  . GLN A 1 369 ? 36.373  10.861  -3.364  1.00 47.74 ? 369  GLN A CB  1 
ATOM   2800 C CG  . GLN A 1 369 ? 35.144  9.936   -3.521  1.00 49.71 ? 369  GLN A CG  1 
ATOM   2801 C CD  . GLN A 1 369 ? 33.803  10.466  -2.935  1.00 50.88 ? 369  GLN A CD  1 
ATOM   2802 O OE1 . GLN A 1 369 ? 33.671  11.628  -2.506  1.00 48.56 ? 369  GLN A OE1 1 
ATOM   2803 N NE2 . GLN A 1 369 ? 32.802  9.580   -2.923  1.00 51.68 ? 369  GLN A NE2 1 
ATOM   2804 N N   . ALA A 1 370 ? 35.026  12.312  -6.334  1.00 49.65 ? 370  ALA A N   1 
ATOM   2805 C CA  . ALA A 1 370 ? 34.480  11.947  -7.645  1.00 50.31 ? 370  ALA A CA  1 
ATOM   2806 C C   . ALA A 1 370 ? 35.370  12.349  -8.823  1.00 50.91 ? 370  ALA A C   1 
ATOM   2807 O O   . ALA A 1 370 ? 35.892  13.464  -8.874  1.00 50.65 ? 370  ALA A O   1 
ATOM   2808 C CB  . ALA A 1 370 ? 33.107  12.533  -7.824  1.00 50.51 ? 370  ALA A CB  1 
ATOM   2809 N N   . SER A 1 371 ? 35.516  11.438  -9.781  1.00 51.65 ? 371  SER A N   1 
ATOM   2810 C CA  . SER A 1 371 ? 36.181  11.740  -11.034 1.00 52.35 ? 371  SER A CA  1 
ATOM   2811 C C   . SER A 1 371 ? 35.313  12.723  -11.824 1.00 52.83 ? 371  SER A C   1 
ATOM   2812 O O   . SER A 1 371 ? 34.347  13.268  -11.292 1.00 53.39 ? 371  SER A O   1 
ATOM   2813 C CB  . SER A 1 371 ? 36.395  10.461  -11.828 1.00 52.39 ? 371  SER A CB  1 
ATOM   2814 O OG  . SER A 1 371 ? 35.176  10.013  -12.414 1.00 54.30 ? 371  SER A OG  1 
ATOM   2815 N N   . ASP A 1 372 ? 35.661  12.965  -13.081 1.00 53.15 ? 372  ASP A N   1 
ATOM   2816 C CA  . ASP A 1 372 ? 34.873  13.844  -13.922 1.00 53.42 ? 372  ASP A CA  1 
ATOM   2817 C C   . ASP A 1 372 ? 33.579  13.168  -14.369 1.00 53.02 ? 372  ASP A C   1 
ATOM   2818 O O   . ASP A 1 372 ? 32.516  13.797  -14.368 1.00 52.60 ? 372  ASP A O   1 
ATOM   2819 C CB  . ASP A 1 372 ? 35.688  14.320  -15.125 1.00 54.06 ? 372  ASP A CB  1 
ATOM   2820 C CG  . ASP A 1 372 ? 36.614  15.475  -14.783 1.00 55.74 ? 372  ASP A CG  1 
ATOM   2821 O OD1 . ASP A 1 372 ? 36.991  15.633  -13.599 1.00 57.16 ? 372  ASP A OD1 1 
ATOM   2822 O OD2 . ASP A 1 372 ? 36.976  16.225  -15.710 1.00 58.45 ? 372  ASP A OD2 1 
ATOM   2823 N N   . LEU A 1 373 ? 33.672  11.892  -14.741 1.00 52.60 ? 373  LEU A N   1 
ATOM   2824 C CA  . LEU A 1 373 ? 32.489  11.147  -15.152 1.00 52.49 ? 373  LEU A CA  1 
ATOM   2825 C C   . LEU A 1 373 ? 31.427  11.104  -14.032 1.00 52.05 ? 373  LEU A C   1 
ATOM   2826 O O   . LEU A 1 373 ? 30.281  11.533  -14.233 1.00 51.96 ? 373  LEU A O   1 
ATOM   2827 C CB  . LEU A 1 373 ? 32.861  9.744   -15.642 1.00 52.43 ? 373  LEU A CB  1 
ATOM   2828 C CG  . LEU A 1 373 ? 31.759  8.942   -16.354 1.00 53.11 ? 373  LEU A CG  1 
ATOM   2829 C CD1 . LEU A 1 373 ? 31.060  9.759   -17.448 1.00 51.70 ? 373  LEU A CD1 1 
ATOM   2830 C CD2 . LEU A 1 373 ? 32.301  7.608   -16.914 1.00 52.95 ? 373  LEU A CD2 1 
ATOM   2831 N N   . ALA A 1 374 ? 31.827  10.614  -12.858 1.00 51.43 ? 374  ALA A N   1 
ATOM   2832 C CA  . ALA A 1 374 ? 30.945  10.526  -11.685 1.00 50.40 ? 374  ALA A CA  1 
ATOM   2833 C C   . ALA A 1 374 ? 30.322  11.861  -11.307 1.00 49.72 ? 374  ALA A C   1 
ATOM   2834 O O   . ALA A 1 374 ? 29.148  11.920  -10.980 1.00 48.91 ? 374  ALA A O   1 
ATOM   2835 C CB  . ALA A 1 374 ? 31.697  9.937   -10.489 1.00 50.41 ? 374  ALA A CB  1 
ATOM   2836 N N   . ALA A 1 375 ? 31.116  12.928  -11.339 1.00 49.48 ? 375  ALA A N   1 
ATOM   2837 C CA  . ALA A 1 375 ? 30.595  14.249  -11.023 1.00 49.49 ? 375  ALA A CA  1 
ATOM   2838 C C   . ALA A 1 375 ? 29.453  14.548  -11.978 1.00 49.79 ? 375  ALA A C   1 
ATOM   2839 O O   . ALA A 1 375 ? 28.376  14.984  -11.557 1.00 50.16 ? 375  ALA A O   1 
ATOM   2840 C CB  . ALA A 1 375 ? 31.674  15.299  -11.147 1.00 49.28 ? 375  ALA A CB  1 
ATOM   2841 N N   . GLU A 1 376 ? 29.690  14.278  -13.261 1.00 49.68 ? 376  GLU A N   1 
ATOM   2842 C CA  . GLU A 1 376 ? 28.700  14.511  -14.296 1.00 49.85 ? 376  GLU A CA  1 
ATOM   2843 C C   . GLU A 1 376 ? 27.465  13.622  -14.057 1.00 48.74 ? 376  GLU A C   1 
ATOM   2844 O O   . GLU A 1 376 ? 26.336  14.086  -14.211 1.00 48.75 ? 376  GLU A O   1 
ATOM   2845 C CB  . GLU A 1 376 ? 29.329  14.340  -15.696 1.00 50.57 ? 376  GLU A CB  1 
ATOM   2846 C CG  . GLU A 1 376 ? 28.595  15.011  -16.895 1.00 54.38 ? 376  GLU A CG  1 
ATOM   2847 C CD  . GLU A 1 376 ? 27.972  16.398  -16.581 1.00 60.67 ? 376  GLU A CD  1 
ATOM   2848 O OE1 . GLU A 1 376 ? 28.676  17.300  -16.044 1.00 61.45 ? 376  GLU A OE1 1 
ATOM   2849 O OE2 . GLU A 1 376 ? 26.761  16.581  -16.887 1.00 62.37 ? 376  GLU A OE2 1 
ATOM   2850 N N   . ALA A 1 377 ? 27.683  12.378  -13.630 1.00 47.27 ? 377  ALA A N   1 
ATOM   2851 C CA  . ALA A 1 377 ? 26.581  11.485  -13.268 1.00 46.17 ? 377  ALA A CA  1 
ATOM   2852 C C   . ALA A 1 377 ? 25.712  12.063  -12.147 1.00 45.82 ? 377  ALA A C   1 
ATOM   2853 O O   . ALA A 1 377 ? 24.468  12.076  -12.255 1.00 45.41 ? 377  ALA A O   1 
ATOM   2854 C CB  . ALA A 1 377 ? 27.090  10.121  -12.889 1.00 45.66 ? 377  ALA A CB  1 
ATOM   2855 N N   . VAL A 1 378 ? 26.374  12.554  -11.092 1.00 45.10 ? 378  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 378 ? 25.702  13.203  -9.961  1.00 44.00 ? 378  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 378 ? 24.846  14.369  -10.461 1.00 43.67 ? 378  VAL A C   1 
ATOM   2858 O O   . VAL A 1 378 ? 23.663  14.481  -10.114 1.00 43.50 ? 378  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 378 ? 26.708  13.701  -8.898  1.00 44.07 ? 378  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 378 ? 26.007  14.518  -7.822  1.00 43.44 ? 378  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 378 ? 27.469  12.523  -8.266  1.00 43.28 ? 378  VAL A CG2 1 
ATOM   2862 N N   . VAL A 1 379 ? 25.446  15.207  -11.304 1.00 42.96 ? 379  VAL A N   1 
ATOM   2863 C CA  . VAL A 1 379 ? 24.795  16.405  -11.810 1.00 42.42 ? 379  VAL A CA  1 
ATOM   2864 C C   . VAL A 1 379 ? 23.581  16.050  -12.670 1.00 42.79 ? 379  VAL A C   1 
ATOM   2865 O O   . VAL A 1 379 ? 22.526  16.672  -12.559 1.00 42.62 ? 379  VAL A O   1 
ATOM   2866 C CB  . VAL A 1 379 ? 25.776  17.259  -12.621 1.00 42.03 ? 379  VAL A CB  1 
ATOM   2867 C CG1 . VAL A 1 379 ? 25.033  18.188  -13.563 1.00 41.05 ? 379  VAL A CG1 1 
ATOM   2868 C CG2 . VAL A 1 379 ? 26.690  18.032  -11.696 1.00 40.94 ? 379  VAL A CG2 1 
ATOM   2869 N N   . LEU A 1 380 ? 23.733  15.033  -13.510 1.00 42.83 ? 380  LEU A N   1 
ATOM   2870 C CA  . LEU A 1 380 ? 22.658  14.624  -14.387 1.00 43.17 ? 380  LEU A CA  1 
ATOM   2871 C C   . LEU A 1 380 ? 21.482  14.034  -13.602 1.00 43.00 ? 380  LEU A C   1 
ATOM   2872 O O   . LEU A 1 380 ? 20.312  14.316  -13.913 1.00 43.17 ? 380  LEU A O   1 
ATOM   2873 C CB  . LEU A 1 380 ? 23.183  13.696  -15.488 1.00 43.82 ? 380  LEU A CB  1 
ATOM   2874 C CG  . LEU A 1 380 ? 24.295  14.372  -16.325 1.00 45.83 ? 380  LEU A CG  1 
ATOM   2875 C CD1 . LEU A 1 380 ? 25.028  13.403  -17.254 1.00 48.73 ? 380  LEU A CD1 1 
ATOM   2876 C CD2 . LEU A 1 380 ? 23.817  15.590  -17.117 1.00 46.26 ? 380  LEU A CD2 1 
ATOM   2877 N N   . HIS A 1 381 ? 21.798  13.265  -12.563 1.00 42.09 ? 381  HIS A N   1 
ATOM   2878 C CA  . HIS A 1 381 ? 20.790  12.698  -11.678 1.00 41.68 ? 381  HIS A CA  1 
ATOM   2879 C C   . HIS A 1 381 ? 19.998  13.742  -10.887 1.00 41.28 ? 381  HIS A C   1 
ATOM   2880 O O   . HIS A 1 381 ? 18.780  13.615  -10.731 1.00 41.29 ? 381  HIS A O   1 
ATOM   2881 C CB  . HIS A 1 381 ? 21.446  11.722  -10.709 1.00 41.96 ? 381  HIS A CB  1 
ATOM   2882 C CG  . HIS A 1 381 ? 20.482  10.995  -9.829  1.00 42.66 ? 381  HIS A CG  1 
ATOM   2883 N ND1 . HIS A 1 381 ? 19.952  9.766   -10.161 1.00 45.33 ? 381  HIS A ND1 1 
ATOM   2884 C CD2 . HIS A 1 381 ? 19.969  11.309  -8.618  1.00 43.34 ? 381  HIS A CD2 1 
ATOM   2885 C CE1 . HIS A 1 381 ? 19.151  9.356   -9.194  1.00 44.40 ? 381  HIS A CE1 1 
ATOM   2886 N NE2 . HIS A 1 381 ? 19.142  10.276  -8.246  1.00 44.95 ? 381  HIS A NE2 1 
ATOM   2887 N N   . TYR A 1 382 ? 20.685  14.757  -10.377 1.00 40.32 ? 382  TYR A N   1 
ATOM   2888 C CA  . TYR A 1 382 ? 20.046  15.714  -9.494  1.00 39.46 ? 382  TYR A CA  1 
ATOM   2889 C C   . TYR A 1 382 ? 19.444  16.887  -10.235 1.00 39.83 ? 382  TYR A C   1 
ATOM   2890 O O   . TYR A 1 382 ? 18.646  17.606  -9.662  1.00 40.00 ? 382  TYR A O   1 
ATOM   2891 C CB  . TYR A 1 382 ? 21.006  16.185  -8.399  1.00 38.94 ? 382  TYR A CB  1 
ATOM   2892 C CG  . TYR A 1 382 ? 21.114  15.215  -7.247  1.00 37.55 ? 382  TYR A CG  1 
ATOM   2893 C CD1 . TYR A 1 382 ? 21.988  14.132  -7.297  1.00 37.03 ? 382  TYR A CD1 1 
ATOM   2894 C CD2 . TYR A 1 382 ? 20.337  15.376  -6.116  1.00 36.49 ? 382  TYR A CD2 1 
ATOM   2895 C CE1 . TYR A 1 382 ? 22.079  13.241  -6.250  1.00 36.76 ? 382  TYR A CE1 1 
ATOM   2896 C CE2 . TYR A 1 382 ? 20.425  14.499  -5.056  1.00 36.41 ? 382  TYR A CE2 1 
ATOM   2897 C CZ  . TYR A 1 382 ? 21.290  13.431  -5.125  1.00 37.61 ? 382  TYR A CZ  1 
ATOM   2898 O OH  . TYR A 1 382 ? 21.361  12.552  -4.062  1.00 38.24 ? 382  TYR A OH  1 
ATOM   2899 N N   . THR A 1 383 ? 19.811  17.082  -11.503 1.00 40.31 ? 383  THR A N   1 
ATOM   2900 C CA  . THR A 1 383 ? 19.200  18.134  -12.312 1.00 40.95 ? 383  THR A CA  1 
ATOM   2901 C C   . THR A 1 383 ? 17.730  17.820  -12.549 1.00 42.00 ? 383  THR A C   1 
ATOM   2902 O O   . THR A 1 383 ? 17.379  16.676  -12.850 1.00 42.84 ? 383  THR A O   1 
ATOM   2903 C CB  . THR A 1 383 ? 19.925  18.334  -13.675 1.00 40.92 ? 383  THR A CB  1 
ATOM   2904 O OG1 . THR A 1 383 ? 21.217  18.908  -13.445 1.00 41.35 ? 383  THR A OG1 1 
ATOM   2905 C CG2 . THR A 1 383 ? 19.147  19.276  -14.594 1.00 39.09 ? 383  THR A CG2 1 
ATOM   2906 N N   . ASP A 1 384 ? 16.877  18.823  -12.385 1.00 42.89 ? 384  ASP A N   1 
ATOM   2907 C CA  . ASP A 1 384 ? 15.503  18.734  -12.848 1.00 44.27 ? 384  ASP A CA  1 
ATOM   2908 C C   . ASP A 1 384 ? 15.427  19.226  -14.289 1.00 44.48 ? 384  ASP A C   1 
ATOM   2909 O O   . ASP A 1 384 ? 15.410  20.436  -14.539 1.00 44.41 ? 384  ASP A O   1 
ATOM   2910 C CB  . ASP A 1 384 ? 14.569  19.561  -11.971 1.00 44.79 ? 384  ASP A CB  1 
ATOM   2911 C CG  . ASP A 1 384 ? 13.136  19.595  -12.505 1.00 47.29 ? 384  ASP A CG  1 
ATOM   2912 O OD1 . ASP A 1 384 ? 12.868  19.083  -13.635 1.00 48.19 ? 384  ASP A OD1 1 
ATOM   2913 O OD2 . ASP A 1 384 ? 12.280  20.152  -11.784 1.00 49.61 ? 384  ASP A OD2 1 
ATOM   2914 N N   . TRP A 1 385 ? 15.354  18.282  -15.225 1.00 44.86 ? 385  TRP A N   1 
ATOM   2915 C CA  . TRP A 1 385 ? 15.436  18.603  -16.649 1.00 45.59 ? 385  TRP A CA  1 
ATOM   2916 C C   . TRP A 1 385 ? 14.251  19.397  -17.239 1.00 46.43 ? 385  TRP A C   1 
ATOM   2917 O O   . TRP A 1 385 ? 14.331  19.867  -18.383 1.00 46.59 ? 385  TRP A O   1 
ATOM   2918 C CB  . TRP A 1 385 ? 15.820  17.372  -17.465 1.00 44.89 ? 385  TRP A CB  1 
ATOM   2919 C CG  . TRP A 1 385 ? 17.182  16.897  -17.061 1.00 44.87 ? 385  TRP A CG  1 
ATOM   2920 C CD1 . TRP A 1 385 ? 17.471  15.894  -16.191 1.00 43.57 ? 385  TRP A CD1 1 
ATOM   2921 C CD2 . TRP A 1 385 ? 18.439  17.460  -17.459 1.00 42.85 ? 385  TRP A CD2 1 
ATOM   2922 N NE1 . TRP A 1 385 ? 18.827  15.772  -16.045 1.00 43.17 ? 385  TRP A NE1 1 
ATOM   2923 C CE2 . TRP A 1 385 ? 19.449  16.717  -16.814 1.00 42.06 ? 385  TRP A CE2 1 
ATOM   2924 C CE3 . TRP A 1 385 ? 18.805  18.519  -18.303 1.00 43.18 ? 385  TRP A CE3 1 
ATOM   2925 C CZ2 . TRP A 1 385 ? 20.811  16.989  -16.977 1.00 42.83 ? 385  TRP A CZ2 1 
ATOM   2926 C CZ3 . TRP A 1 385 ? 20.173  18.807  -18.468 1.00 43.97 ? 385  TRP A CZ3 1 
ATOM   2927 C CH2 . TRP A 1 385 ? 21.159  18.033  -17.805 1.00 44.35 ? 385  TRP A CH2 1 
ATOM   2928 N N   . LEU A 1 386 ? 13.179  19.547  -16.459 1.00 47.29 ? 386  LEU A N   1 
ATOM   2929 C CA  . LEU A 1 386 ? 12.133  20.524  -16.784 1.00 48.60 ? 386  LEU A CA  1 
ATOM   2930 C C   . LEU A 1 386 ? 12.575  21.962  -16.499 1.00 48.94 ? 386  LEU A C   1 
ATOM   2931 O O   . LEU A 1 386 ? 12.386  22.834  -17.330 1.00 49.97 ? 386  LEU A O   1 
ATOM   2932 C CB  . LEU A 1 386 ? 10.828  20.232  -16.041 1.00 48.86 ? 386  LEU A CB  1 
ATOM   2933 C CG  . LEU A 1 386 ? 9.724   19.454  -16.756 1.00 50.62 ? 386  LEU A CG  1 
ATOM   2934 C CD1 . LEU A 1 386 ? 8.488   19.415  -15.880 1.00 52.20 ? 386  LEU A CD1 1 
ATOM   2935 C CD2 . LEU A 1 386 ? 9.391   20.061  -18.141 1.00 52.53 ? 386  LEU A CD2 1 
ATOM   2936 N N   . HIS A 1 387 ? 13.148  22.208  -15.326 1.00 49.30 ? 387  HIS A N   1 
ATOM   2937 C CA  . HIS A 1 387 ? 13.652  23.539  -14.969 1.00 49.75 ? 387  HIS A CA  1 
ATOM   2938 C C   . HIS A 1 387 ? 15.169  23.511  -14.631 1.00 48.87 ? 387  HIS A C   1 
ATOM   2939 O O   . HIS A 1 387 ? 15.551  23.842  -13.514 1.00 48.98 ? 387  HIS A O   1 
ATOM   2940 C CB  . HIS A 1 387 ? 12.862  24.114  -13.769 1.00 50.39 ? 387  HIS A CB  1 
ATOM   2941 C CG  . HIS A 1 387 ? 11.370  23.964  -13.865 1.00 52.99 ? 387  HIS A CG  1 
ATOM   2942 N ND1 . HIS A 1 387 ? 10.707  22.814  -13.485 1.00 55.07 ? 387  HIS A ND1 1 
ATOM   2943 C CD2 . HIS A 1 387 ? 10.409  24.834  -14.261 1.00 56.13 ? 387  HIS A CD2 1 
ATOM   2944 C CE1 . HIS A 1 387 ? 9.408   22.974  -13.662 1.00 55.81 ? 387  HIS A CE1 1 
ATOM   2945 N NE2 . HIS A 1 387 ? 9.199   24.191  -14.133 1.00 57.02 ? 387  HIS A NE2 1 
ATOM   2946 N N   . PRO A 1 388 ? 16.036  23.133  -15.591 1.00 48.44 ? 388  PRO A N   1 
ATOM   2947 C CA  . PRO A 1 388 ? 17.476  22.930  -15.292 1.00 47.83 ? 388  PRO A CA  1 
ATOM   2948 C C   . PRO A 1 388 ? 18.284  24.138  -14.790 1.00 47.07 ? 388  PRO A C   1 
ATOM   2949 O O   . PRO A 1 388 ? 19.383  23.958  -14.280 1.00 47.31 ? 388  PRO A O   1 
ATOM   2950 C CB  . PRO A 1 388 ? 18.056  22.454  -16.634 1.00 47.57 ? 388  PRO A CB  1 
ATOM   2951 C CG  . PRO A 1 388 ? 17.096  22.956  -17.661 1.00 48.70 ? 388  PRO A CG  1 
ATOM   2952 C CD  . PRO A 1 388 ? 15.741  22.877  -17.017 1.00 48.49 ? 388  PRO A CD  1 
ATOM   2953 N N   . GLU A 1 389 ? 17.753  25.343  -14.927 1.00 46.77 ? 389  GLU A N   1 
ATOM   2954 C CA  . GLU A 1 389 ? 18.500  26.557  -14.605 1.00 46.60 ? 389  GLU A CA  1 
ATOM   2955 C C   . GLU A 1 389 ? 17.820  27.288  -13.459 1.00 45.26 ? 389  GLU A C   1 
ATOM   2956 O O   . GLU A 1 389 ? 18.231  28.388  -13.077 1.00 44.98 ? 389  GLU A O   1 
ATOM   2957 C CB  . GLU A 1 389 ? 18.597  27.496  -15.831 1.00 47.46 ? 389  GLU A CB  1 
ATOM   2958 C CG  . GLU A 1 389 ? 19.407  26.973  -17.039 1.00 50.34 ? 389  GLU A CG  1 
ATOM   2959 C CD  . GLU A 1 389 ? 20.899  27.354  -16.991 1.00 55.98 ? 389  GLU A CD  1 
ATOM   2960 O OE1 . GLU A 1 389 ? 21.309  28.154  -16.110 1.00 57.41 ? 389  GLU A OE1 1 
ATOM   2961 O OE2 . GLU A 1 389 ? 21.668  26.857  -17.847 1.00 56.81 ? 389  GLU A OE2 1 
ATOM   2962 N N   . ASP A 1 390 ? 16.762  26.689  -12.928 1.00 43.77 ? 390  ASP A N   1 
ATOM   2963 C CA  . ASP A 1 390 ? 16.047  27.282  -11.810 1.00 42.93 ? 390  ASP A CA  1 
ATOM   2964 C C   . ASP A 1 390 ? 16.891  27.322  -10.523 1.00 42.17 ? 390  ASP A C   1 
ATOM   2965 O O   . ASP A 1 390 ? 17.281  26.291  -10.003 1.00 41.59 ? 390  ASP A O   1 
ATOM   2966 C CB  . ASP A 1 390 ? 14.723  26.556  -11.571 1.00 42.88 ? 390  ASP A CB  1 
ATOM   2967 C CG  . ASP A 1 390 ? 13.924  27.181  -10.459 1.00 42.57 ? 390  ASP A CG  1 
ATOM   2968 O OD1 . ASP A 1 390 ? 13.375  28.261  -10.646 1.00 43.96 ? 390  ASP A OD1 1 
ATOM   2969 O OD2 . ASP A 1 390 ? 13.855  26.608  -9.373  1.00 46.20 ? 390  ASP A OD2 1 
ATOM   2970 N N   . PRO A 1 391 ? 17.154  28.526  -10.005 1.00 42.35 ? 391  PRO A N   1 
ATOM   2971 C CA  . PRO A 1 391 ? 18.027  28.749  -8.847  1.00 42.03 ? 391  PRO A CA  1 
ATOM   2972 C C   . PRO A 1 391 ? 17.549  28.092  -7.561  1.00 42.26 ? 391  PRO A C   1 
ATOM   2973 O O   . PRO A 1 391 ? 18.389  27.619  -6.793  1.00 42.71 ? 391  PRO A O   1 
ATOM   2974 C CB  . PRO A 1 391 ? 18.012  30.273  -8.678  1.00 41.94 ? 391  PRO A CB  1 
ATOM   2975 C CG  . PRO A 1 391 ? 17.590  30.808  -9.988  1.00 41.89 ? 391  PRO A CG  1 
ATOM   2976 C CD  . PRO A 1 391 ? 16.618  29.799  -10.523 1.00 42.34 ? 391  PRO A CD  1 
ATOM   2977 N N   . THR A 1 392 ? 16.232  28.069  -7.312  1.00 41.81 ? 392  THR A N   1 
ATOM   2978 C CA  . THR A 1 392 ? 15.707  27.461  -6.085  1.00 41.09 ? 392  THR A CA  1 
ATOM   2979 C C   . THR A 1 392 ? 15.942  25.962  -6.109  1.00 40.83 ? 392  THR A C   1 
ATOM   2980 O O   . THR A 1 392 ? 16.320  25.377  -5.087  1.00 40.03 ? 392  THR A O   1 
ATOM   2981 C CB  . THR A 1 392 ? 14.192  27.764  -5.847  1.00 41.48 ? 392  THR A CB  1 
ATOM   2982 O OG1 . THR A 1 392 ? 14.023  29.147  -5.522  1.00 41.47 ? 392  THR A OG1 1 
ATOM   2983 C CG2 . THR A 1 392 ? 13.623  26.918  -4.689  1.00 40.36 ? 392  THR A CG2 1 
ATOM   2984 N N   . HIS A 1 393 ? 15.705  25.349  -7.270  1.00 40.69 ? 393  HIS A N   1 
ATOM   2985 C CA  . HIS A 1 393 ? 15.917  23.929  -7.411  1.00 41.32 ? 393  HIS A CA  1 
ATOM   2986 C C   . HIS A 1 393 ? 17.394  23.570  -7.255  1.00 40.71 ? 393  HIS A C   1 
ATOM   2987 O O   . HIS A 1 393 ? 17.730  22.641  -6.519  1.00 41.26 ? 393  HIS A O   1 
ATOM   2988 C CB  . HIS A 1 393 ? 15.401  23.373  -8.733  1.00 42.08 ? 393  HIS A CB  1 
ATOM   2989 C CG  . HIS A 1 393 ? 15.868  21.968  -8.983  1.00 46.69 ? 393  HIS A CG  1 
ATOM   2990 N ND1 . HIS A 1 393 ? 15.481  20.903  -8.188  1.00 51.87 ? 393  HIS A ND1 1 
ATOM   2991 C CD2 . HIS A 1 393 ? 16.743  21.462  -9.888  1.00 50.54 ? 393  HIS A CD2 1 
ATOM   2992 C CE1 . HIS A 1 393 ? 16.070  19.798  -8.618  1.00 52.57 ? 393  HIS A CE1 1 
ATOM   2993 N NE2 . HIS A 1 393 ? 16.851  20.113  -9.640  1.00 51.93 ? 393  HIS A NE2 1 
ATOM   2994 N N   . LEU A 1 394 ? 18.266  24.314  -7.930  1.00 39.36 ? 394  LEU A N   1 
ATOM   2995 C CA  . LEU A 1 394 ? 19.696  24.091  -7.841  1.00 38.31 ? 394  LEU A CA  1 
ATOM   2996 C C   . LEU A 1 394 ? 20.190  24.244  -6.397  1.00 38.26 ? 394  LEU A C   1 
ATOM   2997 O O   . LEU A 1 394 ? 21.051  23.506  -5.954  1.00 37.01 ? 394  LEU A O   1 
ATOM   2998 C CB  . LEU A 1 394 ? 20.443  25.015  -8.804  1.00 37.85 ? 394  LEU A CB  1 
ATOM   2999 C CG  . LEU A 1 394 ? 20.136  24.695  -10.276 1.00 36.62 ? 394  LEU A CG  1 
ATOM   3000 C CD1 . LEU A 1 394 ? 20.370  25.897  -11.201 1.00 35.59 ? 394  LEU A CD1 1 
ATOM   3001 C CD2 . LEU A 1 394 ? 20.871  23.432  -10.776 1.00 32.84 ? 394  LEU A CD2 1 
ATOM   3002 N N   . ARG A 1 395 ? 19.601  25.185  -5.664  1.00 38.25 ? 395  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 395 ? 19.956  25.387  -4.280  1.00 38.33 ? 395  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 395 ? 19.598  24.141  -3.474  1.00 38.80 ? 395  ARG A C   1 
ATOM   3005 O O   . ARG A 1 395 ? 20.433  23.610  -2.741  1.00 39.04 ? 395  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 395 ? 19.287  26.645  -3.728  1.00 37.93 ? 395  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 395 ? 19.456  26.858  -2.221  1.00 38.15 ? 395  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 395 ? 18.125  26.702  -1.524  1.00 38.65 ? 395  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 395 ? 17.441  27.979  -1.443  1.00 38.12 ? 395  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 395 ? 16.134  28.157  -1.254  1.00 39.21 ? 395  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 395 ? 15.279  27.134  -1.115  1.00 34.75 ? 395  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 395 ? 15.683  29.404  -1.185  1.00 40.39 ? 395  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 396 ? 18.381  23.638  -3.666  1.00 39.10 ? 396  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 396 ? 17.888  22.513  -2.881  1.00 39.18 ? 396  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 396 ? 18.526  21.208  -3.342  1.00 38.83 ? 396  ASP A C   1 
ATOM   3016 O O   . ASP A 1 396 ? 18.644  20.262  -2.565  1.00 39.06 ? 396  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 396 ? 16.352  22.426  -2.946  1.00 39.10 ? 396  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 396 ? 15.659  23.663  -2.352  1.00 41.31 ? 396  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 396 ? 16.296  24.428  -1.574  1.00 40.70 ? 396  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 396 ? 14.464  23.872  -2.673  1.00 43.06 ? 396  ASP A OD2 1 
ATOM   3021 N N   . ALA A 1 397 ? 18.930  21.159  -4.603  1.00 38.36 ? 397  ALA A N   1 
ATOM   3022 C CA  . ALA A 1 397 ? 19.564  19.955  -5.131  1.00 38.56 ? 397  ALA A CA  1 
ATOM   3023 C C   . ALA A 1 397 ? 20.989  19.830  -4.594  1.00 38.49 ? 397  ALA A C   1 
ATOM   3024 O O   . ALA A 1 397 ? 21.414  18.725  -4.210  1.00 39.22 ? 397  ALA A O   1 
ATOM   3025 C CB  . ALA A 1 397 ? 19.541  19.922  -6.656  1.00 38.00 ? 397  ALA A CB  1 
ATOM   3026 N N   . MET A 1 398 ? 21.707  20.955  -4.544  1.00 37.64 ? 398  MET A N   1 
ATOM   3027 C CA  . MET A 1 398 ? 23.044  20.996  -3.967  1.00 36.72 ? 398  MET A CA  1 
ATOM   3028 C C   . MET A 1 398 ? 22.995  20.440  -2.551  1.00 36.61 ? 398  MET A C   1 
ATOM   3029 O O   . MET A 1 398 ? 23.839  19.642  -2.159  1.00 37.23 ? 398  MET A O   1 
ATOM   3030 C CB  . MET A 1 398 ? 23.591  22.423  -3.940  1.00 36.54 ? 398  MET A CB  1 
ATOM   3031 C CG  . MET A 1 398 ? 25.076  22.523  -3.554  1.00 35.46 ? 398  MET A CG  1 
ATOM   3032 S SD  . MET A 1 398 ? 26.091  21.662  -4.761  1.00 35.77 ? 398  MET A SD  1 
ATOM   3033 C CE  . MET A 1 398 ? 26.561  20.205  -3.857  1.00 32.33 ? 398  MET A CE  1 
ATOM   3034 N N   . SER A 1 399 ? 21.986  20.856  -1.797  1.00 36.03 ? 399  SER A N   1 
ATOM   3035 C CA  . SER A 1 399 ? 21.779  20.385  -0.429  1.00 34.99 ? 399  SER A CA  1 
ATOM   3036 C C   . SER A 1 399 ? 21.570  18.874  -0.384  1.00 34.40 ? 399  SER A C   1 
ATOM   3037 O O   . SER A 1 399 ? 22.171  18.172  0.442   1.00 34.26 ? 399  SER A O   1 
ATOM   3038 C CB  . SER A 1 399 ? 20.576  21.095  0.184   1.00 34.30 ? 399  SER A CB  1 
ATOM   3039 O OG  . SER A 1 399 ? 20.221  20.526  1.435   1.00 34.73 ? 399  SER A OG  1 
ATOM   3040 N N   . ALA A 1 400 ? 20.738  18.384  -1.292  1.00 33.67 ? 400  ALA A N   1 
ATOM   3041 C CA  . ALA A 1 400 ? 20.325  16.986  -1.281  1.00 33.67 ? 400  ALA A CA  1 
ATOM   3042 C C   . ALA A 1 400 ? 21.498  16.082  -1.667  1.00 33.16 ? 400  ALA A C   1 
ATOM   3043 O O   . ALA A 1 400 ? 21.677  15.024  -1.097  1.00 32.44 ? 400  ALA A O   1 
ATOM   3044 C CB  . ALA A 1 400 ? 19.094  16.762  -2.208  1.00 33.43 ? 400  ALA A CB  1 
ATOM   3045 N N   . VAL A 1 401 ? 22.309  16.544  -2.613  1.00 33.63 ? 401  VAL A N   1 
ATOM   3046 C CA  . VAL A 1 401 ? 23.550  15.870  -3.001  1.00 33.89 ? 401  VAL A CA  1 
ATOM   3047 C C   . VAL A 1 401 ? 24.443  15.568  -1.790  1.00 33.76 ? 401  VAL A C   1 
ATOM   3048 O O   . VAL A 1 401 ? 24.935  14.449  -1.628  1.00 33.89 ? 401  VAL A O   1 
ATOM   3049 C CB  . VAL A 1 401 ? 24.329  16.708  -4.054  1.00 34.53 ? 401  VAL A CB  1 
ATOM   3050 C CG1 . VAL A 1 401 ? 25.816  16.257  -4.155  1.00 33.92 ? 401  VAL A CG1 1 
ATOM   3051 C CG2 . VAL A 1 401 ? 23.632  16.631  -5.407  1.00 32.44 ? 401  VAL A CG2 1 
ATOM   3052 N N   . VAL A 1 402 ? 24.597  16.566  -0.932  1.00 33.49 ? 402  VAL A N   1 
ATOM   3053 C CA  . VAL A 1 402 ? 25.494  16.508  0.198   1.00 33.30 ? 402  VAL A CA  1 
ATOM   3054 C C   . VAL A 1 402 ? 24.867  15.740  1.339   1.00 34.24 ? 402  VAL A C   1 
ATOM   3055 O O   . VAL A 1 402 ? 25.545  14.942  2.022   1.00 35.02 ? 402  VAL A O   1 
ATOM   3056 C CB  . VAL A 1 402 ? 25.836  17.922  0.644   1.00 33.01 ? 402  VAL A CB  1 
ATOM   3057 C CG1 . VAL A 1 402 ? 26.533  17.917  1.986   1.00 32.14 ? 402  VAL A CG1 1 
ATOM   3058 C CG2 . VAL A 1 402 ? 26.683  18.586  -0.417  1.00 32.98 ? 402  VAL A CG2 1 
ATOM   3059 N N   . GLY A 1 403 ? 23.570  15.971  1.549   1.00 34.16 ? 403  GLY A N   1 
ATOM   3060 C CA  . GLY A 1 403 ? 22.818  15.183  2.517   1.00 34.29 ? 403  GLY A CA  1 
ATOM   3061 C C   . GLY A 1 403 ? 22.777  13.703  2.173   1.00 34.56 ? 403  GLY A C   1 
ATOM   3062 O O   . GLY A 1 403 ? 22.955  12.863  3.062   1.00 34.65 ? 403  GLY A O   1 
ATOM   3063 N N   . ASP A 1 404 ? 22.551  13.386  0.893   1.00 34.83 ? 404  ASP A N   1 
ATOM   3064 C CA  . ASP A 1 404 ? 22.304  12.011  0.448   1.00 35.68 ? 404  ASP A CA  1 
ATOM   3065 C C   . ASP A 1 404 ? 23.575  11.197  0.412   1.00 36.44 ? 404  ASP A C   1 
ATOM   3066 O O   . ASP A 1 404 ? 23.600  10.059  0.851   1.00 37.43 ? 404  ASP A O   1 
ATOM   3067 C CB  . ASP A 1 404 ? 21.693  11.982  -0.949  1.00 35.80 ? 404  ASP A CB  1 
ATOM   3068 C CG  . ASP A 1 404 ? 20.267  12.461  -0.978  1.00 36.91 ? 404  ASP A CG  1 
ATOM   3069 O OD1 . ASP A 1 404 ? 19.643  12.602  0.099   1.00 37.58 ? 404  ASP A OD1 1 
ATOM   3070 O OD2 . ASP A 1 404 ? 19.762  12.696  -2.100  1.00 40.69 ? 404  ASP A OD2 1 
ATOM   3071 N N   . HIS A 1 405 ? 24.623  11.790  -0.139  1.00 36.74 ? 405  HIS A N   1 
ATOM   3072 C CA  . HIS A 1 405 ? 25.937  11.178  -0.222  1.00 36.71 ? 405  HIS A CA  1 
ATOM   3073 C C   . HIS A 1 405 ? 26.553  10.861  1.146   1.00 36.64 ? 405  HIS A C   1 
ATOM   3074 O O   . HIS A 1 405 ? 27.178  9.816   1.307   1.00 37.76 ? 405  HIS A O   1 
ATOM   3075 C CB  . HIS A 1 405 ? 26.851  12.123  -1.005  1.00 36.41 ? 405  HIS A CB  1 
ATOM   3076 C CG  . HIS A 1 405 ? 28.274  11.679  -1.095  1.00 36.36 ? 405  HIS A CG  1 
ATOM   3077 N ND1 . HIS A 1 405 ? 28.632  10.381  -1.388  1.00 36.16 ? 405  HIS A ND1 1 
ATOM   3078 C CD2 . HIS A 1 405 ? 29.433  12.377  -0.982  1.00 35.83 ? 405  HIS A CD2 1 
ATOM   3079 C CE1 . HIS A 1 405 ? 29.950  10.297  -1.442  1.00 36.97 ? 405  HIS A CE1 1 
ATOM   3080 N NE2 . HIS A 1 405 ? 30.459  11.494  -1.201  1.00 35.50 ? 405  HIS A NE2 1 
ATOM   3081 N N   . ASN A 1 406 ? 26.387  11.755  2.120   1.00 36.06 ? 406  ASN A N   1 
ATOM   3082 C CA  . ASN A 1 406 ? 27.094  11.622  3.393   1.00 35.16 ? 406  ASN A CA  1 
ATOM   3083 C C   . ASN A 1 406 ? 26.303  10.988  4.522   1.00 35.31 ? 406  ASN A C   1 
ATOM   3084 O O   . ASN A 1 406 ? 26.880  10.346  5.403   1.00 35.05 ? 406  ASN A O   1 
ATOM   3085 C CB  . ASN A 1 406 ? 27.600  12.979  3.852   1.00 34.95 ? 406  ASN A CB  1 
ATOM   3086 C CG  . ASN A 1 406 ? 28.711  13.493  2.983   1.00 33.89 ? 406  ASN A CG  1 
ATOM   3087 O OD1 . ASN A 1 406 ? 29.782  12.883  2.902   1.00 33.07 ? 406  ASN A OD1 1 
ATOM   3088 N ND2 . ASN A 1 406 ? 28.460  14.612  2.303   1.00 30.88 ? 406  ASN A ND2 1 
ATOM   3089 N N   . VAL A 1 407 ? 24.989  11.186  4.510   1.00 35.40 ? 407  VAL A N   1 
ATOM   3090 C CA  . VAL A 1 407 ? 24.156  10.706  5.592   1.00 35.88 ? 407  VAL A CA  1 
ATOM   3091 C C   . VAL A 1 407 ? 23.051  9.759   5.124   1.00 36.60 ? 407  VAL A C   1 
ATOM   3092 O O   . VAL A 1 407 ? 23.072  8.600   5.497   1.00 36.25 ? 407  VAL A O   1 
ATOM   3093 C CB  . VAL A 1 407 ? 23.572  11.866  6.430   1.00 35.65 ? 407  VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 407 ? 22.648  11.326  7.530   1.00 35.66 ? 407  VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 407 ? 24.685  12.674  7.056   1.00 35.19 ? 407  VAL A CG2 1 
ATOM   3096 N N   . VAL A 1 408 ? 22.110  10.251  4.303   1.00 37.34 ? 408  VAL A N   1 
ATOM   3097 C CA  . VAL A 1 408 ? 20.874  9.524   4.011   1.00 37.46 ? 408  VAL A CA  1 
ATOM   3098 C C   . VAL A 1 408 ? 21.127  8.171   3.366   1.00 38.58 ? 408  VAL A C   1 
ATOM   3099 O O   . VAL A 1 408 ? 20.524  7.177   3.772   1.00 38.87 ? 408  VAL A O   1 
ATOM   3100 C CB  . VAL A 1 408 ? 19.862  10.337  3.146   1.00 37.50 ? 408  VAL A CB  1 
ATOM   3101 C CG1 . VAL A 1 408 ? 18.602  9.546   2.938   1.00 35.19 ? 408  VAL A CG1 1 
ATOM   3102 C CG2 . VAL A 1 408 ? 19.512  11.658  3.808   1.00 36.90 ? 408  VAL A CG2 1 
ATOM   3103 N N   . CYS A 1 409 ? 22.022  8.130   2.382   1.00 38.80 ? 409  CYS A N   1 
ATOM   3104 C CA  . CYS A 1 409 ? 22.308  6.882   1.690   1.00 39.58 ? 409  CYS A CA  1 
ATOM   3105 C C   . CYS A 1 409 ? 23.228  5.894   2.446   1.00 39.96 ? 409  CYS A C   1 
ATOM   3106 O O   . CYS A 1 409 ? 22.992  4.677   2.395   1.00 40.75 ? 409  CYS A O   1 
ATOM   3107 C CB  . CYS A 1 409 ? 22.758  7.141   0.247   1.00 39.88 ? 409  CYS A CB  1 
ATOM   3108 S SG  . CYS A 1 409 ? 21.388  7.791   -0.780  1.00 40.11 ? 409  CYS A SG  1 
ATOM   3109 N N   . PRO A 1 410 ? 24.298  6.386   3.104   1.00 39.66 ? 410  PRO A N   1 
ATOM   3110 C CA  . PRO A 1 410 ? 24.944  5.539   4.111   1.00 39.37 ? 410  PRO A CA  1 
ATOM   3111 C C   . PRO A 1 410 ? 24.003  4.942   5.173   1.00 39.13 ? 410  PRO A C   1 
ATOM   3112 O O   . PRO A 1 410 ? 24.166  3.781   5.550   1.00 38.91 ? 410  PRO A O   1 
ATOM   3113 C CB  . PRO A 1 410 ? 25.963  6.484   4.741   1.00 39.18 ? 410  PRO A CB  1 
ATOM   3114 C CG  . PRO A 1 410 ? 26.355  7.357   3.584   1.00 39.86 ? 410  PRO A CG  1 
ATOM   3115 C CD  . PRO A 1 410 ? 25.046  7.641   2.906   1.00 39.40 ? 410  PRO A CD  1 
ATOM   3116 N N   . VAL A 1 411 ? 23.040  5.716   5.659   1.00 39.25 ? 411  VAL A N   1 
ATOM   3117 C CA  . VAL A 1 411 ? 22.075  5.178   6.620   1.00 39.44 ? 411  VAL A CA  1 
ATOM   3118 C C   . VAL A 1 411 ? 21.222  4.063   5.981   1.00 39.97 ? 411  VAL A C   1 
ATOM   3119 O O   . VAL A 1 411 ? 21.041  3.009   6.589   1.00 40.11 ? 411  VAL A O   1 
ATOM   3120 C CB  . VAL A 1 411 ? 21.220  6.282   7.253   1.00 39.27 ? 411  VAL A CB  1 
ATOM   3121 C CG1 . VAL A 1 411 ? 19.951  5.715   7.888   1.00 39.11 ? 411  VAL A CG1 1 
ATOM   3122 C CG2 . VAL A 1 411 ? 22.022  7.017   8.283   1.00 38.37 ? 411  VAL A CG2 1 
ATOM   3123 N N   . ALA A 1 412 ? 20.749  4.282   4.750   1.00 40.21 ? 412  ALA A N   1 
ATOM   3124 C CA  . ALA A 1 412 ? 19.969  3.278   4.017   1.00 40.84 ? 412  ALA A CA  1 
ATOM   3125 C C   . ALA A 1 412 ? 20.751  1.973   3.824   1.00 41.20 ? 412  ALA A C   1 
ATOM   3126 O O   . ALA A 1 412 ? 20.247  0.888   4.134   1.00 41.28 ? 412  ALA A O   1 
ATOM   3127 C CB  . ALA A 1 412 ? 19.499  3.830   2.680   1.00 40.79 ? 412  ALA A CB  1 
ATOM   3128 N N   . GLN A 1 413 ? 21.985  2.096   3.341   1.00 41.33 ? 413  GLN A N   1 
ATOM   3129 C CA  . GLN A 1 413 ? 22.905  0.975   3.231   1.00 42.02 ? 413  GLN A CA  1 
ATOM   3130 C C   . GLN A 1 413 ? 23.028  0.215   4.561   1.00 42.20 ? 413  GLN A C   1 
ATOM   3131 O O   . GLN A 1 413 ? 22.983  -1.017  4.587   1.00 41.81 ? 413  GLN A O   1 
ATOM   3132 C CB  . GLN A 1 413 ? 24.266  1.497   2.820   1.00 42.81 ? 413  GLN A CB  1 
ATOM   3133 C CG  . GLN A 1 413 ? 25.328  0.447   2.677   1.00 45.76 ? 413  GLN A CG  1 
ATOM   3134 C CD  . GLN A 1 413 ? 25.582  0.139   1.246   1.00 51.83 ? 413  GLN A CD  1 
ATOM   3135 O OE1 . GLN A 1 413 ? 24.690  -0.333  0.522   1.00 54.75 ? 413  GLN A OE1 1 
ATOM   3136 N NE2 . GLN A 1 413 ? 26.801  0.431   0.796   1.00 54.73 ? 413  GLN A NE2 1 
ATOM   3137 N N   . LEU A 1 414 ? 23.173  0.960   5.661   1.00 42.17 ? 414  LEU A N   1 
ATOM   3138 C CA  . LEU A 1 414 ? 23.306  0.356   6.974   1.00 41.71 ? 414  LEU A CA  1 
ATOM   3139 C C   . LEU A 1 414 ? 22.053  -0.394  7.407   1.00 41.93 ? 414  LEU A C   1 
ATOM   3140 O O   . LEU A 1 414 ? 22.156  -1.561  7.790   1.00 41.16 ? 414  LEU A O   1 
ATOM   3141 C CB  . LEU A 1 414 ? 23.700  1.378   8.032   1.00 41.42 ? 414  LEU A CB  1 
ATOM   3142 C CG  . LEU A 1 414 ? 24.066  0.831   9.414   1.00 41.01 ? 414  LEU A CG  1 
ATOM   3143 C CD1 . LEU A 1 414 ? 25.339  -0.040  9.357   1.00 42.67 ? 414  LEU A CD1 1 
ATOM   3144 C CD2 . LEU A 1 414 ? 24.257  1.974   10.374  1.00 41.13 ? 414  LEU A CD2 1 
ATOM   3145 N N   . ALA A 1 415 ? 20.893  0.271   7.360   1.00 42.25 ? 415  ALA A N   1 
ATOM   3146 C CA  . ALA A 1 415 ? 19.622  -0.347  7.761   1.00 42.53 ? 415  ALA A CA  1 
ATOM   3147 C C   . ALA A 1 415 ? 19.387  -1.641  6.980   1.00 43.75 ? 415  ALA A C   1 
ATOM   3148 O O   . ALA A 1 415 ? 19.107  -2.686  7.572   1.00 43.25 ? 415  ALA A O   1 
ATOM   3149 C CB  . ALA A 1 415 ? 18.484  0.603   7.565   1.00 41.90 ? 415  ALA A CB  1 
ATOM   3150 N N   . GLY A 1 416 ? 19.552  -1.561  5.657   1.00 45.00 ? 416  GLY A N   1 
ATOM   3151 C CA  . GLY A 1 416 ? 19.437  -2.710  4.764   1.00 46.82 ? 416  GLY A CA  1 
ATOM   3152 C C   . GLY A 1 416 ? 20.394  -3.856  5.057   1.00 48.14 ? 416  GLY A C   1 
ATOM   3153 O O   . GLY A 1 416 ? 19.971  -5.013  5.135   1.00 48.83 ? 416  GLY A O   1 
ATOM   3154 N N   . ARG A 1 417 ? 21.679  -3.558  5.216   1.00 48.84 ? 417  ARG A N   1 
ATOM   3155 C CA  . ARG A 1 417 ? 22.643  -4.616  5.463   1.00 49.79 ? 417  ARG A CA  1 
ATOM   3156 C C   . ARG A 1 417 ? 22.463  -5.252  6.842   1.00 49.90 ? 417  ARG A C   1 
ATOM   3157 O O   . ARG A 1 417 ? 22.624  -6.462  6.981   1.00 50.22 ? 417  ARG A O   1 
ATOM   3158 C CB  . ARG A 1 417 ? 24.085  -4.140  5.251   1.00 50.43 ? 417  ARG A CB  1 
ATOM   3159 C CG  . ARG A 1 417 ? 24.493  -3.858  3.785   1.00 53.62 ? 417  ARG A CG  1 
ATOM   3160 C CD  . ARG A 1 417 ? 24.005  -4.924  2.777   1.00 59.49 ? 417  ARG A CD  1 
ATOM   3161 N NE  . ARG A 1 417 ? 24.565  -6.257  3.024   1.00 64.04 ? 417  ARG A NE  1 
ATOM   3162 C CZ  . ARG A 1 417 ? 25.392  -6.913  2.202   1.00 66.48 ? 417  ARG A CZ  1 
ATOM   3163 N NH1 . ARG A 1 417 ? 25.775  -6.375  1.041   1.00 65.66 ? 417  ARG A NH1 1 
ATOM   3164 N NH2 . ARG A 1 417 ? 25.838  -8.123  2.548   1.00 66.70 ? 417  ARG A NH2 1 
ATOM   3165 N N   . LEU A 1 418 ? 22.116  -4.449  7.848   1.00 49.67 ? 418  LEU A N   1 
ATOM   3166 C CA  . LEU A 1 418 ? 21.930  -4.970  9.196   1.00 49.60 ? 418  LEU A CA  1 
ATOM   3167 C C   . LEU A 1 418 ? 20.647  -5.807  9.285   1.00 50.06 ? 418  LEU A C   1 
ATOM   3168 O O   . LEU A 1 418 ? 20.616  -6.826  9.971   1.00 49.87 ? 418  LEU A O   1 
ATOM   3169 C CB  . LEU A 1 418 ? 21.925  -3.854  10.263  1.00 49.28 ? 418  LEU A CB  1 
ATOM   3170 C CG  . LEU A 1 418 ? 23.098  -2.890  10.530  1.00 48.96 ? 418  LEU A CG  1 
ATOM   3171 C CD1 . LEU A 1 418 ? 22.753  -1.983  11.681  1.00 47.66 ? 418  LEU A CD1 1 
ATOM   3172 C CD2 . LEU A 1 418 ? 24.423  -3.578  10.820  1.00 48.93 ? 418  LEU A CD2 1 
ATOM   3173 N N   . ALA A 1 419 ? 19.600  -5.374  8.591   1.00 50.52 ? 419  ALA A N   1 
ATOM   3174 C CA  . ALA A 1 419 ? 18.319  -6.071  8.598   1.00 51.19 ? 419  ALA A CA  1 
ATOM   3175 C C   . ALA A 1 419 ? 18.418  -7.441  7.911   1.00 52.26 ? 419  ALA A C   1 
ATOM   3176 O O   . ALA A 1 419 ? 17.947  -8.451  8.445   1.00 52.00 ? 419  ALA A O   1 
ATOM   3177 C CB  . ALA A 1 419 ? 17.254  -5.226  7.931   1.00 50.69 ? 419  ALA A CB  1 
ATOM   3178 N N   . ALA A 1 420 ? 19.051  -7.458  6.737   1.00 53.25 ? 420  ALA A N   1 
ATOM   3179 C CA  . ALA A 1 420 ? 19.236  -8.669  5.948   1.00 53.98 ? 420  ALA A CA  1 
ATOM   3180 C C   . ALA A 1 420 ? 19.967  -9.735  6.737   1.00 54.46 ? 420  ALA A C   1 
ATOM   3181 O O   . ALA A 1 420 ? 19.998  -10.901 6.331   1.00 55.24 ? 420  ALA A O   1 
ATOM   3182 C CB  . ALA A 1 420 ? 20.005  -8.358  4.665   1.00 54.00 ? 420  ALA A CB  1 
ATOM   3183 N N   . GLN A 1 421 ? 20.538  -9.338  7.870   1.00 54.42 ? 421  GLN A N   1 
ATOM   3184 C CA  . GLN A 1 421 ? 21.495  -10.184 8.575   1.00 54.50 ? 421  GLN A CA  1 
ATOM   3185 C C   . GLN A 1 421 ? 21.166  -10.337 10.045  1.00 53.80 ? 421  GLN A C   1 
ATOM   3186 O O   . GLN A 1 421 ? 22.063  -10.561 10.879  1.00 53.57 ? 421  GLN A O   1 
ATOM   3187 C CB  . GLN A 1 421 ? 22.913  -9.657  8.376   1.00 54.53 ? 421  GLN A CB  1 
ATOM   3188 C CG  . GLN A 1 421 ? 23.323  -9.662  6.914   1.00 57.71 ? 421  GLN A CG  1 
ATOM   3189 C CD  . GLN A 1 421 ? 24.783  -9.332  6.716   1.00 62.25 ? 421  GLN A CD  1 
ATOM   3190 O OE1 . GLN A 1 421 ? 25.170  -8.762  5.687   1.00 65.21 ? 421  GLN A OE1 1 
ATOM   3191 N NE2 . GLN A 1 421 ? 25.610  -9.688  7.695   1.00 62.84 ? 421  GLN A NE2 1 
ATOM   3192 N N   . GLY A 1 422 ? 19.876  -10.200 10.350  1.00 53.01 ? 422  GLY A N   1 
ATOM   3193 C CA  . GLY A 1 422 ? 19.338  -10.611 11.637  1.00 52.78 ? 422  GLY A CA  1 
ATOM   3194 C C   . GLY A 1 422 ? 18.905  -9.530  12.602  1.00 52.53 ? 422  GLY A C   1 
ATOM   3195 O O   . GLY A 1 422 ? 18.093  -9.793  13.508  1.00 52.97 ? 422  GLY A O   1 
ATOM   3196 N N   . ALA A 1 423 ? 19.440  -8.324  12.426  1.00 51.51 ? 423  ALA A N   1 
ATOM   3197 C CA  . ALA A 1 423 ? 19.197  -7.243  13.375  1.00 50.40 ? 423  ALA A CA  1 
ATOM   3198 C C   . ALA A 1 423 ? 17.755  -6.797  13.333  1.00 49.45 ? 423  ALA A C   1 
ATOM   3199 O O   . ALA A 1 423 ? 17.129  -6.829  12.287  1.00 49.48 ? 423  ALA A O   1 
ATOM   3200 C CB  . ALA A 1 423 ? 20.115  -6.074  13.089  1.00 50.55 ? 423  ALA A CB  1 
ATOM   3201 N N   . ARG A 1 424 ? 17.226  -6.403  14.479  1.00 48.67 ? 424  ARG A N   1 
ATOM   3202 C CA  . ARG A 1 424 ? 15.960  -5.697  14.500  1.00 48.46 ? 424  ARG A CA  1 
ATOM   3203 C C   . ARG A 1 424 ? 16.255  -4.205  14.320  1.00 47.19 ? 424  ARG A C   1 
ATOM   3204 O O   . ARG A 1 424 ? 16.941  -3.603  15.145  1.00 46.86 ? 424  ARG A O   1 
ATOM   3205 C CB  . ARG A 1 424 ? 15.196  -5.966  15.797  1.00 48.78 ? 424  ARG A CB  1 
ATOM   3206 C CG  . ARG A 1 424 ? 13.724  -5.600  15.695  1.00 52.07 ? 424  ARG A CG  1 
ATOM   3207 C CD  . ARG A 1 424 ? 12.841  -6.510  16.551  1.00 58.77 ? 424  ARG A CD  1 
ATOM   3208 N NE  . ARG A 1 424 ? 12.469  -5.911  17.843  1.00 62.95 ? 424  ARG A NE  1 
ATOM   3209 C CZ  . ARG A 1 424 ? 12.743  -6.439  19.043  1.00 65.67 ? 424  ARG A CZ  1 
ATOM   3210 N NH1 . ARG A 1 424 ? 13.412  -7.592  19.146  1.00 66.25 ? 424  ARG A NH1 1 
ATOM   3211 N NH2 . ARG A 1 424 ? 12.336  -5.813  20.152  1.00 65.56 ? 424  ARG A NH2 1 
ATOM   3212 N N   . VAL A 1 425 ? 15.743  -3.635  13.232  1.00 46.20 ? 425  VAL A N   1 
ATOM   3213 C CA  . VAL A 1 425 ? 16.047  -2.266  12.819  1.00 45.06 ? 425  VAL A CA  1 
ATOM   3214 C C   . VAL A 1 425 ? 14.776  -1.441  12.757  1.00 44.94 ? 425  VAL A C   1 
ATOM   3215 O O   . VAL A 1 425 ? 13.835  -1.820  12.076  1.00 44.60 ? 425  VAL A O   1 
ATOM   3216 C CB  . VAL A 1 425 ? 16.683  -2.221  11.402  1.00 44.93 ? 425  VAL A CB  1 
ATOM   3217 C CG1 . VAL A 1 425 ? 17.163  -0.791  11.072  1.00 44.11 ? 425  VAL A CG1 1 
ATOM   3218 C CG2 . VAL A 1 425 ? 17.812  -3.237  11.260  1.00 43.79 ? 425  VAL A CG2 1 
ATOM   3219 N N   . TYR A 1 426 ? 14.761  -0.316  13.463  1.00 44.92 ? 426  TYR A N   1 
ATOM   3220 C CA  . TYR A 1 426 ? 13.701  0.680   13.336  1.00 44.98 ? 426  TYR A CA  1 
ATOM   3221 C C   . TYR A 1 426 ? 14.278  1.919   12.671  1.00 44.65 ? 426  TYR A C   1 
ATOM   3222 O O   . TYR A 1 426 ? 15.443  2.269   12.905  1.00 44.60 ? 426  TYR A O   1 
ATOM   3223 C CB  . TYR A 1 426 ? 13.112  1.015   14.703  1.00 45.73 ? 426  TYR A CB  1 
ATOM   3224 C CG  . TYR A 1 426 ? 12.406  -0.159  15.339  1.00 46.90 ? 426  TYR A CG  1 
ATOM   3225 C CD1 . TYR A 1 426 ? 13.112  -1.084  16.116  1.00 47.37 ? 426  TYR A CD1 1 
ATOM   3226 C CD2 . TYR A 1 426 ? 11.029  -0.370  15.140  1.00 47.55 ? 426  TYR A CD2 1 
ATOM   3227 C CE1 . TYR A 1 426 ? 12.474  -2.182  16.698  1.00 48.12 ? 426  TYR A CE1 1 
ATOM   3228 C CE2 . TYR A 1 426 ? 10.375  -1.467  15.719  1.00 46.96 ? 426  TYR A CE2 1 
ATOM   3229 C CZ  . TYR A 1 426 ? 11.103  -2.364  16.496  1.00 48.44 ? 426  TYR A CZ  1 
ATOM   3230 O OH  . TYR A 1 426 ? 10.478  -3.452  17.065  1.00 49.23 ? 426  TYR A OH  1 
ATOM   3231 N N   . ALA A 1 427 ? 13.477  2.571   11.832  1.00 43.80 ? 427  ALA A N   1 
ATOM   3232 C CA  . ALA A 1 427 ? 13.985  3.628   10.977  1.00 42.96 ? 427  ALA A CA  1 
ATOM   3233 C C   . ALA A 1 427 ? 13.070  4.823   10.964  1.00 42.96 ? 427  ALA A C   1 
ATOM   3234 O O   . ALA A 1 427 ? 11.852  4.664   10.831  1.00 43.96 ? 427  ALA A O   1 
ATOM   3235 C CB  . ALA A 1 427 ? 14.185  3.106   9.572   1.00 43.04 ? 427  ALA A CB  1 
ATOM   3236 N N   . TYR A 1 428 ? 13.650  6.018   11.090  1.00 42.42 ? 428  TYR A N   1 
ATOM   3237 C CA  . TYR A 1 428 ? 12.878  7.270   11.101  1.00 41.85 ? 428  TYR A CA  1 
ATOM   3238 C C   . TYR A 1 428 ? 13.457  8.332   10.157  1.00 41.96 ? 428  TYR A C   1 
ATOM   3239 O O   . TYR A 1 428 ? 14.619  8.253   9.737   1.00 41.92 ? 428  TYR A O   1 
ATOM   3240 C CB  . TYR A 1 428 ? 12.777  7.849   12.521  1.00 41.51 ? 428  TYR A CB  1 
ATOM   3241 C CG  . TYR A 1 428 ? 14.086  8.419   13.043  1.00 41.38 ? 428  TYR A CG  1 
ATOM   3242 C CD1 . TYR A 1 428 ? 14.446  9.744   12.786  1.00 40.50 ? 428  TYR A CD1 1 
ATOM   3243 C CD2 . TYR A 1 428 ? 14.968  7.630   13.772  1.00 40.01 ? 428  TYR A CD2 1 
ATOM   3244 C CE1 . TYR A 1 428 ? 15.645  10.268  13.246  1.00 40.60 ? 428  TYR A CE1 1 
ATOM   3245 C CE2 . TYR A 1 428 ? 16.173  8.143   14.242  1.00 41.27 ? 428  TYR A CE2 1 
ATOM   3246 C CZ  . TYR A 1 428 ? 16.509  9.462   13.977  1.00 42.05 ? 428  TYR A CZ  1 
ATOM   3247 O OH  . TYR A 1 428 ? 17.705  9.974   14.441  1.00 41.59 ? 428  TYR A OH  1 
ATOM   3248 N N   . ILE A 1 429 ? 12.617  9.305   9.808   1.00 41.32 ? 429  ILE A N   1 
ATOM   3249 C CA  . ILE A 1 429 ? 13.064  10.558  9.230   1.00 40.62 ? 429  ILE A CA  1 
ATOM   3250 C C   . ILE A 1 429 ? 12.448  11.637  10.113  1.00 40.58 ? 429  ILE A C   1 
ATOM   3251 O O   . ILE A 1 429 ? 11.240  11.621  10.372  1.00 41.06 ? 429  ILE A O   1 
ATOM   3252 C CB  . ILE A 1 429 ? 12.643  10.738  7.748   1.00 40.80 ? 429  ILE A CB  1 
ATOM   3253 C CG1 . ILE A 1 429 ? 13.094  12.120  7.239   1.00 40.25 ? 429  ILE A CG1 1 
ATOM   3254 C CG2 . ILE A 1 429 ? 11.126  10.543  7.569   1.00 40.28 ? 429  ILE A CG2 1 
ATOM   3255 C CD1 . ILE A 1 429 ? 12.964  12.312  5.742   1.00 40.53 ? 429  ILE A CD1 1 
ATOM   3256 N N   . PHE A 1 430 ? 13.279  12.550  10.598  1.00 39.65 ? 430  PHE A N   1 
ATOM   3257 C CA  . PHE A 1 430 ? 12.826  13.614  11.482  1.00 39.06 ? 430  PHE A CA  1 
ATOM   3258 C C   . PHE A 1 430 ? 12.552  14.864  10.652  1.00 39.34 ? 430  PHE A C   1 
ATOM   3259 O O   . PHE A 1 430 ? 13.419  15.312  9.924   1.00 39.70 ? 430  PHE A O   1 
ATOM   3260 C CB  . PHE A 1 430 ? 13.904  13.868  12.537  1.00 38.18 ? 430  PHE A CB  1 
ATOM   3261 C CG  . PHE A 1 430 ? 13.527  14.890  13.554  1.00 36.67 ? 430  PHE A CG  1 
ATOM   3262 C CD1 . PHE A 1 430 ? 13.792  16.243  13.333  1.00 34.00 ? 430  PHE A CD1 1 
ATOM   3263 C CD2 . PHE A 1 430 ? 12.930  14.507  14.746  1.00 34.45 ? 430  PHE A CD2 1 
ATOM   3264 C CE1 . PHE A 1 430 ? 13.448  17.194  14.272  1.00 32.44 ? 430  PHE A CE1 1 
ATOM   3265 C CE2 . PHE A 1 430 ? 12.591  15.462  15.699  1.00 35.20 ? 430  PHE A CE2 1 
ATOM   3266 C CZ  . PHE A 1 430 ? 12.841  16.807  15.452  1.00 33.87 ? 430  PHE A CZ  1 
ATOM   3267 N N   . GLU A 1 431 ? 11.348  15.421  10.759  1.00 40.41 ? 431  GLU A N   1 
ATOM   3268 C CA  . GLU A 1 431 ? 10.885  16.445  9.813   1.00 40.79 ? 431  GLU A CA  1 
ATOM   3269 C C   . GLU A 1 431 ? 10.356  17.725  10.442  1.00 41.20 ? 431  GLU A C   1 
ATOM   3270 O O   . GLU A 1 431 ? 9.897   18.619  9.723   1.00 41.22 ? 431  GLU A O   1 
ATOM   3271 C CB  . GLU A 1 431 ? 9.769   15.898  8.935   1.00 40.95 ? 431  GLU A CB  1 
ATOM   3272 C CG  . GLU A 1 431 ? 10.122  14.749  8.035   1.00 42.63 ? 431  GLU A CG  1 
ATOM   3273 C CD  . GLU A 1 431 ? 8.977   14.414  7.094   1.00 45.50 ? 431  GLU A CD  1 
ATOM   3274 O OE1 . GLU A 1 431 ? 7.797   14.483  7.549   1.00 45.95 ? 431  GLU A OE1 1 
ATOM   3275 O OE2 . GLU A 1 431 ? 9.261   14.093  5.910   1.00 44.04 ? 431  GLU A OE2 1 
ATOM   3276 N N   . HIS A 1 432 ? 10.391  17.833  11.762  1.00 41.46 ? 432  HIS A N   1 
ATOM   3277 C CA  . HIS A 1 432 ? 9.954   19.073  12.374  1.00 42.40 ? 432  HIS A CA  1 
ATOM   3278 C C   . HIS A 1 432 ? 11.099  20.085  12.588  1.00 42.82 ? 432  HIS A C   1 
ATOM   3279 O O   . HIS A 1 432 ? 12.093  19.787  13.257  1.00 42.72 ? 432  HIS A O   1 
ATOM   3280 C CB  . HIS A 1 432 ? 9.213   18.804  13.681  1.00 42.41 ? 432  HIS A CB  1 
ATOM   3281 C CG  . HIS A 1 432 ? 8.827   20.050  14.402  1.00 43.23 ? 432  HIS A CG  1 
ATOM   3282 N ND1 . HIS A 1 432 ? 7.900   20.937  13.901  1.00 44.97 ? 432  HIS A ND1 1 
ATOM   3283 C CD2 . HIS A 1 432 ? 9.267   20.581  15.566  1.00 44.41 ? 432  HIS A CD2 1 
ATOM   3284 C CE1 . HIS A 1 432 ? 7.773   21.955  14.735  1.00 45.39 ? 432  HIS A CE1 1 
ATOM   3285 N NE2 . HIS A 1 432 ? 8.589   21.762  15.754  1.00 44.79 ? 432  HIS A NE2 1 
ATOM   3286 N N   . ARG A 1 433 ? 10.944  21.278  12.023  1.00 43.33 ? 433  ARG A N   1 
ATOM   3287 C CA  . ARG A 1 433 ? 11.901  22.367  12.234  1.00 44.59 ? 433  ARG A CA  1 
ATOM   3288 C C   . ARG A 1 433 ? 11.548  23.153  13.498  1.00 45.25 ? 433  ARG A C   1 
ATOM   3289 O O   . ARG A 1 433 ? 10.430  23.680  13.623  1.00 45.85 ? 433  ARG A O   1 
ATOM   3290 C CB  . ARG A 1 433 ? 11.949  23.294  11.010  1.00 44.48 ? 433  ARG A CB  1 
ATOM   3291 C CG  . ARG A 1 433 ? 12.367  24.725  11.324  1.00 45.56 ? 433  ARG A CG  1 
ATOM   3292 C CD  . ARG A 1 433 ? 12.103  25.673  10.176  1.00 44.88 ? 433  ARG A CD  1 
ATOM   3293 N NE  . ARG A 1 433 ? 13.339  25.932  9.476   1.00 46.26 ? 433  ARG A NE  1 
ATOM   3294 C CZ  . ARG A 1 433 ? 14.113  26.994  9.664   1.00 45.74 ? 433  ARG A CZ  1 
ATOM   3295 N NH1 . ARG A 1 433 ? 13.775  27.933  10.520  1.00 44.88 ? 433  ARG A NH1 1 
ATOM   3296 N NH2 . ARG A 1 433 ? 15.241  27.104  8.978   1.00 47.04 ? 433  ARG A NH2 1 
ATOM   3297 N N   . ALA A 1 434 ? 12.498  23.237  14.428  1.00 45.39 ? 434  ALA A N   1 
ATOM   3298 C CA  . ALA A 1 434 ? 12.272  23.929  15.686  1.00 45.50 ? 434  ALA A CA  1 
ATOM   3299 C C   . ALA A 1 434 ? 11.767  25.334  15.401  1.00 46.01 ? 434  ALA A C   1 
ATOM   3300 O O   . ALA A 1 434 ? 12.287  26.014  14.511  1.00 46.12 ? 434  ALA A O   1 
ATOM   3301 C CB  . ALA A 1 434 ? 13.561  23.982  16.510  1.00 45.58 ? 434  ALA A CB  1 
ATOM   3302 N N   . SER A 1 435 ? 10.748  25.767  16.144  1.00 46.14 ? 435  SER A N   1 
ATOM   3303 C CA  . SER A 1 435 ? 10.249  27.131  16.002  1.00 46.40 ? 435  SER A CA  1 
ATOM   3304 C C   . SER A 1 435 ? 11.336  28.139  16.402  1.00 46.66 ? 435  SER A C   1 
ATOM   3305 O O   . SER A 1 435 ? 11.367  29.260  15.895  1.00 46.56 ? 435  SER A O   1 
ATOM   3306 C CB  . SER A 1 435 ? 8.982   27.344  16.827  1.00 46.18 ? 435  SER A CB  1 
ATOM   3307 O OG  . SER A 1 435 ? 9.267   27.390  18.208  1.00 46.07 ? 435  SER A OG  1 
ATOM   3308 N N   . THR A 1 436 ? 12.232  27.708  17.288  1.00 46.46 ? 436  THR A N   1 
ATOM   3309 C CA  . THR A 1 436 ? 13.301  28.555  17.816  1.00 46.82 ? 436  THR A CA  1 
ATOM   3310 C C   . THR A 1 436 ? 14.561  28.602  16.957  1.00 46.36 ? 436  THR A C   1 
ATOM   3311 O O   . THR A 1 436 ? 15.524  29.266  17.325  1.00 46.61 ? 436  THR A O   1 
ATOM   3312 C CB  . THR A 1 436 ? 13.749  28.078  19.220  1.00 47.08 ? 436  THR A CB  1 
ATOM   3313 O OG1 . THR A 1 436 ? 14.198  26.718  19.147  1.00 47.78 ? 436  THR A OG1 1 
ATOM   3314 C CG2 . THR A 1 436 ? 12.600  28.167  20.213  1.00 48.23 ? 436  THR A CG2 1 
ATOM   3315 N N   . LEU A 1 437 ? 14.567  27.891  15.837  1.00 46.00 ? 437  LEU A N   1 
ATOM   3316 C CA  . LEU A 1 437 ? 15.767  27.766  15.004  1.00 46.19 ? 437  LEU A CA  1 
ATOM   3317 C C   . LEU A 1 437 ? 16.242  29.127  14.496  1.00 46.04 ? 437  LEU A C   1 
ATOM   3318 O O   . LEU A 1 437 ? 15.419  29.965  14.113  1.00 46.15 ? 437  LEU A O   1 
ATOM   3319 C CB  . LEU A 1 437 ? 15.479  26.840  13.823  1.00 45.93 ? 437  LEU A CB  1 
ATOM   3320 C CG  . LEU A 1 437 ? 16.619  26.266  12.994  1.00 46.36 ? 437  LEU A CG  1 
ATOM   3321 C CD1 . LEU A 1 437 ? 17.625  25.550  13.848  1.00 46.52 ? 437  LEU A CD1 1 
ATOM   3322 C CD2 . LEU A 1 437 ? 16.040  25.295  11.991  1.00 46.94 ? 437  LEU A CD2 1 
ATOM   3323 N N   . THR A 1 438 ? 17.555  29.350  14.486  1.00 45.24 ? 438  THR A N   1 
ATOM   3324 C CA  . THR A 1 438 ? 18.075  30.640  14.050  1.00 45.05 ? 438  THR A CA  1 
ATOM   3325 C C   . THR A 1 438 ? 18.754  30.584  12.686  1.00 44.57 ? 438  THR A C   1 
ATOM   3326 O O   . THR A 1 438 ? 19.261  31.603  12.201  1.00 44.85 ? 438  THR A O   1 
ATOM   3327 C CB  . THR A 1 438 ? 19.065  31.254  15.075  1.00 45.53 ? 438  THR A CB  1 
ATOM   3328 O OG1 . THR A 1 438 ? 20.253  30.450  15.147  1.00 46.22 ? 438  THR A OG1 1 
ATOM   3329 C CG2 . THR A 1 438 ? 18.431  31.364  16.461  1.00 45.78 ? 438  THR A CG2 1 
ATOM   3330 N N   . TRP A 1 439 ? 18.792  29.401  12.074  1.00 43.79 ? 439  TRP A N   1 
ATOM   3331 C CA  . TRP A 1 439 ? 19.303  29.269  10.716  1.00 42.48 ? 439  TRP A CA  1 
ATOM   3332 C C   . TRP A 1 439 ? 18.173  29.660  9.766   1.00 42.61 ? 439  TRP A C   1 
ATOM   3333 O O   . TRP A 1 439 ? 16.988  29.537  10.116  1.00 42.79 ? 439  TRP A O   1 
ATOM   3334 C CB  . TRP A 1 439 ? 19.768  27.849  10.427  1.00 41.82 ? 439  TRP A CB  1 
ATOM   3335 C CG  . TRP A 1 439 ? 21.018  27.449  11.143  1.00 41.22 ? 439  TRP A CG  1 
ATOM   3336 C CD1 . TRP A 1 439 ? 21.104  26.709  12.282  1.00 40.68 ? 439  TRP A CD1 1 
ATOM   3337 C CD2 . TRP A 1 439 ? 22.363  27.749  10.757  1.00 39.69 ? 439  TRP A CD2 1 
ATOM   3338 N NE1 . TRP A 1 439 ? 22.420  26.554  12.651  1.00 39.65 ? 439  TRP A NE1 1 
ATOM   3339 C CE2 . TRP A 1 439 ? 23.214  27.172  11.725  1.00 39.27 ? 439  TRP A CE2 1 
ATOM   3340 C CE3 . TRP A 1 439 ? 22.932  28.463  9.696   1.00 39.45 ? 439  TRP A CE3 1 
ATOM   3341 C CZ2 . TRP A 1 439 ? 24.611  27.281  11.665  1.00 40.49 ? 439  TRP A CZ2 1 
ATOM   3342 C CZ3 . TRP A 1 439 ? 24.325  28.571  9.633   1.00 40.77 ? 439  TRP A CZ3 1 
ATOM   3343 C CH2 . TRP A 1 439 ? 25.149  27.972  10.615  1.00 40.90 ? 439  TRP A CH2 1 
ATOM   3344 N N   . PRO A 1 440 ? 18.526  30.107  8.548   1.00 42.23 ? 440  PRO A N   1 
ATOM   3345 C CA  . PRO A 1 440 ? 17.506  30.594  7.643   1.00 41.77 ? 440  PRO A CA  1 
ATOM   3346 C C   . PRO A 1 440 ? 16.547  29.482  7.279   1.00 41.57 ? 440  PRO A C   1 
ATOM   3347 O O   . PRO A 1 440 ? 16.890  28.302  7.418   1.00 41.52 ? 440  PRO A O   1 
ATOM   3348 C CB  . PRO A 1 440 ? 18.309  31.023  6.409   1.00 41.81 ? 440  PRO A CB  1 
ATOM   3349 C CG  . PRO A 1 440 ? 19.556  30.221  6.477   1.00 42.02 ? 440  PRO A CG  1 
ATOM   3350 C CD  . PRO A 1 440 ? 19.865  30.141  7.928   1.00 42.12 ? 440  PRO A CD  1 
ATOM   3351 N N   . LEU A 1 441 ? 15.357  29.867  6.818   1.00 41.33 ? 441  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 441 ? 14.341  28.931  6.393   1.00 40.85 ? 441  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 441 ? 14.738  27.981  5.274   1.00 40.37 ? 441  LEU A C   1 
ATOM   3354 O O   . LEU A 1 441 ? 14.186  26.883  5.199   1.00 40.55 ? 441  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 441 ? 13.109  29.697  5.969   1.00 41.78 ? 441  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 441 ? 12.132  29.955  7.109   1.00 44.12 ? 441  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 441 ? 11.415  31.322  6.910   1.00 45.65 ? 441  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 441 ? 11.159  28.750  7.230   1.00 45.83 ? 441  LEU A CD2 1 
ATOM   3359 N N   . TRP A 1 442 ? 15.659  28.390  4.392   1.00 39.78 ? 442  TRP A N   1 
ATOM   3360 C CA  . TRP A 1 442 ? 16.001  27.560  3.225   1.00 39.06 ? 442  TRP A CA  1 
ATOM   3361 C C   . TRP A 1 442 ? 16.650  26.251  3.656   1.00 39.47 ? 442  TRP A C   1 
ATOM   3362 O O   . TRP A 1 442 ? 16.516  25.232  2.974   1.00 38.85 ? 442  TRP A O   1 
ATOM   3363 C CB  . TRP A 1 442 ? 16.819  28.293  2.148   1.00 37.84 ? 442  TRP A CB  1 
ATOM   3364 C CG  . TRP A 1 442 ? 18.227  28.687  2.510   1.00 38.46 ? 442  TRP A CG  1 
ATOM   3365 C CD1 . TRP A 1 442 ? 18.638  29.912  2.957   1.00 38.21 ? 442  TRP A CD1 1 
ATOM   3366 C CD2 . TRP A 1 442 ? 19.421  27.875  2.414   1.00 36.96 ? 442  TRP A CD2 1 
ATOM   3367 N NE1 . TRP A 1 442 ? 20.000  29.904  3.181   1.00 38.66 ? 442  TRP A NE1 1 
ATOM   3368 C CE2 . TRP A 1 442 ? 20.503  28.673  2.847   1.00 36.47 ? 442  TRP A CE2 1 
ATOM   3369 C CE3 . TRP A 1 442 ? 19.672  26.549  2.018   1.00 36.59 ? 442  TRP A CE3 1 
ATOM   3370 C CZ2 . TRP A 1 442 ? 21.820  28.192  2.900   1.00 35.82 ? 442  TRP A CZ2 1 
ATOM   3371 C CZ3 . TRP A 1 442 ? 20.981  26.076  2.056   1.00 36.36 ? 442  TRP A CZ3 1 
ATOM   3372 C CH2 . TRP A 1 442 ? 22.036  26.899  2.497   1.00 36.96 ? 442  TRP A CH2 1 
ATOM   3373 N N   . MET A 1 443 ? 17.301  26.291  4.822   1.00 39.72 ? 443  MET A N   1 
ATOM   3374 C CA  . MET A 1 443 ? 18.004  25.148  5.369   1.00 39.59 ? 443  MET A CA  1 
ATOM   3375 C C   . MET A 1 443 ? 17.093  24.091  5.950   1.00 39.20 ? 443  MET A C   1 
ATOM   3376 O O   . MET A 1 443 ? 17.564  23.018  6.349   1.00 39.70 ? 443  MET A O   1 
ATOM   3377 C CB  . MET A 1 443 ? 19.035  25.601  6.393   1.00 39.71 ? 443  MET A CB  1 
ATOM   3378 C CG  . MET A 1 443 ? 20.276  26.221  5.780   1.00 39.05 ? 443  MET A CG  1 
ATOM   3379 S SD  . MET A 1 443 ? 21.369  26.694  7.112   1.00 41.37 ? 443  MET A SD  1 
ATOM   3380 C CE  . MET A 1 443 ? 22.512  27.783  6.298   1.00 41.16 ? 443  MET A CE  1 
ATOM   3381 N N   . GLY A 1 444 ? 15.789  24.373  5.981   1.00 38.94 ? 444  GLY A N   1 
ATOM   3382 C CA  . GLY A 1 444 ? 14.783  23.369  6.362   1.00 37.56 ? 444  GLY A CA  1 
ATOM   3383 C C   . GLY A 1 444 ? 15.006  22.810  7.751   1.00 37.10 ? 444  GLY A C   1 
ATOM   3384 O O   . GLY A 1 444 ? 15.053  23.573  8.715   1.00 36.86 ? 444  GLY A O   1 
ATOM   3385 N N   . VAL A 1 445 ? 15.124  21.484  7.856   1.00 36.38 ? 445  VAL A N   1 
ATOM   3386 C CA  . VAL A 1 445 ? 15.480  20.837  9.119   1.00 36.11 ? 445  VAL A CA  1 
ATOM   3387 C C   . VAL A 1 445 ? 16.923  20.346  9.028   1.00 36.22 ? 445  VAL A C   1 
ATOM   3388 O O   . VAL A 1 445 ? 17.187  19.262  8.477   1.00 36.11 ? 445  VAL A O   1 
ATOM   3389 C CB  . VAL A 1 445 ? 14.583  19.636  9.472   1.00 36.43 ? 445  VAL A CB  1 
ATOM   3390 C CG1 . VAL A 1 445 ? 14.844  19.222  10.910  1.00 36.22 ? 445  VAL A CG1 1 
ATOM   3391 C CG2 . VAL A 1 445 ? 13.108  19.958  9.272   1.00 36.25 ? 445  VAL A CG2 1 
ATOM   3392 N N   . PRO A 1 446 ? 17.867  21.153  9.534   1.00 35.74 ? 446  PRO A N   1 
ATOM   3393 C CA  . PRO A 1 446 ? 19.271  20.860  9.350   1.00 35.79 ? 446  PRO A CA  1 
ATOM   3394 C C   . PRO A 1 446 ? 19.807  19.788  10.293  1.00 36.23 ? 446  PRO A C   1 
ATOM   3395 O O   . PRO A 1 446 ? 19.180  19.450  11.315  1.00 35.67 ? 446  PRO A O   1 
ATOM   3396 C CB  . PRO A 1 446 ? 19.961  22.207  9.624   1.00 35.48 ? 446  PRO A CB  1 
ATOM   3397 C CG  . PRO A 1 446 ? 18.839  23.204  9.819   1.00 36.00 ? 446  PRO A CG  1 
ATOM   3398 C CD  . PRO A 1 446 ? 17.672  22.407  10.269  1.00 35.79 ? 446  PRO A CD  1 
ATOM   3399 N N   . HIS A 1 447 ? 20.978  19.279  9.909   1.00 35.79 ? 447  HIS A N   1 
ATOM   3400 C CA  . HIS A 1 447 ? 21.740  18.273  10.608  1.00 35.68 ? 447  HIS A CA  1 
ATOM   3401 C C   . HIS A 1 447 ? 21.943  18.732  12.049  1.00 35.20 ? 447  HIS A C   1 
ATOM   3402 O O   . HIS A 1 447 ? 22.298  19.890  12.288  1.00 35.20 ? 447  HIS A O   1 
ATOM   3403 C CB  . HIS A 1 447 ? 23.067  18.173  9.847   1.00 36.51 ? 447  HIS A CB  1 
ATOM   3404 C CG  . HIS A 1 447 ? 24.001  17.111  10.327  1.00 37.87 ? 447  HIS A CG  1 
ATOM   3405 N ND1 . HIS A 1 447 ? 23.872  15.785  9.971   1.00 38.39 ? 447  HIS A ND1 1 
ATOM   3406 C CD2 . HIS A 1 447 ? 25.137  17.197  11.062  1.00 38.42 ? 447  HIS A CD2 1 
ATOM   3407 C CE1 . HIS A 1 447 ? 24.866  15.094  10.501  1.00 38.71 ? 447  HIS A CE1 1 
ATOM   3408 N NE2 . HIS A 1 447 ? 25.649  15.928  11.167  1.00 38.17 ? 447  HIS A NE2 1 
ATOM   3409 N N   . GLY A 1 448 ? 21.679  17.843  13.012  1.00 34.74 ? 448  GLY A N   1 
ATOM   3410 C CA  . GLY A 1 448 ? 21.823  18.187  14.437  1.00 33.51 ? 448  GLY A CA  1 
ATOM   3411 C C   . GLY A 1 448 ? 20.609  18.788  15.145  1.00 33.14 ? 448  GLY A C   1 
ATOM   3412 O O   . GLY A 1 448 ? 20.619  18.928  16.360  1.00 33.07 ? 448  GLY A O   1 
ATOM   3413 N N   . TYR A 1 449 ? 19.544  19.109  14.416  1.00 33.16 ? 449  TYR A N   1 
ATOM   3414 C CA  . TYR A 1 449 ? 18.420  19.821  15.043  1.00 33.43 ? 449  TYR A CA  1 
ATOM   3415 C C   . TYR A 1 449 ? 17.226  18.978  15.537  1.00 33.15 ? 449  TYR A C   1 
ATOM   3416 O O   . TYR A 1 449 ? 16.195  19.516  15.898  1.00 33.05 ? 449  TYR A O   1 
ATOM   3417 C CB  . TYR A 1 449 ? 18.032  21.076  14.230  1.00 33.28 ? 449  TYR A CB  1 
ATOM   3418 C CG  . TYR A 1 449 ? 19.115  22.142  14.388  1.00 33.53 ? 449  TYR A CG  1 
ATOM   3419 C CD1 . TYR A 1 449 ? 20.194  22.222  13.489  1.00 32.89 ? 449  TYR A CD1 1 
ATOM   3420 C CD2 . TYR A 1 449 ? 19.118  23.003  15.482  1.00 33.18 ? 449  TYR A CD2 1 
ATOM   3421 C CE1 . TYR A 1 449 ? 21.225  23.159  13.660  1.00 30.51 ? 449  TYR A CE1 1 
ATOM   3422 C CE2 . TYR A 1 449 ? 20.146  23.951  15.653  1.00 33.25 ? 449  TYR A CE2 1 
ATOM   3423 C CZ  . TYR A 1 449 ? 21.183  24.016  14.730  1.00 33.40 ? 449  TYR A CZ  1 
ATOM   3424 O OH  . TYR A 1 449 ? 22.184  24.949  14.893  1.00 36.39 ? 449  TYR A OH  1 
ATOM   3425 N N   . GLU A 1 450 ? 17.402  17.660  15.592  1.00 33.28 ? 450  GLU A N   1 
ATOM   3426 C CA  . GLU A 1 450 ? 16.485  16.775  16.324  1.00 33.14 ? 450  GLU A CA  1 
ATOM   3427 C C   . GLU A 1 450 ? 16.993  16.572  17.739  1.00 33.32 ? 450  GLU A C   1 
ATOM   3428 O O   . GLU A 1 450 ? 16.226  16.232  18.627  1.00 33.82 ? 450  GLU A O   1 
ATOM   3429 C CB  . GLU A 1 450 ? 16.322  15.427  15.633  1.00 32.83 ? 450  GLU A CB  1 
ATOM   3430 C CG  . GLU A 1 450 ? 17.371  14.383  15.967  1.00 34.42 ? 450  GLU A CG  1 
ATOM   3431 C CD  . GLU A 1 450 ? 18.765  14.671  15.389  1.00 36.95 ? 450  GLU A CD  1 
ATOM   3432 O OE1 . GLU A 1 450 ? 19.075  15.839  15.038  1.00 37.30 ? 450  GLU A OE1 1 
ATOM   3433 O OE2 . GLU A 1 450 ? 19.567  13.705  15.296  1.00 37.83 ? 450  GLU A OE2 1 
ATOM   3434 N N   . ILE A 1 451 ? 18.279  16.819  17.969  1.00 33.15 ? 451  ILE A N   1 
ATOM   3435 C CA  . ILE A 1 451 ? 18.870  16.452  19.255  1.00 32.60 ? 451  ILE A CA  1 
ATOM   3436 C C   . ILE A 1 451 ? 18.150  17.109  20.420  1.00 32.58 ? 451  ILE A C   1 
ATOM   3437 O O   . ILE A 1 451 ? 17.823  16.436  21.410  1.00 32.31 ? 451  ILE A O   1 
ATOM   3438 C CB  . ILE A 1 451 ? 20.378  16.757  19.350  1.00 32.17 ? 451  ILE A CB  1 
ATOM   3439 C CG1 . ILE A 1 451 ? 21.153  15.943  18.317  1.00 32.60 ? 451  ILE A CG1 1 
ATOM   3440 C CG2 . ILE A 1 451 ? 20.866  16.429  20.745  1.00 31.03 ? 451  ILE A CG2 1 
ATOM   3441 C CD1 . ILE A 1 451 ? 22.632  16.384  18.114  1.00 32.14 ? 451  ILE A CD1 1 
ATOM   3442 N N   . GLU A 1 452 ? 17.921  18.420  20.309  1.00 32.65 ? 452  GLU A N   1 
ATOM   3443 C CA  . GLU A 1 452 ? 17.223  19.175  21.362  1.00 32.96 ? 452  GLU A CA  1 
ATOM   3444 C C   . GLU A 1 452 ? 15.845  18.595  21.718  1.00 32.61 ? 452  GLU A C   1 
ATOM   3445 O O   . GLU A 1 452 ? 15.419  18.732  22.868  1.00 32.99 ? 452  GLU A O   1 
ATOM   3446 C CB  . GLU A 1 452 ? 17.089  20.662  21.004  1.00 33.44 ? 452  GLU A CB  1 
ATOM   3447 C CG  . GLU A 1 452 ? 16.474  20.928  19.623  1.00 34.26 ? 452  GLU A CG  1 
ATOM   3448 C CD  . GLU A 1 452 ? 16.777  22.318  19.125  1.00 37.64 ? 452  GLU A CD  1 
ATOM   3449 O OE1 . GLU A 1 452 ? 15.863  23.154  19.137  1.00 38.85 ? 452  GLU A OE1 1 
ATOM   3450 O OE2 . GLU A 1 452 ? 17.943  22.603  18.753  1.00 39.90 ? 452  GLU A OE2 1 
ATOM   3451 N N   . PHE A 1 453 ? 15.171  17.947  20.762  1.00 32.09 ? 453  PHE A N   1 
ATOM   3452 C CA  . PHE A 1 453 ? 13.878  17.275  21.034  1.00 32.36 ? 453  PHE A CA  1 
ATOM   3453 C C   . PHE A 1 453 ? 13.989  15.911  21.751  1.00 32.28 ? 453  PHE A C   1 
ATOM   3454 O O   . PHE A 1 453 ? 13.280  15.671  22.738  1.00 32.40 ? 453  PHE A O   1 
ATOM   3455 C CB  . PHE A 1 453 ? 13.029  17.187  19.761  1.00 32.61 ? 453  PHE A CB  1 
ATOM   3456 C CG  . PHE A 1 453 ? 12.597  18.538  19.228  1.00 32.99 ? 453  PHE A CG  1 
ATOM   3457 C CD1 . PHE A 1 453 ? 11.356  19.063  19.565  1.00 32.99 ? 453  PHE A CD1 1 
ATOM   3458 C CD2 . PHE A 1 453 ? 13.453  19.291  18.419  1.00 32.66 ? 453  PHE A CD2 1 
ATOM   3459 C CE1 . PHE A 1 453 ? 10.967  20.311  19.108  1.00 33.77 ? 453  PHE A CE1 1 
ATOM   3460 C CE2 . PHE A 1 453 ? 13.085  20.542  17.946  1.00 33.85 ? 453  PHE A CE2 1 
ATOM   3461 C CZ  . PHE A 1 453 ? 11.829  21.058  18.282  1.00 35.11 ? 453  PHE A CZ  1 
ATOM   3462 N N   . ILE A 1 454 ? 14.873  15.041  21.275  1.00 31.98 ? 454  ILE A N   1 
ATOM   3463 C CA  . ILE A 1 454 ? 15.236  13.788  21.965  1.00 32.60 ? 454  ILE A CA  1 
ATOM   3464 C C   . ILE A 1 454 ? 15.622  14.017  23.411  1.00 33.02 ? 454  ILE A C   1 
ATOM   3465 O O   . ILE A 1 454 ? 15.289  13.215  24.265  1.00 32.73 ? 454  ILE A O   1 
ATOM   3466 C CB  . ILE A 1 454 ? 16.448  13.092  21.287  1.00 33.04 ? 454  ILE A CB  1 
ATOM   3467 C CG1 . ILE A 1 454 ? 16.252  13.008  19.762  1.00 32.94 ? 454  ILE A CG1 1 
ATOM   3468 C CG2 . ILE A 1 454 ? 16.769  11.725  21.936  1.00 32.77 ? 454  ILE A CG2 1 
ATOM   3469 C CD1 . ILE A 1 454 ? 15.028  12.332  19.355  1.00 32.93 ? 454  ILE A CD1 1 
ATOM   3470 N N   . PHE A 1 455 ? 16.328  15.113  23.689  1.00 34.23 ? 455  PHE A N   1 
ATOM   3471 C CA  . PHE A 1 455 ? 16.787  15.381  25.056  1.00 34.96 ? 455  PHE A CA  1 
ATOM   3472 C C   . PHE A 1 455 ? 15.750  16.105  25.898  1.00 35.81 ? 455  PHE A C   1 
ATOM   3473 O O   . PHE A 1 455 ? 15.936  16.257  27.109  1.00 36.43 ? 455  PHE A O   1 
ATOM   3474 C CB  . PHE A 1 455 ? 18.123  16.131  25.075  1.00 34.51 ? 455  PHE A CB  1 
ATOM   3475 C CG  . PHE A 1 455 ? 19.324  15.232  24.990  1.00 33.19 ? 455  PHE A CG  1 
ATOM   3476 C CD1 . PHE A 1 455 ? 19.804  14.821  23.767  1.00 31.67 ? 455  PHE A CD1 1 
ATOM   3477 C CD2 . PHE A 1 455 ? 19.975  14.814  26.141  1.00 32.50 ? 455  PHE A CD2 1 
ATOM   3478 C CE1 . PHE A 1 455 ? 20.911  13.998  23.680  1.00 32.93 ? 455  PHE A CE1 1 
ATOM   3479 C CE2 . PHE A 1 455 ? 21.093  14.012  26.075  1.00 31.87 ? 455  PHE A CE2 1 
ATOM   3480 C CZ  . PHE A 1 455 ? 21.560  13.588  24.832  1.00 33.78 ? 455  PHE A CZ  1 
ATOM   3481 N N   . GLY A 1 456 ? 14.663  16.542  25.261  1.00 36.59 ? 456  GLY A N   1 
ATOM   3482 C CA  . GLY A 1 456 ? 13.557  17.189  25.956  1.00 37.26 ? 456  GLY A CA  1 
ATOM   3483 C C   . GLY A 1 456 ? 13.784  18.626  26.407  1.00 38.44 ? 456  GLY A C   1 
ATOM   3484 O O   . GLY A 1 456 ? 13.145  19.067  27.359  1.00 38.50 ? 456  GLY A O   1 
ATOM   3485 N N   . LEU A 1 457 ? 14.668  19.378  25.738  1.00 39.19 ? 457  LEU A N   1 
ATOM   3486 C CA  . LEU A 1 457 ? 14.782  20.814  26.047  1.00 39.97 ? 457  LEU A CA  1 
ATOM   3487 C C   . LEU A 1 457 ? 13.447  21.574  25.923  1.00 40.67 ? 457  LEU A C   1 
ATOM   3488 O O   . LEU A 1 457 ? 13.182  22.455  26.730  1.00 40.76 ? 457  LEU A O   1 
ATOM   3489 C CB  . LEU A 1 457 ? 15.866  21.532  25.224  1.00 39.61 ? 457  LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 457 ? 17.351  21.133  25.125  1.00 40.43 ? 457  LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 457 ? 18.228  22.394  24.947  1.00 39.20 ? 457  LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 457 ? 17.889  20.249  26.265  1.00 38.27 ? 457  LEU A CD2 1 
ATOM   3493 N N   . PRO A 1 458 ? 12.599  21.252  24.923  1.00 41.77 ? 458  PRO A N   1 
ATOM   3494 C CA  . PRO A 1 458 ? 11.334  21.997  24.896  1.00 42.88 ? 458  PRO A CA  1 
ATOM   3495 C C   . PRO A 1 458 ? 10.495  21.921  26.182  1.00 43.87 ? 458  PRO A C   1 
ATOM   3496 O O   . PRO A 1 458 ? 9.558   22.701  26.315  1.00 43.78 ? 458  PRO A O   1 
ATOM   3497 C CB  . PRO A 1 458 ? 10.574  21.358  23.728  1.00 42.76 ? 458  PRO A CB  1 
ATOM   3498 C CG  . PRO A 1 458 ? 11.664  20.837  22.843  1.00 42.53 ? 458  PRO A CG  1 
ATOM   3499 C CD  . PRO A 1 458 ? 12.672  20.301  23.798  1.00 41.73 ? 458  PRO A CD  1 
ATOM   3500 N N   . LEU A 1 459 ? 10.834  21.020  27.114  1.00 45.02 ? 459  LEU A N   1 
ATOM   3501 C CA  . LEU A 1 459 ? 10.168  20.994  28.419  1.00 46.41 ? 459  LEU A CA  1 
ATOM   3502 C C   . LEU A 1 459 ? 10.584  22.128  29.342  1.00 47.77 ? 459  LEU A C   1 
ATOM   3503 O O   . LEU A 1 459 ? 9.952   22.333  30.371  1.00 48.40 ? 459  LEU A O   1 
ATOM   3504 C CB  . LEU A 1 459 ? 10.378  19.669  29.155  1.00 46.05 ? 459  LEU A CB  1 
ATOM   3505 C CG  . LEU A 1 459 ? 10.068  18.314  28.509  1.00 46.46 ? 459  LEU A CG  1 
ATOM   3506 C CD1 . LEU A 1 459 ? 9.897   17.282  29.581  1.00 43.93 ? 459  LEU A CD1 1 
ATOM   3507 C CD2 . LEU A 1 459 ? 8.843   18.356  27.629  1.00 46.45 ? 459  LEU A CD2 1 
ATOM   3508 N N   . ASP A 1 460 ? 11.653  22.846  29.016  1.00 49.17 ? 460  ASP A N   1 
ATOM   3509 C CA  . ASP A 1 460 ? 12.074  23.952  29.873  1.00 50.91 ? 460  ASP A CA  1 
ATOM   3510 C C   . ASP A 1 460 ? 11.296  25.214  29.500  1.00 51.74 ? 460  ASP A C   1 
ATOM   3511 O O   . ASP A 1 460 ? 11.524  25.789  28.429  1.00 51.56 ? 460  ASP A O   1 
ATOM   3512 C CB  . ASP A 1 460 ? 13.590  24.183  29.795  1.00 51.00 ? 460  ASP A CB  1 
ATOM   3513 C CG  . ASP A 1 460 ? 14.070  25.304  30.713  1.00 52.52 ? 460  ASP A CG  1 
ATOM   3514 O OD1 . ASP A 1 460 ? 13.296  26.229  31.040  1.00 55.70 ? 460  ASP A OD1 1 
ATOM   3515 O OD2 . ASP A 1 460 ? 15.248  25.272  31.112  1.00 55.49 ? 460  ASP A OD2 1 
ATOM   3516 N N   . PRO A 1 461 ? 10.405  25.676  30.402  1.00 52.89 ? 461  PRO A N   1 
ATOM   3517 C CA  . PRO A 1 461 ? 9.476   26.781  30.083  1.00 53.45 ? 461  PRO A CA  1 
ATOM   3518 C C   . PRO A 1 461 ? 10.234  27.985  29.530  1.00 53.69 ? 461  PRO A C   1 
ATOM   3519 O O   . PRO A 1 461 ? 9.810   28.584  28.544  1.00 53.72 ? 461  PRO A O   1 
ATOM   3520 C CB  . PRO A 1 461 ? 8.860   27.134  31.438  1.00 53.35 ? 461  PRO A CB  1 
ATOM   3521 C CG  . PRO A 1 461 ? 9.015   25.897  32.263  1.00 54.14 ? 461  PRO A CG  1 
ATOM   3522 C CD  . PRO A 1 461 ? 10.273  25.222  31.800  1.00 52.97 ? 461  PRO A CD  1 
ATOM   3523 N N   . SER A 1 462 ? 11.377  28.285  30.141  1.00 54.06 ? 462  SER A N   1 
ATOM   3524 C CA  . SER A 1 462 ? 12.184  29.447  29.787  1.00 54.51 ? 462  SER A CA  1 
ATOM   3525 C C   . SER A 1 462 ? 12.785  29.435  28.372  1.00 54.59 ? 462  SER A C   1 
ATOM   3526 O O   . SER A 1 462 ? 13.408  30.422  27.962  1.00 54.76 ? 462  SER A O   1 
ATOM   3527 C CB  . SER A 1 462 ? 13.287  29.662  30.836  1.00 54.73 ? 462  SER A CB  1 
ATOM   3528 O OG  . SER A 1 462 ? 14.336  28.719  30.695  1.00 54.73 ? 462  SER A OG  1 
ATOM   3529 N N   . LEU A 1 463 ? 12.587  28.347  27.622  1.00 54.58 ? 463  LEU A N   1 
ATOM   3530 C CA  . LEU A 1 463 ? 13.193  28.221  26.292  1.00 54.27 ? 463  LEU A CA  1 
ATOM   3531 C C   . LEU A 1 463 ? 12.330  28.685  25.098  1.00 54.40 ? 463  LEU A C   1 
ATOM   3532 O O   . LEU A 1 463 ? 12.838  28.784  23.975  1.00 54.39 ? 463  LEU A O   1 
ATOM   3533 C CB  . LEU A 1 463 ? 13.764  26.810  26.073  1.00 54.26 ? 463  LEU A CB  1 
ATOM   3534 C CG  . LEU A 1 463 ? 15.001  26.415  26.908  1.00 54.42 ? 463  LEU A CG  1 
ATOM   3535 C CD1 . LEU A 1 463 ? 15.424  24.967  26.630  1.00 52.90 ? 463  LEU A CD1 1 
ATOM   3536 C CD2 . LEU A 1 463 ? 16.197  27.371  26.729  1.00 51.76 ? 463  LEU A CD2 1 
ATOM   3537 N N   . ASN A 1 464 ? 11.046  28.968  25.333  1.00 54.59 ? 464  ASN A N   1 
ATOM   3538 C CA  . ASN A 1 464 ? 10.140  29.568  24.302  1.00 54.98 ? 464  ASN A CA  1 
ATOM   3539 C C   . ASN A 1 464 ? 9.666   28.625  23.175  1.00 53.58 ? 464  ASN A C   1 
ATOM   3540 O O   . ASN A 1 464 ? 9.262   29.083  22.104  1.00 53.38 ? 464  ASN A O   1 
ATOM   3541 C CB  . ASN A 1 464 ? 10.709  30.884  23.690  1.00 55.78 ? 464  ASN A CB  1 
ATOM   3542 C CG  . ASN A 1 464 ? 10.986  31.973  24.741  1.00 60.39 ? 464  ASN A CG  1 
ATOM   3543 O OD1 . ASN A 1 464 ? 10.370  31.996  25.816  1.00 60.89 ? 464  ASN A OD1 1 
ATOM   3544 N ND2 . ASN A 1 464 ? 11.927  32.879  24.423  1.00 67.32 ? 464  ASN A ND2 1 
ATOM   3545 N N   . TYR A 1 465 ? 9.708   27.318  23.411  1.00 52.09 ? 465  TYR A N   1 
ATOM   3546 C CA  . TYR A 1 465 ? 9.151   26.372  22.449  1.00 50.86 ? 465  TYR A CA  1 
ATOM   3547 C C   . TYR A 1 465 ? 7.634   26.412  22.536  1.00 50.68 ? 465  TYR A C   1 
ATOM   3548 O O   . TYR A 1 465 ? 7.091   26.770  23.575  1.00 50.49 ? 465  TYR A O   1 
ATOM   3549 C CB  . TYR A 1 465 ? 9.635   24.951  22.741  1.00 49.87 ? 465  TYR A CB  1 
ATOM   3550 C CG  . TYR A 1 465 ? 11.084  24.681  22.419  1.00 48.54 ? 465  TYR A CG  1 
ATOM   3551 C CD1 . TYR A 1 465 ? 11.450  24.108  21.200  1.00 47.84 ? 465  TYR A CD1 1 
ATOM   3552 C CD2 . TYR A 1 465 ? 12.091  24.977  23.342  1.00 47.08 ? 465  TYR A CD2 1 
ATOM   3553 C CE1 . TYR A 1 465 ? 12.787  23.848  20.900  1.00 46.69 ? 465  TYR A CE1 1 
ATOM   3554 C CE2 . TYR A 1 465 ? 13.422  24.721  23.055  1.00 45.95 ? 465  TYR A CE2 1 
ATOM   3555 C CZ  . TYR A 1 465 ? 13.760  24.157  21.837  1.00 46.70 ? 465  TYR A CZ  1 
ATOM   3556 O OH  . TYR A 1 465 ? 15.074  23.900  21.563  1.00 47.46 ? 465  TYR A OH  1 
ATOM   3557 N N   . THR A 1 466 ? 6.948   26.033  21.459  1.00 50.81 ? 466  THR A N   1 
ATOM   3558 C CA  . THR A 1 466 ? 5.484   25.899  21.502  1.00 50.78 ? 466  THR A CA  1 
ATOM   3559 C C   . THR A 1 466 ? 5.055   24.725  22.369  1.00 51.09 ? 466  THR A C   1 
ATOM   3560 O O   . THR A 1 466 ? 5.836   23.804  22.637  1.00 51.07 ? 466  THR A O   1 
ATOM   3561 C CB  . THR A 1 466 ? 4.838   25.692  20.108  1.00 50.76 ? 466  THR A CB  1 
ATOM   3562 O OG1 . THR A 1 466 ? 5.145   24.371  19.608  1.00 51.43 ? 466  THR A OG1 1 
ATOM   3563 C CG2 . THR A 1 466 ? 5.265   26.770  19.128  1.00 48.78 ? 466  THR A CG2 1 
ATOM   3564 N N   . THR A 1 467 ? 3.790   24.764  22.783  1.00 51.43 ? 467  THR A N   1 
ATOM   3565 C CA  . THR A 1 467 ? 3.170   23.705  23.573  1.00 51.17 ? 467  THR A CA  1 
ATOM   3566 C C   . THR A 1 467 ? 3.198   22.390  22.779  1.00 51.27 ? 467  THR A C   1 
ATOM   3567 O O   . THR A 1 467 ? 3.469   21.316  23.326  1.00 51.37 ? 467  THR A O   1 
ATOM   3568 C CB  . THR A 1 467 ? 1.729   24.138  23.975  1.00 51.46 ? 467  THR A CB  1 
ATOM   3569 O OG1 . THR A 1 467 ? 1.805   25.193  24.948  1.00 51.53 ? 467  THR A OG1 1 
ATOM   3570 C CG2 . THR A 1 467 ? 0.905   22.979  24.553  1.00 51.22 ? 467  THR A CG2 1 
ATOM   3571 N N   . GLU A 1 468 ? 2.941   22.499  21.480  1.00 51.18 ? 468  GLU A N   1 
ATOM   3572 C CA  . GLU A 1 468 ? 2.957   21.370  20.566  1.00 51.48 ? 468  GLU A CA  1 
ATOM   3573 C C   . GLU A 1 468 ? 4.363   20.717  20.542  1.00 50.90 ? 468  GLU A C   1 
ATOM   3574 O O   . GLU A 1 468 ? 4.489   19.483  20.553  1.00 50.23 ? 468  GLU A O   1 
ATOM   3575 C CB  . GLU A 1 468 ? 2.518   21.833  19.163  1.00 51.89 ? 468  GLU A CB  1 
ATOM   3576 C CG  . GLU A 1 468 ? 1.169   22.614  19.115  1.00 55.40 ? 468  GLU A CG  1 
ATOM   3577 C CD  . GLU A 1 468 ? 1.315   24.147  19.282  1.00 59.33 ? 468  GLU A CD  1 
ATOM   3578 O OE1 . GLU A 1 468 ? 1.572   24.638  20.413  1.00 59.86 ? 468  GLU A OE1 1 
ATOM   3579 O OE2 . GLU A 1 468 ? 1.146   24.869  18.272  1.00 60.57 ? 468  GLU A OE2 1 
ATOM   3580 N N   . GLU A 1 469 ? 5.401   21.561  20.538  1.00 50.17 ? 469  GLU A N   1 
ATOM   3581 C CA  . GLU A 1 469 ? 6.793   21.111  20.625  1.00 49.87 ? 469  GLU A CA  1 
ATOM   3582 C C   . GLU A 1 469 ? 7.113   20.392  21.925  1.00 49.67 ? 469  GLU A C   1 
ATOM   3583 O O   . GLU A 1 469 ? 7.859   19.417  21.923  1.00 49.81 ? 469  GLU A O   1 
ATOM   3584 C CB  . GLU A 1 469 ? 7.774   22.264  20.380  1.00 49.40 ? 469  GLU A CB  1 
ATOM   3585 C CG  . GLU A 1 469 ? 7.991   22.492  18.897  1.00 48.93 ? 469  GLU A CG  1 
ATOM   3586 C CD  . GLU A 1 469 ? 8.712   23.772  18.565  1.00 48.58 ? 469  GLU A CD  1 
ATOM   3587 O OE1 . GLU A 1 469 ? 8.580   24.767  19.312  1.00 49.41 ? 469  GLU A OE1 1 
ATOM   3588 O OE2 . GLU A 1 469 ? 9.394   23.789  17.524  1.00 47.90 ? 469  GLU A OE2 1 
ATOM   3589 N N   . ARG A 1 470 ? 6.531   20.857  23.027  1.00 49.51 ? 470  ARG A N   1 
ATOM   3590 C CA  . ARG A 1 470 ? 6.729   20.218  24.322  1.00 49.26 ? 470  ARG A CA  1 
ATOM   3591 C C   . ARG A 1 470 ? 6.147   18.804  24.302  1.00 48.40 ? 470  ARG A C   1 
ATOM   3592 O O   . ARG A 1 470 ? 6.805   17.859  24.727  1.00 48.45 ? 470  ARG A O   1 
ATOM   3593 C CB  . ARG A 1 470 ? 6.132   21.087  25.420  1.00 49.90 ? 470  ARG A CB  1 
ATOM   3594 C CG  . ARG A 1 470 ? 6.681   20.857  26.813  1.00 53.30 ? 470  ARG A CG  1 
ATOM   3595 C CD  . ARG A 1 470 ? 5.627   20.219  27.743  1.00 59.96 ? 470  ARG A CD  1 
ATOM   3596 N NE  . ARG A 1 470 ? 4.398   21.019  27.827  1.00 63.40 ? 470  ARG A NE  1 
ATOM   3597 C CZ  . ARG A 1 470 ? 3.169   20.509  27.956  1.00 66.16 ? 470  ARG A CZ  1 
ATOM   3598 N NH1 . ARG A 1 470 ? 2.982   19.184  28.016  1.00 65.48 ? 470  ARG A NH1 1 
ATOM   3599 N NH2 . ARG A 1 470 ? 2.119   21.331  28.009  1.00 66.49 ? 470  ARG A NH2 1 
ATOM   3600 N N   . ILE A 1 471 ? 4.939   18.663  23.758  1.00 47.25 ? 471  ILE A N   1 
ATOM   3601 C CA  . ILE A 1 471 ? 4.267   17.372  23.604  1.00 46.19 ? 471  ILE A CA  1 
ATOM   3602 C C   . ILE A 1 471 ? 5.010   16.429  22.644  1.00 45.33 ? 471  ILE A C   1 
ATOM   3603 O O   . ILE A 1 471 ? 5.245   15.250  22.947  1.00 45.72 ? 471  ILE A O   1 
ATOM   3604 C CB  . ILE A 1 471 ? 2.781   17.590  23.138  1.00 46.67 ? 471  ILE A CB  1 
ATOM   3605 C CG1 . ILE A 1 471 ? 1.952   18.177  24.290  1.00 47.68 ? 471  ILE A CG1 1 
ATOM   3606 C CG2 . ILE A 1 471 ? 2.144   16.284  22.604  1.00 45.45 ? 471  ILE A CG2 1 
ATOM   3607 C CD1 . ILE A 1 471 ? 0.856   19.139  23.845  1.00 50.71 ? 471  ILE A CD1 1 
ATOM   3608 N N   . PHE A 1 472 ? 5.350   16.950  21.475  1.00 44.23 ? 472  PHE A N   1 
ATOM   3609 C CA  . PHE A 1 472 ? 6.205   16.254  20.517  1.00 43.27 ? 472  PHE A CA  1 
ATOM   3610 C C   . PHE A 1 472 ? 7.514   15.746  21.164  1.00 42.70 ? 472  PHE A C   1 
ATOM   3611 O O   . PHE A 1 472 ? 7.907   14.606  20.940  1.00 42.02 ? 472  PHE A O   1 
ATOM   3612 C CB  . PHE A 1 472 ? 6.494   17.192  19.349  1.00 42.88 ? 472  PHE A CB  1 
ATOM   3613 C CG  . PHE A 1 472 ? 7.440   16.639  18.328  1.00 42.52 ? 472  PHE A CG  1 
ATOM   3614 C CD1 . PHE A 1 472 ? 7.236   15.374  17.776  1.00 40.91 ? 472  PHE A CD1 1 
ATOM   3615 C CD2 . PHE A 1 472 ? 8.515   17.413  17.883  1.00 39.71 ? 472  PHE A CD2 1 
ATOM   3616 C CE1 . PHE A 1 472 ? 8.103   14.870  16.815  1.00 41.68 ? 472  PHE A CE1 1 
ATOM   3617 C CE2 . PHE A 1 472 ? 9.377   16.931  16.931  1.00 41.30 ? 472  PHE A CE2 1 
ATOM   3618 C CZ  . PHE A 1 472 ? 9.182   15.655  16.385  1.00 42.05 ? 472  PHE A CZ  1 
ATOM   3619 N N   . ALA A 1 473 ? 8.156   16.579  21.984  1.00 42.43 ? 473  ALA A N   1 
ATOM   3620 C CA  . ALA A 1 473 ? 9.406   16.191  22.653  1.00 42.94 ? 473  ALA A CA  1 
ATOM   3621 C C   . ALA A 1 473 ? 9.174   14.997  23.575  1.00 43.34 ? 473  ALA A C   1 
ATOM   3622 O O   . ALA A 1 473 ? 9.955   14.039  23.568  1.00 43.58 ? 473  ALA A O   1 
ATOM   3623 C CB  . ALA A 1 473 ? 10.020  17.362  23.411  1.00 42.13 ? 473  ALA A CB  1 
ATOM   3624 N N   . GLN A 1 474 ? 8.082   15.052  24.340  1.00 43.42 ? 474  GLN A N   1 
ATOM   3625 C CA  . GLN A 1 474 ? 7.687   13.954  25.228  1.00 44.13 ? 474  GLN A CA  1 
ATOM   3626 C C   . GLN A 1 474 ? 7.444   12.653  24.470  1.00 43.42 ? 474  GLN A C   1 
ATOM   3627 O O   . GLN A 1 474 ? 7.806   11.581  24.938  1.00 44.05 ? 474  GLN A O   1 
ATOM   3628 C CB  . GLN A 1 474 ? 6.448   14.339  26.040  1.00 43.89 ? 474  GLN A CB  1 
ATOM   3629 C CG  . GLN A 1 474 ? 6.727   15.414  27.085  1.00 45.75 ? 474  GLN A CG  1 
ATOM   3630 C CD  . GLN A 1 474 ? 5.466   15.913  27.773  1.00 46.32 ? 474  GLN A CD  1 
ATOM   3631 O OE1 . GLN A 1 474 ? 4.471   16.259  27.119  1.00 49.22 ? 474  GLN A OE1 1 
ATOM   3632 N NE2 . GLN A 1 474 ? 5.506   15.964  29.104  1.00 48.02 ? 474  GLN A NE2 1 
ATOM   3633 N N   . ARG A 1 475 ? 6.835   12.747  23.296  1.00 42.88 ? 475  ARG A N   1 
ATOM   3634 C CA  . ARG A 1 475 ? 6.655   11.584  22.448  1.00 42.36 ? 475  ARG A CA  1 
ATOM   3635 C C   . ARG A 1 475 ? 8.006   10.944  22.061  1.00 41.79 ? 475  ARG A C   1 
ATOM   3636 O O   . ARG A 1 475 ? 8.169   9.712   22.144  1.00 41.40 ? 475  ARG A O   1 
ATOM   3637 C CB  . ARG A 1 475 ? 5.892   11.984  21.194  1.00 42.48 ? 475  ARG A CB  1 
ATOM   3638 C CG  . ARG A 1 475 ? 4.679   11.135  20.894  1.00 43.46 ? 475  ARG A CG  1 
ATOM   3639 C CD  . ARG A 1 475 ? 3.896   11.809  19.765  1.00 44.71 ? 475  ARG A CD  1 
ATOM   3640 N NE  . ARG A 1 475 ? 4.288   11.261  18.471  1.00 43.95 ? 475  ARG A NE  1 
ATOM   3641 C CZ  . ARG A 1 475 ? 4.418   11.959  17.354  1.00 42.89 ? 475  ARG A CZ  1 
ATOM   3642 N NH1 . ARG A 1 475 ? 4.208   13.270  17.342  1.00 42.66 ? 475  ARG A NH1 1 
ATOM   3643 N NH2 . ARG A 1 475 ? 4.785   11.334  16.244  1.00 45.26 ? 475  ARG A NH2 1 
ATOM   3644 N N   . LEU A 1 476 ? 8.965   11.780  21.645  1.00 40.85 ? 476  LEU A N   1 
ATOM   3645 C CA  . LEU A 1 476 ? 10.289  11.288  21.210  1.00 39.92 ? 476  LEU A CA  1 
ATOM   3646 C C   . LEU A 1 476 ? 11.076  10.699  22.357  1.00 39.66 ? 476  LEU A C   1 
ATOM   3647 O O   . LEU A 1 476 ? 11.716  9.664   22.192  1.00 39.42 ? 476  LEU A O   1 
ATOM   3648 C CB  . LEU A 1 476 ? 11.095  12.383  20.527  1.00 39.84 ? 476  LEU A CB  1 
ATOM   3649 C CG  . LEU A 1 476 ? 10.360  13.022  19.354  1.00 38.27 ? 476  LEU A CG  1 
ATOM   3650 C CD1 . LEU A 1 476 ? 11.135  14.193  18.859  1.00 36.87 ? 476  LEU A CD1 1 
ATOM   3651 C CD2 . LEU A 1 476 ? 10.153  11.993  18.260  1.00 37.09 ? 476  LEU A CD2 1 
ATOM   3652 N N   . MET A 1 477 ? 11.006  11.347  23.522  1.00 39.87 ? 477  MET A N   1 
ATOM   3653 C CA  . MET A 1 477 ? 11.593  10.800  24.747  1.00 40.19 ? 477  MET A CA  1 
ATOM   3654 C C   . MET A 1 477 ? 11.003  9.420   25.065  1.00 40.52 ? 477  MET A C   1 
ATOM   3655 O O   . MET A 1 477 ? 11.752  8.505   25.422  1.00 40.07 ? 477  MET A O   1 
ATOM   3656 C CB  . MET A 1 477 ? 11.407  11.752  25.930  1.00 39.98 ? 477  MET A CB  1 
ATOM   3657 C CG  . MET A 1 477 ? 12.253  13.011  25.874  1.00 40.15 ? 477  MET A CG  1 
ATOM   3658 S SD  . MET A 1 477 ? 11.729  14.291  27.059  1.00 39.99 ? 477  MET A SD  1 
ATOM   3659 C CE  . MET A 1 477 ? 12.350  13.715  28.607  1.00 38.50 ? 477  MET A CE  1 
ATOM   3660 N N   . LYS A 1 478 ? 9.678   9.275   24.909  1.00 41.11 ? 478  LYS A N   1 
ATOM   3661 C CA  . LYS A 1 478 ? 9.006   7.981   25.068  1.00 41.93 ? 478  LYS A CA  1 
ATOM   3662 C C   . LYS A 1 478 ? 9.619   6.937   24.142  1.00 41.46 ? 478  LYS A C   1 
ATOM   3663 O O   . LYS A 1 478 ? 10.047  5.876   24.618  1.00 41.57 ? 478  LYS A O   1 
ATOM   3664 C CB  . LYS A 1 478 ? 7.480   8.052   24.815  1.00 42.90 ? 478  LYS A CB  1 
ATOM   3665 C CG  . LYS A 1 478 ? 6.604   8.626   25.934  1.00 44.49 ? 478  LYS A CG  1 
ATOM   3666 C CD  . LYS A 1 478 ? 6.449   7.660   27.112  1.00 47.94 ? 478  LYS A CD  1 
ATOM   3667 C CE  . LYS A 1 478 ? 5.964   8.393   28.381  1.00 47.29 ? 478  LYS A CE  1 
ATOM   3668 N NZ  . LYS A 1 478 ? 6.444   7.666   29.602  1.00 48.36 ? 478  LYS A NZ  1 
ATOM   3669 N N   . TYR A 1 479 ? 9.668   7.223   22.836  1.00 41.24 ? 479  TYR A N   1 
ATOM   3670 C CA  . TYR A 1 479 ? 10.219  6.246   21.865  1.00 41.13 ? 479  TYR A CA  1 
ATOM   3671 C C   . TYR A 1 479 ? 11.629  5.802   22.231  1.00 40.50 ? 479  TYR A C   1 
ATOM   3672 O O   . TYR A 1 479 ? 11.907  4.598   22.299  1.00 40.61 ? 479  TYR A O   1 
ATOM   3673 C CB  . TYR A 1 479 ? 10.274  6.792   20.441  1.00 41.71 ? 479  TYR A CB  1 
ATOM   3674 C CG  . TYR A 1 479 ? 8.959   7.128   19.806  1.00 42.75 ? 479  TYR A CG  1 
ATOM   3675 C CD1 . TYR A 1 479 ? 7.893   6.211   19.783  1.00 42.26 ? 479  TYR A CD1 1 
ATOM   3676 C CD2 . TYR A 1 479 ? 8.793   8.349   19.176  1.00 43.33 ? 479  TYR A CD2 1 
ATOM   3677 C CE1 . TYR A 1 479 ? 6.694   6.536   19.173  1.00 42.62 ? 479  TYR A CE1 1 
ATOM   3678 C CE2 . TYR A 1 479 ? 7.606   8.689   18.572  1.00 44.25 ? 479  TYR A CE2 1 
ATOM   3679 C CZ  . TYR A 1 479 ? 6.557   7.783   18.571  1.00 44.14 ? 479  TYR A CZ  1 
ATOM   3680 O OH  . TYR A 1 479 ? 5.384   8.171   17.956  1.00 45.22 ? 479  TYR A OH  1 
ATOM   3681 N N   . TRP A 1 480 ? 12.506  6.781   22.456  1.00 39.50 ? 480  TRP A N   1 
ATOM   3682 C CA  . TRP A 1 480 ? 13.915  6.524   22.724  1.00 39.39 ? 480  TRP A CA  1 
ATOM   3683 C C   . TRP A 1 480 ? 14.090  5.644   23.948  1.00 39.56 ? 480  TRP A C   1 
ATOM   3684 O O   . TRP A 1 480 ? 14.767  4.612   23.882  1.00 38.79 ? 480  TRP A O   1 
ATOM   3685 C CB  . TRP A 1 480 ? 14.716  7.837   22.848  1.00 38.69 ? 480  TRP A CB  1 
ATOM   3686 C CG  . TRP A 1 480 ? 15.529  8.178   21.603  1.00 38.08 ? 480  TRP A CG  1 
ATOM   3687 C CD1 . TRP A 1 480 ? 16.886  8.244   21.510  1.00 37.07 ? 480  TRP A CD1 1 
ATOM   3688 C CD2 . TRP A 1 480 ? 15.027  8.474   20.286  1.00 38.12 ? 480  TRP A CD2 1 
ATOM   3689 N NE1 . TRP A 1 480 ? 17.261  8.557   20.230  1.00 37.11 ? 480  TRP A NE1 1 
ATOM   3690 C CE2 . TRP A 1 480 ? 16.145  8.708   19.458  1.00 36.05 ? 480  TRP A CE2 1 
ATOM   3691 C CE3 . TRP A 1 480 ? 13.739  8.543   19.721  1.00 37.50 ? 480  TRP A CE3 1 
ATOM   3692 C CZ2 . TRP A 1 480 ? 16.022  9.020   18.112  1.00 37.17 ? 480  TRP A CZ2 1 
ATOM   3693 C CZ3 . TRP A 1 480 ? 13.614  8.855   18.390  1.00 36.08 ? 480  TRP A CZ3 1 
ATOM   3694 C CH2 . TRP A 1 480 ? 14.748  9.098   17.595  1.00 38.38 ? 480  TRP A CH2 1 
ATOM   3695 N N   . THR A 1 481 ? 13.454  6.039   25.053  1.00 40.04 ? 481  THR A N   1 
ATOM   3696 C CA  . THR A 1 481 ? 13.545  5.261   26.280  1.00 40.34 ? 481  THR A CA  1 
ATOM   3697 C C   . THR A 1 481 ? 12.798  3.943   26.205  1.00 40.57 ? 481  THR A C   1 
ATOM   3698 O O   . THR A 1 481 ? 13.225  2.995   26.845  1.00 41.15 ? 481  THR A O   1 
ATOM   3699 C CB  . THR A 1 481 ? 13.113  6.037   27.519  1.00 40.43 ? 481  THR A CB  1 
ATOM   3700 O OG1 . THR A 1 481 ? 11.842  6.654   27.282  1.00 41.55 ? 481  THR A OG1 1 
ATOM   3701 C CG2 . THR A 1 481 ? 14.141  7.100   27.856  1.00 41.14 ? 481  THR A CG2 1 
ATOM   3702 N N   . ASN A 1 482 ? 11.710  3.849   25.436  1.00 40.75 ? 482  ASN A N   1 
ATOM   3703 C CA  . ASN A 1 482 ? 11.087  2.528   25.238  1.00 41.34 ? 482  ASN A CA  1 
ATOM   3704 C C   . ASN A 1 482 ? 12.110  1.613   24.564  1.00 42.01 ? 482  ASN A C   1 
ATOM   3705 O O   . ASN A 1 482 ? 12.370  0.502   25.050  1.00 42.44 ? 482  ASN A O   1 
ATOM   3706 C CB  . ASN A 1 482 ? 9.804   2.570   24.399  1.00 41.13 ? 482  ASN A CB  1 
ATOM   3707 C CG  . ASN A 1 482 ? 8.578   3.087   25.171  1.00 41.75 ? 482  ASN A CG  1 
ATOM   3708 O OD1 . ASN A 1 482 ? 8.546   3.156   26.403  1.00 42.88 ? 482  ASN A OD1 1 
ATOM   3709 N ND2 . ASN A 1 482 ? 7.562   3.453   24.423  1.00 43.12 ? 482  ASN A ND2 1 
ATOM   3710 N N   . PHE A 1 483 ? 12.705  2.092   23.465  1.00 42.03 ? 483  PHE A N   1 
ATOM   3711 C CA  . PHE A 1 483 ? 13.688  1.319   22.727  1.00 42.05 ? 483  PHE A CA  1 
ATOM   3712 C C   . PHE A 1 483 ? 14.896  0.913   23.596  1.00 43.11 ? 483  PHE A C   1 
ATOM   3713 O O   . PHE A 1 483 ? 15.430  -0.211  23.476  1.00 42.98 ? 483  PHE A O   1 
ATOM   3714 C CB  . PHE A 1 483 ? 14.149  2.054   21.460  1.00 41.84 ? 483  PHE A CB  1 
ATOM   3715 C CG  . PHE A 1 483 ? 15.305  1.380   20.783  1.00 40.30 ? 483  PHE A CG  1 
ATOM   3716 C CD1 . PHE A 1 483 ? 15.091  0.293   19.931  1.00 38.12 ? 483  PHE A CD1 1 
ATOM   3717 C CD2 . PHE A 1 483 ? 16.609  1.776   21.057  1.00 37.96 ? 483  PHE A CD2 1 
ATOM   3718 C CE1 . PHE A 1 483 ? 16.157  -0.374  19.328  1.00 37.45 ? 483  PHE A CE1 1 
ATOM   3719 C CE2 . PHE A 1 483 ? 17.675  1.117   20.460  1.00 37.91 ? 483  PHE A CE2 1 
ATOM   3720 C CZ  . PHE A 1 483 ? 17.442  0.035   19.589  1.00 38.80 ? 483  PHE A CZ  1 
ATOM   3721 N N   . ALA A 1 484 ? 15.328  1.821   24.469  1.00 44.25 ? 484  ALA A N   1 
ATOM   3722 C CA  . ALA A 1 484 ? 16.401  1.495   25.405  1.00 45.73 ? 484  ALA A CA  1 
ATOM   3723 C C   . ALA A 1 484 ? 15.947  0.390   26.357  1.00 46.61 ? 484  ALA A C   1 
ATOM   3724 O O   . ALA A 1 484 ? 16.674  -0.579  26.572  1.00 46.64 ? 484  ALA A O   1 
ATOM   3725 C CB  . ALA A 1 484 ? 16.863  2.726   26.172  1.00 45.48 ? 484  ALA A CB  1 
ATOM   3726 N N   . ARG A 1 485 ? 14.738  0.541   26.898  1.00 47.68 ? 485  ARG A N   1 
ATOM   3727 C CA  . ARG A 1 485 ? 14.163  -0.433  27.826  1.00 49.16 ? 485  ARG A CA  1 
ATOM   3728 C C   . ARG A 1 485 ? 13.987  -1.824  27.234  1.00 48.63 ? 485  ARG A C   1 
ATOM   3729 O O   . ARG A 1 485 ? 14.345  -2.804  27.866  1.00 48.89 ? 485  ARG A O   1 
ATOM   3730 C CB  . ARG A 1 485 ? 12.817  0.057   28.382  1.00 48.93 ? 485  ARG A CB  1 
ATOM   3731 C CG  . ARG A 1 485 ? 12.924  1.023   29.555  1.00 51.22 ? 485  ARG A CG  1 
ATOM   3732 C CD  . ARG A 1 485 ? 11.525  1.383   30.121  1.00 51.51 ? 485  ARG A CD  1 
ATOM   3733 N NE  . ARG A 1 485 ? 10.815  2.347   29.278  1.00 55.30 ? 485  ARG A NE  1 
ATOM   3734 C CZ  . ARG A 1 485 ? 10.794  3.664   29.490  1.00 55.52 ? 485  ARG A CZ  1 
ATOM   3735 N NH1 . ARG A 1 485 ? 11.432  4.176   30.533  1.00 55.70 ? 485  ARG A NH1 1 
ATOM   3736 N NH2 . ARG A 1 485 ? 10.116  4.468   28.664  1.00 55.87 ? 485  ARG A NH2 1 
ATOM   3737 N N   . THR A 1 486 ? 13.451  -1.913  26.022  1.00 49.00 ? 486  THR A N   1 
ATOM   3738 C CA  . THR A 1 486 ? 12.960  -3.198  25.512  1.00 49.15 ? 486  THR A CA  1 
ATOM   3739 C C   . THR A 1 486 ? 13.515  -3.608  24.162  1.00 49.22 ? 486  THR A C   1 
ATOM   3740 O O   . THR A 1 486 ? 13.431  -4.778  23.792  1.00 49.19 ? 486  THR A O   1 
ATOM   3741 C CB  . THR A 1 486 ? 11.435  -3.189  25.365  1.00 49.15 ? 486  THR A CB  1 
ATOM   3742 O OG1 . THR A 1 486 ? 11.077  -2.359  24.255  1.00 50.27 ? 486  THR A OG1 1 
ATOM   3743 C CG2 . THR A 1 486 ? 10.752  -2.676  26.644  1.00 49.20 ? 486  THR A CG2 1 
ATOM   3744 N N   . GLY A 1 487 ? 14.053  -2.650  23.415  1.00 49.48 ? 487  GLY A N   1 
ATOM   3745 C CA  . GLY A 1 487 ? 14.480  -2.905  22.039  1.00 49.60 ? 487  GLY A CA  1 
ATOM   3746 C C   . GLY A 1 487 ? 13.375  -2.593  21.054  1.00 49.89 ? 487  GLY A C   1 
ATOM   3747 O O   . GLY A 1 487 ? 13.490  -2.908  19.876  1.00 49.71 ? 487  GLY A O   1 
ATOM   3748 N N   . ASP A 1 488 ? 12.319  -1.949  21.551  1.00 50.51 ? 488  ASP A N   1 
ATOM   3749 C CA  . ASP A 1 488 ? 11.119  -1.647  20.784  1.00 51.43 ? 488  ASP A CA  1 
ATOM   3750 C C   . ASP A 1 488 ? 10.614  -0.256  21.177  1.00 52.10 ? 488  ASP A C   1 
ATOM   3751 O O   . ASP A 1 488 ? 10.267  -0.031  22.335  1.00 52.14 ? 488  ASP A O   1 
ATOM   3752 C CB  . ASP A 1 488 ? 10.048  -2.703  21.101  1.00 51.45 ? 488  ASP A CB  1 
ATOM   3753 C CG  . ASP A 1 488 ? 8.817   -2.626  20.186  1.00 51.39 ? 488  ASP A CG  1 
ATOM   3754 O OD1 . ASP A 1 488 ? 8.502   -1.567  19.586  1.00 49.74 ? 488  ASP A OD1 1 
ATOM   3755 O OD2 . ASP A 1 488 ? 8.132   -3.660  20.092  1.00 52.37 ? 488  ASP A OD2 1 
ATOM   3756 N N   . PRO A 1 489 ? 10.559  0.680   20.216  1.00 53.16 ? 489  PRO A N   1 
ATOM   3757 C CA  . PRO A 1 489 ? 10.141  2.061   20.505  1.00 54.28 ? 489  PRO A CA  1 
ATOM   3758 C C   . PRO A 1 489 ? 8.660   2.218   20.857  1.00 55.87 ? 489  PRO A C   1 
ATOM   3759 O O   . PRO A 1 489 ? 8.270   3.203   21.493  1.00 55.81 ? 489  PRO A O   1 
ATOM   3760 C CB  . PRO A 1 489 ? 10.459  2.797   19.202  1.00 53.93 ? 489  PRO A CB  1 
ATOM   3761 C CG  . PRO A 1 489 ? 10.383  1.738   18.147  1.00 53.30 ? 489  PRO A CG  1 
ATOM   3762 C CD  . PRO A 1 489 ? 10.914  0.498   18.794  1.00 53.17 ? 489  PRO A CD  1 
ATOM   3763 N N   . ASN A 1 490 ? 7.843   1.254   20.445  1.00 57.85 ? 490  ASN A N   1 
ATOM   3764 C CA  . ASN A 1 490 ? 6.400   1.306   20.691  1.00 59.83 ? 490  ASN A CA  1 
ATOM   3765 C C   . ASN A 1 490 ? 6.022   1.140   22.161  1.00 62.10 ? 490  ASN A C   1 
ATOM   3766 O O   . ASN A 1 490 ? 6.747   0.511   22.932  1.00 62.20 ? 490  ASN A O   1 
ATOM   3767 C CB  . ASN A 1 490 ? 5.687   0.251   19.842  1.00 58.99 ? 490  ASN A CB  1 
ATOM   3768 C CG  . ASN A 1 490 ? 5.900   0.464   18.357  1.00 56.58 ? 490  ASN A CG  1 
ATOM   3769 O OD1 . ASN A 1 490 ? 5.336   1.390   17.765  1.00 53.75 ? 490  ASN A OD1 1 
ATOM   3770 N ND2 . ASN A 1 490 ? 6.712   -0.389  17.748  1.00 51.40 ? 490  ASN A ND2 1 
ATOM   3771 N N   . ASP A 1 491 ? 4.887   1.724   22.539  1.00 65.29 ? 491  ASP A N   1 
ATOM   3772 C CA  . ASP A 1 491 ? 4.304   1.516   23.866  1.00 68.38 ? 491  ASP A CA  1 
ATOM   3773 C C   . ASP A 1 491 ? 3.456   0.229   23.883  1.00 70.36 ? 491  ASP A C   1 
ATOM   3774 O O   . ASP A 1 491 ? 2.503   0.104   23.100  1.00 70.12 ? 491  ASP A O   1 
ATOM   3775 C CB  . ASP A 1 491 ? 3.450   2.726   24.271  1.00 68.76 ? 491  ASP A CB  1 
ATOM   3776 C CG  . ASP A 1 491 ? 3.108   2.745   25.772  1.00 70.24 ? 491  ASP A CG  1 
ATOM   3777 O OD1 . ASP A 1 491 ? 3.143   3.851   26.365  1.00 70.36 ? 491  ASP A OD1 1 
ATOM   3778 O OD2 . ASP A 1 491 ? 2.803   1.669   26.355  1.00 71.70 ? 491  ASP A OD2 1 
ATOM   3779 N N   . PRO A 1 492 ? 3.811   -0.731  24.767  1.00 72.55 ? 492  PRO A N   1 
ATOM   3780 C CA  . PRO A 1 492 ? 3.084   -2.006  24.946  1.00 74.28 ? 492  PRO A CA  1 
ATOM   3781 C C   . PRO A 1 492 ? 1.573   -1.837  25.179  1.00 75.92 ? 492  PRO A C   1 
ATOM   3782 O O   . PRO A 1 492 ? 0.768   -2.516  24.529  1.00 76.05 ? 492  PRO A O   1 
ATOM   3783 C CB  . PRO A 1 492 ? 3.758   -2.614  26.180  1.00 74.23 ? 492  PRO A CB  1 
ATOM   3784 C CG  . PRO A 1 492 ? 5.158   -2.065  26.129  1.00 73.70 ? 492  PRO A CG  1 
ATOM   3785 C CD  . PRO A 1 492 ? 4.983   -0.647  25.661  1.00 72.71 ? 492  PRO A CD  1 
ATOM   3786 N N   . ARG A 1 493 ? 1.211   -0.934  26.092  1.00 77.81 ? 493  ARG A N   1 
ATOM   3787 C CA  . ARG A 1 493 ? -0.184  -0.559  26.346  1.00 79.72 ? 493  ARG A CA  1 
ATOM   3788 C C   . ARG A 1 493 ? -0.776  0.086   25.096  1.00 80.45 ? 493  ARG A C   1 
ATOM   3789 O O   . ARG A 1 493 ? -1.380  -0.592  24.249  1.00 80.63 ? 493  ARG A O   1 
ATOM   3790 C CB  . ARG A 1 493 ? -0.273  0.457   27.500  1.00 80.07 ? 493  ARG A CB  1 
ATOM   3791 C CG  . ARG A 1 493 ? 0.477   0.081   28.771  1.00 82.21 ? 493  ARG A CG  1 
ATOM   3792 C CD  . ARG A 1 493 ? 1.003   1.323   29.484  1.00 85.00 ? 493  ARG A CD  1 
ATOM   3793 N NE  . ARG A 1 493 ? 2.043   0.978   30.456  1.00 87.55 ? 493  ARG A NE  1 
ATOM   3794 C CZ  . ARG A 1 493 ? 2.805   1.860   31.103  1.00 88.49 ? 493  ARG A CZ  1 
ATOM   3795 N NH1 . ARG A 1 493 ? 2.657   3.166   30.893  1.00 88.34 ? 493  ARG A NH1 1 
ATOM   3796 N NH2 . ARG A 1 493 ? 3.720   1.431   31.966  1.00 88.24 ? 493  ARG A NH2 1 
ATOM   3797 N N   . ASP A 1 494 ? -0.565  1.404   25.010  1.00 81.26 ? 494  ASP A N   1 
ATOM   3798 C CA  . ASP A 1 494 ? -1.037  2.291   23.941  1.00 81.85 ? 494  ASP A CA  1 
ATOM   3799 C C   . ASP A 1 494 ? -1.103  1.648   22.546  1.00 82.14 ? 494  ASP A C   1 
ATOM   3800 O O   . ASP A 1 494 ? -0.114  1.616   21.800  1.00 82.33 ? 494  ASP A O   1 
ATOM   3801 C CB  . ASP A 1 494 ? -0.176  3.565   23.933  1.00 81.98 ? 494  ASP A CB  1 
ATOM   3802 C CG  . ASP A 1 494 ? -0.683  4.610   22.968  1.00 82.66 ? 494  ASP A CG  1 
ATOM   3803 O OD1 . ASP A 1 494 ? -0.505  4.423   21.747  1.00 82.81 ? 494  ASP A OD1 1 
ATOM   3804 O OD2 . ASP A 1 494 ? -1.248  5.625   23.434  1.00 83.74 ? 494  ASP A OD2 1 
ATOM   3805 N N   . SER A 1 495 ? -2.283  1.131   22.213  1.00 82.36 ? 495  SER A N   1 
ATOM   3806 C CA  . SER A 1 495 ? -2.530  0.556   20.896  1.00 82.36 ? 495  SER A CA  1 
ATOM   3807 C C   . SER A 1 495 ? -3.315  1.565   20.039  1.00 82.19 ? 495  SER A C   1 
ATOM   3808 O O   . SER A 1 495 ? -3.510  1.365   18.829  1.00 82.17 ? 495  SER A O   1 
ATOM   3809 C CB  . SER A 1 495 ? -3.260  -0.788  21.027  1.00 82.61 ? 495  SER A CB  1 
ATOM   3810 O OG  . SER A 1 495 ? -2.765  -1.730  20.083  1.00 82.80 ? 495  SER A OG  1 
ATOM   3811 N N   . LYS A 1 496 ? -3.734  2.659   20.682  1.00 81.72 ? 496  LYS A N   1 
ATOM   3812 C CA  . LYS A 1 496 ? -4.358  3.811   20.008  1.00 81.18 ? 496  LYS A CA  1 
ATOM   3813 C C   . LYS A 1 496 ? -3.399  4.492   19.012  1.00 79.84 ? 496  LYS A C   1 
ATOM   3814 O O   . LYS A 1 496 ? -3.732  4.633   17.824  1.00 79.93 ? 496  LYS A O   1 
ATOM   3815 C CB  . LYS A 1 496 ? -4.879  4.831   21.036  1.00 81.44 ? 496  LYS A CB  1 
ATOM   3816 C CG  . LYS A 1 496 ? -5.927  4.273   22.000  1.00 82.36 ? 496  LYS A CG  1 
ATOM   3817 C CD  . LYS A 1 496 ? -6.416  5.328   23.000  1.00 82.42 ? 496  LYS A CD  1 
ATOM   3818 C CE  . LYS A 1 496 ? -7.393  4.717   24.016  1.00 83.57 ? 496  LYS A CE  1 
ATOM   3819 N NZ  . LYS A 1 496 ? -8.141  5.766   24.778  1.00 84.98 ? 496  LYS A NZ  1 
ATOM   3820 N N   . SER A 1 497 ? -2.223  4.908   19.503  1.00 77.95 ? 497  SER A N   1 
ATOM   3821 C CA  . SER A 1 497 ? -1.174  5.489   18.657  1.00 75.89 ? 497  SER A CA  1 
ATOM   3822 C C   . SER A 1 497 ? -0.731  4.479   17.605  1.00 74.13 ? 497  SER A C   1 
ATOM   3823 O O   . SER A 1 497 ? -0.582  3.283   17.910  1.00 74.16 ? 497  SER A O   1 
ATOM   3824 C CB  . SER A 1 497 ? 0.044   5.933   19.482  1.00 76.13 ? 497  SER A CB  1 
ATOM   3825 O OG  . SER A 1 497 ? -0.275  6.976   20.394  1.00 76.23 ? 497  SER A OG  1 
ATOM   3826 N N   . PRO A 1 498 ? -0.540  4.950   16.357  1.00 72.12 ? 498  PRO A N   1 
ATOM   3827 C CA  . PRO A 1 498 ? -0.083  4.063   15.278  1.00 70.34 ? 498  PRO A CA  1 
ATOM   3828 C C   . PRO A 1 498 ? 1.263   3.409   15.607  1.00 68.35 ? 498  PRO A C   1 
ATOM   3829 O O   . PRO A 1 498 ? 2.063   3.969   16.368  1.00 68.02 ? 498  PRO A O   1 
ATOM   3830 C CB  . PRO A 1 498 ? 0.018   4.992   14.059  1.00 70.46 ? 498  PRO A CB  1 
ATOM   3831 C CG  . PRO A 1 498 ? -0.028  6.391   14.612  1.00 71.31 ? 498  PRO A CG  1 
ATOM   3832 C CD  . PRO A 1 498 ? -0.771  6.332   15.897  1.00 71.89 ? 498  PRO A CD  1 
ATOM   3833 N N   . GLN A 1 499 ? 1.485   2.221   15.053  1.00 65.94 ? 499  GLN A N   1 
ATOM   3834 C CA  . GLN A 1 499 ? 2.685   1.436   15.350  1.00 63.57 ? 499  GLN A CA  1 
ATOM   3835 C C   . GLN A 1 499 ? 3.883   1.766   14.440  1.00 61.29 ? 499  GLN A C   1 
ATOM   3836 O O   . GLN A 1 499 ? 3.725   2.108   13.261  1.00 61.11 ? 499  GLN A O   1 
ATOM   3837 C CB  . GLN A 1 499 ? 2.376   -0.070  15.297  1.00 63.99 ? 499  GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 499 ? 1.249   -0.519  16.239  1.00 65.42 ? 499  GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 499 ? 1.555   -0.253  17.715  1.00 66.01 ? 499  GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 499 ? 2.445   -0.883  18.299  1.00 65.26 ? 499  GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 499 ? 0.801   0.671   18.326  1.00 65.52 ? 499  GLN A NE2 1 
ATOM   3842 N N   . TRP A 1 500 ? 5.076   1.654   15.016  1.00 57.89 ? 500  TRP A N   1 
ATOM   3843 C CA  . TRP A 1 500 ? 6.319   1.833   14.306  1.00 54.57 ? 500  TRP A CA  1 
ATOM   3844 C C   . TRP A 1 500 ? 6.808   0.440   13.902  1.00 53.13 ? 500  TRP A C   1 
ATOM   3845 O O   . TRP A 1 500 ? 7.334   -0.307  14.728  1.00 52.66 ? 500  TRP A O   1 
ATOM   3846 C CB  . TRP A 1 500 ? 7.317   2.543   15.228  1.00 53.45 ? 500  TRP A CB  1 
ATOM   3847 C CG  . TRP A 1 500 ? 8.645   2.944   14.630  1.00 52.04 ? 500  TRP A CG  1 
ATOM   3848 C CD1 . TRP A 1 500 ? 9.263   2.408   13.536  1.00 51.64 ? 500  TRP A CD1 1 
ATOM   3849 C CD2 . TRP A 1 500 ? 9.538   3.939   15.144  1.00 50.88 ? 500  TRP A CD2 1 
ATOM   3850 N NE1 . TRP A 1 500 ? 10.472  3.029   13.318  1.00 52.08 ? 500  TRP A NE1 1 
ATOM   3851 C CE2 . TRP A 1 500 ? 10.668  3.967   14.297  1.00 51.17 ? 500  TRP A CE2 1 
ATOM   3852 C CE3 . TRP A 1 500 ? 9.486   4.819   16.230  1.00 49.19 ? 500  TRP A CE3 1 
ATOM   3853 C CZ2 . TRP A 1 500 ? 11.731  4.847   14.499  1.00 51.39 ? 500  TRP A CZ2 1 
ATOM   3854 C CZ3 . TRP A 1 500 ? 10.545  5.689   16.432  1.00 51.42 ? 500  TRP A CZ3 1 
ATOM   3855 C CH2 . TRP A 1 500 ? 11.653  5.696   15.573  1.00 51.17 ? 500  TRP A CH2 1 
ATOM   3856 N N   . PRO A 1 501 ? 6.616   0.070   12.628  1.00 51.94 ? 501  PRO A N   1 
ATOM   3857 C CA  . PRO A 1 501 ? 7.081   -1.246  12.226  1.00 51.10 ? 501  PRO A CA  1 
ATOM   3858 C C   . PRO A 1 501 ? 8.576   -1.236  12.042  1.00 50.46 ? 501  PRO A C   1 
ATOM   3859 O O   . PRO A 1 501 ? 9.130   -0.196  11.690  1.00 50.42 ? 501  PRO A O   1 
ATOM   3860 C CB  . PRO A 1 501 ? 6.409   -1.456  10.868  1.00 50.69 ? 501  PRO A CB  1 
ATOM   3861 C CG  . PRO A 1 501 ? 6.210   -0.098  10.331  1.00 50.87 ? 501  PRO A CG  1 
ATOM   3862 C CD  . PRO A 1 501 ? 5.985   0.799   11.512  1.00 51.72 ? 501  PRO A CD  1 
ATOM   3863 N N   . PRO A 1 502 ? 9.228   -2.382  12.281  1.00 49.98 ? 502  PRO A N   1 
ATOM   3864 C CA  . PRO A 1 502 ? 10.631  -2.595  11.911  1.00 49.69 ? 502  PRO A CA  1 
ATOM   3865 C C   . PRO A 1 502 ? 10.921  -2.322  10.434  1.00 49.59 ? 502  PRO A C   1 
ATOM   3866 O O   . PRO A 1 502 ? 10.033  -2.437  9.595   1.00 49.61 ? 502  PRO A O   1 
ATOM   3867 C CB  . PRO A 1 502 ? 10.846  -4.087  12.195  1.00 49.33 ? 502  PRO A CB  1 
ATOM   3868 C CG  . PRO A 1 502 ? 9.870   -4.397  13.281  1.00 49.66 ? 502  PRO A CG  1 
ATOM   3869 C CD  . PRO A 1 502 ? 8.659   -3.551  12.977  1.00 49.72 ? 502  PRO A CD  1 
ATOM   3870 N N   . TYR A 1 503 ? 12.167  -1.963  10.142  1.00 49.44 ? 503  TYR A N   1 
ATOM   3871 C CA  . TYR A 1 503 ? 12.650  -1.828  8.789   1.00 49.16 ? 503  TYR A CA  1 
ATOM   3872 C C   . TYR A 1 503 ? 13.071  -3.185  8.230   1.00 49.44 ? 503  TYR A C   1 
ATOM   3873 O O   . TYR A 1 503 ? 13.897  -3.875  8.820   1.00 49.04 ? 503  TYR A O   1 
ATOM   3874 C CB  . TYR A 1 503 ? 13.835  -0.855  8.748   1.00 48.78 ? 503  TYR A CB  1 
ATOM   3875 C CG  . TYR A 1 503 ? 14.380  -0.656  7.358   1.00 47.84 ? 503  TYR A CG  1 
ATOM   3876 C CD1 . TYR A 1 503 ? 15.477  -1.396  6.898   1.00 47.23 ? 503  TYR A CD1 1 
ATOM   3877 C CD2 . TYR A 1 503 ? 13.789  0.252   6.494   1.00 47.31 ? 503  TYR A CD2 1 
ATOM   3878 C CE1 . TYR A 1 503 ? 15.965  -1.221  5.614   1.00 46.95 ? 503  TYR A CE1 1 
ATOM   3879 C CE2 . TYR A 1 503 ? 14.272  0.439   5.215   1.00 46.96 ? 503  TYR A CE2 1 
ATOM   3880 C CZ  . TYR A 1 503 ? 15.348  -0.299  4.783   1.00 47.85 ? 503  TYR A CZ  1 
ATOM   3881 O OH  . TYR A 1 503 ? 15.794  -0.106  3.502   1.00 50.09 ? 503  TYR A OH  1 
ATOM   3882 N N   . THR A 1 504 ? 12.528  -3.549  7.071   1.00 50.08 ? 504  THR A N   1 
ATOM   3883 C CA  . THR A 1 504 ? 12.913  -4.809  6.399   1.00 50.78 ? 504  THR A CA  1 
ATOM   3884 C C   . THR A 1 504 ? 13.417  -4.561  4.977   1.00 50.88 ? 504  THR A C   1 
ATOM   3885 O O   . THR A 1 504 ? 13.070  -3.551  4.367   1.00 50.54 ? 504  THR A O   1 
ATOM   3886 C CB  . THR A 1 504 ? 11.727  -5.793  6.346   1.00 50.64 ? 504  THR A CB  1 
ATOM   3887 O OG1 . THR A 1 504 ? 10.580  -5.118  5.805   1.00 51.61 ? 504  THR A OG1 1 
ATOM   3888 C CG2 . THR A 1 504 ? 11.386  -6.294  7.746   1.00 50.10 ? 504  THR A CG2 1 
ATOM   3889 N N   . THR A 1 505 ? 14.232  -5.474  4.448   1.00 51.25 ? 505  THR A N   1 
ATOM   3890 C CA  . THR A 1 505 ? 14.630  -5.375  3.042   1.00 51.57 ? 505  THR A CA  1 
ATOM   3891 C C   . THR A 1 505 ? 13.417  -5.538  2.109   1.00 51.28 ? 505  THR A C   1 
ATOM   3892 O O   . THR A 1 505 ? 13.308  -4.854  1.083   1.00 51.36 ? 505  THR A O   1 
ATOM   3893 C CB  . THR A 1 505 ? 15.717  -6.404  2.652   1.00 52.15 ? 505  THR A CB  1 
ATOM   3894 O OG1 . THR A 1 505 ? 15.155  -7.715  2.626   1.00 51.78 ? 505  THR A OG1 1 
ATOM   3895 C CG2 . THR A 1 505 ? 16.908  -6.369  3.628   1.00 53.40 ? 505  THR A CG2 1 
ATOM   3896 N N   . ALA A 1 506 ? 12.510  -6.442  2.470   1.00 50.79 ? 506  ALA A N   1 
ATOM   3897 C CA  . ALA A 1 506 ? 11.309  -6.682  1.677   1.00 50.72 ? 506  ALA A CA  1 
ATOM   3898 C C   . ALA A 1 506 ? 10.403  -5.468  1.607   1.00 50.17 ? 506  ALA A C   1 
ATOM   3899 O O   . ALA A 1 506 ? 9.940   -5.115  0.523   1.00 50.38 ? 506  ALA A O   1 
ATOM   3900 C CB  . ALA A 1 506 ? 10.512  -7.903  2.212   1.00 51.11 ? 506  ALA A CB  1 
ATOM   3901 N N   . ALA A 1 507 ? 10.144  -4.841  2.754   1.00 49.44 ? 507  ALA A N   1 
ATOM   3902 C CA  . ALA A 1 507 ? 9.144   -3.767  2.814   1.00 49.05 ? 507  ALA A CA  1 
ATOM   3903 C C   . ALA A 1 507 ? 9.707   -2.353  3.017   1.00 48.54 ? 507  ALA A C   1 
ATOM   3904 O O   . ALA A 1 507 ? 9.036   -1.369  2.681   1.00 48.47 ? 507  ALA A O   1 
ATOM   3905 C CB  . ALA A 1 507 ? 8.052   -4.087  3.853   1.00 48.86 ? 507  ALA A CB  1 
ATOM   3906 N N   . GLN A 1 508 ? 10.920  -2.250  3.559   1.00 47.77 ? 508  GLN A N   1 
ATOM   3907 C CA  . GLN A 1 508 ? 11.629  -0.958  3.653   1.00 47.64 ? 508  GLN A CA  1 
ATOM   3908 C C   . GLN A 1 508 ? 10.817  0.120   4.369   1.00 47.31 ? 508  GLN A C   1 
ATOM   3909 O O   . GLN A 1 508 ? 10.723  1.259   3.898   1.00 47.25 ? 508  GLN A O   1 
ATOM   3910 C CB  . GLN A 1 508 ? 12.080  -0.461  2.261   1.00 47.27 ? 508  GLN A CB  1 
ATOM   3911 C CG  . GLN A 1 508 ? 13.149  -1.345  1.580   1.00 47.98 ? 508  GLN A CG  1 
ATOM   3912 C CD  . GLN A 1 508 ? 13.446  -0.926  0.142   1.00 48.47 ? 508  GLN A CD  1 
ATOM   3913 O OE1 . GLN A 1 508 ? 13.100  -1.633  -0.816  1.00 48.13 ? 508  GLN A OE1 1 
ATOM   3914 N NE2 . GLN A 1 508 ? 14.084  0.234   -0.015  1.00 49.32 ? 508  GLN A NE2 1 
ATOM   3915 N N   . GLN A 1 509 ? 10.237  -0.244  5.509   1.00 47.12 ? 509  GLN A N   1 
ATOM   3916 C CA  . GLN A 1 509 ? 9.372   0.669   6.265   1.00 47.30 ? 509  GLN A CA  1 
ATOM   3917 C C   . GLN A 1 509 ? 10.092  1.586   7.261   1.00 46.54 ? 509  GLN A C   1 
ATOM   3918 O O   . GLN A 1 509 ? 11.022  1.168   7.947   1.00 46.57 ? 509  GLN A O   1 
ATOM   3919 C CB  . GLN A 1 509 ? 8.260   -0.103  6.985   1.00 47.07 ? 509  GLN A CB  1 
ATOM   3920 C CG  . GLN A 1 509 ? 7.148   -0.565  6.069   1.00 48.30 ? 509  GLN A CG  1 
ATOM   3921 C CD  . GLN A 1 509 ? 6.191   -1.510  6.762   1.00 49.02 ? 509  GLN A CD  1 
ATOM   3922 O OE1 . GLN A 1 509 ? 6.593   -2.588  7.225   1.00 48.55 ? 509  GLN A OE1 1 
ATOM   3923 N NE2 . GLN A 1 509 ? 4.921   -1.108  6.854   1.00 47.31 ? 509  GLN A NE2 1 
ATOM   3924 N N   . TYR A 1 510 ? 9.626   2.829   7.337   1.00 45.65 ? 510  TYR A N   1 
ATOM   3925 C CA  . TYR A 1 510 ? 10.165  3.816   8.260   1.00 45.34 ? 510  TYR A CA  1 
ATOM   3926 C C   . TYR A 1 510 ? 9.081   4.825   8.630   1.00 45.91 ? 510  TYR A C   1 
ATOM   3927 O O   . TYR A 1 510 ? 8.062   4.928   7.954   1.00 46.39 ? 510  TYR A O   1 
ATOM   3928 C CB  . TYR A 1 510 ? 11.406  4.503   7.673   1.00 44.34 ? 510  TYR A CB  1 
ATOM   3929 C CG  . TYR A 1 510 ? 11.159  5.407   6.486   1.00 43.35 ? 510  TYR A CG  1 
ATOM   3930 C CD1 . TYR A 1 510 ? 11.064  4.890   5.189   1.00 40.35 ? 510  TYR A CD1 1 
ATOM   3931 C CD2 . TYR A 1 510 ? 11.057  6.801   6.656   1.00 42.75 ? 510  TYR A CD2 1 
ATOM   3932 C CE1 . TYR A 1 510 ? 10.845  5.724   4.105   1.00 40.72 ? 510  TYR A CE1 1 
ATOM   3933 C CE2 . TYR A 1 510 ? 10.833  7.637   5.584   1.00 41.66 ? 510  TYR A CE2 1 
ATOM   3934 C CZ  . TYR A 1 510 ? 10.733  7.104   4.309   1.00 42.91 ? 510  TYR A CZ  1 
ATOM   3935 O OH  . TYR A 1 510 ? 10.526  7.962   3.239   1.00 43.59 ? 510  TYR A OH  1 
ATOM   3936 N N   . VAL A 1 511 ? 9.283   5.564   9.712   1.00 46.22 ? 511  VAL A N   1 
ATOM   3937 C CA  . VAL A 1 511 ? 8.244   6.469   10.171  1.00 46.37 ? 511  VAL A CA  1 
ATOM   3938 C C   . VAL A 1 511 ? 8.682   7.920   10.040  1.00 46.43 ? 511  VAL A C   1 
ATOM   3939 O O   . VAL A 1 511 ? 9.865   8.223   10.134  1.00 46.41 ? 511  VAL A O   1 
ATOM   3940 C CB  . VAL A 1 511 ? 7.822   6.164   11.633  1.00 46.65 ? 511  VAL A CB  1 
ATOM   3941 C CG1 . VAL A 1 511 ? 7.248   4.754   11.742  1.00 46.97 ? 511  VAL A CG1 1 
ATOM   3942 C CG2 . VAL A 1 511 ? 8.986   6.340   12.603  1.00 45.68 ? 511  VAL A CG2 1 
ATOM   3943 N N   . SER A 1 512 ? 7.728   8.811   9.812   1.00 46.69 ? 512  SER A N   1 
ATOM   3944 C CA  . SER A 1 512 ? 8.002   10.243  9.888   1.00 47.20 ? 512  SER A CA  1 
ATOM   3945 C C   . SER A 1 512 ? 7.858   10.715  11.334  1.00 47.15 ? 512  SER A C   1 
ATOM   3946 O O   . SER A 1 512 ? 6.907   10.338  12.021  1.00 47.63 ? 512  SER A O   1 
ATOM   3947 C CB  . SER A 1 512 ? 7.061   11.031  8.965   1.00 47.20 ? 512  SER A CB  1 
ATOM   3948 O OG  . SER A 1 512 ? 5.694   10.783  9.269   1.00 47.76 ? 512  SER A OG  1 
ATOM   3949 N N   . LEU A 1 513 ? 8.812   11.519  11.796  1.00 47.02 ? 513  LEU A N   1 
ATOM   3950 C CA  . LEU A 1 513 ? 8.727   12.157  13.106  1.00 46.65 ? 513  LEU A CA  1 
ATOM   3951 C C   . LEU A 1 513 ? 8.465   13.657  12.932  1.00 46.96 ? 513  LEU A C   1 
ATOM   3952 O O   . LEU A 1 513 ? 9.354   14.425  12.505  1.00 46.48 ? 513  LEU A O   1 
ATOM   3953 C CB  . LEU A 1 513 ? 9.987   11.893  13.954  1.00 46.37 ? 513  LEU A CB  1 
ATOM   3954 C CG  . LEU A 1 513 ? 10.408  10.448  14.291  1.00 45.99 ? 513  LEU A CG  1 
ATOM   3955 C CD1 . LEU A 1 513 ? 11.658  10.426  15.151  1.00 42.27 ? 513  LEU A CD1 1 
ATOM   3956 C CD2 . LEU A 1 513 ? 9.284   9.704   15.005  1.00 45.51 ? 513  LEU A CD2 1 
ATOM   3957 N N   . ASN A 1 514 ? 7.221   14.044  13.220  1.00 47.21 ? 514  ASN A N   1 
ATOM   3958 C CA  . ASN A 1 514 ? 6.778   15.450  13.238  1.00 47.90 ? 514  ASN A CA  1 
ATOM   3959 C C   . ASN A 1 514 ? 5.638   15.653  14.235  1.00 48.08 ? 514  ASN A C   1 
ATOM   3960 O O   . ASN A 1 514 ? 5.335   14.760  15.018  1.00 48.08 ? 514  ASN A O   1 
ATOM   3961 C CB  . ASN A 1 514 ? 6.389   15.946  11.833  1.00 47.72 ? 514  ASN A CB  1 
ATOM   3962 C CG  . ASN A 1 514 ? 5.497   14.960  11.086  1.00 48.17 ? 514  ASN A CG  1 
ATOM   3963 O OD1 . ASN A 1 514 ? 4.532   14.422  11.646  1.00 48.64 ? 514  ASN A OD1 1 
ATOM   3964 N ND2 . ASN A 1 514 ? 5.821   14.714  9.818   1.00 46.96 ? 514  ASN A ND2 1 
ATOM   3965 N N   . LEU A 1 515 ? 5.018   16.828  14.217  1.00 48.90 ? 515  LEU A N   1 
ATOM   3966 C CA  . LEU A 1 515 ? 3.911   17.139  15.127  1.00 49.21 ? 515  LEU A CA  1 
ATOM   3967 C C   . LEU A 1 515 ? 2.693   16.229  14.921  1.00 49.89 ? 515  LEU A C   1 
ATOM   3968 O O   . LEU A 1 515 ? 1.873   16.062  15.818  1.00 49.79 ? 515  LEU A O   1 
ATOM   3969 C CB  . LEU A 1 515 ? 3.517   18.606  14.970  1.00 49.12 ? 515  LEU A CB  1 
ATOM   3970 C CG  . LEU A 1 515 ? 4.631   19.632  15.223  1.00 49.12 ? 515  LEU A CG  1 
ATOM   3971 C CD1 . LEU A 1 515 ? 4.101   21.052  15.147  1.00 48.22 ? 515  LEU A CD1 1 
ATOM   3972 C CD2 . LEU A 1 515 ? 5.308   19.387  16.577  1.00 47.74 ? 515  LEU A CD2 1 
ATOM   3973 N N   . LYS A 1 516 ? 2.591   15.647  13.729  1.00 50.60 ? 516  LYS A N   1 
ATOM   3974 C CA  . LYS A 1 516 ? 1.509   14.736  13.381  1.00 51.60 ? 516  LYS A CA  1 
ATOM   3975 C C   . LYS A 1 516 ? 1.775   13.308  13.885  1.00 51.44 ? 516  LYS A C   1 
ATOM   3976 O O   . LYS A 1 516 ? 2.921   12.909  14.087  1.00 51.53 ? 516  LYS A O   1 
ATOM   3977 C CB  . LYS A 1 516 ? 1.264   14.763  11.861  1.00 51.33 ? 516  LYS A CB  1 
ATOM   3978 C CG  . LYS A 1 516 ? 0.471   16.003  11.383  1.00 53.10 ? 516  LYS A CG  1 
ATOM   3979 C CD  . LYS A 1 516 ? 0.648   16.316  9.870   1.00 53.45 ? 516  LYS A CD  1 
ATOM   3980 C CE  . LYS A 1 516 ? 0.362   15.102  8.948   1.00 56.34 ? 516  LYS A CE  1 
ATOM   3981 N NZ  . LYS A 1 516 ? 0.619   15.397  7.486   1.00 55.25 ? 516  LYS A NZ  1 
ATOM   3982 N N   . PRO A 1 517 ? 0.708   12.539  14.129  1.00 51.64 ? 517  PRO A N   1 
ATOM   3983 C CA  . PRO A 1 517 ? 0.898   11.140  14.518  1.00 51.51 ? 517  PRO A CA  1 
ATOM   3984 C C   . PRO A 1 517 ? 1.772   10.369  13.524  1.00 51.41 ? 517  PRO A C   1 
ATOM   3985 O O   . PRO A 1 517 ? 1.718   10.639  12.311  1.00 51.24 ? 517  PRO A O   1 
ATOM   3986 C CB  . PRO A 1 517 ? -0.532  10.577  14.504  1.00 51.27 ? 517  PRO A CB  1 
ATOM   3987 C CG  . PRO A 1 517 ? -1.395  11.750  14.758  1.00 51.98 ? 517  PRO A CG  1 
ATOM   3988 C CD  . PRO A 1 517 ? -0.718  12.924  14.105  1.00 51.53 ? 517  PRO A CD  1 
ATOM   3989 N N   . LEU A 1 518 ? 2.553   9.416   14.038  1.00 51.05 ? 518  LEU A N   1 
ATOM   3990 C CA  . LEU A 1 518 ? 3.386   8.554   13.197  1.00 51.48 ? 518  LEU A CA  1 
ATOM   3991 C C   . LEU A 1 518 ? 2.727   8.168   11.878  1.00 51.79 ? 518  LEU A C   1 
ATOM   3992 O O   . LEU A 1 518 ? 1.636   7.619   11.861  1.00 51.95 ? 518  LEU A O   1 
ATOM   3993 C CB  . LEU A 1 518 ? 3.764   7.262   13.932  1.00 51.04 ? 518  LEU A CB  1 
ATOM   3994 C CG  . LEU A 1 518 ? 4.960   7.202   14.872  1.00 51.25 ? 518  LEU A CG  1 
ATOM   3995 C CD1 . LEU A 1 518 ? 5.359   5.749   15.049  1.00 52.19 ? 518  LEU A CD1 1 
ATOM   3996 C CD2 . LEU A 1 518 ? 6.140   7.989   14.349  1.00 50.95 ? 518  LEU A CD2 1 
ATOM   3997 N N   . GLU A 1 519 ? 3.408   8.445   10.779  1.00 52.44 ? 519  GLU A N   1 
ATOM   3998 C CA  . GLU A 1 519 ? 2.977   7.981   9.478   1.00 53.20 ? 519  GLU A CA  1 
ATOM   3999 C C   . GLU A 1 519 ? 4.054   7.068   8.919   1.00 52.68 ? 519  GLU A C   1 
ATOM   4000 O O   . GLU A 1 519 ? 5.231   7.413   8.962   1.00 52.69 ? 519  GLU A O   1 
ATOM   4001 C CB  . GLU A 1 519 ? 2.750   9.171   8.549   1.00 53.02 ? 519  GLU A CB  1 
ATOM   4002 C CG  . GLU A 1 519 ? 2.821   8.821   7.062   1.00 54.97 ? 519  GLU A CG  1 
ATOM   4003 C CD  . GLU A 1 519 ? 2.617   10.021  6.162   1.00 55.62 ? 519  GLU A CD  1 
ATOM   4004 O OE1 . GLU A 1 519 ? 1.819   10.917  6.539   1.00 60.76 ? 519  GLU A OE1 1 
ATOM   4005 O OE2 . GLU A 1 519 ? 3.252   10.068  5.082   1.00 57.40 ? 519  GLU A OE2 1 
ATOM   4006 N N   . VAL A 1 520 ? 3.653   5.909   8.400   1.00 52.23 ? 520  VAL A N   1 
ATOM   4007 C CA  . VAL A 1 520 ? 4.603   4.933   7.863   1.00 51.96 ? 520  VAL A CA  1 
ATOM   4008 C C   . VAL A 1 520 ? 4.803   5.134   6.365   1.00 52.34 ? 520  VAL A C   1 
ATOM   4009 O O   . VAL A 1 520 ? 3.837   5.155   5.589   1.00 52.30 ? 520  VAL A O   1 
ATOM   4010 C CB  . VAL A 1 520 ? 4.145   3.481   8.134   1.00 51.88 ? 520  VAL A CB  1 
ATOM   4011 C CG1 . VAL A 1 520 ? 5.027   2.478   7.403   1.00 51.38 ? 520  VAL A CG1 1 
ATOM   4012 C CG2 . VAL A 1 520 ? 4.137   3.200   9.624   1.00 51.28 ? 520  VAL A CG2 1 
ATOM   4013 N N   . ARG A 1 521 ? 6.066   5.298   5.972   1.00 52.25 ? 521  ARG A N   1 
ATOM   4014 C CA  . ARG A 1 521 ? 6.437   5.436   4.568   1.00 52.04 ? 521  ARG A CA  1 
ATOM   4015 C C   . ARG A 1 521 ? 7.291   4.247   4.162   1.00 52.09 ? 521  ARG A C   1 
ATOM   4016 O O   . ARG A 1 521 ? 7.816   3.536   5.024   1.00 52.18 ? 521  ARG A O   1 
ATOM   4017 C CB  . ARG A 1 521 ? 7.163   6.766   4.316   1.00 51.99 ? 521  ARG A CB  1 
ATOM   4018 C CG  . ARG A 1 521 ? 6.275   7.977   4.562   1.00 51.46 ? 521  ARG A CG  1 
ATOM   4019 C CD  . ARG A 1 521 ? 7.034   9.280   4.582   1.00 49.45 ? 521  ARG A CD  1 
ATOM   4020 N NE  . ARG A 1 521 ? 6.230   10.352  5.166   1.00 48.18 ? 521  ARG A NE  1 
ATOM   4021 C CZ  . ARG A 1 521 ? 6.706   11.545  5.531   1.00 48.42 ? 521  ARG A CZ  1 
ATOM   4022 N NH1 . ARG A 1 521 ? 7.991   11.838  5.383   1.00 46.15 ? 521  ARG A NH1 1 
ATOM   4023 N NH2 . ARG A 1 521 ? 5.894   12.451  6.061   1.00 47.32 ? 521  ARG A NH2 1 
ATOM   4024 N N   . ARG A 1 522 ? 7.408   4.024   2.856   1.00 52.09 ? 522  ARG A N   1 
ATOM   4025 C CA  . ARG A 1 522 ? 8.162   2.892   2.335   1.00 52.98 ? 522  ARG A CA  1 
ATOM   4026 C C   . ARG A 1 522 ? 9.309   3.365   1.448   1.00 52.06 ? 522  ARG A C   1 
ATOM   4027 O O   . ARG A 1 522 ? 9.134   4.259   0.612   1.00 52.17 ? 522  ARG A O   1 
ATOM   4028 C CB  . ARG A 1 522 ? 7.249   1.915   1.564   1.00 52.87 ? 522  ARG A CB  1 
ATOM   4029 C CG  . ARG A 1 522 ? 6.182   1.181   2.431   1.00 54.83 ? 522  ARG A CG  1 
ATOM   4030 C CD  . ARG A 1 522 ? 5.608   -0.095  1.748   1.00 55.42 ? 522  ARG A CD  1 
ATOM   4031 N NE  . ARG A 1 522 ? 6.667   -0.902  1.117   1.00 61.39 ? 522  ARG A NE  1 
ATOM   4032 C CZ  . ARG A 1 522 ? 6.517   -1.654  0.021   1.00 62.83 ? 522  ARG A CZ  1 
ATOM   4033 N NH1 . ARG A 1 522 ? 5.330   -1.741  -0.578  1.00 64.39 ? 522  ARG A NH1 1 
ATOM   4034 N NH2 . ARG A 1 522 ? 7.559   -2.322  -0.478  1.00 61.85 ? 522  ARG A NH2 1 
ATOM   4035 N N   . GLY A 1 523 ? 10.478  2.765   1.642   1.00 51.26 ? 523  GLY A N   1 
ATOM   4036 C CA  . GLY A 1 523 ? 11.650  3.047   0.808   1.00 50.90 ? 523  GLY A CA  1 
ATOM   4037 C C   . GLY A 1 523 ? 12.407  4.304   1.203   1.00 50.54 ? 523  GLY A C   1 
ATOM   4038 O O   . GLY A 1 523 ? 11.921  5.417   1.008   1.00 50.49 ? 523  GLY A O   1 
ATOM   4039 N N   . LEU A 1 524 ? 13.599  4.134   1.766   1.00 50.41 ? 524  LEU A N   1 
ATOM   4040 C CA  . LEU A 1 524 ? 14.382  5.291   2.204   1.00 50.41 ? 524  LEU A CA  1 
ATOM   4041 C C   . LEU A 1 524 ? 15.175  5.872   1.046   1.00 49.57 ? 524  LEU A C   1 
ATOM   4042 O O   . LEU A 1 524 ? 16.286  5.422   0.777   1.00 49.92 ? 524  LEU A O   1 
ATOM   4043 C CB  . LEU A 1 524 ? 15.312  4.913   3.354   1.00 50.61 ? 524  LEU A CB  1 
ATOM   4044 C CG  . LEU A 1 524 ? 15.669  6.127   4.223   1.00 53.02 ? 524  LEU A CG  1 
ATOM   4045 C CD1 . LEU A 1 524 ? 14.529  6.491   5.187   1.00 53.57 ? 524  LEU A CD1 1 
ATOM   4046 C CD2 . LEU A 1 524 ? 16.978  5.891   4.988   1.00 54.27 ? 524  LEU A CD2 1 
ATOM   4047 N N   . ARG A 1 525 ? 14.600  6.856   0.360   1.00 48.72 ? 525  ARG A N   1 
ATOM   4048 C CA  . ARG A 1 525 ? 15.179  7.384   -0.879  1.00 48.96 ? 525  ARG A CA  1 
ATOM   4049 C C   . ARG A 1 525 ? 15.645  6.261   -1.805  1.00 48.32 ? 525  ARG A C   1 
ATOM   4050 O O   . ARG A 1 525 ? 16.785  6.273   -2.287  1.00 48.66 ? 525  ARG A O   1 
ATOM   4051 C CB  . ARG A 1 525 ? 16.372  8.304   -0.575  1.00 49.62 ? 525  ARG A CB  1 
ATOM   4052 C CG  . ARG A 1 525 ? 16.022  9.617   0.084   1.00 51.14 ? 525  ARG A CG  1 
ATOM   4053 C CD  . ARG A 1 525 ? 15.959  10.727  -0.927  1.00 54.53 ? 525  ARG A CD  1 
ATOM   4054 N NE  . ARG A 1 525 ? 16.659  11.894  -0.403  1.00 58.14 ? 525  ARG A NE  1 
ATOM   4055 C CZ  . ARG A 1 525 ? 16.169  12.716  0.523   1.00 59.03 ? 525  ARG A CZ  1 
ATOM   4056 N NH1 . ARG A 1 525 ? 14.954  12.512  1.031   1.00 58.78 ? 525  ARG A NH1 1 
ATOM   4057 N NH2 . ARG A 1 525 ? 16.897  13.749  0.936   1.00 58.96 ? 525  ARG A NH2 1 
ATOM   4058 N N   . ALA A 1 526 ? 14.771  5.294   -2.060  1.00 47.77 ? 526  ALA A N   1 
ATOM   4059 C CA  . ALA A 1 526 ? 15.190  4.059   -2.727  1.00 47.08 ? 526  ALA A CA  1 
ATOM   4060 C C   . ALA A 1 526 ? 15.879  4.274   -4.082  1.00 46.57 ? 526  ALA A C   1 
ATOM   4061 O O   . ALA A 1 526 ? 16.935  3.702   -4.299  1.00 46.33 ? 526  ALA A O   1 
ATOM   4062 C CB  . ALA A 1 526 ? 14.028  3.072   -2.839  1.00 46.77 ? 526  ALA A CB  1 
ATOM   4063 N N   . GLN A 1 527 ? 15.312  5.106   -4.970  1.00 46.04 ? 527  GLN A N   1 
ATOM   4064 C CA  . GLN A 1 527 ? 15.904  5.285   -6.314  1.00 45.77 ? 527  GLN A CA  1 
ATOM   4065 C C   . GLN A 1 527 ? 17.263  5.939   -6.243  1.00 45.21 ? 527  GLN A C   1 
ATOM   4066 O O   . GLN A 1 527 ? 18.243  5.404   -6.756  1.00 45.35 ? 527  GLN A O   1 
ATOM   4067 C CB  . GLN A 1 527 ? 15.005  6.063   -7.291  1.00 45.81 ? 527  GLN A CB  1 
ATOM   4068 C CG  . GLN A 1 527 ? 13.845  5.271   -7.946  1.00 47.10 ? 527  GLN A CG  1 
ATOM   4069 C CD  . GLN A 1 527 ? 14.229  3.872   -8.463  1.00 47.78 ? 527  GLN A CD  1 
ATOM   4070 O OE1 . GLN A 1 527 ? 13.802  2.857   -7.903  1.00 48.87 ? 527  GLN A OE1 1 
ATOM   4071 N NE2 . GLN A 1 527 ? 15.014  3.820   -9.534  1.00 47.97 ? 527  GLN A NE2 1 
ATOM   4072 N N   . THR A 1 528 ? 17.306  7.097   -5.599  1.00 44.73 ? 528  THR A N   1 
ATOM   4073 C CA  . THR A 1 528 ? 18.527  7.869   -5.445  1.00 44.21 ? 528  THR A CA  1 
ATOM   4074 C C   . THR A 1 528 ? 19.621  7.058   -4.737  1.00 44.44 ? 528  THR A C   1 
ATOM   4075 O O   . THR A 1 528 ? 20.776  7.071   -5.176  1.00 44.06 ? 528  THR A O   1 
ATOM   4076 C CB  . THR A 1 528 ? 18.244  9.185   -4.702  1.00 44.23 ? 528  THR A CB  1 
ATOM   4077 O OG1 . THR A 1 528 ? 17.557  10.081  -5.584  1.00 43.27 ? 528  THR A OG1 1 
ATOM   4078 C CG2 . THR A 1 528 ? 19.535  9.839   -4.204  1.00 43.67 ? 528  THR A CG2 1 
ATOM   4079 N N   . CYS A 1 529 ? 19.265  6.329   -3.675  1.00 44.01 ? 529  CYS A N   1 
ATOM   4080 C CA  . CYS A 1 529 ? 20.288  5.557   -2.971  1.00 44.26 ? 529  CYS A CA  1 
ATOM   4081 C C   . CYS A 1 529 ? 20.886  4.404   -3.792  1.00 43.74 ? 529  CYS A C   1 
ATOM   4082 O O   . CYS A 1 529 ? 22.049  4.054   -3.587  1.00 43.55 ? 529  CYS A O   1 
ATOM   4083 C CB  . CYS A 1 529 ? 19.860  5.138   -1.560  1.00 44.20 ? 529  CYS A CB  1 
ATOM   4084 S SG  . CYS A 1 529 ? 19.803  6.555   -0.355  1.00 46.19 ? 529  CYS A SG  1 
ATOM   4085 N N   . ALA A 1 530 ? 20.130  3.854   -4.743  1.00 43.00 ? 530  ALA A N   1 
ATOM   4086 C CA  . ALA A 1 530 ? 20.730  2.926   -5.711  1.00 42.87 ? 530  ALA A CA  1 
ATOM   4087 C C   . ALA A 1 530 ? 21.841  3.588   -6.533  1.00 42.96 ? 530  ALA A C   1 
ATOM   4088 O O   . ALA A 1 530 ? 22.825  2.935   -6.889  1.00 43.05 ? 530  ALA A O   1 
ATOM   4089 C CB  . ALA A 1 530 ? 19.705  2.361   -6.631  1.00 42.51 ? 530  ALA A CB  1 
ATOM   4090 N N   . PHE A 1 531 ? 21.672  4.869   -6.854  1.00 42.33 ? 531  PHE A N   1 
ATOM   4091 C CA  . PHE A 1 531 ? 22.714  5.593   -7.541  1.00 42.28 ? 531  PHE A CA  1 
ATOM   4092 C C   . PHE A 1 531 ? 24.014  5.642   -6.709  1.00 42.29 ? 531  PHE A C   1 
ATOM   4093 O O   . PHE A 1 531 ? 25.079  5.252   -7.191  1.00 42.47 ? 531  PHE A O   1 
ATOM   4094 C CB  . PHE A 1 531 ? 22.243  7.001   -7.916  1.00 42.44 ? 531  PHE A CB  1 
ATOM   4095 C CG  . PHE A 1 531 ? 23.333  7.866   -8.453  1.00 41.91 ? 531  PHE A CG  1 
ATOM   4096 C CD1 . PHE A 1 531 ? 23.754  7.726   -9.766  1.00 41.14 ? 531  PHE A CD1 1 
ATOM   4097 C CD2 . PHE A 1 531 ? 23.964  8.795   -7.633  1.00 42.12 ? 531  PHE A CD2 1 
ATOM   4098 C CE1 . PHE A 1 531 ? 24.767  8.502   -10.272 1.00 41.52 ? 531  PHE A CE1 1 
ATOM   4099 C CE2 . PHE A 1 531 ? 24.997  9.581   -8.125  1.00 42.39 ? 531  PHE A CE2 1 
ATOM   4100 C CZ  . PHE A 1 531 ? 25.398  9.435   -9.450  1.00 42.79 ? 531  PHE A CZ  1 
ATOM   4101 N N   . TRP A 1 532 ? 23.922  6.108   -5.468  1.00 42.06 ? 532  TRP A N   1 
ATOM   4102 C CA  . TRP A 1 532 ? 25.109  6.252   -4.613  1.00 42.10 ? 532  TRP A CA  1 
ATOM   4103 C C   . TRP A 1 532 ? 25.710  4.911   -4.187  1.00 42.82 ? 532  TRP A C   1 
ATOM   4104 O O   . TRP A 1 532 ? 26.935  4.763   -4.153  1.00 42.72 ? 532  TRP A O   1 
ATOM   4105 C CB  . TRP A 1 532 ? 24.802  7.101   -3.373  1.00 40.82 ? 532  TRP A CB  1 
ATOM   4106 C CG  . TRP A 1 532 ? 24.436  8.533   -3.687  1.00 39.52 ? 532  TRP A CG  1 
ATOM   4107 C CD1 . TRP A 1 532 ? 23.185  9.077   -3.693  1.00 37.61 ? 532  TRP A CD1 1 
ATOM   4108 C CD2 . TRP A 1 532 ? 25.334  9.592   -4.036  1.00 38.47 ? 532  TRP A CD2 1 
ATOM   4109 N NE1 . TRP A 1 532 ? 23.245  10.410  -4.020  1.00 36.37 ? 532  TRP A NE1 1 
ATOM   4110 C CE2 . TRP A 1 532 ? 24.552  10.753  -4.241  1.00 37.47 ? 532  TRP A CE2 1 
ATOM   4111 C CE3 . TRP A 1 532 ? 26.728  9.676   -4.193  1.00 38.38 ? 532  TRP A CE3 1 
ATOM   4112 C CZ2 . TRP A 1 532 ? 25.112  11.979  -4.604  1.00 37.21 ? 532  TRP A CZ2 1 
ATOM   4113 C CZ3 . TRP A 1 532 ? 27.285  10.902  -4.551  1.00 37.52 ? 532  TRP A CZ3 1 
ATOM   4114 C CH2 . TRP A 1 532 ? 26.476  12.033  -4.749  1.00 38.50 ? 532  TRP A CH2 1 
ATOM   4115 N N   . ASN A 1 533 ? 24.851  3.933   -3.902  1.00 43.48 ? 533  ASN A N   1 
ATOM   4116 C CA  . ASN A 1 533 ? 25.298  2.696   -3.263  1.00 44.47 ? 533  ASN A CA  1 
ATOM   4117 C C   . ASN A 1 533 ? 25.583  1.535   -4.196  1.00 45.20 ? 533  ASN A C   1 
ATOM   4118 O O   . ASN A 1 533 ? 26.369  0.664   -3.860  1.00 45.26 ? 533  ASN A O   1 
ATOM   4119 C CB  . ASN A 1 533 ? 24.292  2.250   -2.209  1.00 44.45 ? 533  ASN A CB  1 
ATOM   4120 C CG  . ASN A 1 533 ? 24.166  3.230   -1.086  1.00 44.30 ? 533  ASN A CG  1 
ATOM   4121 O OD1 . ASN A 1 533 ? 23.150  3.266   -0.395  1.00 45.01 ? 533  ASN A OD1 1 
ATOM   4122 N ND2 . ASN A 1 533 ? 25.196  4.044   -0.893  1.00 44.95 ? 533  ASN A ND2 1 
ATOM   4123 N N   . ARG A 1 534 ? 24.929  1.521   -5.353  1.00 46.51 ? 534  ARG A N   1 
ATOM   4124 C CA  . ARG A 1 534 ? 25.109  0.464   -6.338  1.00 47.61 ? 534  ARG A CA  1 
ATOM   4125 C C   . ARG A 1 534 ? 25.816  0.981   -7.586  1.00 48.57 ? 534  ARG A C   1 
ATOM   4126 O O   . ARG A 1 534 ? 26.723  0.319   -8.100  1.00 49.05 ? 534  ARG A O   1 
ATOM   4127 C CB  . ARG A 1 534 ? 23.772  -0.183  -6.705  1.00 47.61 ? 534  ARG A CB  1 
ATOM   4128 C CG  . ARG A 1 534 ? 23.079  -0.925  -5.557  1.00 48.45 ? 534  ARG A CG  1 
ATOM   4129 C CD  . ARG A 1 534 ? 21.558  -1.045  -5.780  1.00 48.12 ? 534  ARG A CD  1 
ATOM   4130 N NE  . ARG A 1 534 ? 20.880  -1.556  -4.586  1.00 49.80 ? 534  ARG A NE  1 
ATOM   4131 C CZ  . ARG A 1 534 ? 20.779  -2.850  -4.260  1.00 51.20 ? 534  ARG A CZ  1 
ATOM   4132 N NH1 . ARG A 1 534 ? 21.303  -3.798  -5.040  1.00 50.78 ? 534  ARG A NH1 1 
ATOM   4133 N NH2 . ARG A 1 534 ? 20.145  -3.205  -3.149  1.00 50.48 ? 534  ARG A NH2 1 
ATOM   4134 N N   . PHE A 1 535 ? 25.438  2.157   -8.082  1.00 49.34 ? 535  PHE A N   1 
ATOM   4135 C CA  . PHE A 1 535 ? 26.065  2.618   -9.321  1.00 50.24 ? 535  PHE A CA  1 
ATOM   4136 C C   . PHE A 1 535 ? 27.416  3.270   -9.112  1.00 51.23 ? 535  PHE A C   1 
ATOM   4137 O O   . PHE A 1 535 ? 28.392  2.837   -9.698  1.00 50.99 ? 535  PHE A O   1 
ATOM   4138 C CB  . PHE A 1 535 ? 25.158  3.515   -10.163 1.00 49.45 ? 535  PHE A CB  1 
ATOM   4139 C CG  . PHE A 1 535 ? 25.733  3.848   -11.514 1.00 48.17 ? 535  PHE A CG  1 
ATOM   4140 C CD1 . PHE A 1 535 ? 25.933  2.849   -12.467 1.00 48.01 ? 535  PHE A CD1 1 
ATOM   4141 C CD2 . PHE A 1 535 ? 26.079  5.152   -11.835 1.00 47.51 ? 535  PHE A CD2 1 
ATOM   4142 C CE1 . PHE A 1 535 ? 26.470  3.142   -13.712 1.00 46.30 ? 535  PHE A CE1 1 
ATOM   4143 C CE2 . PHE A 1 535 ? 26.609  5.458   -13.081 1.00 47.89 ? 535  PHE A CE2 1 
ATOM   4144 C CZ  . PHE A 1 535 ? 26.799  4.447   -14.026 1.00 47.63 ? 535  PHE A CZ  1 
ATOM   4145 N N   . LEU A 1 536 ? 27.461  4.309   -8.286  1.00 53.23 ? 536  LEU A N   1 
ATOM   4146 C CA  . LEU A 1 536 ? 28.664  5.130   -8.135  1.00 55.48 ? 536  LEU A CA  1 
ATOM   4147 C C   . LEU A 1 536 ? 29.959  4.337   -7.880  1.00 57.17 ? 536  LEU A C   1 
ATOM   4148 O O   . LEU A 1 536 ? 30.974  4.634   -8.513  1.00 57.13 ? 536  LEU A O   1 
ATOM   4149 C CB  . LEU A 1 536 ? 28.475  6.185   -7.056  1.00 55.31 ? 536  LEU A CB  1 
ATOM   4150 C CG  . LEU A 1 536 ? 29.336  7.439   -7.181  1.00 56.82 ? 536  LEU A CG  1 
ATOM   4151 C CD1 . LEU A 1 536 ? 28.523  8.541   -7.823  1.00 58.48 ? 536  LEU A CD1 1 
ATOM   4152 C CD2 . LEU A 1 536 ? 29.854  7.905   -5.810  1.00 58.38 ? 536  LEU A CD2 1 
ATOM   4153 N N   . PRO A 1 537 ? 29.935  3.330   -6.969  1.00 59.02 ? 537  PRO A N   1 
ATOM   4154 C CA  . PRO A 1 537 ? 31.185  2.602   -6.730  1.00 60.68 ? 537  PRO A CA  1 
ATOM   4155 C C   . PRO A 1 537 ? 31.753  1.959   -7.999  1.00 62.38 ? 537  PRO A C   1 
ATOM   4156 O O   . PRO A 1 537 ? 32.969  2.045   -8.236  1.00 62.91 ? 537  PRO A O   1 
ATOM   4157 C CB  . PRO A 1 537 ? 30.779  1.535   -5.704  1.00 60.56 ? 537  PRO A CB  1 
ATOM   4158 C CG  . PRO A 1 537 ? 29.614  2.138   -5.005  1.00 59.78 ? 537  PRO A CG  1 
ATOM   4159 C CD  . PRO A 1 537 ? 28.854  2.804   -6.111  1.00 59.05 ? 537  PRO A CD  1 
ATOM   4160 N N   . LYS A 1 538 ? 30.881  1.351   -8.804  1.00 63.74 ? 538  LYS A N   1 
ATOM   4161 C CA  . LYS A 1 538 ? 31.265  0.761   -10.091 1.00 65.48 ? 538  LYS A CA  1 
ATOM   4162 C C   . LYS A 1 538 ? 31.850  1.790   -11.065 1.00 66.37 ? 538  LYS A C   1 
ATOM   4163 O O   . LYS A 1 538 ? 32.875  1.547   -11.704 1.00 66.53 ? 538  LYS A O   1 
ATOM   4164 C CB  . LYS A 1 538 ? 30.075  0.045   -10.727 1.00 65.52 ? 538  LYS A CB  1 
ATOM   4165 C CG  . LYS A 1 538 ? 29.584  -1.157  -9.938  1.00 67.01 ? 538  LYS A CG  1 
ATOM   4166 C CD  . LYS A 1 538 ? 28.500  -1.907  -10.700 1.00 69.50 ? 538  LYS A CD  1 
ATOM   4167 C CE  . LYS A 1 538 ? 28.050  -3.147  -9.921  1.00 72.08 ? 538  LYS A CE  1 
ATOM   4168 N NZ  . LYS A 1 538 ? 27.379  -4.152  -10.810 1.00 73.70 ? 538  LYS A NZ  1 
ATOM   4169 N N   . LEU A 1 539 ? 31.205  2.946   -11.159 1.00 67.71 ? 539  LEU A N   1 
ATOM   4170 C CA  . LEU A 1 539 ? 31.686  4.023   -12.009 1.00 69.03 ? 539  LEU A CA  1 
ATOM   4171 C C   . LEU A 1 539 ? 33.086  4.475   -11.608 1.00 70.54 ? 539  LEU A C   1 
ATOM   4172 O O   . LEU A 1 539 ? 33.901  4.831   -12.464 1.00 71.01 ? 539  LEU A O   1 
ATOM   4173 C CB  . LEU A 1 539 ? 30.721  5.206   -11.954 1.00 69.07 ? 539  LEU A CB  1 
ATOM   4174 C CG  . LEU A 1 539 ? 30.978  6.378   -12.897 1.00 68.42 ? 539  LEU A CG  1 
ATOM   4175 C CD1 . LEU A 1 539 ? 31.143  5.854   -14.306 1.00 68.57 ? 539  LEU A CD1 1 
ATOM   4176 C CD2 . LEU A 1 539 ? 29.835  7.359   -12.821 1.00 68.45 ? 539  LEU A CD2 1 
ATOM   4177 N N   . LEU A 1 540 ? 33.361  4.467   -10.305 1.00 72.10 ? 540  LEU A N   1 
ATOM   4178 C CA  . LEU A 1 540 ? 34.672  4.872   -9.802  1.00 73.32 ? 540  LEU A CA  1 
ATOM   4179 C C   . LEU A 1 540 ? 35.740  3.762   -9.944  1.00 74.20 ? 540  LEU A C   1 
ATOM   4180 O O   . LEU A 1 540 ? 36.931  4.030   -9.760  1.00 74.49 ? 540  LEU A O   1 
ATOM   4181 C CB  . LEU A 1 540 ? 34.564  5.403   -8.364  1.00 73.33 ? 540  LEU A CB  1 
ATOM   4182 C CG  . LEU A 1 540 ? 33.831  6.749   -8.171  1.00 73.02 ? 540  LEU A CG  1 
ATOM   4183 C CD1 . LEU A 1 540 ? 33.359  6.913   -6.723  1.00 72.01 ? 540  LEU A CD1 1 
ATOM   4184 C CD2 . LEU A 1 540 ? 34.677  7.964   -8.612  1.00 71.82 ? 540  LEU A CD2 1 
ATOM   4185 N N   . SER A 1 541 ? 35.308  2.539   -10.285 1.00 74.84 ? 541  SER A N   1 
ATOM   4186 C CA  . SER A 1 541 ? 36.212  1.439   -10.692 1.00 75.49 ? 541  SER A CA  1 
ATOM   4187 C C   . SER A 1 541 ? 36.379  1.362   -12.225 1.00 76.03 ? 541  SER A C   1 
ATOM   4188 O O   . SER A 1 541 ? 36.244  0.281   -12.827 1.00 76.28 ? 541  SER A O   1 
ATOM   4189 C CB  . SER A 1 541 ? 35.705  0.085   -10.170 1.00 75.32 ? 541  SER A CB  1 
ATOM   4190 O OG  . SER A 1 541 ? 35.788  0.005   -8.762  1.00 75.51 ? 541  SER A OG  1 
ATOM   4191 N N   . ALA A 1 542 ? 36.657  2.511   -12.848 1.00 76.15 ? 542  ALA A N   1 
ATOM   4192 C CA  . ALA A 1 542 ? 36.817  2.612   -14.301 1.00 76.17 ? 542  ALA A CA  1 
ATOM   4193 C C   . ALA A 1 542 ? 37.251  4.022   -14.704 1.00 76.07 ? 542  ALA A C   1 
ATOM   4194 O O   . ALA A 1 542 ? 36.746  5.013   -14.176 1.00 75.88 ? 542  ALA A O   1 
ATOM   4195 C CB  . ALA A 1 542 ? 35.519  2.216   -15.024 1.00 76.13 ? 542  ALA A CB  1 
ATOM   4196 N N   . GLU B 1 4   ? -16.922 5.221   -69.432 1.00 75.96 ? 4    GLU B N   1 
ATOM   4197 C CA  . GLU B 1 4   ? -15.689 6.024   -69.177 1.00 75.84 ? 4    GLU B CA  1 
ATOM   4198 C C   . GLU B 1 4   ? -15.967 7.331   -68.396 1.00 75.30 ? 4    GLU B C   1 
ATOM   4199 O O   . GLU B 1 4   ? -16.260 8.392   -68.977 1.00 75.30 ? 4    GLU B O   1 
ATOM   4200 C CB  . GLU B 1 4   ? -14.936 6.294   -70.491 1.00 76.14 ? 4    GLU B CB  1 
ATOM   4201 C CG  . GLU B 1 4   ? -13.533 6.899   -70.315 1.00 76.95 ? 4    GLU B CG  1 
ATOM   4202 C CD  . GLU B 1 4   ? -12.450 5.860   -70.005 1.00 77.81 ? 4    GLU B CD  1 
ATOM   4203 O OE1 . GLU B 1 4   ? -12.493 5.228   -68.923 1.00 78.05 ? 4    GLU B OE1 1 
ATOM   4204 O OE2 . GLU B 1 4   ? -11.535 5.701   -70.844 1.00 77.97 ? 4    GLU B OE2 1 
ATOM   4205 N N   . ASP B 1 5   ? -15.864 7.216   -67.071 1.00 74.33 ? 5    ASP B N   1 
ATOM   4206 C CA  . ASP B 1 5   ? -16.016 8.322   -66.128 1.00 73.24 ? 5    ASP B CA  1 
ATOM   4207 C C   . ASP B 1 5   ? -14.856 9.315   -66.273 1.00 72.77 ? 5    ASP B C   1 
ATOM   4208 O O   . ASP B 1 5   ? -13.725 8.994   -65.908 1.00 73.19 ? 5    ASP B O   1 
ATOM   4209 C CB  . ASP B 1 5   ? -16.042 7.738   -64.713 1.00 73.02 ? 5    ASP B CB  1 
ATOM   4210 C CG  . ASP B 1 5   ? -16.575 8.702   -63.678 1.00 72.07 ? 5    ASP B CG  1 
ATOM   4211 O OD1 . ASP B 1 5   ? -17.038 8.203   -62.628 1.00 69.99 ? 5    ASP B OD1 1 
ATOM   4212 O OD2 . ASP B 1 5   ? -16.529 9.936   -63.901 1.00 71.29 ? 5    ASP B OD2 1 
ATOM   4213 N N   . PRO B 1 6   ? -15.126 10.527  -66.799 1.00 72.11 ? 6    PRO B N   1 
ATOM   4214 C CA  . PRO B 1 6   ? -14.033 11.471  -67.081 1.00 71.49 ? 6    PRO B CA  1 
ATOM   4215 C C   . PRO B 1 6   ? -13.375 12.030  -65.823 1.00 70.88 ? 6    PRO B C   1 
ATOM   4216 O O   . PRO B 1 6   ? -12.362 12.722  -65.919 1.00 70.73 ? 6    PRO B O   1 
ATOM   4217 C CB  . PRO B 1 6   ? -14.720 12.590  -67.870 1.00 71.78 ? 6    PRO B CB  1 
ATOM   4218 C CG  . PRO B 1 6   ? -16.155 12.519  -67.461 1.00 71.85 ? 6    PRO B CG  1 
ATOM   4219 C CD  . PRO B 1 6   ? -16.447 11.081  -67.153 1.00 72.03 ? 6    PRO B CD  1 
ATOM   4220 N N   . GLN B 1 7   ? -13.964 11.737  -64.663 1.00 70.01 ? 7    GLN B N   1 
ATOM   4221 C CA  . GLN B 1 7   ? -13.345 12.026  -63.370 1.00 69.20 ? 7    GLN B CA  1 
ATOM   4222 C C   . GLN B 1 7   ? -12.154 11.110  -63.142 1.00 68.21 ? 7    GLN B C   1 
ATOM   4223 O O   . GLN B 1 7   ? -11.185 11.490  -62.477 1.00 68.07 ? 7    GLN B O   1 
ATOM   4224 C CB  . GLN B 1 7   ? -14.348 11.822  -62.231 1.00 69.53 ? 7    GLN B CB  1 
ATOM   4225 C CG  . GLN B 1 7   ? -15.386 12.935  -62.100 1.00 70.75 ? 7    GLN B CG  1 
ATOM   4226 C CD  . GLN B 1 7   ? -14.750 14.279  -61.823 1.00 71.36 ? 7    GLN B CD  1 
ATOM   4227 O OE1 . GLN B 1 7   ? -14.047 14.451  -60.831 1.00 72.27 ? 7    GLN B OE1 1 
ATOM   4228 N NE2 . GLN B 1 7   ? -14.980 15.236  -62.710 1.00 72.03 ? 7    GLN B NE2 1 
ATOM   4229 N N   . LEU B 1 8   ? -12.243 9.907   -63.703 1.00 66.79 ? 8    LEU B N   1 
ATOM   4230 C CA  . LEU B 1 8   ? -11.235 8.879   -63.508 1.00 65.72 ? 8    LEU B CA  1 
ATOM   4231 C C   . LEU B 1 8   ? -10.184 8.830   -64.611 1.00 65.03 ? 8    LEU B C   1 
ATOM   4232 O O   . LEU B 1 8   ? -9.467  7.848   -64.736 1.00 65.07 ? 8    LEU B O   1 
ATOM   4233 C CB  . LEU B 1 8   ? -11.905 7.512   -63.368 1.00 65.57 ? 8    LEU B CB  1 
ATOM   4234 C CG  . LEU B 1 8   ? -12.937 7.371   -62.255 1.00 64.90 ? 8    LEU B CG  1 
ATOM   4235 C CD1 . LEU B 1 8   ? -13.490 5.951   -62.257 1.00 64.16 ? 8    LEU B CD1 1 
ATOM   4236 C CD2 . LEU B 1 8   ? -12.325 7.725   -60.909 1.00 63.70 ? 8    LEU B CD2 1 
ATOM   4237 N N   . LEU B 1 9   ? -10.086 9.890   -65.401 1.00 64.26 ? 9    LEU B N   1 
ATOM   4238 C CA  . LEU B 1 9   ? -9.119  9.933   -66.477 1.00 63.69 ? 9    LEU B CA  1 
ATOM   4239 C C   . LEU B 1 9   ? -8.177  11.100  -66.271 1.00 63.15 ? 9    LEU B C   1 
ATOM   4240 O O   . LEU B 1 9   ? -8.613  12.251  -66.258 1.00 63.20 ? 9    LEU B O   1 
ATOM   4241 C CB  . LEU B 1 9   ? -9.831  10.083  -67.818 1.00 63.91 ? 9    LEU B CB  1 
ATOM   4242 C CG  . LEU B 1 9   ? -9.195  9.332   -68.987 1.00 64.84 ? 9    LEU B CG  1 
ATOM   4243 C CD1 . LEU B 1 9   ? -9.719  7.893   -69.005 1.00 64.69 ? 9    LEU B CD1 1 
ATOM   4244 C CD2 . LEU B 1 9   ? -9.479  10.048  -70.318 1.00 66.21 ? 9    LEU B CD2 1 
ATOM   4245 N N   . VAL B 1 10  ? -6.890  10.808  -66.114 1.00 62.35 ? 10   VAL B N   1 
ATOM   4246 C CA  . VAL B 1 10  ? -5.904  11.854  -65.851 1.00 61.87 ? 10   VAL B CA  1 
ATOM   4247 C C   . VAL B 1 10  ? -4.743  11.772  -66.831 1.00 61.77 ? 10   VAL B C   1 
ATOM   4248 O O   . VAL B 1 10  ? -4.309  10.677  -67.191 1.00 61.76 ? 10   VAL B O   1 
ATOM   4249 C CB  . VAL B 1 10  ? -5.368  11.787  -64.391 1.00 61.66 ? 10   VAL B CB  1 
ATOM   4250 C CG1 . VAL B 1 10  ? -4.438  12.939  -64.097 1.00 61.42 ? 10   VAL B CG1 1 
ATOM   4251 C CG2 . VAL B 1 10  ? -6.512  11.810  -63.402 1.00 62.00 ? 10   VAL B CG2 1 
ATOM   4252 N N   . ARG B 1 11  ? -4.256  12.936  -67.265 1.00 61.55 ? 11   ARG B N   1 
ATOM   4253 C CA  . ARG B 1 11  ? -3.018  13.024  -68.019 1.00 61.66 ? 11   ARG B CA  1 
ATOM   4254 C C   . ARG B 1 11  ? -1.868  13.517  -67.140 1.00 60.87 ? 11   ARG B C   1 
ATOM   4255 O O   . ARG B 1 11  ? -1.788  14.694  -66.790 1.00 61.10 ? 11   ARG B O   1 
ATOM   4256 C CB  . ARG B 1 11  ? -3.167  13.928  -69.248 1.00 61.42 ? 11   ARG B CB  1 
ATOM   4257 C CG  . ARG B 1 11  ? -1.952  13.872  -70.178 1.00 62.94 ? 11   ARG B CG  1 
ATOM   4258 C CD  . ARG B 1 11  ? -2.162  14.631  -71.489 1.00 63.92 ? 11   ARG B CD  1 
ATOM   4259 N NE  . ARG B 1 11  ? -1.874  13.779  -72.651 1.00 69.96 ? 11   ARG B NE  1 
ATOM   4260 C CZ  . ARG B 1 11  ? -2.743  12.912  -73.182 1.00 71.97 ? 11   ARG B CZ  1 
ATOM   4261 N NH1 . ARG B 1 11  ? -3.962  12.775  -72.659 1.00 73.88 ? 11   ARG B NH1 1 
ATOM   4262 N NH2 . ARG B 1 11  ? -2.401  12.173  -74.231 1.00 71.93 ? 11   ARG B NH2 1 
ATOM   4263 N N   . VAL B 1 12  ? -0.974  12.602  -66.796 1.00 60.33 ? 12   VAL B N   1 
ATOM   4264 C CA  . VAL B 1 12  ? 0.290   12.948  -66.153 1.00 59.51 ? 12   VAL B CA  1 
ATOM   4265 C C   . VAL B 1 12  ? 1.343   13.068  -67.256 1.00 59.37 ? 12   VAL B C   1 
ATOM   4266 O O   . VAL B 1 12  ? 1.032   12.801  -68.416 1.00 59.10 ? 12   VAL B O   1 
ATOM   4267 C CB  . VAL B 1 12  ? 0.690   11.913  -65.069 1.00 59.16 ? 12   VAL B CB  1 
ATOM   4268 C CG1 . VAL B 1 12  ? -0.301  11.946  -63.916 1.00 58.80 ? 12   VAL B CG1 1 
ATOM   4269 C CG2 . VAL B 1 12  ? 0.770   10.522  -65.647 1.00 58.25 ? 12   VAL B CG2 1 
ATOM   4270 N N   . ARG B 1 13  ? 2.565   13.472  -66.901 1.00 59.18 ? 13   ARG B N   1 
ATOM   4271 C CA  . ARG B 1 13  ? 3.639   13.715  -67.879 1.00 59.70 ? 13   ARG B CA  1 
ATOM   4272 C C   . ARG B 1 13  ? 3.982   12.503  -68.738 1.00 58.61 ? 13   ARG B C   1 
ATOM   4273 O O   . ARG B 1 13  ? 4.400   12.653  -69.879 1.00 58.47 ? 13   ARG B O   1 
ATOM   4274 C CB  . ARG B 1 13  ? 4.921   14.203  -67.191 1.00 59.54 ? 13   ARG B CB  1 
ATOM   4275 C CG  . ARG B 1 13  ? 4.981   15.701  -66.937 1.00 61.45 ? 13   ARG B CG  1 
ATOM   4276 C CD  . ARG B 1 13  ? 6.407   16.143  -66.537 1.00 62.45 ? 13   ARG B CD  1 
ATOM   4277 N NE  . ARG B 1 13  ? 6.419   17.488  -65.941 1.00 68.49 ? 13   ARG B NE  1 
ATOM   4278 C CZ  . ARG B 1 13  ? 7.502   18.120  -65.472 1.00 70.33 ? 13   ARG B CZ  1 
ATOM   4279 N NH1 . ARG B 1 13  ? 8.706   17.545  -65.512 1.00 71.73 ? 13   ARG B NH1 1 
ATOM   4280 N NH2 . ARG B 1 13  ? 7.378   19.337  -64.948 1.00 70.29 ? 13   ARG B NH2 1 
ATOM   4281 N N   . GLY B 1 14  ? 3.818   11.309  -68.178 1.00 57.81 ? 14   GLY B N   1 
ATOM   4282 C CA  . GLY B 1 14  ? 4.183   10.088  -68.871 1.00 56.89 ? 14   GLY B CA  1 
ATOM   4283 C C   . GLY B 1 14  ? 3.082   9.492   -69.718 1.00 56.24 ? 14   GLY B C   1 
ATOM   4284 O O   . GLY B 1 14  ? 3.309   8.502   -70.402 1.00 56.21 ? 14   GLY B O   1 
ATOM   4285 N N   . GLY B 1 15  ? 1.888   10.082  -69.662 1.00 55.72 ? 15   GLY B N   1 
ATOM   4286 C CA  . GLY B 1 15  ? 0.739   9.602   -70.438 1.00 54.87 ? 15   GLY B CA  1 
ATOM   4287 C C   . GLY B 1 15  ? -0.542  9.524   -69.634 1.00 54.57 ? 15   GLY B C   1 
ATOM   4288 O O   . GLY B 1 15  ? -0.665  10.163  -68.586 1.00 54.66 ? 15   GLY B O   1 
ATOM   4289 N N   . GLN B 1 16  ? -1.492  8.720   -70.109 1.00 54.21 ? 16   GLN B N   1 
ATOM   4290 C CA  . GLN B 1 16  ? -2.845  8.685   -69.538 1.00 53.79 ? 16   GLN B CA  1 
ATOM   4291 C C   . GLN B 1 16  ? -3.070  7.577   -68.514 1.00 53.07 ? 16   GLN B C   1 
ATOM   4292 O O   . GLN B 1 16  ? -2.565  6.463   -68.661 1.00 53.11 ? 16   GLN B O   1 
ATOM   4293 C CB  . GLN B 1 16  ? -3.891  8.539   -70.640 1.00 54.17 ? 16   GLN B CB  1 
ATOM   4294 C CG  . GLN B 1 16  ? -3.934  9.647   -71.668 1.00 56.23 ? 16   GLN B CG  1 
ATOM   4295 C CD  . GLN B 1 16  ? -5.354  9.835   -72.213 1.00 60.87 ? 16   GLN B CD  1 
ATOM   4296 O OE1 . GLN B 1 16  ? -5.703  9.318   -73.284 1.00 61.23 ? 16   GLN B OE1 1 
ATOM   4297 N NE2 . GLN B 1 16  ? -6.192  10.547  -71.449 1.00 61.66 ? 16   GLN B NE2 1 
ATOM   4298 N N   . LEU B 1 17  ? -3.862  7.886   -67.495 1.00 52.49 ? 17   LEU B N   1 
ATOM   4299 C CA  . LEU B 1 17  ? -4.144  6.959   -66.412 1.00 52.50 ? 17   LEU B CA  1 
ATOM   4300 C C   . LEU B 1 17  ? -5.634  6.838   -66.259 1.00 52.66 ? 17   LEU B C   1 
ATOM   4301 O O   . LEU B 1 17  ? -6.362  7.809   -66.489 1.00 52.75 ? 17   LEU B O   1 
ATOM   4302 C CB  . LEU B 1 17  ? -3.570  7.486   -65.085 1.00 52.41 ? 17   LEU B CB  1 
ATOM   4303 C CG  . LEU B 1 17  ? -2.067  7.740   -65.013 1.00 52.61 ? 17   LEU B CG  1 
ATOM   4304 C CD1 . LEU B 1 17  ? -1.712  8.539   -63.780 1.00 53.12 ? 17   LEU B CD1 1 
ATOM   4305 C CD2 . LEU B 1 17  ? -1.320  6.426   -65.036 1.00 53.57 ? 17   LEU B CD2 1 
ATOM   4306 N N   . ARG B 1 18  ? -6.083  5.658   -65.848 1.00 52.83 ? 18   ARG B N   1 
ATOM   4307 C CA  . ARG B 1 18  ? -7.487  5.426   -65.540 1.00 53.32 ? 18   ARG B CA  1 
ATOM   4308 C C   . ARG B 1 18  ? -7.579  4.935   -64.119 1.00 52.91 ? 18   ARG B C   1 
ATOM   4309 O O   . ARG B 1 18  ? -7.106  3.848   -63.793 1.00 52.48 ? 18   ARG B O   1 
ATOM   4310 C CB  . ARG B 1 18  ? -8.144  4.426   -66.521 1.00 53.34 ? 18   ARG B CB  1 
ATOM   4311 C CG  . ARG B 1 18  ? -9.562  3.926   -66.106 1.00 54.22 ? 18   ARG B CG  1 
ATOM   4312 C CD  . ARG B 1 18  ? -10.369 3.245   -67.243 1.00 55.38 ? 18   ARG B CD  1 
ATOM   4313 N NE  . ARG B 1 18  ? -9.572  2.346   -68.093 1.00 59.78 ? 18   ARG B NE  1 
ATOM   4314 C CZ  . ARG B 1 18  ? -9.374  2.517   -69.404 1.00 61.63 ? 18   ARG B CZ  1 
ATOM   4315 N NH1 . ARG B 1 18  ? -9.922  3.540   -70.058 1.00 62.01 ? 18   ARG B NH1 1 
ATOM   4316 N NH2 . ARG B 1 18  ? -8.621  1.654   -70.076 1.00 63.47 ? 18   ARG B NH2 1 
ATOM   4317 N N   . GLY B 1 19  ? -8.190  5.755   -63.274 1.00 53.14 ? 19   GLY B N   1 
ATOM   4318 C CA  . GLY B 1 19  ? -8.429  5.386   -61.893 1.00 53.47 ? 19   GLY B CA  1 
ATOM   4319 C C   . GLY B 1 19  ? -9.700  4.592   -61.719 1.00 53.65 ? 19   GLY B C   1 
ATOM   4320 O O   . GLY B 1 19  ? -10.320 4.167   -62.684 1.00 53.44 ? 19   GLY B O   1 
ATOM   4321 N N   . ILE B 1 20  ? -10.082 4.395   -60.472 1.00 54.35 ? 20   ILE B N   1 
ATOM   4322 C CA  . ILE B 1 20  ? -11.265 3.624   -60.138 1.00 55.47 ? 20   ILE B CA  1 
ATOM   4323 C C   . ILE B 1 20  ? -12.014 4.402   -59.066 1.00 56.72 ? 20   ILE B C   1 
ATOM   4324 O O   . ILE B 1 20  ? -11.389 5.058   -58.221 1.00 57.08 ? 20   ILE B O   1 
ATOM   4325 C CB  . ILE B 1 20  ? -10.885 2.217   -59.634 1.00 55.32 ? 20   ILE B CB  1 
ATOM   4326 C CG1 . ILE B 1 20  ? -12.135 1.396   -59.276 1.00 55.45 ? 20   ILE B CG1 1 
ATOM   4327 C CG2 . ILE B 1 20  ? -9.900  2.302   -58.469 1.00 54.62 ? 20   ILE B CG2 1 
ATOM   4328 C CD1 . ILE B 1 20  ? -11.852 -0.061  -58.882 1.00 55.00 ? 20   ILE B CD1 1 
ATOM   4329 N N   . ARG B 1 21  ? -13.342 4.356   -59.105 1.00 57.75 ? 21   ARG B N   1 
ATOM   4330 C CA  . ARG B 1 21  ? -14.132 5.057   -58.103 1.00 59.05 ? 21   ARG B CA  1 
ATOM   4331 C C   . ARG B 1 21  ? -14.352 4.100   -56.957 1.00 58.80 ? 21   ARG B C   1 
ATOM   4332 O O   . ARG B 1 21  ? -14.857 3.002   -57.149 1.00 59.03 ? 21   ARG B O   1 
ATOM   4333 C CB  . ARG B 1 21  ? -15.454 5.575   -58.686 1.00 58.99 ? 21   ARG B CB  1 
ATOM   4334 C CG  . ARG B 1 21  ? -16.373 6.248   -57.672 1.00 60.35 ? 21   ARG B CG  1 
ATOM   4335 C CD  . ARG B 1 21  ? -17.600 6.928   -58.311 1.00 61.47 ? 21   ARG B CD  1 
ATOM   4336 N NE  . ARG B 1 21  ? -18.424 6.019   -59.117 1.00 66.51 ? 21   ARG B NE  1 
ATOM   4337 C CZ  . ARG B 1 21  ? -19.225 5.068   -58.628 1.00 68.19 ? 21   ARG B CZ  1 
ATOM   4338 N NH1 . ARG B 1 21  ? -19.325 4.874   -57.314 1.00 67.93 ? 21   ARG B NH1 1 
ATOM   4339 N NH2 . ARG B 1 21  ? -19.926 4.300   -59.467 1.00 69.14 ? 21   ARG B NH2 1 
ATOM   4340 N N   . LEU B 1 22  ? -13.944 4.514   -55.766 1.00 59.24 ? 22   LEU B N   1 
ATOM   4341 C CA  . LEU B 1 22  ? -14.059 3.660   -54.597 1.00 60.07 ? 22   LEU B CA  1 
ATOM   4342 C C   . LEU B 1 22  ? -15.148 4.156   -53.657 1.00 60.58 ? 22   LEU B C   1 
ATOM   4343 O O   . LEU B 1 22  ? -15.543 5.320   -53.705 1.00 60.18 ? 22   LEU B O   1 
ATOM   4344 C CB  . LEU B 1 22  ? -12.717 3.554   -53.861 1.00 60.09 ? 22   LEU B CB  1 
ATOM   4345 C CG  . LEU B 1 22  ? -11.500 2.910   -54.541 1.00 60.39 ? 22   LEU B CG  1 
ATOM   4346 C CD1 . LEU B 1 22  ? -10.332 2.842   -53.556 1.00 62.17 ? 22   LEU B CD1 1 
ATOM   4347 C CD2 . LEU B 1 22  ? -11.800 1.523   -55.080 1.00 60.18 ? 22   LEU B CD2 1 
ATOM   4348 N N   . LYS B 1 23  ? -15.626 3.256   -52.805 1.00 61.60 ? 23   LYS B N   1 
ATOM   4349 C CA  . LYS B 1 23  ? -16.651 3.588   -51.824 1.00 62.55 ? 23   LYS B CA  1 
ATOM   4350 C C   . LYS B 1 23  ? -16.033 3.871   -50.456 1.00 62.50 ? 23   LYS B C   1 
ATOM   4351 O O   . LYS B 1 23  ? -15.332 3.028   -49.880 1.00 62.30 ? 23   LYS B O   1 
ATOM   4352 C CB  . LYS B 1 23  ? -17.707 2.471   -51.729 1.00 63.46 ? 23   LYS B CB  1 
ATOM   4353 C CG  . LYS B 1 23  ? -18.914 2.782   -50.832 1.00 64.90 ? 23   LYS B CG  1 
ATOM   4354 C CD  . LYS B 1 23  ? -19.752 3.955   -51.371 1.00 67.55 ? 23   LYS B CD  1 
ATOM   4355 C CE  . LYS B 1 23  ? -20.970 4.240   -50.475 1.00 67.46 ? 23   LYS B CE  1 
ATOM   4356 N NZ  . LYS B 1 23  ? -21.835 5.313   -51.056 1.00 69.46 ? 23   LYS B NZ  1 
ATOM   4357 N N   . ALA B 1 24  ? -16.284 5.088   -49.979 1.00 62.39 ? 24   ALA B N   1 
ATOM   4358 C CA  . ALA B 1 24  ? -15.987 5.510   -48.618 1.00 62.30 ? 24   ALA B CA  1 
ATOM   4359 C C   . ALA B 1 24  ? -17.329 5.785   -47.912 1.00 62.29 ? 24   ALA B C   1 
ATOM   4360 O O   . ALA B 1 24  ? -18.297 6.183   -48.564 1.00 62.35 ? 24   ALA B O   1 
ATOM   4361 C CB  . ALA B 1 24  ? -15.109 6.750   -48.643 1.00 61.97 ? 24   ALA B CB  1 
ATOM   4362 N N   . PRO B 1 25  ? -17.395 5.594   -46.579 1.00 62.28 ? 25   PRO B N   1 
ATOM   4363 C CA  . PRO B 1 25  ? -18.711 5.532   -45.923 1.00 62.18 ? 25   PRO B CA  1 
ATOM   4364 C C   . PRO B 1 25  ? -19.561 6.772   -46.150 1.00 61.93 ? 25   PRO B C   1 
ATOM   4365 O O   . PRO B 1 25  ? -20.787 6.687   -46.110 1.00 62.19 ? 25   PRO B O   1 
ATOM   4366 C CB  . PRO B 1 25  ? -18.365 5.410   -44.436 1.00 62.13 ? 25   PRO B CB  1 
ATOM   4367 C CG  . PRO B 1 25  ? -16.997 4.877   -44.405 1.00 62.44 ? 25   PRO B CG  1 
ATOM   4368 C CD  . PRO B 1 25  ? -16.299 5.446   -45.608 1.00 62.21 ? 25   PRO B CD  1 
ATOM   4369 N N   . GLY B 1 26  ? -18.913 7.905   -46.400 1.00 61.56 ? 26   GLY B N   1 
ATOM   4370 C CA  . GLY B 1 26  ? -19.620 9.173   -46.576 1.00 60.91 ? 26   GLY B CA  1 
ATOM   4371 C C   . GLY B 1 26  ? -19.782 9.618   -48.017 1.00 60.32 ? 26   GLY B C   1 
ATOM   4372 O O   . GLY B 1 26  ? -20.306 10.705  -48.276 1.00 60.36 ? 26   GLY B O   1 
ATOM   4373 N N   . GLY B 1 27  ? -19.331 8.788   -48.955 1.00 59.68 ? 27   GLY B N   1 
ATOM   4374 C CA  . GLY B 1 27  ? -19.387 9.127   -50.377 1.00 59.00 ? 27   GLY B CA  1 
ATOM   4375 C C   . GLY B 1 27  ? -18.312 8.429   -51.188 1.00 58.62 ? 27   GLY B C   1 
ATOM   4376 O O   . GLY B 1 27  ? -17.622 7.551   -50.669 1.00 59.02 ? 27   GLY B O   1 
ATOM   4377 N N   . PRO B 1 28  ? -18.180 8.792   -52.480 1.00 57.89 ? 28   PRO B N   1 
ATOM   4378 C CA  . PRO B 1 28  ? -17.130 8.230   -53.333 1.00 56.87 ? 28   PRO B CA  1 
ATOM   4379 C C   . PRO B 1 28  ? -15.807 9.022   -53.354 1.00 55.79 ? 28   PRO B C   1 
ATOM   4380 O O   . PRO B 1 28  ? -15.787 10.226  -53.068 1.00 55.26 ? 28   PRO B O   1 
ATOM   4381 C CB  . PRO B 1 28  ? -17.774 8.258   -54.724 1.00 57.09 ? 28   PRO B CB  1 
ATOM   4382 C CG  . PRO B 1 28  ? -18.741 9.434   -54.675 1.00 57.40 ? 28   PRO B CG  1 
ATOM   4383 C CD  . PRO B 1 28  ? -19.055 9.723   -53.225 1.00 57.81 ? 28   PRO B CD  1 
ATOM   4384 N N   . VAL B 1 29  ? -14.727 8.322   -53.709 1.00 54.47 ? 29   VAL B N   1 
ATOM   4385 C CA  . VAL B 1 29  ? -13.396 8.902   -53.919 1.00 53.53 ? 29   VAL B CA  1 
ATOM   4386 C C   . VAL B 1 29  ? -12.781 8.325   -55.197 1.00 52.95 ? 29   VAL B C   1 
ATOM   4387 O O   . VAL B 1 29  ? -13.093 7.196   -55.580 1.00 53.02 ? 29   VAL B O   1 
ATOM   4388 C CB  . VAL B 1 29  ? -12.432 8.592   -52.740 1.00 53.65 ? 29   VAL B CB  1 
ATOM   4389 C CG1 . VAL B 1 29  ? -12.922 9.232   -51.448 1.00 53.97 ? 29   VAL B CG1 1 
ATOM   4390 C CG2 . VAL B 1 29  ? -12.242 7.066   -52.550 1.00 53.08 ? 29   VAL B CG2 1 
ATOM   4391 N N   . SER B 1 30  ? -11.910 9.092   -55.845 1.00 51.84 ? 30   SER B N   1 
ATOM   4392 C CA  . SER B 1 30  ? -11.138 8.607   -56.986 1.00 50.83 ? 30   SER B CA  1 
ATOM   4393 C C   . SER B 1 30  ? -9.795  8.079   -56.509 1.00 50.02 ? 30   SER B C   1 
ATOM   4394 O O   . SER B 1 30  ? -9.035  8.801   -55.862 1.00 50.12 ? 30   SER B O   1 
ATOM   4395 C CB  . SER B 1 30  ? -10.886 9.736   -57.982 1.00 50.87 ? 30   SER B CB  1 
ATOM   4396 O OG  . SER B 1 30  ? -12.076 10.409  -58.323 1.00 51.45 ? 30   SER B OG  1 
ATOM   4397 N N   . ALA B 1 31  ? -9.499  6.825   -56.830 1.00 48.99 ? 31   ALA B N   1 
ATOM   4398 C CA  . ALA B 1 31  ? -8.207  6.226   -56.495 1.00 47.41 ? 31   ALA B CA  1 
ATOM   4399 C C   . ALA B 1 31  ? -7.457  5.853   -57.756 1.00 46.83 ? 31   ALA B C   1 
ATOM   4400 O O   . ALA B 1 31  ? -8.007  5.201   -58.638 1.00 46.28 ? 31   ALA B O   1 
ATOM   4401 C CB  . ALA B 1 31  ? -8.396  5.016   -55.633 1.00 47.41 ? 31   ALA B CB  1 
ATOM   4402 N N   . PHE B 1 32  ? -6.206  6.301   -57.841 1.00 46.19 ? 32   PHE B N   1 
ATOM   4403 C CA  . PHE B 1 32  ? -5.296  5.919   -58.905 1.00 45.29 ? 32   PHE B CA  1 
ATOM   4404 C C   . PHE B 1 32  ? -4.158  5.128   -58.295 1.00 44.79 ? 32   PHE B C   1 
ATOM   4405 O O   . PHE B 1 32  ? -3.224  5.698   -57.732 1.00 44.98 ? 32   PHE B O   1 
ATOM   4406 C CB  . PHE B 1 32  ? -4.772  7.153   -59.613 1.00 45.85 ? 32   PHE B CB  1 
ATOM   4407 C CG  . PHE B 1 32  ? -5.851  8.093   -60.025 1.00 46.29 ? 32   PHE B CG  1 
ATOM   4408 C CD1 . PHE B 1 32  ? -6.392  8.989   -59.110 1.00 46.99 ? 32   PHE B CD1 1 
ATOM   4409 C CD2 . PHE B 1 32  ? -6.347  8.064   -61.316 1.00 46.86 ? 32   PHE B CD2 1 
ATOM   4410 C CE1 . PHE B 1 32  ? -7.406  9.855   -59.485 1.00 48.20 ? 32   PHE B CE1 1 
ATOM   4411 C CE2 . PHE B 1 32  ? -7.366  8.913   -61.709 1.00 47.46 ? 32   PHE B CE2 1 
ATOM   4412 C CZ  . PHE B 1 32  ? -7.899  9.814   -60.794 1.00 47.80 ? 32   PHE B CZ  1 
ATOM   4413 N N   . LEU B 1 33  ? -4.256  3.809   -58.400 1.00 43.52 ? 33   LEU B N   1 
ATOM   4414 C CA  . LEU B 1 33  ? -3.333  2.903   -57.738 1.00 42.51 ? 33   LEU B CA  1 
ATOM   4415 C C   . LEU B 1 33  ? -2.326  2.291   -58.705 1.00 42.18 ? 33   LEU B C   1 
ATOM   4416 O O   . LEU B 1 33  ? -2.635  2.060   -59.859 1.00 42.56 ? 33   LEU B O   1 
ATOM   4417 C CB  . LEU B 1 33  ? -4.123  1.796   -57.035 1.00 41.76 ? 33   LEU B CB  1 
ATOM   4418 C CG  . LEU B 1 33  ? -5.408  2.193   -56.295 1.00 40.99 ? 33   LEU B CG  1 
ATOM   4419 C CD1 . LEU B 1 33  ? -6.147  0.955   -55.758 1.00 36.75 ? 33   LEU B CD1 1 
ATOM   4420 C CD2 . LEU B 1 33  ? -5.122  3.189   -55.157 1.00 39.05 ? 33   LEU B CD2 1 
ATOM   4421 N N   . GLY B 1 34  ? -1.117  2.019   -58.227 1.00 41.88 ? 34   GLY B N   1 
ATOM   4422 C CA  . GLY B 1 34  ? -0.115  1.340   -59.037 1.00 40.89 ? 34   GLY B CA  1 
ATOM   4423 C C   . GLY B 1 34  ? 0.459   2.161   -60.163 1.00 40.36 ? 34   GLY B C   1 
ATOM   4424 O O   . GLY B 1 34  ? 0.739   1.631   -61.235 1.00 41.32 ? 34   GLY B O   1 
ATOM   4425 N N   . ILE B 1 35  ? 0.633   3.458   -59.943 1.00 39.65 ? 35   ILE B N   1 
ATOM   4426 C CA  . ILE B 1 35  ? 1.182   4.331   -60.981 1.00 39.15 ? 35   ILE B CA  1 
ATOM   4427 C C   . ILE B 1 35  ? 2.703   4.240   -60.951 1.00 38.74 ? 35   ILE B C   1 
ATOM   4428 O O   . ILE B 1 35  ? 3.300   4.431   -59.898 1.00 39.64 ? 35   ILE B O   1 
ATOM   4429 C CB  . ILE B 1 35  ? 0.792   5.814   -60.747 1.00 39.15 ? 35   ILE B CB  1 
ATOM   4430 C CG1 . ILE B 1 35  ? -0.720  5.967   -60.565 1.00 38.99 ? 35   ILE B CG1 1 
ATOM   4431 C CG2 . ILE B 1 35  ? 1.340   6.709   -61.868 1.00 38.18 ? 35   ILE B CG2 1 
ATOM   4432 C CD1 . ILE B 1 35  ? -1.130  7.355   -60.009 1.00 39.07 ? 35   ILE B CD1 1 
ATOM   4433 N N   . PRO B 1 36  ? 3.342   3.950   -62.091 1.00 38.43 ? 36   PRO B N   1 
ATOM   4434 C CA  . PRO B 1 36  ? 4.804   3.774   -62.022 1.00 38.17 ? 36   PRO B CA  1 
ATOM   4435 C C   . PRO B 1 36  ? 5.532   5.104   -62.021 1.00 37.79 ? 36   PRO B C   1 
ATOM   4436 O O   . PRO B 1 36  ? 5.209   5.964   -62.833 1.00 37.20 ? 36   PRO B O   1 
ATOM   4437 C CB  . PRO B 1 36  ? 5.115   3.008   -63.308 1.00 37.75 ? 36   PRO B CB  1 
ATOM   4438 C CG  . PRO B 1 36  ? 4.040   3.467   -64.273 1.00 37.76 ? 36   PRO B CG  1 
ATOM   4439 C CD  . PRO B 1 36  ? 2.821   3.771   -63.460 1.00 38.05 ? 36   PRO B CD  1 
ATOM   4440 N N   . PHE B 1 37  ? 6.503   5.272   -61.123 1.00 38.26 ? 37   PHE B N   1 
ATOM   4441 C CA  . PHE B 1 37  ? 7.317   6.514   -61.094 1.00 38.24 ? 37   PHE B CA  1 
ATOM   4442 C C   . PHE B 1 37  ? 8.779   6.266   -61.441 1.00 39.03 ? 37   PHE B C   1 
ATOM   4443 O O   . PHE B 1 37  ? 9.571   7.211   -61.577 1.00 39.47 ? 37   PHE B O   1 
ATOM   4444 C CB  . PHE B 1 37  ? 7.199   7.266   -59.750 1.00 37.85 ? 37   PHE B CB  1 
ATOM   4445 C CG  . PHE B 1 37  ? 7.628   6.458   -58.540 1.00 36.36 ? 37   PHE B CG  1 
ATOM   4446 C CD1 . PHE B 1 37  ? 8.937   6.515   -58.078 1.00 34.63 ? 37   PHE B CD1 1 
ATOM   4447 C CD2 . PHE B 1 37  ? 6.715   5.654   -57.860 1.00 36.00 ? 37   PHE B CD2 1 
ATOM   4448 C CE1 . PHE B 1 37  ? 9.343   5.774   -56.968 1.00 34.05 ? 37   PHE B CE1 1 
ATOM   4449 C CE2 . PHE B 1 37  ? 7.111   4.889   -56.744 1.00 35.65 ? 37   PHE B CE2 1 
ATOM   4450 C CZ  . PHE B 1 37  ? 8.434   4.951   -56.300 1.00 35.60 ? 37   PHE B CZ  1 
ATOM   4451 N N   . ALA B 1 38  ? 9.147   4.998   -61.582 1.00 39.13 ? 38   ALA B N   1 
ATOM   4452 C CA  . ALA B 1 38  ? 10.515  4.664   -61.972 1.00 39.31 ? 38   ALA B CA  1 
ATOM   4453 C C   . ALA B 1 38  ? 10.549  3.518   -62.976 1.00 39.54 ? 38   ALA B C   1 
ATOM   4454 O O   . ALA B 1 38  ? 9.603   2.720   -63.053 1.00 39.66 ? 38   ALA B O   1 
ATOM   4455 C CB  . ALA B 1 38  ? 11.341  4.315   -60.745 1.00 38.61 ? 38   ALA B CB  1 
ATOM   4456 N N   . GLU B 1 39  ? 11.636  3.429   -63.737 1.00 39.84 ? 39   GLU B N   1 
ATOM   4457 C CA  . GLU B 1 39  ? 11.953  2.178   -64.449 1.00 40.56 ? 39   GLU B CA  1 
ATOM   4458 C C   . GLU B 1 39  ? 12.059  1.056   -63.427 1.00 40.89 ? 39   GLU B C   1 
ATOM   4459 O O   . GLU B 1 39  ? 12.628  1.251   -62.365 1.00 41.51 ? 39   GLU B O   1 
ATOM   4460 C CB  . GLU B 1 39  ? 13.261  2.300   -65.231 1.00 39.84 ? 39   GLU B CB  1 
ATOM   4461 C CG  . GLU B 1 39  ? 13.163  3.210   -66.421 1.00 40.66 ? 39   GLU B CG  1 
ATOM   4462 C CD  . GLU B 1 39  ? 12.147  2.711   -67.425 1.00 41.40 ? 39   GLU B CD  1 
ATOM   4463 O OE1 . GLU B 1 39  ? 12.471  1.765   -68.176 1.00 41.43 ? 39   GLU B OE1 1 
ATOM   4464 O OE2 . GLU B 1 39  ? 11.017  3.258   -67.454 1.00 42.54 ? 39   GLU B OE2 1 
ATOM   4465 N N   . PRO B 1 40  ? 11.486  -0.115  -63.716 1.00 41.85 ? 40   PRO B N   1 
ATOM   4466 C CA  . PRO B 1 40  ? 11.670  -1.223  -62.757 1.00 42.53 ? 40   PRO B CA  1 
ATOM   4467 C C   . PRO B 1 40  ? 13.157  -1.516  -62.467 1.00 43.51 ? 40   PRO B C   1 
ATOM   4468 O O   . PRO B 1 40  ? 13.921  -1.789  -63.393 1.00 44.18 ? 40   PRO B O   1 
ATOM   4469 C CB  . PRO B 1 40  ? 11.011  -2.397  -63.465 1.00 42.76 ? 40   PRO B CB  1 
ATOM   4470 C CG  . PRO B 1 40  ? 9.981   -1.741  -64.380 1.00 41.90 ? 40   PRO B CG  1 
ATOM   4471 C CD  . PRO B 1 40  ? 10.640  -0.494  -64.859 1.00 41.52 ? 40   PRO B CD  1 
ATOM   4472 N N   . PRO B 1 41  ? 13.572  -1.454  -61.187 1.00 44.20 ? 41   PRO B N   1 
ATOM   4473 C CA  . PRO B 1 41  ? 14.987  -1.591  -60.840 1.00 44.61 ? 41   PRO B CA  1 
ATOM   4474 C C   . PRO B 1 41  ? 15.420  -3.069  -60.801 1.00 45.24 ? 41   PRO B C   1 
ATOM   4475 O O   . PRO B 1 41  ? 15.858  -3.581  -59.756 1.00 45.26 ? 41   PRO B O   1 
ATOM   4476 C CB  . PRO B 1 41  ? 15.036  -0.990  -59.444 1.00 44.60 ? 41   PRO B CB  1 
ATOM   4477 C CG  . PRO B 1 41  ? 13.712  -1.432  -58.863 1.00 44.41 ? 41   PRO B CG  1 
ATOM   4478 C CD  . PRO B 1 41  ? 12.734  -1.274  -59.986 1.00 43.70 ? 41   PRO B CD  1 
ATOM   4479 N N   . VAL B 1 42  ? 15.284  -3.737  -61.939 1.00 45.60 ? 42   VAL B N   1 
ATOM   4480 C CA  . VAL B 1 42  ? 15.582  -5.159  -62.058 1.00 46.08 ? 42   VAL B CA  1 
ATOM   4481 C C   . VAL B 1 42  ? 16.842  -5.395  -62.884 1.00 46.37 ? 42   VAL B C   1 
ATOM   4482 O O   . VAL B 1 42  ? 17.279  -4.528  -63.637 1.00 46.46 ? 42   VAL B O   1 
ATOM   4483 C CB  . VAL B 1 42  ? 14.406  -5.926  -62.687 1.00 46.04 ? 42   VAL B CB  1 
ATOM   4484 C CG1 . VAL B 1 42  ? 13.191  -5.897  -61.735 1.00 46.19 ? 42   VAL B CG1 1 
ATOM   4485 C CG2 . VAL B 1 42  ? 14.059  -5.356  -64.066 1.00 44.70 ? 42   VAL B CG2 1 
ATOM   4486 N N   . GLY B 1 43  ? 17.426  -6.576  -62.727 1.00 46.92 ? 43   GLY B N   1 
ATOM   4487 C CA  . GLY B 1 43  ? 18.640  -6.931  -63.457 1.00 47.46 ? 43   GLY B CA  1 
ATOM   4488 C C   . GLY B 1 43  ? 19.842  -6.120  -63.019 1.00 47.83 ? 43   GLY B C   1 
ATOM   4489 O O   . GLY B 1 43  ? 20.248  -6.176  -61.850 1.00 48.32 ? 43   GLY B O   1 
ATOM   4490 N N   . SER B 1 44  ? 20.403  -5.361  -63.957 1.00 47.87 ? 44   SER B N   1 
ATOM   4491 C CA  . SER B 1 44  ? 21.601  -4.577  -63.698 1.00 48.14 ? 44   SER B CA  1 
ATOM   4492 C C   . SER B 1 44  ? 21.229  -3.263  -62.984 1.00 48.37 ? 44   SER B C   1 
ATOM   4493 O O   . SER B 1 44  ? 22.091  -2.426  -62.669 1.00 47.89 ? 44   SER B O   1 
ATOM   4494 C CB  . SER B 1 44  ? 22.371  -4.327  -65.013 1.00 48.16 ? 44   SER B CB  1 
ATOM   4495 O OG  . SER B 1 44  ? 22.105  -3.044  -65.577 1.00 48.56 ? 44   SER B OG  1 
ATOM   4496 N N   . ARG B 1 45  ? 19.929  -3.092  -62.749 1.00 48.16 ? 45   ARG B N   1 
ATOM   4497 C CA  . ARG B 1 45  ? 19.434  -1.938  -62.016 1.00 47.94 ? 45   ARG B CA  1 
ATOM   4498 C C   . ARG B 1 45  ? 19.257  -2.196  -60.506 1.00 47.22 ? 45   ARG B C   1 
ATOM   4499 O O   . ARG B 1 45  ? 19.016  -1.260  -59.742 1.00 47.64 ? 45   ARG B O   1 
ATOM   4500 C CB  . ARG B 1 45  ? 18.166  -1.382  -62.678 1.00 48.03 ? 45   ARG B CB  1 
ATOM   4501 C CG  . ARG B 1 45  ? 18.465  -0.459  -63.860 1.00 49.66 ? 45   ARG B CG  1 
ATOM   4502 C CD  . ARG B 1 45  ? 18.902  0.938   -63.357 1.00 55.00 ? 45   ARG B CD  1 
ATOM   4503 N NE  . ARG B 1 45  ? 20.213  1.384   -63.862 1.00 57.32 ? 45   ARG B NE  1 
ATOM   4504 C CZ  . ARG B 1 45  ? 20.835  2.507   -63.478 1.00 59.55 ? 45   ARG B CZ  1 
ATOM   4505 N NH1 . ARG B 1 45  ? 20.281  3.327   -62.574 1.00 58.11 ? 45   ARG B NH1 1 
ATOM   4506 N NH2 . ARG B 1 45  ? 22.024  2.817   -64.001 1.00 59.65 ? 45   ARG B NH2 1 
ATOM   4507 N N   . ARG B 1 46  ? 19.396  -3.456  -60.088 1.00 45.79 ? 46   ARG B N   1 
ATOM   4508 C CA  . ARG B 1 46  ? 19.487  -3.822  -58.669 1.00 44.58 ? 46   ARG B CA  1 
ATOM   4509 C C   . ARG B 1 46  ? 20.604  -3.062  -57.929 1.00 44.22 ? 46   ARG B C   1 
ATOM   4510 O O   . ARG B 1 46  ? 21.735  -2.965  -58.428 1.00 43.89 ? 46   ARG B O   1 
ATOM   4511 C CB  . ARG B 1 46  ? 19.719  -5.325  -58.535 1.00 44.34 ? 46   ARG B CB  1 
ATOM   4512 C CG  . ARG B 1 46  ? 19.739  -5.824  -57.118 1.00 43.74 ? 46   ARG B CG  1 
ATOM   4513 C CD  . ARG B 1 46  ? 20.012  -7.311  -57.092 1.00 44.82 ? 46   ARG B CD  1 
ATOM   4514 N NE  . ARG B 1 46  ? 18.799  -8.117  -57.177 1.00 44.47 ? 46   ARG B NE  1 
ATOM   4515 C CZ  . ARG B 1 46  ? 18.800  -9.446  -57.177 1.00 44.88 ? 46   ARG B CZ  1 
ATOM   4516 N NH1 . ARG B 1 46  ? 19.960  -10.099 -57.107 1.00 46.33 ? 46   ARG B NH1 1 
ATOM   4517 N NH2 . ARG B 1 46  ? 17.657  -10.124 -57.236 1.00 40.84 ? 46   ARG B NH2 1 
ATOM   4518 N N   . PHE B 1 47  ? 20.276  -2.530  -56.744 1.00 43.53 ? 47   PHE B N   1 
ATOM   4519 C CA  . PHE B 1 47  ? 21.210  -1.742  -55.913 1.00 42.80 ? 47   PHE B CA  1 
ATOM   4520 C C   . PHE B 1 47  ? 21.535  -0.356  -56.475 1.00 43.01 ? 47   PHE B C   1 
ATOM   4521 O O   . PHE B 1 47  ? 22.320  0.387   -55.880 1.00 43.26 ? 47   PHE B O   1 
ATOM   4522 C CB  . PHE B 1 47  ? 22.536  -2.490  -55.634 1.00 42.39 ? 47   PHE B CB  1 
ATOM   4523 C CG  . PHE B 1 47  ? 22.362  -3.908  -55.164 1.00 40.33 ? 47   PHE B CG  1 
ATOM   4524 C CD1 . PHE B 1 47  ? 21.556  -4.203  -54.064 1.00 38.82 ? 47   PHE B CD1 1 
ATOM   4525 C CD2 . PHE B 1 47  ? 23.027  -4.950  -55.816 1.00 38.84 ? 47   PHE B CD2 1 
ATOM   4526 C CE1 . PHE B 1 47  ? 21.387  -5.528  -53.627 1.00 40.15 ? 47   PHE B CE1 1 
ATOM   4527 C CE2 . PHE B 1 47  ? 22.890  -6.278  -55.387 1.00 38.62 ? 47   PHE B CE2 1 
ATOM   4528 C CZ  . PHE B 1 47  ? 22.066  -6.573  -54.288 1.00 41.16 ? 47   PHE B CZ  1 
ATOM   4529 N N   . MET B 1 48  ? 20.939  -0.003  -57.609 1.00 43.23 ? 48   MET B N   1 
ATOM   4530 C CA  . MET B 1 48  ? 21.242  1.276   -58.282 1.00 43.68 ? 48   MET B CA  1 
ATOM   4531 C C   . MET B 1 48  ? 20.192  2.364   -58.013 1.00 43.11 ? 48   MET B C   1 
ATOM   4532 O O   . MET B 1 48  ? 19.037  2.046   -57.744 1.00 42.71 ? 48   MET B O   1 
ATOM   4533 C CB  . MET B 1 48  ? 21.365  1.036   -59.791 1.00 44.07 ? 48   MET B CB  1 
ATOM   4534 C CG  . MET B 1 48  ? 22.601  0.221   -60.224 1.00 46.65 ? 48   MET B CG  1 
ATOM   4535 S SD  . MET B 1 48  ? 24.080  1.241   -60.428 1.00 51.68 ? 48   MET B SD  1 
ATOM   4536 C CE  . MET B 1 48  ? 24.452  1.642   -58.753 1.00 54.06 ? 48   MET B CE  1 
ATOM   4537 N N   . PRO B 1 49  ? 20.590  3.650   -58.074 1.00 43.28 ? 49   PRO B N   1 
ATOM   4538 C CA  . PRO B 1 49  ? 19.597  4.741   -58.025 1.00 43.17 ? 49   PRO B CA  1 
ATOM   4539 C C   . PRO B 1 49  ? 18.520  4.583   -59.100 1.00 43.30 ? 49   PRO B C   1 
ATOM   4540 O O   . PRO B 1 49  ? 18.839  4.177   -60.226 1.00 42.84 ? 49   PRO B O   1 
ATOM   4541 C CB  . PRO B 1 49  ? 20.414  6.013   -58.291 1.00 43.28 ? 49   PRO B CB  1 
ATOM   4542 C CG  . PRO B 1 49  ? 21.841  5.613   -58.376 1.00 42.93 ? 49   PRO B CG  1 
ATOM   4543 C CD  . PRO B 1 49  ? 21.979  4.144   -58.159 1.00 43.27 ? 49   PRO B CD  1 
ATOM   4544 N N   . PRO B 1 50  ? 17.245  4.882   -58.749 1.00 43.67 ? 50   PRO B N   1 
ATOM   4545 C CA  . PRO B 1 50  ? 16.096  4.720   -59.656 1.00 43.63 ? 50   PRO B CA  1 
ATOM   4546 C C   . PRO B 1 50  ? 16.117  5.722   -60.804 1.00 44.21 ? 50   PRO B C   1 
ATOM   4547 O O   . PRO B 1 50  ? 16.463  6.878   -60.602 1.00 44.56 ? 50   PRO B O   1 
ATOM   4548 C CB  . PRO B 1 50  ? 14.893  4.989   -58.746 1.00 43.55 ? 50   PRO B CB  1 
ATOM   4549 C CG  . PRO B 1 50  ? 15.413  5.893   -57.677 1.00 42.90 ? 50   PRO B CG  1 
ATOM   4550 C CD  . PRO B 1 50  ? 16.829  5.419   -57.435 1.00 43.55 ? 50   PRO B CD  1 
ATOM   4551 N N   . GLU B 1 51  ? 15.775  5.277   -62.006 1.00 45.06 ? 51   GLU B N   1 
ATOM   4552 C CA  . GLU B 1 51  ? 15.657  6.170   -63.157 1.00 46.28 ? 51   GLU B CA  1 
ATOM   4553 C C   . GLU B 1 51  ? 14.164  6.486   -63.364 1.00 45.36 ? 51   GLU B C   1 
ATOM   4554 O O   . GLU B 1 51  ? 13.314  5.631   -63.123 1.00 45.21 ? 51   GLU B O   1 
ATOM   4555 C CB  . GLU B 1 51  ? 16.253  5.507   -64.411 1.00 46.10 ? 51   GLU B CB  1 
ATOM   4556 C CG  . GLU B 1 51  ? 17.686  4.955   -64.258 1.00 48.62 ? 51   GLU B CG  1 
ATOM   4557 C CD  . GLU B 1 51  ? 18.067  3.878   -65.309 1.00 50.60 ? 51   GLU B CD  1 
ATOM   4558 O OE1 . GLU B 1 51  ? 17.304  2.876   -65.505 1.00 55.62 ? 51   GLU B OE1 1 
ATOM   4559 O OE2 . GLU B 1 51  ? 19.161  4.019   -65.923 1.00 56.11 ? 51   GLU B OE2 1 
ATOM   4560 N N   . PRO B 1 52  ? 13.836  7.720   -63.783 1.00 45.15 ? 52   PRO B N   1 
ATOM   4561 C CA  . PRO B 1 52  ? 12.444  8.070   -64.119 1.00 44.77 ? 52   PRO B CA  1 
ATOM   4562 C C   . PRO B 1 52  ? 11.772  7.146   -65.151 1.00 44.63 ? 52   PRO B C   1 
ATOM   4563 O O   . PRO B 1 52  ? 12.411  6.687   -66.108 1.00 44.41 ? 52   PRO B O   1 
ATOM   4564 C CB  . PRO B 1 52  ? 12.543  9.507   -64.663 1.00 44.98 ? 52   PRO B CB  1 
ATOM   4565 C CG  . PRO B 1 52  ? 14.027  9.776   -64.878 1.00 45.87 ? 52   PRO B CG  1 
ATOM   4566 C CD  . PRO B 1 52  ? 14.757  8.866   -63.922 1.00 45.19 ? 52   PRO B CD  1 
ATOM   4567 N N   . LYS B 1 53  ? 10.483  6.887   -64.936 1.00 44.34 ? 53   LYS B N   1 
ATOM   4568 C CA  . LYS B 1 53  ? 9.686   6.002   -65.782 1.00 44.29 ? 53   LYS B CA  1 
ATOM   4569 C C   . LYS B 1 53  ? 9.604   6.545   -67.193 1.00 44.93 ? 53   LYS B C   1 
ATOM   4570 O O   . LYS B 1 53  ? 9.434   7.750   -67.389 1.00 45.20 ? 53   LYS B O   1 
ATOM   4571 C CB  . LYS B 1 53  ? 8.275   5.832   -65.201 1.00 43.83 ? 53   LYS B CB  1 
ATOM   4572 C CG  . LYS B 1 53  ? 7.297   4.986   -66.034 1.00 43.25 ? 53   LYS B CG  1 
ATOM   4573 C CD  . LYS B 1 53  ? 7.650   3.484   -66.034 1.00 42.55 ? 53   LYS B CD  1 
ATOM   4574 C CE  . LYS B 1 53  ? 6.793   2.688   -67.040 1.00 42.06 ? 53   LYS B CE  1 
ATOM   4575 N NZ  . LYS B 1 53  ? 7.019   3.162   -68.437 1.00 38.53 ? 53   LYS B NZ  1 
ATOM   4576 N N   . ARG B 1 54  ? 9.734   5.656   -68.179 1.00 45.34 ? 54   ARG B N   1 
ATOM   4577 C CA  . ARG B 1 54  ? 9.564   6.057   -69.570 1.00 45.25 ? 54   ARG B CA  1 
ATOM   4578 C C   . ARG B 1 54  ? 8.085   6.325   -69.861 1.00 45.52 ? 54   ARG B C   1 
ATOM   4579 O O   . ARG B 1 54  ? 7.199   5.648   -69.321 1.00 44.81 ? 54   ARG B O   1 
ATOM   4580 C CB  . ARG B 1 54  ? 10.135  5.009   -70.529 1.00 45.24 ? 54   ARG B CB  1 
ATOM   4581 C CG  . ARG B 1 54  ? 11.667  4.939   -70.558 1.00 45.41 ? 54   ARG B CG  1 
ATOM   4582 C CD  . ARG B 1 54  ? 12.179  3.776   -71.425 1.00 44.77 ? 54   ARG B CD  1 
ATOM   4583 N NE  . ARG B 1 54  ? 11.718  2.475   -70.936 1.00 44.92 ? 54   ARG B NE  1 
ATOM   4584 C CZ  . ARG B 1 54  ? 10.831  1.688   -71.556 1.00 47.37 ? 54   ARG B CZ  1 
ATOM   4585 N NH1 . ARG B 1 54  ? 10.483  0.527   -71.002 1.00 47.98 ? 54   ARG B NH1 1 
ATOM   4586 N NH2 . ARG B 1 54  ? 10.295  2.038   -72.726 1.00 45.86 ? 54   ARG B NH2 1 
ATOM   4587 N N   . PRO B 1 55  ? 7.815   7.344   -70.682 1.00 46.20 ? 55   PRO B N   1 
ATOM   4588 C CA  . PRO B 1 55  ? 6.482   7.597   -71.244 1.00 47.08 ? 55   PRO B CA  1 
ATOM   4589 C C   . PRO B 1 55  ? 5.842   6.328   -71.824 1.00 47.39 ? 55   PRO B C   1 
ATOM   4590 O O   . PRO B 1 55  ? 6.539   5.547   -72.475 1.00 47.69 ? 55   PRO B O   1 
ATOM   4591 C CB  . PRO B 1 55  ? 6.768   8.591   -72.369 1.00 47.43 ? 55   PRO B CB  1 
ATOM   4592 C CG  . PRO B 1 55  ? 7.993   9.362   -71.875 1.00 47.99 ? 55   PRO B CG  1 
ATOM   4593 C CD  . PRO B 1 55  ? 8.805   8.366   -71.075 1.00 46.51 ? 55   PRO B CD  1 
ATOM   4594 N N   . TRP B 1 56  ? 4.543   6.134   -71.580 1.00 47.45 ? 56   TRP B N   1 
ATOM   4595 C CA  . TRP B 1 56  ? 3.779   4.996   -72.109 1.00 47.68 ? 56   TRP B CA  1 
ATOM   4596 C C   . TRP B 1 56  ? 2.672   5.437   -73.074 1.00 48.34 ? 56   TRP B C   1 
ATOM   4597 O O   . TRP B 1 56  ? 2.300   6.625   -73.123 1.00 48.30 ? 56   TRP B O   1 
ATOM   4598 C CB  . TRP B 1 56  ? 3.162   4.191   -70.971 1.00 47.66 ? 56   TRP B CB  1 
ATOM   4599 C CG  . TRP B 1 56  ? 2.228   4.997   -70.140 1.00 48.74 ? 56   TRP B CG  1 
ATOM   4600 C CD1 . TRP B 1 56  ? 0.889   5.164   -70.343 1.00 49.05 ? 56   TRP B CD1 1 
ATOM   4601 C CD2 . TRP B 1 56  ? 2.559   5.773   -68.974 1.00 48.96 ? 56   TRP B CD2 1 
ATOM   4602 N NE1 . TRP B 1 56  ? 0.362   5.987   -69.374 1.00 49.71 ? 56   TRP B NE1 1 
ATOM   4603 C CE2 . TRP B 1 56  ? 1.364   6.378   -68.524 1.00 49.82 ? 56   TRP B CE2 1 
ATOM   4604 C CE3 . TRP B 1 56  ? 3.746   6.013   -68.271 1.00 47.96 ? 56   TRP B CE3 1 
ATOM   4605 C CZ2 . TRP B 1 56  ? 1.319   7.200   -67.388 1.00 49.20 ? 56   TRP B CZ2 1 
ATOM   4606 C CZ3 . TRP B 1 56  ? 3.708   6.834   -67.153 1.00 48.63 ? 56   TRP B CZ3 1 
ATOM   4607 C CH2 . TRP B 1 56  ? 2.497   7.418   -66.720 1.00 49.20 ? 56   TRP B CH2 1 
ATOM   4608 N N   . SER B 1 57  ? 2.132   4.468   -73.819 1.00 48.23 ? 57   SER B N   1 
ATOM   4609 C CA  . SER B 1 57  ? 1.130   4.727   -74.842 1.00 48.40 ? 57   SER B CA  1 
ATOM   4610 C C   . SER B 1 57  ? -0.265  4.394   -74.312 1.00 48.62 ? 57   SER B C   1 
ATOM   4611 O O   . SER B 1 57  ? -0.398  3.648   -73.346 1.00 48.79 ? 57   SER B O   1 
ATOM   4612 C CB  . SER B 1 57  ? 1.429   3.876   -76.079 1.00 48.66 ? 57   SER B CB  1 
ATOM   4613 O OG  . SER B 1 57  ? 0.969   2.539   -75.884 1.00 48.39 ? 57   SER B OG  1 
ATOM   4614 N N   . GLY B 1 58  ? -1.301  4.943   -74.940 1.00 48.32 ? 58   GLY B N   1 
ATOM   4615 C CA  . GLY B 1 58  ? -2.675  4.638   -74.540 1.00 48.05 ? 58   GLY B CA  1 
ATOM   4616 C C   . GLY B 1 58  ? -3.025  5.005   -73.102 1.00 48.25 ? 58   GLY B C   1 
ATOM   4617 O O   . GLY B 1 58  ? -2.495  5.978   -72.538 1.00 47.66 ? 58   GLY B O   1 
ATOM   4618 N N   . VAL B 1 59  ? -3.929  4.225   -72.515 1.00 47.97 ? 59   VAL B N   1 
ATOM   4619 C CA  . VAL B 1 59  ? -4.404  4.481   -71.167 1.00 48.02 ? 59   VAL B CA  1 
ATOM   4620 C C   . VAL B 1 59  ? -3.932  3.378   -70.238 1.00 48.17 ? 59   VAL B C   1 
ATOM   4621 O O   . VAL B 1 59  ? -4.397  2.233   -70.341 1.00 47.39 ? 59   VAL B O   1 
ATOM   4622 C CB  . VAL B 1 59  ? -5.955  4.511   -71.106 1.00 48.38 ? 59   VAL B CB  1 
ATOM   4623 C CG1 . VAL B 1 59  ? -6.431  4.882   -69.704 1.00 47.55 ? 59   VAL B CG1 1 
ATOM   4624 C CG2 . VAL B 1 59  ? -6.531  5.468   -72.162 1.00 48.93 ? 59   VAL B CG2 1 
ATOM   4625 N N   . LEU B 1 60  ? -3.035  3.740   -69.314 1.00 48.38 ? 60   LEU B N   1 
ATOM   4626 C CA  . LEU B 1 60  ? -2.522  2.807   -68.297 1.00 48.27 ? 60   LEU B CA  1 
ATOM   4627 C C   . LEU B 1 60  ? -3.532  2.539   -67.199 1.00 48.15 ? 60   LEU B C   1 
ATOM   4628 O O   . LEU B 1 60  ? -4.072  3.466   -66.613 1.00 48.64 ? 60   LEU B O   1 
ATOM   4629 C CB  . LEU B 1 60  ? -1.229  3.335   -67.683 1.00 48.28 ? 60   LEU B CB  1 
ATOM   4630 C CG  . LEU B 1 60  ? -0.423  2.347   -66.834 1.00 48.62 ? 60   LEU B CG  1 
ATOM   4631 C CD1 . LEU B 1 60  ? 0.356   1.369   -67.704 1.00 49.39 ? 60   LEU B CD1 1 
ATOM   4632 C CD2 . LEU B 1 60  ? 0.527   3.108   -65.950 1.00 47.92 ? 60   LEU B CD2 1 
ATOM   4633 N N   . ASP B 1 61  ? -3.763  1.263   -66.918 1.00 48.54 ? 61   ASP B N   1 
ATOM   4634 C CA  . ASP B 1 61  ? -4.734  0.819   -65.929 1.00 48.94 ? 61   ASP B CA  1 
ATOM   4635 C C   . ASP B 1 61  ? -4.231  1.050   -64.499 1.00 49.05 ? 61   ASP B C   1 
ATOM   4636 O O   . ASP B 1 61  ? -3.269  0.404   -64.064 1.00 49.86 ? 61   ASP B O   1 
ATOM   4637 C CB  . ASP B 1 61  ? -5.044  -0.662  -66.159 1.00 49.03 ? 61   ASP B CB  1 
ATOM   4638 C CG  . ASP B 1 61  ? -5.822  -1.291  -65.009 1.00 51.59 ? 61   ASP B CG  1 
ATOM   4639 O OD1 . ASP B 1 61  ? -5.437  -2.405  -64.565 1.00 52.33 ? 61   ASP B OD1 1 
ATOM   4640 O OD2 . ASP B 1 61  ? -6.810  -0.666  -64.545 1.00 53.40 ? 61   ASP B OD2 1 
ATOM   4641 N N   . ALA B 1 62  ? -4.884  1.957   -63.770 1.00 48.45 ? 62   ALA B N   1 
ATOM   4642 C CA  . ALA B 1 62  ? -4.475  2.309   -62.397 1.00 47.93 ? 62   ALA B CA  1 
ATOM   4643 C C   . ALA B 1 62  ? -5.608  2.100   -61.403 1.00 47.56 ? 62   ALA B C   1 
ATOM   4644 O O   . ALA B 1 62  ? -5.995  3.014   -60.668 1.00 47.07 ? 62   ALA B O   1 
ATOM   4645 C CB  . ALA B 1 62  ? -3.950  3.759   -62.331 1.00 47.48 ? 62   ALA B CB  1 
ATOM   4646 N N   . THR B 1 63  ? -6.134  0.883   -61.393 1.00 47.61 ? 63   THR B N   1 
ATOM   4647 C CA  . THR B 1 63  ? -7.319  0.563   -60.620 1.00 47.67 ? 63   THR B CA  1 
ATOM   4648 C C   . THR B 1 63  ? -7.015  -0.485  -59.572 1.00 47.44 ? 63   THR B C   1 
ATOM   4649 O O   . THR B 1 63  ? -7.869  -0.822  -58.746 1.00 47.57 ? 63   THR B O   1 
ATOM   4650 C CB  . THR B 1 63  ? -8.493  0.113   -61.538 1.00 48.35 ? 63   THR B CB  1 
ATOM   4651 O OG1 . THR B 1 63  ? -8.203  -1.171  -62.129 1.00 48.98 ? 63   THR B OG1 1 
ATOM   4652 C CG2 . THR B 1 63  ? -8.751  1.166   -62.637 1.00 47.18 ? 63   THR B CG2 1 
ATOM   4653 N N   . THR B 1 64  ? -5.784  -0.976  -59.588 1.00 47.33 ? 64   THR B N   1 
ATOM   4654 C CA  . THR B 1 64  ? -5.332  -1.953  -58.600 1.00 47.41 ? 64   THR B CA  1 
ATOM   4655 C C   . THR B 1 64  ? -3.934  -1.627  -58.036 1.00 46.57 ? 64   THR B C   1 
ATOM   4656 O O   . THR B 1 64  ? -3.114  -0.993  -58.702 1.00 46.42 ? 64   THR B O   1 
ATOM   4657 C CB  . THR B 1 64  ? -5.384  -3.404  -59.182 1.00 47.89 ? 64   THR B CB  1 
ATOM   4658 O OG1 . THR B 1 64  ? -5.034  -4.347  -58.159 1.00 49.57 ? 64   THR B OG1 1 
ATOM   4659 C CG2 . THR B 1 64  ? -4.429  -3.569  -60.392 1.00 48.22 ? 64   THR B CG2 1 
ATOM   4660 N N   . PHE B 1 65  ? -3.682  -2.041  -56.798 1.00 45.94 ? 65   PHE B N   1 
ATOM   4661 C CA  . PHE B 1 65  ? -2.330  -1.983  -56.231 1.00 45.44 ? 65   PHE B CA  1 
ATOM   4662 C C   . PHE B 1 65  ? -1.359  -2.861  -56.995 1.00 45.08 ? 65   PHE B C   1 
ATOM   4663 O O   . PHE B 1 65  ? -1.713  -3.946  -57.447 1.00 45.30 ? 65   PHE B O   1 
ATOM   4664 C CB  . PHE B 1 65  ? -2.320  -2.415  -54.767 1.00 45.18 ? 65   PHE B CB  1 
ATOM   4665 C CG  . PHE B 1 65  ? -2.949  -1.419  -53.835 1.00 44.82 ? 65   PHE B CG  1 
ATOM   4666 C CD1 . PHE B 1 65  ? -2.392  -0.144  -53.673 1.00 41.95 ? 65   PHE B CD1 1 
ATOM   4667 C CD2 . PHE B 1 65  ? -4.086  -1.768  -53.099 1.00 42.86 ? 65   PHE B CD2 1 
ATOM   4668 C CE1 . PHE B 1 65  ? -2.967  0.767   -52.810 1.00 41.82 ? 65   PHE B CE1 1 
ATOM   4669 C CE2 . PHE B 1 65  ? -4.666  -0.874  -52.231 1.00 42.98 ? 65   PHE B CE2 1 
ATOM   4670 C CZ  . PHE B 1 65  ? -4.108  0.414   -52.088 1.00 43.65 ? 65   PHE B CZ  1 
ATOM   4671 N N   . GLN B 1 66  ? -0.132  -2.375  -57.130 1.00 44.70 ? 66   GLN B N   1 
ATOM   4672 C CA  . GLN B 1 66  ? 0.933   -3.112  -57.780 1.00 43.98 ? 66   GLN B CA  1 
ATOM   4673 C C   . GLN B 1 66  ? 1.677   -4.011  -56.797 1.00 43.66 ? 66   GLN B C   1 
ATOM   4674 O O   . GLN B 1 66  ? 1.302   -4.125  -55.619 1.00 43.06 ? 66   GLN B O   1 
ATOM   4675 C CB  . GLN B 1 66  ? 1.903   -2.145  -58.454 1.00 44.07 ? 66   GLN B CB  1 
ATOM   4676 C CG  . GLN B 1 66  ? 1.534   -1.795  -59.881 1.00 44.64 ? 66   GLN B CG  1 
ATOM   4677 C CD  . GLN B 1 66  ? 1.879   -2.904  -60.881 1.00 47.90 ? 66   GLN B CD  1 
ATOM   4678 O OE1 . GLN B 1 66  ? 1.598   -2.780  -62.074 1.00 46.97 ? 66   GLN B OE1 1 
ATOM   4679 N NE2 . GLN B 1 66  ? 2.501   -3.989  -60.397 1.00 49.04 ? 66   GLN B NE2 1 
ATOM   4680 N N   . ASN B 1 67  ? 2.728   -4.666  -57.285 1.00 43.02 ? 67   ASN B N   1 
ATOM   4681 C CA  . ASN B 1 67  ? 3.508   -5.552  -56.440 1.00 42.37 ? 67   ASN B CA  1 
ATOM   4682 C C   . ASN B 1 67  ? 4.223   -4.878  -55.250 1.00 41.95 ? 67   ASN B C   1 
ATOM   4683 O O   . ASN B 1 67  ? 4.657   -3.732  -55.319 1.00 41.93 ? 67   ASN B O   1 
ATOM   4684 C CB  . ASN B 1 67  ? 4.494   -6.333  -57.298 1.00 42.98 ? 67   ASN B CB  1 
ATOM   4685 C CG  . ASN B 1 67  ? 3.802   -7.313  -58.246 1.00 43.75 ? 67   ASN B CG  1 
ATOM   4686 O OD1 . ASN B 1 67  ? 2.815   -7.961  -57.882 1.00 44.20 ? 67   ASN B OD1 1 
ATOM   4687 N ND2 . ASN B 1 67  ? 4.322   -7.422  -59.464 1.00 42.80 ? 67   ASN B ND2 1 
ATOM   4688 N N   . VAL B 1 68  ? 4.309   -5.610  -54.154 1.00 41.38 ? 68   VAL B N   1 
ATOM   4689 C CA  . VAL B 1 68  ? 5.071   -5.236  -52.987 1.00 41.20 ? 68   VAL B CA  1 
ATOM   4690 C C   . VAL B 1 68  ? 6.570   -5.485  -53.238 1.00 41.92 ? 68   VAL B C   1 
ATOM   4691 O O   . VAL B 1 68  ? 6.945   -6.510  -53.826 1.00 42.56 ? 68   VAL B O   1 
ATOM   4692 C CB  . VAL B 1 68  ? 4.568   -6.077  -51.805 1.00 41.07 ? 68   VAL B CB  1 
ATOM   4693 C CG1 . VAL B 1 68  ? 5.461   -5.947  -50.584 1.00 40.18 ? 68   VAL B CG1 1 
ATOM   4694 C CG2 . VAL B 1 68  ? 3.117   -5.708  -51.480 1.00 39.96 ? 68   VAL B CG2 1 
ATOM   4695 N N   . CYS B 1 69  ? 7.422   -4.554  -52.811 1.00 41.77 ? 69   CYS B N   1 
ATOM   4696 C CA  . CYS B 1 69  ? 8.873   -4.730  -52.922 1.00 42.16 ? 69   CYS B CA  1 
ATOM   4697 C C   . CYS B 1 69  ? 9.359   -5.985  -52.206 1.00 42.39 ? 69   CYS B C   1 
ATOM   4698 O O   . CYS B 1 69  ? 8.825   -6.366  -51.160 1.00 42.15 ? 69   CYS B O   1 
ATOM   4699 C CB  . CYS B 1 69  ? 9.608   -3.510  -52.398 1.00 41.94 ? 69   CYS B CB  1 
ATOM   4700 S SG  . CYS B 1 69  ? 9.372   -2.011  -53.400 1.00 44.04 ? 69   CYS B SG  1 
ATOM   4701 N N   . TYR B 1 70  ? 10.368  -6.635  -52.790 1.00 43.03 ? 70   TYR B N   1 
ATOM   4702 C CA  . TYR B 1 70  ? 10.845  -7.917  -52.281 1.00 42.97 ? 70   TYR B CA  1 
ATOM   4703 C C   . TYR B 1 70  ? 11.381  -7.797  -50.866 1.00 43.20 ? 70   TYR B C   1 
ATOM   4704 O O   . TYR B 1 70  ? 12.287  -7.016  -50.599 1.00 42.77 ? 70   TYR B O   1 
ATOM   4705 C CB  . TYR B 1 70  ? 11.875  -8.575  -53.219 1.00 43.12 ? 70   TYR B CB  1 
ATOM   4706 C CG  . TYR B 1 70  ? 11.779  -10.077 -53.104 1.00 43.80 ? 70   TYR B CG  1 
ATOM   4707 C CD1 . TYR B 1 70  ? 10.812  -10.791 -53.822 1.00 43.43 ? 70   TYR B CD1 1 
ATOM   4708 C CD2 . TYR B 1 70  ? 12.590  -10.779 -52.208 1.00 43.66 ? 70   TYR B CD2 1 
ATOM   4709 C CE1 . TYR B 1 70  ? 10.688  -12.190 -53.681 1.00 44.41 ? 70   TYR B CE1 1 
ATOM   4710 C CE2 . TYR B 1 70  ? 12.466  -12.167 -52.056 1.00 44.77 ? 70   TYR B CE2 1 
ATOM   4711 C CZ  . TYR B 1 70  ? 11.519  -12.867 -52.791 1.00 44.09 ? 70   TYR B CZ  1 
ATOM   4712 O OH  . TYR B 1 70  ? 11.412  -14.229 -52.625 1.00 42.71 ? 70   TYR B OH  1 
ATOM   4713 N N   . GLN B 1 71  ? 10.798  -8.565  -49.957 1.00 44.07 ? 71   GLN B N   1 
ATOM   4714 C CA  . GLN B 1 71  ? 11.126  -8.437  -48.546 1.00 45.13 ? 71   GLN B CA  1 
ATOM   4715 C C   . GLN B 1 71  ? 10.937  -9.729  -47.791 1.00 46.52 ? 71   GLN B C   1 
ATOM   4716 O O   . GLN B 1 71  ? 10.237  -10.637 -48.256 1.00 46.26 ? 71   GLN B O   1 
ATOM   4717 C CB  . GLN B 1 71  ? 10.273  -7.353  -47.883 1.00 44.41 ? 71   GLN B CB  1 
ATOM   4718 C CG  . GLN B 1 71  ? 8.793   -7.662  -47.849 1.00 43.94 ? 71   GLN B CG  1 
ATOM   4719 C CD  . GLN B 1 71  ? 7.956   -6.431  -47.615 1.00 44.26 ? 71   GLN B CD  1 
ATOM   4720 O OE1 . GLN B 1 71  ? 7.199   -6.360  -46.655 1.00 43.46 ? 71   GLN B OE1 1 
ATOM   4721 N NE2 . GLN B 1 71  ? 8.097   -5.441  -48.489 1.00 45.16 ? 71   GLN B NE2 1 
ATOM   4722 N N   . TYR B 1 72  ? 11.559  -9.780  -46.611 1.00 48.12 ? 72   TYR B N   1 
ATOM   4723 C CA  . TYR B 1 72  ? 11.317  -10.819 -45.638 1.00 49.97 ? 72   TYR B CA  1 
ATOM   4724 C C   . TYR B 1 72  ? 9.839   -10.828 -45.267 1.00 50.85 ? 72   TYR B C   1 
ATOM   4725 O O   . TYR B 1 72  ? 9.198   -9.785  -45.192 1.00 50.60 ? 72   TYR B O   1 
ATOM   4726 C CB  . TYR B 1 72  ? 12.190  -10.568 -44.406 1.00 50.83 ? 72   TYR B CB  1 
ATOM   4727 C CG  . TYR B 1 72  ? 11.954  -11.533 -43.266 1.00 51.59 ? 72   TYR B CG  1 
ATOM   4728 C CD1 . TYR B 1 72  ? 11.106  -11.189 -42.202 1.00 52.89 ? 72   TYR B CD1 1 
ATOM   4729 C CD2 . TYR B 1 72  ? 12.571  -12.784 -43.243 1.00 52.18 ? 72   TYR B CD2 1 
ATOM   4730 C CE1 . TYR B 1 72  ? 10.871  -12.071 -41.139 1.00 52.68 ? 72   TYR B CE1 1 
ATOM   4731 C CE2 . TYR B 1 72  ? 12.342  -13.684 -42.175 1.00 53.25 ? 72   TYR B CE2 1 
ATOM   4732 C CZ  . TYR B 1 72  ? 11.493  -13.313 -41.129 1.00 52.73 ? 72   TYR B CZ  1 
ATOM   4733 O OH  . TYR B 1 72  ? 11.256  -14.177 -40.075 1.00 52.97 ? 72   TYR B OH  1 
ATOM   4734 N N   . VAL B 1 73  ? 9.287   -12.011 -45.057 1.00 52.38 ? 73   VAL B N   1 
ATOM   4735 C CA  . VAL B 1 73  ? 7.895   -12.103 -44.633 1.00 53.66 ? 73   VAL B CA  1 
ATOM   4736 C C   . VAL B 1 73  ? 7.871   -12.725 -43.246 1.00 55.09 ? 73   VAL B C   1 
ATOM   4737 O O   . VAL B 1 73  ? 8.464   -13.780 -43.023 1.00 55.02 ? 73   VAL B O   1 
ATOM   4738 C CB  . VAL B 1 73  ? 7.035   -12.919 -45.628 1.00 53.53 ? 73   VAL B CB  1 
ATOM   4739 C CG1 . VAL B 1 73  ? 5.583   -13.075 -45.114 1.00 52.92 ? 73   VAL B CG1 1 
ATOM   4740 C CG2 . VAL B 1 73  ? 7.063   -12.274 -47.011 1.00 52.89 ? 73   VAL B CG2 1 
ATOM   4741 N N   . ASP B 1 74  ? 7.196   -12.058 -42.313 1.00 56.87 ? 74   ASP B N   1 
ATOM   4742 C CA  . ASP B 1 74  ? 7.139   -12.537 -40.936 1.00 58.39 ? 74   ASP B CA  1 
ATOM   4743 C C   . ASP B 1 74  ? 6.354   -13.843 -40.790 1.00 59.47 ? 74   ASP B C   1 
ATOM   4744 O O   . ASP B 1 74  ? 5.247   -13.972 -41.309 1.00 59.58 ? 74   ASP B O   1 
ATOM   4745 C CB  . ASP B 1 74  ? 6.566   -11.474 -40.006 1.00 58.08 ? 74   ASP B CB  1 
ATOM   4746 C CG  . ASP B 1 74  ? 6.759   -11.830 -38.562 1.00 58.48 ? 74   ASP B CG  1 
ATOM   4747 O OD1 . ASP B 1 74  ? 5.807   -12.382 -37.950 1.00 58.24 ? 74   ASP B OD1 1 
ATOM   4748 O OD2 . ASP B 1 74  ? 7.888   -11.612 -38.069 1.00 58.38 ? 74   ASP B OD2 1 
ATOM   4749 N N   . THR B 1 75  ? 6.936   -14.783 -40.047 1.00 61.01 ? 75   THR B N   1 
ATOM   4750 C CA  . THR B 1 75  ? 6.430   -16.154 -39.933 1.00 62.73 ? 75   THR B CA  1 
ATOM   4751 C C   . THR B 1 75  ? 6.176   -16.562 -38.480 1.00 63.43 ? 75   THR B C   1 
ATOM   4752 O O   . THR B 1 75  ? 5.464   -17.534 -38.222 1.00 63.86 ? 75   THR B O   1 
ATOM   4753 C CB  . THR B 1 75  ? 7.433   -17.181 -40.558 1.00 63.02 ? 75   THR B CB  1 
ATOM   4754 O OG1 . THR B 1 75  ? 8.756   -16.943 -40.042 1.00 63.61 ? 75   THR B OG1 1 
ATOM   4755 C CG2 . THR B 1 75  ? 7.460   -17.081 -42.095 1.00 62.98 ? 75   THR B CG2 1 
ATOM   4756 N N   . LEU B 1 76  ? 6.754   -15.813 -37.544 1.00 64.25 ? 76   LEU B N   1 
ATOM   4757 C CA  . LEU B 1 76  ? 6.710   -16.131 -36.110 1.00 64.66 ? 76   LEU B CA  1 
ATOM   4758 C C   . LEU B 1 76  ? 5.329   -16.535 -35.536 1.00 64.87 ? 76   LEU B C   1 
ATOM   4759 O O   . LEU B 1 76  ? 5.265   -17.352 -34.614 1.00 65.37 ? 76   LEU B O   1 
ATOM   4760 C CB  . LEU B 1 76  ? 7.325   -14.975 -35.298 1.00 64.64 ? 76   LEU B CB  1 
ATOM   4761 C CG  . LEU B 1 76  ? 7.332   -15.030 -33.758 1.00 64.89 ? 76   LEU B CG  1 
ATOM   4762 C CD1 . LEU B 1 76  ? 8.219   -16.174 -33.208 1.00 65.68 ? 76   LEU B CD1 1 
ATOM   4763 C CD2 . LEU B 1 76  ? 7.732   -13.682 -33.145 1.00 64.82 ? 76   LEU B CD2 1 
ATOM   4764 N N   . TYR B 1 77  ? 4.240   -15.980 -36.066 1.00 64.87 ? 77   TYR B N   1 
ATOM   4765 C CA  . TYR B 1 77  ? 2.897   -16.286 -35.552 1.00 64.88 ? 77   TYR B CA  1 
ATOM   4766 C C   . TYR B 1 77  ? 1.869   -16.513 -36.672 1.00 64.83 ? 77   TYR B C   1 
ATOM   4767 O O   . TYR B 1 77  ? 0.977   -15.689 -36.865 1.00 64.82 ? 77   TYR B O   1 
ATOM   4768 C CB  . TYR B 1 77  ? 2.405   -15.163 -34.636 1.00 64.80 ? 77   TYR B CB  1 
ATOM   4769 C CG  . TYR B 1 77  ? 3.103   -15.058 -33.298 1.00 65.35 ? 77   TYR B CG  1 
ATOM   4770 C CD1 . TYR B 1 77  ? 2.949   -16.049 -32.330 1.00 65.88 ? 77   TYR B CD1 1 
ATOM   4771 C CD2 . TYR B 1 77  ? 3.890   -13.944 -32.981 1.00 64.77 ? 77   TYR B CD2 1 
ATOM   4772 C CE1 . TYR B 1 77  ? 3.579   -15.949 -31.085 1.00 65.91 ? 77   TYR B CE1 1 
ATOM   4773 C CE2 . TYR B 1 77  ? 4.517   -13.831 -31.740 1.00 64.38 ? 77   TYR B CE2 1 
ATOM   4774 C CZ  . TYR B 1 77  ? 4.361   -14.838 -30.797 1.00 65.58 ? 77   TYR B CZ  1 
ATOM   4775 O OH  . TYR B 1 77  ? 4.976   -14.749 -29.562 1.00 65.28 ? 77   TYR B OH  1 
ATOM   4776 N N   . PRO B 1 78  ? 1.957   -17.653 -37.380 1.00 64.82 ? 78   PRO B N   1 
ATOM   4777 C CA  . PRO B 1 78  ? 1.190   -17.859 -38.624 1.00 64.73 ? 78   PRO B CA  1 
ATOM   4778 C C   . PRO B 1 78  ? -0.324  -17.777 -38.432 1.00 64.33 ? 78   PRO B C   1 
ATOM   4779 O O   . PRO B 1 78  ? -0.850  -18.385 -37.504 1.00 64.24 ? 78   PRO B O   1 
ATOM   4780 C CB  . PRO B 1 78  ? 1.597   -19.272 -39.062 1.00 64.82 ? 78   PRO B CB  1 
ATOM   4781 C CG  . PRO B 1 78  ? 2.912   -19.536 -38.354 1.00 65.26 ? 78   PRO B CG  1 
ATOM   4782 C CD  . PRO B 1 78  ? 2.762   -18.838 -37.031 1.00 65.12 ? 78   PRO B CD  1 
ATOM   4783 N N   . GLY B 1 79  ? -0.999  -17.011 -39.290 1.00 63.93 ? 79   GLY B N   1 
ATOM   4784 C CA  . GLY B 1 79  ? -2.455  -16.838 -39.221 1.00 63.89 ? 79   GLY B CA  1 
ATOM   4785 C C   . GLY B 1 79  ? -2.992  -15.793 -38.245 1.00 63.79 ? 79   GLY B C   1 
ATOM   4786 O O   . GLY B 1 79  ? -4.204  -15.522 -38.216 1.00 63.70 ? 79   GLY B O   1 
ATOM   4787 N N   . PHE B 1 80  ? -2.095  -15.210 -37.449 1.00 63.44 ? 80   PHE B N   1 
ATOM   4788 C CA  . PHE B 1 80  ? -2.444  -14.216 -36.426 1.00 63.13 ? 80   PHE B CA  1 
ATOM   4789 C C   . PHE B 1 80  ? -2.586  -12.817 -37.051 1.00 62.56 ? 80   PHE B C   1 
ATOM   4790 O O   . PHE B 1 80  ? -1.654  -12.321 -37.683 1.00 62.58 ? 80   PHE B O   1 
ATOM   4791 C CB  . PHE B 1 80  ? -1.379  -14.255 -35.316 1.00 63.37 ? 80   PHE B CB  1 
ATOM   4792 C CG  . PHE B 1 80  ? -1.554  -13.216 -34.237 1.00 63.98 ? 80   PHE B CG  1 
ATOM   4793 C CD1 . PHE B 1 80  ? -2.734  -13.132 -33.502 1.00 64.49 ? 80   PHE B CD1 1 
ATOM   4794 C CD2 . PHE B 1 80  ? -0.513  -12.343 -33.930 1.00 64.13 ? 80   PHE B CD2 1 
ATOM   4795 C CE1 . PHE B 1 80  ? -2.881  -12.176 -32.495 1.00 65.11 ? 80   PHE B CE1 1 
ATOM   4796 C CE2 . PHE B 1 80  ? -0.649  -11.389 -32.924 1.00 64.12 ? 80   PHE B CE2 1 
ATOM   4797 C CZ  . PHE B 1 80  ? -1.832  -11.303 -32.205 1.00 64.39 ? 80   PHE B CZ  1 
ATOM   4798 N N   . GLU B 1 81  ? -3.753  -12.191 -36.889 1.00 62.20 ? 81   GLU B N   1 
ATOM   4799 C CA  . GLU B 1 81  ? -4.035  -10.904 -37.555 1.00 61.62 ? 81   GLU B CA  1 
ATOM   4800 C C   . GLU B 1 81  ? -3.069  -9.784  -37.115 1.00 60.63 ? 81   GLU B C   1 
ATOM   4801 O O   . GLU B 1 81  ? -2.745  -8.894  -37.904 1.00 60.30 ? 81   GLU B O   1 
ATOM   4802 C CB  . GLU B 1 81  ? -5.521  -10.506 -37.407 1.00 61.95 ? 81   GLU B CB  1 
ATOM   4803 C CG  . GLU B 1 81  ? -5.979  -9.184  -38.128 1.00 63.74 ? 81   GLU B CG  1 
ATOM   4804 C CD  . GLU B 1 81  ? -5.989  -9.227  -39.685 1.00 68.32 ? 81   GLU B CD  1 
ATOM   4805 O OE1 . GLU B 1 81  ? -5.962  -10.328 -40.287 1.00 70.32 ? 81   GLU B OE1 1 
ATOM   4806 O OE2 . GLU B 1 81  ? -6.036  -8.138  -40.318 1.00 68.73 ? 81   GLU B OE2 1 
ATOM   4807 N N   . GLY B 1 82  ? -2.580  -9.879  -35.881 1.00 59.60 ? 82   GLY B N   1 
ATOM   4808 C CA  . GLY B 1 82  ? -1.646  -8.910  -35.311 1.00 58.32 ? 82   GLY B CA  1 
ATOM   4809 C C   . GLY B 1 82  ? -0.325  -8.778  -36.042 1.00 57.52 ? 82   GLY B C   1 
ATOM   4810 O O   . GLY B 1 82  ? 0.284   -7.702  -36.035 1.00 57.33 ? 82   GLY B O   1 
ATOM   4811 N N   . THR B 1 83  ? 0.117   -9.868  -36.668 1.00 56.52 ? 83   THR B N   1 
ATOM   4812 C CA  . THR B 1 83  ? 1.309   -9.852  -37.512 1.00 55.64 ? 83   THR B CA  1 
ATOM   4813 C C   . THR B 1 83  ? 0.979   -9.795  -39.003 1.00 55.12 ? 83   THR B C   1 
ATOM   4814 O O   . THR B 1 83  ? 1.662   -9.112  -39.771 1.00 55.00 ? 83   THR B O   1 
ATOM   4815 C CB  . THR B 1 83  ? 2.224   -11.069 -37.251 1.00 55.85 ? 83   THR B CB  1 
ATOM   4816 O OG1 . THR B 1 83  ? 1.454   -12.276 -37.335 1.00 55.57 ? 83   THR B OG1 1 
ATOM   4817 C CG2 . THR B 1 83  ? 2.895   -10.967 -35.885 1.00 55.09 ? 83   THR B CG2 1 
ATOM   4818 N N   . GLU B 1 84  ? -0.064  -10.508 -39.413 1.00 54.54 ? 84   GLU B N   1 
ATOM   4819 C CA  . GLU B 1 84  ? -0.439  -10.563 -40.830 1.00 54.25 ? 84   GLU B CA  1 
ATOM   4820 C C   . GLU B 1 84  ? -0.870  -9.195  -41.386 1.00 53.11 ? 84   GLU B C   1 
ATOM   4821 O O   . GLU B 1 84  ? -0.815  -8.967  -42.603 1.00 52.99 ? 84   GLU B O   1 
ATOM   4822 C CB  . GLU B 1 84  ? -1.555  -11.590 -41.067 1.00 54.91 ? 84   GLU B CB  1 
ATOM   4823 C CG  . GLU B 1 84  ? -1.275  -13.013 -40.554 1.00 57.93 ? 84   GLU B CG  1 
ATOM   4824 C CD  . GLU B 1 84  ? -0.371  -13.841 -41.466 1.00 62.32 ? 84   GLU B CD  1 
ATOM   4825 O OE1 . GLU B 1 84  ? 0.197   -13.287 -42.446 1.00 65.44 ? 84   GLU B OE1 1 
ATOM   4826 O OE2 . GLU B 1 84  ? -0.232  -15.060 -41.196 1.00 63.03 ? 84   GLU B OE2 1 
ATOM   4827 N N   . MET B 1 85  ? -1.292  -8.281  -40.512 1.00 51.40 ? 85   MET B N   1 
ATOM   4828 C CA  . MET B 1 85  ? -1.723  -6.954  -40.978 1.00 50.08 ? 85   MET B CA  1 
ATOM   4829 C C   . MET B 1 85  ? -0.551  -6.153  -41.566 1.00 48.97 ? 85   MET B C   1 
ATOM   4830 O O   . MET B 1 85  ? -0.751  -5.248  -42.368 1.00 48.45 ? 85   MET B O   1 
ATOM   4831 C CB  . MET B 1 85  ? -2.443  -6.174  -39.873 1.00 49.77 ? 85   MET B CB  1 
ATOM   4832 C CG  . MET B 1 85  ? -1.601  -5.918  -38.642 1.00 49.31 ? 85   MET B CG  1 
ATOM   4833 S SD  . MET B 1 85  ? -2.470  -4.975  -37.379 1.00 50.43 ? 85   MET B SD  1 
ATOM   4834 C CE  . MET B 1 85  ? -2.578  -3.362  -38.191 1.00 47.34 ? 85   MET B CE  1 
ATOM   4835 N N   . TRP B 1 86  ? 0.659   -6.524  -41.161 1.00 47.93 ? 86   TRP B N   1 
ATOM   4836 C CA  . TRP B 1 86  ? 1.884   -5.902  -41.640 1.00 47.40 ? 86   TRP B CA  1 
ATOM   4837 C C   . TRP B 1 86  ? 2.556   -6.698  -42.770 1.00 46.89 ? 86   TRP B C   1 
ATOM   4838 O O   . TRP B 1 86  ? 3.550   -6.240  -43.329 1.00 46.68 ? 86   TRP B O   1 
ATOM   4839 C CB  . TRP B 1 86  ? 2.869   -5.678  -40.473 1.00 47.07 ? 86   TRP B CB  1 
ATOM   4840 C CG  . TRP B 1 86  ? 2.221   -5.001  -39.299 1.00 47.10 ? 86   TRP B CG  1 
ATOM   4841 C CD1 . TRP B 1 86  ? 1.855   -5.579  -38.123 1.00 47.15 ? 86   TRP B CD1 1 
ATOM   4842 C CD2 . TRP B 1 86  ? 1.827   -3.624  -39.209 1.00 46.79 ? 86   TRP B CD2 1 
ATOM   4843 N NE1 . TRP B 1 86  ? 1.260   -4.654  -37.303 1.00 47.52 ? 86   TRP B NE1 1 
ATOM   4844 C CE2 . TRP B 1 86  ? 1.232   -3.444  -37.945 1.00 47.27 ? 86   TRP B CE2 1 
ATOM   4845 C CE3 . TRP B 1 86  ? 1.931   -2.525  -40.071 1.00 46.45 ? 86   TRP B CE3 1 
ATOM   4846 C CZ2 . TRP B 1 86  ? 0.750   -2.200  -37.509 1.00 47.32 ? 86   TRP B CZ2 1 
ATOM   4847 C CZ3 . TRP B 1 86  ? 1.441   -1.293  -39.646 1.00 47.01 ? 86   TRP B CZ3 1 
ATOM   4848 C CH2 . TRP B 1 86  ? 0.858   -1.143  -38.376 1.00 47.14 ? 86   TRP B CH2 1 
ATOM   4849 N N   . ASN B 1 87  ? 2.022   -7.874  -43.102 1.00 46.03 ? 87   ASN B N   1 
ATOM   4850 C CA  . ASN B 1 87  ? 2.608   -8.696  -44.173 1.00 45.77 ? 87   ASN B CA  1 
ATOM   4851 C C   . ASN B 1 87  ? 2.219   -8.227  -45.582 1.00 45.16 ? 87   ASN B C   1 
ATOM   4852 O O   . ASN B 1 87  ? 1.225   -7.517  -45.747 1.00 44.84 ? 87   ASN B O   1 
ATOM   4853 C CB  . ASN B 1 87  ? 2.291   -10.187 -43.972 1.00 45.80 ? 87   ASN B CB  1 
ATOM   4854 C CG  . ASN B 1 87  ? 3.244   -10.873 -42.983 1.00 47.45 ? 87   ASN B CG  1 
ATOM   4855 O OD1 . ASN B 1 87  ? 4.396   -10.445 -42.772 1.00 48.29 ? 87   ASN B OD1 1 
ATOM   4856 N ND2 . ASN B 1 87  ? 2.771   -11.959 -42.389 1.00 48.81 ? 87   ASN B ND2 1 
ATOM   4857 N N   . PRO B 1 88  ? 3.017   -8.595  -46.606 1.00 44.84 ? 88   PRO B N   1 
ATOM   4858 C CA  . PRO B 1 88  ? 2.630   -8.207  -47.965 1.00 44.62 ? 88   PRO B CA  1 
ATOM   4859 C C   . PRO B 1 88  ? 1.233   -8.702  -48.326 1.00 44.74 ? 88   PRO B C   1 
ATOM   4860 O O   . PRO B 1 88  ? 0.896   -9.853  -48.057 1.00 44.82 ? 88   PRO B O   1 
ATOM   4861 C CB  . PRO B 1 88  ? 3.690   -8.868  -48.839 1.00 44.02 ? 88   PRO B CB  1 
ATOM   4862 C CG  . PRO B 1 88  ? 4.855   -9.045  -47.946 1.00 44.08 ? 88   PRO B CG  1 
ATOM   4863 C CD  . PRO B 1 88  ? 4.302   -9.320  -46.591 1.00 44.84 ? 88   PRO B CD  1 
ATOM   4864 N N   . ASN B 1 89  ? 0.425   -7.824  -48.911 1.00 44.95 ? 89   ASN B N   1 
ATOM   4865 C CA  . ASN B 1 89  ? -0.925  -8.192  -49.316 1.00 45.29 ? 89   ASN B CA  1 
ATOM   4866 C C   . ASN B 1 89  ? -1.031  -8.242  -50.842 1.00 45.54 ? 89   ASN B C   1 
ATOM   4867 O O   . ASN B 1 89  ? -2.131  -8.293  -51.385 1.00 45.98 ? 89   ASN B O   1 
ATOM   4868 C CB  . ASN B 1 89  ? -1.965  -7.253  -48.679 1.00 44.68 ? 89   ASN B CB  1 
ATOM   4869 C CG  . ASN B 1 89  ? -1.850  -5.798  -49.188 1.00 45.47 ? 89   ASN B CG  1 
ATOM   4870 O OD1 . ASN B 1 89  ? -0.834  -5.396  -49.776 1.00 42.87 ? 89   ASN B OD1 1 
ATOM   4871 N ND2 . ASN B 1 89  ? -2.912  -5.014  -48.974 1.00 44.28 ? 89   ASN B ND2 1 
ATOM   4872 N N   . ARG B 1 90  ? 0.124   -8.209  -51.514 1.00 45.55 ? 90   ARG B N   1 
ATOM   4873 C CA  . ARG B 1 90  ? 0.242   -8.389  -52.969 1.00 45.97 ? 90   ARG B CA  1 
ATOM   4874 C C   . ARG B 1 90  ? 1.501   -9.219  -53.285 1.00 46.48 ? 90   ARG B C   1 
ATOM   4875 O O   . ARG B 1 90  ? 2.320   -9.470  -52.395 1.00 46.45 ? 90   ARG B O   1 
ATOM   4876 C CB  . ARG B 1 90  ? 0.318   -7.040  -53.693 1.00 46.12 ? 90   ARG B CB  1 
ATOM   4877 C CG  . ARG B 1 90  ? -0.964  -6.196  -53.701 1.00 46.78 ? 90   ARG B CG  1 
ATOM   4878 C CD  . ARG B 1 90  ? -2.115  -6.918  -54.394 1.00 49.53 ? 90   ARG B CD  1 
ATOM   4879 N NE  . ARG B 1 90  ? -3.332  -6.116  -54.422 1.00 51.61 ? 90   ARG B NE  1 
ATOM   4880 C CZ  . ARG B 1 90  ? -4.196  -6.008  -53.411 1.00 53.07 ? 90   ARG B CZ  1 
ATOM   4881 N NH1 . ARG B 1 90  ? -3.991  -6.661  -52.268 1.00 52.53 ? 90   ARG B NH1 1 
ATOM   4882 N NH2 . ARG B 1 90  ? -5.271  -5.234  -53.538 1.00 52.67 ? 90   ARG B NH2 1 
ATOM   4883 N N   . GLU B 1 91  ? 1.650   -9.650  -54.544 1.00 46.55 ? 91   GLU B N   1 
ATOM   4884 C CA  . GLU B 1 91  ? 2.793   -10.473 -54.961 1.00 46.31 ? 91   GLU B CA  1 
ATOM   4885 C C   . GLU B 1 91  ? 4.109   -9.733  -54.746 1.00 45.05 ? 91   GLU B C   1 
ATOM   4886 O O   . GLU B 1 91  ? 4.192   -8.531  -54.992 1.00 45.21 ? 91   GLU B O   1 
ATOM   4887 C CB  . GLU B 1 91  ? 2.686   -10.890 -56.445 1.00 47.07 ? 91   GLU B CB  1 
ATOM   4888 C CG  . GLU B 1 91  ? 1.665   -12.012 -56.787 1.00 51.12 ? 91   GLU B CG  1 
ATOM   4889 C CD  . GLU B 1 91  ? 1.853   -13.303 -55.981 1.00 56.21 ? 91   GLU B CD  1 
ATOM   4890 O OE1 . GLU B 1 91  ? 3.014   -13.758 -55.774 1.00 58.00 ? 91   GLU B OE1 1 
ATOM   4891 O OE2 . GLU B 1 91  ? 0.818   -13.866 -55.554 1.00 58.80 ? 91   GLU B OE2 1 
ATOM   4892 N N   . LEU B 1 92  ? 5.131   -10.443 -54.285 1.00 43.41 ? 92   LEU B N   1 
ATOM   4893 C CA  . LEU B 1 92  ? 6.447   -9.850  -54.144 1.00 42.45 ? 92   LEU B CA  1 
ATOM   4894 C C   . LEU B 1 92  ? 7.113   -9.764  -55.508 1.00 42.21 ? 92   LEU B C   1 
ATOM   4895 O O   . LEU B 1 92  ? 6.927   -10.636 -56.340 1.00 42.73 ? 92   LEU B O   1 
ATOM   4896 C CB  . LEU B 1 92  ? 7.321   -10.673 -53.216 1.00 41.72 ? 92   LEU B CB  1 
ATOM   4897 C CG  . LEU B 1 92  ? 6.946   -10.929 -51.760 1.00 42.38 ? 92   LEU B CG  1 
ATOM   4898 C CD1 . LEU B 1 92  ? 8.070   -11.727 -51.088 1.00 39.44 ? 92   LEU B CD1 1 
ATOM   4899 C CD2 . LEU B 1 92  ? 6.683   -9.640  -51.002 1.00 41.96 ? 92   LEU B CD2 1 
ATOM   4900 N N   . SER B 1 93  ? 7.912   -8.727  -55.725 1.00 41.61 ? 93   SER B N   1 
ATOM   4901 C CA  . SER B 1 93  ? 8.639   -8.546  -56.975 1.00 40.73 ? 93   SER B CA  1 
ATOM   4902 C C   . SER B 1 93  ? 9.651   -7.436  -56.758 1.00 40.39 ? 93   SER B C   1 
ATOM   4903 O O   . SER B 1 93  ? 9.438   -6.570  -55.913 1.00 40.64 ? 93   SER B O   1 
ATOM   4904 C CB  . SER B 1 93  ? 7.672   -8.162  -58.098 1.00 40.67 ? 93   SER B CB  1 
ATOM   4905 O OG  . SER B 1 93  ? 8.372   -7.772  -59.269 1.00 41.61 ? 93   SER B OG  1 
ATOM   4906 N N   . GLU B 1 94  ? 10.757  -7.473  -57.493 1.00 40.02 ? 94   GLU B N   1 
ATOM   4907 C CA  . GLU B 1 94  ? 11.708  -6.362  -57.499 1.00 39.52 ? 94   GLU B CA  1 
ATOM   4908 C C   . GLU B 1 94  ? 11.193  -5.248  -58.388 1.00 39.04 ? 94   GLU B C   1 
ATOM   4909 O O   . GLU B 1 94  ? 11.700  -4.120  -58.358 1.00 37.85 ? 94   GLU B O   1 
ATOM   4910 C CB  . GLU B 1 94  ? 13.083  -6.808  -57.983 1.00 39.46 ? 94   GLU B CB  1 
ATOM   4911 C CG  . GLU B 1 94  ? 13.935  -7.422  -56.888 1.00 41.51 ? 94   GLU B CG  1 
ATOM   4912 C CD  . GLU B 1 94  ? 15.187  -8.055  -57.443 1.00 43.75 ? 94   GLU B CD  1 
ATOM   4913 O OE1 . GLU B 1 94  ? 16.186  -7.327  -57.656 1.00 44.22 ? 94   GLU B OE1 1 
ATOM   4914 O OE2 . GLU B 1 94  ? 15.157  -9.286  -57.681 1.00 45.64 ? 94   GLU B OE2 1 
ATOM   4915 N N   . ASP B 1 95  ? 10.197  -5.593  -59.206 1.00 38.95 ? 95   ASP B N   1 
ATOM   4916 C CA  . ASP B 1 95  ? 9.487   -4.615  -60.008 1.00 39.01 ? 95   ASP B CA  1 
ATOM   4917 C C   . ASP B 1 95  ? 8.383   -4.043  -59.137 1.00 38.53 ? 95   ASP B C   1 
ATOM   4918 O O   . ASP B 1 95  ? 7.244   -4.501  -59.192 1.00 38.77 ? 95   ASP B O   1 
ATOM   4919 C CB  . ASP B 1 95  ? 8.936   -5.296  -61.264 1.00 39.25 ? 95   ASP B CB  1 
ATOM   4920 C CG  . ASP B 1 95  ? 8.175   -4.356  -62.171 1.00 40.66 ? 95   ASP B CG  1 
ATOM   4921 O OD1 . ASP B 1 95  ? 8.035   -3.147  -61.867 1.00 42.08 ? 95   ASP B OD1 1 
ATOM   4922 O OD2 . ASP B 1 95  ? 7.676   -4.852  -63.196 1.00 43.23 ? 95   ASP B OD2 1 
ATOM   4923 N N   . CYS B 1 96  ? 8.723   -3.042  -58.318 1.00 38.56 ? 96   CYS B N   1 
ATOM   4924 C CA  . CYS B 1 96  ? 7.786   -2.546  -57.285 1.00 38.24 ? 96   CYS B CA  1 
ATOM   4925 C C   . CYS B 1 96  ? 7.663   -1.037  -57.146 1.00 37.42 ? 96   CYS B C   1 
ATOM   4926 O O   . CYS B 1 96  ? 7.026   -0.552  -56.215 1.00 37.95 ? 96   CYS B O   1 
ATOM   4927 C CB  . CYS B 1 96  ? 8.164   -3.128  -55.928 1.00 38.37 ? 96   CYS B CB  1 
ATOM   4928 S SG  . CYS B 1 96  ? 9.789   -2.590  -55.332 1.00 40.91 ? 96   CYS B SG  1 
ATOM   4929 N N   . LEU B 1 97  ? 8.250   -0.290  -58.062 1.00 36.51 ? 97   LEU B N   1 
ATOM   4930 C CA  . LEU B 1 97  ? 8.321   1.134   -57.890 1.00 36.19 ? 97   LEU B CA  1 
ATOM   4931 C C   . LEU B 1 97  ? 7.053   1.845   -58.396 1.00 37.00 ? 97   LEU B C   1 
ATOM   4932 O O   . LEU B 1 97  ? 7.018   2.445   -59.474 1.00 36.67 ? 97   LEU B O   1 
ATOM   4933 C CB  . LEU B 1 97  ? 9.641   1.684   -58.462 1.00 35.26 ? 97   LEU B CB  1 
ATOM   4934 C CG  . LEU B 1 97  ? 10.861  1.260   -57.611 1.00 35.06 ? 97   LEU B CG  1 
ATOM   4935 C CD1 . LEU B 1 97  ? 12.165  1.939   -58.016 1.00 34.63 ? 97   LEU B CD1 1 
ATOM   4936 C CD2 . LEU B 1 97  ? 10.626  1.466   -56.111 1.00 33.26 ? 97   LEU B CD2 1 
ATOM   4937 N N   . TYR B 1 98  ? 6.016   1.780   -57.568 1.00 38.11 ? 98   TYR B N   1 
ATOM   4938 C CA  . TYR B 1 98  ? 4.721   2.355   -57.893 1.00 39.33 ? 98   TYR B CA  1 
ATOM   4939 C C   . TYR B 1 98  ? 4.170   3.161   -56.730 1.00 39.72 ? 98   TYR B C   1 
ATOM   4940 O O   . TYR B 1 98  ? 4.416   2.832   -55.553 1.00 39.85 ? 98   TYR B O   1 
ATOM   4941 C CB  . TYR B 1 98  ? 3.730   1.241   -58.255 1.00 39.89 ? 98   TYR B CB  1 
ATOM   4942 C CG  . TYR B 1 98  ? 4.192   0.392   -59.418 1.00 41.03 ? 98   TYR B CG  1 
ATOM   4943 C CD1 . TYR B 1 98  ? 3.947   0.795   -60.738 1.00 40.83 ? 98   TYR B CD1 1 
ATOM   4944 C CD2 . TYR B 1 98  ? 4.868   -0.813  -59.209 1.00 40.46 ? 98   TYR B CD2 1 
ATOM   4945 C CE1 . TYR B 1 98  ? 4.361   0.023   -61.806 1.00 40.63 ? 98   TYR B CE1 1 
ATOM   4946 C CE2 . TYR B 1 98  ? 5.290   -1.598  -60.285 1.00 41.44 ? 98   TYR B CE2 1 
ATOM   4947 C CZ  . TYR B 1 98  ? 5.032   -1.167  -61.579 1.00 41.57 ? 98   TYR B CZ  1 
ATOM   4948 O OH  . TYR B 1 98  ? 5.449   -1.918  -62.661 1.00 43.10 ? 98   TYR B OH  1 
ATOM   4949 N N   . LEU B 1 99  ? 3.411   4.204   -57.067 1.00 39.83 ? 99   LEU B N   1 
ATOM   4950 C CA  . LEU B 1 99  ? 2.716   5.014   -56.065 1.00 39.83 ? 99   LEU B CA  1 
ATOM   4951 C C   . LEU B 1 99  ? 1.180   5.022   -56.266 1.00 40.28 ? 99   LEU B C   1 
ATOM   4952 O O   . LEU B 1 99  ? 0.687   4.708   -57.352 1.00 39.92 ? 99   LEU B O   1 
ATOM   4953 C CB  . LEU B 1 99  ? 3.286   6.446   -56.032 1.00 39.26 ? 99   LEU B CB  1 
ATOM   4954 C CG  . LEU B 1 99  ? 3.275   7.301   -57.306 1.00 39.62 ? 99   LEU B CG  1 
ATOM   4955 C CD1 . LEU B 1 99  ? 1.897   7.908   -57.581 1.00 36.79 ? 99   LEU B CD1 1 
ATOM   4956 C CD2 . LEU B 1 99  ? 4.331   8.415   -57.239 1.00 38.36 ? 99   LEU B CD2 1 
ATOM   4957 N N   . ASN B 1 100 ? 0.458   5.412   -55.213 1.00 40.73 ? 100  ASN B N   1 
ATOM   4958 C CA  . ASN B 1 100 ? -1.001  5.504   -55.207 1.00 41.60 ? 100  ASN B CA  1 
ATOM   4959 C C   . ASN B 1 100 ? -1.499  6.900   -54.817 1.00 42.23 ? 100  ASN B C   1 
ATOM   4960 O O   . ASN B 1 100 ? -0.938  7.546   -53.927 1.00 42.41 ? 100  ASN B O   1 
ATOM   4961 C CB  . ASN B 1 100 ? -1.576  4.460   -54.257 1.00 41.38 ? 100  ASN B CB  1 
ATOM   4962 C CG  . ASN B 1 100 ? -0.880  3.130   -54.387 1.00 41.92 ? 100  ASN B CG  1 
ATOM   4963 O OD1 . ASN B 1 100 ? -0.784  2.571   -55.481 1.00 44.43 ? 100  ASN B OD1 1 
ATOM   4964 N ND2 . ASN B 1 100 ? -0.368  2.621   -53.284 1.00 41.13 ? 100  ASN B ND2 1 
ATOM   4965 N N   . VAL B 1 101 ? -2.542  7.359   -55.505 1.00 42.98 ? 101  VAL B N   1 
ATOM   4966 C CA  . VAL B 1 101 ? -3.163  8.662   -55.258 1.00 43.45 ? 101  VAL B CA  1 
ATOM   4967 C C   . VAL B 1 101 ? -4.667  8.486   -54.973 1.00 44.70 ? 101  VAL B C   1 
ATOM   4968 O O   . VAL B 1 101 ? -5.387  7.833   -55.744 1.00 44.90 ? 101  VAL B O   1 
ATOM   4969 C CB  . VAL B 1 101 ? -2.970  9.602   -56.467 1.00 43.10 ? 101  VAL B CB  1 
ATOM   4970 C CG1 . VAL B 1 101 ? -3.647  10.926  -56.234 1.00 43.23 ? 101  VAL B CG1 1 
ATOM   4971 C CG2 . VAL B 1 101 ? -1.488  9.839   -56.754 1.00 42.64 ? 101  VAL B CG2 1 
ATOM   4972 N N   . TRP B 1 102 ? -5.129  9.032   -53.850 1.00 45.79 ? 102  TRP B N   1 
ATOM   4973 C CA  . TRP B 1 102 ? -6.559  9.164   -53.574 1.00 46.78 ? 102  TRP B CA  1 
ATOM   4974 C C   . TRP B 1 102 ? -6.917  10.643  -53.611 1.00 48.44 ? 102  TRP B C   1 
ATOM   4975 O O   . TRP B 1 102 ? -6.178  11.491  -53.085 1.00 48.24 ? 102  TRP B O   1 
ATOM   4976 C CB  . TRP B 1 102 ? -6.902  8.633   -52.195 1.00 46.05 ? 102  TRP B CB  1 
ATOM   4977 C CG  . TRP B 1 102 ? -6.854  7.153   -52.018 1.00 45.97 ? 102  TRP B CG  1 
ATOM   4978 C CD1 . TRP B 1 102 ? -7.903  6.287   -52.110 1.00 45.58 ? 102  TRP B CD1 1 
ATOM   4979 C CD2 . TRP B 1 102 ? -5.711  6.361   -51.654 1.00 44.92 ? 102  TRP B CD2 1 
ATOM   4980 N NE1 . TRP B 1 102 ? -7.483  4.997   -51.841 1.00 46.52 ? 102  TRP B NE1 1 
ATOM   4981 C CE2 . TRP B 1 102 ? -6.143  5.018   -51.559 1.00 45.19 ? 102  TRP B CE2 1 
ATOM   4982 C CE3 . TRP B 1 102 ? -4.365  6.655   -51.411 1.00 44.91 ? 102  TRP B CE3 1 
ATOM   4983 C CZ2 . TRP B 1 102 ? -5.279  3.974   -51.231 1.00 44.60 ? 102  TRP B CZ2 1 
ATOM   4984 C CZ3 . TRP B 1 102 ? -3.502  5.614   -51.087 1.00 44.96 ? 102  TRP B CZ3 1 
ATOM   4985 C CH2 . TRP B 1 102 ? -3.963  4.292   -51.003 1.00 45.34 ? 102  TRP B CH2 1 
ATOM   4986 N N   . THR B 1 103 ? -8.044  10.962  -54.239 1.00 50.40 ? 103  THR B N   1 
ATOM   4987 C CA  . THR B 1 103 ? -8.548  12.340  -54.257 1.00 52.43 ? 103  THR B CA  1 
ATOM   4988 C C   . THR B 1 103 ? -10.020 12.266  -53.929 1.00 53.81 ? 103  THR B C   1 
ATOM   4989 O O   . THR B 1 103 ? -10.588 11.181  -53.980 1.00 54.25 ? 103  THR B O   1 
ATOM   4990 C CB  . THR B 1 103 ? -8.362  13.027  -55.628 1.00 52.21 ? 103  THR B CB  1 
ATOM   4991 O OG1 . THR B 1 103 ? -9.218  12.409  -56.596 1.00 53.38 ? 103  THR B OG1 1 
ATOM   4992 C CG2 . THR B 1 103 ? -6.926  12.917  -56.097 1.00 52.44 ? 103  THR B CG2 1 
ATOM   4993 N N   . PRO B 1 104 ? -10.643 13.399  -53.546 1.00 55.29 ? 104  PRO B N   1 
ATOM   4994 C CA  . PRO B 1 104 ? -12.104 13.381  -53.448 1.00 56.21 ? 104  PRO B CA  1 
ATOM   4995 C C   . PRO B 1 104 ? -12.771 13.243  -54.818 1.00 57.22 ? 104  PRO B C   1 
ATOM   4996 O O   . PRO B 1 104 ? -12.124 13.425  -55.846 1.00 57.12 ? 104  PRO B O   1 
ATOM   4997 C CB  . PRO B 1 104 ? -12.440 14.735  -52.814 1.00 56.25 ? 104  PRO B CB  1 
ATOM   4998 C CG  . PRO B 1 104 ? -11.276 15.592  -53.089 1.00 55.69 ? 104  PRO B CG  1 
ATOM   4999 C CD  . PRO B 1 104 ? -10.078 14.702  -53.151 1.00 55.40 ? 104  PRO B CD  1 
ATOM   5000 N N   . TYR B 1 105 ? -14.057 12.900  -54.809 1.00 58.80 ? 105  TYR B N   1 
ATOM   5001 C CA  . TYR B 1 105 ? -14.850 12.716  -56.017 1.00 59.92 ? 105  TYR B CA  1 
ATOM   5002 C C   . TYR B 1 105 ? -16.105 13.586  -55.916 1.00 60.42 ? 105  TYR B C   1 
ATOM   5003 O O   . TYR B 1 105 ? -16.950 13.359  -55.039 1.00 60.59 ? 105  TYR B O   1 
ATOM   5004 C CB  . TYR B 1 105 ? -15.226 11.238  -56.158 1.00 60.52 ? 105  TYR B CB  1 
ATOM   5005 C CG  . TYR B 1 105 ? -15.989 10.892  -57.410 1.00 61.70 ? 105  TYR B CG  1 
ATOM   5006 C CD1 . TYR B 1 105 ? -15.378 10.201  -58.451 1.00 63.26 ? 105  TYR B CD1 1 
ATOM   5007 C CD2 . TYR B 1 105 ? -17.328 11.247  -57.552 1.00 63.21 ? 105  TYR B CD2 1 
ATOM   5008 C CE1 . TYR B 1 105 ? -16.083 9.878   -59.612 1.00 64.18 ? 105  TYR B CE1 1 
ATOM   5009 C CE2 . TYR B 1 105 ? -18.041 10.938  -58.704 1.00 63.74 ? 105  TYR B CE2 1 
ATOM   5010 C CZ  . TYR B 1 105 ? -17.419 10.253  -59.731 1.00 63.61 ? 105  TYR B CZ  1 
ATOM   5011 O OH  . TYR B 1 105 ? -18.140 9.954   -60.872 1.00 62.94 ? 105  TYR B OH  1 
ATOM   5012 N N   . PRO B 1 106 ? -16.253 14.578  -56.812 1.00 61.07 ? 106  PRO B N   1 
ATOM   5013 C CA  . PRO B 1 106 ? -15.384 14.923  -57.939 1.00 61.56 ? 106  PRO B CA  1 
ATOM   5014 C C   . PRO B 1 106 ? -14.063 15.521  -57.459 1.00 61.91 ? 106  PRO B C   1 
ATOM   5015 O O   . PRO B 1 106 ? -13.974 15.965  -56.312 1.00 61.82 ? 106  PRO B O   1 
ATOM   5016 C CB  . PRO B 1 106 ? -16.203 15.982  -58.694 1.00 61.80 ? 106  PRO B CB  1 
ATOM   5017 C CG  . PRO B 1 106 ? -17.043 16.632  -57.627 1.00 61.41 ? 106  PRO B CG  1 
ATOM   5018 C CD  . PRO B 1 106 ? -17.407 15.500  -56.707 1.00 61.19 ? 106  PRO B CD  1 
ATOM   5019 N N   . ARG B 1 107 ? -13.051 15.534  -58.324 1.00 62.39 ? 107  ARG B N   1 
ATOM   5020 C CA  . ARG B 1 107 ? -11.725 15.988  -57.910 1.00 63.21 ? 107  ARG B CA  1 
ATOM   5021 C C   . ARG B 1 107 ? -11.731 17.471  -57.550 1.00 63.05 ? 107  ARG B C   1 
ATOM   5022 O O   . ARG B 1 107 ? -12.445 18.257  -58.172 1.00 63.17 ? 107  ARG B O   1 
ATOM   5023 C CB  . ARG B 1 107 ? -10.638 15.640  -58.940 1.00 63.58 ? 107  ARG B CB  1 
ATOM   5024 C CG  . ARG B 1 107 ? -10.723 16.351  -60.261 1.00 65.23 ? 107  ARG B CG  1 
ATOM   5025 C CD  . ARG B 1 107 ? -10.458 15.332  -61.357 1.00 69.65 ? 107  ARG B CD  1 
ATOM   5026 N NE  . ARG B 1 107 ? -9.214  15.542  -62.100 1.00 70.61 ? 107  ARG B NE  1 
ATOM   5027 C CZ  . ARG B 1 107 ? -8.849  14.804  -63.149 1.00 71.44 ? 107  ARG B CZ  1 
ATOM   5028 N NH1 . ARG B 1 107 ? -9.616  13.793  -63.561 1.00 70.79 ? 107  ARG B NH1 1 
ATOM   5029 N NH2 . ARG B 1 107 ? -7.712  15.064  -63.785 1.00 72.01 ? 107  ARG B NH2 1 
ATOM   5030 N N   . PRO B 1 108 ? -10.920 17.855  -56.553 1.00 62.86 ? 108  PRO B N   1 
ATOM   5031 C CA  . PRO B 1 108 ? -11.050 19.171  -55.939 1.00 62.73 ? 108  PRO B CA  1 
ATOM   5032 C C   . PRO B 1 108 ? -11.158 20.285  -56.977 1.00 62.50 ? 108  PRO B C   1 
ATOM   5033 O O   . PRO B 1 108 ? -10.436 20.282  -57.982 1.00 62.04 ? 108  PRO B O   1 
ATOM   5034 C CB  . PRO B 1 108 ? -9.752  19.323  -55.151 1.00 62.88 ? 108  PRO B CB  1 
ATOM   5035 C CG  . PRO B 1 108 ? -9.297  17.920  -54.873 1.00 63.11 ? 108  PRO B CG  1 
ATOM   5036 C CD  . PRO B 1 108 ? -9.799  17.075  -55.991 1.00 62.96 ? 108  PRO B CD  1 
ATOM   5037 N N   . ALA B 1 109 ? -12.074 21.218  -56.723 1.00 62.40 ? 109  ALA B N   1 
ATOM   5038 C CA  . ALA B 1 109 ? -12.256 22.391  -57.578 1.00 61.77 ? 109  ALA B CA  1 
ATOM   5039 C C   . ALA B 1 109 ? -11.018 23.311  -57.572 1.00 61.03 ? 109  ALA B C   1 
ATOM   5040 O O   . ALA B 1 109 ? -10.703 23.938  -58.586 1.00 61.22 ? 109  ALA B O   1 
ATOM   5041 C CB  . ALA B 1 109 ? -13.513 23.157  -57.160 1.00 62.22 ? 109  ALA B CB  1 
ATOM   5042 N N   . SER B 1 110 ? -10.320 23.376  -56.436 1.00 59.77 ? 110  SER B N   1 
ATOM   5043 C CA  . SER B 1 110 ? -9.108  24.206  -56.297 1.00 58.59 ? 110  SER B CA  1 
ATOM   5044 C C   . SER B 1 110 ? -7.952  23.408  -55.672 1.00 57.26 ? 110  SER B C   1 
ATOM   5045 O O   . SER B 1 110 ? -8.202  22.412  -54.995 1.00 57.28 ? 110  SER B O   1 
ATOM   5046 C CB  . SER B 1 110 ? -9.416  25.426  -55.427 1.00 58.76 ? 110  SER B CB  1 
ATOM   5047 O OG  . SER B 1 110 ? -10.043 25.019  -54.220 1.00 58.34 ? 110  SER B OG  1 
ATOM   5048 N N   . PRO B 1 111 ? -6.691  23.841  -55.894 1.00 55.85 ? 111  PRO B N   1 
ATOM   5049 C CA  . PRO B 1 111 ? -5.504  23.221  -55.272 1.00 54.76 ? 111  PRO B CA  1 
ATOM   5050 C C   . PRO B 1 111 ? -5.723  22.757  -53.827 1.00 53.23 ? 111  PRO B C   1 
ATOM   5051 O O   . PRO B 1 111 ? -6.180  23.526  -52.981 1.00 53.29 ? 111  PRO B O   1 
ATOM   5052 C CB  . PRO B 1 111 ? -4.477  24.353  -55.308 1.00 55.02 ? 111  PRO B CB  1 
ATOM   5053 C CG  . PRO B 1 111 ? -4.804  25.088  -56.586 1.00 55.52 ? 111  PRO B CG  1 
ATOM   5054 C CD  . PRO B 1 111 ? -6.308  24.955  -56.784 1.00 55.95 ? 111  PRO B CD  1 
ATOM   5055 N N   . THR B 1 112 ? -5.408  21.498  -53.558 1.00 51.48 ? 112  THR B N   1 
ATOM   5056 C CA  . THR B 1 112 ? -5.690  20.902  -52.259 1.00 49.76 ? 112  THR B CA  1 
ATOM   5057 C C   . THR B 1 112 ? -4.412  20.395  -51.635 1.00 48.58 ? 112  THR B C   1 
ATOM   5058 O O   . THR B 1 112 ? -3.629  19.733  -52.311 1.00 48.83 ? 112  THR B O   1 
ATOM   5059 C CB  . THR B 1 112 ? -6.682  19.748  -52.399 1.00 49.64 ? 112  THR B CB  1 
ATOM   5060 O OG1 . THR B 1 112 ? -7.840  20.226  -53.081 1.00 51.11 ? 112  THR B OG1 1 
ATOM   5061 C CG2 . THR B 1 112 ? -7.110  19.230  -51.045 1.00 49.70 ? 112  THR B CG2 1 
ATOM   5062 N N   . PRO B 1 113 ? -4.176  20.724  -50.349 1.00 47.37 ? 113  PRO B N   1 
ATOM   5063 C CA  . PRO B 1 113 ? -2.989  20.214  -49.662 1.00 46.09 ? 113  PRO B CA  1 
ATOM   5064 C C   . PRO B 1 113 ? -2.797  18.728  -49.876 1.00 44.54 ? 113  PRO B C   1 
ATOM   5065 O O   . PRO B 1 113 ? -3.766  17.979  -49.884 1.00 44.79 ? 113  PRO B O   1 
ATOM   5066 C CB  . PRO B 1 113 ? -3.281  20.523  -48.194 1.00 46.22 ? 113  PRO B CB  1 
ATOM   5067 C CG  . PRO B 1 113 ? -4.073  21.793  -48.281 1.00 47.32 ? 113  PRO B CG  1 
ATOM   5068 C CD  . PRO B 1 113 ? -4.960  21.627  -49.482 1.00 47.17 ? 113  PRO B CD  1 
ATOM   5069 N N   . VAL B 1 114 ? -1.546  18.331  -50.074 1.00 42.88 ? 114  VAL B N   1 
ATOM   5070 C CA  . VAL B 1 114 ? -1.176  16.960  -50.367 1.00 41.45 ? 114  VAL B CA  1 
ATOM   5071 C C   . VAL B 1 114 ? -0.528  16.331  -49.137 1.00 41.18 ? 114  VAL B C   1 
ATOM   5072 O O   . VAL B 1 114 ? 0.350   16.927  -48.522 1.00 40.72 ? 114  VAL B O   1 
ATOM   5073 C CB  . VAL B 1 114 ? -0.183  16.905  -51.554 1.00 41.43 ? 114  VAL B CB  1 
ATOM   5074 C CG1 . VAL B 1 114 ? 0.218   15.471  -51.880 1.00 40.99 ? 114  VAL B CG1 1 
ATOM   5075 C CG2 . VAL B 1 114 ? -0.769  17.598  -52.789 1.00 40.81 ? 114  VAL B CG2 1 
ATOM   5076 N N   . LEU B 1 115 ? -0.983  15.137  -48.764 1.00 40.72 ? 115  LEU B N   1 
ATOM   5077 C CA  . LEU B 1 115 ? -0.285  14.337  -47.770 1.00 40.10 ? 115  LEU B CA  1 
ATOM   5078 C C   . LEU B 1 115 ? 0.425   13.148  -48.448 1.00 39.81 ? 115  LEU B C   1 
ATOM   5079 O O   . LEU B 1 115 ? -0.194  12.399  -49.232 1.00 40.08 ? 115  LEU B O   1 
ATOM   5080 C CB  . LEU B 1 115 ? -1.245  13.824  -46.703 1.00 40.05 ? 115  LEU B CB  1 
ATOM   5081 C CG  . LEU B 1 115 ? -1.859  14.620  -45.546 1.00 40.35 ? 115  LEU B CG  1 
ATOM   5082 C CD1 . LEU B 1 115 ? -2.844  13.704  -44.856 1.00 42.24 ? 115  LEU B CD1 1 
ATOM   5083 C CD2 . LEU B 1 115 ? -0.844  15.010  -44.537 1.00 42.18 ? 115  LEU B CD2 1 
ATOM   5084 N N   . ILE B 1 116 ? 1.710   12.971  -48.144 1.00 38.22 ? 116  ILE B N   1 
ATOM   5085 C CA  . ILE B 1 116 ? 2.472   11.870  -48.703 1.00 37.00 ? 116  ILE B CA  1 
ATOM   5086 C C   . ILE B 1 116 ? 2.896   10.920  -47.589 1.00 36.75 ? 116  ILE B C   1 
ATOM   5087 O O   . ILE B 1 116 ? 3.674   11.304  -46.694 1.00 37.42 ? 116  ILE B O   1 
ATOM   5088 C CB  . ILE B 1 116 ? 3.708   12.364  -49.463 1.00 37.24 ? 116  ILE B CB  1 
ATOM   5089 C CG1 . ILE B 1 116 ? 3.295   13.377  -50.539 1.00 36.74 ? 116  ILE B CG1 1 
ATOM   5090 C CG2 . ILE B 1 116 ? 4.475   11.183  -50.067 1.00 37.13 ? 116  ILE B CG2 1 
ATOM   5091 C CD1 . ILE B 1 116 ? 4.412   13.810  -51.453 1.00 38.12 ? 116  ILE B CD1 1 
ATOM   5092 N N   . TRP B 1 117 ? 2.377   9.693   -47.642 1.00 34.71 ? 117  TRP B N   1 
ATOM   5093 C CA  . TRP B 1 117 ? 2.659   8.671   -46.648 1.00 33.85 ? 117  TRP B CA  1 
ATOM   5094 C C   . TRP B 1 117 ? 3.872   7.797   -47.027 1.00 33.75 ? 117  TRP B C   1 
ATOM   5095 O O   . TRP B 1 117 ? 4.006   7.346   -48.182 1.00 33.06 ? 117  TRP B O   1 
ATOM   5096 C CB  . TRP B 1 117 ? 1.420   7.777   -46.440 1.00 33.20 ? 117  TRP B CB  1 
ATOM   5097 C CG  . TRP B 1 117 ? 1.693   6.583   -45.592 1.00 32.56 ? 117  TRP B CG  1 
ATOM   5098 C CD1 . TRP B 1 117 ? 1.904   5.294   -46.014 1.00 32.86 ? 117  TRP B CD1 1 
ATOM   5099 C CD2 . TRP B 1 117 ? 1.828   6.562   -44.165 1.00 32.70 ? 117  TRP B CD2 1 
ATOM   5100 N NE1 . TRP B 1 117 ? 2.143   4.473   -44.925 1.00 31.38 ? 117  TRP B NE1 1 
ATOM   5101 C CE2 . TRP B 1 117 ? 2.104   5.229   -43.786 1.00 30.46 ? 117  TRP B CE2 1 
ATOM   5102 C CE3 . TRP B 1 117 ? 1.734   7.547   -43.164 1.00 34.14 ? 117  TRP B CE3 1 
ATOM   5103 C CZ2 . TRP B 1 117 ? 2.286   4.857   -42.457 1.00 31.96 ? 117  TRP B CZ2 1 
ATOM   5104 C CZ3 . TRP B 1 117 ? 1.910   7.170   -41.838 1.00 32.21 ? 117  TRP B CZ3 1 
ATOM   5105 C CH2 . TRP B 1 117 ? 2.184   5.837   -41.501 1.00 33.16 ? 117  TRP B CH2 1 
ATOM   5106 N N   . ILE B 1 118 ? 4.728   7.549   -46.038 1.00 33.52 ? 118  ILE B N   1 
ATOM   5107 C CA  . ILE B 1 118 ? 5.926   6.705   -46.206 1.00 33.97 ? 118  ILE B CA  1 
ATOM   5108 C C   . ILE B 1 118 ? 5.858   5.588   -45.143 1.00 34.62 ? 118  ILE B C   1 
ATOM   5109 O O   . ILE B 1 118 ? 6.080   5.842   -43.961 1.00 35.46 ? 118  ILE B O   1 
ATOM   5110 C CB  . ILE B 1 118 ? 7.254   7.521   -46.057 1.00 33.69 ? 118  ILE B CB  1 
ATOM   5111 C CG1 . ILE B 1 118 ? 7.194   8.860   -46.809 1.00 32.91 ? 118  ILE B CG1 1 
ATOM   5112 C CG2 . ILE B 1 118 ? 8.441   6.724   -46.539 1.00 33.14 ? 118  ILE B CG2 1 
ATOM   5113 C CD1 . ILE B 1 118 ? 8.587   9.575   -46.979 1.00 32.43 ? 118  ILE B CD1 1 
ATOM   5114 N N   . TYR B 1 119 ? 5.516   4.370   -45.546 1.00 34.37 ? 119  TYR B N   1 
ATOM   5115 C CA  . TYR B 1 119 ? 5.359   3.271   -44.587 1.00 34.66 ? 119  TYR B CA  1 
ATOM   5116 C C   . TYR B 1 119 ? 6.607   2.931   -43.768 1.00 35.22 ? 119  TYR B C   1 
ATOM   5117 O O   . TYR B 1 119 ? 7.738   3.220   -44.173 1.00 34.97 ? 119  TYR B O   1 
ATOM   5118 C CB  . TYR B 1 119 ? 4.877   1.989   -45.293 1.00 34.39 ? 119  TYR B CB  1 
ATOM   5119 C CG  . TYR B 1 119 ? 5.750   1.507   -46.440 1.00 33.01 ? 119  TYR B CG  1 
ATOM   5120 C CD1 . TYR B 1 119 ? 6.971   0.857   -46.195 1.00 32.90 ? 119  TYR B CD1 1 
ATOM   5121 C CD2 . TYR B 1 119 ? 5.347   1.677   -47.767 1.00 30.34 ? 119  TYR B CD2 1 
ATOM   5122 C CE1 . TYR B 1 119 ? 7.776   0.398   -47.251 1.00 31.72 ? 119  TYR B CE1 1 
ATOM   5123 C CE2 . TYR B 1 119 ? 6.138   1.227   -48.826 1.00 32.14 ? 119  TYR B CE2 1 
ATOM   5124 C CZ  . TYR B 1 119 ? 7.355   0.575   -48.564 1.00 33.54 ? 119  TYR B CZ  1 
ATOM   5125 O OH  . TYR B 1 119 ? 8.153   0.121   -49.617 1.00 33.55 ? 119  TYR B OH  1 
ATOM   5126 N N   . GLY B 1 120 ? 6.369   2.280   -42.631 1.00 35.98 ? 120  GLY B N   1 
ATOM   5127 C CA  . GLY B 1 120 ? 7.424   1.668   -41.814 1.00 36.94 ? 120  GLY B CA  1 
ATOM   5128 C C   . GLY B 1 120 ? 7.684   0.219   -42.176 1.00 37.75 ? 120  GLY B C   1 
ATOM   5129 O O   . GLY B 1 120 ? 7.273   -0.247  -43.248 1.00 37.85 ? 120  GLY B O   1 
ATOM   5130 N N   . GLY B 1 121 ? 8.374   -0.492  -41.286 1.00 38.84 ? 121  GLY B N   1 
ATOM   5131 C CA  . GLY B 1 121 ? 8.815   -1.872  -41.551 1.00 39.94 ? 121  GLY B CA  1 
ATOM   5132 C C   . GLY B 1 121 ? 10.322  -2.078  -41.379 1.00 40.79 ? 121  GLY B C   1 
ATOM   5133 O O   . GLY B 1 121 ? 10.903  -3.037  -41.930 1.00 41.89 ? 121  GLY B O   1 
ATOM   5134 N N   . GLY B 1 122 ? 10.955  -1.170  -40.634 1.00 40.48 ? 122  GLY B N   1 
ATOM   5135 C CA  . GLY B 1 122 ? 12.374  -1.248  -40.288 1.00 39.61 ? 122  GLY B CA  1 
ATOM   5136 C C   . GLY B 1 122 ? 13.346  -1.190  -41.445 1.00 39.19 ? 122  GLY B C   1 
ATOM   5137 O O   . GLY B 1 122 ? 14.448  -1.704  -41.348 1.00 39.40 ? 122  GLY B O   1 
ATOM   5138 N N   . PHE B 1 123 ? 12.954  -0.553  -42.540 1.00 38.88 ? 123  PHE B N   1 
ATOM   5139 C CA  . PHE B 1 123 ? 13.770  -0.554  -43.762 1.00 38.49 ? 123  PHE B CA  1 
ATOM   5140 C C   . PHE B 1 123 ? 13.952  -1.952  -44.369 1.00 38.35 ? 123  PHE B C   1 
ATOM   5141 O O   . PHE B 1 123 ? 14.699  -2.104  -45.342 1.00 38.50 ? 123  PHE B O   1 
ATOM   5142 C CB  . PHE B 1 123 ? 15.124  0.152   -43.546 1.00 38.12 ? 123  PHE B CB  1 
ATOM   5143 C CG  . PHE B 1 123 ? 14.999  1.635   -43.252 1.00 38.08 ? 123  PHE B CG  1 
ATOM   5144 C CD1 . PHE B 1 123 ? 14.599  2.536   -44.256 1.00 36.15 ? 123  PHE B CD1 1 
ATOM   5145 C CD2 . PHE B 1 123 ? 15.272  2.131   -41.974 1.00 36.51 ? 123  PHE B CD2 1 
ATOM   5146 C CE1 . PHE B 1 123 ? 14.461  3.899   -43.990 1.00 35.43 ? 123  PHE B CE1 1 
ATOM   5147 C CE2 . PHE B 1 123 ? 15.143  3.491   -41.695 1.00 36.00 ? 123  PHE B CE2 1 
ATOM   5148 C CZ  . PHE B 1 123 ? 14.741  4.381   -42.710 1.00 36.49 ? 123  PHE B CZ  1 
ATOM   5149 N N   . TYR B 1 124 ? 13.254  -2.956  -43.822 1.00 37.96 ? 124  TYR B N   1 
ATOM   5150 C CA  . TYR B 1 124 ? 13.321  -4.340  -44.351 1.00 38.32 ? 124  TYR B CA  1 
ATOM   5151 C C   . TYR B 1 124 ? 11.963  -4.880  -44.867 1.00 38.65 ? 124  TYR B C   1 
ATOM   5152 O O   . TYR B 1 124 ? 11.910  -5.913  -45.550 1.00 39.03 ? 124  TYR B O   1 
ATOM   5153 C CB  . TYR B 1 124 ? 13.914  -5.329  -43.319 1.00 37.26 ? 124  TYR B CB  1 
ATOM   5154 C CG  . TYR B 1 124 ? 12.947  -5.714  -42.210 1.00 36.41 ? 124  TYR B CG  1 
ATOM   5155 C CD1 . TYR B 1 124 ? 11.984  -6.710  -42.405 1.00 34.91 ? 124  TYR B CD1 1 
ATOM   5156 C CD2 . TYR B 1 124 ? 12.996  -5.080  -40.968 1.00 35.50 ? 124  TYR B CD2 1 
ATOM   5157 C CE1 . TYR B 1 124 ? 11.090  -7.059  -41.399 1.00 33.14 ? 124  TYR B CE1 1 
ATOM   5158 C CE2 . TYR B 1 124 ? 12.097  -5.416  -39.948 1.00 35.37 ? 124  TYR B CE2 1 
ATOM   5159 C CZ  . TYR B 1 124 ? 11.149  -6.414  -40.180 1.00 35.01 ? 124  TYR B CZ  1 
ATOM   5160 O OH  . TYR B 1 124 ? 10.272  -6.754  -39.184 1.00 34.08 ? 124  TYR B OH  1 
ATOM   5161 N N   . SER B 1 125 ? 10.876  -4.204  -44.512 1.00 38.35 ? 125  SER B N   1 
ATOM   5162 C CA  . SER B 1 125 ? 9.552   -4.599  -44.964 1.00 37.80 ? 125  SER B CA  1 
ATOM   5163 C C   . SER B 1 125 ? 8.652   -3.393  -45.150 1.00 37.93 ? 125  SER B C   1 
ATOM   5164 O O   . SER B 1 125 ? 9.062   -2.254  -44.956 1.00 37.93 ? 125  SER B O   1 
ATOM   5165 C CB  . SER B 1 125 ? 8.905   -5.573  -43.975 1.00 37.85 ? 125  SER B CB  1 
ATOM   5166 O OG  . SER B 1 125 ? 8.976   -5.090  -42.634 1.00 37.66 ? 125  SER B OG  1 
ATOM   5167 N N   . GLY B 1 126 ? 7.404   -3.670  -45.505 1.00 37.99 ? 126  GLY B N   1 
ATOM   5168 C CA  . GLY B 1 126 ? 6.397   -2.662  -45.666 1.00 37.30 ? 126  GLY B CA  1 
ATOM   5169 C C   . GLY B 1 126 ? 5.897   -2.680  -47.079 1.00 37.73 ? 126  GLY B C   1 
ATOM   5170 O O   . GLY B 1 126 ? 6.502   -3.321  -47.962 1.00 37.80 ? 126  GLY B O   1 
ATOM   5171 N N   . ALA B 1 127 ? 4.786   -1.976  -47.283 1.00 37.50 ? 127  ALA B N   1 
ATOM   5172 C CA  . ALA B 1 127 ? 4.169   -1.801  -48.597 1.00 38.01 ? 127  ALA B CA  1 
ATOM   5173 C C   . ALA B 1 127 ? 3.062   -0.757  -48.477 1.00 37.70 ? 127  ALA B C   1 
ATOM   5174 O O   . ALA B 1 127 ? 2.409   -0.671  -47.457 1.00 37.29 ? 127  ALA B O   1 
ATOM   5175 C CB  . ALA B 1 127 ? 3.606   -3.117  -49.112 1.00 37.05 ? 127  ALA B CB  1 
ATOM   5176 N N   . ALA B 1 128 ? 2.868   0.036   -49.516 1.00 38.05 ? 128  ALA B N   1 
ATOM   5177 C CA  . ALA B 1 128 ? 1.918   1.147   -49.440 1.00 39.16 ? 128  ALA B CA  1 
ATOM   5178 C C   . ALA B 1 128 ? 0.466   0.668   -49.605 1.00 39.68 ? 128  ALA B C   1 
ATOM   5179 O O   . ALA B 1 128 ? -0.442  1.476   -49.630 1.00 40.37 ? 128  ALA B O   1 
ATOM   5180 C CB  . ALA B 1 128 ? 2.264   2.228   -50.471 1.00 37.89 ? 128  ALA B CB  1 
ATOM   5181 N N   . SER B 1 129 ? 0.266   -0.650  -49.665 1.00 40.32 ? 129  SER B N   1 
ATOM   5182 C CA  . SER B 1 129 ? -1.025  -1.246  -50.016 1.00 40.28 ? 129  SER B CA  1 
ATOM   5183 C C   . SER B 1 129 ? -1.758  -1.883  -48.845 1.00 40.46 ? 129  SER B C   1 
ATOM   5184 O O   . SER B 1 129 ? -2.898  -2.330  -49.004 1.00 40.17 ? 129  SER B O   1 
ATOM   5185 C CB  . SER B 1 129 ? -0.828  -2.292  -51.117 1.00 40.34 ? 129  SER B CB  1 
ATOM   5186 O OG  . SER B 1 129 ? 0.189   -3.205  -50.750 1.00 40.48 ? 129  SER B OG  1 
ATOM   5187 N N   . LEU B 1 130 ? -1.122  -1.922  -47.676 1.00 40.59 ? 130  LEU B N   1 
ATOM   5188 C CA  . LEU B 1 130 ? -1.736  -2.537  -46.509 1.00 41.44 ? 130  LEU B CA  1 
ATOM   5189 C C   . LEU B 1 130 ? -3.016  -1.791  -46.182 1.00 42.18 ? 130  LEU B C   1 
ATOM   5190 O O   . LEU B 1 130 ? -3.115  -0.583  -46.465 1.00 42.43 ? 130  LEU B O   1 
ATOM   5191 C CB  . LEU B 1 130 ? -0.777  -2.513  -45.316 1.00 41.47 ? 130  LEU B CB  1 
ATOM   5192 C CG  . LEU B 1 130 ? 0.656   -3.041  -45.538 1.00 41.80 ? 130  LEU B CG  1 
ATOM   5193 C CD1 . LEU B 1 130 ? 1.497   -2.913  -44.276 1.00 39.24 ? 130  LEU B CD1 1 
ATOM   5194 C CD2 . LEU B 1 130 ? 0.646   -4.486  -46.020 1.00 41.15 ? 130  LEU B CD2 1 
ATOM   5195 N N   . ASP B 1 131 ? -3.993  -2.487  -45.595 1.00 42.92 ? 131  ASP B N   1 
ATOM   5196 C CA  . ASP B 1 131 ? -5.287  -1.858  -45.259 1.00 43.55 ? 131  ASP B CA  1 
ATOM   5197 C C   . ASP B 1 131 ? -5.162  -0.637  -44.346 1.00 43.32 ? 131  ASP B C   1 
ATOM   5198 O O   . ASP B 1 131 ? -5.919  0.325   -44.502 1.00 43.27 ? 131  ASP B O   1 
ATOM   5199 C CB  . ASP B 1 131 ? -6.244  -2.852  -44.600 1.00 44.53 ? 131  ASP B CB  1 
ATOM   5200 C CG  . ASP B 1 131 ? -6.670  -3.974  -45.531 1.00 47.29 ? 131  ASP B CG  1 
ATOM   5201 O OD1 . ASP B 1 131 ? -6.369  -3.919  -46.748 1.00 49.33 ? 131  ASP B OD1 1 
ATOM   5202 O OD2 . ASP B 1 131 ? -7.312  -4.922  -45.023 1.00 50.55 ? 131  ASP B OD2 1 
ATOM   5203 N N   . VAL B 1 132 ? -4.212  -0.667  -43.400 1.00 42.64 ? 132  VAL B N   1 
ATOM   5204 C CA  . VAL B 1 132 ? -4.040  0.462   -42.456 1.00 41.67 ? 132  VAL B CA  1 
ATOM   5205 C C   . VAL B 1 132 ? -3.558  1.779   -43.093 1.00 40.76 ? 132  VAL B C   1 
ATOM   5206 O O   . VAL B 1 132 ? -3.604  2.828   -42.444 1.00 40.55 ? 132  VAL B O   1 
ATOM   5207 C CB  . VAL B 1 132 ? -3.181  0.095   -41.231 1.00 41.44 ? 132  VAL B CB  1 
ATOM   5208 C CG1 . VAL B 1 132 ? -3.880  -0.959  -40.428 1.00 41.86 ? 132  VAL B CG1 1 
ATOM   5209 C CG2 . VAL B 1 132 ? -1.787  -0.379  -41.645 1.00 41.56 ? 132  VAL B CG2 1 
ATOM   5210 N N   . TYR B 1 133 ? -3.103  1.717   -44.348 1.00 39.62 ? 133  TYR B N   1 
ATOM   5211 C CA  . TYR B 1 133 ? -2.689  2.920   -45.084 1.00 38.54 ? 133  TYR B CA  1 
ATOM   5212 C C   . TYR B 1 133 ? -3.703  3.362   -46.107 1.00 39.20 ? 133  TYR B C   1 
ATOM   5213 O O   . TYR B 1 133 ? -3.402  4.183   -46.949 1.00 38.82 ? 133  TYR B O   1 
ATOM   5214 C CB  . TYR B 1 133 ? -1.330  2.728   -45.771 1.00 37.06 ? 133  TYR B CB  1 
ATOM   5215 C CG  . TYR B 1 133 ? -0.281  2.143   -44.875 1.00 34.39 ? 133  TYR B CG  1 
ATOM   5216 C CD1 . TYR B 1 133 ? -0.250  2.455   -43.525 1.00 30.95 ? 133  TYR B CD1 1 
ATOM   5217 C CD2 . TYR B 1 133 ? 0.686   1.268   -45.381 1.00 33.60 ? 133  TYR B CD2 1 
ATOM   5218 C CE1 . TYR B 1 133 ? 0.702   1.914   -42.699 1.00 33.25 ? 133  TYR B CE1 1 
ATOM   5219 C CE2 . TYR B 1 133 ? 1.663   0.727   -44.562 1.00 32.70 ? 133  TYR B CE2 1 
ATOM   5220 C CZ  . TYR B 1 133 ? 1.659   1.057   -43.213 1.00 33.35 ? 133  TYR B CZ  1 
ATOM   5221 O OH  . TYR B 1 133 ? 2.581   0.524   -42.371 1.00 33.41 ? 133  TYR B OH  1 
ATOM   5222 N N   . ASP B 1 134 ? -4.909  2.808   -46.027 1.00 41.07 ? 134  ASP B N   1 
ATOM   5223 C CA  . ASP B 1 134 ? -5.992  3.149   -46.941 1.00 42.17 ? 134  ASP B CA  1 
ATOM   5224 C C   . ASP B 1 134 ? -6.289  4.638   -46.852 1.00 42.32 ? 134  ASP B C   1 
ATOM   5225 O O   . ASP B 1 134 ? -6.655  5.129   -45.796 1.00 42.06 ? 134  ASP B O   1 
ATOM   5226 C CB  . ASP B 1 134 ? -7.235  2.357   -46.555 1.00 43.11 ? 134  ASP B CB  1 
ATOM   5227 C CG  . ASP B 1 134 ? -8.247  2.272   -47.679 1.00 45.13 ? 134  ASP B CG  1 
ATOM   5228 O OD1 . ASP B 1 134 ? -8.178  3.102   -48.611 1.00 46.35 ? 134  ASP B OD1 1 
ATOM   5229 O OD2 . ASP B 1 134 ? -9.107  1.364   -47.624 1.00 47.94 ? 134  ASP B OD2 1 
ATOM   5230 N N   . GLY B 1 135 ? -6.119  5.347   -47.961 1.00 43.07 ? 135  GLY B N   1 
ATOM   5231 C CA  . GLY B 1 135 ? -6.275  6.799   -47.995 1.00 43.80 ? 135  GLY B CA  1 
ATOM   5232 C C   . GLY B 1 135 ? -7.651  7.308   -48.401 1.00 44.50 ? 135  GLY B C   1 
ATOM   5233 O O   . GLY B 1 135 ? -7.817  8.504   -48.663 1.00 44.04 ? 135  GLY B O   1 
ATOM   5234 N N   . ARG B 1 136 ? -8.645  6.421   -48.454 1.00 44.99 ? 136  ARG B N   1 
ATOM   5235 C CA  . ARG B 1 136 ? -9.989  6.842   -48.895 1.00 45.96 ? 136  ARG B CA  1 
ATOM   5236 C C   . ARG B 1 136 ? -10.705 7.730   -47.855 1.00 45.57 ? 136  ARG B C   1 
ATOM   5237 O O   . ARG B 1 136 ? -11.375 8.705   -48.213 1.00 45.04 ? 136  ARG B O   1 
ATOM   5238 C CB  . ARG B 1 136 ? -10.839 5.639   -49.352 1.00 46.14 ? 136  ARG B CB  1 
ATOM   5239 C CG  . ARG B 1 136 ? -11.685 4.980   -48.294 1.00 48.61 ? 136  ARG B CG  1 
ATOM   5240 C CD  . ARG B 1 136 ? -11.487 3.481   -48.303 1.00 53.49 ? 136  ARG B CD  1 
ATOM   5241 N NE  . ARG B 1 136 ? -12.354 2.799   -49.257 1.00 57.26 ? 136  ARG B NE  1 
ATOM   5242 C CZ  . ARG B 1 136 ? -12.029 1.676   -49.904 1.00 58.55 ? 136  ARG B CZ  1 
ATOM   5243 N NH1 . ARG B 1 136 ? -10.838 1.105   -49.730 1.00 57.91 ? 136  ARG B NH1 1 
ATOM   5244 N NH2 . ARG B 1 136 ? -12.896 1.133   -50.749 1.00 58.75 ? 136  ARG B NH2 1 
ATOM   5245 N N   . PHE B 1 137 ? -10.528 7.402   -46.579 1.00 45.60 ? 137  PHE B N   1 
ATOM   5246 C CA  . PHE B 1 137 ? -11.142 8.159   -45.499 1.00 46.12 ? 137  PHE B CA  1 
ATOM   5247 C C   . PHE B 1 137 ? -10.660 9.609   -45.481 1.00 46.61 ? 137  PHE B C   1 
ATOM   5248 O O   . PHE B 1 137 ? -11.481 10.534  -45.578 1.00 46.81 ? 137  PHE B O   1 
ATOM   5249 C CB  . PHE B 1 137 ? -10.911 7.465   -44.159 1.00 45.90 ? 137  PHE B CB  1 
ATOM   5250 C CG  . PHE B 1 137 ? -11.322 6.029   -44.162 1.00 46.76 ? 137  PHE B CG  1 
ATOM   5251 C CD1 . PHE B 1 137 ? -12.677 5.677   -44.144 1.00 46.90 ? 137  PHE B CD1 1 
ATOM   5252 C CD2 . PHE B 1 137 ? -10.361 5.017   -44.216 1.00 47.61 ? 137  PHE B CD2 1 
ATOM   5253 C CE1 . PHE B 1 137 ? -13.079 4.343   -44.164 1.00 47.17 ? 137  PHE B CE1 1 
ATOM   5254 C CE2 . PHE B 1 137 ? -10.742 3.662   -44.238 1.00 48.32 ? 137  PHE B CE2 1 
ATOM   5255 C CZ  . PHE B 1 137 ? -12.107 3.320   -44.210 1.00 48.10 ? 137  PHE B CZ  1 
ATOM   5256 N N   . LEU B 1 138 ? -9.341  9.809   -45.387 1.00 46.70 ? 138  LEU B N   1 
ATOM   5257 C CA  . LEU B 1 138 ? -8.765  11.157  -45.428 1.00 46.62 ? 138  LEU B CA  1 
ATOM   5258 C C   . LEU B 1 138 ? -9.214  11.903  -46.678 1.00 47.02 ? 138  LEU B C   1 
ATOM   5259 O O   . LEU B 1 138 ? -9.514  13.095  -46.623 1.00 47.90 ? 138  LEU B O   1 
ATOM   5260 C CB  . LEU B 1 138 ? -7.226  11.136  -45.324 1.00 46.25 ? 138  LEU B CB  1 
ATOM   5261 C CG  . LEU B 1 138 ? -6.620  10.784  -43.960 1.00 44.52 ? 138  LEU B CG  1 
ATOM   5262 C CD1 . LEU B 1 138 ? -5.144  10.545  -44.078 1.00 43.50 ? 138  LEU B CD1 1 
ATOM   5263 C CD2 . LEU B 1 138 ? -6.876  11.859  -42.938 1.00 43.79 ? 138  LEU B CD2 1 
ATOM   5264 N N   . ALA B 1 139 ? -9.279  11.204  -47.801 1.00 47.16 ? 139  ALA B N   1 
ATOM   5265 C CA  . ALA B 1 139 ? -9.708  11.835  -49.039 1.00 47.34 ? 139  ALA B CA  1 
ATOM   5266 C C   . ALA B 1 139 ? -11.173 12.260  -48.970 1.00 47.75 ? 139  ALA B C   1 
ATOM   5267 O O   . ALA B 1 139 ? -11.523 13.346  -49.430 1.00 48.28 ? 139  ALA B O   1 
ATOM   5268 C CB  . ALA B 1 139 ? -9.470  10.920  -50.222 1.00 46.92 ? 139  ALA B CB  1 
ATOM   5269 N N   . GLN B 1 140 ? -12.016 11.412  -48.390 1.00 48.10 ? 140  GLN B N   1 
ATOM   5270 C CA  . GLN B 1 140 ? -13.458 11.651  -48.377 1.00 48.66 ? 140  GLN B CA  1 
ATOM   5271 C C   . GLN B 1 140 ? -13.864 12.677  -47.321 1.00 48.72 ? 140  GLN B C   1 
ATOM   5272 O O   . GLN B 1 140 ? -14.535 13.657  -47.634 1.00 49.11 ? 140  GLN B O   1 
ATOM   5273 C CB  . GLN B 1 140 ? -14.215 10.340  -48.143 1.00 48.70 ? 140  GLN B CB  1 
ATOM   5274 C CG  . GLN B 1 140 ? -15.640 10.316  -48.708 1.00 49.91 ? 140  GLN B CG  1 
ATOM   5275 C CD  . GLN B 1 140 ? -16.642 11.141  -47.895 1.00 50.30 ? 140  GLN B CD  1 
ATOM   5276 O OE1 . GLN B 1 140 ? -16.709 11.050  -46.667 1.00 51.13 ? 140  GLN B OE1 1 
ATOM   5277 N NE2 . GLN B 1 140 ? -17.423 11.946  -48.589 1.00 49.79 ? 140  GLN B NE2 1 
ATOM   5278 N N   . VAL B 1 141 ? -13.457 12.444  -46.077 1.00 48.44 ? 141  VAL B N   1 
ATOM   5279 C CA  . VAL B 1 141 ? -13.893 13.260  -44.954 1.00 48.38 ? 141  VAL B CA  1 
ATOM   5280 C C   . VAL B 1 141 ? -13.259 14.644  -44.954 1.00 48.70 ? 141  VAL B C   1 
ATOM   5281 O O   . VAL B 1 141 ? -13.926 15.632  -44.626 1.00 49.10 ? 141  VAL B O   1 
ATOM   5282 C CB  . VAL B 1 141 ? -13.602 12.560  -43.609 1.00 48.48 ? 141  VAL B CB  1 
ATOM   5283 C CG1 . VAL B 1 141 ? -14.128 13.379  -42.440 1.00 47.80 ? 141  VAL B CG1 1 
ATOM   5284 C CG2 . VAL B 1 141 ? -14.206 11.151  -43.601 1.00 47.86 ? 141  VAL B CG2 1 
ATOM   5285 N N   . GLU B 1 142 ? -11.984 14.719  -45.334 1.00 48.33 ? 142  GLU B N   1 
ATOM   5286 C CA  . GLU B 1 142 ? -11.215 15.942  -45.159 1.00 47.80 ? 142  GLU B CA  1 
ATOM   5287 C C   . GLU B 1 142 ? -10.830 16.637  -46.460 1.00 47.52 ? 142  GLU B C   1 
ATOM   5288 O O   . GLU B 1 142 ? -10.143 17.667  -46.435 1.00 47.45 ? 142  GLU B O   1 
ATOM   5289 C CB  . GLU B 1 142 ? -9.966  15.663  -44.316 1.00 47.91 ? 142  GLU B CB  1 
ATOM   5290 C CG  . GLU B 1 142 ? -10.247 15.326  -42.848 1.00 48.34 ? 142  GLU B CG  1 
ATOM   5291 C CD  . GLU B 1 142 ? -10.902 16.474  -42.059 1.00 50.21 ? 142  GLU B CD  1 
ATOM   5292 O OE1 . GLU B 1 142 ? -10.763 17.663  -42.440 1.00 50.25 ? 142  GLU B OE1 1 
ATOM   5293 O OE2 . GLU B 1 142 ? -11.553 16.173  -41.035 1.00 51.43 ? 142  GLU B OE2 1 
ATOM   5294 N N   . GLY B 1 143 ? -11.275 16.086  -47.588 1.00 46.99 ? 143  GLY B N   1 
ATOM   5295 C CA  . GLY B 1 143 ? -10.843 16.561  -48.901 1.00 46.71 ? 143  GLY B CA  1 
ATOM   5296 C C   . GLY B 1 143 ? -9.322  16.514  -49.128 1.00 46.68 ? 143  GLY B C   1 
ATOM   5297 O O   . GLY B 1 143 ? -8.763  17.361  -49.839 1.00 46.51 ? 143  GLY B O   1 
ATOM   5298 N N   . ALA B 1 144 ? -8.641  15.536  -48.531 1.00 45.99 ? 144  ALA B N   1 
ATOM   5299 C CA  . ALA B 1 144 ? -7.190  15.434  -48.714 1.00 45.35 ? 144  ALA B CA  1 
ATOM   5300 C C   . ALA B 1 144 ? -6.888  14.729  -50.025 1.00 44.75 ? 144  ALA B C   1 
ATOM   5301 O O   . ALA B 1 144 ? -7.620  13.831  -50.425 1.00 44.52 ? 144  ALA B O   1 
ATOM   5302 C CB  . ALA B 1 144 ? -6.538  14.705  -47.545 1.00 44.93 ? 144  ALA B CB  1 
ATOM   5303 N N   . VAL B 1 145 ? -5.842  15.183  -50.707 1.00 44.05 ? 145  VAL B N   1 
ATOM   5304 C CA  . VAL B 1 145 ? -5.199  14.400  -51.741 1.00 43.67 ? 145  VAL B CA  1 
ATOM   5305 C C   . VAL B 1 145 ? -4.096  13.620  -51.024 1.00 43.51 ? 145  VAL B C   1 
ATOM   5306 O O   . VAL B 1 145 ? -3.191  14.205  -50.430 1.00 43.70 ? 145  VAL B O   1 
ATOM   5307 C CB  . VAL B 1 145 ? -4.632  15.302  -52.865 1.00 44.12 ? 145  VAL B CB  1 
ATOM   5308 C CG1 . VAL B 1 145 ? -3.679  14.538  -53.799 1.00 42.91 ? 145  VAL B CG1 1 
ATOM   5309 C CG2 . VAL B 1 145 ? -5.769  15.916  -53.658 1.00 43.76 ? 145  VAL B CG2 1 
ATOM   5310 N N   . LEU B 1 146 ? -4.199  12.302  -51.047 1.00 43.06 ? 146  LEU B N   1 
ATOM   5311 C CA  . LEU B 1 146 ? -3.244  11.464  -50.354 1.00 42.88 ? 146  LEU B CA  1 
ATOM   5312 C C   . LEU B 1 146 ? -2.398  10.642  -51.325 1.00 42.46 ? 146  LEU B C   1 
ATOM   5313 O O   . LEU B 1 146 ? -2.939  9.974   -52.221 1.00 43.13 ? 146  LEU B O   1 
ATOM   5314 C CB  . LEU B 1 146 ? -3.957  10.548  -49.353 1.00 43.20 ? 146  LEU B CB  1 
ATOM   5315 C CG  . LEU B 1 146 ? -3.012  10.004  -48.270 1.00 44.15 ? 146  LEU B CG  1 
ATOM   5316 C CD1 . LEU B 1 146 ? -3.688  9.951   -46.952 1.00 43.52 ? 146  LEU B CD1 1 
ATOM   5317 C CD2 . LEU B 1 146 ? -2.413  8.625   -48.634 1.00 45.08 ? 146  LEU B CD2 1 
ATOM   5318 N N   . VAL B 1 147 ? -1.078  10.687  -51.131 1.00 40.98 ? 147  VAL B N   1 
ATOM   5319 C CA  . VAL B 1 147 ? -0.137  9.936   -51.961 1.00 39.61 ? 147  VAL B CA  1 
ATOM   5320 C C   . VAL B 1 147 ? 0.622   8.940   -51.074 1.00 39.33 ? 147  VAL B C   1 
ATOM   5321 O O   . VAL B 1 147 ? 0.916   9.242   -49.927 1.00 39.45 ? 147  VAL B O   1 
ATOM   5322 C CB  . VAL B 1 147 ? 0.827   10.882  -52.708 1.00 39.51 ? 147  VAL B CB  1 
ATOM   5323 C CG1 . VAL B 1 147 ? 1.786   10.110  -53.608 1.00 38.95 ? 147  VAL B CG1 1 
ATOM   5324 C CG2 . VAL B 1 147 ? 0.046   11.866  -53.547 1.00 39.40 ? 147  VAL B CG2 1 
ATOM   5325 N N   . SER B 1 148 ? 0.864   7.730   -51.575 1.00 38.68 ? 148  SER B N   1 
ATOM   5326 C CA  . SER B 1 148 ? 1.797   6.789   -50.932 1.00 38.35 ? 148  SER B CA  1 
ATOM   5327 C C   . SER B 1 148 ? 2.617   6.056   -51.986 1.00 37.72 ? 148  SER B C   1 
ATOM   5328 O O   . SER B 1 148 ? 2.115   5.768   -53.058 1.00 37.77 ? 148  SER B O   1 
ATOM   5329 C CB  . SER B 1 148 ? 1.060   5.785   -50.059 1.00 38.15 ? 148  SER B CB  1 
ATOM   5330 O OG  . SER B 1 148 ? 0.210   4.982   -50.849 1.00 39.27 ? 148  SER B OG  1 
ATOM   5331 N N   . MET B 1 149 ? 3.876   5.761   -51.686 1.00 37.51 ? 149  MET B N   1 
ATOM   5332 C CA  . MET B 1 149 ? 4.748   5.102   -52.667 1.00 37.21 ? 149  MET B CA  1 
ATOM   5333 C C   . MET B 1 149 ? 5.329   3.836   -52.087 1.00 37.13 ? 149  MET B C   1 
ATOM   5334 O O   . MET B 1 149 ? 5.413   3.700   -50.859 1.00 37.91 ? 149  MET B O   1 
ATOM   5335 C CB  . MET B 1 149 ? 5.884   6.032   -53.118 1.00 36.91 ? 149  MET B CB  1 
ATOM   5336 C CG  . MET B 1 149 ? 7.099   6.063   -52.173 1.00 37.56 ? 149  MET B CG  1 
ATOM   5337 S SD  . MET B 1 149 ? 6.760   6.894   -50.605 1.00 36.77 ? 149  MET B SD  1 
ATOM   5338 C CE  . MET B 1 149 ? 6.907   8.588   -51.160 1.00 32.81 ? 149  MET B CE  1 
ATOM   5339 N N   . ASN B 1 150 ? 5.702   2.908   -52.966 1.00 36.51 ? 150  ASN B N   1 
ATOM   5340 C CA  . ASN B 1 150 ? 6.550   1.791   -52.602 1.00 35.85 ? 150  ASN B CA  1 
ATOM   5341 C C   . ASN B 1 150 ? 7.991   2.268   -52.725 1.00 35.25 ? 150  ASN B C   1 
ATOM   5342 O O   . ASN B 1 150 ? 8.289   3.113   -53.563 1.00 34.90 ? 150  ASN B O   1 
ATOM   5343 C CB  . ASN B 1 150 ? 6.314   0.606   -53.537 1.00 36.05 ? 150  ASN B CB  1 
ATOM   5344 C CG  . ASN B 1 150 ? 5.007   -0.143  -53.238 1.00 37.53 ? 150  ASN B CG  1 
ATOM   5345 O OD1 . ASN B 1 150 ? 4.309   0.142   -52.257 1.00 36.48 ? 150  ASN B OD1 1 
ATOM   5346 N ND2 . ASN B 1 150 ? 4.679   -1.114  -54.092 1.00 39.29 ? 150  ASN B ND2 1 
ATOM   5347 N N   . TYR B 1 151 ? 8.868   1.756   -51.867 1.00 34.34 ? 151  TYR B N   1 
ATOM   5348 C CA  . TYR B 1 151 ? 10.291  2.018   -51.983 1.00 34.28 ? 151  TYR B CA  1 
ATOM   5349 C C   . TYR B 1 151 ? 11.045  0.730   -51.630 1.00 33.99 ? 151  TYR B C   1 
ATOM   5350 O O   . TYR B 1 151 ? 10.584  -0.043  -50.818 1.00 33.90 ? 151  TYR B O   1 
ATOM   5351 C CB  . TYR B 1 151 ? 10.718  3.222   -51.113 1.00 33.81 ? 151  TYR B CB  1 
ATOM   5352 C CG  . TYR B 1 151 ? 10.532  3.022   -49.627 1.00 33.53 ? 151  TYR B CG  1 
ATOM   5353 C CD1 . TYR B 1 151 ? 9.326   3.342   -48.996 1.00 33.77 ? 151  TYR B CD1 1 
ATOM   5354 C CD2 . TYR B 1 151 ? 11.559  2.488   -48.847 1.00 33.52 ? 151  TYR B CD2 1 
ATOM   5355 C CE1 . TYR B 1 151 ? 9.167   3.150   -47.621 1.00 34.38 ? 151  TYR B CE1 1 
ATOM   5356 C CE2 . TYR B 1 151 ? 11.412  2.285   -47.485 1.00 31.55 ? 151  TYR B CE2 1 
ATOM   5357 C CZ  . TYR B 1 151 ? 10.220  2.616   -46.874 1.00 34.73 ? 151  TYR B CZ  1 
ATOM   5358 O OH  . TYR B 1 151 ? 10.091  2.411   -45.509 1.00 35.58 ? 151  TYR B OH  1 
ATOM   5359 N N   . ARG B 1 152 ? 12.194  0.508   -52.252 1.00 34.46 ? 152  ARG B N   1 
ATOM   5360 C CA  . ARG B 1 152 ? 12.961  -0.728  -52.061 1.00 35.01 ? 152  ARG B CA  1 
ATOM   5361 C C   . ARG B 1 152 ? 13.478  -0.889  -50.631 1.00 35.06 ? 152  ARG B C   1 
ATOM   5362 O O   . ARG B 1 152 ? 14.030  0.033   -50.056 1.00 35.76 ? 152  ARG B O   1 
ATOM   5363 C CB  . ARG B 1 152 ? 14.136  -0.762  -53.035 1.00 35.13 ? 152  ARG B CB  1 
ATOM   5364 C CG  . ARG B 1 152 ? 13.785  -1.114  -54.465 1.00 33.82 ? 152  ARG B CG  1 
ATOM   5365 C CD  . ARG B 1 152 ? 15.034  -0.980  -55.342 1.00 33.84 ? 152  ARG B CD  1 
ATOM   5366 N NE  . ARG B 1 152 ? 15.276  0.413   -55.694 1.00 33.66 ? 152  ARG B NE  1 
ATOM   5367 C CZ  . ARG B 1 152 ? 16.296  0.867   -56.414 1.00 34.11 ? 152  ARG B CZ  1 
ATOM   5368 N NH1 . ARG B 1 152 ? 17.234  0.047   -56.886 1.00 35.41 ? 152  ARG B NH1 1 
ATOM   5369 N NH2 . ARG B 1 152 ? 16.378  2.167   -56.665 1.00 33.44 ? 152  ARG B NH2 1 
ATOM   5370 N N   . VAL B 1 153 ? 13.264  -2.059  -50.058 1.00 35.38 ? 153  VAL B N   1 
ATOM   5371 C CA  . VAL B 1 153 ? 13.643  -2.344  -48.677 1.00 35.54 ? 153  VAL B CA  1 
ATOM   5372 C C   . VAL B 1 153 ? 14.679  -3.462  -48.616 1.00 36.08 ? 153  VAL B C   1 
ATOM   5373 O O   . VAL B 1 153 ? 14.972  -4.096  -49.636 1.00 35.77 ? 153  VAL B O   1 
ATOM   5374 C CB  . VAL B 1 153 ? 12.424  -2.779  -47.837 1.00 35.54 ? 153  VAL B CB  1 
ATOM   5375 C CG1 . VAL B 1 153 ? 11.460  -1.607  -47.647 1.00 34.70 ? 153  VAL B CG1 1 
ATOM   5376 C CG2 . VAL B 1 153 ? 11.739  -3.995  -48.463 1.00 34.10 ? 153  VAL B CG2 1 
ATOM   5377 N N   . GLY B 1 154 ? 15.217  -3.700  -47.415 1.00 36.82 ? 154  GLY B N   1 
ATOM   5378 C CA  . GLY B 1 154 ? 16.251  -4.729  -47.183 1.00 37.05 ? 154  GLY B CA  1 
ATOM   5379 C C   . GLY B 1 154 ? 17.453  -4.522  -48.080 1.00 37.60 ? 154  GLY B C   1 
ATOM   5380 O O   . GLY B 1 154 ? 17.814  -3.392  -48.382 1.00 38.20 ? 154  GLY B O   1 
ATOM   5381 N N   . THR B 1 155 ? 18.050  -5.609  -48.554 1.00 38.67 ? 155  THR B N   1 
ATOM   5382 C CA  . THR B 1 155 ? 19.240  -5.524  -49.404 1.00 39.23 ? 155  THR B CA  1 
ATOM   5383 C C   . THR B 1 155 ? 18.999  -4.690  -50.656 1.00 39.11 ? 155  THR B C   1 
ATOM   5384 O O   . THR B 1 155 ? 19.858  -3.899  -51.078 1.00 39.38 ? 155  THR B O   1 
ATOM   5385 C CB  . THR B 1 155 ? 19.725  -6.906  -49.822 1.00 39.14 ? 155  THR B CB  1 
ATOM   5386 O OG1 . THR B 1 155 ? 18.638  -7.614  -50.406 1.00 40.67 ? 155  THR B OG1 1 
ATOM   5387 C CG2 . THR B 1 155 ? 20.198  -7.687  -48.615 1.00 39.96 ? 155  THR B CG2 1 
ATOM   5388 N N   . PHE B 1 156 ? 17.821  -4.847  -51.240 1.00 38.73 ? 156  PHE B N   1 
ATOM   5389 C CA  . PHE B 1 156 ? 17.516  -4.148  -52.493 1.00 38.72 ? 156  PHE B CA  1 
ATOM   5390 C C   . PHE B 1 156 ? 17.494  -2.625  -52.369 1.00 38.64 ? 156  PHE B C   1 
ATOM   5391 O O   . PHE B 1 156 ? 17.888  -1.933  -53.292 1.00 38.88 ? 156  PHE B O   1 
ATOM   5392 C CB  . PHE B 1 156 ? 16.208  -4.681  -53.078 1.00 38.40 ? 156  PHE B CB  1 
ATOM   5393 C CG  . PHE B 1 156 ? 16.130  -6.168  -53.065 1.00 38.12 ? 156  PHE B CG  1 
ATOM   5394 C CD1 . PHE B 1 156 ? 16.746  -6.917  -54.076 1.00 37.59 ? 156  PHE B CD1 1 
ATOM   5395 C CD2 . PHE B 1 156 ? 15.489  -6.834  -52.017 1.00 37.78 ? 156  PHE B CD2 1 
ATOM   5396 C CE1 . PHE B 1 156 ? 16.707  -8.325  -54.055 1.00 37.69 ? 156  PHE B CE1 1 
ATOM   5397 C CE2 . PHE B 1 156 ? 15.438  -8.244  -51.989 1.00 39.36 ? 156  PHE B CE2 1 
ATOM   5398 C CZ  . PHE B 1 156 ? 16.052  -8.992  -53.022 1.00 36.52 ? 156  PHE B CZ  1 
ATOM   5399 N N   . GLY B 1 157 ? 17.056  -2.100  -51.228 1.00 38.74 ? 157  GLY B N   1 
ATOM   5400 C CA  . GLY B 1 157 ? 17.063  -0.652  -51.029 1.00 38.59 ? 157  GLY B CA  1 
ATOM   5401 C C   . GLY B 1 157 ? 18.308  -0.123  -50.342 1.00 39.00 ? 157  GLY B C   1 
ATOM   5402 O O   . GLY B 1 157 ? 18.743  1.014   -50.598 1.00 38.74 ? 157  GLY B O   1 
ATOM   5403 N N   . PHE B 1 158 ? 18.907  -0.938  -49.480 1.00 39.02 ? 158  PHE B N   1 
ATOM   5404 C CA  . PHE B 1 158 ? 19.889  -0.377  -48.577 1.00 39.77 ? 158  PHE B CA  1 
ATOM   5405 C C   . PHE B 1 158 ? 21.274  -1.002  -48.523 1.00 41.21 ? 158  PHE B C   1 
ATOM   5406 O O   . PHE B 1 158 ? 22.168  -0.445  -47.887 1.00 41.34 ? 158  PHE B O   1 
ATOM   5407 C CB  . PHE B 1 158 ? 19.269  -0.135  -47.198 1.00 39.44 ? 158  PHE B CB  1 
ATOM   5408 C CG  . PHE B 1 158 ? 18.100  0.833   -47.242 1.00 37.51 ? 158  PHE B CG  1 
ATOM   5409 C CD1 . PHE B 1 158 ? 18.315  2.185   -47.398 1.00 34.06 ? 158  PHE B CD1 1 
ATOM   5410 C CD2 . PHE B 1 158 ? 16.792  0.367   -47.195 1.00 36.55 ? 158  PHE B CD2 1 
ATOM   5411 C CE1 . PHE B 1 158 ? 17.251  3.070   -47.469 1.00 36.24 ? 158  PHE B CE1 1 
ATOM   5412 C CE2 . PHE B 1 158 ? 15.712  1.239   -47.274 1.00 36.01 ? 158  PHE B CE2 1 
ATOM   5413 C CZ  . PHE B 1 158 ? 15.935  2.594   -47.406 1.00 37.29 ? 158  PHE B CZ  1 
ATOM   5414 N N   . LEU B 1 159 ? 21.469  -2.120  -49.229 1.00 42.41 ? 159  LEU B N   1 
ATOM   5415 C CA  . LEU B 1 159 ? 22.792  -2.721  -49.326 1.00 43.03 ? 159  LEU B CA  1 
ATOM   5416 C C   . LEU B 1 159 ? 23.748  -1.753  -50.018 1.00 43.90 ? 159  LEU B C   1 
ATOM   5417 O O   . LEU B 1 159 ? 23.496  -1.323  -51.135 1.00 44.36 ? 159  LEU B O   1 
ATOM   5418 C CB  . LEU B 1 159 ? 22.745  -4.058  -50.063 1.00 42.69 ? 159  LEU B CB  1 
ATOM   5419 C CG  . LEU B 1 159 ? 24.079  -4.820  -50.126 1.00 42.29 ? 159  LEU B CG  1 
ATOM   5420 C CD1 . LEU B 1 159 ? 23.833  -6.319  -50.141 1.00 42.12 ? 159  LEU B CD1 1 
ATOM   5421 C CD2 . LEU B 1 159 ? 24.937  -4.381  -51.317 1.00 40.76 ? 159  LEU B CD2 1 
ATOM   5422 N N   . ALA B 1 160 ? 24.850  -1.429  -49.348 1.00 44.81 ? 160  ALA B N   1 
ATOM   5423 C CA  . ALA B 1 160 ? 25.782  -0.430  -49.852 1.00 45.92 ? 160  ALA B CA  1 
ATOM   5424 C C   . ALA B 1 160 ? 27.228  -0.896  -49.738 1.00 46.47 ? 160  ALA B C   1 
ATOM   5425 O O   . ALA B 1 160 ? 27.623  -1.519  -48.756 1.00 46.96 ? 160  ALA B O   1 
ATOM   5426 C CB  . ALA B 1 160 ? 25.597  0.903   -49.109 1.00 45.69 ? 160  ALA B CB  1 
ATOM   5427 N N   . LEU B 1 161 ? 27.998  -0.613  -50.774 1.00 47.25 ? 161  LEU B N   1 
ATOM   5428 C CA  . LEU B 1 161 ? 29.440  -0.644  -50.685 1.00 48.01 ? 161  LEU B CA  1 
ATOM   5429 C C   . LEU B 1 161 ? 29.812  0.793   -50.895 1.00 48.35 ? 161  LEU B C   1 
ATOM   5430 O O   . LEU B 1 161 ? 29.946  1.239   -52.033 1.00 48.02 ? 161  LEU B O   1 
ATOM   5431 C CB  . LEU B 1 161 ? 30.048  -1.553  -51.748 1.00 48.05 ? 161  LEU B CB  1 
ATOM   5432 C CG  . LEU B 1 161 ? 29.874  -3.011  -51.328 1.00 49.40 ? 161  LEU B CG  1 
ATOM   5433 C CD1 . LEU B 1 161 ? 29.949  -3.946  -52.504 1.00 50.97 ? 161  LEU B CD1 1 
ATOM   5434 C CD2 . LEU B 1 161 ? 30.910  -3.387  -50.287 1.00 50.67 ? 161  LEU B CD2 1 
ATOM   5435 N N   . PRO B 1 162 ? 29.920  1.546   -49.788 1.00 49.02 ? 162  PRO B N   1 
ATOM   5436 C CA  . PRO B 1 162 ? 30.098  2.991   -49.872 1.00 49.78 ? 162  PRO B CA  1 
ATOM   5437 C C   . PRO B 1 162 ? 31.266  3.347   -50.776 1.00 50.65 ? 162  PRO B C   1 
ATOM   5438 O O   . PRO B 1 162 ? 32.330  2.748   -50.662 1.00 50.89 ? 162  PRO B O   1 
ATOM   5439 C CB  . PRO B 1 162 ? 30.380  3.397   -48.422 1.00 49.56 ? 162  PRO B CB  1 
ATOM   5440 C CG  . PRO B 1 162 ? 29.722  2.333   -47.604 1.00 49.47 ? 162  PRO B CG  1 
ATOM   5441 C CD  . PRO B 1 162 ? 29.871  1.068   -48.394 1.00 48.87 ? 162  PRO B CD  1 
ATOM   5442 N N   . GLY B 1 163 ? 31.043  4.299   -51.678 1.00 51.68 ? 163  GLY B N   1 
ATOM   5443 C CA  . GLY B 1 163 ? 32.073  4.794   -52.590 1.00 52.31 ? 163  GLY B CA  1 
ATOM   5444 C C   . GLY B 1 163 ? 32.037  4.118   -53.949 1.00 53.00 ? 163  GLY B C   1 
ATOM   5445 O O   . GLY B 1 163 ? 32.565  4.648   -54.928 1.00 53.11 ? 163  GLY B O   1 
ATOM   5446 N N   . SER B 1 164 ? 31.431  2.936   -54.007 1.00 53.69 ? 164  SER B N   1 
ATOM   5447 C CA  . SER B 1 164 ? 31.270  2.206   -55.270 1.00 54.27 ? 164  SER B CA  1 
ATOM   5448 C C   . SER B 1 164 ? 30.276  2.891   -56.219 1.00 55.01 ? 164  SER B C   1 
ATOM   5449 O O   . SER B 1 164 ? 29.464  3.725   -55.798 1.00 55.16 ? 164  SER B O   1 
ATOM   5450 C CB  . SER B 1 164 ? 30.821  0.768   -55.006 1.00 54.25 ? 164  SER B CB  1 
ATOM   5451 O OG  . SER B 1 164 ? 29.428  0.700   -54.731 1.00 52.78 ? 164  SER B OG  1 
ATOM   5452 N N   . ARG B 1 165 ? 30.350  2.523   -57.495 1.00 55.67 ? 165  ARG B N   1 
ATOM   5453 C CA  . ARG B 1 165 ? 29.453  3.048   -58.515 1.00 56.34 ? 165  ARG B CA  1 
ATOM   5454 C C   . ARG B 1 165 ? 28.131  2.284   -58.504 1.00 55.75 ? 165  ARG B C   1 
ATOM   5455 O O   . ARG B 1 165 ? 27.081  2.861   -58.790 1.00 56.05 ? 165  ARG B O   1 
ATOM   5456 C CB  . ARG B 1 165 ? 30.097  2.924   -59.899 1.00 56.94 ? 165  ARG B CB  1 
ATOM   5457 C CG  . ARG B 1 165 ? 29.454  3.791   -60.996 1.00 60.90 ? 165  ARG B CG  1 
ATOM   5458 C CD  . ARG B 1 165 ? 29.476  3.100   -62.386 1.00 64.58 ? 165  ARG B CD  1 
ATOM   5459 N NE  . ARG B 1 165 ? 28.221  2.385   -62.649 1.00 67.92 ? 165  ARG B NE  1 
ATOM   5460 C CZ  . ARG B 1 165 ? 28.090  1.317   -63.442 1.00 69.06 ? 165  ARG B CZ  1 
ATOM   5461 N NH1 . ARG B 1 165 ? 29.146  0.802   -64.069 1.00 69.44 ? 165  ARG B NH1 1 
ATOM   5462 N NH2 . ARG B 1 165 ? 26.896  0.755   -63.597 1.00 67.90 ? 165  ARG B NH2 1 
ATOM   5463 N N   . GLU B 1 166 ? 28.181  0.997   -58.169 1.00 54.74 ? 166  GLU B N   1 
ATOM   5464 C CA  . GLU B 1 166 ? 27.033  0.117   -58.394 1.00 54.63 ? 166  GLU B CA  1 
ATOM   5465 C C   . GLU B 1 166 ? 26.313  -0.373  -57.140 1.00 53.19 ? 166  GLU B C   1 
ATOM   5466 O O   . GLU B 1 166 ? 25.491  -1.288  -57.212 1.00 53.15 ? 166  GLU B O   1 
ATOM   5467 C CB  . GLU B 1 166 ? 27.387  -1.050  -59.340 1.00 55.36 ? 166  GLU B CB  1 
ATOM   5468 C CG  . GLU B 1 166 ? 28.745  -1.691  -59.110 1.00 58.58 ? 166  GLU B CG  1 
ATOM   5469 C CD  . GLU B 1 166 ? 29.905  -0.829  -59.613 1.00 62.82 ? 166  GLU B CD  1 
ATOM   5470 O OE1 . GLU B 1 166 ? 29.978  -0.578  -60.843 1.00 64.72 ? 166  GLU B OE1 1 
ATOM   5471 O OE2 . GLU B 1 166 ? 30.739  -0.408  -58.773 1.00 63.59 ? 166  GLU B OE2 1 
ATOM   5472 N N   . ALA B 1 167 ? 26.626  0.260   -56.010 1.00 51.63 ? 167  ALA B N   1 
ATOM   5473 C CA  . ALA B 1 167 ? 25.959  0.056   -54.724 1.00 50.03 ? 167  ALA B CA  1 
ATOM   5474 C C   . ALA B 1 167 ? 26.267  1.258   -53.832 1.00 49.06 ? 167  ALA B C   1 
ATOM   5475 O O   . ALA B 1 167 ? 26.862  1.102   -52.762 1.00 49.40 ? 167  ALA B O   1 
ATOM   5476 C CB  . ALA B 1 167 ? 26.421  -1.226  -54.065 1.00 49.81 ? 167  ALA B CB  1 
ATOM   5477 N N   . PRO B 1 168 ? 25.869  2.469   -54.266 1.00 47.81 ? 168  PRO B N   1 
ATOM   5478 C CA  . PRO B 1 168 ? 26.274  3.677   -53.544 1.00 46.81 ? 168  PRO B CA  1 
ATOM   5479 C C   . PRO B 1 168 ? 25.509  3.915   -52.238 1.00 45.72 ? 168  PRO B C   1 
ATOM   5480 O O   . PRO B 1 168 ? 25.778  4.903   -51.549 1.00 45.19 ? 168  PRO B O   1 
ATOM   5481 C CB  . PRO B 1 168 ? 25.973  4.799   -54.547 1.00 46.59 ? 168  PRO B CB  1 
ATOM   5482 C CG  . PRO B 1 168 ? 24.820  4.288   -55.317 1.00 47.60 ? 168  PRO B CG  1 
ATOM   5483 C CD  . PRO B 1 168 ? 25.027  2.789   -55.435 1.00 47.84 ? 168  PRO B CD  1 
ATOM   5484 N N   . GLY B 1 169 ? 24.571  3.020   -51.919 1.00 44.72 ? 169  GLY B N   1 
ATOM   5485 C CA  . GLY B 1 169 ? 23.730  3.138   -50.731 1.00 43.51 ? 169  GLY B CA  1 
ATOM   5486 C C   . GLY B 1 169 ? 22.529  4.060   -50.873 1.00 42.84 ? 169  GLY B C   1 
ATOM   5487 O O   . GLY B 1 169 ? 22.458  4.873   -51.804 1.00 42.27 ? 169  GLY B O   1 
ATOM   5488 N N   . ASN B 1 170 ? 21.580  3.911   -49.944 1.00 42.52 ? 170  ASN B N   1 
ATOM   5489 C CA  . ASN B 1 170 ? 20.425  4.813   -49.806 1.00 41.96 ? 170  ASN B CA  1 
ATOM   5490 C C   . ASN B 1 170 ? 19.438  4.857   -50.990 1.00 41.32 ? 170  ASN B C   1 
ATOM   5491 O O   . ASN B 1 170 ? 18.694  5.816   -51.127 1.00 41.32 ? 170  ASN B O   1 
ATOM   5492 C CB  . ASN B 1 170 ? 20.900  6.249   -49.478 1.00 41.62 ? 170  ASN B CB  1 
ATOM   5493 C CG  . ASN B 1 170 ? 21.762  6.321   -48.208 1.00 42.01 ? 170  ASN B CG  1 
ATOM   5494 O OD1 . ASN B 1 170 ? 21.499  5.646   -47.204 1.00 39.55 ? 170  ASN B OD1 1 
ATOM   5495 N ND2 . ASN B 1 170 ? 22.803  7.154   -48.256 1.00 43.18 ? 170  ASN B ND2 1 
ATOM   5496 N N   . VAL B 1 171 ? 19.425  3.837   -51.841 1.00 41.16 ? 171  VAL B N   1 
ATOM   5497 C CA  . VAL B 1 171 ? 18.627  3.928   -53.071 1.00 40.71 ? 171  VAL B CA  1 
ATOM   5498 C C   . VAL B 1 171 ? 17.123  3.911   -52.766 1.00 40.49 ? 171  VAL B C   1 
ATOM   5499 O O   . VAL B 1 171 ? 16.333  4.558   -53.462 1.00 40.75 ? 171  VAL B O   1 
ATOM   5500 C CB  . VAL B 1 171 ? 19.036  2.896   -54.174 1.00 40.67 ? 171  VAL B CB  1 
ATOM   5501 C CG1 . VAL B 1 171 ? 20.495  3.087   -54.578 1.00 40.60 ? 171  VAL B CG1 1 
ATOM   5502 C CG2 . VAL B 1 171 ? 18.777  1.460   -53.740 1.00 40.43 ? 171  VAL B CG2 1 
ATOM   5503 N N   . GLY B 1 172 ? 16.749  3.199   -51.706 1.00 39.66 ? 172  GLY B N   1 
ATOM   5504 C CA  . GLY B 1 172 ? 15.391  3.217   -51.195 1.00 39.19 ? 172  GLY B CA  1 
ATOM   5505 C C   . GLY B 1 172 ? 14.911  4.605   -50.812 1.00 38.99 ? 172  GLY B C   1 
ATOM   5506 O O   . GLY B 1 172 ? 13.725  4.896   -50.909 1.00 39.14 ? 172  GLY B O   1 
ATOM   5507 N N   . LEU B 1 173 ? 15.827  5.469   -50.378 1.00 38.63 ? 173  LEU B N   1 
ATOM   5508 C CA  . LEU B 1 173 ? 15.470  6.830   -50.025 1.00 37.94 ? 173  LEU B CA  1 
ATOM   5509 C C   . LEU B 1 173 ? 15.386  7.632   -51.301 1.00 37.96 ? 173  LEU B C   1 
ATOM   5510 O O   . LEU B 1 173 ? 14.591  8.587   -51.398 1.00 38.04 ? 173  LEU B O   1 
ATOM   5511 C CB  . LEU B 1 173 ? 16.491  7.458   -49.063 1.00 38.23 ? 173  LEU B CB  1 
ATOM   5512 C CG  . LEU B 1 173 ? 16.528  6.934   -47.615 1.00 38.28 ? 173  LEU B CG  1 
ATOM   5513 C CD1 . LEU B 1 173 ? 17.718  7.492   -46.876 1.00 36.30 ? 173  LEU B CD1 1 
ATOM   5514 C CD2 . LEU B 1 173 ? 15.249  7.238   -46.862 1.00 36.44 ? 173  LEU B CD2 1 
ATOM   5515 N N   . LEU B 1 174 ? 16.205  7.250   -52.282 1.00 37.11 ? 174  LEU B N   1 
ATOM   5516 C CA  . LEU B 1 174 ? 16.180  7.915   -53.579 1.00 36.77 ? 174  LEU B CA  1 
ATOM   5517 C C   . LEU B 1 174 ? 14.888  7.579   -54.315 1.00 36.31 ? 174  LEU B C   1 
ATOM   5518 O O   . LEU B 1 174 ? 14.326  8.427   -54.998 1.00 36.27 ? 174  LEU B O   1 
ATOM   5519 C CB  . LEU B 1 174 ? 17.423  7.568   -54.407 1.00 36.82 ? 174  LEU B CB  1 
ATOM   5520 C CG  . LEU B 1 174 ? 18.740  8.211   -53.940 1.00 36.90 ? 174  LEU B CG  1 
ATOM   5521 C CD1 . LEU B 1 174 ? 19.941  7.680   -54.717 1.00 36.13 ? 174  LEU B CD1 1 
ATOM   5522 C CD2 . LEU B 1 174 ? 18.687  9.720   -54.075 1.00 36.81 ? 174  LEU B CD2 1 
ATOM   5523 N N   . ASP B 1 175 ? 14.429  6.333   -54.164 1.00 36.16 ? 175  ASP B N   1 
ATOM   5524 C CA  . ASP B 1 175 ? 13.081  5.925   -54.565 1.00 35.37 ? 175  ASP B CA  1 
ATOM   5525 C C   . ASP B 1 175 ? 12.041  6.913   -54.001 1.00 35.52 ? 175  ASP B C   1 
ATOM   5526 O O   . ASP B 1 175 ? 11.268  7.496   -54.765 1.00 35.65 ? 175  ASP B O   1 
ATOM   5527 C CB  . ASP B 1 175 ? 12.785  4.502   -54.073 1.00 35.30 ? 175  ASP B CB  1 
ATOM   5528 C CG  . ASP B 1 175 ? 13.628  3.427   -54.776 1.00 33.90 ? 175  ASP B CG  1 
ATOM   5529 O OD1 . ASP B 1 175 ? 14.387  3.756   -55.700 1.00 31.53 ? 175  ASP B OD1 1 
ATOM   5530 O OD2 . ASP B 1 175 ? 13.510  2.232   -54.407 1.00 32.13 ? 175  ASP B OD2 1 
ATOM   5531 N N   . GLN B 1 176 ? 12.042  7.123   -52.681 1.00 35.20 ? 176  GLN B N   1 
ATOM   5532 C CA  . GLN B 1 176 ? 11.160  8.120   -52.048 1.00 35.49 ? 176  GLN B CA  1 
ATOM   5533 C C   . GLN B 1 176 ? 11.320  9.520   -52.643 1.00 36.28 ? 176  GLN B C   1 
ATOM   5534 O O   . GLN B 1 176 ? 10.320  10.169  -52.982 1.00 36.94 ? 176  GLN B O   1 
ATOM   5535 C CB  . GLN B 1 176 ? 11.377  8.183   -50.538 1.00 35.54 ? 176  GLN B CB  1 
ATOM   5536 C CG  . GLN B 1 176 ? 11.071  6.882   -49.772 1.00 35.49 ? 176  GLN B CG  1 
ATOM   5537 C CD  . GLN B 1 176 ? 11.720  6.876   -48.393 1.00 34.87 ? 176  GLN B CD  1 
ATOM   5538 O OE1 . GLN B 1 176 ? 12.014  7.934   -47.854 1.00 29.92 ? 176  GLN B OE1 1 
ATOM   5539 N NE2 . GLN B 1 176 ? 11.937  5.682   -47.815 1.00 33.59 ? 176  GLN B NE2 1 
ATOM   5540 N N   . ARG B 1 177 ? 12.563  9.980   -52.799 1.00 36.49 ? 177  ARG B N   1 
ATOM   5541 C CA  . ARG B 1 177 ? 12.819  11.272  -53.440 1.00 36.96 ? 177  ARG B CA  1 
ATOM   5542 C C   . ARG B 1 177 ? 12.216  11.392  -54.847 1.00 37.17 ? 177  ARG B C   1 
ATOM   5543 O O   . ARG B 1 177 ? 11.615  12.422  -55.188 1.00 37.74 ? 177  ARG B O   1 
ATOM   5544 C CB  . ARG B 1 177 ? 14.312  11.580  -53.481 1.00 37.07 ? 177  ARG B CB  1 
ATOM   5545 C CG  . ARG B 1 177 ? 14.654  12.913  -54.120 1.00 39.06 ? 177  ARG B CG  1 
ATOM   5546 C CD  . ARG B 1 177 ? 16.117  13.247  -53.973 1.00 41.12 ? 177  ARG B CD  1 
ATOM   5547 N NE  . ARG B 1 177 ? 16.378  13.664  -52.603 1.00 44.94 ? 177  ARG B NE  1 
ATOM   5548 C CZ  . ARG B 1 177 ? 17.579  13.679  -52.031 1.00 45.35 ? 177  ARG B CZ  1 
ATOM   5549 N NH1 . ARG B 1 177 ? 18.658  13.296  -52.716 1.00 46.35 ? 177  ARG B NH1 1 
ATOM   5550 N NH2 . ARG B 1 177 ? 17.694  14.078  -50.771 1.00 43.63 ? 177  ARG B NH2 1 
ATOM   5551 N N   . LEU B 1 178 ? 12.369  10.353  -55.661 1.00 37.10 ? 178  LEU B N   1 
ATOM   5552 C CA  . LEU B 1 178 ? 11.770  10.361  -56.996 1.00 37.20 ? 178  LEU B CA  1 
ATOM   5553 C C   . LEU B 1 178 ? 10.218  10.461  -56.935 1.00 37.46 ? 178  LEU B C   1 
ATOM   5554 O O   . LEU B 1 178 ? 9.613   11.232  -57.672 1.00 37.11 ? 178  LEU B O   1 
ATOM   5555 C CB  . LEU B 1 178 ? 12.244  9.165   -57.826 1.00 36.60 ? 178  LEU B CB  1 
ATOM   5556 C CG  . LEU B 1 178 ? 11.811  9.072   -59.303 1.00 37.29 ? 178  LEU B CG  1 
ATOM   5557 C CD1 . LEU B 1 178 ? 12.141  10.318  -60.127 1.00 33.61 ? 178  LEU B CD1 1 
ATOM   5558 C CD2 . LEU B 1 178 ? 12.445  7.839   -59.944 1.00 36.94 ? 178  LEU B CD2 1 
ATOM   5559 N N   . ALA B 1 179 ? 9.593   9.717   -56.032 1.00 37.77 ? 179  ALA B N   1 
ATOM   5560 C CA  . ALA B 1 179 ? 8.143   9.780   -55.869 1.00 38.56 ? 179  ALA B CA  1 
ATOM   5561 C C   . ALA B 1 179 ? 7.677   11.185  -55.426 1.00 39.56 ? 179  ALA B C   1 
ATOM   5562 O O   . ALA B 1 179 ? 6.598   11.623  -55.798 1.00 40.03 ? 179  ALA B O   1 
ATOM   5563 C CB  . ALA B 1 179 ? 7.683   8.724   -54.899 1.00 37.58 ? 179  ALA B CB  1 
ATOM   5564 N N   . LEU B 1 180 ? 8.499   11.887  -54.644 1.00 40.42 ? 180  LEU B N   1 
ATOM   5565 C CA  . LEU B 1 180 ? 8.194   13.257  -54.249 1.00 40.93 ? 180  LEU B CA  1 
ATOM   5566 C C   . LEU B 1 180 ? 8.349   14.193  -55.424 1.00 41.87 ? 180  LEU B C   1 
ATOM   5567 O O   . LEU B 1 180 ? 7.579   15.149  -55.548 1.00 42.62 ? 180  LEU B O   1 
ATOM   5568 C CB  . LEU B 1 180 ? 9.079   13.753  -53.101 1.00 40.18 ? 180  LEU B CB  1 
ATOM   5569 C CG  . LEU B 1 180 ? 9.195   12.996  -51.778 1.00 40.29 ? 180  LEU B CG  1 
ATOM   5570 C CD1 . LEU B 1 180 ? 9.969   13.841  -50.755 1.00 40.71 ? 180  LEU B CD1 1 
ATOM   5571 C CD2 . LEU B 1 180 ? 7.860   12.517  -51.206 1.00 39.06 ? 180  LEU B CD2 1 
ATOM   5572 N N   . GLN B 1 181 ? 9.359   13.928  -56.260 1.00 42.98 ? 181  GLN B N   1 
ATOM   5573 C CA  . GLN B 1 181 ? 9.614   14.685  -57.498 1.00 43.61 ? 181  GLN B CA  1 
ATOM   5574 C C   . GLN B 1 181 ? 8.428   14.527  -58.427 1.00 42.99 ? 181  GLN B C   1 
ATOM   5575 O O   . GLN B 1 181 ? 7.983   15.497  -59.030 1.00 43.25 ? 181  GLN B O   1 
ATOM   5576 C CB  . GLN B 1 181 ? 10.886  14.190  -58.200 1.00 43.75 ? 181  GLN B CB  1 
ATOM   5577 C CG  . GLN B 1 181 ? 12.023  15.216  -58.305 1.00 48.32 ? 181  GLN B CG  1 
ATOM   5578 C CD  . GLN B 1 181 ? 13.435  14.611  -58.038 1.00 52.81 ? 181  GLN B CD  1 
ATOM   5579 O OE1 . GLN B 1 181 ? 14.274  15.245  -57.379 1.00 52.64 ? 181  GLN B OE1 1 
ATOM   5580 N NE2 . GLN B 1 181 ? 13.683  13.379  -58.535 1.00 52.62 ? 181  GLN B NE2 1 
ATOM   5581 N N   . TRP B 1 182 ? 7.928   13.297  -58.521 1.00 42.79 ? 182  TRP B N   1 
ATOM   5582 C CA  . TRP B 1 182 ? 6.743   12.953  -59.301 1.00 42.52 ? 182  TRP B CA  1 
ATOM   5583 C C   . TRP B 1 182 ? 5.523   13.734  -58.836 1.00 42.85 ? 182  TRP B C   1 
ATOM   5584 O O   . TRP B 1 182 ? 4.764   14.235  -59.661 1.00 43.20 ? 182  TRP B O   1 
ATOM   5585 C CB  . TRP B 1 182 ? 6.458   11.455  -59.198 1.00 41.95 ? 182  TRP B CB  1 
ATOM   5586 C CG  . TRP B 1 182 ? 5.401   10.971  -60.163 1.00 41.78 ? 182  TRP B CG  1 
ATOM   5587 C CD1 . TRP B 1 182 ? 5.607   10.433  -61.401 1.00 40.31 ? 182  TRP B CD1 1 
ATOM   5588 C CD2 . TRP B 1 182 ? 3.979   10.992  -59.965 1.00 40.98 ? 182  TRP B CD2 1 
ATOM   5589 N NE1 . TRP B 1 182 ? 4.409   10.105  -61.978 1.00 41.06 ? 182  TRP B NE1 1 
ATOM   5590 C CE2 . TRP B 1 182 ? 3.391   10.433  -61.124 1.00 40.71 ? 182  TRP B CE2 1 
ATOM   5591 C CE3 . TRP B 1 182 ? 3.147   11.427  -58.923 1.00 39.35 ? 182  TRP B CE3 1 
ATOM   5592 C CZ2 . TRP B 1 182 ? 2.009   10.301  -61.278 1.00 40.49 ? 182  TRP B CZ2 1 
ATOM   5593 C CZ3 . TRP B 1 182 ? 1.774   11.286  -59.070 1.00 40.60 ? 182  TRP B CZ3 1 
ATOM   5594 C CH2 . TRP B 1 182 ? 1.218   10.731  -60.243 1.00 41.16 ? 182  TRP B CH2 1 
ATOM   5595 N N   . VAL B 1 183 ? 5.333   13.822  -57.523 1.00 43.14 ? 183  VAL B N   1 
ATOM   5596 C CA  . VAL B 1 183 ? 4.263   14.634  -56.946 1.00 43.71 ? 183  VAL B CA  1 
ATOM   5597 C C   . VAL B 1 183 ? 4.360   16.120  -57.380 1.00 44.67 ? 183  VAL B C   1 
ATOM   5598 O O   . VAL B 1 183 ? 3.364   16.713  -57.792 1.00 44.72 ? 183  VAL B O   1 
ATOM   5599 C CB  . VAL B 1 183 ? 4.192   14.458  -55.401 1.00 43.74 ? 183  VAL B CB  1 
ATOM   5600 C CG1 . VAL B 1 183 ? 3.218   15.444  -54.759 1.00 42.14 ? 183  VAL B CG1 1 
ATOM   5601 C CG2 . VAL B 1 183 ? 3.792   13.026  -55.059 1.00 42.45 ? 183  VAL B CG2 1 
ATOM   5602 N N   . GLN B 1 184 ? 5.556   16.700  -57.325 1.00 45.13 ? 184  GLN B N   1 
ATOM   5603 C CA  . GLN B 1 184 ? 5.756   18.061  -57.804 1.00 46.09 ? 184  GLN B CA  1 
ATOM   5604 C C   . GLN B 1 184 ? 5.324   18.237  -59.252 1.00 46.57 ? 184  GLN B C   1 
ATOM   5605 O O   . GLN B 1 184 ? 4.631   19.204  -59.590 1.00 46.40 ? 184  GLN B O   1 
ATOM   5606 C CB  . GLN B 1 184 ? 7.218   18.469  -57.668 1.00 46.19 ? 184  GLN B CB  1 
ATOM   5607 C CG  . GLN B 1 184 ? 7.639   18.676  -56.250 1.00 48.05 ? 184  GLN B CG  1 
ATOM   5608 C CD  . GLN B 1 184 ? 6.923   19.855  -55.626 1.00 50.75 ? 184  GLN B CD  1 
ATOM   5609 O OE1 . GLN B 1 184 ? 7.149   20.999  -56.022 1.00 52.70 ? 184  GLN B OE1 1 
ATOM   5610 N NE2 . GLN B 1 184 ? 6.060   19.586  -54.644 1.00 48.84 ? 184  GLN B NE2 1 
ATOM   5611 N N   . GLU B 1 185 ? 5.737   17.299  -60.103 1.00 46.86 ? 185  GLU B N   1 
ATOM   5612 C CA  . GLU B 1 185 ? 5.504   17.416  -61.536 1.00 47.20 ? 185  GLU B CA  1 
ATOM   5613 C C   . GLU B 1 185 ? 4.085   17.060  -61.962 1.00 46.73 ? 185  GLU B C   1 
ATOM   5614 O O   . GLU B 1 185 ? 3.645   17.491  -63.026 1.00 46.61 ? 185  GLU B O   1 
ATOM   5615 C CB  . GLU B 1 185 ? 6.488   16.553  -62.311 1.00 47.22 ? 185  GLU B CB  1 
ATOM   5616 C CG  . GLU B 1 185 ? 7.931   17.019  -62.184 1.00 51.22 ? 185  GLU B CG  1 
ATOM   5617 C CD  . GLU B 1 185 ? 8.920   15.918  -62.539 1.00 54.96 ? 185  GLU B CD  1 
ATOM   5618 O OE1 . GLU B 1 185 ? 8.491   14.742  -62.634 1.00 56.30 ? 185  GLU B OE1 1 
ATOM   5619 O OE2 . GLU B 1 185 ? 10.121  16.227  -62.709 1.00 56.39 ? 185  GLU B OE2 1 
ATOM   5620 N N   . ASN B 1 186 ? 3.377   16.280  -61.148 1.00 46.08 ? 186  ASN B N   1 
ATOM   5621 C CA  . ASN B 1 186 ? 2.118   15.682  -61.600 1.00 45.98 ? 186  ASN B CA  1 
ATOM   5622 C C   . ASN B 1 186 ? 0.877   15.903  -60.749 1.00 45.31 ? 186  ASN B C   1 
ATOM   5623 O O   . ASN B 1 186 ? -0.230  15.722  -61.243 1.00 45.53 ? 186  ASN B O   1 
ATOM   5624 C CB  . ASN B 1 186 ? 2.303   14.173  -61.824 1.00 46.43 ? 186  ASN B CB  1 
ATOM   5625 C CG  . ASN B 1 186 ? 3.392   13.867  -62.822 1.00 47.20 ? 186  ASN B CG  1 
ATOM   5626 O OD1 . ASN B 1 186 ? 3.206   14.031  -64.021 1.00 48.69 ? 186  ASN B OD1 1 
ATOM   5627 N ND2 . ASN B 1 186 ? 4.539   13.428  -62.331 1.00 48.70 ? 186  ASN B ND2 1 
ATOM   5628 N N   . ILE B 1 187 ? 1.044   16.265  -59.480 1.00 44.88 ? 187  ILE B N   1 
ATOM   5629 C CA  . ILE B 1 187 ? -0.073  16.239  -58.536 1.00 44.36 ? 187  ILE B CA  1 
ATOM   5630 C C   . ILE B 1 187 ? -1.181  17.259  -58.837 1.00 44.79 ? 187  ILE B C   1 
ATOM   5631 O O   . ILE B 1 187 ? -2.339  17.019  -58.493 1.00 44.78 ? 187  ILE B O   1 
ATOM   5632 C CB  . ILE B 1 187 ? 0.403   16.298  -57.045 1.00 44.01 ? 187  ILE B CB  1 
ATOM   5633 C CG1 . ILE B 1 187 ? -0.589  15.583  -56.116 1.00 42.32 ? 187  ILE B CG1 1 
ATOM   5634 C CG2 . ILE B 1 187 ? 0.675   17.726  -56.588 1.00 43.87 ? 187  ILE B CG2 1 
ATOM   5635 C CD1 . ILE B 1 187 ? -0.820  14.117  -56.466 1.00 38.89 ? 187  ILE B CD1 1 
ATOM   5636 N N   . ALA B 1 188 ? -0.819  18.371  -59.484 1.00 45.02 ? 188  ALA B N   1 
ATOM   5637 C CA  . ALA B 1 188 ? -1.781  19.386  -59.912 1.00 45.97 ? 188  ALA B CA  1 
ATOM   5638 C C   . ALA B 1 188 ? -2.866  18.808  -60.823 1.00 46.71 ? 188  ALA B C   1 
ATOM   5639 O O   . ALA B 1 188 ? -4.037  19.183  -60.719 1.00 47.46 ? 188  ALA B O   1 
ATOM   5640 C CB  . ALA B 1 188 ? -1.073  20.565  -60.599 1.00 45.85 ? 188  ALA B CB  1 
ATOM   5641 N N   . ALA B 1 189 ? -2.475  17.882  -61.694 1.00 46.80 ? 189  ALA B N   1 
ATOM   5642 C CA  . ALA B 1 189 ? -3.402  17.209  -62.593 1.00 47.01 ? 189  ALA B CA  1 
ATOM   5643 C C   . ALA B 1 189 ? -4.507  16.466  -61.856 1.00 47.04 ? 189  ALA B C   1 
ATOM   5644 O O   . ALA B 1 189 ? -5.559  16.178  -62.436 1.00 47.48 ? 189  ALA B O   1 
ATOM   5645 C CB  . ALA B 1 189 ? -2.643  16.253  -63.525 1.00 47.17 ? 189  ALA B CB  1 
ATOM   5646 N N   . PHE B 1 190 ? -4.266  16.159  -60.586 1.00 46.80 ? 190  PHE B N   1 
ATOM   5647 C CA  . PHE B 1 190 ? -5.233  15.454  -59.749 1.00 46.67 ? 190  PHE B CA  1 
ATOM   5648 C C   . PHE B 1 190 ? -6.003  16.436  -58.858 1.00 47.09 ? 190  PHE B C   1 
ATOM   5649 O O   . PHE B 1 190 ? -6.956  16.049  -58.163 1.00 46.66 ? 190  PHE B O   1 
ATOM   5650 C CB  . PHE B 1 190 ? -4.528  14.441  -58.853 1.00 46.28 ? 190  PHE B CB  1 
ATOM   5651 C CG  . PHE B 1 190 ? -3.834  13.344  -59.596 1.00 45.73 ? 190  PHE B CG  1 
ATOM   5652 C CD1 . PHE B 1 190 ? -2.524  13.509  -60.041 1.00 44.85 ? 190  PHE B CD1 1 
ATOM   5653 C CD2 . PHE B 1 190 ? -4.472  12.127  -59.817 1.00 45.19 ? 190  PHE B CD2 1 
ATOM   5654 C CE1 . PHE B 1 190 ? -1.872  12.490  -60.712 1.00 44.86 ? 190  PHE B CE1 1 
ATOM   5655 C CE2 . PHE B 1 190 ? -3.825  11.103  -60.494 1.00 45.83 ? 190  PHE B CE2 1 
ATOM   5656 C CZ  . PHE B 1 190 ? -2.523  11.287  -60.945 1.00 45.45 ? 190  PHE B CZ  1 
ATOM   5657 N N   . GLY B 1 191 ? -5.574  17.697  -58.877 1.00 47.34 ? 191  GLY B N   1 
ATOM   5658 C CA  . GLY B 1 191 ? -6.160  18.725  -58.021 1.00 48.01 ? 191  GLY B CA  1 
ATOM   5659 C C   . GLY B 1 191 ? -5.376  18.943  -56.740 1.00 48.22 ? 191  GLY B C   1 
ATOM   5660 O O   . GLY B 1 191 ? -5.762  19.751  -55.899 1.00 48.84 ? 191  GLY B O   1 
ATOM   5661 N N   . GLY B 1 192 ? -4.273  18.221  -56.589 1.00 48.27 ? 192  GLY B N   1 
ATOM   5662 C CA  . GLY B 1 192 ? -3.342  18.465  -55.497 1.00 48.08 ? 192  GLY B CA  1 
ATOM   5663 C C   . GLY B 1 192 ? -2.652  19.802  -55.656 1.00 48.06 ? 192  GLY B C   1 
ATOM   5664 O O   . GLY B 1 192 ? -2.568  20.333  -56.758 1.00 48.30 ? 192  GLY B O   1 
ATOM   5665 N N   . ASP B 1 193 ? -2.180  20.349  -54.541 1.00 48.15 ? 193  ASP B N   1 
ATOM   5666 C CA  . ASP B 1 193 ? -1.425  21.595  -54.504 1.00 48.08 ? 193  ASP B CA  1 
ATOM   5667 C C   . ASP B 1 193 ? 0.053   21.256  -54.263 1.00 48.40 ? 193  ASP B C   1 
ATOM   5668 O O   . ASP B 1 193 ? 0.423   20.873  -53.163 1.00 48.58 ? 193  ASP B O   1 
ATOM   5669 C CB  . ASP B 1 193 ? -1.968  22.444  -53.355 1.00 47.77 ? 193  ASP B CB  1 
ATOM   5670 C CG  . ASP B 1 193 ? -1.368  23.860  -53.292 1.00 48.59 ? 193  ASP B CG  1 
ATOM   5671 O OD1 . ASP B 1 193 ? -0.439  24.196  -54.069 1.00 46.35 ? 193  ASP B OD1 1 
ATOM   5672 O OD2 . ASP B 1 193 ? -1.856  24.642  -52.432 1.00 49.67 ? 193  ASP B OD2 1 
ATOM   5673 N N   . PRO B 1 194 ? 0.908   21.407  -55.284 1.00 49.01 ? 194  PRO B N   1 
ATOM   5674 C CA  . PRO B 1 194 ? 2.326   21.047  -55.088 1.00 49.37 ? 194  PRO B CA  1 
ATOM   5675 C C   . PRO B 1 194 ? 3.077   22.041  -54.191 1.00 50.08 ? 194  PRO B C   1 
ATOM   5676 O O   . PRO B 1 194 ? 4.243   21.829  -53.825 1.00 50.48 ? 194  PRO B O   1 
ATOM   5677 C CB  . PRO B 1 194 ? 2.893   21.063  -56.514 1.00 49.48 ? 194  PRO B CB  1 
ATOM   5678 C CG  . PRO B 1 194 ? 1.990   22.029  -57.279 1.00 48.95 ? 194  PRO B CG  1 
ATOM   5679 C CD  . PRO B 1 194 ? 0.627   21.919  -56.645 1.00 48.88 ? 194  PRO B CD  1 
ATOM   5680 N N   . MET B 1 195 ? 2.405   23.119  -53.826 1.00 50.52 ? 195  MET B N   1 
ATOM   5681 C CA  . MET B 1 195 ? 3.017   24.136  -52.980 1.00 51.42 ? 195  MET B CA  1 
ATOM   5682 C C   . MET B 1 195 ? 2.660   23.958  -51.519 1.00 49.07 ? 195  MET B C   1 
ATOM   5683 O O   . MET B 1 195 ? 3.015   24.780  -50.670 1.00 49.38 ? 195  MET B O   1 
ATOM   5684 C CB  . MET B 1 195 ? 2.637   25.513  -53.474 1.00 50.88 ? 195  MET B CB  1 
ATOM   5685 C CG  . MET B 1 195 ? 3.312   25.799  -54.768 1.00 52.99 ? 195  MET B CG  1 
ATOM   5686 S SD  . MET B 1 195 ? 3.689   27.534  -54.783 1.00 58.05 ? 195  MET B SD  1 
ATOM   5687 C CE  . MET B 1 195 ? 2.299   28.197  -55.737 1.00 58.64 ? 195  MET B CE  1 
ATOM   5688 N N   . SER B 1 196 ? 1.984   22.853  -51.240 1.00 46.90 ? 196  SER B N   1 
ATOM   5689 C CA  . SER B 1 196 ? 1.620   22.488  -49.893 1.00 45.18 ? 196  SER B CA  1 
ATOM   5690 C C   . SER B 1 196 ? 1.662   20.960  -49.796 1.00 44.01 ? 196  SER B C   1 
ATOM   5691 O O   . SER B 1 196 ? 0.621   20.276  -49.856 1.00 42.95 ? 196  SER B O   1 
ATOM   5692 C CB  . SER B 1 196 ? 0.242   23.052  -49.529 1.00 45.11 ? 196  SER B CB  1 
ATOM   5693 O OG  . SER B 1 196 ? -0.104  22.691  -48.208 1.00 44.88 ? 196  SER B OG  1 
ATOM   5694 N N   . VAL B 1 197 ? 2.885   20.441  -49.662 1.00 42.14 ? 197  VAL B N   1 
ATOM   5695 C CA  . VAL B 1 197 ? 3.108   19.012  -49.531 1.00 40.58 ? 197  VAL B CA  1 
ATOM   5696 C C   . VAL B 1 197 ? 3.579   18.714  -48.122 1.00 39.60 ? 197  VAL B C   1 
ATOM   5697 O O   . VAL B 1 197 ? 4.611   19.226  -47.694 1.00 39.82 ? 197  VAL B O   1 
ATOM   5698 C CB  . VAL B 1 197 ? 4.159   18.514  -50.564 1.00 40.95 ? 197  VAL B CB  1 
ATOM   5699 C CG1 . VAL B 1 197 ? 4.532   17.067  -50.304 1.00 39.83 ? 197  VAL B CG1 1 
ATOM   5700 C CG2 . VAL B 1 197 ? 3.634   18.696  -51.995 1.00 40.76 ? 197  VAL B CG2 1 
ATOM   5701 N N   . THR B 1 198 ? 2.817   17.904  -47.399 1.00 38.04 ? 198  THR B N   1 
ATOM   5702 C CA  . THR B 1 198 ? 3.217   17.433  -46.079 1.00 36.98 ? 198  THR B CA  1 
ATOM   5703 C C   . THR B 1 198 ? 3.590   15.965  -46.143 1.00 36.42 ? 198  THR B C   1 
ATOM   5704 O O   . THR B 1 198 ? 2.790   15.134  -46.590 1.00 36.86 ? 198  THR B O   1 
ATOM   5705 C CB  . THR B 1 198 ? 2.066   17.563  -45.062 1.00 37.09 ? 198  THR B CB  1 
ATOM   5706 O OG1 . THR B 1 198 ? 1.478   18.862  -45.186 1.00 38.73 ? 198  THR B OG1 1 
ATOM   5707 C CG2 . THR B 1 198 ? 2.560   17.362  -43.626 1.00 35.35 ? 198  THR B CG2 1 
ATOM   5708 N N   . LEU B 1 199 ? 4.797   15.642  -45.689 1.00 34.94 ? 199  LEU B N   1 
ATOM   5709 C CA  . LEU B 1 199 ? 5.208   14.257  -45.571 1.00 33.32 ? 199  LEU B CA  1 
ATOM   5710 C C   . LEU B 1 199 ? 4.777   13.766  -44.216 1.00 32.93 ? 199  LEU B C   1 
ATOM   5711 O O   . LEU B 1 199 ? 4.888   14.503  -43.249 1.00 33.79 ? 199  LEU B O   1 
ATOM   5712 C CB  . LEU B 1 199 ? 6.722   14.115  -45.665 1.00 32.50 ? 199  LEU B CB  1 
ATOM   5713 C CG  . LEU B 1 199 ? 7.455   14.780  -46.820 1.00 31.52 ? 199  LEU B CG  1 
ATOM   5714 C CD1 . LEU B 1 199 ? 8.977   14.488  -46.711 1.00 27.84 ? 199  LEU B CD1 1 
ATOM   5715 C CD2 . LEU B 1 199 ? 6.859   14.337  -48.168 1.00 29.11 ? 199  LEU B CD2 1 
ATOM   5716 N N   . PHE B 1 200 ? 4.293   12.530  -44.135 1.00 31.86 ? 200  PHE B N   1 
ATOM   5717 C CA  . PHE B 1 200 ? 4.106   11.892  -42.845 1.00 30.90 ? 200  PHE B CA  1 
ATOM   5718 C C   . PHE B 1 200 ? 4.444   10.416  -42.944 1.00 30.95 ? 200  PHE B C   1 
ATOM   5719 O O   . PHE B 1 200 ? 4.381   9.840   -44.020 1.00 31.38 ? 200  PHE B O   1 
ATOM   5720 C CB  . PHE B 1 200 ? 2.709   12.175  -42.263 1.00 30.64 ? 200  PHE B CB  1 
ATOM   5721 C CG  . PHE B 1 200 ? 1.555   11.435  -42.923 1.00 30.04 ? 200  PHE B CG  1 
ATOM   5722 C CD1 . PHE B 1 200 ? 1.347   11.472  -44.291 1.00 29.37 ? 200  PHE B CD1 1 
ATOM   5723 C CD2 . PHE B 1 200 ? 0.617   10.773  -42.128 1.00 30.31 ? 200  PHE B CD2 1 
ATOM   5724 C CE1 . PHE B 1 200 ? 0.227   10.819  -44.870 1.00 31.64 ? 200  PHE B CE1 1 
ATOM   5725 C CE2 . PHE B 1 200 ? -0.492  10.132  -42.679 1.00 29.05 ? 200  PHE B CE2 1 
ATOM   5726 C CZ  . PHE B 1 200 ? -0.689  10.152  -44.059 1.00 30.43 ? 200  PHE B CZ  1 
ATOM   5727 N N   . GLY B 1 201 ? 4.835   9.808   -41.836 1.00 31.00 ? 201  GLY B N   1 
ATOM   5728 C CA  . GLY B 1 201 ? 5.321   8.420   -41.870 1.00 31.45 ? 201  GLY B CA  1 
ATOM   5729 C C   . GLY B 1 201 ? 5.512   7.897   -40.474 1.00 31.12 ? 201  GLY B C   1 
ATOM   5730 O O   . GLY B 1 201 ? 5.595   8.676   -39.539 1.00 31.71 ? 201  GLY B O   1 
ATOM   5731 N N   . GLU B 1 202 ? 5.567   6.581   -40.327 1.00 31.62 ? 202  GLU B N   1 
ATOM   5732 C CA  . GLU B 1 202 ? 5.699   5.960   -39.002 1.00 31.95 ? 202  GLU B CA  1 
ATOM   5733 C C   . GLU B 1 202 ? 6.848   4.939   -38.946 1.00 32.90 ? 202  GLU B C   1 
ATOM   5734 O O   . GLU B 1 202 ? 7.100   4.246   -39.933 1.00 33.59 ? 202  GLU B O   1 
ATOM   5735 C CB  . GLU B 1 202 ? 4.373   5.328   -38.580 1.00 30.57 ? 202  GLU B CB  1 
ATOM   5736 C CG  . GLU B 1 202 ? 4.380   4.707   -37.176 1.00 29.78 ? 202  GLU B CG  1 
ATOM   5737 C CD  . GLU B 1 202 ? 4.769   3.226   -37.185 1.00 30.25 ? 202  GLU B CD  1 
ATOM   5738 O OE1 . GLU B 1 202 ? 4.900   2.656   -38.299 1.00 28.19 ? 202  GLU B OE1 1 
ATOM   5739 O OE2 . GLU B 1 202 ? 4.947   2.635   -36.085 1.00 29.20 ? 202  GLU B OE2 1 
HETATM 5740 N N   A SVV B 1 203 ? 7.508   4.841   -37.785 0.50 33.48 ? 203  SVV B N   1 
HETATM 5741 C CA  A SVV B 1 203 ? 8.738   4.037   -37.580 0.50 34.23 ? 203  SVV B CA  1 
HETATM 5742 C C   A SVV B 1 203 ? 9.858   4.357   -38.592 0.50 34.39 ? 203  SVV B C   1 
HETATM 5743 O O   A SVV B 1 203 ? 10.363  5.492   -38.631 0.50 34.58 ? 203  SVV B O   1 
HETATM 5744 C CB  A SVV B 1 203 ? 8.424   2.546   -37.543 0.50 34.69 ? 203  SVV B CB  1 
HETATM 5745 O OG  A SVV B 1 203 ? 9.431   1.841   -36.825 0.50 35.61 ? 203  SVV B OG  1 
HETATM 5746 O O3  A SVV B 1 203 ? 10.021  0.645   -39.010 0.50 29.82 ? 203  SVV B O3  1 
HETATM 5747 P P1  A SVV B 1 203 ? 9.858   0.467   -37.520 0.50 32.67 ? 203  SVV B P1  1 
HETATM 5748 O O2  A SVV B 1 203 ? 8.880   -0.536  -36.966 0.50 32.03 ? 203  SVV B O2  1 
HETATM 5749 N N4  A SVV B 1 203 ? 11.413  0.284   -36.749 0.50 30.94 ? 203  SVV B N4  1 
HETATM 5750 N N   B SVW B 1 203 ? 7.508   4.841   -37.785 0.50 33.48 ? 203  SVW B N   1 
HETATM 5751 C CA  B SVW B 1 203 ? 8.738   4.037   -37.580 0.50 34.23 ? 203  SVW B CA  1 
HETATM 5752 C C   B SVW B 1 203 ? 9.858   4.357   -38.592 0.50 34.39 ? 203  SVW B C   1 
HETATM 5753 O O   B SVW B 1 203 ? 10.363  5.492   -38.631 0.50 34.58 ? 203  SVW B O   1 
HETATM 5754 C CB  B SVW B 1 203 ? 8.424   2.546   -37.543 0.50 34.69 ? 203  SVW B CB  1 
HETATM 5755 O OG  B SVW B 1 203 ? 9.431   1.841   -36.825 0.50 35.61 ? 203  SVW B OG  1 
HETATM 5756 O O3  B SVW B 1 203 ? 10.992  0.205   -36.651 0.50 56.27 ? 203  SVW B O3  1 
HETATM 5757 P P1  B SVW B 1 203 ? 9.778   0.489   -37.516 0.50 55.10 ? 203  SVW B P1  1 
HETATM 5758 O O4  B SVW B 1 203 ? 9.975   0.679   -39.015 0.50 54.73 ? 203  SVW B O4  1 
HETATM 5759 N N2  B SVW B 1 203 ? 8.607   -0.793  -37.265 0.50 55.67 ? 203  SVW B N2  1 
ATOM   5760 N N   . ALA B 1 204 ? 10.241  3.391   -39.428 1.00 34.16 ? 204  ALA B N   1 
ATOM   5761 C CA  . ALA B 1 204 ? 11.255  3.688   -40.459 1.00 33.53 ? 204  ALA B CA  1 
ATOM   5762 C C   . ALA B 1 204 ? 10.753  4.776   -41.421 1.00 33.01 ? 204  ALA B C   1 
ATOM   5763 O O   . ALA B 1 204 ? 11.552  5.559   -41.960 1.00 32.72 ? 204  ALA B O   1 
ATOM   5764 C CB  . ALA B 1 204 ? 11.674  2.433   -41.211 1.00 32.91 ? 204  ALA B CB  1 
ATOM   5765 N N   . GLY B 1 205 ? 9.431   4.817   -41.622 1.00 32.40 ? 205  GLY B N   1 
ATOM   5766 C CA  . GLY B 1 205 ? 8.777   5.857   -42.438 1.00 32.02 ? 205  GLY B CA  1 
ATOM   5767 C C   . GLY B 1 205 ? 9.020   7.263   -41.899 1.00 31.93 ? 205  GLY B C   1 
ATOM   5768 O O   . GLY B 1 205 ? 9.336   8.184   -42.652 1.00 32.09 ? 205  GLY B O   1 
ATOM   5769 N N   . ALA B 1 206 ? 8.929   7.402   -40.583 1.00 31.81 ? 206  ALA B N   1 
ATOM   5770 C CA  . ALA B 1 206 ? 9.322   8.613   -39.892 1.00 31.91 ? 206  ALA B CA  1 
ATOM   5771 C C   . ALA B 1 206 ? 10.811  8.966   -40.025 1.00 32.24 ? 206  ALA B C   1 
ATOM   5772 O O   . ALA B 1 206 ? 11.133  10.121  -40.341 1.00 32.90 ? 206  ALA B O   1 
ATOM   5773 C CB  . ALA B 1 206 ? 8.929   8.531   -38.432 1.00 32.21 ? 206  ALA B CB  1 
ATOM   5774 N N   . ALA B 1 207 ? 11.711  8.012   -39.783 1.00 32.28 ? 207  ALA B N   1 
ATOM   5775 C CA  . ALA B 1 207 ? 13.151  8.265   -39.953 1.00 32.76 ? 207  ALA B CA  1 
ATOM   5776 C C   . ALA B 1 207 ? 13.468  8.681   -41.379 1.00 33.42 ? 207  ALA B C   1 
ATOM   5777 O O   . ALA B 1 207 ? 14.349  9.521   -41.597 1.00 33.79 ? 207  ALA B O   1 
ATOM   5778 C CB  . ALA B 1 207 ? 13.963  7.058   -39.583 1.00 33.05 ? 207  ALA B CB  1 
ATOM   5779 N N   . SER B 1 208 ? 12.738  8.113   -42.351 1.00 33.78 ? 208  SER B N   1 
ATOM   5780 C CA  . SER B 1 208 ? 12.854  8.553   -43.752 1.00 33.70 ? 208  SER B CA  1 
ATOM   5781 C C   . SER B 1 208 ? 12.392  9.985   -43.890 1.00 33.48 ? 208  SER B C   1 
ATOM   5782 O O   . SER B 1 208 ? 13.051  10.782  -44.535 1.00 33.77 ? 208  SER B O   1 
ATOM   5783 C CB  . SER B 1 208 ? 12.048  7.669   -44.697 1.00 33.50 ? 208  SER B CB  1 
ATOM   5784 O OG  . SER B 1 208 ? 12.381  6.307   -44.524 1.00 35.21 ? 208  SER B OG  1 
ATOM   5785 N N   . VAL B 1 209 ? 11.252  10.319  -43.295 1.00 33.72 ? 209  VAL B N   1 
ATOM   5786 C CA  . VAL B 1 209 ? 10.802  11.711  -43.331 1.00 33.73 ? 209  VAL B CA  1 
ATOM   5787 C C   . VAL B 1 209 ? 11.951  12.592  -42.810 1.00 34.32 ? 209  VAL B C   1 
ATOM   5788 O O   . VAL B 1 209 ? 12.371  13.521  -43.485 1.00 34.67 ? 209  VAL B O   1 
ATOM   5789 C CB  . VAL B 1 209 ? 9.500   11.946  -42.526 1.00 33.44 ? 209  VAL B CB  1 
ATOM   5790 C CG1 . VAL B 1 209 ? 9.221   13.422  -42.421 1.00 30.69 ? 209  VAL B CG1 1 
ATOM   5791 C CG2 . VAL B 1 209 ? 8.317   11.204  -43.183 1.00 31.88 ? 209  VAL B CG2 1 
ATOM   5792 N N   . GLY B 1 210 ? 12.480  12.243  -41.644 1.00 34.69 ? 210  GLY B N   1 
ATOM   5793 C CA  . GLY B 1 210 ? 13.619  12.930  -41.050 1.00 36.43 ? 210  GLY B CA  1 
ATOM   5794 C C   . GLY B 1 210 ? 14.842  13.057  -41.946 1.00 37.50 ? 210  GLY B C   1 
ATOM   5795 O O   . GLY B 1 210 ? 15.482  14.100  -41.974 1.00 37.90 ? 210  GLY B O   1 
ATOM   5796 N N   . MET B 1 211 ? 15.173  12.010  -42.690 1.00 38.35 ? 211  MET B N   1 
ATOM   5797 C CA  . MET B 1 211 ? 16.288  12.118  -43.613 1.00 39.79 ? 211  MET B CA  1 
ATOM   5798 C C   . MET B 1 211 ? 16.009  13.081  -44.780 1.00 39.70 ? 211  MET B C   1 
ATOM   5799 O O   . MET B 1 211 ? 16.924  13.773  -45.229 1.00 39.72 ? 211  MET B O   1 
ATOM   5800 C CB  . MET B 1 211 ? 16.784  10.744  -44.050 1.00 39.59 ? 211  MET B CB  1 
ATOM   5801 C CG  . MET B 1 211 ? 17.631  10.099  -42.947 1.00 40.44 ? 211  MET B CG  1 
ATOM   5802 S SD  . MET B 1 211 ? 17.585  8.312   -42.992 1.00 42.46 ? 211  MET B SD  1 
ATOM   5803 C CE  . MET B 1 211 ? 17.488  7.942   -41.238 1.00 39.22 ? 211  MET B CE  1 
ATOM   5804 N N   . HIS B 1 212 ? 14.757  13.161  -45.238 1.00 39.29 ? 212  HIS B N   1 
ATOM   5805 C CA  . HIS B 1 212 ? 14.421  14.170  -46.234 1.00 39.32 ? 212  HIS B CA  1 
ATOM   5806 C C   . HIS B 1 212 ? 14.557  15.553  -45.636 1.00 40.13 ? 212  HIS B C   1 
ATOM   5807 O O   . HIS B 1 212 ? 15.050  16.462  -46.305 1.00 40.83 ? 212  HIS B O   1 
ATOM   5808 C CB  . HIS B 1 212 ? 13.041  13.950  -46.862 1.00 38.49 ? 212  HIS B CB  1 
ATOM   5809 C CG  . HIS B 1 212 ? 12.950  12.686  -47.656 1.00 37.83 ? 212  HIS B CG  1 
ATOM   5810 N ND1 . HIS B 1 212 ? 13.650  12.491  -48.831 1.00 35.44 ? 212  HIS B ND1 1 
ATOM   5811 C CD2 . HIS B 1 212 ? 12.275  11.533  -47.424 1.00 36.43 ? 212  HIS B CD2 1 
ATOM   5812 C CE1 . HIS B 1 212 ? 13.401  11.276  -49.288 1.00 35.89 ? 212  HIS B CE1 1 
ATOM   5813 N NE2 . HIS B 1 212 ? 12.568  10.676  -48.455 1.00 34.93 ? 212  HIS B NE2 1 
ATOM   5814 N N   . ILE B 1 213 ? 14.154  15.717  -44.372 1.00 40.31 ? 213  ILE B N   1 
ATOM   5815 C CA  . ILE B 1 213 ? 14.424  16.975  -43.676 1.00 40.40 ? 213  ILE B CA  1 
ATOM   5816 C C   . ILE B 1 213 ? 15.926  17.307  -43.708 1.00 40.32 ? 213  ILE B C   1 
ATOM   5817 O O   . ILE B 1 213 ? 16.286  18.451  -43.937 1.00 40.12 ? 213  ILE B O   1 
ATOM   5818 C CB  . ILE B 1 213 ? 13.875  17.002  -42.223 1.00 40.62 ? 213  ILE B CB  1 
ATOM   5819 C CG1 . ILE B 1 213 ? 12.344  17.049  -42.236 1.00 40.68 ? 213  ILE B CG1 1 
ATOM   5820 C CG2 . ILE B 1 213 ? 14.400  18.244  -41.460 1.00 40.27 ? 213  ILE B CG2 1 
ATOM   5821 C CD1 . ILE B 1 213 ? 11.679  16.604  -40.944 1.00 39.70 ? 213  ILE B CD1 1 
ATOM   5822 N N   . LEU B 1 214 ? 16.778  16.292  -43.526 1.00 40.49 ? 214  LEU B N   1 
ATOM   5823 C CA  . LEU B 1 214 ? 18.224  16.470  -43.374 1.00 40.52 ? 214  LEU B CA  1 
ATOM   5824 C C   . LEU B 1 214 ? 19.026  16.358  -44.662 1.00 41.53 ? 214  LEU B C   1 
ATOM   5825 O O   . LEU B 1 214 ? 20.267  16.402  -44.626 1.00 42.00 ? 214  LEU B O   1 
ATOM   5826 C CB  . LEU B 1 214 ? 18.789  15.481  -42.348 1.00 39.92 ? 214  LEU B CB  1 
ATOM   5827 C CG  . LEU B 1 214 ? 18.325  15.588  -40.897 1.00 39.08 ? 214  LEU B CG  1 
ATOM   5828 C CD1 . LEU B 1 214 ? 18.849  14.423  -40.107 1.00 40.03 ? 214  LEU B CD1 1 
ATOM   5829 C CD2 . LEU B 1 214 ? 18.755  16.892  -40.263 1.00 38.63 ? 214  LEU B CD2 1 
ATOM   5830 N N   . SER B 1 215 ? 18.338  16.226  -45.796 1.00 42.20 ? 215  SER B N   1 
ATOM   5831 C CA  . SER B 1 215 ? 19.011  16.136  -47.086 1.00 42.72 ? 215  SER B CA  1 
ATOM   5832 C C   . SER B 1 215 ? 18.533  17.240  -48.006 1.00 43.68 ? 215  SER B C   1 
ATOM   5833 O O   . SER B 1 215 ? 17.346  17.316  -48.331 1.00 43.83 ? 215  SER B O   1 
ATOM   5834 C CB  . SER B 1 215 ? 18.783  14.772  -47.714 1.00 42.42 ? 215  SER B CB  1 
ATOM   5835 O OG  . SER B 1 215 ? 19.614  14.590  -48.838 1.00 42.85 ? 215  SER B OG  1 
ATOM   5836 N N   . LEU B 1 216 ? 19.458  18.102  -48.423 1.00 44.89 ? 216  LEU B N   1 
ATOM   5837 C CA  . LEU B 1 216 ? 19.079  19.335  -49.108 1.00 46.13 ? 216  LEU B CA  1 
ATOM   5838 C C   . LEU B 1 216 ? 18.297  19.120  -50.408 1.00 46.19 ? 216  LEU B C   1 
ATOM   5839 O O   . LEU B 1 216 ? 17.291  19.801  -50.623 1.00 46.37 ? 216  LEU B O   1 
ATOM   5840 C CB  . LEU B 1 216 ? 20.277  20.260  -49.337 1.00 47.00 ? 216  LEU B CB  1 
ATOM   5841 C CG  . LEU B 1 216 ? 19.911  21.640  -49.906 1.00 49.32 ? 216  LEU B CG  1 
ATOM   5842 C CD1 . LEU B 1 216 ? 19.577  22.650  -48.782 1.00 51.76 ? 216  LEU B CD1 1 
ATOM   5843 C CD2 . LEU B 1 216 ? 21.010  22.180  -50.830 1.00 52.41 ? 216  LEU B CD2 1 
ATOM   5844 N N   . PRO B 1 217 ? 18.740  18.187  -51.280 1.00 46.04 ? 217  PRO B N   1 
ATOM   5845 C CA  . PRO B 1 217 ? 17.957  17.990  -52.514 1.00 45.92 ? 217  PRO B CA  1 
ATOM   5846 C C   . PRO B 1 217 ? 16.479  17.626  -52.287 1.00 45.46 ? 217  PRO B C   1 
ATOM   5847 O O   . PRO B 1 217 ? 15.659  17.851  -53.181 1.00 45.90 ? 217  PRO B O   1 
ATOM   5848 C CB  . PRO B 1 217 ? 18.688  16.838  -53.219 1.00 45.81 ? 217  PRO B CB  1 
ATOM   5849 C CG  . PRO B 1 217 ? 20.078  16.891  -52.686 1.00 45.64 ? 217  PRO B CG  1 
ATOM   5850 C CD  . PRO B 1 217 ? 19.914  17.296  -51.244 1.00 46.12 ? 217  PRO B CD  1 
ATOM   5851 N N   . SER B 1 218 ? 16.144  17.082  -51.115 1.00 44.72 ? 218  SER B N   1 
ATOM   5852 C CA  . SER B 1 218 ? 14.749  16.741  -50.796 1.00 44.12 ? 218  SER B CA  1 
ATOM   5853 C C   . SER B 1 218 ? 13.954  17.944  -50.345 1.00 44.15 ? 218  SER B C   1 
ATOM   5854 O O   . SER B 1 218 ? 12.734  17.982  -50.521 1.00 44.32 ? 218  SER B O   1 
ATOM   5855 C CB  . SER B 1 218 ? 14.672  15.678  -49.708 1.00 43.90 ? 218  SER B CB  1 
ATOM   5856 O OG  . SER B 1 218 ? 14.963  14.390  -50.216 1.00 43.32 ? 218  SER B OG  1 
ATOM   5857 N N   . ARG B 1 219 ? 14.646  18.925  -49.770 1.00 43.98 ? 219  ARG B N   1 
ATOM   5858 C CA  . ARG B 1 219 ? 13.994  20.035  -49.077 1.00 44.17 ? 219  ARG B CA  1 
ATOM   5859 C C   . ARG B 1 219 ? 13.090  20.905  -49.938 1.00 43.95 ? 219  ARG B C   1 
ATOM   5860 O O   . ARG B 1 219 ? 12.169  21.532  -49.432 1.00 44.21 ? 219  ARG B O   1 
ATOM   5861 C CB  . ARG B 1 219 ? 15.009  20.890  -48.320 1.00 44.21 ? 219  ARG B CB  1 
ATOM   5862 C CG  . ARG B 1 219 ? 15.576  20.196  -47.077 1.00 45.62 ? 219  ARG B CG  1 
ATOM   5863 C CD  . ARG B 1 219 ? 14.538  20.053  -45.960 1.00 48.87 ? 219  ARG B CD  1 
ATOM   5864 N NE  . ARG B 1 219 ? 14.114  21.342  -45.414 1.00 52.17 ? 219  ARG B NE  1 
ATOM   5865 C CZ  . ARG B 1 219 ? 14.767  22.009  -44.460 1.00 53.82 ? 219  ARG B CZ  1 
ATOM   5866 N NH1 . ARG B 1 219 ? 15.883  21.504  -43.924 1.00 53.19 ? 219  ARG B NH1 1 
ATOM   5867 N NH2 . ARG B 1 219 ? 14.303  23.186  -44.036 1.00 52.80 ? 219  ARG B NH2 1 
ATOM   5868 N N   . SER B 1 220 ? 13.340  20.933  -51.236 1.00 43.79 ? 220  SER B N   1 
ATOM   5869 C CA  . SER B 1 220 ? 12.483  21.676  -52.141 1.00 43.64 ? 220  SER B CA  1 
ATOM   5870 C C   . SER B 1 220 ? 11.305  20.834  -52.660 1.00 42.89 ? 220  SER B C   1 
ATOM   5871 O O   . SER B 1 220 ? 10.619  21.243  -53.597 1.00 43.02 ? 220  SER B O   1 
ATOM   5872 C CB  . SER B 1 220 ? 13.317  22.234  -53.301 1.00 44.04 ? 220  SER B CB  1 
ATOM   5873 O OG  . SER B 1 220 ? 14.057  21.195  -53.929 1.00 46.10 ? 220  SER B OG  1 
ATOM   5874 N N   . LEU B 1 221 ? 11.067  19.673  -52.050 1.00 41.75 ? 221  LEU B N   1 
ATOM   5875 C CA  . LEU B 1 221 ? 9.980   18.786  -52.481 1.00 40.95 ? 221  LEU B CA  1 
ATOM   5876 C C   . LEU B 1 221 ? 8.823   18.695  -51.489 1.00 40.83 ? 221  LEU B C   1 
ATOM   5877 O O   . LEU B 1 221 ? 7.804   18.101  -51.798 1.00 40.95 ? 221  LEU B O   1 
ATOM   5878 C CB  . LEU B 1 221 ? 10.504  17.378  -52.807 1.00 40.72 ? 221  LEU B CB  1 
ATOM   5879 C CG  . LEU B 1 221 ? 11.692  17.307  -53.771 1.00 40.28 ? 221  LEU B CG  1 
ATOM   5880 C CD1 . LEU B 1 221 ? 12.119  15.879  -53.976 1.00 39.71 ? 221  LEU B CD1 1 
ATOM   5881 C CD2 . LEU B 1 221 ? 11.352  17.982  -55.097 1.00 39.61 ? 221  LEU B CD2 1 
ATOM   5882 N N   . PHE B 1 222 ? 8.980   19.275  -50.301 1.00 40.63 ? 222  PHE B N   1 
ATOM   5883 C CA  . PHE B 1 222 ? 7.899   19.322  -49.324 1.00 40.67 ? 222  PHE B CA  1 
ATOM   5884 C C   . PHE B 1 222 ? 8.008   20.573  -48.449 1.00 40.64 ? 222  PHE B C   1 
ATOM   5885 O O   . PHE B 1 222 ? 8.974   21.334  -48.561 1.00 40.58 ? 222  PHE B O   1 
ATOM   5886 C CB  . PHE B 1 222 ? 7.896   18.052  -48.472 1.00 40.40 ? 222  PHE B CB  1 
ATOM   5887 C CG  . PHE B 1 222 ? 9.102   17.907  -47.612 1.00 39.89 ? 222  PHE B CG  1 
ATOM   5888 C CD1 . PHE B 1 222 ? 10.314  17.500  -48.155 1.00 39.50 ? 222  PHE B CD1 1 
ATOM   5889 C CD2 . PHE B 1 222 ? 9.027   18.177  -46.249 1.00 39.63 ? 222  PHE B CD2 1 
ATOM   5890 C CE1 . PHE B 1 222 ? 11.428  17.355  -47.355 1.00 40.72 ? 222  PHE B CE1 1 
ATOM   5891 C CE2 . PHE B 1 222 ? 10.141  18.045  -45.434 1.00 38.64 ? 222  PHE B CE2 1 
ATOM   5892 C CZ  . PHE B 1 222 ? 11.349  17.628  -45.990 1.00 40.03 ? 222  PHE B CZ  1 
ATOM   5893 N N   . HIS B 1 223 ? 7.022   20.786  -47.582 1.00 40.70 ? 223  HIS B N   1 
ATOM   5894 C CA  . HIS B 1 223 ? 6.979   22.009  -46.763 1.00 41.11 ? 223  HIS B CA  1 
ATOM   5895 C C   . HIS B 1 223 ? 6.810   21.714  -45.282 1.00 41.08 ? 223  HIS B C   1 
ATOM   5896 O O   . HIS B 1 223 ? 7.256   22.496  -44.442 1.00 41.79 ? 223  HIS B O   1 
ATOM   5897 C CB  . HIS B 1 223 ? 5.871   22.944  -47.266 1.00 41.22 ? 223  HIS B CB  1 
ATOM   5898 C CG  . HIS B 1 223 ? 5.803   23.009  -48.757 1.00 42.17 ? 223  HIS B CG  1 
ATOM   5899 N ND1 . HIS B 1 223 ? 6.703   23.737  -49.509 1.00 43.72 ? 223  HIS B ND1 1 
ATOM   5900 C CD2 . HIS B 1 223 ? 5.001   22.369  -49.642 1.00 41.01 ? 223  HIS B CD2 1 
ATOM   5901 C CE1 . HIS B 1 223 ? 6.433   23.570  -50.794 1.00 43.13 ? 223  HIS B CE1 1 
ATOM   5902 N NE2 . HIS B 1 223 ? 5.406   22.745  -50.900 1.00 41.87 ? 223  HIS B NE2 1 
ATOM   5903 N N   . ARG B 1 224 ? 6.196   20.574  -44.962 1.00 40.20 ? 224  ARG B N   1 
ATOM   5904 C CA  . ARG B 1 224 ? 5.928   20.200  -43.573 1.00 39.61 ? 224  ARG B CA  1 
ATOM   5905 C C   . ARG B 1 224 ? 6.179   18.712  -43.398 1.00 38.19 ? 224  ARG B C   1 
ATOM   5906 O O   . ARG B 1 224 ? 6.161   17.961  -44.367 1.00 38.31 ? 224  ARG B O   1 
ATOM   5907 C CB  . ARG B 1 224 ? 4.472   20.532  -43.206 1.00 39.68 ? 224  ARG B CB  1 
ATOM   5908 C CG  . ARG B 1 224 ? 4.200   22.010  -42.977 1.00 41.44 ? 224  ARG B CG  1 
ATOM   5909 C CD  . ARG B 1 224 ? 2.685   22.333  -42.909 1.00 40.76 ? 224  ARG B CD  1 
ATOM   5910 N NE  . ARG B 1 224 ? 2.111   22.664  -44.217 1.00 43.69 ? 224  ARG B NE  1 
ATOM   5911 C CZ  . ARG B 1 224 ? 2.392   23.768  -44.912 1.00 45.15 ? 224  ARG B CZ  1 
ATOM   5912 N NH1 . ARG B 1 224 ? 3.254   24.653  -44.445 1.00 44.36 ? 224  ARG B NH1 1 
ATOM   5913 N NH2 . ARG B 1 224 ? 1.827   23.982  -46.097 1.00 47.09 ? 224  ARG B NH2 1 
ATOM   5914 N N   . ALA B 1 225 ? 6.390   18.281  -42.161 1.00 36.77 ? 225  ALA B N   1 
ATOM   5915 C CA  . ALA B 1 225 ? 6.718   16.898  -41.899 1.00 35.36 ? 225  ALA B CA  1 
ATOM   5916 C C   . ALA B 1 225 ? 6.072   16.416  -40.632 1.00 34.49 ? 225  ALA B C   1 
ATOM   5917 O O   . ALA B 1 225 ? 5.970   17.168  -39.667 1.00 34.65 ? 225  ALA B O   1 
ATOM   5918 C CB  . ALA B 1 225 ? 8.210   16.744  -41.794 1.00 35.57 ? 225  ALA B CB  1 
ATOM   5919 N N   . VAL B 1 226 ? 5.666   15.152  -40.633 1.00 33.25 ? 226  VAL B N   1 
ATOM   5920 C CA  . VAL B 1 226 ? 5.154   14.476  -39.448 1.00 32.28 ? 226  VAL B CA  1 
ATOM   5921 C C   . VAL B 1 226 ? 5.955   13.204  -39.235 1.00 32.36 ? 226  VAL B C   1 
ATOM   5922 O O   . VAL B 1 226 ? 6.078   12.394  -40.147 1.00 31.39 ? 226  VAL B O   1 
ATOM   5923 C CB  . VAL B 1 226 ? 3.665   14.055  -39.624 1.00 31.88 ? 226  VAL B CB  1 
ATOM   5924 C CG1 . VAL B 1 226 ? 3.128   13.372  -38.378 1.00 29.42 ? 226  VAL B CG1 1 
ATOM   5925 C CG2 . VAL B 1 226 ? 2.811   15.249  -40.024 1.00 32.95 ? 226  VAL B CG2 1 
ATOM   5926 N N   . LEU B 1 227 ? 6.464   13.028  -38.017 1.00 33.08 ? 227  LEU B N   1 
ATOM   5927 C CA  . LEU B 1 227 ? 7.273   11.868  -37.660 1.00 33.76 ? 227  LEU B CA  1 
ATOM   5928 C C   . LEU B 1 227 ? 6.610   11.161  -36.510 1.00 34.65 ? 227  LEU B C   1 
ATOM   5929 O O   . LEU B 1 227 ? 6.621   11.660  -35.379 1.00 34.56 ? 227  LEU B O   1 
ATOM   5930 C CB  . LEU B 1 227 ? 8.697   12.266  -37.255 1.00 33.28 ? 227  LEU B CB  1 
ATOM   5931 C CG  . LEU B 1 227 ? 9.622   12.762  -38.364 1.00 34.03 ? 227  LEU B CG  1 
ATOM   5932 C CD1 . LEU B 1 227 ? 9.294   14.222  -38.745 1.00 30.63 ? 227  LEU B CD1 1 
ATOM   5933 C CD2 . LEU B 1 227 ? 11.107  12.609  -37.949 1.00 32.99 ? 227  LEU B CD2 1 
ATOM   5934 N N   . GLN B 1 228 ? 6.051   9.987   -36.805 1.00 35.22 ? 228  GLN B N   1 
ATOM   5935 C CA  . GLN B 1 228 ? 5.320   9.203   -35.822 1.00 35.76 ? 228  GLN B CA  1 
ATOM   5936 C C   . GLN B 1 228 ? 6.184   8.039   -35.383 1.00 35.39 ? 228  GLN B C   1 
ATOM   5937 O O   . GLN B 1 228 ? 6.524   7.190   -36.195 1.00 35.49 ? 228  GLN B O   1 
ATOM   5938 C CB  . GLN B 1 228 ? 4.017   8.678   -36.431 1.00 35.41 ? 228  GLN B CB  1 
ATOM   5939 C CG  . GLN B 1 228 ? 3.185   9.774   -37.076 1.00 36.52 ? 228  GLN B CG  1 
ATOM   5940 C CD  . GLN B 1 228 ? 1.968   9.256   -37.835 1.00 36.18 ? 228  GLN B CD  1 
ATOM   5941 O OE1 . GLN B 1 228 ? 1.425   9.959   -38.702 1.00 35.89 ? 228  GLN B OE1 1 
ATOM   5942 N NE2 . GLN B 1 228 ? 1.526   8.035   -37.509 1.00 33.60 ? 228  GLN B NE2 1 
ATOM   5943 N N   . SER B 1 229 ? 6.524   7.990   -34.103 1.00 35.08 ? 229  SER B N   1 
ATOM   5944 C CA  . SER B 1 229 ? 7.277   6.857   -33.551 1.00 35.67 ? 229  SER B CA  1 
ATOM   5945 C C   . SER B 1 229 ? 8.586   6.492   -34.288 1.00 35.43 ? 229  SER B C   1 
ATOM   5946 O O   . SER B 1 229 ? 8.903   5.322   -34.406 1.00 36.15 ? 229  SER B O   1 
ATOM   5947 C CB  . SER B 1 229 ? 6.385   5.602   -33.474 1.00 35.87 ? 229  SER B CB  1 
ATOM   5948 O OG  . SER B 1 229 ? 5.302   5.788   -32.579 1.00 35.37 ? 229  SER B OG  1 
ATOM   5949 N N   . GLY B 1 230 ? 9.333   7.478   -34.768 1.00 34.65 ? 230  GLY B N   1 
ATOM   5950 C CA  . GLY B 1 230 ? 10.613  7.226   -35.398 1.00 34.48 ? 230  GLY B CA  1 
ATOM   5951 C C   . GLY B 1 230 ? 11.327  8.520   -35.743 1.00 34.36 ? 230  GLY B C   1 
ATOM   5952 O O   . GLY B 1 230 ? 10.689  9.565   -35.889 1.00 34.55 ? 230  GLY B O   1 
ATOM   5953 N N   . THR B 1 231 ? 12.645  8.434   -35.895 1.00 34.04 ? 231  THR B N   1 
ATOM   5954 C CA  . THR B 1 231 ? 13.525  9.593   -36.059 1.00 34.39 ? 231  THR B CA  1 
ATOM   5955 C C   . THR B 1 231 ? 14.740  9.217   -36.884 1.00 34.82 ? 231  THR B C   1 
ATOM   5956 O O   . THR B 1 231 ? 15.148  8.060   -36.878 1.00 34.60 ? 231  THR B O   1 
ATOM   5957 C CB  . THR B 1 231 ? 14.094  10.081  -34.691 1.00 34.46 ? 231  THR B CB  1 
ATOM   5958 O OG1 . THR B 1 231 ? 14.844  9.027   -34.085 1.00 33.09 ? 231  THR B OG1 1 
ATOM   5959 C CG2 . THR B 1 231 ? 12.984  10.533  -33.740 1.00 33.32 ? 231  THR B CG2 1 
ATOM   5960 N N   . PRO B 1 232 ? 15.339  10.193  -37.584 1.00 35.53 ? 232  PRO B N   1 
ATOM   5961 C CA  . PRO B 1 232 ? 16.569  9.873   -38.312 1.00 36.26 ? 232  PRO B CA  1 
ATOM   5962 C C   . PRO B 1 232 ? 17.751  9.656   -37.370 1.00 37.27 ? 232  PRO B C   1 
ATOM   5963 O O   . PRO B 1 232 ? 18.670  8.922   -37.697 1.00 38.43 ? 232  PRO B O   1 
ATOM   5964 C CB  . PRO B 1 232 ? 16.793  11.108  -39.196 1.00 35.94 ? 232  PRO B CB  1 
ATOM   5965 C CG  . PRO B 1 232 ? 16.127  12.220  -38.472 1.00 35.79 ? 232  PRO B CG  1 
ATOM   5966 C CD  . PRO B 1 232 ? 14.933  11.601  -37.773 1.00 35.50 ? 232  PRO B CD  1 
ATOM   5967 N N   . ASN B 1 233 ? 17.724  10.303  -36.214 1.00 38.20 ? 233  ASN B N   1 
ATOM   5968 C CA  . ASN B 1 233 ? 18.752  10.144  -35.205 1.00 38.74 ? 233  ASN B CA  1 
ATOM   5969 C C   . ASN B 1 233 ? 18.438  8.876   -34.445 1.00 39.83 ? 233  ASN B C   1 
ATOM   5970 O O   . ASN B 1 233 ? 17.373  8.293   -34.649 1.00 40.24 ? 233  ASN B O   1 
ATOM   5971 C CB  . ASN B 1 233 ? 18.792  11.357  -34.270 1.00 38.01 ? 233  ASN B CB  1 
ATOM   5972 C CG  . ASN B 1 233 ? 17.409  11.748  -33.743 1.00 38.20 ? 233  ASN B CG  1 
ATOM   5973 O OD1 . ASN B 1 233 ? 16.507  12.159  -34.506 1.00 34.35 ? 233  ASN B OD1 1 
ATOM   5974 N ND2 . ASN B 1 233 ? 17.242  11.646  -32.429 1.00 37.69 ? 233  ASN B ND2 1 
ATOM   5975 N N   . GLY B 1 234 ? 19.367  8.426   -33.601 1.00 40.70 ? 234  GLY B N   1 
ATOM   5976 C CA  . GLY B 1 234 ? 19.124  7.260   -32.758 1.00 41.19 ? 234  GLY B CA  1 
ATOM   5977 C C   . GLY B 1 234 ? 19.868  6.024   -33.215 1.00 41.63 ? 234  GLY B C   1 
ATOM   5978 O O   . GLY B 1 234 ? 20.550  6.055   -34.227 1.00 41.69 ? 234  GLY B O   1 
ATOM   5979 N N   . PRO B 1 235 ? 19.707  4.910   -32.482 1.00 41.99 ? 235  PRO B N   1 
ATOM   5980 C CA  . PRO B 1 235 ? 20.580  3.749   -32.649 1.00 41.76 ? 235  PRO B CA  1 
ATOM   5981 C C   . PRO B 1 235 ? 20.306  2.814   -33.831 1.00 41.59 ? 235  PRO B C   1 
ATOM   5982 O O   . PRO B 1 235 ? 21.201  2.025   -34.190 1.00 41.65 ? 235  PRO B O   1 
ATOM   5983 C CB  . PRO B 1 235 ? 20.416  2.999   -31.323 1.00 42.07 ? 235  PRO B CB  1 
ATOM   5984 C CG  . PRO B 1 235 ? 19.077  3.401   -30.809 1.00 42.27 ? 235  PRO B CG  1 
ATOM   5985 C CD  . PRO B 1 235 ? 18.682  4.702   -31.442 1.00 41.99 ? 235  PRO B CD  1 
ATOM   5986 N N   . TRP B 1 236 ? 19.126  2.895   -34.456 1.00 40.58 ? 236  TRP B N   1 
ATOM   5987 C CA  . TRP B 1 236 ? 18.754  1.886   -35.464 1.00 39.44 ? 236  TRP B CA  1 
ATOM   5988 C C   . TRP B 1 236 ? 18.576  2.402   -36.891 1.00 39.42 ? 236  TRP B C   1 
ATOM   5989 O O   . TRP B 1 236 ? 18.571  1.616   -37.830 1.00 39.33 ? 236  TRP B O   1 
ATOM   5990 C CB  . TRP B 1 236 ? 17.496  1.143   -35.023 1.00 39.34 ? 236  TRP B CB  1 
ATOM   5991 C CG  . TRP B 1 236 ? 16.356  2.080   -34.810 1.00 39.22 ? 236  TRP B CG  1 
ATOM   5992 C CD1 . TRP B 1 236 ? 15.993  2.676   -33.637 1.00 39.66 ? 236  TRP B CD1 1 
ATOM   5993 C CD2 . TRP B 1 236 ? 15.459  2.573   -35.808 1.00 39.59 ? 236  TRP B CD2 1 
ATOM   5994 N NE1 . TRP B 1 236 ? 14.920  3.513   -33.838 1.00 40.88 ? 236  TRP B NE1 1 
ATOM   5995 C CE2 . TRP B 1 236 ? 14.560  3.462   -35.159 1.00 40.95 ? 236  TRP B CE2 1 
ATOM   5996 C CE3 . TRP B 1 236 ? 15.312  2.341   -37.183 1.00 38.83 ? 236  TRP B CE3 1 
ATOM   5997 C CZ2 . TRP B 1 236 ? 13.524  4.117   -35.838 1.00 39.69 ? 236  TRP B CZ2 1 
ATOM   5998 C CZ3 . TRP B 1 236 ? 14.294  3.008   -37.870 1.00 40.78 ? 236  TRP B CZ3 1 
ATOM   5999 C CH2 . TRP B 1 236 ? 13.409  3.887   -37.189 1.00 40.18 ? 236  TRP B CH2 1 
ATOM   6000 N N   . ALA B 1 237 ? 18.429  3.712   -37.067 1.00 39.32 ? 237  ALA B N   1 
ATOM   6001 C CA  . ALA B 1 237 ? 18.038  4.264   -38.377 1.00 39.09 ? 237  ALA B CA  1 
ATOM   6002 C C   . ALA B 1 237 ? 19.176  4.484   -39.379 1.00 39.08 ? 237  ALA B C   1 
ATOM   6003 O O   . ALA B 1 237 ? 18.927  4.616   -40.573 1.00 39.63 ? 237  ALA B O   1 
ATOM   6004 C CB  . ALA B 1 237 ? 17.234  5.541   -38.204 1.00 38.97 ? 237  ALA B CB  1 
ATOM   6005 N N   . THR B 1 238 ? 20.416  4.543   -38.912 1.00 38.64 ? 238  THR B N   1 
ATOM   6006 C CA  . THR B 1 238 ? 21.544  4.709   -39.819 1.00 38.37 ? 238  THR B CA  1 
ATOM   6007 C C   . THR B 1 238 ? 22.664  3.799   -39.392 1.00 39.17 ? 238  THR B C   1 
ATOM   6008 O O   . THR B 1 238 ? 22.713  3.367   -38.249 1.00 39.09 ? 238  THR B O   1 
ATOM   6009 C CB  . THR B 1 238 ? 22.104  6.151   -39.831 1.00 37.61 ? 238  THR B CB  1 
ATOM   6010 O OG1 . THR B 1 238 ? 22.370  6.554   -38.493 1.00 36.13 ? 238  THR B OG1 1 
ATOM   6011 C CG2 . THR B 1 238 ? 21.120  7.127   -40.448 1.00 37.56 ? 238  THR B CG2 1 
ATOM   6012 N N   . VAL B 1 239 ? 23.562  3.503   -40.321 1.00 39.91 ? 239  VAL B N   1 
ATOM   6013 C CA  . VAL B 1 239 ? 24.826  2.891   -39.977 1.00 41.01 ? 239  VAL B CA  1 
ATOM   6014 C C   . VAL B 1 239 ? 25.917  3.694   -40.647 1.00 42.43 ? 239  VAL B C   1 
ATOM   6015 O O   . VAL B 1 239 ? 25.638  4.501   -41.540 1.00 43.03 ? 239  VAL B O   1 
ATOM   6016 C CB  . VAL B 1 239 ? 24.901  1.405   -40.397 1.00 40.82 ? 239  VAL B CB  1 
ATOM   6017 C CG1 . VAL B 1 239 ? 24.053  0.561   -39.457 1.00 39.67 ? 239  VAL B CG1 1 
ATOM   6018 C CG2 . VAL B 1 239 ? 24.486  1.217   -41.874 1.00 39.50 ? 239  VAL B CG2 1 
ATOM   6019 N N   . SER B 1 240 ? 27.155  3.487   -40.211 1.00 43.91 ? 240  SER B N   1 
ATOM   6020 C CA  . SER B 1 240 ? 28.305  4.180   -40.794 1.00 45.27 ? 240  SER B CA  1 
ATOM   6021 C C   . SER B 1 240 ? 28.696  3.503   -42.110 1.00 46.14 ? 240  SER B C   1 
ATOM   6022 O O   . SER B 1 240 ? 28.238  2.383   -42.422 1.00 45.46 ? 240  SER B O   1 
ATOM   6023 C CB  . SER B 1 240 ? 29.486  4.121   -39.839 1.00 44.99 ? 240  SER B CB  1 
ATOM   6024 O OG  . SER B 1 240 ? 29.845  2.761   -39.646 1.00 46.94 ? 240  SER B OG  1 
ATOM   6025 N N   . ALA B 1 241 ? 29.556  4.191   -42.866 1.00 47.24 ? 241  ALA B N   1 
ATOM   6026 C CA  . ALA B 1 241 ? 30.107  3.649   -44.105 1.00 48.02 ? 241  ALA B CA  1 
ATOM   6027 C C   . ALA B 1 241 ? 30.746  2.290   -43.850 1.00 48.60 ? 241  ALA B C   1 
ATOM   6028 O O   . ALA B 1 241 ? 30.376  1.304   -44.496 1.00 48.90 ? 241  ALA B O   1 
ATOM   6029 C CB  . ALA B 1 241 ? 31.101  4.607   -44.700 1.00 48.05 ? 241  ALA B CB  1 
ATOM   6030 N N   . GLY B 1 242 ? 31.650  2.238   -42.865 1.00 48.84 ? 242  GLY B N   1 
ATOM   6031 C CA  . GLY B 1 242 ? 32.387  1.024   -42.524 1.00 48.96 ? 242  GLY B CA  1 
ATOM   6032 C C   . GLY B 1 242 ? 31.539  -0.166  -42.139 1.00 49.30 ? 242  GLY B C   1 
ATOM   6033 O O   . GLY B 1 242 ? 31.851  -1.299  -42.504 1.00 50.06 ? 242  GLY B O   1 
ATOM   6034 N N   . GLU B 1 243 ? 30.468  0.076   -41.391 1.00 49.52 ? 243  GLU B N   1 
ATOM   6035 C CA  . GLU B 1 243 ? 29.592  -1.011  -40.940 1.00 49.08 ? 243  GLU B CA  1 
ATOM   6036 C C   . GLU B 1 243 ? 28.626  -1.500  -42.036 1.00 48.88 ? 243  GLU B C   1 
ATOM   6037 O O   . GLU B 1 243 ? 28.202  -2.664  -42.017 1.00 48.64 ? 243  GLU B O   1 
ATOM   6038 C CB  . GLU B 1 243 ? 28.845  -0.601  -39.660 1.00 49.23 ? 243  GLU B CB  1 
ATOM   6039 C CG  . GLU B 1 243 ? 27.776  -1.591  -39.145 1.00 48.70 ? 243  GLU B CG  1 
ATOM   6040 C CD  . GLU B 1 243 ? 28.340  -2.914  -38.642 1.00 49.49 ? 243  GLU B CD  1 
ATOM   6041 O OE1 . GLU B 1 243 ? 27.544  -3.729  -38.129 1.00 49.57 ? 243  GLU B OE1 1 
ATOM   6042 O OE2 . GLU B 1 243 ? 29.561  -3.160  -38.759 1.00 49.28 ? 243  GLU B OE2 1 
ATOM   6043 N N   . ALA B 1 244 ? 28.279  -0.616  -42.974 1.00 48.57 ? 244  ALA B N   1 
ATOM   6044 C CA  . ALA B 1 244 ? 27.495  -1.007  -44.154 1.00 48.86 ? 244  ALA B CA  1 
ATOM   6045 C C   . ALA B 1 244 ? 28.347  -1.880  -45.067 1.00 49.30 ? 244  ALA B C   1 
ATOM   6046 O O   . ALA B 1 244 ? 27.917  -2.961  -45.475 1.00 48.59 ? 244  ALA B O   1 
ATOM   6047 C CB  . ALA B 1 244 ? 26.986  0.214   -44.906 1.00 48.27 ? 244  ALA B CB  1 
ATOM   6048 N N   . ARG B 1 245 ? 29.569  -1.409  -45.349 1.00 50.15 ? 245  ARG B N   1 
ATOM   6049 C CA  . ARG B 1 245 ? 30.543  -2.164  -46.133 1.00 51.11 ? 245  ARG B CA  1 
ATOM   6050 C C   . ARG B 1 245 ? 30.707  -3.572  -45.582 1.00 51.66 ? 245  ARG B C   1 
ATOM   6051 O O   . ARG B 1 245 ? 30.695  -4.553  -46.342 1.00 52.19 ? 245  ARG B O   1 
ATOM   6052 C CB  . ARG B 1 245 ? 31.896  -1.451  -46.166 1.00 51.48 ? 245  ARG B CB  1 
ATOM   6053 C CG  . ARG B 1 245 ? 32.986  -2.219  -46.921 1.00 51.69 ? 245  ARG B CG  1 
ATOM   6054 C CD  . ARG B 1 245 ? 34.166  -1.319  -47.287 1.00 52.22 ? 245  ARG B CD  1 
ATOM   6055 N NE  . ARG B 1 245 ? 33.832  -0.363  -48.343 1.00 52.23 ? 245  ARG B NE  1 
ATOM   6056 C CZ  . ARG B 1 245 ? 33.724  -0.678  -49.634 1.00 52.60 ? 245  ARG B CZ  1 
ATOM   6057 N NH1 . ARG B 1 245 ? 33.417  0.254   -50.538 1.00 50.06 ? 245  ARG B NH1 1 
ATOM   6058 N NH2 . ARG B 1 245 ? 33.918  -1.933  -50.024 1.00 52.65 ? 245  ARG B NH2 1 
ATOM   6059 N N   . ARG B 1 246 ? 30.823  -3.662  -44.261 1.00 51.79 ? 246  ARG B N   1 
ATOM   6060 C CA  . ARG B 1 246 ? 31.041  -4.923  -43.578 1.00 52.27 ? 246  ARG B CA  1 
ATOM   6061 C C   . ARG B 1 246 ? 29.866  -5.885  -43.772 1.00 52.78 ? 246  ARG B C   1 
ATOM   6062 O O   . ARG B 1 246 ? 30.064  -7.059  -44.120 1.00 53.07 ? 246  ARG B O   1 
ATOM   6063 C CB  . ARG B 1 246 ? 31.298  -4.657  -42.090 1.00 52.42 ? 246  ARG B CB  1 
ATOM   6064 C CG  . ARG B 1 246 ? 31.728  -5.863  -41.290 1.00 52.04 ? 246  ARG B CG  1 
ATOM   6065 C CD  . ARG B 1 246 ? 31.279  -5.747  -39.835 1.00 52.83 ? 246  ARG B CD  1 
ATOM   6066 N NE  . ARG B 1 246 ? 30.648  -7.000  -39.438 1.00 53.68 ? 246  ARG B NE  1 
ATOM   6067 C CZ  . ARG B 1 246 ? 29.372  -7.149  -39.096 1.00 53.28 ? 246  ARG B CZ  1 
ATOM   6068 N NH1 . ARG B 1 246 ? 28.555  -6.106  -39.033 1.00 52.00 ? 246  ARG B NH1 1 
ATOM   6069 N NH2 . ARG B 1 246 ? 28.924  -8.359  -38.780 1.00 54.75 ? 246  ARG B NH2 1 
ATOM   6070 N N   . ARG B 1 247 ? 28.647  -5.388  -43.552 1.00 53.13 ? 247  ARG B N   1 
ATOM   6071 C CA  . ARG B 1 247 ? 27.439  -6.227  -43.649 1.00 52.96 ? 247  ARG B CA  1 
ATOM   6072 C C   . ARG B 1 247 ? 27.180  -6.739  -45.074 1.00 52.95 ? 247  ARG B C   1 
ATOM   6073 O O   . ARG B 1 247 ? 26.712  -7.865  -45.255 1.00 52.98 ? 247  ARG B O   1 
ATOM   6074 C CB  . ARG B 1 247 ? 26.211  -5.485  -43.110 1.00 52.83 ? 247  ARG B CB  1 
ATOM   6075 C CG  . ARG B 1 247 ? 26.302  -5.074  -41.640 1.00 52.61 ? 247  ARG B CG  1 
ATOM   6076 C CD  . ARG B 1 247 ? 25.108  -4.215  -41.255 1.00 52.44 ? 247  ARG B CD  1 
ATOM   6077 N NE  . ARG B 1 247 ? 25.153  -3.723  -39.881 1.00 52.49 ? 247  ARG B NE  1 
ATOM   6078 C CZ  . ARG B 1 247 ? 24.085  -3.312  -39.194 1.00 53.47 ? 247  ARG B CZ  1 
ATOM   6079 N NH1 . ARG B 1 247 ? 22.871  -3.354  -39.753 1.00 53.49 ? 247  ARG B NH1 1 
ATOM   6080 N NH2 . ARG B 1 247 ? 24.221  -2.872  -37.944 1.00 50.76 ? 247  ARG B NH2 1 
ATOM   6081 N N   . ALA B 1 248 ? 27.495  -5.911  -46.070 1.00 53.05 ? 248  ALA B N   1 
ATOM   6082 C CA  . ALA B 1 248 ? 27.325  -6.264  -47.479 1.00 53.42 ? 248  ALA B CA  1 
ATOM   6083 C C   . ALA B 1 248 ? 28.325  -7.343  -47.885 1.00 54.12 ? 248  ALA B C   1 
ATOM   6084 O O   . ALA B 1 248 ? 27.943  -8.381  -48.447 1.00 54.36 ? 248  ALA B O   1 
ATOM   6085 C CB  . ALA B 1 248 ? 27.479  -5.028  -48.352 1.00 53.03 ? 248  ALA B CB  1 
ATOM   6086 N N   . THR B 1 249 ? 29.600  -7.092  -47.575 1.00 54.60 ? 249  THR B N   1 
ATOM   6087 C CA  . THR B 1 249 ? 30.682  -8.057  -47.743 1.00 54.80 ? 249  THR B CA  1 
ATOM   6088 C C   . THR B 1 249 ? 30.378  -9.406  -47.082 1.00 55.29 ? 249  THR B C   1 
ATOM   6089 O O   . THR B 1 249 ? 30.680  -10.469 -47.645 1.00 55.51 ? 249  THR B O   1 
ATOM   6090 C CB  . THR B 1 249 ? 32.002  -7.487  -47.187 1.00 54.86 ? 249  THR B CB  1 
ATOM   6091 O OG1 . THR B 1 249 ? 32.341  -6.285  -47.896 1.00 54.61 ? 249  THR B OG1 1 
ATOM   6092 C CG2 . THR B 1 249 ? 33.143  -8.506  -47.319 1.00 54.83 ? 249  THR B CG2 1 
ATOM   6093 N N   . LEU B 1 250 ? 29.778  -9.361  -45.896 1.00 55.78 ? 250  LEU B N   1 
ATOM   6094 C CA  . LEU B 1 250 ? 29.436  -10.576 -45.164 1.00 56.32 ? 250  LEU B CA  1 
ATOM   6095 C C   . LEU B 1 250 ? 28.268  -11.302 -45.808 1.00 56.66 ? 250  LEU B C   1 
ATOM   6096 O O   . LEU B 1 250 ? 28.244  -12.539 -45.854 1.00 56.63 ? 250  LEU B O   1 
ATOM   6097 C CB  . LEU B 1 250 ? 29.140  -10.271 -43.682 1.00 56.48 ? 250  LEU B CB  1 
ATOM   6098 C CG  . LEU B 1 250 ? 28.678  -11.422 -42.770 1.00 56.34 ? 250  LEU B CG  1 
ATOM   6099 C CD1 . LEU B 1 250 ? 29.598  -12.649 -42.847 1.00 56.35 ? 250  LEU B CD1 1 
ATOM   6100 C CD2 . LEU B 1 250 ? 28.526  -10.951 -41.334 1.00 56.39 ? 250  LEU B CD2 1 
ATOM   6101 N N   . LEU B 1 251 ? 27.296  -10.537 -46.301 1.00 57.12 ? 251  LEU B N   1 
ATOM   6102 C CA  . LEU B 1 251 ? 26.140  -11.132 -46.961 1.00 57.35 ? 251  LEU B CA  1 
ATOM   6103 C C   . LEU B 1 251 ? 26.570  -11.791 -48.274 1.00 57.75 ? 251  LEU B C   1 
ATOM   6104 O O   . LEU B 1 251 ? 26.052  -12.849 -48.646 1.00 57.23 ? 251  LEU B O   1 
ATOM   6105 C CB  . LEU B 1 251 ? 25.050  -10.089 -47.204 1.00 57.20 ? 251  LEU B CB  1 
ATOM   6106 C CG  . LEU B 1 251 ? 23.882  -10.597 -48.040 1.00 56.62 ? 251  LEU B CG  1 
ATOM   6107 C CD1 . LEU B 1 251 ? 22.746  -11.090 -47.175 1.00 55.87 ? 251  LEU B CD1 1 
ATOM   6108 C CD2 . LEU B 1 251 ? 23.431  -9.520  -48.976 1.00 57.45 ? 251  LEU B CD2 1 
ATOM   6109 N N   . ALA B 1 252 ? 27.523  -11.159 -48.960 1.00 58.46 ? 252  ALA B N   1 
ATOM   6110 C CA  . ALA B 1 252 ? 28.064  -11.690 -50.213 1.00 59.31 ? 252  ALA B CA  1 
ATOM   6111 C C   . ALA B 1 252 ? 28.808  -13.001 -49.973 1.00 59.98 ? 252  ALA B C   1 
ATOM   6112 O O   . ALA B 1 252 ? 28.581  -13.987 -50.679 1.00 60.00 ? 252  ALA B O   1 
ATOM   6113 C CB  . ALA B 1 252 ? 28.953  -10.677 -50.884 1.00 58.96 ? 252  ALA B CB  1 
ATOM   6114 N N   . ARG B 1 253 ? 29.670  -13.012 -48.959 1.00 61.10 ? 253  ARG B N   1 
ATOM   6115 C CA  . ARG B 1 253 ? 30.372  -14.233 -48.548 1.00 62.05 ? 253  ARG B CA  1 
ATOM   6116 C C   . ARG B 1 253 ? 29.362  -15.364 -48.291 1.00 62.16 ? 253  ARG B C   1 
ATOM   6117 O O   . ARG B 1 253 ? 29.548  -16.488 -48.753 1.00 62.40 ? 253  ARG B O   1 
ATOM   6118 C CB  . ARG B 1 253 ? 31.238  -13.973 -47.304 1.00 62.16 ? 253  ARG B CB  1 
ATOM   6119 C CG  . ARG B 1 253 ? 32.481  -14.850 -47.189 1.00 64.00 ? 253  ARG B CG  1 
ATOM   6120 C CD  . ARG B 1 253 ? 32.908  -15.050 -45.722 1.00 66.42 ? 253  ARG B CD  1 
ATOM   6121 N NE  . ARG B 1 253 ? 32.234  -16.190 -45.085 1.00 67.37 ? 253  ARG B NE  1 
ATOM   6122 C CZ  . ARG B 1 253 ? 32.042  -16.327 -43.771 1.00 67.98 ? 253  ARG B CZ  1 
ATOM   6123 N NH1 . ARG B 1 253 ? 32.461  -15.389 -42.921 1.00 67.91 ? 253  ARG B NH1 1 
ATOM   6124 N NH2 . ARG B 1 253 ? 31.416  -17.402 -43.301 1.00 68.11 ? 253  ARG B NH2 1 
ATOM   6125 N N   . LEU B 1 254 ? 28.277  -15.047 -47.589 1.00 62.36 ? 254  LEU B N   1 
ATOM   6126 C CA  . LEU B 1 254 ? 27.244  -16.032 -47.265 1.00 62.52 ? 254  LEU B CA  1 
ATOM   6127 C C   . LEU B 1 254 ? 26.484  -16.572 -48.471 1.00 62.73 ? 254  LEU B C   1 
ATOM   6128 O O   . LEU B 1 254 ? 25.897  -17.651 -48.400 1.00 62.59 ? 254  LEU B O   1 
ATOM   6129 C CB  . LEU B 1 254 ? 26.256  -15.450 -46.256 1.00 62.50 ? 254  LEU B CB  1 
ATOM   6130 C CG  . LEU B 1 254 ? 26.704  -15.388 -44.795 1.00 63.07 ? 254  LEU B CG  1 
ATOM   6131 C CD1 . LEU B 1 254 ? 25.831  -14.417 -44.028 1.00 62.96 ? 254  LEU B CD1 1 
ATOM   6132 C CD2 . LEU B 1 254 ? 26.689  -16.784 -44.142 1.00 63.35 ? 254  LEU B CD2 1 
ATOM   6133 N N   . VAL B 1 255 ? 26.470  -15.811 -49.563 1.00 63.37 ? 255  VAL B N   1 
ATOM   6134 C CA  . VAL B 1 255 ? 25.831  -16.265 -50.806 1.00 63.91 ? 255  VAL B CA  1 
ATOM   6135 C C   . VAL B 1 255 ? 26.868  -16.587 -51.892 1.00 64.42 ? 255  VAL B C   1 
ATOM   6136 O O   . VAL B 1 255 ? 26.525  -16.767 -53.067 1.00 64.86 ? 255  VAL B O   1 
ATOM   6137 C CB  . VAL B 1 255 ? 24.709  -15.295 -51.325 1.00 63.80 ? 255  VAL B CB  1 
ATOM   6138 C CG1 . VAL B 1 255 ? 23.530  -15.264 -50.351 1.00 63.58 ? 255  VAL B CG1 1 
ATOM   6139 C CG2 . VAL B 1 255 ? 25.245  -13.896 -51.599 1.00 63.13 ? 255  VAL B CG2 1 
ATOM   6140 N N   . GLY B 1 256 ? 28.133  -16.636 -51.476 1.00 64.65 ? 256  GLY B N   1 
ATOM   6141 C CA  . GLY B 1 256 ? 29.236  -17.108 -52.302 1.00 64.85 ? 256  GLY B CA  1 
ATOM   6142 C C   . GLY B 1 256 ? 29.684  -16.165 -53.398 1.00 65.07 ? 256  GLY B C   1 
ATOM   6143 O O   . GLY B 1 256 ? 29.658  -16.532 -54.561 1.00 65.44 ? 256  GLY B O   1 
ATOM   6144 N N   . CYS B 1 257 ? 30.120  -14.961 -53.044 1.00 65.17 ? 257  CYS B N   1 
ATOM   6145 C CA  . CYS B 1 257 ? 30.515  -13.990 -54.063 1.00 65.47 ? 257  CYS B CA  1 
ATOM   6146 C C   . CYS B 1 257 ? 31.857  -13.318 -53.774 1.00 65.68 ? 257  CYS B C   1 
ATOM   6147 O O   . CYS B 1 257 ? 32.139  -12.947 -52.636 1.00 65.84 ? 257  CYS B O   1 
ATOM   6148 C CB  . CYS B 1 257 ? 29.395  -12.957 -54.275 1.00 65.39 ? 257  CYS B CB  1 
ATOM   6149 S SG  . CYS B 1 257 ? 27.884  -13.638 -55.099 1.00 65.86 ? 257  CYS B SG  1 
ATOM   6150 N N   . ASN B 1 265 ? 37.700  -6.246  -55.054 1.00 73.44 ? 265  ASN B N   1 
ATOM   6151 C CA  . ASN B 1 265 ? 37.025  -5.484  -56.105 1.00 73.84 ? 265  ASN B CA  1 
ATOM   6152 C C   . ASN B 1 265 ? 35.502  -5.361  -55.893 1.00 73.37 ? 265  ASN B C   1 
ATOM   6153 O O   . ASN B 1 265 ? 34.772  -6.371  -55.944 1.00 73.37 ? 265  ASN B O   1 
ATOM   6154 C CB  . ASN B 1 265 ? 37.317  -6.106  -57.480 1.00 74.22 ? 265  ASN B CB  1 
ATOM   6155 C CG  . ASN B 1 265 ? 36.930  -5.189  -58.635 1.00 75.50 ? 265  ASN B CG  1 
ATOM   6156 O OD1 . ASN B 1 265 ? 35.892  -5.384  -59.277 1.00 76.02 ? 265  ASN B OD1 1 
ATOM   6157 N ND2 . ASN B 1 265 ? 37.767  -4.180  -58.902 1.00 75.99 ? 265  ASN B ND2 1 
ATOM   6158 N N   . ASP B 1 266 ? 35.034  -4.130  -55.663 1.00 72.48 ? 266  ASP B N   1 
ATOM   6159 C CA  . ASP B 1 266 ? 33.599  -3.857  -55.470 1.00 71.57 ? 266  ASP B CA  1 
ATOM   6160 C C   . ASP B 1 266 ? 32.748  -4.282  -56.674 1.00 71.08 ? 266  ASP B C   1 
ATOM   6161 O O   . ASP B 1 266 ? 31.779  -5.032  -56.515 1.00 70.58 ? 266  ASP B O   1 
ATOM   6162 C CB  . ASP B 1 266 ? 33.353  -2.380  -55.125 1.00 71.38 ? 266  ASP B CB  1 
ATOM   6163 C CG  . ASP B 1 266 ? 33.577  -2.066  -53.642 1.00 70.88 ? 266  ASP B CG  1 
ATOM   6164 O OD1 . ASP B 1 266 ? 33.741  -3.008  -52.830 1.00 69.69 ? 266  ASP B OD1 1 
ATOM   6165 O OD2 . ASP B 1 266 ? 33.580  -0.865  -53.287 1.00 69.81 ? 266  ASP B OD2 1 
ATOM   6166 N N   . THR B 1 267 ? 33.136  -3.824  -57.868 1.00 70.70 ? 267  THR B N   1 
ATOM   6167 C CA  . THR B 1 267 ? 32.414  -4.122  -59.115 1.00 70.25 ? 267  THR B CA  1 
ATOM   6168 C C   . THR B 1 267 ? 32.088  -5.611  -59.248 1.00 70.21 ? 267  THR B C   1 
ATOM   6169 O O   . THR B 1 267 ? 30.941  -5.980  -59.544 1.00 70.21 ? 267  THR B O   1 
ATOM   6170 C CB  . THR B 1 267 ? 33.189  -3.631  -60.365 1.00 70.28 ? 267  THR B CB  1 
ATOM   6171 O OG1 . THR B 1 267 ? 33.622  -2.280  -60.164 1.00 69.71 ? 267  THR B OG1 1 
ATOM   6172 C CG2 . THR B 1 267 ? 32.316  -3.695  -61.626 1.00 70.14 ? 267  THR B CG2 1 
ATOM   6173 N N   . GLU B 1 268 ? 33.092  -6.451  -59.001 1.00 69.93 ? 268  GLU B N   1 
ATOM   6174 C CA  . GLU B 1 268 ? 32.950  -7.900  -59.118 1.00 70.13 ? 268  GLU B CA  1 
ATOM   6175 C C   . GLU B 1 268 ? 32.027  -8.475  -58.054 1.00 68.66 ? 268  GLU B C   1 
ATOM   6176 O O   . GLU B 1 268 ? 31.247  -9.388  -58.331 1.00 68.62 ? 268  GLU B O   1 
ATOM   6177 C CB  . GLU B 1 268 ? 34.320  -8.594  -59.063 1.00 70.27 ? 268  GLU B CB  1 
ATOM   6178 C CG  . GLU B 1 268 ? 34.988  -8.846  -60.437 1.00 72.31 ? 268  GLU B CG  1 
ATOM   6179 C CD  . GLU B 1 268 ? 36.179  -9.838  -60.362 1.00 72.80 ? 268  GLU B CD  1 
ATOM   6180 O OE1 . GLU B 1 268 ? 36.210  -10.685 -59.427 1.00 75.88 ? 268  GLU B OE1 1 
ATOM   6181 O OE2 . GLU B 1 268 ? 37.085  -9.766  -61.238 1.00 75.48 ? 268  GLU B OE2 1 
ATOM   6182 N N   . LEU B 1 269 ? 32.121  -7.943  -56.838 1.00 67.62 ? 269  LEU B N   1 
ATOM   6183 C CA  . LEU B 1 269 ? 31.264  -8.381  -55.733 1.00 66.15 ? 269  LEU B CA  1 
ATOM   6184 C C   . LEU B 1 269 ? 29.797  -8.121  -56.065 1.00 65.07 ? 269  LEU B C   1 
ATOM   6185 O O   . LEU B 1 269 ? 28.960  -9.014  -55.940 1.00 64.68 ? 269  LEU B O   1 
ATOM   6186 C CB  . LEU B 1 269 ? 31.650  -7.675  -54.427 1.00 66.18 ? 269  LEU B CB  1 
ATOM   6187 C CG  . LEU B 1 269 ? 31.200  -8.309  -53.106 1.00 66.53 ? 269  LEU B CG  1 
ATOM   6188 C CD1 . LEU B 1 269 ? 31.955  -9.603  -52.822 1.00 67.47 ? 269  LEU B CD1 1 
ATOM   6189 C CD2 . LEU B 1 269 ? 31.413  -7.350  -51.969 1.00 66.36 ? 269  LEU B CD2 1 
ATOM   6190 N N   . ILE B 1 270 ? 29.502  -6.903  -56.515 1.00 63.72 ? 270  ILE B N   1 
ATOM   6191 C CA  . ILE B 1 270 ? 28.129  -6.505  -56.813 1.00 62.75 ? 270  ILE B CA  1 
ATOM   6192 C C   . ILE B 1 270 ? 27.566  -7.249  -58.028 1.00 62.35 ? 270  ILE B C   1 
ATOM   6193 O O   . ILE B 1 270 ? 26.394  -7.672  -58.013 1.00 62.01 ? 270  ILE B O   1 
ATOM   6194 C CB  . ILE B 1 270 ? 28.003  -4.974  -56.971 1.00 62.87 ? 270  ILE B CB  1 
ATOM   6195 C CG1 . ILE B 1 270 ? 28.421  -4.291  -55.667 1.00 62.27 ? 270  ILE B CG1 1 
ATOM   6196 C CG2 . ILE B 1 270 ? 26.576  -4.571  -57.333 1.00 61.96 ? 270  ILE B CG2 1 
ATOM   6197 C CD1 . ILE B 1 270 ? 29.107  -2.968  -55.874 1.00 62.98 ? 270  ILE B CD1 1 
ATOM   6198 N N   . ALA B 1 271 ? 28.399  -7.436  -59.056 1.00 61.38 ? 271  ALA B N   1 
ATOM   6199 C CA  . ALA B 1 271 ? 27.977  -8.185  -60.238 1.00 60.62 ? 271  ALA B CA  1 
ATOM   6200 C C   . ALA B 1 271 ? 27.512  -9.602  -59.897 1.00 60.09 ? 271  ALA B C   1 
ATOM   6201 O O   . ALA B 1 271 ? 26.486  -10.053 -60.411 1.00 60.05 ? 271  ALA B O   1 
ATOM   6202 C CB  . ALA B 1 271 ? 29.057  -8.194  -61.295 1.00 60.73 ? 271  ALA B CB  1 
ATOM   6203 N N   . CYS B 1 272 ? 28.235  -10.283 -59.007 1.00 59.76 ? 272  CYS B N   1 
ATOM   6204 C CA  . CYS B 1 272 ? 27.820  -11.621 -58.533 1.00 58.91 ? 272  CYS B CA  1 
ATOM   6205 C C   . CYS B 1 272 ? 26.540  -11.565 -57.696 1.00 57.84 ? 272  CYS B C   1 
ATOM   6206 O O   . CYS B 1 272 ? 25.680  -12.451 -57.794 1.00 57.82 ? 272  CYS B O   1 
ATOM   6207 C CB  . CYS B 1 272 ? 28.939  -12.313 -57.740 1.00 58.96 ? 272  CYS B CB  1 
ATOM   6208 S SG  . CYS B 1 272 ? 28.488  -13.960 -57.086 1.00 61.01 ? 272  CYS B SG  1 
ATOM   6209 N N   . LEU B 1 273 ? 26.424  -10.537 -56.860 1.00 56.67 ? 273  LEU B N   1 
ATOM   6210 C CA  . LEU B 1 273 ? 25.201  -10.323 -56.091 1.00 55.75 ? 273  LEU B CA  1 
ATOM   6211 C C   . LEU B 1 273 ? 23.986  -10.142 -57.013 1.00 55.39 ? 273  LEU B C   1 
ATOM   6212 O O   . LEU B 1 273 ? 22.916  -10.670 -56.731 1.00 54.76 ? 273  LEU B O   1 
ATOM   6213 C CB  . LEU B 1 273 ? 25.348  -9.141  -55.130 1.00 55.31 ? 273  LEU B CB  1 
ATOM   6214 C CG  . LEU B 1 273 ? 26.080  -9.380  -53.809 1.00 53.57 ? 273  LEU B CG  1 
ATOM   6215 C CD1 . LEU B 1 273 ? 26.253  -8.066  -53.066 1.00 52.37 ? 273  LEU B CD1 1 
ATOM   6216 C CD2 . LEU B 1 273 ? 25.360  -10.393 -52.934 1.00 52.26 ? 273  LEU B CD2 1 
ATOM   6217 N N   . ARG B 1 274 ? 24.182  -9.440  -58.132 1.00 55.41 ? 274  ARG B N   1 
ATOM   6218 C CA  . ARG B 1 274 ? 23.124  -9.239  -59.141 1.00 55.67 ? 274  ARG B CA  1 
ATOM   6219 C C   . ARG B 1 274 ? 22.634  -10.526 -59.826 1.00 55.62 ? 274  ARG B C   1 
ATOM   6220 O O   . ARG B 1 274 ? 21.496  -10.582 -60.321 1.00 55.49 ? 274  ARG B O   1 
ATOM   6221 C CB  . ARG B 1 274 ? 23.544  -8.207  -60.188 1.00 55.61 ? 274  ARG B CB  1 
ATOM   6222 C CG  . ARG B 1 274 ? 23.778  -6.834  -59.592 1.00 57.42 ? 274  ARG B CG  1 
ATOM   6223 C CD  . ARG B 1 274 ? 23.356  -5.751  -60.524 1.00 60.01 ? 274  ARG B CD  1 
ATOM   6224 N NE  . ARG B 1 274 ? 24.479  -5.008  -61.084 1.00 64.08 ? 274  ARG B NE  1 
ATOM   6225 C CZ  . ARG B 1 274 ? 24.865  -3.800  -60.658 1.00 66.20 ? 274  ARG B CZ  1 
ATOM   6226 N NH1 . ARG B 1 274 ? 24.243  -3.191  -59.643 1.00 64.84 ? 274  ARG B NH1 1 
ATOM   6227 N NH2 . ARG B 1 274 ? 25.882  -3.189  -61.251 1.00 67.62 ? 274  ARG B NH2 1 
ATOM   6228 N N   . THR B 1 275 ? 23.481  -11.554 -59.847 1.00 55.40 ? 275  THR B N   1 
ATOM   6229 C CA  . THR B 1 275 ? 23.123  -12.822 -60.484 1.00 55.01 ? 275  THR B CA  1 
ATOM   6230 C C   . THR B 1 275 ? 22.232  -13.640 -59.573 1.00 55.08 ? 275  THR B C   1 
ATOM   6231 O O   . THR B 1 275 ? 21.624  -14.606 -60.011 1.00 55.74 ? 275  THR B O   1 
ATOM   6232 C CB  . THR B 1 275 ? 24.364  -13.676 -60.874 1.00 55.14 ? 275  THR B CB  1 
ATOM   6233 O OG1 . THR B 1 275 ? 25.028  -14.150 -59.692 1.00 54.75 ? 275  THR B OG1 1 
ATOM   6234 C CG2 . THR B 1 275 ? 25.341  -12.880 -61.764 1.00 54.33 ? 275  THR B CG2 1 
ATOM   6235 N N   . ARG B 1 276 ? 22.140  -13.254 -58.306 1.00 54.67 ? 276  ARG B N   1 
ATOM   6236 C CA  . ARG B 1 276 ? 21.408  -14.064 -57.353 1.00 54.58 ? 276  ARG B CA  1 
ATOM   6237 C C   . ARG B 1 276 ? 19.902  -13.788 -57.323 1.00 54.44 ? 276  ARG B C   1 
ATOM   6238 O O   . ARG B 1 276 ? 19.478  -12.632 -57.254 1.00 54.39 ? 276  ARG B O   1 
ATOM   6239 C CB  . ARG B 1 276 ? 22.018  -13.937 -55.956 1.00 54.75 ? 276  ARG B CB  1 
ATOM   6240 C CG  . ARG B 1 276 ? 23.442  -14.502 -55.840 1.00 56.18 ? 276  ARG B CG  1 
ATOM   6241 C CD  . ARG B 1 276 ? 23.477  -16.038 -55.881 1.00 57.93 ? 276  ARG B CD  1 
ATOM   6242 N NE  . ARG B 1 276 ? 24.785  -16.547 -55.454 1.00 61.10 ? 276  ARG B NE  1 
ATOM   6243 C CZ  . ARG B 1 276 ? 25.836  -16.717 -56.258 1.00 61.90 ? 276  ARG B CZ  1 
ATOM   6244 N NH1 . ARG B 1 276 ? 25.753  -16.424 -57.554 1.00 63.38 ? 276  ARG B NH1 1 
ATOM   6245 N NH2 . ARG B 1 276 ? 26.977  -17.175 -55.766 1.00 60.93 ? 276  ARG B NH2 1 
ATOM   6246 N N   . PRO B 1 277 ? 19.088  -14.855 -57.401 1.00 53.98 ? 277  PRO B N   1 
ATOM   6247 C CA  . PRO B 1 277 ? 17.661  -14.771 -57.111 1.00 53.77 ? 277  PRO B CA  1 
ATOM   6248 C C   . PRO B 1 277 ? 17.369  -13.941 -55.860 1.00 53.77 ? 277  PRO B C   1 
ATOM   6249 O O   . PRO B 1 277 ? 18.157  -13.937 -54.912 1.00 53.43 ? 277  PRO B O   1 
ATOM   6250 C CB  . PRO B 1 277 ? 17.257  -16.232 -56.869 1.00 53.84 ? 277  PRO B CB  1 
ATOM   6251 C CG  . PRO B 1 277 ? 18.283  -17.056 -57.543 1.00 53.51 ? 277  PRO B CG  1 
ATOM   6252 C CD  . PRO B 1 277 ? 19.490  -16.203 -57.838 1.00 53.89 ? 277  PRO B CD  1 
ATOM   6253 N N   . ALA B 1 278 ? 16.226  -13.256 -55.868 1.00 54.03 ? 278  ALA B N   1 
ATOM   6254 C CA  . ALA B 1 278 ? 15.840  -12.362 -54.782 1.00 53.61 ? 278  ALA B CA  1 
ATOM   6255 C C   . ALA B 1 278 ? 15.821  -13.048 -53.411 1.00 53.60 ? 278  ALA B C   1 
ATOM   6256 O O   . ALA B 1 278 ? 16.398  -12.527 -52.450 1.00 53.53 ? 278  ALA B O   1 
ATOM   6257 C CB  . ALA B 1 278 ? 14.508  -11.717 -55.083 1.00 53.61 ? 278  ALA B CB  1 
ATOM   6258 N N   . GLN B 1 279 ? 15.196  -14.224 -53.331 1.00 53.42 ? 279  GLN B N   1 
ATOM   6259 C CA  . GLN B 1 279 ? 15.050  -14.940 -52.052 1.00 53.26 ? 279  GLN B CA  1 
ATOM   6260 C C   . GLN B 1 279 ? 16.369  -15.387 -51.418 1.00 53.47 ? 279  GLN B C   1 
ATOM   6261 O O   . GLN B 1 279 ? 16.445  -15.529 -50.198 1.00 53.71 ? 279  GLN B O   1 
ATOM   6262 C CB  . GLN B 1 279 ? 14.084  -16.122 -52.180 1.00 52.79 ? 279  GLN B CB  1 
ATOM   6263 C CG  . GLN B 1 279 ? 13.637  -16.708 -50.845 1.00 52.41 ? 279  GLN B CG  1 
ATOM   6264 C CD  . GLN B 1 279 ? 13.028  -15.684 -49.889 1.00 52.16 ? 279  GLN B CD  1 
ATOM   6265 O OE1 . GLN B 1 279 ? 12.298  -14.780 -50.293 1.00 52.84 ? 279  GLN B OE1 1 
ATOM   6266 N NE2 . GLN B 1 279 ? 13.306  -15.846 -48.610 1.00 51.95 ? 279  GLN B NE2 1 
ATOM   6267 N N   . ASP B 1 280 ? 17.397  -15.599 -52.240 1.00 53.83 ? 280  ASP B N   1 
ATOM   6268 C CA  . ASP B 1 280 ? 18.741  -15.959 -51.752 1.00 54.13 ? 280  ASP B CA  1 
ATOM   6269 C C   . ASP B 1 280 ? 19.344  -14.857 -50.877 1.00 54.00 ? 280  ASP B C   1 
ATOM   6270 O O   . ASP B 1 280 ? 19.955  -15.146 -49.847 1.00 54.52 ? 280  ASP B O   1 
ATOM   6271 C CB  . ASP B 1 280 ? 19.704  -16.272 -52.913 1.00 54.19 ? 280  ASP B CB  1 
ATOM   6272 C CG  . ASP B 1 280 ? 19.425  -17.621 -53.585 1.00 55.04 ? 280  ASP B CG  1 
ATOM   6273 O OD1 . ASP B 1 280 ? 18.478  -18.336 -53.174 1.00 57.24 ? 280  ASP B OD1 1 
ATOM   6274 O OD2 . ASP B 1 280 ? 20.164  -17.959 -54.541 1.00 53.92 ? 280  ASP B OD2 1 
ATOM   6275 N N   . LEU B 1 281 ? 19.180  -13.602 -51.294 1.00 53.75 ? 281  LEU B N   1 
ATOM   6276 C CA  . LEU B 1 281 ? 19.680  -12.449 -50.537 1.00 53.21 ? 281  LEU B CA  1 
ATOM   6277 C C   . LEU B 1 281 ? 18.907  -12.275 -49.232 1.00 53.10 ? 281  LEU B C   1 
ATOM   6278 O O   . LEU B 1 281 ? 19.495  -12.004 -48.198 1.00 52.99 ? 281  LEU B O   1 
ATOM   6279 C CB  . LEU B 1 281 ? 19.622  -11.175 -51.385 1.00 53.05 ? 281  LEU B CB  1 
ATOM   6280 C CG  . LEU B 1 281 ? 20.370  -11.196 -52.725 1.00 52.82 ? 281  LEU B CG  1 
ATOM   6281 C CD1 . LEU B 1 281 ? 20.395  -9.818  -53.365 1.00 52.89 ? 281  LEU B CD1 1 
ATOM   6282 C CD2 . LEU B 1 281 ? 21.788  -11.720 -52.574 1.00 51.58 ? 281  LEU B CD2 1 
ATOM   6283 N N   . VAL B 1 282 ? 17.593  -12.475 -49.296 1.00 53.06 ? 282  VAL B N   1 
ATOM   6284 C CA  . VAL B 1 282 ? 16.703  -12.375 -48.147 1.00 52.99 ? 282  VAL B CA  1 
ATOM   6285 C C   . VAL B 1 282 ? 16.975  -13.489 -47.125 1.00 53.59 ? 282  VAL B C   1 
ATOM   6286 O O   . VAL B 1 282 ? 16.938  -13.250 -45.907 1.00 53.61 ? 282  VAL B O   1 
ATOM   6287 C CB  . VAL B 1 282 ? 15.212  -12.338 -48.616 1.00 52.93 ? 282  VAL B CB  1 
ATOM   6288 C CG1 . VAL B 1 282 ? 14.217  -12.582 -47.471 1.00 52.31 ? 282  VAL B CG1 1 
ATOM   6289 C CG2 . VAL B 1 282 ? 14.915  -11.013 -49.300 1.00 52.53 ? 282  VAL B CG2 1 
ATOM   6290 N N   . ASP B 1 283 ? 17.265  -14.692 -47.623 1.00 53.97 ? 283  ASP B N   1 
ATOM   6291 C CA  . ASP B 1 283 ? 17.628  -15.849 -46.782 1.00 54.27 ? 283  ASP B CA  1 
ATOM   6292 C C   . ASP B 1 283 ? 18.760  -15.549 -45.777 1.00 54.52 ? 283  ASP B C   1 
ATOM   6293 O O   . ASP B 1 283 ? 18.767  -16.099 -44.669 1.00 54.20 ? 283  ASP B O   1 
ATOM   6294 C CB  . ASP B 1 283 ? 18.013  -17.065 -47.657 1.00 54.44 ? 283  ASP B CB  1 
ATOM   6295 C CG  . ASP B 1 283 ? 16.795  -17.904 -48.109 1.00 55.47 ? 283  ASP B CG  1 
ATOM   6296 O OD1 . ASP B 1 283 ? 15.680  -17.752 -47.555 1.00 55.43 ? 283  ASP B OD1 1 
ATOM   6297 O OD2 . ASP B 1 283 ? 16.957  -18.743 -49.025 1.00 56.78 ? 283  ASP B OD2 1 
ATOM   6298 N N   . HIS B 1 284 ? 19.697  -14.676 -46.159 1.00 54.55 ? 284  HIS B N   1 
ATOM   6299 C CA  . HIS B 1 284 ? 20.839  -14.352 -45.306 1.00 55.04 ? 284  HIS B CA  1 
ATOM   6300 C C   . HIS B 1 284 ? 20.856  -12.903 -44.804 1.00 55.78 ? 284  HIS B C   1 
ATOM   6301 O O   . HIS B 1 284 ? 21.885  -12.407 -44.315 1.00 55.76 ? 284  HIS B O   1 
ATOM   6302 C CB  . HIS B 1 284 ? 22.152  -14.707 -46.010 1.00 55.00 ? 284  HIS B CB  1 
ATOM   6303 C CG  . HIS B 1 284 ? 22.330  -16.179 -46.227 1.00 56.04 ? 284  HIS B CG  1 
ATOM   6304 N ND1 . HIS B 1 284 ? 22.507  -17.068 -45.186 1.00 56.72 ? 284  HIS B ND1 1 
ATOM   6305 C CD2 . HIS B 1 284 ? 22.333  -16.919 -47.360 1.00 55.13 ? 284  HIS B CD2 1 
ATOM   6306 C CE1 . HIS B 1 284 ? 22.613  -18.292 -45.670 1.00 57.42 ? 284  HIS B CE1 1 
ATOM   6307 N NE2 . HIS B 1 284 ? 22.512  -18.228 -46.986 1.00 57.07 ? 284  HIS B NE2 1 
ATOM   6308 N N   . GLU B 1 285 ? 19.709  -12.234 -44.918 1.00 56.22 ? 285  GLU B N   1 
ATOM   6309 C CA  . GLU B 1 285 ? 19.562  -10.848 -44.488 1.00 56.47 ? 285  GLU B CA  1 
ATOM   6310 C C   . GLU B 1 285 ? 19.852  -10.719 -42.995 1.00 56.70 ? 285  GLU B C   1 
ATOM   6311 O O   . GLU B 1 285 ? 20.587  -9.824  -42.563 1.00 56.26 ? 285  GLU B O   1 
ATOM   6312 C CB  . GLU B 1 285 ? 18.142  -10.364 -44.765 1.00 56.23 ? 285  GLU B CB  1 
ATOM   6313 C CG  . GLU B 1 285 ? 18.083  -8.961  -45.280 1.00 56.94 ? 285  GLU B CG  1 
ATOM   6314 C CD  . GLU B 1 285 ? 16.679  -8.401  -45.279 1.00 57.58 ? 285  GLU B CD  1 
ATOM   6315 O OE1 . GLU B 1 285 ? 15.777  -9.044  -45.849 1.00 57.12 ? 285  GLU B OE1 1 
ATOM   6316 O OE2 . GLU B 1 285 ? 16.487  -7.309  -44.706 1.00 58.82 ? 285  GLU B OE2 1 
ATOM   6317 N N   . TRP B 1 286 ? 19.278  -11.631 -42.220 1.00 57.20 ? 286  TRP B N   1 
ATOM   6318 C CA  . TRP B 1 286 ? 19.369  -11.568 -40.773 1.00 58.00 ? 286  TRP B CA  1 
ATOM   6319 C C   . TRP B 1 286 ? 20.679  -12.099 -40.166 1.00 57.76 ? 286  TRP B C   1 
ATOM   6320 O O   . TRP B 1 286 ? 20.889  -12.004 -38.957 1.00 58.20 ? 286  TRP B O   1 
ATOM   6321 C CB  . TRP B 1 286 ? 18.131  -12.208 -40.150 1.00 59.01 ? 286  TRP B CB  1 
ATOM   6322 C CG  . TRP B 1 286 ? 16.886  -11.444 -40.550 1.00 60.98 ? 286  TRP B CG  1 
ATOM   6323 C CD1 . TRP B 1 286 ? 15.922  -11.844 -41.435 1.00 60.76 ? 286  TRP B CD1 1 
ATOM   6324 C CD2 . TRP B 1 286 ? 16.506  -10.124 -40.113 1.00 62.41 ? 286  TRP B CD2 1 
ATOM   6325 N NE1 . TRP B 1 286 ? 14.963  -10.873 -41.558 1.00 61.25 ? 286  TRP B NE1 1 
ATOM   6326 C CE2 . TRP B 1 286 ? 15.295  -9.805  -40.762 1.00 62.17 ? 286  TRP B CE2 1 
ATOM   6327 C CE3 . TRP B 1 286 ? 17.072  -9.184  -39.228 1.00 62.82 ? 286  TRP B CE3 1 
ATOM   6328 C CZ2 . TRP B 1 286 ? 14.627  -8.584  -40.552 1.00 62.23 ? 286  TRP B CZ2 1 
ATOM   6329 C CZ3 . TRP B 1 286 ? 16.411  -7.968  -39.022 1.00 61.53 ? 286  TRP B CZ3 1 
ATOM   6330 C CH2 . TRP B 1 286 ? 15.201  -7.682  -39.683 1.00 61.70 ? 286  TRP B CH2 1 
ATOM   6331 N N   . HIS B 1 287 ? 21.584  -12.601 -40.994 1.00 57.12 ? 287  HIS B N   1 
ATOM   6332 C CA  . HIS B 1 287 ? 22.802  -13.194 -40.455 1.00 56.72 ? 287  HIS B CA  1 
ATOM   6333 C C   . HIS B 1 287 ? 23.969  -12.230 -40.340 1.00 56.04 ? 287  HIS B C   1 
ATOM   6334 O O   . HIS B 1 287 ? 25.076  -12.652 -40.018 1.00 56.16 ? 287  HIS B O   1 
ATOM   6335 C CB  . HIS B 1 287 ? 23.212  -14.449 -41.247 1.00 56.78 ? 287  HIS B CB  1 
ATOM   6336 C CG  . HIS B 1 287 ? 22.150  -15.502 -41.298 1.00 56.87 ? 287  HIS B CG  1 
ATOM   6337 N ND1 . HIS B 1 287 ? 22.001  -16.354 -42.371 1.00 56.95 ? 287  HIS B ND1 1 
ATOM   6338 C CD2 . HIS B 1 287 ? 21.169  -15.826 -40.421 1.00 57.82 ? 287  HIS B CD2 1 
ATOM   6339 C CE1 . HIS B 1 287 ? 20.985  -17.170 -42.146 1.00 57.81 ? 287  HIS B CE1 1 
ATOM   6340 N NE2 . HIS B 1 287 ? 20.461  -16.870 -40.970 1.00 58.32 ? 287  HIS B NE2 1 
ATOM   6341 N N   . VAL B 1 288 ? 23.729  -10.943 -40.575 1.00 55.28 ? 288  VAL B N   1 
ATOM   6342 C CA  . VAL B 1 288 ? 24.833  -9.970  -40.650 1.00 54.57 ? 288  VAL B CA  1 
ATOM   6343 C C   . VAL B 1 288 ? 24.954  -8.962  -39.491 1.00 54.52 ? 288  VAL B C   1 
ATOM   6344 O O   . VAL B 1 288 ? 25.883  -8.141  -39.493 1.00 54.68 ? 288  VAL B O   1 
ATOM   6345 C CB  . VAL B 1 288 ? 24.846  -9.194  -42.005 1.00 54.37 ? 288  VAL B CB  1 
ATOM   6346 C CG1 . VAL B 1 288 ? 25.134  -10.125 -43.159 1.00 54.33 ? 288  VAL B CG1 1 
ATOM   6347 C CG2 . VAL B 1 288 ? 23.536  -8.452  -42.221 1.00 53.75 ? 288  VAL B CG2 1 
ATOM   6348 N N   . LEU B 1 289 ? 24.026  -9.004  -38.533 1.00 54.02 ? 289  LEU B N   1 
ATOM   6349 C CA  . LEU B 1 289 ? 24.059  -8.101  -37.376 1.00 54.02 ? 289  LEU B CA  1 
ATOM   6350 C C   . LEU B 1 289 ? 25.201  -8.468  -36.406 1.00 54.26 ? 289  LEU B C   1 
ATOM   6351 O O   . LEU B 1 289 ? 25.411  -9.648  -36.110 1.00 53.80 ? 289  LEU B O   1 
ATOM   6352 C CB  . LEU B 1 289 ? 22.706  -8.092  -36.642 1.00 53.88 ? 289  LEU B CB  1 
ATOM   6353 C CG  . LEU B 1 289 ? 21.478  -7.519  -37.370 1.00 53.48 ? 289  LEU B CG  1 
ATOM   6354 C CD1 . LEU B 1 289 ? 20.163  -7.959  -36.723 1.00 51.01 ? 289  LEU B CD1 1 
ATOM   6355 C CD2 . LEU B 1 289 ? 21.557  -6.006  -37.471 1.00 51.88 ? 289  LEU B CD2 1 
ATOM   6356 N N   . PRO B 1 290 ? 25.945  -7.456  -35.909 1.00 54.58 ? 290  PRO B N   1 
ATOM   6357 C CA  . PRO B 1 290 ? 27.145  -7.754  -35.097 1.00 54.75 ? 290  PRO B CA  1 
ATOM   6358 C C   . PRO B 1 290 ? 26.867  -8.383  -33.728 1.00 54.98 ? 290  PRO B C   1 
ATOM   6359 O O   . PRO B 1 290 ? 27.773  -8.981  -33.147 1.00 55.34 ? 290  PRO B O   1 
ATOM   6360 C CB  . PRO B 1 290 ? 27.825  -6.390  -34.945 1.00 54.62 ? 290  PRO B CB  1 
ATOM   6361 C CG  . PRO B 1 290 ? 26.714  -5.381  -35.129 1.00 54.65 ? 290  PRO B CG  1 
ATOM   6362 C CD  . PRO B 1 290 ? 25.725  -6.005  -36.078 1.00 54.32 ? 290  PRO B CD  1 
ATOM   6363 N N   . GLN B 1 291 ? 25.637  -8.251  -33.228 1.00 55.25 ? 291  GLN B N   1 
ATOM   6364 C CA  . GLN B 1 291 ? 25.219  -8.842  -31.948 1.00 55.59 ? 291  GLN B CA  1 
ATOM   6365 C C   . GLN B 1 291 ? 23.769  -9.335  -32.007 1.00 55.63 ? 291  GLN B C   1 
ATOM   6366 O O   . GLN B 1 291 ? 22.996  -8.924  -32.869 1.00 55.18 ? 291  GLN B O   1 
ATOM   6367 C CB  . GLN B 1 291 ? 25.331  -7.838  -30.785 1.00 55.91 ? 291  GLN B CB  1 
ATOM   6368 C CG  . GLN B 1 291 ? 26.684  -7.140  -30.587 1.00 57.12 ? 291  GLN B CG  1 
ATOM   6369 C CD  . GLN B 1 291 ? 26.766  -5.798  -31.311 1.00 58.68 ? 291  GLN B CD  1 
ATOM   6370 O OE1 . GLN B 1 291 ? 27.853  -5.238  -31.496 1.00 58.27 ? 291  GLN B OE1 1 
ATOM   6371 N NE2 . GLN B 1 291 ? 25.611  -5.282  -31.733 1.00 59.26 ? 291  GLN B NE2 1 
ATOM   6372 N N   . GLU B 1 292 ? 23.419  -10.220 -31.073 1.00 56.01 ? 292  GLU B N   1 
ATOM   6373 C CA  . GLU B 1 292 ? 22.053  -10.676 -30.865 1.00 56.45 ? 292  GLU B CA  1 
ATOM   6374 C C   . GLU B 1 292 ? 21.240  -9.471  -30.397 1.00 55.41 ? 292  GLU B C   1 
ATOM   6375 O O   . GLU B 1 292 ? 21.526  -8.890  -29.341 1.00 56.15 ? 292  GLU B O   1 
ATOM   6376 C CB  . GLU B 1 292 ? 22.045  -11.770 -29.792 1.00 56.50 ? 292  GLU B CB  1 
ATOM   6377 C CG  . GLU B 1 292 ? 20.673  -12.419 -29.492 1.00 58.25 ? 292  GLU B CG  1 
ATOM   6378 C CD  . GLU B 1 292 ? 20.738  -13.407 -28.307 1.00 59.28 ? 292  GLU B CD  1 
ATOM   6379 O OE1 . GLU B 1 292 ? 21.867  -13.666 -27.792 1.00 62.60 ? 292  GLU B OE1 1 
ATOM   6380 O OE2 . GLU B 1 292 ? 19.662  -13.915 -27.888 1.00 61.44 ? 292  GLU B OE2 1 
ATOM   6381 N N   . SER B 1 293 ? 20.245  -9.070  -31.172 1.00 53.80 ? 293  SER B N   1 
ATOM   6382 C CA  . SER B 1 293 ? 19.543  -7.848  -30.828 1.00 52.47 ? 293  SER B CA  1 
ATOM   6383 C C   . SER B 1 293 ? 18.069  -7.855  -31.156 1.00 51.38 ? 293  SER B C   1 
ATOM   6384 O O   . SER B 1 293 ? 17.575  -8.753  -31.823 1.00 51.75 ? 293  SER B O   1 
ATOM   6385 C CB  . SER B 1 293 ? 20.240  -6.628  -31.446 1.00 52.47 ? 293  SER B CB  1 
ATOM   6386 O OG  . SER B 1 293 ? 20.815  -6.908  -32.710 1.00 52.11 ? 293  SER B OG  1 
ATOM   6387 N N   . ILE B 1 294 ? 17.367  -6.868  -30.618 1.00 50.05 ? 294  ILE B N   1 
ATOM   6388 C CA  . ILE B 1 294 ? 16.035  -6.522  -31.075 1.00 48.37 ? 294  ILE B CA  1 
ATOM   6389 C C   . ILE B 1 294 ? 16.101  -5.060  -31.500 1.00 47.68 ? 294  ILE B C   1 
ATOM   6390 O O   . ILE B 1 294 ? 17.060  -4.375  -31.162 1.00 47.25 ? 294  ILE B O   1 
ATOM   6391 C CB  . ILE B 1 294 ? 14.954  -6.764  -30.005 1.00 48.39 ? 294  ILE B CB  1 
ATOM   6392 C CG1 . ILE B 1 294 ? 15.369  -6.190  -28.648 1.00 47.13 ? 294  ILE B CG1 1 
ATOM   6393 C CG2 . ILE B 1 294 ? 14.636  -8.258  -29.894 1.00 48.22 ? 294  ILE B CG2 1 
ATOM   6394 C CD1 . ILE B 1 294 ? 14.163  -5.879  -27.749 1.00 44.94 ? 294  ILE B CD1 1 
ATOM   6395 N N   . PHE B 1 295 ? 15.113  -4.608  -32.277 1.00 46.70 ? 295  PHE B N   1 
ATOM   6396 C CA  . PHE B 1 295 ? 15.051  -3.242  -32.812 1.00 45.30 ? 295  PHE B CA  1 
ATOM   6397 C C   . PHE B 1 295 ? 16.342  -2.861  -33.504 1.00 45.44 ? 295  PHE B C   1 
ATOM   6398 O O   . PHE B 1 295 ? 16.817  -1.729  -33.387 1.00 45.59 ? 295  PHE B O   1 
ATOM   6399 C CB  . PHE B 1 295 ? 14.725  -2.216  -31.727 1.00 44.59 ? 295  PHE B CB  1 
ATOM   6400 C CG  . PHE B 1 295 ? 13.746  -1.146  -32.166 1.00 43.46 ? 295  PHE B CG  1 
ATOM   6401 C CD1 . PHE B 1 295 ? 13.970  -0.390  -33.319 1.00 40.62 ? 295  PHE B CD1 1 
ATOM   6402 C CD2 . PHE B 1 295 ? 12.595  -0.897  -31.415 1.00 41.82 ? 295  PHE B CD2 1 
ATOM   6403 C CE1 . PHE B 1 295 ? 13.070  0.584   -33.714 1.00 40.08 ? 295  PHE B CE1 1 
ATOM   6404 C CE2 . PHE B 1 295 ? 11.687  0.086   -31.803 1.00 41.52 ? 295  PHE B CE2 1 
ATOM   6405 C CZ  . PHE B 1 295 ? 11.926  0.825   -32.960 1.00 41.46 ? 295  PHE B CZ  1 
ATOM   6406 N N   . ARG B 1 296 ? 16.922  -3.824  -34.207 1.00 45.10 ? 296  ARG B N   1 
ATOM   6407 C CA  . ARG B 1 296 ? 18.101  -3.572  -34.990 1.00 44.80 ? 296  ARG B CA  1 
ATOM   6408 C C   . ARG B 1 296 ? 17.859  -4.249  -36.335 1.00 44.50 ? 296  ARG B C   1 
ATOM   6409 O O   . ARG B 1 296 ? 17.328  -5.362  -36.397 1.00 44.39 ? 296  ARG B O   1 
ATOM   6410 C CB  . ARG B 1 296 ? 19.348  -4.102  -34.264 1.00 45.22 ? 296  ARG B CB  1 
ATOM   6411 C CG  . ARG B 1 296 ? 20.602  -3.183  -34.353 1.00 45.76 ? 296  ARG B CG  1 
ATOM   6412 C CD  . ARG B 1 296 ? 20.865  -2.313  -33.112 1.00 43.72 ? 296  ARG B CD  1 
ATOM   6413 N NE  . ARG B 1 296 ? 19.662  -1.662  -32.636 1.00 45.57 ? 296  ARG B NE  1 
ATOM   6414 C CZ  . ARG B 1 296 ? 19.571  -0.839  -31.582 1.00 46.04 ? 296  ARG B CZ  1 
ATOM   6415 N NH1 . ARG B 1 296 ? 20.625  -0.501  -30.835 1.00 42.36 ? 296  ARG B NH1 1 
ATOM   6416 N NH2 . ARG B 1 296 ? 18.382  -0.341  -31.283 1.00 45.89 ? 296  ARG B NH2 1 
ATOM   6417 N N   . PHE B 1 297 ? 18.218  -3.553  -37.409 1.00 43.83 ? 297  PHE B N   1 
ATOM   6418 C CA  . PHE B 1 297 ? 17.915  -3.985  -38.770 1.00 42.91 ? 297  PHE B CA  1 
ATOM   6419 C C   . PHE B 1 297 ? 19.168  -3.978  -39.635 1.00 43.00 ? 297  PHE B C   1 
ATOM   6420 O O   . PHE B 1 297 ? 19.985  -3.039  -39.549 1.00 42.78 ? 297  PHE B O   1 
ATOM   6421 C CB  . PHE B 1 297 ? 16.835  -3.073  -39.357 1.00 42.30 ? 297  PHE B CB  1 
ATOM   6422 C CG  . PHE B 1 297 ? 15.706  -2.814  -38.404 1.00 41.82 ? 297  PHE B CG  1 
ATOM   6423 C CD1 . PHE B 1 297 ? 14.837  -3.845  -38.043 1.00 40.56 ? 297  PHE B CD1 1 
ATOM   6424 C CD2 . PHE B 1 297 ? 15.538  -1.556  -37.823 1.00 40.12 ? 297  PHE B CD2 1 
ATOM   6425 C CE1 . PHE B 1 297 ? 13.809  -3.620  -37.133 1.00 40.81 ? 297  PHE B CE1 1 
ATOM   6426 C CE2 . PHE B 1 297 ? 14.508  -1.324  -36.904 1.00 38.70 ? 297  PHE B CE2 1 
ATOM   6427 C CZ  . PHE B 1 297 ? 13.639  -2.350  -36.570 1.00 39.69 ? 297  PHE B CZ  1 
ATOM   6428 N N   . SER B 1 298 ? 19.308  -5.014  -40.467 1.00 42.71 ? 298  SER B N   1 
ATOM   6429 C CA  . SER B 1 298 ? 20.546  -5.262  -41.234 1.00 42.92 ? 298  SER B CA  1 
ATOM   6430 C C   . SER B 1 298 ? 20.909  -4.211  -42.272 1.00 42.69 ? 298  SER B C   1 
ATOM   6431 O O   . SER B 1 298 ? 22.075  -3.789  -42.354 1.00 42.85 ? 298  SER B O   1 
ATOM   6432 C CB  . SER B 1 298 ? 20.470  -6.601  -41.945 1.00 42.93 ? 298  SER B CB  1 
ATOM   6433 O OG  . SER B 1 298 ? 20.323  -7.643  -41.017 1.00 45.22 ? 298  SER B OG  1 
ATOM   6434 N N   . PHE B 1 299 ? 19.928  -3.812  -43.085 1.00 42.01 ? 299  PHE B N   1 
ATOM   6435 C CA  . PHE B 1 299 ? 20.194  -2.901  -44.201 1.00 41.49 ? 299  PHE B CA  1 
ATOM   6436 C C   . PHE B 1 299 ? 19.309  -1.677  -44.142 1.00 41.37 ? 299  PHE B C   1 
ATOM   6437 O O   . PHE B 1 299 ? 18.080  -1.756  -44.368 1.00 41.30 ? 299  PHE B O   1 
ATOM   6438 C CB  . PHE B 1 299 ? 20.097  -3.639  -45.544 1.00 41.36 ? 299  PHE B CB  1 
ATOM   6439 C CG  . PHE B 1 299 ? 21.177  -4.674  -45.722 1.00 41.33 ? 299  PHE B CG  1 
ATOM   6440 C CD1 . PHE B 1 299 ? 22.442  -4.303  -46.157 1.00 40.53 ? 299  PHE B CD1 1 
ATOM   6441 C CD2 . PHE B 1 299 ? 20.945  -6.010  -45.378 1.00 40.55 ? 299  PHE B CD2 1 
ATOM   6442 C CE1 . PHE B 1 299 ? 23.457  -5.255  -46.279 1.00 41.69 ? 299  PHE B CE1 1 
ATOM   6443 C CE2 . PHE B 1 299 ? 21.944  -6.958  -45.486 1.00 40.16 ? 299  PHE B CE2 1 
ATOM   6444 C CZ  . PHE B 1 299 ? 23.203  -6.587  -45.938 1.00 40.19 ? 299  PHE B CZ  1 
ATOM   6445 N N   . VAL B 1 300 ? 19.956  -0.556  -43.817 1.00 40.74 ? 300  VAL B N   1 
ATOM   6446 C CA  . VAL B 1 300 ? 19.306  0.701   -43.460 1.00 40.44 ? 300  VAL B CA  1 
ATOM   6447 C C   . VAL B 1 300 ? 20.122  1.837   -44.074 1.00 41.12 ? 300  VAL B C   1 
ATOM   6448 O O   . VAL B 1 300 ? 21.225  1.593   -44.556 1.00 41.23 ? 300  VAL B O   1 
ATOM   6449 C CB  . VAL B 1 300 ? 19.206  0.900   -41.907 1.00 40.18 ? 300  VAL B CB  1 
ATOM   6450 C CG1 . VAL B 1 300 ? 18.400  -0.202  -41.248 1.00 38.82 ? 300  VAL B CG1 1 
ATOM   6451 C CG2 . VAL B 1 300 ? 20.590  1.020   -41.263 1.00 40.12 ? 300  VAL B CG2 1 
ATOM   6452 N N   . PRO B 1 301 ? 19.574  3.075   -44.103 1.00 41.57 ? 301  PRO B N   1 
ATOM   6453 C CA  . PRO B 1 301 ? 20.319  4.194   -44.647 1.00 41.79 ? 301  PRO B CA  1 
ATOM   6454 C C   . PRO B 1 301 ? 21.717  4.292   -44.053 1.00 42.58 ? 301  PRO B C   1 
ATOM   6455 O O   . PRO B 1 301 ? 21.918  3.991   -42.873 1.00 43.03 ? 301  PRO B O   1 
ATOM   6456 C CB  . PRO B 1 301 ? 19.482  5.394   -44.232 1.00 41.59 ? 301  PRO B CB  1 
ATOM   6457 C CG  . PRO B 1 301 ? 18.113  4.878   -44.204 1.00 41.94 ? 301  PRO B CG  1 
ATOM   6458 C CD  . PRO B 1 301 ? 18.214  3.483   -43.697 1.00 41.58 ? 301  PRO B CD  1 
ATOM   6459 N N   . VAL B 1 302 ? 22.670  4.700   -44.882 1.00 42.99 ? 302  VAL B N   1 
ATOM   6460 C CA  . VAL B 1 302 ? 24.086  4.740   -44.509 1.00 43.23 ? 302  VAL B CA  1 
ATOM   6461 C C   . VAL B 1 302 ? 24.578  6.189   -44.517 1.00 43.47 ? 302  VAL B C   1 
ATOM   6462 O O   . VAL B 1 302 ? 24.194  6.962   -45.384 1.00 43.73 ? 302  VAL B O   1 
ATOM   6463 C CB  . VAL B 1 302 ? 24.936  3.865   -45.479 1.00 42.70 ? 302  VAL B CB  1 
ATOM   6464 C CG1 . VAL B 1 302 ? 24.776  4.343   -46.922 1.00 42.02 ? 302  VAL B CG1 1 
ATOM   6465 C CG2 . VAL B 1 302 ? 26.410  3.850   -45.067 1.00 42.67 ? 302  VAL B CG2 1 
ATOM   6466 N N   . VAL B 1 303 ? 25.406  6.562   -43.551 1.00 44.25 ? 303  VAL B N   1 
ATOM   6467 C CA  . VAL B 1 303 ? 26.045  7.879   -43.608 1.00 45.43 ? 303  VAL B CA  1 
ATOM   6468 C C   . VAL B 1 303 ? 27.099  7.805   -44.706 1.00 46.08 ? 303  VAL B C   1 
ATOM   6469 O O   . VAL B 1 303 ? 28.163  7.223   -44.521 1.00 46.62 ? 303  VAL B O   1 
ATOM   6470 C CB  . VAL B 1 303 ? 26.650  8.337   -42.251 1.00 44.98 ? 303  VAL B CB  1 
ATOM   6471 C CG1 . VAL B 1 303 ? 27.150  9.741   -42.353 1.00 44.86 ? 303  VAL B CG1 1 
ATOM   6472 C CG2 . VAL B 1 303 ? 25.610  8.275   -41.159 1.00 45.37 ? 303  VAL B CG2 1 
ATOM   6473 N N   . ASP B 1 304 ? 26.759  8.381   -45.855 1.00 46.95 ? 304  ASP B N   1 
ATOM   6474 C CA  . ASP B 1 304 ? 27.514  8.215   -47.097 1.00 47.73 ? 304  ASP B CA  1 
ATOM   6475 C C   . ASP B 1 304 ? 28.339  9.447   -47.470 1.00 48.17 ? 304  ASP B C   1 
ATOM   6476 O O   . ASP B 1 304 ? 29.171  9.382   -48.370 1.00 48.72 ? 304  ASP B O   1 
ATOM   6477 C CB  . ASP B 1 304 ? 26.543  7.883   -48.253 1.00 47.46 ? 304  ASP B CB  1 
ATOM   6478 C CG  . ASP B 1 304 ? 25.504  8.992   -48.506 1.00 47.49 ? 304  ASP B CG  1 
ATOM   6479 O OD1 . ASP B 1 304 ? 25.233  9.821   -47.606 1.00 45.33 ? 304  ASP B OD1 1 
ATOM   6480 O OD2 . ASP B 1 304 ? 24.944  9.034   -49.626 1.00 48.23 ? 304  ASP B OD2 1 
ATOM   6481 N N   . GLY B 1 305 ? 28.081  10.564  -46.794 1.00 48.56 ? 305  GLY B N   1 
ATOM   6482 C CA  . GLY B 1 305 ? 28.658  11.856  -47.157 1.00 49.29 ? 305  GLY B CA  1 
ATOM   6483 C C   . GLY B 1 305 ? 27.954  12.485  -48.345 1.00 49.94 ? 305  GLY B C   1 
ATOM   6484 O O   . GLY B 1 305 ? 28.342  13.565  -48.799 1.00 49.92 ? 305  GLY B O   1 
ATOM   6485 N N   . ASP B 1 306 ? 26.908  11.816  -48.838 1.00 50.34 ? 306  ASP B N   1 
ATOM   6486 C CA  . ASP B 1 306 ? 26.166  12.248  -50.040 1.00 50.70 ? 306  ASP B CA  1 
ATOM   6487 C C   . ASP B 1 306 ? 24.705  12.616  -49.699 1.00 50.15 ? 306  ASP B C   1 
ATOM   6488 O O   . ASP B 1 306 ? 24.410  13.788  -49.452 1.00 50.05 ? 306  ASP B O   1 
ATOM   6489 C CB  . ASP B 1 306 ? 26.258  11.166  -51.139 1.00 50.93 ? 306  ASP B CB  1 
ATOM   6490 C CG  . ASP B 1 306 ? 25.656  11.596  -52.467 1.00 52.73 ? 306  ASP B CG  1 
ATOM   6491 O OD1 . ASP B 1 306 ? 25.319  12.794  -52.644 1.00 53.63 ? 306  ASP B OD1 1 
ATOM   6492 O OD2 . ASP B 1 306 ? 25.531  10.714  -53.352 1.00 54.49 ? 306  ASP B OD2 1 
ATOM   6493 N N   . PHE B 1 307 ? 23.803  11.629  -49.691 1.00 49.65 ? 307  PHE B N   1 
ATOM   6494 C CA  . PHE B 1 307 ? 22.411  11.852  -49.272 1.00 48.53 ? 307  PHE B CA  1 
ATOM   6495 C C   . PHE B 1 307 ? 22.434  12.425  -47.858 1.00 48.33 ? 307  PHE B C   1 
ATOM   6496 O O   . PHE B 1 307 ? 21.828  13.454  -47.585 1.00 47.81 ? 307  PHE B O   1 
ATOM   6497 C CB  . PHE B 1 307 ? 21.595  10.550  -49.314 1.00 48.15 ? 307  PHE B CB  1 
ATOM   6498 C CG  . PHE B 1 307 ? 20.092  10.759  -49.193 1.00 47.54 ? 307  PHE B CG  1 
ATOM   6499 C CD1 . PHE B 1 307 ? 19.508  11.090  -47.968 1.00 47.06 ? 307  PHE B CD1 1 
ATOM   6500 C CD2 . PHE B 1 307 ? 19.270  10.627  -50.301 1.00 46.67 ? 307  PHE B CD2 1 
ATOM   6501 C CE1 . PHE B 1 307 ? 18.135  11.287  -47.846 1.00 47.18 ? 307  PHE B CE1 1 
ATOM   6502 C CE2 . PHE B 1 307 ? 17.891  10.825  -50.190 1.00 48.41 ? 307  PHE B CE2 1 
ATOM   6503 C CZ  . PHE B 1 307 ? 17.324  11.154  -48.952 1.00 48.13 ? 307  PHE B CZ  1 
ATOM   6504 N N   . LEU B 1 308 ? 23.159  11.743  -46.976 1.00 48.36 ? 308  LEU B N   1 
ATOM   6505 C CA  . LEU B 1 308 ? 23.452  12.232  -45.637 1.00 48.45 ? 308  LEU B CA  1 
ATOM   6506 C C   . LEU B 1 308 ? 24.895  12.751  -45.579 1.00 49.06 ? 308  LEU B C   1 
ATOM   6507 O O   . LEU B 1 308 ? 25.848  11.956  -45.561 1.00 49.07 ? 308  LEU B O   1 
ATOM   6508 C CB  . LEU B 1 308 ? 23.257  11.110  -44.619 1.00 47.84 ? 308  LEU B CB  1 
ATOM   6509 C CG  . LEU B 1 308 ? 21.869  10.469  -44.496 1.00 47.53 ? 308  LEU B CG  1 
ATOM   6510 C CD1 . LEU B 1 308 ? 21.920  9.286   -43.565 1.00 46.24 ? 308  LEU B CD1 1 
ATOM   6511 C CD2 . LEU B 1 308 ? 20.833  11.467  -44.017 1.00 46.56 ? 308  LEU B CD2 1 
ATOM   6512 N N   . SER B 1 309 ? 25.060  14.072  -45.549 1.00 49.41 ? 309  SER B N   1 
ATOM   6513 C CA  . SER B 1 309 ? 26.409  14.675  -45.521 1.00 50.34 ? 309  SER B CA  1 
ATOM   6514 C C   . SER B 1 309 ? 27.195  14.373  -44.235 1.00 50.78 ? 309  SER B C   1 
ATOM   6515 O O   . SER B 1 309 ? 28.418  14.298  -44.270 1.00 51.15 ? 309  SER B O   1 
ATOM   6516 C CB  . SER B 1 309 ? 26.359  16.184  -45.775 1.00 49.82 ? 309  SER B CB  1 
ATOM   6517 O OG  . SER B 1 309 ? 25.862  16.858  -44.636 1.00 50.34 ? 309  SER B OG  1 
ATOM   6518 N N   . ASP B 1 310 ? 26.488  14.189  -43.120 1.00 51.07 ? 310  ASP B N   1 
ATOM   6519 C CA  . ASP B 1 310 ? 27.091  13.777  -41.849 1.00 51.56 ? 310  ASP B CA  1 
ATOM   6520 C C   . ASP B 1 310 ? 26.114  12.827  -41.134 1.00 51.82 ? 310  ASP B C   1 
ATOM   6521 O O   . ASP B 1 310 ? 25.117  12.403  -41.730 1.00 52.07 ? 310  ASP B O   1 
ATOM   6522 C CB  . ASP B 1 310 ? 27.387  15.008  -40.988 1.00 51.60 ? 310  ASP B CB  1 
ATOM   6523 C CG  . ASP B 1 310 ? 28.681  14.882  -40.160 1.00 52.43 ? 310  ASP B CG  1 
ATOM   6524 O OD1 . ASP B 1 310 ? 29.153  13.743  -39.889 1.00 50.04 ? 310  ASP B OD1 1 
ATOM   6525 O OD2 . ASP B 1 310 ? 29.209  15.957  -39.767 1.00 52.07 ? 310  ASP B OD2 1 
ATOM   6526 N N   . THR B 1 311 ? 26.384  12.486  -39.875 1.00 51.84 ? 311  THR B N   1 
ATOM   6527 C CA  . THR B 1 311 ? 25.429  11.708  -39.083 1.00 51.99 ? 311  THR B CA  1 
ATOM   6528 C C   . THR B 1 311 ? 24.166  12.534  -38.852 1.00 52.36 ? 311  THR B C   1 
ATOM   6529 O O   . THR B 1 311 ? 24.222  13.768  -38.851 1.00 52.21 ? 311  THR B O   1 
ATOM   6530 C CB  . THR B 1 311 ? 25.997  11.326  -37.708 1.00 51.97 ? 311  THR B CB  1 
ATOM   6531 O OG1 . THR B 1 311 ? 26.407  12.510  -37.025 1.00 52.49 ? 311  THR B OG1 1 
ATOM   6532 C CG2 . THR B 1 311 ? 27.189  10.373  -37.844 1.00 51.52 ? 311  THR B CG2 1 
ATOM   6533 N N   . PRO B 1 312 ? 23.013  11.870  -38.668 1.00 52.87 ? 312  PRO B N   1 
ATOM   6534 C CA  . PRO B 1 312 ? 21.828  12.654  -38.317 1.00 53.30 ? 312  PRO B CA  1 
ATOM   6535 C C   . PRO B 1 312 ? 22.091  13.505  -37.093 1.00 53.83 ? 312  PRO B C   1 
ATOM   6536 O O   . PRO B 1 312 ? 21.662  14.658  -37.043 1.00 54.24 ? 312  PRO B O   1 
ATOM   6537 C CB  . PRO B 1 312 ? 20.777  11.589  -38.018 1.00 53.21 ? 312  PRO B CB  1 
ATOM   6538 C CG  . PRO B 1 312 ? 21.194  10.430  -38.850 1.00 53.29 ? 312  PRO B CG  1 
ATOM   6539 C CD  . PRO B 1 312 ? 22.702  10.436  -38.802 1.00 52.77 ? 312  PRO B CD  1 
ATOM   6540 N N   . GLU B 1 313 ? 22.815  12.942  -36.131 1.00 54.75 ? 313  GLU B N   1 
ATOM   6541 C CA  . GLU B 1 313 ? 23.202  13.654  -34.911 1.00 55.81 ? 313  GLU B CA  1 
ATOM   6542 C C   . GLU B 1 313 ? 23.875  14.977  -35.235 1.00 55.82 ? 313  GLU B C   1 
ATOM   6543 O O   . GLU B 1 313 ? 23.433  16.016  -34.765 1.00 55.96 ? 313  GLU B O   1 
ATOM   6544 C CB  . GLU B 1 313 ? 24.125  12.790  -34.040 1.00 56.17 ? 313  GLU B CB  1 
ATOM   6545 C CG  . GLU B 1 313 ? 23.398  11.716  -33.191 1.00 58.93 ? 313  GLU B CG  1 
ATOM   6546 C CD  . GLU B 1 313 ? 22.870  10.505  -33.996 1.00 60.27 ? 313  GLU B CD  1 
ATOM   6547 O OE1 . GLU B 1 313 ? 23.294  10.286  -35.164 1.00 59.69 ? 313  GLU B OE1 1 
ATOM   6548 O OE2 . GLU B 1 313 ? 22.020  9.774   -33.437 1.00 60.67 ? 313  GLU B OE2 1 
ATOM   6549 N N   . ALA B 1 314 ? 24.928  14.939  -36.052 1.00 55.94 ? 314  ALA B N   1 
ATOM   6550 C CA  . ALA B 1 314 ? 25.638  16.158  -36.428 1.00 56.34 ? 314  ALA B CA  1 
ATOM   6551 C C   . ALA B 1 314 ? 24.699  17.143  -37.111 1.00 56.59 ? 314  ALA B C   1 
ATOM   6552 O O   . ALA B 1 314 ? 24.654  18.322  -36.744 1.00 57.00 ? 314  ALA B O   1 
ATOM   6553 C CB  . ALA B 1 314 ? 26.841  15.853  -37.317 1.00 56.06 ? 314  ALA B CB  1 
ATOM   6554 N N   . LEU B 1 315 ? 23.927  16.631  -38.069 1.00 56.71 ? 315  LEU B N   1 
ATOM   6555 C CA  . LEU B 1 315 ? 23.046  17.430  -38.913 1.00 56.52 ? 315  LEU B CA  1 
ATOM   6556 C C   . LEU B 1 315 ? 21.915  18.151  -38.180 1.00 56.76 ? 315  LEU B C   1 
ATOM   6557 O O   . LEU B 1 315 ? 21.567  19.270  -38.542 1.00 56.42 ? 315  LEU B O   1 
ATOM   6558 C CB  . LEU B 1 315 ? 22.469  16.555  -40.020 1.00 56.35 ? 315  LEU B CB  1 
ATOM   6559 C CG  . LEU B 1 315 ? 23.449  16.151  -41.113 1.00 56.25 ? 315  LEU B CG  1 
ATOM   6560 C CD1 . LEU B 1 315 ? 22.770  15.211  -42.085 1.00 56.19 ? 315  LEU B CD1 1 
ATOM   6561 C CD2 . LEU B 1 315 ? 23.998  17.385  -41.831 1.00 56.49 ? 315  LEU B CD2 1 
ATOM   6562 N N   . ILE B 1 316 ? 21.335  17.508  -37.170 1.00 57.32 ? 316  ILE B N   1 
ATOM   6563 C CA  . ILE B 1 316 ? 20.253  18.140  -36.405 1.00 58.04 ? 316  ILE B CA  1 
ATOM   6564 C C   . ILE B 1 316 ? 20.822  19.116  -35.390 1.00 58.50 ? 316  ILE B C   1 
ATOM   6565 O O   . ILE B 1 316 ? 20.168  20.098  -35.048 1.00 58.36 ? 316  ILE B O   1 
ATOM   6566 C CB  . ILE B 1 316 ? 19.277  17.130  -35.694 1.00 57.90 ? 316  ILE B CB  1 
ATOM   6567 C CG1 . ILE B 1 316 ? 20.024  16.143  -34.802 1.00 57.70 ? 316  ILE B CG1 1 
ATOM   6568 C CG2 . ILE B 1 316 ? 18.433  16.375  -36.710 1.00 57.99 ? 316  ILE B CG2 1 
ATOM   6569 C CD1 . ILE B 1 316 ? 19.194  15.604  -33.638 1.00 58.18 ? 316  ILE B CD1 1 
ATOM   6570 N N   . ASN B 1 317 ? 22.036  18.839  -34.911 1.00 59.03 ? 317  ASN B N   1 
ATOM   6571 C CA  . ASN B 1 317 ? 22.726  19.750  -34.001 1.00 59.69 ? 317  ASN B CA  1 
ATOM   6572 C C   . ASN B 1 317 ? 23.053  21.088  -34.649 1.00 59.65 ? 317  ASN B C   1 
ATOM   6573 O O   . ASN B 1 317 ? 22.970  22.118  -33.988 1.00 59.62 ? 317  ASN B O   1 
ATOM   6574 C CB  . ASN B 1 317 ? 24.002  19.120  -33.423 1.00 59.84 ? 317  ASN B CB  1 
ATOM   6575 C CG  . ASN B 1 317 ? 23.717  18.119  -32.295 1.00 60.94 ? 317  ASN B CG  1 
ATOM   6576 O OD1 . ASN B 1 317 ? 24.644  17.585  -31.674 1.00 60.44 ? 317  ASN B OD1 1 
ATOM   6577 N ND2 . ASN B 1 317 ? 22.432  17.861  -32.030 1.00 61.68 ? 317  ASN B ND2 1 
ATOM   6578 N N   . THR B 1 318 ? 23.401  21.070  -35.937 1.00 59.81 ? 318  THR B N   1 
ATOM   6579 C CA  . THR B 1 318 ? 23.903  22.271  -36.622 1.00 60.16 ? 318  THR B CA  1 
ATOM   6580 C C   . THR B 1 318 ? 22.987  22.837  -37.695 1.00 60.21 ? 318  THR B C   1 
ATOM   6581 O O   . THR B 1 318 ? 23.282  23.892  -38.257 1.00 60.23 ? 318  THR B O   1 
ATOM   6582 C CB  . THR B 1 318 ? 25.294  22.042  -37.307 1.00 60.51 ? 318  THR B CB  1 
ATOM   6583 O OG1 . THR B 1 318 ? 25.126  21.357  -38.564 1.00 59.09 ? 318  THR B OG1 1 
ATOM   6584 C CG2 . THR B 1 318 ? 26.272  21.287  -36.381 1.00 60.95 ? 318  THR B CG2 1 
ATOM   6585 N N   . GLY B 1 319 ? 21.905  22.133  -38.010 1.00 60.24 ? 319  GLY B N   1 
ATOM   6586 C CA  . GLY B 1 319 ? 21.000  22.576  -39.070 1.00 60.39 ? 319  GLY B CA  1 
ATOM   6587 C C   . GLY B 1 319 ? 20.256  23.852  -38.714 1.00 60.38 ? 319  GLY B C   1 
ATOM   6588 O O   . GLY B 1 319 ? 20.175  24.228  -37.539 1.00 59.83 ? 319  GLY B O   1 
ATOM   6589 N N   . ASP B 1 320 ? 19.728  24.522  -39.737 1.00 60.86 ? 320  ASP B N   1 
ATOM   6590 C CA  . ASP B 1 320 ? 18.841  25.675  -39.543 1.00 61.52 ? 320  ASP B CA  1 
ATOM   6591 C C   . ASP B 1 320 ? 17.436  25.351  -40.062 1.00 61.04 ? 320  ASP B C   1 
ATOM   6592 O O   . ASP B 1 320 ? 17.248  25.070  -41.256 1.00 60.85 ? 320  ASP B O   1 
ATOM   6593 C CB  . ASP B 1 320 ? 19.391  26.937  -40.224 1.00 62.10 ? 320  ASP B CB  1 
ATOM   6594 C CG  . ASP B 1 320 ? 18.485  28.153  -40.024 1.00 63.79 ? 320  ASP B CG  1 
ATOM   6595 O OD1 . ASP B 1 320 ? 18.139  28.463  -38.858 1.00 66.22 ? 320  ASP B OD1 1 
ATOM   6596 O OD2 . ASP B 1 320 ? 18.122  28.800  -41.030 1.00 64.77 ? 320  ASP B OD2 1 
ATOM   6597 N N   . PHE B 1 321 ? 16.458  25.401  -39.159 1.00 60.47 ? 321  PHE B N   1 
ATOM   6598 C CA  . PHE B 1 321 ? 15.123  24.873  -39.445 1.00 59.87 ? 321  PHE B CA  1 
ATOM   6599 C C   . PHE B 1 321 ? 14.031  25.925  -39.292 1.00 60.12 ? 321  PHE B C   1 
ATOM   6600 O O   . PHE B 1 321 ? 12.947  25.643  -38.791 1.00 60.38 ? 321  PHE B O   1 
ATOM   6601 C CB  . PHE B 1 321 ? 14.860  23.644  -38.566 1.00 59.26 ? 321  PHE B CB  1 
ATOM   6602 C CG  . PHE B 1 321 ? 15.878  22.539  -38.744 1.00 57.90 ? 321  PHE B CG  1 
ATOM   6603 C CD1 . PHE B 1 321 ? 15.902  21.771  -39.910 1.00 56.30 ? 321  PHE B CD1 1 
ATOM   6604 C CD2 . PHE B 1 321 ? 16.815  22.274  -37.756 1.00 56.35 ? 321  PHE B CD2 1 
ATOM   6605 C CE1 . PHE B 1 321 ? 16.841  20.754  -40.086 1.00 56.45 ? 321  PHE B CE1 1 
ATOM   6606 C CE2 . PHE B 1 321 ? 17.754  21.245  -37.919 1.00 56.72 ? 321  PHE B CE2 1 
ATOM   6607 C CZ  . PHE B 1 321 ? 17.766  20.484  -39.092 1.00 56.31 ? 321  PHE B CZ  1 
ATOM   6608 N N   . GLN B 1 322 ? 14.320  27.131  -39.777 1.00 60.30 ? 322  GLN B N   1 
ATOM   6609 C CA  . GLN B 1 322 ? 13.514  28.318  -39.494 1.00 60.18 ? 322  GLN B CA  1 
ATOM   6610 C C   . GLN B 1 322 ? 12.125  28.308  -40.142 1.00 59.44 ? 322  GLN B C   1 
ATOM   6611 O O   . GLN B 1 322 ? 11.118  28.610  -39.476 1.00 59.47 ? 322  GLN B O   1 
ATOM   6612 C CB  . GLN B 1 322 ? 14.291  29.583  -39.878 1.00 60.84 ? 322  GLN B CB  1 
ATOM   6613 C CG  . GLN B 1 322 ? 15.389  29.978  -38.875 1.00 62.72 ? 322  GLN B CG  1 
ATOM   6614 C CD  . GLN B 1 322 ? 14.989  31.154  -37.982 1.00 65.63 ? 322  GLN B CD  1 
ATOM   6615 O OE1 . GLN B 1 322 ? 14.979  31.050  -36.744 1.00 65.77 ? 322  GLN B OE1 1 
ATOM   6616 N NE2 . GLN B 1 322 ? 14.659  32.285  -38.611 1.00 66.10 ? 322  GLN B NE2 1 
ATOM   6617 N N   . ASP B 1 323 ? 12.060  27.955  -41.425 1.00 58.27 ? 323  ASP B N   1 
ATOM   6618 C CA  . ASP B 1 323 ? 10.766  27.959  -42.137 1.00 57.15 ? 323  ASP B CA  1 
ATOM   6619 C C   . ASP B 1 323 ? 10.112  26.566  -42.200 1.00 54.98 ? 323  ASP B C   1 
ATOM   6620 O O   . ASP B 1 323 ? 9.468   26.214  -43.188 1.00 54.72 ? 323  ASP B O   1 
ATOM   6621 C CB  . ASP B 1 323 ? 10.905  28.598  -43.536 1.00 58.06 ? 323  ASP B CB  1 
ATOM   6622 C CG  . ASP B 1 323 ? 10.973  30.137  -43.483 1.00 60.49 ? 323  ASP B CG  1 
ATOM   6623 O OD1 . ASP B 1 323 ? 10.351  30.742  -42.570 1.00 63.06 ? 323  ASP B OD1 1 
ATOM   6624 O OD2 . ASP B 1 323 ? 11.651  30.739  -44.357 1.00 62.26 ? 323  ASP B OD2 1 
ATOM   6625 N N   . LEU B 1 324 ? 10.276  25.799  -41.122 1.00 52.26 ? 324  LEU B N   1 
ATOM   6626 C CA  . LEU B 1 324 ? 9.877   24.398  -41.090 1.00 49.35 ? 324  LEU B CA  1 
ATOM   6627 C C   . LEU B 1 324 ? 8.922   24.108  -39.945 1.00 47.09 ? 324  LEU B C   1 
ATOM   6628 O O   . LEU B 1 324 ? 9.166   24.520  -38.811 1.00 46.44 ? 324  LEU B O   1 
ATOM   6629 C CB  . LEU B 1 324 ? 11.107  23.497  -40.978 1.00 49.24 ? 324  LEU B CB  1 
ATOM   6630 C CG  . LEU B 1 324 ? 10.807  22.000  -40.798 1.00 49.42 ? 324  LEU B CG  1 
ATOM   6631 C CD1 . LEU B 1 324 ? 10.234  21.406  -42.088 1.00 49.58 ? 324  LEU B CD1 1 
ATOM   6632 C CD2 . LEU B 1 324 ? 12.043  21.253  -40.366 1.00 48.67 ? 324  LEU B CD2 1 
ATOM   6633 N N   . GLN B 1 325 ? 7.838   23.404  -40.255 1.00 44.52 ? 325  GLN B N   1 
ATOM   6634 C CA  . GLN B 1 325 ? 6.898   22.949  -39.234 1.00 42.86 ? 325  GLN B CA  1 
ATOM   6635 C C   . GLN B 1 325 ? 6.861   21.425  -39.116 1.00 41.39 ? 325  GLN B C   1 
ATOM   6636 O O   . GLN B 1 325 ? 6.855   20.715  -40.128 1.00 40.83 ? 325  GLN B O   1 
ATOM   6637 C CB  . GLN B 1 325 ? 5.504   23.502  -39.491 1.00 43.20 ? 325  GLN B CB  1 
ATOM   6638 C CG  . GLN B 1 325 ? 5.458   25.023  -39.579 1.00 43.97 ? 325  GLN B CG  1 
ATOM   6639 C CD  . GLN B 1 325 ? 5.541   25.526  -40.998 1.00 46.44 ? 325  GLN B CD  1 
ATOM   6640 O OE1 . GLN B 1 325 ? 4.884   24.996  -41.900 1.00 45.25 ? 325  GLN B OE1 1 
ATOM   6641 N NE2 . GLN B 1 325 ? 6.363   26.559  -41.214 1.00 49.38 ? 325  GLN B NE2 1 
ATOM   6642 N N   . VAL B 1 326 ? 6.844   20.935  -37.877 1.00 39.56 ? 326  VAL B N   1 
ATOM   6643 C CA  . VAL B 1 326 ? 6.984   19.517  -37.604 1.00 38.38 ? 326  VAL B CA  1 
ATOM   6644 C C   . VAL B 1 326 ? 6.046   19.056  -36.506 1.00 37.57 ? 326  VAL B C   1 
ATOM   6645 O O   . VAL B 1 326 ? 5.920   19.723  -35.492 1.00 37.26 ? 326  VAL B O   1 
ATOM   6646 C CB  . VAL B 1 326 ? 8.433   19.137  -37.173 1.00 38.38 ? 326  VAL B CB  1 
ATOM   6647 C CG1 . VAL B 1 326 ? 8.591   17.634  -37.180 1.00 38.97 ? 326  VAL B CG1 1 
ATOM   6648 C CG2 . VAL B 1 326 ? 9.458   19.714  -38.102 1.00 37.79 ? 326  VAL B CG2 1 
ATOM   6649 N N   . LEU B 1 327 ? 5.405   17.907  -36.730 1.00 36.67 ? 327  LEU B N   1 
ATOM   6650 C CA  . LEU B 1 327 ? 4.638   17.177  -35.722 1.00 35.94 ? 327  LEU B CA  1 
ATOM   6651 C C   . LEU B 1 327 ? 5.357   15.847  -35.429 1.00 35.86 ? 327  LEU B C   1 
ATOM   6652 O O   . LEU B 1 327 ? 5.677   15.095  -36.345 1.00 35.52 ? 327  LEU B O   1 
ATOM   6653 C CB  . LEU B 1 327 ? 3.205   16.935  -36.218 1.00 35.92 ? 327  LEU B CB  1 
ATOM   6654 C CG  . LEU B 1 327 ? 2.269   15.989  -35.441 1.00 36.35 ? 327  LEU B CG  1 
ATOM   6655 C CD1 . LEU B 1 327 ? 2.052   16.446  -34.015 1.00 36.48 ? 327  LEU B CD1 1 
ATOM   6656 C CD2 . LEU B 1 327 ? 0.923   15.834  -36.142 1.00 35.96 ? 327  LEU B CD2 1 
ATOM   6657 N N   . VAL B 1 328 ? 5.647   15.576  -34.162 1.00 35.58 ? 328  VAL B N   1 
ATOM   6658 C CA  . VAL B 1 328 ? 6.343   14.348  -33.792 1.00 36.05 ? 328  VAL B CA  1 
ATOM   6659 C C   . VAL B 1 328 ? 5.636   13.719  -32.619 1.00 36.18 ? 328  VAL B C   1 
ATOM   6660 O O   . VAL B 1 328 ? 5.031   14.432  -31.827 1.00 37.10 ? 328  VAL B O   1 
ATOM   6661 C CB  . VAL B 1 328 ? 7.823   14.586  -33.388 1.00 35.70 ? 328  VAL B CB  1 
ATOM   6662 C CG1 . VAL B 1 328 ? 8.628   14.949  -34.567 1.00 36.36 ? 328  VAL B CG1 1 
ATOM   6663 C CG2 . VAL B 1 328 ? 7.930   15.679  -32.340 1.00 36.31 ? 328  VAL B CG2 1 
ATOM   6664 N N   . GLY B 1 329 ? 5.721   12.402  -32.476 1.00 36.18 ? 329  GLY B N   1 
ATOM   6665 C CA  . GLY B 1 329 ? 5.086   11.769  -31.333 1.00 36.12 ? 329  GLY B CA  1 
ATOM   6666 C C   . GLY B 1 329 ? 5.402   10.308  -31.185 1.00 36.43 ? 329  GLY B C   1 
ATOM   6667 O O   . GLY B 1 329 ? 6.089   9.749   -32.017 1.00 36.74 ? 329  GLY B O   1 
ATOM   6668 N N   . VAL B 1 330 ? 4.889   9.709   -30.109 1.00 36.52 ? 330  VAL B N   1 
ATOM   6669 C CA  . VAL B 1 330 ? 5.148   8.338   -29.731 1.00 36.60 ? 330  VAL B CA  1 
ATOM   6670 C C   . VAL B 1 330 ? 3.837   7.704   -29.250 1.00 37.74 ? 330  VAL B C   1 
ATOM   6671 O O   . VAL B 1 330 ? 2.884   8.414   -28.968 1.00 37.97 ? 330  VAL B O   1 
ATOM   6672 C CB  . VAL B 1 330 ? 6.196   8.251   -28.572 1.00 36.62 ? 330  VAL B CB  1 
ATOM   6673 C CG1 . VAL B 1 330 ? 7.574   8.733   -29.019 1.00 36.36 ? 330  VAL B CG1 1 
ATOM   6674 C CG2 . VAL B 1 330 ? 5.721   9.012   -27.314 1.00 34.94 ? 330  VAL B CG2 1 
ATOM   6675 N N   . VAL B 1 331 ? 3.792   6.375   -29.152 1.00 38.32 ? 331  VAL B N   1 
ATOM   6676 C CA  . VAL B 1 331 ? 2.671   5.700   -28.518 1.00 38.85 ? 331  VAL B CA  1 
ATOM   6677 C C   . VAL B 1 331 ? 3.050   5.360   -27.084 1.00 40.30 ? 331  VAL B C   1 
ATOM   6678 O O   . VAL B 1 331 ? 4.239   5.377   -26.729 1.00 40.54 ? 331  VAL B O   1 
ATOM   6679 C CB  . VAL B 1 331 ? 2.232   4.418   -29.294 1.00 39.54 ? 331  VAL B CB  1 
ATOM   6680 C CG1 . VAL B 1 331 ? 1.618   4.796   -30.659 1.00 37.25 ? 331  VAL B CG1 1 
ATOM   6681 C CG2 . VAL B 1 331 ? 3.403   3.388   -29.428 1.00 35.85 ? 331  VAL B CG2 1 
ATOM   6682 N N   . LYS B 1 332 ? 2.047   5.048   -26.262 1.00 41.25 ? 332  LYS B N   1 
ATOM   6683 C CA  . LYS B 1 332 ? 2.277   4.798   -24.840 1.00 42.21 ? 332  LYS B CA  1 
ATOM   6684 C C   . LYS B 1 332 ? 3.279   3.670   -24.580 1.00 41.88 ? 332  LYS B C   1 
ATOM   6685 O O   . LYS B 1 332 ? 3.976   3.686   -23.573 1.00 41.87 ? 332  LYS B O   1 
ATOM   6686 C CB  . LYS B 1 332 ? 0.946   4.564   -24.086 1.00 42.26 ? 332  LYS B CB  1 
ATOM   6687 C CG  . LYS B 1 332 ? 1.051   4.380   -22.535 1.00 42.38 ? 332  LYS B CG  1 
ATOM   6688 C CD  . LYS B 1 332 ? -0.373  4.256   -21.867 1.00 44.16 ? 332  LYS B CD  1 
ATOM   6689 C CE  . LYS B 1 332 ? -0.469  3.126   -20.768 1.00 48.91 ? 332  LYS B CE  1 
ATOM   6690 N NZ  . LYS B 1 332 ? -0.506  1.661   -21.295 1.00 48.18 ? 332  LYS B NZ  1 
ATOM   6691 N N   . ASP B 1 333 ? 3.366   2.699   -25.481 1.00 42.33 ? 333  ASP B N   1 
ATOM   6692 C CA  . ASP B 1 333 ? 4.198   1.518   -25.213 1.00 43.17 ? 333  ASP B CA  1 
ATOM   6693 C C   . ASP B 1 333 ? 5.077   1.125   -26.399 1.00 43.12 ? 333  ASP B C   1 
ATOM   6694 O O   . ASP B 1 333 ? 4.913   0.068   -26.995 1.00 43.43 ? 333  ASP B O   1 
ATOM   6695 C CB  . ASP B 1 333 ? 3.321   0.350   -24.767 1.00 43.60 ? 333  ASP B CB  1 
ATOM   6696 C CG  . ASP B 1 333 ? 2.486   0.682   -23.553 1.00 43.89 ? 333  ASP B CG  1 
ATOM   6697 O OD1 . ASP B 1 333 ? 1.267   0.882   -23.702 1.00 43.31 ? 333  ASP B OD1 1 
ATOM   6698 O OD2 . ASP B 1 333 ? 3.060   0.775   -22.453 1.00 46.78 ? 333  ASP B OD2 1 
ATOM   6699 N N   . GLU B 1 334 ? 6.027   1.982   -26.737 1.00 43.16 ? 334  GLU B N   1 
ATOM   6700 C CA  . GLU B 1 334 ? 6.807   1.775   -27.953 1.00 43.03 ? 334  GLU B CA  1 
ATOM   6701 C C   . GLU B 1 334 ? 7.564   0.453   -27.985 1.00 42.85 ? 334  GLU B C   1 
ATOM   6702 O O   . GLU B 1 334 ? 7.826   -0.069  -29.056 1.00 43.18 ? 334  GLU B O   1 
ATOM   6703 C CB  . GLU B 1 334 ? 7.768   2.936   -28.188 1.00 42.72 ? 334  GLU B CB  1 
ATOM   6704 C CG  . GLU B 1 334 ? 7.072   4.227   -28.557 1.00 42.60 ? 334  GLU B CG  1 
ATOM   6705 C CD  . GLU B 1 334 ? 6.639   4.296   -30.010 1.00 42.43 ? 334  GLU B CD  1 
ATOM   6706 O OE1 . GLU B 1 334 ? 6.864   3.332   -30.764 1.00 43.44 ? 334  GLU B OE1 1 
ATOM   6707 O OE2 . GLU B 1 334 ? 6.063   5.330   -30.403 1.00 41.50 ? 334  GLU B OE2 1 
ATOM   6708 N N   . GLY B 1 335 ? 7.897   -0.101  -26.832 1.00 42.78 ? 335  GLY B N   1 
ATOM   6709 C CA  . GLY B 1 335 ? 8.771   -1.269  -26.816 1.00 44.35 ? 335  GLY B CA  1 
ATOM   6710 C C   . GLY B 1 335 ? 8.182   -2.670  -26.671 1.00 45.22 ? 335  GLY B C   1 
ATOM   6711 O O   . GLY B 1 335 ? 8.879   -3.651  -26.902 1.00 45.45 ? 335  GLY B O   1 
ATOM   6712 N N   . SER B 1 336 ? 6.921   -2.782  -26.277 1.00 46.09 ? 336  SER B N   1 
ATOM   6713 C CA  . SER B 1 336 ? 6.356   -4.089  -25.943 1.00 47.43 ? 336  SER B CA  1 
ATOM   6714 C C   . SER B 1 336 ? 6.525   -5.101  -27.098 1.00 48.21 ? 336  SER B C   1 
ATOM   6715 O O   . SER B 1 336 ? 7.201   -6.128  -26.958 1.00 48.67 ? 336  SER B O   1 
ATOM   6716 C CB  . SER B 1 336 ? 4.892   -3.925  -25.531 1.00 47.58 ? 336  SER B CB  1 
ATOM   6717 O OG  . SER B 1 336 ? 4.130   -3.298  -26.555 1.00 47.07 ? 336  SER B OG  1 
ATOM   6718 N N   . TYR B 1 337 ? 5.954   -4.749  -28.242 1.00 48.99 ? 337  TYR B N   1 
ATOM   6719 C CA  . TYR B 1 337 ? 5.993   -5.503  -29.492 1.00 49.71 ? 337  TYR B CA  1 
ATOM   6720 C C   . TYR B 1 337 ? 7.286   -6.260  -29.773 1.00 49.66 ? 337  TYR B C   1 
ATOM   6721 O O   . TYR B 1 337 ? 7.248   -7.405  -30.218 1.00 50.09 ? 337  TYR B O   1 
ATOM   6722 C CB  . TYR B 1 337 ? 5.758   -4.507  -30.617 1.00 50.99 ? 337  TYR B CB  1 
ATOM   6723 C CG  . TYR B 1 337 ? 5.418   -5.078  -31.961 1.00 53.10 ? 337  TYR B CG  1 
ATOM   6724 C CD1 . TYR B 1 337 ? 4.088   -5.144  -32.379 1.00 54.51 ? 337  TYR B CD1 1 
ATOM   6725 C CD2 . TYR B 1 337 ? 6.421   -5.509  -32.843 1.00 54.79 ? 337  TYR B CD2 1 
ATOM   6726 C CE1 . TYR B 1 337 ? 3.745   -5.648  -33.635 1.00 55.34 ? 337  TYR B CE1 1 
ATOM   6727 C CE2 . TYR B 1 337 ? 6.094   -6.023  -34.110 1.00 56.48 ? 337  TYR B CE2 1 
ATOM   6728 C CZ  . TYR B 1 337 ? 4.743   -6.088  -34.497 1.00 55.82 ? 337  TYR B CZ  1 
ATOM   6729 O OH  . TYR B 1 337 ? 4.376   -6.585  -35.736 1.00 55.96 ? 337  TYR B OH  1 
ATOM   6730 N N   . PHE B 1 338 ? 8.417   -5.613  -29.527 1.00 49.15 ? 338  PHE B N   1 
ATOM   6731 C CA  . PHE B 1 338 ? 9.722   -6.099  -29.968 1.00 49.04 ? 338  PHE B CA  1 
ATOM   6732 C C   . PHE B 1 338 ? 10.295  -7.200  -29.102 1.00 49.48 ? 338  PHE B C   1 
ATOM   6733 O O   . PHE B 1 338 ? 11.139  -7.976  -29.545 1.00 49.46 ? 338  PHE B O   1 
ATOM   6734 C CB  . PHE B 1 338 ? 10.710  -4.936  -30.026 1.00 48.32 ? 338  PHE B CB  1 
ATOM   6735 C CG  . PHE B 1 338 ? 10.410  -3.971  -31.119 1.00 48.28 ? 338  PHE B CG  1 
ATOM   6736 C CD1 . PHE B 1 338 ? 9.528   -2.904  -30.905 1.00 46.70 ? 338  PHE B CD1 1 
ATOM   6737 C CD2 . PHE B 1 338 ? 10.960  -4.150  -32.383 1.00 46.16 ? 338  PHE B CD2 1 
ATOM   6738 C CE1 . PHE B 1 338 ? 9.218   -2.027  -31.926 1.00 45.03 ? 338  PHE B CE1 1 
ATOM   6739 C CE2 . PHE B 1 338 ? 10.651  -3.270  -33.410 1.00 46.15 ? 338  PHE B CE2 1 
ATOM   6740 C CZ  . PHE B 1 338 ? 9.779   -2.206  -33.178 1.00 45.86 ? 338  PHE B CZ  1 
ATOM   6741 N N   . LEU B 1 339 ? 9.838   -7.254  -27.859 1.00 50.18 ? 339  LEU B N   1 
ATOM   6742 C CA  . LEU B 1 339 ? 10.421  -8.149  -26.876 1.00 50.59 ? 339  LEU B CA  1 
ATOM   6743 C C   . LEU B 1 339 ? 10.186  -9.616  -27.252 1.00 51.14 ? 339  LEU B C   1 
ATOM   6744 O O   . LEU B 1 339 ? 11.067  -10.456 -27.046 1.00 50.93 ? 339  LEU B O   1 
ATOM   6745 C CB  . LEU B 1 339 ? 9.881   -7.816  -25.479 1.00 50.32 ? 339  LEU B CB  1 
ATOM   6746 C CG  . LEU B 1 339 ? 10.107  -6.365  -25.018 1.00 50.00 ? 339  LEU B CG  1 
ATOM   6747 C CD1 . LEU B 1 339 ? 9.436   -6.097  -23.682 1.00 47.99 ? 339  LEU B CD1 1 
ATOM   6748 C CD2 . LEU B 1 339 ? 11.589  -6.022  -24.949 1.00 49.00 ? 339  LEU B CD2 1 
ATOM   6749 N N   . VAL B 1 340 ? 9.015   -9.895  -27.832 1.00 51.55 ? 340  VAL B N   1 
ATOM   6750 C CA  . VAL B 1 340 ? 8.631   -11.244 -28.284 1.00 52.50 ? 340  VAL B CA  1 
ATOM   6751 C C   . VAL B 1 340 ? 9.473   -11.777 -29.462 1.00 53.02 ? 340  VAL B C   1 
ATOM   6752 O O   . VAL B 1 340 ? 9.407   -12.958 -29.790 1.00 53.41 ? 340  VAL B O   1 
ATOM   6753 C CB  . VAL B 1 340 ? 7.095   -11.356 -28.617 1.00 52.25 ? 340  VAL B CB  1 
ATOM   6754 C CG1 . VAL B 1 340 ? 6.249   -10.704 -27.530 1.00 52.38 ? 340  VAL B CG1 1 
ATOM   6755 C CG2 . VAL B 1 340 ? 6.771   -10.734 -29.948 1.00 51.82 ? 340  VAL B CG2 1 
ATOM   6756 N N   . TYR B 1 341 ? 10.269  -10.906 -30.077 1.00 53.99 ? 341  TYR B N   1 
ATOM   6757 C CA  . TYR B 1 341 ? 11.115  -11.278 -31.219 1.00 54.69 ? 341  TYR B CA  1 
ATOM   6758 C C   . TYR B 1 341 ? 12.572  -11.558 -30.832 1.00 55.03 ? 341  TYR B C   1 
ATOM   6759 O O   . TYR B 1 341 ? 13.486  -11.412 -31.653 1.00 55.12 ? 341  TYR B O   1 
ATOM   6760 C CB  . TYR B 1 341 ? 11.053  -10.207 -32.314 1.00 54.74 ? 341  TYR B CB  1 
ATOM   6761 C CG  . TYR B 1 341 ? 9.793   -10.251 -33.151 1.00 55.48 ? 341  TYR B CG  1 
ATOM   6762 C CD1 . TYR B 1 341 ? 8.599   -9.689  -32.688 1.00 54.64 ? 341  TYR B CD1 1 
ATOM   6763 C CD2 . TYR B 1 341 ? 9.799   -10.838 -34.418 1.00 55.31 ? 341  TYR B CD2 1 
ATOM   6764 C CE1 . TYR B 1 341 ? 7.442   -9.720  -33.458 1.00 55.46 ? 341  TYR B CE1 1 
ATOM   6765 C CE2 . TYR B 1 341 ? 8.651   -10.873 -35.193 1.00 56.19 ? 341  TYR B CE2 1 
ATOM   6766 C CZ  . TYR B 1 341 ? 7.469   -10.316 -34.711 1.00 56.28 ? 341  TYR B CZ  1 
ATOM   6767 O OH  . TYR B 1 341 ? 6.323   -10.357 -35.489 1.00 55.96 ? 341  TYR B OH  1 
ATOM   6768 N N   . GLY B 1 342 ? 12.798  -11.969 -29.589 1.00 55.27 ? 342  GLY B N   1 
ATOM   6769 C CA  . GLY B 1 342 ? 14.139  -12.389 -29.210 1.00 55.51 ? 342  GLY B CA  1 
ATOM   6770 C C   . GLY B 1 342 ? 14.521  -12.256 -27.755 1.00 55.63 ? 342  GLY B C   1 
ATOM   6771 O O   . GLY B 1 342 ? 15.635  -12.631 -27.376 1.00 55.94 ? 342  GLY B O   1 
ATOM   6772 N N   . VAL B 1 343 ? 13.621  -11.727 -26.932 1.00 55.51 ? 343  VAL B N   1 
ATOM   6773 C CA  . VAL B 1 343 ? 13.909  -11.635 -25.510 1.00 55.43 ? 343  VAL B CA  1 
ATOM   6774 C C   . VAL B 1 343 ? 13.263  -12.801 -24.784 1.00 55.32 ? 343  VAL B C   1 
ATOM   6775 O O   . VAL B 1 343 ? 12.033  -12.871 -24.706 1.00 55.31 ? 343  VAL B O   1 
ATOM   6776 C CB  . VAL B 1 343 ? 13.478  -10.286 -24.880 1.00 55.45 ? 343  VAL B CB  1 
ATOM   6777 C CG1 . VAL B 1 343 ? 13.998  -10.188 -23.446 1.00 54.89 ? 343  VAL B CG1 1 
ATOM   6778 C CG2 . VAL B 1 343 ? 13.997  -9.116  -25.704 1.00 55.67 ? 343  VAL B CG2 1 
ATOM   6779 N N   . PRO B 1 344 ? 14.098  -13.721 -24.254 1.00 55.50 ? 344  PRO B N   1 
ATOM   6780 C CA  . PRO B 1 344 ? 13.628  -14.915 -23.551 1.00 55.71 ? 344  PRO B CA  1 
ATOM   6781 C C   . PRO B 1 344 ? 12.692  -14.520 -22.417 1.00 56.25 ? 344  PRO B C   1 
ATOM   6782 O O   . PRO B 1 344 ? 13.037  -13.643 -21.613 1.00 56.40 ? 344  PRO B O   1 
ATOM   6783 C CB  . PRO B 1 344 ? 14.922  -15.523 -22.994 1.00 55.77 ? 344  PRO B CB  1 
ATOM   6784 C CG  . PRO B 1 344 ? 15.988  -15.068 -23.947 1.00 55.50 ? 344  PRO B CG  1 
ATOM   6785 C CD  . PRO B 1 344 ? 15.574  -13.662 -24.299 1.00 55.41 ? 344  PRO B CD  1 
ATOM   6786 N N   . GLY B 1 345 ? 11.508  -15.132 -22.383 1.00 56.27 ? 345  GLY B N   1 
ATOM   6787 C CA  . GLY B 1 345 ? 10.533  -14.866 -21.341 1.00 56.29 ? 345  GLY B CA  1 
ATOM   6788 C C   . GLY B 1 345 ? 9.354   -14.057 -21.833 1.00 56.81 ? 345  GLY B C   1 
ATOM   6789 O O   . GLY B 1 345 ? 8.418   -13.769 -21.070 1.00 57.13 ? 345  GLY B O   1 
ATOM   6790 N N   . PHE B 1 346 ? 9.383   -13.682 -23.106 1.00 56.85 ? 346  PHE B N   1 
ATOM   6791 C CA  . PHE B 1 346 ? 8.299   -12.882 -23.659 1.00 56.98 ? 346  PHE B CA  1 
ATOM   6792 C C   . PHE B 1 346 ? 7.554   -13.613 -24.768 1.00 57.67 ? 346  PHE B C   1 
ATOM   6793 O O   . PHE B 1 346 ? 8.164   -14.269 -25.618 1.00 57.86 ? 346  PHE B O   1 
ATOM   6794 C CB  . PHE B 1 346 ? 8.829   -11.525 -24.129 1.00 56.35 ? 346  PHE B CB  1 
ATOM   6795 C CG  . PHE B 1 346 ? 9.272   -10.622 -23.000 1.00 55.18 ? 346  PHE B CG  1 
ATOM   6796 C CD1 . PHE B 1 346 ? 10.572  -10.677 -22.514 1.00 53.21 ? 346  PHE B CD1 1 
ATOM   6797 C CD2 . PHE B 1 346 ? 8.382   -9.717  -22.421 1.00 54.32 ? 346  PHE B CD2 1 
ATOM   6798 C CE1 . PHE B 1 346 ? 10.985  -9.851  -21.480 1.00 52.80 ? 346  PHE B CE1 1 
ATOM   6799 C CE2 . PHE B 1 346 ? 8.791   -8.888  -21.376 1.00 53.33 ? 346  PHE B CE2 1 
ATOM   6800 C CZ  . PHE B 1 346 ? 10.096  -8.954  -20.914 1.00 53.69 ? 346  PHE B CZ  1 
ATOM   6801 N N   . SER B 1 347 ? 6.229   -13.499 -24.736 1.00 58.24 ? 347  SER B N   1 
ATOM   6802 C CA  . SER B 1 347 ? 5.338   -14.155 -25.690 1.00 58.45 ? 347  SER B CA  1 
ATOM   6803 C C   . SER B 1 347 ? 3.994   -13.451 -25.642 1.00 58.75 ? 347  SER B C   1 
ATOM   6804 O O   . SER B 1 347 ? 3.627   -12.880 -24.615 1.00 58.62 ? 347  SER B O   1 
ATOM   6805 C CB  . SER B 1 347 ? 5.165   -15.635 -25.323 1.00 58.70 ? 347  SER B CB  1 
ATOM   6806 O OG  . SER B 1 347 ? 3.943   -16.182 -25.815 1.00 59.19 ? 347  SER B OG  1 
ATOM   6807 N N   . LYS B 1 348 ? 3.262   -13.497 -26.750 1.00 59.30 ? 348  LYS B N   1 
ATOM   6808 C CA  . LYS B 1 348 ? 1.945   -12.891 -26.819 1.00 60.08 ? 348  LYS B CA  1 
ATOM   6809 C C   . LYS B 1 348 ? 0.895   -13.792 -26.176 1.00 60.89 ? 348  LYS B C   1 
ATOM   6810 O O   . LYS B 1 348 ? -0.237  -13.361 -25.933 1.00 60.89 ? 348  LYS B O   1 
ATOM   6811 C CB  . LYS B 1 348 ? 1.565   -12.612 -28.272 1.00 59.94 ? 348  LYS B CB  1 
ATOM   6812 C CG  . LYS B 1 348 ? 1.433   -13.855 -29.131 1.00 60.52 ? 348  LYS B CG  1 
ATOM   6813 C CD  . LYS B 1 348 ? 0.799   -13.533 -30.466 1.00 61.03 ? 348  LYS B CD  1 
ATOM   6814 C CE  . LYS B 1 348 ? 0.001   -14.715 -30.996 1.00 61.78 ? 348  LYS B CE  1 
ATOM   6815 N NZ  . LYS B 1 348 ? -1.285  -14.868 -30.251 1.00 62.05 ? 348  LYS B NZ  1 
ATOM   6816 N N   . ASP B 1 349 ? 1.274   -15.040 -25.909 1.00 61.59 ? 349  ASP B N   1 
ATOM   6817 C CA  . ASP B 1 349 ? 0.311   -16.063 -25.492 1.00 62.59 ? 349  ASP B CA  1 
ATOM   6818 C C   . ASP B 1 349 ? 0.164   -16.202 -23.966 1.00 62.97 ? 349  ASP B C   1 
ATOM   6819 O O   . ASP B 1 349 ? -0.669  -16.973 -23.489 1.00 62.97 ? 349  ASP B O   1 
ATOM   6820 C CB  . ASP B 1 349 ? 0.622   -17.411 -26.176 1.00 62.64 ? 349  ASP B CB  1 
ATOM   6821 C CG  . ASP B 1 349 ? 0.449   -17.356 -27.708 1.00 63.31 ? 349  ASP B CG  1 
ATOM   6822 O OD1 . ASP B 1 349 ? -0.459  -16.635 -28.193 1.00 63.05 ? 349  ASP B OD1 1 
ATOM   6823 O OD2 . ASP B 1 349 ? 1.224   -18.034 -28.429 1.00 62.95 ? 349  ASP B OD2 1 
ATOM   6824 N N   . ASN B 1 350 ? 0.963   -15.444 -23.214 1.00 63.42 ? 350  ASN B N   1 
ATOM   6825 C CA  . ASN B 1 350 ? 0.821   -15.347 -21.757 1.00 63.78 ? 350  ASN B CA  1 
ATOM   6826 C C   . ASN B 1 350 ? 1.121   -13.926 -21.230 1.00 63.94 ? 350  ASN B C   1 
ATOM   6827 O O   . ASN B 1 350 ? 1.226   -12.979 -22.015 1.00 64.22 ? 350  ASN B O   1 
ATOM   6828 C CB  . ASN B 1 350 ? 1.671   -16.419 -21.050 1.00 63.80 ? 350  ASN B CB  1 
ATOM   6829 C CG  . ASN B 1 350 ? 3.159   -16.279 -21.327 1.00 64.72 ? 350  ASN B CG  1 
ATOM   6830 O OD1 . ASN B 1 350 ? 3.701   -15.171 -21.388 1.00 65.63 ? 350  ASN B OD1 1 
ATOM   6831 N ND2 . ASN B 1 350 ? 3.835   -17.410 -21.470 1.00 65.34 ? 350  ASN B ND2 1 
ATOM   6832 N N   . GLU B 1 351 ? 1.260   -13.779 -19.913 1.00 63.85 ? 351  GLU B N   1 
ATOM   6833 C CA  . GLU B 1 351 ? 1.527   -12.467 -19.301 1.00 63.71 ? 351  GLU B CA  1 
ATOM   6834 C C   . GLU B 1 351 ? 3.011   -12.062 -19.248 1.00 62.60 ? 351  GLU B C   1 
ATOM   6835 O O   . GLU B 1 351 ? 3.336   -10.974 -18.782 1.00 62.15 ? 351  GLU B O   1 
ATOM   6836 C CB  . GLU B 1 351 ? 0.894   -12.379 -17.910 1.00 63.61 ? 351  GLU B CB  1 
ATOM   6837 C CG  . GLU B 1 351 ? -0.522  -11.824 -17.900 1.00 64.56 ? 351  GLU B CG  1 
ATOM   6838 C CD  . GLU B 1 351 ? -1.236  -12.062 -16.566 1.00 65.77 ? 351  GLU B CD  1 
ATOM   6839 O OE1 . GLU B 1 351 ? -0.645  -11.795 -15.484 1.00 67.59 ? 351  GLU B OE1 1 
ATOM   6840 O OE2 . GLU B 1 351 ? -2.401  -12.522 -16.601 1.00 69.04 ? 351  GLU B OE2 1 
ATOM   6841 N N   . SER B 1 352 ? 3.896   -12.940 -19.719 1.00 61.95 ? 352  SER B N   1 
ATOM   6842 C CA  . SER B 1 352 ? 5.329   -12.639 -19.857 1.00 61.45 ? 352  SER B CA  1 
ATOM   6843 C C   . SER B 1 352 ? 5.936   -12.018 -18.597 1.00 61.39 ? 352  SER B C   1 
ATOM   6844 O O   . SER B 1 352 ? 6.671   -11.019 -18.665 1.00 61.27 ? 352  SER B O   1 
ATOM   6845 C CB  . SER B 1 352 ? 5.587   -11.727 -21.068 1.00 61.26 ? 352  SER B CB  1 
ATOM   6846 O OG  . SER B 1 352 ? 4.702   -12.001 -22.142 1.00 61.24 ? 352  SER B OG  1 
ATOM   6847 N N   . LEU B 1 353 ? 5.628   -12.609 -17.447 1.00 61.03 ? 353  LEU B N   1 
ATOM   6848 C CA  . LEU B 1 353 ? 6.157   -12.116 -16.183 1.00 60.88 ? 353  LEU B CA  1 
ATOM   6849 C C   . LEU B 1 353 ? 7.563   -12.666 -15.992 1.00 60.62 ? 353  LEU B C   1 
ATOM   6850 O O   . LEU B 1 353 ? 7.739   -13.855 -15.780 1.00 60.84 ? 353  LEU B O   1 
ATOM   6851 C CB  . LEU B 1 353 ? 5.227   -12.487 -15.024 1.00 60.53 ? 353  LEU B CB  1 
ATOM   6852 C CG  . LEU B 1 353 ? 3.788   -11.954 -15.120 1.00 61.14 ? 353  LEU B CG  1 
ATOM   6853 C CD1 . LEU B 1 353 ? 2.873   -12.654 -14.111 1.00 61.39 ? 353  LEU B CD1 1 
ATOM   6854 C CD2 . LEU B 1 353 ? 3.701   -10.419 -14.964 1.00 60.61 ? 353  LEU B CD2 1 
ATOM   6855 N N   . ILE B 1 354 ? 8.563   -11.797 -16.095 1.00 60.55 ? 354  ILE B N   1 
ATOM   6856 C CA  . ILE B 1 354 ? 9.972   -12.226 -16.051 1.00 60.38 ? 354  ILE B CA  1 
ATOM   6857 C C   . ILE B 1 354 ? 10.619  -12.182 -14.666 1.00 60.57 ? 354  ILE B C   1 
ATOM   6858 O O   . ILE B 1 354 ? 10.113  -11.537 -13.749 1.00 60.35 ? 354  ILE B O   1 
ATOM   6859 C CB  . ILE B 1 354 ? 10.863  -11.406 -17.014 1.00 60.19 ? 354  ILE B CB  1 
ATOM   6860 C CG1 . ILE B 1 354 ? 10.493  -9.914  -16.976 1.00 59.46 ? 354  ILE B CG1 1 
ATOM   6861 C CG2 . ILE B 1 354 ? 10.782  -11.960 -18.424 1.00 60.40 ? 354  ILE B CG2 1 
ATOM   6862 C CD1 . ILE B 1 354 ? 11.571  -9.008  -17.546 1.00 58.52 ? 354  ILE B CD1 1 
ATOM   6863 N N   . SER B 1 355 ? 11.738  -12.892 -14.542 1.00 61.06 ? 355  SER B N   1 
ATOM   6864 C CA  . SER B 1 355 ? 12.610  -12.837 -13.370 1.00 61.70 ? 355  SER B CA  1 
ATOM   6865 C C   . SER B 1 355 ? 13.620  -11.694 -13.529 1.00 61.81 ? 355  SER B C   1 
ATOM   6866 O O   . SER B 1 355 ? 13.771  -11.133 -14.626 1.00 61.74 ? 355  SER B O   1 
ATOM   6867 C CB  . SER B 1 355 ? 13.387  -14.150 -13.228 1.00 61.83 ? 355  SER B CB  1 
ATOM   6868 O OG  . SER B 1 355 ? 14.490  -14.174 -14.132 1.00 62.80 ? 355  SER B OG  1 
ATOM   6869 N N   . ARG B 1 356 ? 14.334  -11.386 -12.447 1.00 61.90 ? 356  ARG B N   1 
ATOM   6870 C CA  . ARG B 1 356 ? 15.416  -10.407 -12.494 1.00 62.11 ? 356  ARG B CA  1 
ATOM   6871 C C   . ARG B 1 356 ? 16.520  -10.810 -13.473 1.00 62.03 ? 356  ARG B C   1 
ATOM   6872 O O   . ARG B 1 356 ? 17.014  -9.974  -14.242 1.00 62.39 ? 356  ARG B O   1 
ATOM   6873 C CB  . ARG B 1 356 ? 15.989  -10.148 -11.095 1.00 62.14 ? 356  ARG B CB  1 
ATOM   6874 C CG  . ARG B 1 356 ? 17.086  -9.097  -11.086 1.00 62.95 ? 356  ARG B CG  1 
ATOM   6875 C CD  . ARG B 1 356 ? 16.891  -8.050  -9.997  1.00 64.84 ? 356  ARG B CD  1 
ATOM   6876 N NE  . ARG B 1 356 ? 17.949  -7.039  -10.066 1.00 66.81 ? 356  ARG B NE  1 
ATOM   6877 C CZ  . ARG B 1 356 ? 17.800  -5.799  -10.541 1.00 67.54 ? 356  ARG B CZ  1 
ATOM   6878 N NH1 . ARG B 1 356 ? 16.620  -5.377  -10.989 1.00 67.04 ? 356  ARG B NH1 1 
ATOM   6879 N NH2 . ARG B 1 356 ? 18.841  -4.971  -10.559 1.00 67.36 ? 356  ARG B NH2 1 
ATOM   6880 N N   . ALA B 1 357 ? 16.895  -12.088 -13.457 1.00 61.70 ? 357  ALA B N   1 
ATOM   6881 C CA  . ALA B 1 357 ? 17.994  -12.566 -14.296 1.00 61.20 ? 357  ALA B CA  1 
ATOM   6882 C C   . ALA B 1 357 ? 17.644  -12.394 -15.767 1.00 60.66 ? 357  ALA B C   1 
ATOM   6883 O O   . ALA B 1 357 ? 18.492  -12.012 -16.574 1.00 60.22 ? 357  ALA B O   1 
ATOM   6884 C CB  . ALA B 1 357 ? 18.329  -14.030 -13.978 1.00 61.18 ? 357  ALA B CB  1 
ATOM   6885 N N   . GLN B 1 358 ? 16.381  -12.671 -16.086 1.00 60.26 ? 358  GLN B N   1 
ATOM   6886 C CA  . GLN B 1 358 ? 15.845  -12.533 -17.437 1.00 60.05 ? 358  GLN B CA  1 
ATOM   6887 C C   . GLN B 1 358 ? 15.885  -11.076 -17.889 1.00 59.54 ? 358  GLN B C   1 
ATOM   6888 O O   . GLN B 1 358 ? 16.132  -10.783 -19.066 1.00 59.18 ? 358  GLN B O   1 
ATOM   6889 C CB  . GLN B 1 358 ? 14.416  -13.087 -17.494 1.00 59.94 ? 358  GLN B CB  1 
ATOM   6890 C CG  . GLN B 1 358 ? 14.364  -14.617 -17.564 1.00 60.55 ? 358  GLN B CG  1 
ATOM   6891 C CD  . GLN B 1 358 ? 12.964  -15.186 -17.355 1.00 60.53 ? 358  GLN B CD  1 
ATOM   6892 O OE1 . GLN B 1 358 ? 12.298  -14.876 -16.367 1.00 61.83 ? 358  GLN B OE1 1 
ATOM   6893 N NE2 . GLN B 1 358 ? 12.524  -16.042 -18.277 1.00 59.87 ? 358  GLN B NE2 1 
ATOM   6894 N N   . PHE B 1 359 ? 15.671  -10.176 -16.929 1.00 59.06 ? 359  PHE B N   1 
ATOM   6895 C CA  . PHE B 1 359 ? 15.692  -8.743  -17.177 1.00 58.37 ? 359  PHE B CA  1 
ATOM   6896 C C   . PHE B 1 359 ? 17.099  -8.238  -17.479 1.00 57.97 ? 359  PHE B C   1 
ATOM   6897 O O   . PHE B 1 359 ? 17.266  -7.421  -18.373 1.00 58.16 ? 359  PHE B O   1 
ATOM   6898 C CB  . PHE B 1 359 ? 15.035  -7.972  -16.020 1.00 58.39 ? 359  PHE B CB  1 
ATOM   6899 C CG  . PHE B 1 359 ? 15.200  -6.476  -16.106 1.00 58.30 ? 359  PHE B CG  1 
ATOM   6900 C CD1 . PHE B 1 359 ? 16.070  -5.810  -15.251 1.00 57.85 ? 359  PHE B CD1 1 
ATOM   6901 C CD2 . PHE B 1 359 ? 14.492  -5.735  -17.041 1.00 58.81 ? 359  PHE B CD2 1 
ATOM   6902 C CE1 . PHE B 1 359 ? 16.232  -4.435  -15.326 1.00 57.57 ? 359  PHE B CE1 1 
ATOM   6903 C CE2 . PHE B 1 359 ? 14.654  -4.353  -17.126 1.00 58.79 ? 359  PHE B CE2 1 
ATOM   6904 C CZ  . PHE B 1 359 ? 15.526  -3.706  -16.261 1.00 57.95 ? 359  PHE B CZ  1 
ATOM   6905 N N   . LEU B 1 360 ? 18.110  -8.726  -16.769 1.00 57.59 ? 360  LEU B N   1 
ATOM   6906 C CA  . LEU B 1 360 ? 19.489  -8.315  -17.075 1.00 57.65 ? 360  LEU B CA  1 
ATOM   6907 C C   . LEU B 1 360 ? 19.909  -8.795  -18.453 1.00 57.04 ? 360  LEU B C   1 
ATOM   6908 O O   . LEU B 1 360 ? 20.605  -8.086  -19.176 1.00 57.00 ? 360  LEU B O   1 
ATOM   6909 C CB  . LEU B 1 360 ? 20.504  -8.827  -16.045 1.00 58.03 ? 360  LEU B CB  1 
ATOM   6910 C CG  . LEU B 1 360 ? 20.334  -8.727  -14.520 1.00 59.79 ? 360  LEU B CG  1 
ATOM   6911 C CD1 . LEU B 1 360 ? 21.696  -8.981  -13.856 1.00 62.13 ? 360  LEU B CD1 1 
ATOM   6912 C CD2 . LEU B 1 360 ? 19.767  -7.397  -14.035 1.00 60.57 ? 360  LEU B CD2 1 
ATOM   6913 N N   . ALA B 1 361 ? 19.488  -10.010 -18.798 1.00 56.58 ? 361  ALA B N   1 
ATOM   6914 C CA  . ALA B 1 361 ? 19.818  -10.626 -20.078 1.00 56.01 ? 361  ALA B CA  1 
ATOM   6915 C C   . ALA B 1 361 ? 19.074  -9.930  -21.211 1.00 55.58 ? 361  ALA B C   1 
ATOM   6916 O O   . ALA B 1 361 ? 19.640  -9.707  -22.287 1.00 55.71 ? 361  ALA B O   1 
ATOM   6917 C CB  . ALA B 1 361 ? 19.489  -12.125 -20.051 1.00 55.86 ? 361  ALA B CB  1 
ATOM   6918 N N   . GLY B 1 362 ? 17.807  -9.592  -20.960 1.00 54.98 ? 362  GLY B N   1 
ATOM   6919 C CA  . GLY B 1 362 ? 16.990  -8.819  -21.902 1.00 54.31 ? 362  GLY B CA  1 
ATOM   6920 C C   . GLY B 1 362 ? 17.599  -7.472  -22.266 1.00 53.89 ? 362  GLY B C   1 
ATOM   6921 O O   . GLY B 1 362 ? 17.495  -7.031  -23.410 1.00 53.56 ? 362  GLY B O   1 
ATOM   6922 N N   . VAL B 1 363 ? 18.246  -6.834  -21.288 1.00 53.63 ? 363  VAL B N   1 
ATOM   6923 C CA  . VAL B 1 363 ? 18.893  -5.525  -21.475 1.00 53.22 ? 363  VAL B CA  1 
ATOM   6924 C C   . VAL B 1 363 ? 20.109  -5.583  -22.405 1.00 53.29 ? 363  VAL B C   1 
ATOM   6925 O O   . VAL B 1 363 ? 20.319  -4.653  -23.185 1.00 53.39 ? 363  VAL B O   1 
ATOM   6926 C CB  . VAL B 1 363 ? 19.241  -4.851  -20.114 1.00 52.95 ? 363  VAL B CB  1 
ATOM   6927 C CG1 . VAL B 1 363 ? 20.172  -3.642  -20.288 1.00 52.29 ? 363  VAL B CG1 1 
ATOM   6928 C CG2 . VAL B 1 363 ? 17.963  -4.442  -19.401 1.00 53.19 ? 363  VAL B CG2 1 
ATOM   6929 N N   . ARG B 1 364 ? 20.893  -6.662  -22.342 1.00 53.20 ? 364  ARG B N   1 
ATOM   6930 C CA  . ARG B 1 364 ? 22.048  -6.799  -23.226 1.00 53.57 ? 364  ARG B CA  1 
ATOM   6931 C C   . ARG B 1 364 ? 21.588  -6.982  -24.662 1.00 53.43 ? 364  ARG B C   1 
ATOM   6932 O O   . ARG B 1 364 ? 22.352  -6.741  -25.595 1.00 53.22 ? 364  ARG B O   1 
ATOM   6933 C CB  . ARG B 1 364 ? 22.937  -7.982  -22.838 1.00 54.08 ? 364  ARG B CB  1 
ATOM   6934 C CG  . ARG B 1 364 ? 23.437  -8.034  -21.387 1.00 55.88 ? 364  ARG B CG  1 
ATOM   6935 C CD  . ARG B 1 364 ? 24.105  -6.747  -20.919 1.00 58.50 ? 364  ARG B CD  1 
ATOM   6936 N NE  . ARG B 1 364 ? 25.202  -6.292  -21.783 1.00 60.30 ? 364  ARG B NE  1 
ATOM   6937 C CZ  . ARG B 1 364 ? 26.500  -6.442  -21.506 1.00 60.65 ? 364  ARG B CZ  1 
ATOM   6938 N NH1 . ARG B 1 364 ? 26.882  -7.056  -20.387 1.00 60.20 ? 364  ARG B NH1 1 
ATOM   6939 N NH2 . ARG B 1 364 ? 27.418  -5.978  -22.352 1.00 60.53 ? 364  ARG B NH2 1 
ATOM   6940 N N   . ILE B 1 365 ? 20.334  -7.409  -24.822 1.00 53.42 ? 365  ILE B N   1 
ATOM   6941 C CA  . ILE B 1 365 ? 19.725  -7.648  -26.133 1.00 53.15 ? 365  ILE B CA  1 
ATOM   6942 C C   . ILE B 1 365 ? 19.028  -6.387  -26.651 1.00 52.97 ? 365  ILE B C   1 
ATOM   6943 O O   . ILE B 1 365 ? 19.108  -6.067  -27.846 1.00 52.58 ? 365  ILE B O   1 
ATOM   6944 C CB  . ILE B 1 365 ? 18.748  -8.873  -26.097 1.00 53.24 ? 365  ILE B CB  1 
ATOM   6945 C CG1 . ILE B 1 365 ? 19.548  -10.174 -25.922 1.00 53.42 ? 365  ILE B CG1 1 
ATOM   6946 C CG2 . ILE B 1 365 ? 17.866  -8.942  -27.366 1.00 52.63 ? 365  ILE B CG2 1 
ATOM   6947 C CD1 . ILE B 1 365 ? 18.698  -11.422 -25.691 1.00 53.17 ? 365  ILE B CD1 1 
ATOM   6948 N N   . GLY B 1 366 ? 18.348  -5.683  -25.748 1.00 52.98 ? 366  GLY B N   1 
ATOM   6949 C CA  . GLY B 1 366 ? 17.690  -4.421  -26.076 1.00 53.11 ? 366  GLY B CA  1 
ATOM   6950 C C   . GLY B 1 366 ? 18.682  -3.301  -26.330 1.00 53.23 ? 366  GLY B C   1 
ATOM   6951 O O   . GLY B 1 366 ? 18.433  -2.419  -27.140 1.00 53.62 ? 366  GLY B O   1 
ATOM   6952 N N   . VAL B 1 367 ? 19.809  -3.332  -25.630 1.00 53.34 ? 367  VAL B N   1 
ATOM   6953 C CA  . VAL B 1 367 ? 20.840  -2.329  -25.810 1.00 53.54 ? 367  VAL B CA  1 
ATOM   6954 C C   . VAL B 1 367 ? 22.111  -3.044  -26.227 1.00 54.39 ? 367  VAL B C   1 
ATOM   6955 O O   . VAL B 1 367 ? 23.086  -3.086  -25.476 1.00 53.76 ? 367  VAL B O   1 
ATOM   6956 C CB  . VAL B 1 367 ? 21.084  -1.482  -24.535 1.00 53.38 ? 367  VAL B CB  1 
ATOM   6957 C CG1 . VAL B 1 367 ? 21.796  -0.189  -24.902 1.00 51.36 ? 367  VAL B CG1 1 
ATOM   6958 C CG2 . VAL B 1 367 ? 19.767  -1.197  -23.799 1.00 52.18 ? 367  VAL B CG2 1 
ATOM   6959 N N   . PRO B 1 368 ? 22.109  -3.592  -27.454 1.00 55.40 ? 368  PRO B N   1 
ATOM   6960 C CA  . PRO B 1 368 ? 23.173  -4.480  -27.917 1.00 56.06 ? 368  PRO B CA  1 
ATOM   6961 C C   . PRO B 1 368 ? 24.525  -3.787  -28.006 1.00 56.76 ? 368  PRO B C   1 
ATOM   6962 O O   . PRO B 1 368 ? 25.554  -4.451  -28.005 1.00 56.92 ? 368  PRO B O   1 
ATOM   6963 C CB  . PRO B 1 368 ? 22.698  -4.880  -29.314 1.00 56.05 ? 368  PRO B CB  1 
ATOM   6964 C CG  . PRO B 1 368 ? 21.834  -3.756  -29.748 1.00 55.55 ? 368  PRO B CG  1 
ATOM   6965 C CD  . PRO B 1 368 ? 21.108  -3.354  -28.510 1.00 55.20 ? 368  PRO B CD  1 
ATOM   6966 N N   . GLN B 1 369 ? 24.510  -2.463  -28.080 1.00 57.93 ? 369  GLN B N   1 
ATOM   6967 C CA  . GLN B 1 369 ? 25.735  -1.675  -28.202 1.00 59.56 ? 369  GLN B CA  1 
ATOM   6968 C C   . GLN B 1 369 ? 26.387  -1.455  -26.839 1.00 59.11 ? 369  GLN B C   1 
ATOM   6969 O O   . GLN B 1 369 ? 27.554  -1.083  -26.766 1.00 59.52 ? 369  GLN B O   1 
ATOM   6970 C CB  . GLN B 1 369 ? 25.440  -0.326  -28.867 1.00 59.24 ? 369  GLN B CB  1 
ATOM   6971 C CG  . GLN B 1 369 ? 24.226  0.433   -28.262 1.00 61.32 ? 369  GLN B CG  1 
ATOM   6972 C CD  . GLN B 1 369 ? 24.253  1.944   -28.558 1.00 62.44 ? 369  GLN B CD  1 
ATOM   6973 O OE1 . GLN B 1 369 ? 24.203  2.378   -29.730 1.00 65.61 ? 369  GLN B OE1 1 
ATOM   6974 N NE2 . GLN B 1 369 ? 24.338  2.753   -27.493 1.00 64.97 ? 369  GLN B NE2 1 
ATOM   6975 N N   . ALA B 1 370 ? 25.625  -1.697  -25.775 1.00 59.09 ? 370  ALA B N   1 
ATOM   6976 C CA  . ALA B 1 370 ? 26.049  -1.407  -24.401 1.00 59.46 ? 370  ALA B CA  1 
ATOM   6977 C C   . ALA B 1 370 ? 27.114  -2.350  -23.837 1.00 59.76 ? 370  ALA B C   1 
ATOM   6978 O O   . ALA B 1 370 ? 26.971  -3.582  -23.891 1.00 59.98 ? 370  ALA B O   1 
ATOM   6979 C CB  . ALA B 1 370 ? 24.837  -1.363  -23.457 1.00 59.01 ? 370  ALA B CB  1 
ATOM   6980 N N   . SER B 1 371 ? 28.164  -1.744  -23.283 1.00 59.96 ? 371  SER B N   1 
ATOM   6981 C CA  . SER B 1 371 ? 29.180  -2.440  -22.487 1.00 60.42 ? 371  SER B CA  1 
ATOM   6982 C C   . SER B 1 371 ? 28.587  -2.896  -21.161 1.00 60.43 ? 371  SER B C   1 
ATOM   6983 O O   . SER B 1 371 ? 27.517  -2.432  -20.769 1.00 60.59 ? 371  SER B O   1 
ATOM   6984 C CB  . SER B 1 371 ? 30.359  -1.507  -22.207 1.00 60.36 ? 371  SER B CB  1 
ATOM   6985 O OG  . SER B 1 371 ? 29.906  -0.293  -21.623 1.00 61.12 ? 371  SER B OG  1 
ATOM   6986 N N   . ASP B 1 372 ? 29.294  -3.790  -20.470 1.00 60.48 ? 372  ASP B N   1 
ATOM   6987 C CA  . ASP B 1 372 ? 28.849  -4.337  -19.187 1.00 60.47 ? 372  ASP B CA  1 
ATOM   6988 C C   . ASP B 1 372 ? 28.414  -3.254  -18.212 1.00 59.87 ? 372  ASP B C   1 
ATOM   6989 O O   . ASP B 1 372 ? 27.382  -3.404  -17.534 1.00 60.03 ? 372  ASP B O   1 
ATOM   6990 C CB  . ASP B 1 372 ? 29.950  -5.193  -18.544 1.00 60.95 ? 372  ASP B CB  1 
ATOM   6991 C CG  . ASP B 1 372 ? 30.131  -6.538  -19.241 1.00 62.97 ? 372  ASP B CG  1 
ATOM   6992 O OD1 . ASP B 1 372 ? 30.254  -6.562  -20.495 1.00 63.68 ? 372  ASP B OD1 1 
ATOM   6993 O OD2 . ASP B 1 372 ? 30.156  -7.573  -18.529 1.00 64.84 ? 372  ASP B OD2 1 
ATOM   6994 N N   . LEU B 1 373 ? 29.207  -2.178  -18.149 1.00 58.69 ? 373  LEU B N   1 
ATOM   6995 C CA  . LEU B 1 373 ? 28.952  -1.065  -17.236 1.00 57.90 ? 373  LEU B CA  1 
ATOM   6996 C C   . LEU B 1 373 ? 27.725  -0.267  -17.652 1.00 57.47 ? 373  LEU B C   1 
ATOM   6997 O O   . LEU B 1 373 ? 26.879  0.024   -16.813 1.00 57.60 ? 373  LEU B O   1 
ATOM   6998 C CB  . LEU B 1 373 ? 30.179  -0.149  -17.099 1.00 57.77 ? 373  LEU B CB  1 
ATOM   6999 C CG  . LEU B 1 373 ? 30.026  1.149   -16.278 1.00 58.05 ? 373  LEU B CG  1 
ATOM   7000 C CD1 . LEU B 1 373 ? 29.618  0.900   -14.830 1.00 56.78 ? 373  LEU B CD1 1 
ATOM   7001 C CD2 . LEU B 1 373 ? 31.299  1.958   -16.314 1.00 57.56 ? 373  LEU B CD2 1 
ATOM   7002 N N   . ALA B 1 374 ? 27.641  0.083   -18.938 1.00 56.92 ? 374  ALA B N   1 
ATOM   7003 C CA  . ALA B 1 374 ? 26.477  0.787   -19.487 1.00 56.46 ? 374  ALA B CA  1 
ATOM   7004 C C   . ALA B 1 374 ? 25.190  -0.001  -19.261 1.00 55.96 ? 374  ALA B C   1 
ATOM   7005 O O   . ALA B 1 374 ? 24.169  0.562   -18.863 1.00 55.80 ? 374  ALA B O   1 
ATOM   7006 C CB  . ALA B 1 374 ? 26.672  1.096   -20.971 1.00 56.58 ? 374  ALA B CB  1 
ATOM   7007 N N   . ALA B 1 375 ? 25.262  -1.308  -19.490 1.00 55.27 ? 375  ALA B N   1 
ATOM   7008 C CA  . ALA B 1 375 ? 24.134  -2.191  -19.264 1.00 54.88 ? 375  ALA B CA  1 
ATOM   7009 C C   . ALA B 1 375 ? 23.770  -2.182  -17.793 1.00 54.57 ? 375  ALA B C   1 
ATOM   7010 O O   . ALA B 1 375 ? 22.593  -2.169  -17.440 1.00 55.07 ? 375  ALA B O   1 
ATOM   7011 C CB  . ALA B 1 375 ? 24.463  -3.578  -19.713 1.00 54.94 ? 375  ALA B CB  1 
ATOM   7012 N N   . GLU B 1 376 ? 24.779  -2.175  -16.932 1.00 53.77 ? 376  GLU B N   1 
ATOM   7013 C CA  . GLU B 1 376 ? 24.535  -2.039  -15.504 1.00 52.98 ? 376  GLU B CA  1 
ATOM   7014 C C   . GLU B 1 376 ? 23.781  -0.731  -15.213 1.00 51.50 ? 376  GLU B C   1 
ATOM   7015 O O   . GLU B 1 376 ? 22.759  -0.737  -14.532 1.00 51.11 ? 376  GLU B O   1 
ATOM   7016 C CB  . GLU B 1 376 ? 25.846  -2.130  -14.714 1.00 53.17 ? 376  GLU B CB  1 
ATOM   7017 C CG  . GLU B 1 376 ? 25.646  -2.413  -13.241 1.00 56.23 ? 376  GLU B CG  1 
ATOM   7018 C CD  . GLU B 1 376 ? 24.894  -3.720  -12.981 1.00 61.49 ? 376  GLU B CD  1 
ATOM   7019 O OE1 . GLU B 1 376 ? 25.177  -4.725  -13.681 1.00 63.83 ? 376  GLU B OE1 1 
ATOM   7020 O OE2 . GLU B 1 376 ? 24.023  -3.746  -12.073 1.00 62.68 ? 376  GLU B OE2 1 
ATOM   7021 N N   . ALA B 1 377 ? 24.275  0.377   -15.757 1.00 50.00 ? 377  ALA B N   1 
ATOM   7022 C CA  . ALA B 1 377 ? 23.624  1.668   -15.577 1.00 49.18 ? 377  ALA B CA  1 
ATOM   7023 C C   . ALA B 1 377 ? 22.152  1.615   -15.979 1.00 48.79 ? 377  ALA B C   1 
ATOM   7024 O O   . ALA B 1 377 ? 21.305  2.148   -15.273 1.00 48.94 ? 377  ALA B O   1 
ATOM   7025 C CB  . ALA B 1 377 ? 24.346  2.748   -16.348 1.00 48.81 ? 377  ALA B CB  1 
ATOM   7026 N N   . VAL B 1 378 ? 21.851  0.956   -17.098 1.00 48.46 ? 378  VAL B N   1 
ATOM   7027 C CA  . VAL B 1 378 ? 20.477  0.839   -17.565 1.00 48.06 ? 378  VAL B CA  1 
ATOM   7028 C C   . VAL B 1 378 ? 19.660  0.075   -16.549 1.00 47.94 ? 378  VAL B C   1 
ATOM   7029 O O   . VAL B 1 378 ? 18.580  0.524   -16.152 1.00 47.89 ? 378  VAL B O   1 
ATOM   7030 C CB  . VAL B 1 378 ? 20.372  0.175   -18.953 1.00 48.10 ? 378  VAL B CB  1 
ATOM   7031 C CG1 . VAL B 1 378 ? 18.908  -0.055  -19.343 1.00 47.98 ? 378  VAL B CG1 1 
ATOM   7032 C CG2 . VAL B 1 378 ? 21.035  1.047   -19.989 1.00 48.47 ? 378  VAL B CG2 1 
ATOM   7033 N N   . VAL B 1 379 ? 20.186  -1.062  -16.110 1.00 47.78 ? 379  VAL B N   1 
ATOM   7034 C CA  . VAL B 1 379 ? 19.471  -1.925  -15.175 1.00 47.82 ? 379  VAL B CA  1 
ATOM   7035 C C   . VAL B 1 379 ? 19.154  -1.190  -13.884 1.00 47.77 ? 379  VAL B C   1 
ATOM   7036 O O   . VAL B 1 379 ? 18.013  -1.229  -13.391 1.00 47.48 ? 379  VAL B O   1 
ATOM   7037 C CB  . VAL B 1 379 ? 20.273  -3.192  -14.844 1.00 47.83 ? 379  VAL B CB  1 
ATOM   7038 C CG1 . VAL B 1 379 ? 19.626  -3.934  -13.673 1.00 47.43 ? 379  VAL B CG1 1 
ATOM   7039 C CG2 . VAL B 1 379 ? 20.372  -4.089  -16.074 1.00 47.91 ? 379  VAL B CG2 1 
ATOM   7040 N N   . LEU B 1 380 ? 20.163  -0.506  -13.360 1.00 47.73 ? 380  LEU B N   1 
ATOM   7041 C CA  . LEU B 1 380 ? 20.018  0.234   -12.112 1.00 48.31 ? 380  LEU B CA  1 
ATOM   7042 C C   . LEU B 1 380 ? 19.002  1.371   -12.204 1.00 48.40 ? 380  LEU B C   1 
ATOM   7043 O O   . LEU B 1 380 ? 18.303  1.669   -11.226 1.00 48.76 ? 380  LEU B O   1 
ATOM   7044 C CB  . LEU B 1 380 ? 21.382  0.715   -11.599 1.00 48.42 ? 380  LEU B CB  1 
ATOM   7045 C CG  . LEU B 1 380 ? 22.390  -0.431  -11.334 1.00 49.33 ? 380  LEU B CG  1 
ATOM   7046 C CD1 . LEU B 1 380 ? 23.713  0.062   -10.775 1.00 51.45 ? 380  LEU B CD1 1 
ATOM   7047 C CD2 . LEU B 1 380 ? 21.831  -1.542  -10.421 1.00 51.43 ? 380  LEU B CD2 1 
ATOM   7048 N N   . HIS B 1 381 ? 18.898  1.980   -13.382 1.00 48.08 ? 381  HIS B N   1 
ATOM   7049 C CA  . HIS B 1 381 ? 17.991  3.103   -13.592 1.00 48.02 ? 381  HIS B CA  1 
ATOM   7050 C C   . HIS B 1 381 ? 16.547  2.653   -13.739 1.00 48.10 ? 381  HIS B C   1 
ATOM   7051 O O   . HIS B 1 381 ? 15.642  3.346   -13.306 1.00 48.19 ? 381  HIS B O   1 
ATOM   7052 C CB  . HIS B 1 381 ? 18.421  3.900   -14.824 1.00 48.02 ? 381  HIS B CB  1 
ATOM   7053 C CG  . HIS B 1 381 ? 17.465  4.981   -15.211 1.00 47.93 ? 381  HIS B CG  1 
ATOM   7054 N ND1 . HIS B 1 381 ? 17.573  6.272   -14.743 1.00 48.62 ? 381  HIS B ND1 1 
ATOM   7055 C CD2 . HIS B 1 381 ? 16.381  4.964   -16.023 1.00 48.33 ? 381  HIS B CD2 1 
ATOM   7056 C CE1 . HIS B 1 381 ? 16.594  7.002   -15.246 1.00 48.16 ? 381  HIS B CE1 1 
ATOM   7057 N NE2 . HIS B 1 381 ? 15.858  6.233   -16.029 1.00 47.39 ? 381  HIS B NE2 1 
ATOM   7058 N N   . TYR B 1 382 ? 16.336  1.495   -14.356 1.00 48.51 ? 382  TYR B N   1 
ATOM   7059 C CA  . TYR B 1 382 ? 14.987  1.002   -14.623 1.00 48.80 ? 382  TYR B CA  1 
ATOM   7060 C C   . TYR B 1 382 ? 14.450  0.060   -13.558 1.00 49.85 ? 382  TYR B C   1 
ATOM   7061 O O   . TYR B 1 382 ? 13.238  -0.197  -13.502 1.00 50.42 ? 382  TYR B O   1 
ATOM   7062 C CB  . TYR B 1 382 ? 14.894  0.349   -16.004 1.00 47.78 ? 382  TYR B CB  1 
ATOM   7063 C CG  . TYR B 1 382 ? 14.777  1.345   -17.129 1.00 46.47 ? 382  TYR B CG  1 
ATOM   7064 C CD1 . TYR B 1 382 ? 15.917  1.864   -17.736 1.00 45.36 ? 382  TYR B CD1 1 
ATOM   7065 C CD2 . TYR B 1 382 ? 13.532  1.775   -17.581 1.00 44.82 ? 382  TYR B CD2 1 
ATOM   7066 C CE1 . TYR B 1 382 ? 15.832  2.774   -18.772 1.00 45.11 ? 382  TYR B CE1 1 
ATOM   7067 C CE2 . TYR B 1 382 ? 13.431  2.699   -18.624 1.00 45.60 ? 382  TYR B CE2 1 
ATOM   7068 C CZ  . TYR B 1 382 ? 14.592  3.194   -19.218 1.00 46.07 ? 382  TYR B CZ  1 
ATOM   7069 O OH  . TYR B 1 382 ? 14.530  4.108   -20.259 1.00 46.06 ? 382  TYR B OH  1 
ATOM   7070 N N   . THR B 1 383 ? 15.332  -0.460  -12.713 1.00 50.79 ? 383  THR B N   1 
ATOM   7071 C CA  . THR B 1 383 ? 14.861  -1.193  -11.554 1.00 51.81 ? 383  THR B CA  1 
ATOM   7072 C C   . THR B 1 383 ? 14.090  -0.237  -10.644 1.00 52.70 ? 383  THR B C   1 
ATOM   7073 O O   . THR B 1 383 ? 14.578  0.858   -10.315 1.00 52.50 ? 383  THR B O   1 
ATOM   7074 C CB  . THR B 1 383 ? 16.009  -1.831  -10.787 1.00 51.60 ? 383  THR B CB  1 
ATOM   7075 O OG1 . THR B 1 383 ? 16.729  -2.704  -11.664 1.00 52.83 ? 383  THR B OG1 1 
ATOM   7076 C CG2 . THR B 1 383 ? 15.485  -2.630  -9.602  1.00 51.26 ? 383  THR B CG2 1 
ATOM   7077 N N   . ASP B 1 384 ? 12.869  -0.637  -10.288 1.00 53.64 ? 384  ASP B N   1 
ATOM   7078 C CA  . ASP B 1 384 ? 12.148  0.002   -9.199  1.00 55.08 ? 384  ASP B CA  1 
ATOM   7079 C C   . ASP B 1 384 ? 12.658  -0.592  -7.880  1.00 55.46 ? 384  ASP B C   1 
ATOM   7080 O O   . ASP B 1 384 ? 12.358  -1.740  -7.545  1.00 55.17 ? 384  ASP B O   1 
ATOM   7081 C CB  . ASP B 1 384 ? 10.626  -0.182  -9.330  1.00 55.54 ? 384  ASP B CB  1 
ATOM   7082 C CG  . ASP B 1 384 ? 9.843   0.591   -8.258  1.00 57.74 ? 384  ASP B CG  1 
ATOM   7083 O OD1 . ASP B 1 384 ? 10.423  0.931   -7.197  1.00 58.89 ? 384  ASP B OD1 1 
ATOM   7084 O OD2 . ASP B 1 384 ? 8.637   0.855   -8.472  1.00 60.55 ? 384  ASP B OD2 1 
ATOM   7085 N N   . TRP B 1 385 ? 13.422  0.202   -7.131  1.00 55.70 ? 385  TRP B N   1 
ATOM   7086 C CA  . TRP B 1 385 ? 14.050  -0.294  -5.915  1.00 56.06 ? 385  TRP B CA  1 
ATOM   7087 C C   . TRP B 1 385 ? 13.102  -0.526  -4.730  1.00 57.11 ? 385  TRP B C   1 
ATOM   7088 O O   . TRP B 1 385 ? 13.462  -1.189  -3.760  1.00 57.54 ? 385  TRP B O   1 
ATOM   7089 C CB  . TRP B 1 385 ? 15.267  0.558   -5.575  1.00 54.92 ? 385  TRP B CB  1 
ATOM   7090 C CG  . TRP B 1 385 ? 16.299  0.368   -6.628  1.00 53.87 ? 385  TRP B CG  1 
ATOM   7091 C CD1 . TRP B 1 385 ? 16.601  1.217   -7.651  1.00 52.25 ? 385  TRP B CD1 1 
ATOM   7092 C CD2 . TRP B 1 385 ? 17.112  -0.789  -6.813  1.00 52.76 ? 385  TRP B CD2 1 
ATOM   7093 N NE1 . TRP B 1 385 ? 17.581  0.677   -8.443  1.00 50.73 ? 385  TRP B NE1 1 
ATOM   7094 C CE2 . TRP B 1 385 ? 17.915  -0.556  -7.950  1.00 51.83 ? 385  TRP B CE2 1 
ATOM   7095 C CE3 . TRP B 1 385 ? 17.256  -1.996  -6.118  1.00 51.81 ? 385  TRP B CE3 1 
ATOM   7096 C CZ2 . TRP B 1 385 ? 18.843  -1.489  -8.412  1.00 52.39 ? 385  TRP B CZ2 1 
ATOM   7097 C CZ3 . TRP B 1 385 ? 18.182  -2.925  -6.582  1.00 52.13 ? 385  TRP B CZ3 1 
ATOM   7098 C CH2 . TRP B 1 385 ? 18.953  -2.670  -7.720  1.00 52.62 ? 385  TRP B CH2 1 
ATOM   7099 N N   . LEU B 1 386 ? 11.881  -0.015  -4.825  1.00 58.50 ? 386  LEU B N   1 
ATOM   7100 C CA  . LEU B 1 386 ? 10.837  -0.388  -3.872  1.00 60.06 ? 386  LEU B CA  1 
ATOM   7101 C C   . LEU B 1 386 ? 10.367  -1.827  -4.109  1.00 60.24 ? 386  LEU B C   1 
ATOM   7102 O O   . LEU B 1 386 ? 9.957   -2.504  -3.175  1.00 60.42 ? 386  LEU B O   1 
ATOM   7103 C CB  . LEU B 1 386 ? 9.645   0.564   -3.978  1.00 60.60 ? 386  LEU B CB  1 
ATOM   7104 C CG  . LEU B 1 386 ? 9.712   1.907   -3.244  1.00 62.72 ? 386  LEU B CG  1 
ATOM   7105 C CD1 . LEU B 1 386 ? 8.898   3.007   -3.967  1.00 63.75 ? 386  LEU B CD1 1 
ATOM   7106 C CD2 . LEU B 1 386 ? 9.254   1.718   -1.797  1.00 65.13 ? 386  LEU B CD2 1 
ATOM   7107 N N   . HIS B 1 387 ? 10.421  -2.273  -5.366  1.00 60.72 ? 387  HIS B N   1 
ATOM   7108 C CA  . HIS B 1 387 ? 9.947   -3.603  -5.774  1.00 60.95 ? 387  HIS B CA  1 
ATOM   7109 C C   . HIS B 1 387 ? 10.931  -4.245  -6.768  1.00 60.93 ? 387  HIS B C   1 
ATOM   7110 O O   . HIS B 1 387 ? 10.559  -4.516  -7.914  1.00 60.73 ? 387  HIS B O   1 
ATOM   7111 C CB  . HIS B 1 387 ? 8.560   -3.515  -6.438  1.00 61.04 ? 387  HIS B CB  1 
ATOM   7112 C CG  . HIS B 1 387 ? 7.592   -2.595  -5.755  1.00 61.82 ? 387  HIS B CG  1 
ATOM   7113 N ND1 . HIS B 1 387 ? 7.371   -1.299  -6.177  1.00 63.33 ? 387  HIS B ND1 1 
ATOM   7114 C CD2 . HIS B 1 387 ? 6.759   -2.793  -4.704  1.00 63.03 ? 387  HIS B CD2 1 
ATOM   7115 C CE1 . HIS B 1 387 ? 6.461   -0.731  -5.402  1.00 62.90 ? 387  HIS B CE1 1 
ATOM   7116 N NE2 . HIS B 1 387 ? 6.071   -1.618  -4.503  1.00 62.90 ? 387  HIS B NE2 1 
ATOM   7117 N N   . PRO B 1 388 ? 12.193  -4.467  -6.345  1.00 60.95 ? 388  PRO B N   1 
ATOM   7118 C CA  . PRO B 1 388 ? 13.278  -4.906  -7.241  1.00 60.97 ? 388  PRO B CA  1 
ATOM   7119 C C   . PRO B 1 388 ? 13.071  -6.206  -8.013  1.00 61.03 ? 388  PRO B C   1 
ATOM   7120 O O   . PRO B 1 388 ? 13.679  -6.387  -9.073  1.00 60.53 ? 388  PRO B O   1 
ATOM   7121 C CB  . PRO B 1 388 ? 14.485  -5.059  -6.298  1.00 61.42 ? 388  PRO B CB  1 
ATOM   7122 C CG  . PRO B 1 388 ? 13.927  -5.077  -4.916  1.00 61.13 ? 388  PRO B CG  1 
ATOM   7123 C CD  . PRO B 1 388 ? 12.675  -4.265  -4.966  1.00 61.03 ? 388  PRO B CD  1 
ATOM   7124 N N   . GLU B 1 389 ? 12.241  -7.104  -7.480  1.00 61.47 ? 389  GLU B N   1 
ATOM   7125 C CA  . GLU B 1 389 ? 12.095  -8.466  -8.029  1.00 61.87 ? 389  GLU B CA  1 
ATOM   7126 C C   . GLU B 1 389 ? 10.693  -8.730  -8.571  1.00 61.33 ? 389  GLU B C   1 
ATOM   7127 O O   . GLU B 1 389 ? 10.444  -9.795  -9.145  1.00 61.30 ? 389  GLU B O   1 
ATOM   7128 C CB  . GLU B 1 389 ? 12.452  -9.533  -6.978  1.00 62.10 ? 389  GLU B CB  1 
ATOM   7129 C CG  . GLU B 1 389 ? 13.782  -9.304  -6.250  1.00 65.12 ? 389  GLU B CG  1 
ATOM   7130 C CD  . GLU B 1 389 ? 14.861  -10.347 -6.560  1.00 68.59 ? 389  GLU B CD  1 
ATOM   7131 O OE1 . GLU B 1 389 ? 14.875  -10.935 -7.668  1.00 70.34 ? 389  GLU B OE1 1 
ATOM   7132 O OE2 . GLU B 1 389 ? 15.718  -10.570 -5.675  1.00 70.10 ? 389  GLU B OE2 1 
ATOM   7133 N N   . ASP B 1 390 ? 9.790   -7.764  -8.383  1.00 60.85 ? 390  ASP B N   1 
ATOM   7134 C CA  . ASP B 1 390 ? 8.419   -7.857  -8.879  1.00 60.39 ? 390  ASP B CA  1 
ATOM   7135 C C   . ASP B 1 390 ? 8.382   -8.106  -10.384 1.00 60.37 ? 390  ASP B C   1 
ATOM   7136 O O   . ASP B 1 390 ? 8.763   -7.235  -11.167 1.00 60.39 ? 390  ASP B O   1 
ATOM   7137 C CB  . ASP B 1 390 ? 7.636   -6.590  -8.560  1.00 60.30 ? 390  ASP B CB  1 
ATOM   7138 C CG  . ASP B 1 390 ? 6.187   -6.677  -9.009  1.00 60.51 ? 390  ASP B CG  1 
ATOM   7139 O OD1 . ASP B 1 390 ? 5.493   -7.629  -8.588  1.00 61.30 ? 390  ASP B OD1 1 
ATOM   7140 O OD2 . ASP B 1 390 ? 5.742   -5.804  -9.783  1.00 59.34 ? 390  ASP B OD2 1 
ATOM   7141 N N   . PRO B 1 391 ? 7.921   -9.302  -10.789 1.00 60.41 ? 391  PRO B N   1 
ATOM   7142 C CA  . PRO B 1 391 ? 7.891   -9.715  -12.198 1.00 60.09 ? 391  PRO B CA  1 
ATOM   7143 C C   . PRO B 1 391 ? 7.163   -8.730  -13.133 1.00 59.59 ? 391  PRO B C   1 
ATOM   7144 O O   . PRO B 1 391 ? 7.654   -8.489  -14.237 1.00 59.37 ? 391  PRO B O   1 
ATOM   7145 C CB  . PRO B 1 391 ? 7.180   -11.078 -12.159 1.00 60.14 ? 391  PRO B CB  1 
ATOM   7146 C CG  . PRO B 1 391 ? 6.508   -11.145 -10.810 1.00 60.58 ? 391  PRO B CG  1 
ATOM   7147 C CD  . PRO B 1 391 ? 7.381   -10.348 -9.899  1.00 60.51 ? 391  PRO B CD  1 
ATOM   7148 N N   . THR B 1 392 ? 6.030   -8.167  -12.694 1.00 58.99 ? 392  THR B N   1 
ATOM   7149 C CA  . THR B 1 392 ? 5.291   -7.172  -13.490 1.00 58.81 ? 392  THR B CA  1 
ATOM   7150 C C   . THR B 1 392 ? 6.134   -5.922  -13.784 1.00 58.71 ? 392  THR B C   1 
ATOM   7151 O O   . THR B 1 392 ? 6.139   -5.427  -14.914 1.00 58.86 ? 392  THR B O   1 
ATOM   7152 C CB  . THR B 1 392 ? 3.958   -6.721  -12.817 1.00 58.73 ? 392  THR B CB  1 
ATOM   7153 O OG1 . THR B 1 392 ? 3.138   -7.858  -12.535 1.00 59.59 ? 392  THR B OG1 1 
ATOM   7154 C CG2 . THR B 1 392 ? 3.181   -5.759  -13.722 1.00 58.19 ? 392  THR B CG2 1 
ATOM   7155 N N   . HIS B 1 393 ? 6.818   -5.406  -12.761 1.00 58.45 ? 393  HIS B N   1 
ATOM   7156 C CA  . HIS B 1 393 ? 7.661   -4.220  -12.922 1.00 58.37 ? 393  HIS B CA  1 
ATOM   7157 C C   . HIS B 1 393 ? 8.788   -4.503  -13.894 1.00 57.30 ? 393  HIS B C   1 
ATOM   7158 O O   . HIS B 1 393 ? 9.010   -3.723  -14.819 1.00 57.23 ? 393  HIS B O   1 
ATOM   7159 C CB  . HIS B 1 393 ? 8.215   -3.707  -11.580 1.00 58.74 ? 393  HIS B CB  1 
ATOM   7160 C CG  . HIS B 1 393 ? 7.228   -2.896  -10.801 1.00 61.29 ? 393  HIS B CG  1 
ATOM   7161 N ND1 . HIS B 1 393 ? 6.431   -3.439  -9.814  1.00 63.45 ? 393  HIS B ND1 1 
ATOM   7162 C CD2 . HIS B 1 393 ? 6.878   -1.590  -10.891 1.00 63.75 ? 393  HIS B CD2 1 
ATOM   7163 C CE1 . HIS B 1 393 ? 5.646   -2.499  -9.315  1.00 64.17 ? 393  HIS B CE1 1 
ATOM   7164 N NE2 . HIS B 1 393 ? 5.898   -1.367  -9.950  1.00 65.03 ? 393  HIS B NE2 1 
ATOM   7165 N N   . LEU B 1 394 ? 9.469   -5.627  -13.686 1.00 55.81 ? 394  LEU B N   1 
ATOM   7166 C CA  . LEU B 1 394 ? 10.581  -6.040  -14.535 1.00 54.64 ? 394  LEU B CA  1 
ATOM   7167 C C   . LEU B 1 394 ? 10.197  -6.153  -16.013 1.00 53.86 ? 394  LEU B C   1 
ATOM   7168 O O   . LEU B 1 394 ? 10.989  -5.794  -16.894 1.00 53.39 ? 394  LEU B O   1 
ATOM   7169 C CB  . LEU B 1 394 ? 11.174  -7.350  -14.028 1.00 54.37 ? 394  LEU B CB  1 
ATOM   7170 C CG  . LEU B 1 394 ? 11.882  -7.193  -12.680 1.00 54.72 ? 394  LEU B CG  1 
ATOM   7171 C CD1 . LEU B 1 394 ? 11.970  -8.537  -11.952 1.00 53.56 ? 394  LEU B CD1 1 
ATOM   7172 C CD2 . LEU B 1 394 ? 13.267  -6.524  -12.840 1.00 53.36 ? 394  LEU B CD2 1 
ATOM   7173 N N   . ARG B 1 395 ? 8.981   -6.638  -16.266 1.00 52.62 ? 395  ARG B N   1 
ATOM   7174 C CA  . ARG B 1 395 ? 8.463   -6.792  -17.617 1.00 51.79 ? 395  ARG B CA  1 
ATOM   7175 C C   . ARG B 1 395 ? 8.180   -5.418  -18.228 1.00 51.13 ? 395  ARG B C   1 
ATOM   7176 O O   . ARG B 1 395 ? 8.640   -5.109  -19.330 1.00 51.22 ? 395  ARG B O   1 
ATOM   7177 C CB  . ARG B 1 395 ? 7.215   -7.693  -17.605 1.00 51.98 ? 395  ARG B CB  1 
ATOM   7178 C CG  . ARG B 1 395 ? 6.443   -7.769  -18.912 1.00 51.96 ? 395  ARG B CG  1 
ATOM   7179 C CD  . ARG B 1 395 ? 5.149   -7.023  -18.796 1.00 52.78 ? 395  ARG B CD  1 
ATOM   7180 N NE  . ARG B 1 395 ? 4.066   -7.886  -18.346 1.00 53.54 ? 395  ARG B NE  1 
ATOM   7181 C CZ  . ARG B 1 395 ? 2.900   -7.461  -17.854 1.00 54.22 ? 395  ARG B CZ  1 
ATOM   7182 N NH1 . ARG B 1 395 ? 2.635   -6.161  -17.727 1.00 51.59 ? 395  ARG B NH1 1 
ATOM   7183 N NH2 . ARG B 1 395 ? 1.984   -8.355  -17.491 1.00 55.50 ? 395  ARG B NH2 1 
ATOM   7184 N N   . ASP B 1 396 ? 7.451   -4.589  -17.493 1.00 50.19 ? 396  ASP B N   1 
ATOM   7185 C CA  . ASP B 1 396 ? 7.149   -3.242  -17.939 1.00 49.64 ? 396  ASP B CA  1 
ATOM   7186 C C   . ASP B 1 396 ? 8.418   -2.407  -18.149 1.00 48.83 ? 396  ASP B C   1 
ATOM   7187 O O   . ASP B 1 396 ? 8.468   -1.577  -19.063 1.00 49.15 ? 396  ASP B O   1 
ATOM   7188 C CB  . ASP B 1 396 ? 6.183   -2.563  -16.969 1.00 49.79 ? 396  ASP B CB  1 
ATOM   7189 C CG  . ASP B 1 396 ? 4.763   -3.108  -17.072 1.00 51.65 ? 396  ASP B CG  1 
ATOM   7190 O OD1 . ASP B 1 396 ? 4.481   -3.910  -17.988 1.00 51.90 ? 396  ASP B OD1 1 
ATOM   7191 O OD2 . ASP B 1 396 ? 3.912   -2.725  -16.235 1.00 54.80 ? 396  ASP B OD2 1 
ATOM   7192 N N   . ALA B 1 397 ? 9.442   -2.653  -17.332 1.00 47.66 ? 397  ALA B N   1 
ATOM   7193 C CA  . ALA B 1 397 ? 10.704  -1.919  -17.417 1.00 46.95 ? 397  ALA B CA  1 
ATOM   7194 C C   . ALA B 1 397 ? 11.472  -2.309  -18.668 1.00 46.33 ? 397  ALA B C   1 
ATOM   7195 O O   . ALA B 1 397 ? 12.054  -1.445  -19.331 1.00 46.14 ? 397  ALA B O   1 
ATOM   7196 C CB  . ALA B 1 397 ? 11.563  -2.125  -16.162 1.00 46.75 ? 397  ALA B CB  1 
ATOM   7197 N N   . MET B 1 398 ? 11.457  -3.608  -18.983 1.00 45.63 ? 398  MET B N   1 
ATOM   7198 C CA  . MET B 1 398 ? 12.058  -4.138  -20.208 1.00 44.66 ? 398  MET B CA  1 
ATOM   7199 C C   . MET B 1 398 ? 11.429  -3.507  -21.457 1.00 43.93 ? 398  MET B C   1 
ATOM   7200 O O   . MET B 1 398 ? 12.138  -3.123  -22.389 1.00 43.60 ? 398  MET B O   1 
ATOM   7201 C CB  . MET B 1 398 ? 11.905  -5.662  -20.259 1.00 45.04 ? 398  MET B CB  1 
ATOM   7202 C CG  . MET B 1 398 ? 12.718  -6.346  -21.347 1.00 44.86 ? 398  MET B CG  1 
ATOM   7203 S SD  . MET B 1 398 ? 14.475  -6.092  -21.078 1.00 50.02 ? 398  MET B SD  1 
ATOM   7204 C CE  . MET B 1 398 ? 14.915  -5.018  -22.443 1.00 46.48 ? 398  MET B CE  1 
ATOM   7205 N N   . SER B 1 399 ? 10.099  -3.416  -21.468 1.00 43.04 ? 399  SER B N   1 
ATOM   7206 C CA  . SER B 1 399 ? 9.380   -2.736  -22.533 1.00 42.31 ? 399  SER B CA  1 
ATOM   7207 C C   . SER B 1 399 ? 9.892   -1.305  -22.633 1.00 42.18 ? 399  SER B C   1 
ATOM   7208 O O   . SER B 1 399 ? 10.346  -0.873  -23.699 1.00 42.22 ? 399  SER B O   1 
ATOM   7209 C CB  . SER B 1 399 ? 7.878   -2.752  -22.238 1.00 42.53 ? 399  SER B CB  1 
ATOM   7210 O OG  . SER B 1 399 ? 7.145   -1.929  -23.130 1.00 41.29 ? 399  SER B OG  1 
ATOM   7211 N N   . ALA B 1 400 ? 9.835   -0.597  -21.501 1.00 41.48 ? 400  ALA B N   1 
ATOM   7212 C CA  . ALA B 1 400 ? 10.274  0.797   -21.387 1.00 40.83 ? 400  ALA B CA  1 
ATOM   7213 C C   . ALA B 1 400 ? 11.717  1.007   -21.843 1.00 40.63 ? 400  ALA B C   1 
ATOM   7214 O O   . ALA B 1 400 ? 11.982  1.948   -22.596 1.00 41.12 ? 400  ALA B O   1 
ATOM   7215 C CB  . ALA B 1 400 ? 10.075  1.308   -19.961 1.00 40.61 ? 400  ALA B CB  1 
ATOM   7216 N N   . VAL B 1 401 ? 12.643  0.145   -21.416 1.00 39.50 ? 401  VAL B N   1 
ATOM   7217 C CA  . VAL B 1 401 ? 14.035  0.265   -21.872 1.00 39.44 ? 401  VAL B CA  1 
ATOM   7218 C C   . VAL B 1 401 ? 14.083  0.305   -23.391 1.00 39.42 ? 401  VAL B C   1 
ATOM   7219 O O   . VAL B 1 401 ? 14.741  1.172   -23.980 1.00 39.45 ? 401  VAL B O   1 
ATOM   7220 C CB  . VAL B 1 401 ? 14.948  -0.910  -21.401 1.00 39.69 ? 401  VAL B CB  1 
ATOM   7221 C CG1 . VAL B 1 401 ? 16.246  -0.936  -22.212 1.00 38.79 ? 401  VAL B CG1 1 
ATOM   7222 C CG2 . VAL B 1 401 ? 15.251  -0.804  -19.918 1.00 38.27 ? 401  VAL B CG2 1 
ATOM   7223 N N   . VAL B 1 402 ? 13.376  -0.629  -24.025 1.00 38.96 ? 402  VAL B N   1 
ATOM   7224 C CA  . VAL B 1 402 ? 13.434  -0.749  -25.471 1.00 38.91 ? 402  VAL B CA  1 
ATOM   7225 C C   . VAL B 1 402 ? 12.788  0.455   -26.170 1.00 38.68 ? 402  VAL B C   1 
ATOM   7226 O O   . VAL B 1 402 ? 13.404  1.053   -27.063 1.00 38.53 ? 402  VAL B O   1 
ATOM   7227 C CB  . VAL B 1 402 ? 12.889  -2.107  -25.964 1.00 39.16 ? 402  VAL B CB  1 
ATOM   7228 C CG1 . VAL B 1 402 ? 12.689  -2.092  -27.482 1.00 40.08 ? 402  VAL B CG1 1 
ATOM   7229 C CG2 . VAL B 1 402 ? 13.864  -3.202  -25.593 1.00 40.10 ? 402  VAL B CG2 1 
ATOM   7230 N N   . GLY B 1 403 ? 11.577  0.821   -25.741 1.00 38.10 ? 403  GLY B N   1 
ATOM   7231 C CA  . GLY B 1 403 ? 10.872  1.976   -26.300 1.00 37.92 ? 403  GLY B CA  1 
ATOM   7232 C C   . GLY B 1 403 ? 11.604  3.309   -26.117 1.00 37.77 ? 403  GLY B C   1 
ATOM   7233 O O   . GLY B 1 403 ? 11.680  4.119   -27.052 1.00 37.68 ? 403  GLY B O   1 
ATOM   7234 N N   . ASP B 1 404 ? 12.129  3.537   -24.912 1.00 37.12 ? 404  ASP B N   1 
ATOM   7235 C CA  . ASP B 1 404 ? 12.813  4.778   -24.590 1.00 36.87 ? 404  ASP B CA  1 
ATOM   7236 C C   . ASP B 1 404 ? 14.061  4.921   -25.441 1.00 36.08 ? 404  ASP B C   1 
ATOM   7237 O O   . ASP B 1 404 ? 14.271  5.936   -26.089 1.00 35.82 ? 404  ASP B O   1 
ATOM   7238 C CB  . ASP B 1 404 ? 13.199  4.829   -23.103 1.00 37.09 ? 404  ASP B CB  1 
ATOM   7239 C CG  . ASP B 1 404 ? 12.001  4.975   -22.184 1.00 37.15 ? 404  ASP B CG  1 
ATOM   7240 O OD1 . ASP B 1 404 ? 10.911  5.326   -22.682 1.00 38.16 ? 404  ASP B OD1 1 
ATOM   7241 O OD2 . ASP B 1 404 ? 12.151  4.754   -20.955 1.00 37.60 ? 404  ASP B OD2 1 
ATOM   7242 N N   . HIS B 1 405 ? 14.874  3.878   -25.440 1.00 35.89 ? 405  HIS B N   1 
ATOM   7243 C CA  . HIS B 1 405 ? 16.153  3.871   -26.145 1.00 35.77 ? 405  HIS B CA  1 
ATOM   7244 C C   . HIS B 1 405 ? 15.966  4.004   -27.652 1.00 35.56 ? 405  HIS B C   1 
ATOM   7245 O O   . HIS B 1 405 ? 16.735  4.690   -28.321 1.00 35.98 ? 405  HIS B O   1 
ATOM   7246 C CB  . HIS B 1 405 ? 16.899  2.579   -25.791 1.00 35.63 ? 405  HIS B CB  1 
ATOM   7247 C CG  . HIS B 1 405 ? 18.150  2.356   -26.574 1.00 36.62 ? 405  HIS B CG  1 
ATOM   7248 N ND1 . HIS B 1 405 ? 19.101  3.337   -26.758 1.00 36.70 ? 405  HIS B ND1 1 
ATOM   7249 C CD2 . HIS B 1 405 ? 18.614  1.252   -27.210 1.00 37.95 ? 405  HIS B CD2 1 
ATOM   7250 C CE1 . HIS B 1 405 ? 20.094  2.847   -27.480 1.00 38.38 ? 405  HIS B CE1 1 
ATOM   7251 N NE2 . HIS B 1 405 ? 19.822  1.585   -27.766 1.00 38.95 ? 405  HIS B NE2 1 
ATOM   7252 N N   . ASN B 1 406 ? 14.933  3.375   -28.193 1.00 35.40 ? 406  ASN B N   1 
ATOM   7253 C CA  . ASN B 1 406 ? 14.781  3.364   -29.637 1.00 35.56 ? 406  ASN B CA  1 
ATOM   7254 C C   . ASN B 1 406 ? 13.903  4.453   -30.206 1.00 35.91 ? 406  ASN B C   1 
ATOM   7255 O O   . ASN B 1 406 ? 14.121  4.875   -31.351 1.00 36.33 ? 406  ASN B O   1 
ATOM   7256 C CB  . ASN B 1 406 ? 14.364  1.979   -30.141 1.00 35.57 ? 406  ASN B CB  1 
ATOM   7257 C CG  . ASN B 1 406 ? 15.499  0.975   -30.022 1.00 35.26 ? 406  ASN B CG  1 
ATOM   7258 O OD1 . ASN B 1 406 ? 16.558  1.169   -30.601 1.00 34.13 ? 406  ASN B OD1 1 
ATOM   7259 N ND2 . ASN B 1 406 ? 15.304  -0.058  -29.218 1.00 35.77 ? 406  ASN B ND2 1 
ATOM   7260 N N   . VAL B 1 407 ? 12.921  4.905   -29.428 1.00 35.41 ? 407  VAL B N   1 
ATOM   7261 C CA  . VAL B 1 407 ? 11.934  5.816   -29.965 1.00 35.79 ? 407  VAL B CA  1 
ATOM   7262 C C   . VAL B 1 407 ? 11.754  7.100   -29.146 1.00 35.96 ? 407  VAL B C   1 
ATOM   7263 O O   . VAL B 1 407 ? 12.056  8.177   -29.645 1.00 36.54 ? 407  VAL B O   1 
ATOM   7264 C CB  . VAL B 1 407 ? 10.575  5.102   -30.195 1.00 36.50 ? 407  VAL B CB  1 
ATOM   7265 C CG1 . VAL B 1 407 ? 9.499   6.115   -30.587 1.00 35.46 ? 407  VAL B CG1 1 
ATOM   7266 C CG2 . VAL B 1 407 ? 10.714  4.000   -31.255 1.00 35.51 ? 407  VAL B CG2 1 
ATOM   7267 N N   . VAL B 1 408 ? 11.301  6.982   -27.898 1.00 35.64 ? 408  VAL B N   1 
ATOM   7268 C CA  . VAL B 1 408 ? 10.903  8.138   -27.103 1.00 35.84 ? 408  VAL B CA  1 
ATOM   7269 C C   . VAL B 1 408 ? 12.058  9.117   -26.904 1.00 36.19 ? 408  VAL B C   1 
ATOM   7270 O O   . VAL B 1 408 ? 11.919  10.320  -27.147 1.00 35.73 ? 408  VAL B O   1 
ATOM   7271 C CB  . VAL B 1 408 ? 10.297  7.733   -25.715 1.00 35.99 ? 408  VAL B CB  1 
ATOM   7272 C CG1 . VAL B 1 408 ? 9.649   8.937   -25.051 1.00 34.10 ? 408  VAL B CG1 1 
ATOM   7273 C CG2 . VAL B 1 408 ? 9.285   6.597   -25.870 1.00 34.63 ? 408  VAL B CG2 1 
ATOM   7274 N N   . CYS B 1 409 ? 13.206  8.604   -26.485 1.00 36.67 ? 409  CYS B N   1 
ATOM   7275 C CA  . CYS B 1 409 ? 14.347  9.480   -26.245 1.00 37.14 ? 409  CYS B CA  1 
ATOM   7276 C C   . CYS B 1 409 ? 14.950  10.059  -27.525 1.00 36.90 ? 409  CYS B C   1 
ATOM   7277 O O   . CYS B 1 409 ? 15.253  11.253  -27.569 1.00 37.44 ? 409  CYS B O   1 
ATOM   7278 C CB  . CYS B 1 409 ? 15.371  8.831   -25.324 1.00 37.12 ? 409  CYS B CB  1 
ATOM   7279 S SG  . CYS B 1 409 ? 14.704  8.604   -23.640 1.00 40.16 ? 409  CYS B SG  1 
ATOM   7280 N N   . PRO B 1 410 ? 15.112  9.250   -28.578 1.00 36.72 ? 410  PRO B N   1 
ATOM   7281 C CA  . PRO B 1 410 ? 15.425  9.890   -29.868 1.00 36.60 ? 410  PRO B CA  1 
ATOM   7282 C C   . PRO B 1 410 ? 14.402  10.960  -30.338 1.00 36.81 ? 410  PRO B C   1 
ATOM   7283 O O   . PRO B 1 410 ? 14.808  12.013  -30.862 1.00 36.81 ? 410  PRO B O   1 
ATOM   7284 C CB  . PRO B 1 410 ? 15.478  8.712   -30.833 1.00 36.36 ? 410  PRO B CB  1 
ATOM   7285 C CG  . PRO B 1 410 ? 15.865  7.559   -29.985 1.00 36.25 ? 410  PRO B CG  1 
ATOM   7286 C CD  . PRO B 1 410 ? 15.155  7.782   -28.677 1.00 36.85 ? 410  PRO B CD  1 
ATOM   7287 N N   . VAL B 1 411 ? 13.106  10.704  -30.150 1.00 36.40 ? 411  VAL B N   1 
ATOM   7288 C CA  . VAL B 1 411 ? 12.076  11.712  -30.461 1.00 36.27 ? 411  VAL B CA  1 
ATOM   7289 C C   . VAL B 1 411 ? 12.233  13.010  -29.643 1.00 37.08 ? 411  VAL B C   1 
ATOM   7290 O O   . VAL B 1 411 ? 12.152  14.095  -30.207 1.00 36.86 ? 411  VAL B O   1 
ATOM   7291 C CB  . VAL B 1 411 ? 10.631  11.142  -30.348 1.00 35.84 ? 411  VAL B CB  1 
ATOM   7292 C CG1 . VAL B 1 411 ? 9.602   12.247  -30.262 1.00 33.19 ? 411  VAL B CG1 1 
ATOM   7293 C CG2 . VAL B 1 411 ? 10.331  10.258  -31.534 1.00 34.79 ? 411  VAL B CG2 1 
ATOM   7294 N N   . ALA B 1 412 ? 12.462  12.880  -28.334 1.00 37.95 ? 412  ALA B N   1 
ATOM   7295 C CA  . ALA B 1 412 ? 12.679  14.018  -27.430 1.00 39.11 ? 412  ALA B CA  1 
ATOM   7296 C C   . ALA B 1 412 ? 13.873  14.874  -27.862 1.00 39.68 ? 412  ALA B C   1 
ATOM   7297 O O   . ALA B 1 412 ? 13.787  16.103  -27.934 1.00 40.28 ? 412  ALA B O   1 
ATOM   7298 C CB  . ALA B 1 412 ? 12.874  13.526  -25.992 1.00 39.14 ? 412  ALA B CB  1 
ATOM   7299 N N   . GLN B 1 413 ? 14.974  14.202  -28.166 1.00 40.11 ? 413  GLN B N   1 
ATOM   7300 C CA  . GLN B 1 413 ? 16.173  14.821  -28.705 1.00 40.60 ? 413  GLN B CA  1 
ATOM   7301 C C   . GLN B 1 413 ? 15.893  15.579  -30.009 1.00 40.23 ? 413  GLN B C   1 
ATOM   7302 O O   . GLN B 1 413 ? 16.266  16.757  -30.150 1.00 40.16 ? 413  GLN B O   1 
ATOM   7303 C CB  . GLN B 1 413 ? 17.211  13.734  -28.938 1.00 41.08 ? 413  GLN B CB  1 
ATOM   7304 C CG  . GLN B 1 413 ? 18.388  14.159  -29.759 1.00 45.58 ? 413  GLN B CG  1 
ATOM   7305 C CD  . GLN B 1 413 ? 19.635  14.222  -28.942 1.00 52.00 ? 413  GLN B CD  1 
ATOM   7306 O OE1 . GLN B 1 413 ? 19.826  15.140  -28.130 1.00 54.97 ? 413  GLN B OE1 1 
ATOM   7307 N NE2 . GLN B 1 413 ? 20.502  13.225  -29.127 1.00 53.93 ? 413  GLN B NE2 1 
ATOM   7308 N N   . LEU B 1 414 ? 15.248  14.910  -30.966 1.00 39.71 ? 414  LEU B N   1 
ATOM   7309 C CA  . LEU B 1 414 ? 14.843  15.580  -32.199 1.00 39.15 ? 414  LEU B CA  1 
ATOM   7310 C C   . LEU B 1 414 ? 13.938  16.798  -31.934 1.00 39.30 ? 414  LEU B C   1 
ATOM   7311 O O   . LEU B 1 414 ? 14.161  17.873  -32.493 1.00 39.20 ? 414  LEU B O   1 
ATOM   7312 C CB  . LEU B 1 414 ? 14.161  14.609  -33.167 1.00 38.94 ? 414  LEU B CB  1 
ATOM   7313 C CG  . LEU B 1 414 ? 13.839  15.228  -34.533 1.00 38.38 ? 414  LEU B CG  1 
ATOM   7314 C CD1 . LEU B 1 414 ? 15.118  15.492  -35.341 1.00 38.97 ? 414  LEU B CD1 1 
ATOM   7315 C CD2 . LEU B 1 414 ? 12.905  14.382  -35.303 1.00 36.94 ? 414  LEU B CD2 1 
ATOM   7316 N N   . ALA B 1 415 ? 12.926  16.630  -31.088 1.00 39.23 ? 415  ALA B N   1 
ATOM   7317 C CA  . ALA B 1 415 ? 11.992  17.714  -30.811 1.00 39.89 ? 415  ALA B CA  1 
ATOM   7318 C C   . ALA B 1 415 ? 12.754  18.938  -30.278 1.00 40.21 ? 415  ALA B C   1 
ATOM   7319 O O   . ALA B 1 415 ? 12.545  20.061  -30.735 1.00 39.81 ? 415  ALA B O   1 
ATOM   7320 C CB  . ALA B 1 415 ? 10.944  17.262  -29.809 1.00 39.61 ? 415  ALA B CB  1 
ATOM   7321 N N   . GLY B 1 416 ? 13.636  18.685  -29.314 1.00 40.64 ? 416  GLY B N   1 
ATOM   7322 C CA  . GLY B 1 416 ? 14.470  19.705  -28.693 1.00 41.68 ? 416  GLY B CA  1 
ATOM   7323 C C   . GLY B 1 416 ? 15.363  20.461  -29.663 1.00 42.30 ? 416  GLY B C   1 
ATOM   7324 O O   . GLY B 1 416 ? 15.331  21.699  -29.686 1.00 42.11 ? 416  GLY B O   1 
ATOM   7325 N N   . ARG B 1 417 ? 16.142  19.733  -30.467 1.00 42.79 ? 417  ARG B N   1 
ATOM   7326 C CA  . ARG B 1 417 ? 17.053  20.374  -31.421 1.00 43.90 ? 417  ARG B CA  1 
ATOM   7327 C C   . ARG B 1 417 ? 16.294  21.210  -32.455 1.00 44.13 ? 417  ARG B C   1 
ATOM   7328 O O   . ARG B 1 417 ? 16.670  22.353  -32.722 1.00 44.07 ? 417  ARG B O   1 
ATOM   7329 C CB  . ARG B 1 417 ? 17.981  19.370  -32.120 1.00 44.18 ? 417  ARG B CB  1 
ATOM   7330 C CG  . ARG B 1 417 ? 18.934  18.576  -31.217 1.00 46.72 ? 417  ARG B CG  1 
ATOM   7331 C CD  . ARG B 1 417 ? 19.770  19.429  -30.245 1.00 52.15 ? 417  ARG B CD  1 
ATOM   7332 N NE  . ARG B 1 417 ? 20.535  20.481  -30.923 1.00 59.33 ? 417  ARG B NE  1 
ATOM   7333 C CZ  . ARG B 1 417 ? 21.697  20.994  -30.495 1.00 61.62 ? 417  ARG B CZ  1 
ATOM   7334 N NH1 . ARG B 1 417 ? 22.279  20.547  -29.380 1.00 62.36 ? 417  ARG B NH1 1 
ATOM   7335 N NH2 . ARG B 1 417 ? 22.298  21.948  -31.203 1.00 61.60 ? 417  ARG B NH2 1 
ATOM   7336 N N   . LEU B 1 418 ? 15.227  20.650  -33.028 1.00 44.65 ? 418  LEU B N   1 
ATOM   7337 C CA  . LEU B 1 418 ? 14.433  21.380  -34.021 1.00 45.08 ? 418  LEU B CA  1 
ATOM   7338 C C   . LEU B 1 418 ? 13.873  22.678  -33.442 1.00 45.28 ? 418  LEU B C   1 
ATOM   7339 O O   . LEU B 1 418 ? 13.965  23.725  -34.069 1.00 45.80 ? 418  LEU B O   1 
ATOM   7340 C CB  . LEU B 1 418 ? 13.300  20.524  -34.596 1.00 44.89 ? 418  LEU B CB  1 
ATOM   7341 C CG  . LEU B 1 418 ? 13.584  19.287  -35.455 1.00 45.73 ? 418  LEU B CG  1 
ATOM   7342 C CD1 . LEU B 1 418 ? 12.281  18.548  -35.741 1.00 45.76 ? 418  LEU B CD1 1 
ATOM   7343 C CD2 . LEU B 1 418 ? 14.283  19.643  -36.759 1.00 45.29 ? 418  LEU B CD2 1 
ATOM   7344 N N   . ALA B 1 419 ? 13.312  22.616  -32.244 1.00 45.66 ? 419  ALA B N   1 
ATOM   7345 C CA  . ALA B 1 419 ? 12.711  23.797  -31.630 1.00 46.44 ? 419  ALA B CA  1 
ATOM   7346 C C   . ALA B 1 419 ? 13.750  24.891  -31.380 1.00 46.99 ? 419  ALA B C   1 
ATOM   7347 O O   . ALA B 1 419 ? 13.537  26.062  -31.720 1.00 47.62 ? 419  ALA B O   1 
ATOM   7348 C CB  . ALA B 1 419 ? 12.011  23.413  -30.332 1.00 46.31 ? 419  ALA B CB  1 
ATOM   7349 N N   . ALA B 1 420 ? 14.876  24.479  -30.800 1.00 47.28 ? 420  ALA B N   1 
ATOM   7350 C CA  . ALA B 1 420 ? 16.013  25.331  -30.517 1.00 47.21 ? 420  ALA B CA  1 
ATOM   7351 C C   . ALA B 1 420 ? 16.568  25.968  -31.790 1.00 47.64 ? 420  ALA B C   1 
ATOM   7352 O O   . ALA B 1 420 ? 17.163  27.056  -31.746 1.00 47.75 ? 420  ALA B O   1 
ATOM   7353 C CB  . ALA B 1 420 ? 17.100  24.517  -29.818 1.00 47.39 ? 420  ALA B CB  1 
ATOM   7354 N N   . GLN B 1 421 ? 16.387  25.294  -32.920 1.00 47.21 ? 421  GLN B N   1 
ATOM   7355 C CA  . GLN B 1 421 ? 16.909  25.814  -34.169 1.00 47.21 ? 421  GLN B CA  1 
ATOM   7356 C C   . GLN B 1 421 ? 15.878  26.439  -35.104 1.00 46.92 ? 421  GLN B C   1 
ATOM   7357 O O   . GLN B 1 421 ? 16.065  26.474  -36.318 1.00 47.22 ? 421  GLN B O   1 
ATOM   7358 C CB  . GLN B 1 421 ? 17.816  24.797  -34.846 1.00 47.32 ? 421  GLN B CB  1 
ATOM   7359 C CG  . GLN B 1 421 ? 19.206  24.879  -34.232 1.00 49.65 ? 421  GLN B CG  1 
ATOM   7360 C CD  . GLN B 1 421 ? 19.811  23.542  -33.977 1.00 51.09 ? 421  GLN B CD  1 
ATOM   7361 O OE1 . GLN B 1 421 ? 20.071  23.162  -32.831 1.00 53.06 ? 421  GLN B OE1 1 
ATOM   7362 N NE2 . GLN B 1 421 ? 20.033  22.801  -35.041 1.00 52.92 ? 421  GLN B NE2 1 
ATOM   7363 N N   . GLY B 1 422 ? 14.794  26.944  -34.516 1.00 46.75 ? 422  GLY B N   1 
ATOM   7364 C CA  . GLY B 1 422 ? 13.848  27.792  -35.231 1.00 46.03 ? 422  GLY B CA  1 
ATOM   7365 C C   . GLY B 1 422 ? 12.626  27.097  -35.798 1.00 45.72 ? 422  GLY B C   1 
ATOM   7366 O O   . GLY B 1 422 ? 11.694  27.775  -36.232 1.00 46.43 ? 422  GLY B O   1 
ATOM   7367 N N   . ALA B 1 423 ? 12.608  25.762  -35.789 1.00 44.48 ? 423  ALA B N   1 
ATOM   7368 C CA  . ALA B 1 423 ? 11.454  25.020  -36.296 1.00 43.57 ? 423  ALA B CA  1 
ATOM   7369 C C   . ALA B 1 423 ? 10.223  25.163  -35.399 1.00 43.09 ? 423  ALA B C   1 
ATOM   7370 O O   . ALA B 1 423 ? 10.332  25.345  -34.185 1.00 43.08 ? 423  ALA B O   1 
ATOM   7371 C CB  . ALA B 1 423 ? 11.802  23.556  -36.494 1.00 43.43 ? 423  ALA B CB  1 
ATOM   7372 N N   . ARG B 1 424 ? 9.046   25.080  -35.999 1.00 42.41 ? 424  ARG B N   1 
ATOM   7373 C CA  . ARG B 1 424 ? 7.805   25.072  -35.218 1.00 41.89 ? 424  ARG B CA  1 
ATOM   7374 C C   . ARG B 1 424 ? 7.414   23.623  -34.959 1.00 40.38 ? 424  ARG B C   1 
ATOM   7375 O O   . ARG B 1 424 ? 7.153   22.872  -35.894 1.00 39.73 ? 424  ARG B O   1 
ATOM   7376 C CB  . ARG B 1 424 ? 6.722   25.817  -35.979 1.00 42.47 ? 424  ARG B CB  1 
ATOM   7377 C CG  . ARG B 1 424 ? 5.370   25.837  -35.317 1.00 46.07 ? 424  ARG B CG  1 
ATOM   7378 C CD  . ARG B 1 424 ? 4.358   26.495  -36.292 1.00 52.70 ? 424  ARG B CD  1 
ATOM   7379 N NE  . ARG B 1 424 ? 3.464   27.458  -35.636 1.00 56.44 ? 424  ARG B NE  1 
ATOM   7380 C CZ  . ARG B 1 424 ? 3.778   28.208  -34.576 1.00 55.58 ? 424  ARG B CZ  1 
ATOM   7381 N NH1 . ARG B 1 424 ? 4.983   28.165  -34.012 1.00 55.85 ? 424  ARG B NH1 1 
ATOM   7382 N NH2 . ARG B 1 424 ? 2.871   29.020  -34.088 1.00 55.77 ? 424  ARG B NH2 1 
ATOM   7383 N N   . VAL B 1 425 ? 7.396   23.231  -33.689 1.00 39.24 ? 425  VAL B N   1 
ATOM   7384 C CA  . VAL B 1 425 ? 7.286   21.818  -33.333 1.00 38.17 ? 425  VAL B CA  1 
ATOM   7385 C C   . VAL B 1 425 ? 6.047   21.542  -32.496 1.00 37.96 ? 425  VAL B C   1 
ATOM   7386 O O   . VAL B 1 425 ? 5.789   22.255  -31.540 1.00 39.12 ? 425  VAL B O   1 
ATOM   7387 C CB  . VAL B 1 425 ? 8.554   21.324  -32.571 1.00 37.93 ? 425  VAL B CB  1 
ATOM   7388 C CG1 . VAL B 1 425 ? 8.555   19.793  -32.412 1.00 36.94 ? 425  VAL B CG1 1 
ATOM   7389 C CG2 . VAL B 1 425 ? 9.827   21.792  -33.283 1.00 36.53 ? 425  VAL B CG2 1 
ATOM   7390 N N   . TYR B 1 426 ? 5.292   20.508  -32.851 1.00 37.08 ? 426  TYR B N   1 
ATOM   7391 C CA  . TYR B 1 426 ? 4.207   20.000  -32.015 1.00 36.50 ? 426  TYR B CA  1 
ATOM   7392 C C   . TYR B 1 426 ? 4.450   18.537  -31.646 1.00 36.72 ? 426  TYR B C   1 
ATOM   7393 O O   . TYR B 1 426 ? 4.787   17.723  -32.513 1.00 37.08 ? 426  TYR B O   1 
ATOM   7394 C CB  . TYR B 1 426 ? 2.885   20.113  -32.761 1.00 36.29 ? 426  TYR B CB  1 
ATOM   7395 C CG  . TYR B 1 426 ? 2.468   21.535  -33.065 1.00 35.51 ? 426  TYR B CG  1 
ATOM   7396 C CD1 . TYR B 1 426 ? 2.772   22.128  -34.289 1.00 34.87 ? 426  TYR B CD1 1 
ATOM   7397 C CD2 . TYR B 1 426 ? 1.774   22.286  -32.128 1.00 34.42 ? 426  TYR B CD2 1 
ATOM   7398 C CE1 . TYR B 1 426 ? 2.386   23.430  -34.568 1.00 35.02 ? 426  TYR B CE1 1 
ATOM   7399 C CE2 . TYR B 1 426 ? 1.390   23.594  -32.397 1.00 35.13 ? 426  TYR B CE2 1 
ATOM   7400 C CZ  . TYR B 1 426 ? 1.699   24.155  -33.612 1.00 34.97 ? 426  TYR B CZ  1 
ATOM   7401 O OH  . TYR B 1 426 ? 1.317   25.441  -33.864 1.00 36.31 ? 426  TYR B OH  1 
ATOM   7402 N N   . ALA B 1 427 ? 4.282   18.188  -30.373 1.00 36.56 ? 427  ALA B N   1 
ATOM   7403 C CA  . ALA B 1 427 ? 4.526   16.809  -29.942 1.00 36.59 ? 427  ALA B CA  1 
ATOM   7404 C C   . ALA B 1 427 ? 3.300   16.146  -29.310 1.00 37.13 ? 427  ALA B C   1 
ATOM   7405 O O   . ALA B 1 427 ? 2.437   16.824  -28.711 1.00 36.77 ? 427  ALA B O   1 
ATOM   7406 C CB  . ALA B 1 427 ? 5.685   16.755  -28.990 1.00 36.13 ? 427  ALA B CB  1 
ATOM   7407 N N   . TYR B 1 428 ? 3.245   14.819  -29.413 1.00 36.60 ? 428  TYR B N   1 
ATOM   7408 C CA  . TYR B 1 428 ? 2.156   14.072  -28.805 1.00 36.63 ? 428  TYR B CA  1 
ATOM   7409 C C   . TYR B 1 428 ? 2.632   12.767  -28.214 1.00 37.46 ? 428  TYR B C   1 
ATOM   7410 O O   . TYR B 1 428 ? 3.720   12.264  -28.547 1.00 37.39 ? 428  TYR B O   1 
ATOM   7411 C CB  . TYR B 1 428 ? 1.032   13.790  -29.817 1.00 36.18 ? 428  TYR B CB  1 
ATOM   7412 C CG  . TYR B 1 428 ? 1.446   12.850  -30.937 1.00 35.67 ? 428  TYR B CG  1 
ATOM   7413 C CD1 . TYR B 1 428 ? 1.437   11.459  -30.758 1.00 35.00 ? 428  TYR B CD1 1 
ATOM   7414 C CD2 . TYR B 1 428 ? 1.877   13.348  -32.155 1.00 33.10 ? 428  TYR B CD2 1 
ATOM   7415 C CE1 . TYR B 1 428 ? 1.837   10.607  -31.771 1.00 34.27 ? 428  TYR B CE1 1 
ATOM   7416 C CE2 . TYR B 1 428 ? 2.269   12.508  -33.163 1.00 34.06 ? 428  TYR B CE2 1 
ATOM   7417 C CZ  . TYR B 1 428 ? 2.247   11.143  -32.966 1.00 35.05 ? 428  TYR B CZ  1 
ATOM   7418 O OH  . TYR B 1 428 ? 2.651   10.316  -33.984 1.00 37.17 ? 428  TYR B OH  1 
ATOM   7419 N N   . ILE B 1 429 ? 1.806   12.235  -27.317 1.00 38.01 ? 429  ILE B N   1 
ATOM   7420 C CA  . ILE B 1 429 ? 1.847   10.833  -26.946 1.00 38.03 ? 429  ILE B CA  1 
ATOM   7421 C C   . ILE B 1 429 ? 0.452   10.225  -27.187 1.00 38.97 ? 429  ILE B C   1 
ATOM   7422 O O   . ILE B 1 429 ? -0.580  10.812  -26.829 1.00 38.51 ? 429  ILE B O   1 
ATOM   7423 C CB  . ILE B 1 429 ? 2.324   10.629  -25.513 1.00 38.17 ? 429  ILE B CB  1 
ATOM   7424 C CG1 . ILE B 1 429 ? 2.381   9.135   -25.178 1.00 37.33 ? 429  ILE B CG1 1 
ATOM   7425 C CG2 . ILE B 1 429 ? 1.452   11.422  -24.504 1.00 37.39 ? 429  ILE B CG2 1 
ATOM   7426 C CD1 . ILE B 1 429 ? 3.107   8.839   -23.880 1.00 38.04 ? 429  ILE B CD1 1 
ATOM   7427 N N   . PHE B 1 430 ? 0.438   9.062   -27.829 1.00 39.76 ? 430  PHE B N   1 
ATOM   7428 C CA  . PHE B 1 430 ? -0.790  8.387   -28.184 1.00 40.88 ? 430  PHE B CA  1 
ATOM   7429 C C   . PHE B 1 430 ? -1.098  7.311   -27.145 1.00 41.60 ? 430  PHE B C   1 
ATOM   7430 O O   . PHE B 1 430 ? -0.287  6.417   -26.933 1.00 42.03 ? 430  PHE B O   1 
ATOM   7431 C CB  . PHE B 1 430 ? -0.656  7.780   -29.573 1.00 40.38 ? 430  PHE B CB  1 
ATOM   7432 C CG  . PHE B 1 430 ? -1.947  7.266   -30.127 1.00 41.08 ? 430  PHE B CG  1 
ATOM   7433 C CD1 . PHE B 1 430 ? -2.324  5.934   -29.933 1.00 40.43 ? 430  PHE B CD1 1 
ATOM   7434 C CD2 . PHE B 1 430 ? -2.791  8.111   -30.846 1.00 38.96 ? 430  PHE B CD2 1 
ATOM   7435 C CE1 . PHE B 1 430 ? -3.530  5.456   -30.449 1.00 40.50 ? 430  PHE B CE1 1 
ATOM   7436 C CE2 . PHE B 1 430 ? -3.991  7.642   -31.363 1.00 39.59 ? 430  PHE B CE2 1 
ATOM   7437 C CZ  . PHE B 1 430 ? -4.365  6.308   -31.164 1.00 39.60 ? 430  PHE B CZ  1 
ATOM   7438 N N   . GLU B 1 431 ? -2.268  7.384   -26.511 1.00 42.52 ? 431  GLU B N   1 
ATOM   7439 C CA  . GLU B 1 431 ? -2.518  6.569   -25.312 1.00 43.98 ? 431  GLU B CA  1 
ATOM   7440 C C   . GLU B 1 431 ? -3.750  5.675   -25.402 1.00 44.07 ? 431  GLU B C   1 
ATOM   7441 O O   . GLU B 1 431 ? -4.112  5.011   -24.432 1.00 44.15 ? 431  GLU B O   1 
ATOM   7442 C CB  . GLU B 1 431 ? -2.626  7.467   -24.068 1.00 43.67 ? 431  GLU B CB  1 
ATOM   7443 C CG  . GLU B 1 431 ? -1.298  7.993   -23.569 1.00 45.43 ? 431  GLU B CG  1 
ATOM   7444 C CD  . GLU B 1 431 ? -1.411  8.801   -22.281 1.00 45.98 ? 431  GLU B CD  1 
ATOM   7445 O OE1 . GLU B 1 431 ? -2.485  9.418   -22.033 1.00 47.26 ? 431  GLU B OE1 1 
ATOM   7446 O OE2 . GLU B 1 431 ? -0.402  8.825   -21.527 1.00 47.19 ? 431  GLU B OE2 1 
ATOM   7447 N N   . HIS B 1 432 ? -4.401  5.663   -26.553 1.00 44.59 ? 432  HIS B N   1 
ATOM   7448 C CA  . HIS B 1 432 ? -5.555  4.808   -26.726 1.00 45.42 ? 432  HIS B CA  1 
ATOM   7449 C C   . HIS B 1 432 ? -5.230  3.448   -27.355 1.00 45.12 ? 432  HIS B C   1 
ATOM   7450 O O   . HIS B 1 432 ? -4.770  3.378   -28.488 1.00 44.52 ? 432  HIS B O   1 
ATOM   7451 C CB  . HIS B 1 432 ? -6.611  5.501   -27.562 1.00 45.75 ? 432  HIS B CB  1 
ATOM   7452 C CG  . HIS B 1 432 ? -7.787  4.629   -27.841 1.00 48.83 ? 432  HIS B CG  1 
ATOM   7453 N ND1 . HIS B 1 432 ? -8.645  4.208   -26.847 1.00 51.42 ? 432  HIS B ND1 1 
ATOM   7454 C CD2 . HIS B 1 432 ? -8.226  4.062   -28.989 1.00 50.54 ? 432  HIS B CD2 1 
ATOM   7455 C CE1 . HIS B 1 432 ? -9.578  3.436   -27.378 1.00 52.49 ? 432  HIS B CE1 1 
ATOM   7456 N NE2 . HIS B 1 432 ? -9.348  3.335   -28.675 1.00 52.49 ? 432  HIS B NE2 1 
ATOM   7457 N N   . ARG B 1 433 ? -5.500  2.378   -26.612 1.00 45.41 ? 433  ARG B N   1 
ATOM   7458 C CA  . ARG B 1 433 ? -5.458  1.013   -27.141 1.00 46.04 ? 433  ARG B CA  1 
ATOM   7459 C C   . ARG B 1 433 ? -6.726  0.701   -27.948 1.00 46.20 ? 433  ARG B C   1 
ATOM   7460 O O   . ARG B 1 433 ? -7.840  0.758   -27.408 1.00 46.85 ? 433  ARG B O   1 
ATOM   7461 C CB  . ARG B 1 433 ? -5.325  0.016   -25.991 1.00 45.92 ? 433  ARG B CB  1 
ATOM   7462 C CG  . ARG B 1 433 ? -5.144  -1.441  -26.420 1.00 47.64 ? 433  ARG B CG  1 
ATOM   7463 C CD  . ARG B 1 433 ? -5.100  -2.339  -25.184 1.00 48.77 ? 433  ARG B CD  1 
ATOM   7464 N NE  . ARG B 1 433 ? -5.303  -3.760  -25.467 1.00 49.16 ? 433  ARG B NE  1 
ATOM   7465 C CZ  . ARG B 1 433 ? -4.320  -4.636  -25.675 1.00 49.75 ? 433  ARG B CZ  1 
ATOM   7466 N NH1 . ARG B 1 433 ? -3.041  -4.241  -25.664 1.00 49.27 ? 433  ARG B NH1 1 
ATOM   7467 N NH2 . ARG B 1 433 ? -4.615  -5.915  -25.895 1.00 47.42 ? 433  ARG B NH2 1 
ATOM   7468 N N   . ALA B 1 434 ? -6.567  0.393   -29.235 1.00 46.36 ? 434  ALA B N   1 
ATOM   7469 C CA  . ALA B 1 434 ? -7.689  -0.052  -30.064 1.00 46.97 ? 434  ALA B CA  1 
ATOM   7470 C C   . ALA B 1 434 ? -8.412  -1.199  -29.374 1.00 47.82 ? 434  ALA B C   1 
ATOM   7471 O O   . ALA B 1 434 ? -7.773  -2.128  -28.881 1.00 47.24 ? 434  ALA B O   1 
ATOM   7472 C CB  . ALA B 1 434 ? -7.217  -0.495  -31.417 1.00 46.68 ? 434  ALA B CB  1 
ATOM   7473 N N   . SER B 1 435 ? -9.743  -1.106  -29.327 1.00 48.92 ? 435  SER B N   1 
ATOM   7474 C CA  . SER B 1 435 ? -10.594 -2.157  -28.772 1.00 49.91 ? 435  SER B CA  1 
ATOM   7475 C C   . SER B 1 435 ? -10.430 -3.458  -29.550 1.00 50.56 ? 435  SER B C   1 
ATOM   7476 O O   . SER B 1 435 ? -10.472 -4.543  -28.967 1.00 50.98 ? 435  SER B O   1 
ATOM   7477 C CB  . SER B 1 435 ? -12.066 -1.716  -28.777 1.00 50.01 ? 435  SER B CB  1 
ATOM   7478 O OG  . SER B 1 435 ? -12.508 -1.431  -30.096 1.00 50.63 ? 435  SER B OG  1 
ATOM   7479 N N   . THR B 1 436 ? -10.193 -3.335  -30.857 1.00 51.19 ? 436  THR B N   1 
ATOM   7480 C CA  . THR B 1 436 ? -10.046 -4.479  -31.762 1.00 51.77 ? 436  THR B CA  1 
ATOM   7481 C C   . THR B 1 436 ? -8.663  -5.153  -31.744 1.00 52.27 ? 436  THR B C   1 
ATOM   7482 O O   . THR B 1 436 ? -8.384  -6.029  -32.579 1.00 52.28 ? 436  THR B O   1 
ATOM   7483 C CB  . THR B 1 436 ? -10.354 -4.063  -33.205 1.00 51.81 ? 436  THR B CB  1 
ATOM   7484 O OG1 . THR B 1 436 ? -9.506  -2.967  -33.576 1.00 52.69 ? 436  THR B OG1 1 
ATOM   7485 C CG2 . THR B 1 436 ? -11.822 -3.647  -33.345 1.00 52.07 ? 436  THR B CG2 1 
ATOM   7486 N N   . LEU B 1 437 ? -7.815  -4.772  -30.788 1.00 52.26 ? 437  LEU B N   1 
ATOM   7487 C CA  . LEU B 1 437 ? -6.433  -5.232  -30.766 1.00 52.49 ? 437  LEU B CA  1 
ATOM   7488 C C   . LEU B 1 437 ? -6.264  -6.733  -30.512 1.00 52.84 ? 437  LEU B C   1 
ATOM   7489 O O   . LEU B 1 437 ? -6.774  -7.290  -29.541 1.00 52.70 ? 437  LEU B O   1 
ATOM   7490 C CB  . LEU B 1 437 ? -5.589  -4.422  -29.772 1.00 52.64 ? 437  LEU B CB  1 
ATOM   7491 C CG  . LEU B 1 437 ? -4.094  -4.393  -30.111 1.00 52.66 ? 437  LEU B CG  1 
ATOM   7492 C CD1 . LEU B 1 437 ? -3.889  -3.873  -31.517 1.00 53.16 ? 437  LEU B CD1 1 
ATOM   7493 C CD2 . LEU B 1 437 ? -3.319  -3.552  -29.140 1.00 53.31 ? 437  LEU B CD2 1 
ATOM   7494 N N   . THR B 1 438 ? -5.500  -7.361  -31.393 1.00 52.95 ? 438  THR B N   1 
ATOM   7495 C CA  . THR B 1 438 ? -5.254  -8.787  -31.339 1.00 53.29 ? 438  THR B CA  1 
ATOM   7496 C C   . THR B 1 438 ? -4.218  -9.175  -30.290 1.00 52.89 ? 438  THR B C   1 
ATOM   7497 O O   . THR B 1 438 ? -4.299  -10.258 -29.715 1.00 52.80 ? 438  THR B O   1 
ATOM   7498 C CB  . THR B 1 438 ? -4.843  -9.290  -32.729 1.00 53.56 ? 438  THR B CB  1 
ATOM   7499 O OG1 . THR B 1 438 ? -4.263  -8.204  -33.469 1.00 53.67 ? 438  THR B OG1 1 
ATOM   7500 C CG2 . THR B 1 438 ? -6.086  -9.758  -33.476 1.00 54.34 ? 438  THR B CG2 1 
ATOM   7501 N N   . TRP B 1 439 ? -3.259  -8.280  -30.040 1.00 52.71 ? 439  TRP B N   1 
ATOM   7502 C CA  . TRP B 1 439 ? -2.168  -8.507  -29.076 1.00 52.06 ? 439  TRP B CA  1 
ATOM   7503 C C   . TRP B 1 439 ? -2.672  -8.496  -27.626 1.00 52.14 ? 439  TRP B C   1 
ATOM   7504 O O   . TRP B 1 439 ? -3.687  -7.857  -27.337 1.00 52.14 ? 439  TRP B O   1 
ATOM   7505 C CB  . TRP B 1 439 ? -1.104  -7.427  -29.247 1.00 51.64 ? 439  TRP B CB  1 
ATOM   7506 C CG  . TRP B 1 439 ? -0.419  -7.409  -30.581 1.00 50.94 ? 439  TRP B CG  1 
ATOM   7507 C CD1 . TRP B 1 439 ? -0.695  -6.583  -31.632 1.00 50.40 ? 439  TRP B CD1 1 
ATOM   7508 C CD2 . TRP B 1 439 ? 0.677   -8.235  -30.995 1.00 50.32 ? 439  TRP B CD2 1 
ATOM   7509 N NE1 . TRP B 1 439 ? 0.157   -6.846  -32.679 1.00 49.82 ? 439  TRP B NE1 1 
ATOM   7510 C CE2 . TRP B 1 439 ? 1.009   -7.857  -32.315 1.00 49.95 ? 439  TRP B CE2 1 
ATOM   7511 C CE3 . TRP B 1 439 ? 1.404   -9.268  -30.383 1.00 49.98 ? 439  TRP B CE3 1 
ATOM   7512 C CZ2 . TRP B 1 439 ? 2.031   -8.477  -33.036 1.00 50.24 ? 439  TRP B CZ2 1 
ATOM   7513 C CZ3 . TRP B 1 439 ? 2.426   -9.868  -31.084 1.00 50.27 ? 439  TRP B CZ3 1 
ATOM   7514 C CH2 . TRP B 1 439 ? 2.729   -9.474  -32.405 1.00 51.07 ? 439  TRP B CH2 1 
ATOM   7515 N N   . PRO B 1 440 ? -1.951  -9.162  -26.697 1.00 52.14 ? 440  PRO B N   1 
ATOM   7516 C CA  . PRO B 1 440 ? -2.442  -9.235  -25.309 1.00 52.34 ? 440  PRO B CA  1 
ATOM   7517 C C   . PRO B 1 440 ? -2.348  -7.881  -24.581 1.00 52.76 ? 440  PRO B C   1 
ATOM   7518 O O   . PRO B 1 440 ? -1.647  -6.965  -25.049 1.00 53.00 ? 440  PRO B O   1 
ATOM   7519 C CB  . PRO B 1 440 ? -1.494  -10.245 -24.663 1.00 52.09 ? 440  PRO B CB  1 
ATOM   7520 C CG  . PRO B 1 440 ? -0.221  -10.051 -25.403 1.00 51.78 ? 440  PRO B CG  1 
ATOM   7521 C CD  . PRO B 1 440 ? -0.638  -9.815  -26.840 1.00 52.08 ? 440  PRO B CD  1 
ATOM   7522 N N   . LEU B 1 441 ? -3.026  -7.766  -23.441 1.00 52.89 ? 441  LEU B N   1 
ATOM   7523 C CA  . LEU B 1 441 ? -3.167  -6.475  -22.761 1.00 53.11 ? 441  LEU B CA  1 
ATOM   7524 C C   . LEU B 1 441 ? -1.853  -5.881  -22.250 1.00 52.44 ? 441  LEU B C   1 
ATOM   7525 O O   . LEU B 1 441 ? -1.712  -4.651  -22.162 1.00 52.27 ? 441  LEU B O   1 
ATOM   7526 C CB  . LEU B 1 441 ? -4.191  -6.550  -21.620 1.00 53.39 ? 441  LEU B CB  1 
ATOM   7527 C CG  . LEU B 1 441 ? -5.676  -6.617  -22.021 1.00 55.99 ? 441  LEU B CG  1 
ATOM   7528 C CD1 . LEU B 1 441 ? -6.560  -7.102  -20.853 1.00 57.35 ? 441  LEU B CD1 1 
ATOM   7529 C CD2 . LEU B 1 441 ? -6.198  -5.279  -22.572 1.00 57.82 ? 441  LEU B CD2 1 
ATOM   7530 N N   . TRP B 1 442 ? -0.898  -6.743  -21.924 1.00 51.38 ? 442  TRP B N   1 
ATOM   7531 C CA  . TRP B 1 442 ? 0.339   -6.274  -21.299 1.00 50.82 ? 442  TRP B CA  1 
ATOM   7532 C C   . TRP B 1 442 ? 1.218   -5.459  -22.248 1.00 50.28 ? 442  TRP B C   1 
ATOM   7533 O O   . TRP B 1 442 ? 2.123   -4.750  -21.806 1.00 50.10 ? 442  TRP B O   1 
ATOM   7534 C CB  . TRP B 1 442 ? 1.136   -7.435  -20.696 1.00 50.87 ? 442  TRP B CB  1 
ATOM   7535 C CG  . TRP B 1 442 ? 1.782   -8.359  -21.697 1.00 50.82 ? 442  TRP B CG  1 
ATOM   7536 C CD1 . TRP B 1 442 ? 1.325   -9.584  -22.081 1.00 50.97 ? 442  TRP B CD1 1 
ATOM   7537 C CD2 . TRP B 1 442 ? 3.008   -8.143  -22.419 1.00 51.83 ? 442  TRP B CD2 1 
ATOM   7538 N NE1 . TRP B 1 442 ? 2.183   -10.146 -22.991 1.00 51.73 ? 442  TRP B NE1 1 
ATOM   7539 C CE2 . TRP B 1 442 ? 3.223   -9.285  -23.222 1.00 51.17 ? 442  TRP B CE2 1 
ATOM   7540 C CE3 . TRP B 1 442 ? 3.948   -7.094  -22.466 1.00 50.88 ? 442  TRP B CE3 1 
ATOM   7541 C CZ2 . TRP B 1 442 ? 4.333   -9.412  -24.066 1.00 50.52 ? 442  TRP B CZ2 1 
ATOM   7542 C CZ3 . TRP B 1 442 ? 5.045   -7.216  -23.304 1.00 50.22 ? 442  TRP B CZ3 1 
ATOM   7543 C CH2 . TRP B 1 442 ? 5.232   -8.370  -24.091 1.00 50.80 ? 442  TRP B CH2 1 
ATOM   7544 N N   . MET B 1 443 ? 0.957   -5.582  -23.546 1.00 49.65 ? 443  MET B N   1 
ATOM   7545 C CA  . MET B 1 443 ? 1.697   -4.836  -24.558 1.00 49.08 ? 443  MET B CA  1 
ATOM   7546 C C   . MET B 1 443 ? 1.182   -3.409  -24.666 1.00 48.70 ? 443  MET B C   1 
ATOM   7547 O O   . MET B 1 443 ? 1.823   -2.560  -25.290 1.00 49.34 ? 443  MET B O   1 
ATOM   7548 C CB  . MET B 1 443 ? 1.612   -5.527  -25.913 1.00 48.75 ? 443  MET B CB  1 
ATOM   7549 C CG  . MET B 1 443 ? 2.328   -6.854  -25.971 1.00 48.76 ? 443  MET B CG  1 
ATOM   7550 S SD  . MET B 1 443 ? 2.506   -7.376  -27.685 1.00 49.36 ? 443  MET B SD  1 
ATOM   7551 C CE  . MET B 1 443 ? 3.092   -9.042  -27.413 1.00 49.14 ? 443  MET B CE  1 
ATOM   7552 N N   . GLY B 1 444 ? 0.025   -3.164  -24.052 1.00 47.91 ? 444  GLY B N   1 
ATOM   7553 C CA  . GLY B 1 444 ? -0.571  -1.839  -23.955 1.00 46.64 ? 444  GLY B CA  1 
ATOM   7554 C C   . GLY B 1 444 ? -0.927  -1.280  -25.309 1.00 46.19 ? 444  GLY B C   1 
ATOM   7555 O O   . GLY B 1 444 ? -1.673  -1.903  -26.061 1.00 46.68 ? 444  GLY B O   1 
ATOM   7556 N N   . VAL B 1 445 ? -0.396  -0.094  -25.608 1.00 45.42 ? 445  VAL B N   1 
ATOM   7557 C CA  . VAL B 1 445 ? -0.586  0.558   -26.887 1.00 44.03 ? 445  VAL B CA  1 
ATOM   7558 C C   . VAL B 1 445 ? 0.741   0.431   -27.598 1.00 44.61 ? 445  VAL B C   1 
ATOM   7559 O O   . VAL B 1 445 ? 1.668   1.200   -27.325 1.00 45.29 ? 445  VAL B O   1 
ATOM   7560 C CB  . VAL B 1 445 ? -0.945  2.031   -26.719 1.00 44.07 ? 445  VAL B CB  1 
ATOM   7561 C CG1 . VAL B 1 445 ? -1.435  2.619   -28.058 1.00 42.14 ? 445  VAL B CG1 1 
ATOM   7562 C CG2 . VAL B 1 445 ? -1.988  2.202   -25.613 1.00 41.86 ? 445  VAL B CG2 1 
ATOM   7563 N N   . PRO B 1 446 ? 0.862   -0.585  -28.473 1.00 44.17 ? 446  PRO B N   1 
ATOM   7564 C CA  . PRO B 1 446 ? 2.133   -0.914  -29.092 1.00 43.36 ? 446  PRO B CA  1 
ATOM   7565 C C   . PRO B 1 446 ? 2.450   -0.101  -30.334 1.00 42.79 ? 446  PRO B C   1 
ATOM   7566 O O   . PRO B 1 446 ? 1.563   0.456   -30.974 1.00 42.29 ? 446  PRO B O   1 
ATOM   7567 C CB  . PRO B 1 446 ? 1.970   -2.402  -29.474 1.00 43.44 ? 446  PRO B CB  1 
ATOM   7568 C CG  . PRO B 1 446 ? 0.577   -2.806  -29.031 1.00 43.48 ? 446  PRO B CG  1 
ATOM   7569 C CD  . PRO B 1 446 ? -0.190  -1.524  -28.890 1.00 44.13 ? 446  PRO B CD  1 
ATOM   7570 N N   . HIS B 1 447 ? 3.739   -0.074  -30.646 1.00 42.47 ? 447  HIS B N   1 
ATOM   7571 C CA  . HIS B 1 447 ? 4.301   0.471   -31.858 1.00 42.54 ? 447  HIS B CA  1 
ATOM   7572 C C   . HIS B 1 447 ? 3.441   0.137   -33.083 1.00 42.53 ? 447  HIS B C   1 
ATOM   7573 O O   . HIS B 1 447 ? 3.225   -1.029  -33.390 1.00 43.20 ? 447  HIS B O   1 
ATOM   7574 C CB  . HIS B 1 447 ? 5.700   -0.123  -31.992 1.00 42.64 ? 447  HIS B CB  1 
ATOM   7575 C CG  . HIS B 1 447 ? 6.525   0.474   -33.086 1.00 44.58 ? 447  HIS B CG  1 
ATOM   7576 N ND1 . HIS B 1 447 ? 7.015   1.761   -33.031 1.00 45.45 ? 447  HIS B ND1 1 
ATOM   7577 C CD2 . HIS B 1 447 ? 6.981   -0.056  -34.246 1.00 44.48 ? 447  HIS B CD2 1 
ATOM   7578 C CE1 . HIS B 1 447 ? 7.719   2.007   -34.121 1.00 45.52 ? 447  HIS B CE1 1 
ATOM   7579 N NE2 . HIS B 1 447 ? 7.716   0.920   -34.874 1.00 45.27 ? 447  HIS B NE2 1 
ATOM   7580 N N   . GLY B 1 448 ? 2.932   1.162   -33.763 1.00 42.03 ? 448  GLY B N   1 
ATOM   7581 C CA  . GLY B 1 448 ? 2.190   0.965   -35.009 1.00 41.06 ? 448  GLY B CA  1 
ATOM   7582 C C   . GLY B 1 448 ? 0.679   1.124   -34.877 1.00 40.78 ? 448  GLY B C   1 
ATOM   7583 O O   . GLY B 1 448 ? -0.015  1.332   -35.878 1.00 40.94 ? 448  GLY B O   1 
ATOM   7584 N N   . TYR B 1 449 ? 0.162   1.048   -33.655 1.00 39.99 ? 449  TYR B N   1 
ATOM   7585 C CA  . TYR B 1 449 ? -1.294  1.015   -33.455 1.00 39.73 ? 449  TYR B CA  1 
ATOM   7586 C C   . TYR B 1 449 ? -2.010  2.374   -33.320 1.00 39.43 ? 449  TYR B C   1 
ATOM   7587 O O   . TYR B 1 449 ? -3.179  2.440   -32.992 1.00 39.15 ? 449  TYR B O   1 
ATOM   7588 C CB  . TYR B 1 449 ? -1.673  -0.043  -32.395 1.00 39.33 ? 449  TYR B CB  1 
ATOM   7589 C CG  . TYR B 1 449 ? -1.289  -1.387  -32.949 1.00 39.01 ? 449  TYR B CG  1 
ATOM   7590 C CD1 . TYR B 1 449 ? -0.033  -1.921  -32.719 1.00 39.11 ? 449  TYR B CD1 1 
ATOM   7591 C CD2 . TYR B 1 449 ? -2.139  -2.061  -33.819 1.00 39.72 ? 449  TYR B CD2 1 
ATOM   7592 C CE1 . TYR B 1 449 ? 0.345   -3.129  -33.281 1.00 40.25 ? 449  TYR B CE1 1 
ATOM   7593 C CE2 . TYR B 1 449 ? -1.779  -3.274  -34.384 1.00 40.00 ? 449  TYR B CE2 1 
ATOM   7594 C CZ  . TYR B 1 449 ? -0.538  -3.800  -34.114 1.00 40.07 ? 449  TYR B CZ  1 
ATOM   7595 O OH  . TYR B 1 449 ? -0.177  -4.995  -34.677 1.00 40.29 ? 449  TYR B OH  1 
ATOM   7596 N N   . GLU B 1 450 ? -1.303  3.453   -33.640 1.00 39.35 ? 450  GLU B N   1 
ATOM   7597 C CA  . GLU B 1 450 ? -1.963  4.735   -33.826 1.00 38.64 ? 450  GLU B CA  1 
ATOM   7598 C C   . GLU B 1 450 ? -2.398  4.891   -35.294 1.00 38.60 ? 450  GLU B C   1 
ATOM   7599 O O   . GLU B 1 450 ? -3.357  5.619   -35.600 1.00 38.49 ? 450  GLU B O   1 
ATOM   7600 C CB  . GLU B 1 450 ? -1.050  5.877   -33.370 1.00 38.04 ? 450  GLU B CB  1 
ATOM   7601 C CG  . GLU B 1 450 ? -0.163  6.472   -34.464 1.00 38.01 ? 450  GLU B CG  1 
ATOM   7602 C CD  . GLU B 1 450 ? 1.117   5.674   -34.752 1.00 39.57 ? 450  GLU B CD  1 
ATOM   7603 O OE1 . GLU B 1 450 ? 1.298   4.531   -34.248 1.00 38.88 ? 450  GLU B OE1 1 
ATOM   7604 O OE2 . GLU B 1 450 ? 1.951   6.216   -35.505 1.00 40.37 ? 450  GLU B OE2 1 
ATOM   7605 N N   . ILE B 1 451 ? -1.707  4.188   -36.193 1.00 38.35 ? 451  ILE B N   1 
ATOM   7606 C CA  . ILE B 1 451 ? -1.858  4.408   -37.634 1.00 38.44 ? 451  ILE B CA  1 
ATOM   7607 C C   . ILE B 1 451 ? -3.297  4.230   -38.117 1.00 38.61 ? 451  ILE B C   1 
ATOM   7608 O O   . ILE B 1 451 ? -3.832  5.075   -38.835 1.00 39.48 ? 451  ILE B O   1 
ATOM   7609 C CB  . ILE B 1 451 ? -0.911  3.509   -38.450 1.00 38.76 ? 451  ILE B CB  1 
ATOM   7610 C CG1 . ILE B 1 451 ? 0.568   3.812   -38.120 1.00 39.42 ? 451  ILE B CG1 1 
ATOM   7611 C CG2 . ILE B 1 451 ? -1.183  3.658   -39.954 1.00 37.76 ? 451  ILE B CG2 1 
ATOM   7612 C CD1 . ILE B 1 451 ? 1.546   2.706   -38.586 1.00 38.37 ? 451  ILE B CD1 1 
ATOM   7613 N N   . GLU B 1 452 ? -3.937  3.144   -37.720 1.00 38.42 ? 452  GLU B N   1 
ATOM   7614 C CA  . GLU B 1 452 ? -5.313  2.906   -38.149 1.00 38.82 ? 452  GLU B CA  1 
ATOM   7615 C C   . GLU B 1 452 ? -6.253  4.054   -37.766 1.00 38.82 ? 452  GLU B C   1 
ATOM   7616 O O   . GLU B 1 452 ? -7.190  4.326   -38.502 1.00 38.93 ? 452  GLU B O   1 
ATOM   7617 C CB  . GLU B 1 452 ? -5.842  1.571   -37.624 1.00 38.93 ? 452  GLU B CB  1 
ATOM   7618 C CG  . GLU B 1 452 ? -5.828  1.435   -36.116 1.00 40.57 ? 452  GLU B CG  1 
ATOM   7619 C CD  . GLU B 1 452 ? -5.654  -0.010  -35.667 1.00 44.36 ? 452  GLU B CD  1 
ATOM   7620 O OE1 . GLU B 1 452 ? -6.380  -0.448  -34.753 1.00 45.67 ? 452  GLU B OE1 1 
ATOM   7621 O OE2 . GLU B 1 452 ? -4.785  -0.713  -36.225 1.00 46.65 ? 452  GLU B OE2 1 
ATOM   7622 N N   . PHE B 1 453 ? -5.988  4.722   -36.636 1.00 38.45 ? 453  PHE B N   1 
ATOM   7623 C CA  . PHE B 1 453 ? -6.797  5.857   -36.192 1.00 38.29 ? 453  PHE B CA  1 
ATOM   7624 C C   . PHE B 1 453 ? -6.573  7.116   -37.002 1.00 38.30 ? 453  PHE B C   1 
ATOM   7625 O O   . PHE B 1 453 ? -7.531  7.776   -37.362 1.00 38.55 ? 453  PHE B O   1 
ATOM   7626 C CB  . PHE B 1 453 ? -6.604  6.123   -34.702 1.00 38.20 ? 453  PHE B CB  1 
ATOM   7627 C CG  . PHE B 1 453 ? -7.165  5.044   -33.832 1.00 38.10 ? 453  PHE B CG  1 
ATOM   7628 C CD1 . PHE B 1 453 ? -8.526  5.027   -33.516 1.00 39.29 ? 453  PHE B CD1 1 
ATOM   7629 C CD2 . PHE B 1 453 ? -6.350  4.027   -33.362 1.00 37.82 ? 453  PHE B CD2 1 
ATOM   7630 C CE1 . PHE B 1 453 ? -9.066  4.016   -32.710 1.00 40.36 ? 453  PHE B CE1 1 
ATOM   7631 C CE2 . PHE B 1 453 ? -6.863  3.008   -32.558 1.00 39.87 ? 453  PHE B CE2 1 
ATOM   7632 C CZ  . PHE B 1 453 ? -8.231  2.999   -32.225 1.00 40.03 ? 453  PHE B CZ  1 
ATOM   7633 N N   . ILE B 1 454 ? -5.310  7.429   -37.299 1.00 38.50 ? 454  ILE B N   1 
ATOM   7634 C CA  . ILE B 1 454 ? -4.945  8.569   -38.135 1.00 38.34 ? 454  ILE B CA  1 
ATOM   7635 C C   . ILE B 1 454 ? -5.499  8.456   -39.554 1.00 38.80 ? 454  ILE B C   1 
ATOM   7636 O O   . ILE B 1 454 ? -5.933  9.456   -40.115 1.00 38.50 ? 454  ILE B O   1 
ATOM   7637 C CB  . ILE B 1 454 ? -3.412  8.741   -38.233 1.00 38.25 ? 454  ILE B CB  1 
ATOM   7638 C CG1 . ILE B 1 454 ? -2.753  8.835   -36.839 1.00 39.53 ? 454  ILE B CG1 1 
ATOM   7639 C CG2 . ILE B 1 454 ? -3.034  9.909   -39.149 1.00 37.32 ? 454  ILE B CG2 1 
ATOM   7640 C CD1 . ILE B 1 454 ? -3.293  9.928   -35.932 1.00 41.77 ? 454  ILE B CD1 1 
ATOM   7641 N N   . PHE B 1 455 ? -5.468  7.250   -40.133 1.00 39.51 ? 455  PHE B N   1 
ATOM   7642 C CA  . PHE B 1 455 ? -5.935  7.037   -41.513 1.00 40.20 ? 455  PHE B CA  1 
ATOM   7643 C C   . PHE B 1 455 ? -7.455  6.926   -41.575 1.00 40.77 ? 455  PHE B C   1 
ATOM   7644 O O   . PHE B 1 455 ? -8.043  6.906   -42.654 1.00 40.44 ? 455  PHE B O   1 
ATOM   7645 C CB  . PHE B 1 455 ? -5.274  5.804   -42.151 1.00 39.79 ? 455  PHE B CB  1 
ATOM   7646 C CG  . PHE B 1 455 ? -4.023  6.118   -42.917 1.00 39.97 ? 455  PHE B CG  1 
ATOM   7647 C CD1 . PHE B 1 455 ? -2.779  6.120   -42.284 1.00 40.80 ? 455  PHE B CD1 1 
ATOM   7648 C CD2 . PHE B 1 455 ? -4.077  6.415   -44.268 1.00 39.61 ? 455  PHE B CD2 1 
ATOM   7649 C CE1 . PHE B 1 455 ? -1.615  6.414   -42.993 1.00 40.44 ? 455  PHE B CE1 1 
ATOM   7650 C CE2 . PHE B 1 455 ? -2.907  6.717   -44.986 1.00 40.04 ? 455  PHE B CE2 1 
ATOM   7651 C CZ  . PHE B 1 455 ? -1.678  6.714   -44.343 1.00 39.02 ? 455  PHE B CZ  1 
ATOM   7652 N N   . GLY B 1 456 ? -8.066  6.835   -40.403 1.00 42.11 ? 456  GLY B N   1 
ATOM   7653 C CA  . GLY B 1 456 ? -9.514  6.901   -40.258 1.00 44.49 ? 456  GLY B CA  1 
ATOM   7654 C C   . GLY B 1 456 ? -10.295 5.610   -40.392 1.00 45.90 ? 456  GLY B C   1 
ATOM   7655 O O   . GLY B 1 456 ? -11.473 5.653   -40.748 1.00 46.65 ? 456  GLY B O   1 
ATOM   7656 N N   . LEU B 1 457 ? -9.676  4.464   -40.100 1.00 46.93 ? 457  LEU B N   1 
ATOM   7657 C CA  . LEU B 1 457 ? -10.359 3.181   -40.314 1.00 48.75 ? 457  LEU B CA  1 
ATOM   7658 C C   . LEU B 1 457 ? -11.637 3.006   -39.484 1.00 50.17 ? 457  LEU B C   1 
ATOM   7659 O O   . LEU B 1 457 ? -12.600 2.445   -39.976 1.00 50.47 ? 457  LEU B O   1 
ATOM   7660 C CB  . LEU B 1 457 ? -9.443  1.971   -40.100 1.00 48.09 ? 457  LEU B CB  1 
ATOM   7661 C CG  . LEU B 1 457 ? -8.186  1.724   -40.925 1.00 48.20 ? 457  LEU B CG  1 
ATOM   7662 C CD1 . LEU B 1 457 ? -7.914  0.222   -40.922 1.00 49.05 ? 457  LEU B CD1 1 
ATOM   7663 C CD2 . LEU B 1 457 ? -8.238  2.276   -42.340 1.00 45.12 ? 457  LEU B CD2 1 
ATOM   7664 N N   . PRO B 1 458 ? -11.636 3.444   -38.215 1.00 51.53 ? 458  PRO B N   1 
ATOM   7665 C CA  . PRO B 1 458 ? -12.864 3.316   -37.445 1.00 52.94 ? 458  PRO B CA  1 
ATOM   7666 C C   . PRO B 1 458 ? -14.122 3.952   -38.059 1.00 54.35 ? 458  PRO B C   1 
ATOM   7667 O O   . PRO B 1 458 ? -15.216 3.730   -37.549 1.00 54.63 ? 458  PRO B O   1 
ATOM   7668 C CB  . PRO B 1 458 ? -12.500 3.980   -36.118 1.00 52.78 ? 458  PRO B CB  1 
ATOM   7669 C CG  . PRO B 1 458 ? -11.038 3.739   -36.003 1.00 52.10 ? 458  PRO B CG  1 
ATOM   7670 C CD  . PRO B 1 458 ? -10.545 3.986   -37.387 1.00 51.52 ? 458  PRO B CD  1 
ATOM   7671 N N   . LEU B 1 459 ? -13.988 4.709   -39.142 1.00 55.76 ? 459  LEU B N   1 
ATOM   7672 C CA  . LEU B 1 459 ? -15.176 5.221   -39.814 1.00 57.51 ? 459  LEU B CA  1 
ATOM   7673 C C   . LEU B 1 459 ? -15.846 4.152   -40.687 1.00 58.89 ? 459  LEU B C   1 
ATOM   7674 O O   . LEU B 1 459 ? -16.972 4.342   -41.169 1.00 59.28 ? 459  LEU B O   1 
ATOM   7675 C CB  . LEU B 1 459 ? -14.860 6.473   -40.637 1.00 57.32 ? 459  LEU B CB  1 
ATOM   7676 C CG  . LEU B 1 459 ? -14.025 7.591   -40.006 1.00 58.10 ? 459  LEU B CG  1 
ATOM   7677 C CD1 . LEU B 1 459 ? -14.257 8.879   -40.758 1.00 58.63 ? 459  LEU B CD1 1 
ATOM   7678 C CD2 . LEU B 1 459 ? -14.312 7.790   -38.525 1.00 58.34 ? 459  LEU B CD2 1 
ATOM   7679 N N   . ASP B 1 460 ? -15.150 3.035   -40.890 1.00 60.52 ? 460  ASP B N   1 
ATOM   7680 C CA  . ASP B 1 460 ? -15.696 1.903   -41.625 1.00 62.21 ? 460  ASP B CA  1 
ATOM   7681 C C   . ASP B 1 460 ? -16.469 1.040   -40.642 1.00 63.04 ? 460  ASP B C   1 
ATOM   7682 O O   . ASP B 1 460 ? -15.868 0.388   -39.777 1.00 63.25 ? 460  ASP B O   1 
ATOM   7683 C CB  . ASP B 1 460 ? -14.585 1.101   -42.314 1.00 62.44 ? 460  ASP B CB  1 
ATOM   7684 C CG  . ASP B 1 460 ? -15.116 -0.105  -43.108 1.00 63.63 ? 460  ASP B CG  1 
ATOM   7685 O OD1 . ASP B 1 460 ? -16.352 -0.275  -43.227 1.00 64.05 ? 460  ASP B OD1 1 
ATOM   7686 O OD2 . ASP B 1 460 ? -14.278 -0.885  -43.620 1.00 64.45 ? 460  ASP B OD2 1 
ATOM   7687 N N   . PRO B 1 461 ? -17.807 1.033   -40.773 1.00 63.97 ? 461  PRO B N   1 
ATOM   7688 C CA  . PRO B 1 461 ? -18.674 0.366   -39.792 1.00 64.61 ? 461  PRO B CA  1 
ATOM   7689 C C   . PRO B 1 461 ? -18.418 -1.138  -39.693 1.00 64.99 ? 461  PRO B C   1 
ATOM   7690 O O   . PRO B 1 461 ? -18.511 -1.707  -38.602 1.00 65.41 ? 461  PRO B O   1 
ATOM   7691 C CB  . PRO B 1 461 ? -20.091 0.650   -40.318 1.00 64.65 ? 461  PRO B CB  1 
ATOM   7692 C CG  . PRO B 1 461 ? -19.929 1.856   -41.224 1.00 64.73 ? 461  PRO B CG  1 
ATOM   7693 C CD  . PRO B 1 461 ? -18.586 1.649   -41.862 1.00 64.03 ? 461  PRO B CD  1 
ATOM   7694 N N   . SER B 1 462 ? -18.075 -1.767  -40.814 1.00 65.34 ? 462  SER B N   1 
ATOM   7695 C CA  . SER B 1 462 ? -17.834 -3.212  -40.850 1.00 65.90 ? 462  SER B CA  1 
ATOM   7696 C C   . SER B 1 462 ? -16.609 -3.665  -40.052 1.00 66.05 ? 462  SER B C   1 
ATOM   7697 O O   . SER B 1 462 ? -16.327 -4.862  -39.981 1.00 66.28 ? 462  SER B O   1 
ATOM   7698 C CB  . SER B 1 462 ? -17.717 -3.701  -42.300 1.00 66.16 ? 462  SER B CB  1 
ATOM   7699 O OG  . SER B 1 462 ? -16.561 -3.170  -42.938 1.00 66.92 ? 462  SER B OG  1 
ATOM   7700 N N   . LEU B 1 463 ? -15.883 -2.720  -39.455 1.00 66.12 ? 463  LEU B N   1 
ATOM   7701 C CA  . LEU B 1 463 ? -14.667 -3.060  -38.721 1.00 66.01 ? 463  LEU B CA  1 
ATOM   7702 C C   . LEU B 1 463 ? -14.868 -3.215  -37.208 1.00 66.22 ? 463  LEU B C   1 
ATOM   7703 O O   . LEU B 1 463 ? -13.969 -3.689  -36.499 1.00 66.39 ? 463  LEU B O   1 
ATOM   7704 C CB  . LEU B 1 463 ? -13.532 -2.092  -39.060 1.00 65.82 ? 463  LEU B CB  1 
ATOM   7705 C CG  . LEU B 1 463 ? -12.893 -2.315  -40.440 1.00 65.76 ? 463  LEU B CG  1 
ATOM   7706 C CD1 . LEU B 1 463 ? -12.173 -1.059  -40.946 1.00 64.33 ? 463  LEU B CD1 1 
ATOM   7707 C CD2 . LEU B 1 463 ? -11.954 -3.529  -40.435 1.00 65.46 ? 463  LEU B CD2 1 
ATOM   7708 N N   . ASN B 1 464 ? -16.056 -2.842  -36.731 1.00 66.26 ? 464  ASN B N   1 
ATOM   7709 C CA  . ASN B 1 464 ? -16.475 -3.077  -35.340 1.00 66.64 ? 464  ASN B CA  1 
ATOM   7710 C C   . ASN B 1 464 ? -15.708 -2.248  -34.286 1.00 66.23 ? 464  ASN B C   1 
ATOM   7711 O O   . ASN B 1 464 ? -15.520 -2.692  -33.145 1.00 66.47 ? 464  ASN B O   1 
ATOM   7712 C CB  . ASN B 1 464 ? -16.462 -4.590  -34.966 1.00 66.97 ? 464  ASN B CB  1 
ATOM   7713 C CG  . ASN B 1 464 ? -16.994 -5.509  -36.090 1.00 68.23 ? 464  ASN B CG  1 
ATOM   7714 O OD1 . ASN B 1 464 ? -18.132 -5.373  -36.547 1.00 69.14 ? 464  ASN B OD1 1 
ATOM   7715 N ND2 . ASN B 1 464 ? -16.159 -6.460  -36.521 1.00 69.46 ? 464  ASN B ND2 1 
ATOM   7716 N N   . TYR B 1 465 ? -15.275 -1.047  -34.668 1.00 65.36 ? 465  TYR B N   1 
ATOM   7717 C CA  . TYR B 1 465 ? -14.708 -0.102  -33.709 1.00 64.55 ? 465  TYR B CA  1 
ATOM   7718 C C   . TYR B 1 465 ? -15.852 0.560   -32.948 1.00 64.20 ? 465  TYR B C   1 
ATOM   7719 O O   . TYR B 1 465 ? -16.898 0.839   -33.533 1.00 64.15 ? 465  TYR B O   1 
ATOM   7720 C CB  . TYR B 1 465 ? -13.897 0.985   -34.427 1.00 64.22 ? 465  TYR B CB  1 
ATOM   7721 C CG  . TYR B 1 465 ? -12.522 0.589   -34.920 1.00 63.38 ? 465  TYR B CG  1 
ATOM   7722 C CD1 . TYR B 1 465 ? -11.420 0.593   -34.066 1.00 62.61 ? 465  TYR B CD1 1 
ATOM   7723 C CD2 . TYR B 1 465 ? -12.318 0.247   -36.248 1.00 63.02 ? 465  TYR B CD2 1 
ATOM   7724 C CE1 . TYR B 1 465 ? -10.149 0.243   -34.524 1.00 62.78 ? 465  TYR B CE1 1 
ATOM   7725 C CE2 . TYR B 1 465 ? -11.058 -0.096  -36.721 1.00 62.93 ? 465  TYR B CE2 1 
ATOM   7726 C CZ  . TYR B 1 465 ? -9.973  -0.099  -35.860 1.00 63.42 ? 465  TYR B CZ  1 
ATOM   7727 O OH  . TYR B 1 465 ? -8.723  -0.443  -36.346 1.00 62.65 ? 465  TYR B OH  1 
ATOM   7728 N N   . THR B 1 466 ? -15.645 0.835   -31.660 1.00 63.91 ? 466  THR B N   1 
ATOM   7729 C CA  . THR B 1 466 ? -16.653 1.503   -30.822 1.00 63.51 ? 466  THR B CA  1 
ATOM   7730 C C   . THR B 1 466 ? -16.998 2.890   -31.338 1.00 63.33 ? 466  THR B C   1 
ATOM   7731 O O   . THR B 1 466 ? -16.226 3.492   -32.083 1.00 63.57 ? 466  THR B O   1 
ATOM   7732 C CB  . THR B 1 466 ? -16.213 1.625   -29.340 1.00 63.70 ? 466  THR B CB  1 
ATOM   7733 O OG1 . THR B 1 466 ? -15.262 2.694   -29.186 1.00 63.57 ? 466  THR B OG1 1 
ATOM   7734 C CG2 . THR B 1 466 ? -15.631 0.314   -28.833 1.00 63.19 ? 466  THR B CG2 1 
ATOM   7735 N N   . THR B 1 467 ? -18.155 3.403   -30.940 1.00 63.05 ? 467  THR B N   1 
ATOM   7736 C CA  . THR B 1 467 ? -18.622 4.684   -31.471 1.00 62.90 ? 467  THR B CA  1 
ATOM   7737 C C   . THR B 1 467 ? -17.747 5.868   -31.012 1.00 62.49 ? 467  THR B C   1 
ATOM   7738 O O   . THR B 1 467 ? -17.617 6.870   -31.725 1.00 62.42 ? 467  THR B O   1 
ATOM   7739 C CB  . THR B 1 467 ? -20.140 4.918   -31.203 1.00 62.86 ? 467  THR B CB  1 
ATOM   7740 O OG1 . THR B 1 467 ? -20.602 6.004   -32.012 1.00 63.60 ? 467  THR B OG1 1 
ATOM   7741 C CG2 . THR B 1 467 ? -20.425 5.225   -29.735 1.00 63.13 ? 467  THR B CG2 1 
ATOM   7742 N N   . GLU B 1 468 ? -17.145 5.726   -29.829 1.00 61.87 ? 468  GLU B N   1 
ATOM   7743 C CA  . GLU B 1 468 ? -16.198 6.698   -29.285 1.00 61.33 ? 468  GLU B CA  1 
ATOM   7744 C C   . GLU B 1 468 ? -14.889 6.709   -30.104 1.00 60.21 ? 468  GLU B C   1 
ATOM   7745 O O   . GLU B 1 468 ? -14.317 7.771   -30.372 1.00 59.88 ? 468  GLU B O   1 
ATOM   7746 C CB  . GLU B 1 468 ? -15.924 6.399   -27.799 1.00 61.83 ? 468  GLU B CB  1 
ATOM   7747 C CG  . GLU B 1 468 ? -17.166 6.483   -26.872 1.00 64.66 ? 468  GLU B CG  1 
ATOM   7748 C CD  . GLU B 1 468 ? -17.867 5.121   -26.612 1.00 68.15 ? 468  GLU B CD  1 
ATOM   7749 O OE1 . GLU B 1 468 ? -18.028 4.311   -27.557 1.00 69.32 ? 468  GLU B OE1 1 
ATOM   7750 O OE2 . GLU B 1 468 ? -18.267 4.860   -25.446 1.00 69.43 ? 468  GLU B OE2 1 
ATOM   7751 N N   . GLU B 1 469 ? -14.441 5.521   -30.510 1.00 58.98 ? 469  GLU B N   1 
ATOM   7752 C CA  . GLU B 1 469 ? -13.264 5.354   -31.365 1.00 57.71 ? 469  GLU B CA  1 
ATOM   7753 C C   . GLU B 1 469 ? -13.410 6.019   -32.741 1.00 57.29 ? 469  GLU B C   1 
ATOM   7754 O O   . GLU B 1 469 ? -12.433 6.529   -33.304 1.00 57.35 ? 469  GLU B O   1 
ATOM   7755 C CB  . GLU B 1 469 ? -12.927 3.871   -31.515 1.00 57.51 ? 469  GLU B CB  1 
ATOM   7756 C CG  . GLU B 1 469 ? -12.146 3.283   -30.342 1.00 56.85 ? 469  GLU B CG  1 
ATOM   7757 C CD  . GLU B 1 469 ? -11.910 1.784   -30.487 1.00 57.46 ? 469  GLU B CD  1 
ATOM   7758 O OE1 . GLU B 1 469 ? -12.758 1.108   -31.105 1.00 58.50 ? 469  GLU B OE1 1 
ATOM   7759 O OE2 . GLU B 1 469 ? -10.885 1.265   -29.982 1.00 56.67 ? 469  GLU B OE2 1 
ATOM   7760 N N   . ARG B 1 470 ? -14.627 6.017   -33.275 1.00 56.58 ? 470  ARG B N   1 
ATOM   7761 C CA  . ARG B 1 470 ? -14.923 6.665   -34.541 1.00 56.13 ? 470  ARG B CA  1 
ATOM   7762 C C   . ARG B 1 470 ? -14.786 8.181   -34.359 1.00 55.27 ? 470  ARG B C   1 
ATOM   7763 O O   . ARG B 1 470 ? -14.219 8.870   -35.199 1.00 54.90 ? 470  ARG B O   1 
ATOM   7764 C CB  . ARG B 1 470 ? -16.331 6.258   -34.996 1.00 56.80 ? 470  ARG B CB  1 
ATOM   7765 C CG  . ARG B 1 470 ? -16.787 6.746   -36.369 1.00 59.81 ? 470  ARG B CG  1 
ATOM   7766 C CD  . ARG B 1 470 ? -17.614 8.044   -36.287 1.00 65.08 ? 470  ARG B CD  1 
ATOM   7767 N NE  . ARG B 1 470 ? -18.980 7.838   -35.771 1.00 69.41 ? 470  ARG B NE  1 
ATOM   7768 C CZ  . ARG B 1 470 ? -19.844 8.817   -35.470 1.00 70.59 ? 470  ARG B CZ  1 
ATOM   7769 N NH1 . ARG B 1 470 ? -19.511 10.102  -35.622 1.00 70.29 ? 470  ARG B NH1 1 
ATOM   7770 N NH2 . ARG B 1 470 ? -21.050 8.510   -35.007 1.00 70.75 ? 470  ARG B NH2 1 
ATOM   7771 N N   . ILE B 1 471 ? -15.292 8.687   -33.239 1.00 54.55 ? 471  ILE B N   1 
ATOM   7772 C CA  . ILE B 1 471 ? -15.227 10.120  -32.916 1.00 53.59 ? 471  ILE B CA  1 
ATOM   7773 C C   . ILE B 1 471 ? -13.771 10.555  -32.688 1.00 52.61 ? 471  ILE B C   1 
ATOM   7774 O O   . ILE B 1 471 ? -13.344 11.620  -33.152 1.00 52.28 ? 471  ILE B O   1 
ATOM   7775 C CB  . ILE B 1 471 ? -16.136 10.452  -31.682 1.00 53.88 ? 471  ILE B CB  1 
ATOM   7776 C CG1 . ILE B 1 471 ? -17.605 10.488  -32.108 1.00 54.26 ? 471  ILE B CG1 1 
ATOM   7777 C CG2 . ILE B 1 471 ? -15.722 11.771  -30.988 1.00 53.18 ? 471  ILE B CG2 1 
ATOM   7778 C CD1 . ILE B 1 471 ? -18.585 10.215  -30.960 1.00 55.70 ? 471  ILE B CD1 1 
ATOM   7779 N N   . PHE B 1 472 ? -13.023 9.712   -31.981 1.00 51.61 ? 472  PHE B N   1 
ATOM   7780 C CA  . PHE B 1 472 ? -11.579 9.874   -31.809 1.00 51.00 ? 472  PHE B CA  1 
ATOM   7781 C C   . PHE B 1 472 ? -10.840 9.939   -33.154 1.00 50.71 ? 472  PHE B C   1 
ATOM   7782 O O   . PHE B 1 472 ? -10.068 10.870  -33.391 1.00 50.47 ? 472  PHE B O   1 
ATOM   7783 C CB  . PHE B 1 472 ? -11.041 8.742   -30.931 1.00 50.74 ? 472  PHE B CB  1 
ATOM   7784 C CG  . PHE B 1 472 ? -9.590  8.860   -30.587 1.00 50.27 ? 472  PHE B CG  1 
ATOM   7785 C CD1 . PHE B 1 472 ? -9.020  10.093  -30.293 1.00 50.07 ? 472  PHE B CD1 1 
ATOM   7786 C CD2 . PHE B 1 472 ? -8.798  7.719   -30.520 1.00 49.06 ? 472  PHE B CD2 1 
ATOM   7787 C CE1 . PHE B 1 472 ? -7.679  10.191  -29.966 1.00 50.24 ? 472  PHE B CE1 1 
ATOM   7788 C CE2 . PHE B 1 472 ? -7.468  7.796   -30.194 1.00 49.69 ? 472  PHE B CE2 1 
ATOM   7789 C CZ  . PHE B 1 472 ? -6.897  9.035   -29.911 1.00 50.60 ? 472  PHE B CZ  1 
ATOM   7790 N N   . ALA B 1 473 ? -11.099 8.969   -34.037 1.00 50.44 ? 473  ALA B N   1 
ATOM   7791 C CA  . ALA B 1 473 ? -10.484 8.955   -35.368 1.00 50.10 ? 473  ALA B CA  1 
ATOM   7792 C C   . ALA B 1 473 ? -10.718 10.273  -36.091 1.00 50.25 ? 473  ALA B C   1 
ATOM   7793 O O   . ALA B 1 473 ? -9.800  10.821  -36.717 1.00 50.73 ? 473  ALA B O   1 
ATOM   7794 C CB  . ALA B 1 473 ? -11.009 7.797   -36.196 1.00 49.81 ? 473  ALA B CB  1 
ATOM   7795 N N   . GLN B 1 474 ? -11.942 10.787  -35.996 1.00 49.85 ? 474  GLN B N   1 
ATOM   7796 C CA  . GLN B 1 474 ? -12.310 12.025  -36.681 1.00 50.07 ? 474  GLN B CA  1 
ATOM   7797 C C   . GLN B 1 474 ? -11.487 13.204  -36.161 1.00 49.25 ? 474  GLN B C   1 
ATOM   7798 O O   . GLN B 1 474 ? -11.044 14.057  -36.940 1.00 49.47 ? 474  GLN B O   1 
ATOM   7799 C CB  . GLN B 1 474 ? -13.830 12.280  -36.589 1.00 49.96 ? 474  GLN B CB  1 
ATOM   7800 C CG  . GLN B 1 474 ? -14.672 11.292  -37.436 1.00 50.78 ? 474  GLN B CG  1 
ATOM   7801 C CD  . GLN B 1 474 ? -16.204 11.390  -37.216 1.00 51.29 ? 474  GLN B CD  1 
ATOM   7802 O OE1 . GLN B 1 474 ? -16.701 11.254  -36.099 1.00 53.22 ? 474  GLN B OE1 1 
ATOM   7803 N NE2 . GLN B 1 474 ? -16.944 11.606  -38.301 1.00 52.09 ? 474  GLN B NE2 1 
ATOM   7804 N N   . ARG B 1 475 ? -11.266 13.221  -34.848 1.00 48.63 ? 475  ARG B N   1 
ATOM   7805 C CA  . ARG B 1 475 ? -10.405 14.202  -34.206 1.00 47.93 ? 475  ARG B CA  1 
ATOM   7806 C C   . ARG B 1 475 ? -8.981  14.142  -34.757 1.00 47.35 ? 475  ARG B C   1 
ATOM   7807 O O   . ARG B 1 475 ? -8.390  15.181  -35.069 1.00 46.96 ? 475  ARG B O   1 
ATOM   7808 C CB  . ARG B 1 475 ? -10.375 13.991  -32.688 1.00 47.95 ? 475  ARG B CB  1 
ATOM   7809 C CG  . ARG B 1 475 ? -11.466 14.734  -31.889 1.00 49.10 ? 475  ARG B CG  1 
ATOM   7810 C CD  . ARG B 1 475 ? -11.375 14.422  -30.370 1.00 48.38 ? 475  ARG B CD  1 
ATOM   7811 N NE  . ARG B 1 475 ? -10.096 14.892  -29.840 1.00 47.22 ? 475  ARG B NE  1 
ATOM   7812 C CZ  . ARG B 1 475 ? -9.368  14.282  -28.910 1.00 44.95 ? 475  ARG B CZ  1 
ATOM   7813 N NH1 . ARG B 1 475 ? -9.766  13.140  -28.360 1.00 40.95 ? 475  ARG B NH1 1 
ATOM   7814 N NH2 . ARG B 1 475 ? -8.210  14.825  -28.547 1.00 44.73 ? 475  ARG B NH2 1 
ATOM   7815 N N   . LEU B 1 476 ? -8.439  12.934  -34.892 1.00 46.53 ? 476  LEU B N   1 
ATOM   7816 C CA  . LEU B 1 476 ? -7.044  12.791  -35.313 1.00 46.30 ? 476  LEU B CA  1 
ATOM   7817 C C   . LEU B 1 476 ? -6.828  13.174  -36.767 1.00 46.31 ? 476  LEU B C   1 
ATOM   7818 O O   . LEU B 1 476 ? -5.808  13.782  -37.103 1.00 45.96 ? 476  LEU B O   1 
ATOM   7819 C CB  . LEU B 1 476 ? -6.518  11.386  -35.028 1.00 46.34 ? 476  LEU B CB  1 
ATOM   7820 C CG  . LEU B 1 476 ? -6.649  10.933  -33.575 1.00 45.77 ? 476  LEU B CG  1 
ATOM   7821 C CD1 . LEU B 1 476 ? -6.105  9.546   -33.440 1.00 47.11 ? 476  LEU B CD1 1 
ATOM   7822 C CD2 . LEU B 1 476 ? -5.929  11.877  -32.627 1.00 45.24 ? 476  LEU B CD2 1 
ATOM   7823 N N   . MET B 1 477 ? -7.801  12.847  -37.617 1.00 46.28 ? 477  MET B N   1 
ATOM   7824 C CA  . MET B 1 477 ? -7.719  13.185  -39.032 1.00 46.75 ? 477  MET B CA  1 
ATOM   7825 C C   . MET B 1 477 ? -7.719  14.699  -39.158 1.00 46.56 ? 477  MET B C   1 
ATOM   7826 O O   . MET B 1 477 ? -7.127  15.265  -40.083 1.00 46.57 ? 477  MET B O   1 
ATOM   7827 C CB  . MET B 1 477 ? -8.898  12.590  -39.824 1.00 46.65 ? 477  MET B CB  1 
ATOM   7828 C CG  . MET B 1 477 ? -8.964  11.035  -39.933 1.00 47.39 ? 477  MET B CG  1 
ATOM   7829 S SD  . MET B 1 477 ? -10.596 10.396  -40.487 1.00 48.76 ? 477  MET B SD  1 
ATOM   7830 C CE  . MET B 1 477 ? -10.605 10.872  -42.200 1.00 46.24 ? 477  MET B CE  1 
ATOM   7831 N N   . LYS B 1 478 ? -8.391  15.346  -38.211 1.00 46.37 ? 478  LYS B N   1 
ATOM   7832 C CA  . LYS B 1 478 ? -8.503  16.805  -38.185 1.00 45.88 ? 478  LYS B CA  1 
ATOM   7833 C C   . LYS B 1 478 ? -7.201  17.485  -37.779 1.00 44.44 ? 478  LYS B C   1 
ATOM   7834 O O   . LYS B 1 478 ? -6.817  18.490  -38.382 1.00 44.02 ? 478  LYS B O   1 
ATOM   7835 C CB  . LYS B 1 478 ? -9.651  17.245  -37.264 1.00 46.32 ? 478  LYS B CB  1 
ATOM   7836 C CG  . LYS B 1 478 ? -10.910 17.692  -37.991 1.00 48.93 ? 478  LYS B CG  1 
ATOM   7837 C CD  . LYS B 1 478 ? -10.900 19.214  -38.224 1.00 52.13 ? 478  LYS B CD  1 
ATOM   7838 C CE  . LYS B 1 478 ? -12.047 19.664  -39.141 1.00 54.01 ? 478  LYS B CE  1 
ATOM   7839 N NZ  . LYS B 1 478 ? -11.704 19.610  -40.598 1.00 53.15 ? 478  LYS B NZ  1 
ATOM   7840 N N   . TYR B 1 479 ? -6.530  16.947  -36.761 1.00 43.25 ? 479  TYR B N   1 
ATOM   7841 C CA  . TYR B 1 479 ? -5.248  17.504  -36.321 1.00 42.45 ? 479  TYR B CA  1 
ATOM   7842 C C   . TYR B 1 479 ? -4.258  17.384  -37.463 1.00 41.94 ? 479  TYR B C   1 
ATOM   7843 O O   . TYR B 1 479 ? -3.606  18.363  -37.848 1.00 42.27 ? 479  TYR B O   1 
ATOM   7844 C CB  . TYR B 1 479 ? -4.690  16.755  -35.111 1.00 42.61 ? 479  TYR B CB  1 
ATOM   7845 C CG  . TYR B 1 479 ? -5.478  16.884  -33.834 1.00 42.26 ? 479  TYR B CG  1 
ATOM   7846 C CD1 . TYR B 1 479 ? -6.040  18.107  -33.445 1.00 42.64 ? 479  TYR B CD1 1 
ATOM   7847 C CD2 . TYR B 1 479 ? -5.617  15.794  -32.976 1.00 41.88 ? 479  TYR B CD2 1 
ATOM   7848 C CE1 . TYR B 1 479 ? -6.769  18.220  -32.255 1.00 41.76 ? 479  TYR B CE1 1 
ATOM   7849 C CE2 . TYR B 1 479 ? -6.326  15.899  -31.785 1.00 42.28 ? 479  TYR B CE2 1 
ATOM   7850 C CZ  . TYR B 1 479 ? -6.903  17.112  -31.435 1.00 42.65 ? 479  TYR B CZ  1 
ATOM   7851 O OH  . TYR B 1 479 ? -7.611  17.210  -30.254 1.00 43.89 ? 479  TYR B OH  1 
ATOM   7852 N N   . TRP B 1 480 ? -4.186  16.180  -38.026 1.00 41.32 ? 480  TRP B N   1 
ATOM   7853 C CA  . TRP B 1 480 ? -3.239  15.862  -39.097 1.00 40.59 ? 480  TRP B CA  1 
ATOM   7854 C C   . TRP B 1 480 ? -3.467  16.714  -40.339 1.00 40.40 ? 480  TRP B C   1 
ATOM   7855 O O   . TRP B 1 480 ? -2.524  17.318  -40.860 1.00 40.52 ? 480  TRP B O   1 
ATOM   7856 C CB  . TRP B 1 480 ? -3.258  14.364  -39.409 1.00 39.43 ? 480  TRP B CB  1 
ATOM   7857 C CG  . TRP B 1 480 ? -2.164  13.577  -38.749 1.00 38.12 ? 480  TRP B CG  1 
ATOM   7858 C CD1 . TRP B 1 480 ? -1.155  12.905  -39.380 1.00 37.75 ? 480  TRP B CD1 1 
ATOM   7859 C CD2 . TRP B 1 480 ? -1.957  13.368  -37.343 1.00 38.31 ? 480  TRP B CD2 1 
ATOM   7860 N NE1 . TRP B 1 480 ? -0.333  12.300  -38.466 1.00 37.01 ? 480  TRP B NE1 1 
ATOM   7861 C CE2 . TRP B 1 480 ? -0.792  12.569  -37.207 1.00 37.83 ? 480  TRP B CE2 1 
ATOM   7862 C CE3 . TRP B 1 480 ? -2.624  13.787  -36.185 1.00 37.82 ? 480  TRP B CE3 1 
ATOM   7863 C CZ2 . TRP B 1 480 ? -0.292  12.171  -35.961 1.00 37.71 ? 480  TRP B CZ2 1 
ATOM   7864 C CZ3 . TRP B 1 480 ? -2.128  13.392  -34.948 1.00 37.70 ? 480  TRP B CZ3 1 
ATOM   7865 C CH2 . TRP B 1 480 ? -0.970  12.588  -34.848 1.00 38.45 ? 480  TRP B CH2 1 
ATOM   7866 N N   . THR B 1 481 ? -4.711  16.789  -40.802 1.00 40.27 ? 481  THR B N   1 
ATOM   7867 C CA  . THR B 1 481 ? -5.016  17.596  -41.984 1.00 40.34 ? 481  THR B CA  1 
ATOM   7868 C C   . THR B 1 481 ? -4.985  19.098  -41.702 1.00 40.24 ? 481  THR B C   1 
ATOM   7869 O O   . THR B 1 481 ? -4.664  19.884  -42.593 1.00 40.97 ? 481  THR B O   1 
ATOM   7870 C CB  . THR B 1 481 ? -6.361  17.225  -42.613 1.00 40.37 ? 481  THR B CB  1 
ATOM   7871 O OG1 . THR B 1 481 ? -7.338  17.097  -41.579 1.00 41.85 ? 481  THR B OG1 1 
ATOM   7872 C CG2 . THR B 1 481 ? -6.257  15.904  -43.378 1.00 40.99 ? 481  THR B CG2 1 
ATOM   7873 N N   . ASN B 1 482 ? -5.314  19.517  -40.483 1.00 40.04 ? 482  ASN B N   1 
ATOM   7874 C CA  . ASN B 1 482 ? -5.118  20.934  -40.137 1.00 40.39 ? 482  ASN B CA  1 
ATOM   7875 C C   . ASN B 1 482 ? -3.670  21.291  -40.155 1.00 40.21 ? 482  ASN B C   1 
ATOM   7876 O O   . ASN B 1 482 ? -3.294  22.342  -40.689 1.00 39.91 ? 482  ASN B O   1 
ATOM   7877 C CB  . ASN B 1 482 ? -5.716  21.323  -38.788 1.00 40.46 ? 482  ASN B CB  1 
ATOM   7878 C CG  . ASN B 1 482 ? -7.174  21.612  -38.883 1.00 40.91 ? 482  ASN B CG  1 
ATOM   7879 O OD1 . ASN B 1 482 ? -7.662  22.059  -39.924 1.00 43.24 ? 482  ASN B OD1 1 
ATOM   7880 N ND2 . ASN B 1 482 ? -7.892  21.349  -37.811 1.00 42.08 ? 482  ASN B ND2 1 
ATOM   7881 N N   . PHE B 1 483 ? -2.866  20.407  -39.570 1.00 40.07 ? 483  PHE B N   1 
ATOM   7882 C CA  . PHE B 1 483 ? -1.432  20.558  -39.645 1.00 40.60 ? 483  PHE B CA  1 
ATOM   7883 C C   . PHE B 1 483 ? -0.955  20.606  -41.109 1.00 41.34 ? 483  PHE B C   1 
ATOM   7884 O O   . PHE B 1 483 ? -0.165  21.482  -41.474 1.00 42.15 ? 483  PHE B O   1 
ATOM   7885 C CB  . PHE B 1 483 ? -0.715  19.479  -38.833 1.00 40.26 ? 483  PHE B CB  1 
ATOM   7886 C CG  . PHE B 1 483 ? 0.759   19.497  -39.011 1.00 39.94 ? 483  PHE B CG  1 
ATOM   7887 C CD1 . PHE B 1 483 ? 1.545   20.385  -38.276 1.00 39.20 ? 483  PHE B CD1 1 
ATOM   7888 C CD2 . PHE B 1 483 ? 1.364   18.663  -39.944 1.00 38.41 ? 483  PHE B CD2 1 
ATOM   7889 C CE1 . PHE B 1 483 ? 2.910   20.424  -38.442 1.00 38.30 ? 483  PHE B CE1 1 
ATOM   7890 C CE2 . PHE B 1 483 ? 2.732   18.695  -40.132 1.00 38.75 ? 483  PHE B CE2 1 
ATOM   7891 C CZ  . PHE B 1 483 ? 3.513   19.575  -39.376 1.00 39.85 ? 483  PHE B CZ  1 
ATOM   7892 N N   . ALA B 1 484 ? -1.453  19.709  -41.961 1.00 41.80 ? 484  ALA B N   1 
ATOM   7893 C CA  . ALA B 1 484 ? -1.080  19.748  -43.391 1.00 42.19 ? 484  ALA B CA  1 
ATOM   7894 C C   . ALA B 1 484 ? -1.451  21.079  -44.060 1.00 42.68 ? 484  ALA B C   1 
ATOM   7895 O O   . ALA B 1 484 ? -0.668  21.644  -44.846 1.00 42.24 ? 484  ALA B O   1 
ATOM   7896 C CB  . ALA B 1 484 ? -1.705  18.572  -44.155 1.00 41.71 ? 484  ALA B CB  1 
ATOM   7897 N N   . ARG B 1 485 ? -2.653  21.562  -43.747 1.00 43.34 ? 485  ARG B N   1 
ATOM   7898 C CA  . ARG B 1 485 ? -3.175  22.800  -44.336 1.00 44.83 ? 485  ARG B CA  1 
ATOM   7899 C C   . ARG B 1 485 ? -2.383  24.038  -43.923 1.00 44.40 ? 485  ARG B C   1 
ATOM   7900 O O   . ARG B 1 485 ? -2.117  24.892  -44.756 1.00 44.38 ? 485  ARG B O   1 
ATOM   7901 C CB  . ARG B 1 485 ? -4.660  22.999  -43.965 1.00 44.61 ? 485  ARG B CB  1 
ATOM   7902 C CG  . ARG B 1 485 ? -5.647  22.264  -44.862 1.00 46.68 ? 485  ARG B CG  1 
ATOM   7903 C CD  . ARG B 1 485 ? -7.123  22.540  -44.470 1.00 46.68 ? 485  ARG B CD  1 
ATOM   7904 N NE  . ARG B 1 485 ? -7.539  21.714  -43.340 1.00 49.47 ? 485  ARG B NE  1 
ATOM   7905 C CZ  . ARG B 1 485 ? -8.024  20.478  -43.448 1.00 51.66 ? 485  ARG B CZ  1 
ATOM   7906 N NH1 . ARG B 1 485 ? -8.178  19.930  -44.659 1.00 51.10 ? 485  ARG B NH1 1 
ATOM   7907 N NH2 . ARG B 1 485 ? -8.368  19.794  -42.342 1.00 50.94 ? 485  ARG B NH2 1 
ATOM   7908 N N   . THR B 1 486 ? -2.011  24.117  -42.640 1.00 44.74 ? 486  THR B N   1 
ATOM   7909 C CA  . THR B 1 486 ? -1.592  25.380  -42.016 1.00 45.09 ? 486  THR B CA  1 
ATOM   7910 C C   . THR B 1 486 ? -0.255  25.330  -41.268 1.00 45.28 ? 486  THR B C   1 
ATOM   7911 O O   . THR B 1 486 ? 0.317   26.381  -40.952 1.00 45.11 ? 486  THR B O   1 
ATOM   7912 C CB  . THR B 1 486 ? -2.653  25.891  -40.996 1.00 45.30 ? 486  THR B CB  1 
ATOM   7913 O OG1 . THR B 1 486 ? -2.667  25.039  -39.843 1.00 45.66 ? 486  THR B OG1 1 
ATOM   7914 C CG2 . THR B 1 486 ? -4.073  25.955  -41.604 1.00 44.86 ? 486  THR B CG2 1 
ATOM   7915 N N   . GLY B 1 487 ? 0.231   24.125  -40.965 1.00 45.18 ? 487  GLY B N   1 
ATOM   7916 C CA  . GLY B 1 487 ? 1.443   23.970  -40.153 1.00 45.23 ? 487  GLY B CA  1 
ATOM   7917 C C   . GLY B 1 487 ? 1.124   23.971  -38.671 1.00 45.79 ? 487  GLY B C   1 
ATOM   7918 O O   . GLY B 1 487 ? 2.032   23.903  -37.840 1.00 45.36 ? 487  GLY B O   1 
ATOM   7919 N N   . ASP B 1 488 ? -0.178  24.054  -38.359 1.00 46.24 ? 488  ASP B N   1 
ATOM   7920 C CA  . ASP B 1 488 ? -0.705  24.128  -37.004 1.00 46.71 ? 488  ASP B CA  1 
ATOM   7921 C C   . ASP B 1 488 ? -1.852  23.124  -36.911 1.00 47.30 ? 488  ASP B C   1 
ATOM   7922 O O   . ASP B 1 488 ? -2.799  23.215  -37.672 1.00 47.35 ? 488  ASP B O   1 
ATOM   7923 C CB  . ASP B 1 488 ? -1.201  25.564  -36.725 1.00 46.84 ? 488  ASP B CB  1 
ATOM   7924 C CG  . ASP B 1 488 ? -1.616  25.798  -35.267 1.00 46.69 ? 488  ASP B CG  1 
ATOM   7925 O OD1 . ASP B 1 488 ? -1.867  24.835  -34.518 1.00 47.48 ? 488  ASP B OD1 1 
ATOM   7926 O OD2 . ASP B 1 488 ? -1.708  26.971  -34.865 1.00 46.73 ? 488  ASP B OD2 1 
ATOM   7927 N N   . PRO B 1 489 ? -1.782  22.172  -35.968 1.00 48.26 ? 489  PRO B N   1 
ATOM   7928 C CA  . PRO B 1 489 ? -2.820  21.139  -35.867 1.00 49.47 ? 489  PRO B CA  1 
ATOM   7929 C C   . PRO B 1 489 ? -4.134  21.616  -35.245 1.00 51.03 ? 489  PRO B C   1 
ATOM   7930 O O   . PRO B 1 489 ? -5.111  20.870  -35.236 1.00 51.39 ? 489  PRO B O   1 
ATOM   7931 C CB  . PRO B 1 489 ? -2.173  20.090  -34.957 1.00 48.93 ? 489  PRO B CB  1 
ATOM   7932 C CG  . PRO B 1 489 ? -1.258  20.878  -34.092 1.00 48.41 ? 489  PRO B CG  1 
ATOM   7933 C CD  . PRO B 1 489 ? -0.744  22.006  -34.938 1.00 48.00 ? 489  PRO B CD  1 
ATOM   7934 N N   . ASN B 1 490 ? -4.150  22.829  -34.707 1.00 53.12 ? 490  ASN B N   1 
ATOM   7935 C CA  . ASN B 1 490 ? -5.341  23.356  -34.045 1.00 55.12 ? 490  ASN B CA  1 
ATOM   7936 C C   . ASN B 1 490 ? -6.408  23.811  -35.032 1.00 57.23 ? 490  ASN B C   1 
ATOM   7937 O O   . ASN B 1 490 ? -6.097  24.426  -36.058 1.00 57.38 ? 490  ASN B O   1 
ATOM   7938 C CB  . ASN B 1 490 ? -4.974  24.511  -33.111 1.00 54.33 ? 490  ASN B CB  1 
ATOM   7939 C CG  . ASN B 1 490 ? -4.257  24.050  -31.868 1.00 52.57 ? 490  ASN B CG  1 
ATOM   7940 O OD1 . ASN B 1 490 ? -4.851  23.424  -30.983 1.00 49.43 ? 490  ASN B OD1 1 
ATOM   7941 N ND2 . ASN B 1 490 ? -2.971  24.377  -31.780 1.00 49.83 ? 490  ASN B ND2 1 
ATOM   7942 N N   . ASP B 1 491 ? -7.661  23.508  -34.699 1.00 60.43 ? 491  ASP B N   1 
ATOM   7943 C CA  . ASP B 1 491 ? -8.828  23.879  -35.511 1.00 63.75 ? 491  ASP B CA  1 
ATOM   7944 C C   . ASP B 1 491 ? -8.994  25.404  -35.532 1.00 65.93 ? 491  ASP B C   1 
ATOM   7945 O O   . ASP B 1 491 ? -9.387  25.996  -34.518 1.00 66.15 ? 491  ASP B O   1 
ATOM   7946 C CB  . ASP B 1 491 ? -10.089 23.208  -34.943 1.00 63.94 ? 491  ASP B CB  1 
ATOM   7947 C CG  . ASP B 1 491 ? -11.095 22.815  -36.021 1.00 65.02 ? 491  ASP B CG  1 
ATOM   7948 O OD1 . ASP B 1 491 ? -11.231 23.539  -37.037 1.00 66.18 ? 491  ASP B OD1 1 
ATOM   7949 O OD2 . ASP B 1 491 ? -11.760 21.772  -35.839 1.00 65.68 ? 491  ASP B OD2 1 
ATOM   7950 N N   . PRO B 1 492 ? -8.715  26.040  -36.693 1.00 68.24 ? 492  PRO B N   1 
ATOM   7951 C CA  . PRO B 1 492 ? -8.553  27.500  -36.760 1.00 70.22 ? 492  PRO B CA  1 
ATOM   7952 C C   . PRO B 1 492 ? -9.881  28.251  -36.694 1.00 72.07 ? 492  PRO B C   1 
ATOM   7953 O O   . PRO B 1 492 ? -9.890  29.485  -36.634 1.00 72.10 ? 492  PRO B O   1 
ATOM   7954 C CB  . PRO B 1 492 ? -7.886  27.719  -38.129 1.00 70.21 ? 492  PRO B CB  1 
ATOM   7955 C CG  . PRO B 1 492 ? -8.392  26.584  -38.969 1.00 69.44 ? 492  PRO B CG  1 
ATOM   7956 C CD  . PRO B 1 492 ? -8.582  25.413  -38.026 1.00 68.56 ? 492  PRO B CD  1 
ATOM   7957 N N   . ARG B 1 493 ? -10.983 27.499  -36.716 1.00 74.14 ? 493  ARG B N   1 
ATOM   7958 C CA  . ARG B 1 493 ? -12.331 28.062  -36.666 1.00 76.44 ? 493  ARG B CA  1 
ATOM   7959 C C   . ARG B 1 493 ? -13.067 27.315  -35.553 1.00 76.80 ? 493  ARG B C   1 
ATOM   7960 O O   . ARG B 1 493 ? -14.207 26.854  -35.720 1.00 77.19 ? 493  ARG B O   1 
ATOM   7961 C CB  . ARG B 1 493 ? -13.059 27.909  -38.021 1.00 76.39 ? 493  ARG B CB  1 
ATOM   7962 C CG  . ARG B 1 493 ? -12.181 28.040  -39.290 1.00 77.84 ? 493  ARG B CG  1 
ATOM   7963 C CD  . ARG B 1 493 ? -12.867 27.413  -40.517 1.00 78.62 ? 493  ARG B CD  1 
ATOM   7964 N NE  . ARG B 1 493 ? -13.903 28.300  -41.064 1.00 84.16 ? 493  ARG B NE  1 
ATOM   7965 C CZ  . ARG B 1 493 ? -15.008 27.903  -41.701 1.00 84.94 ? 493  ARG B CZ  1 
ATOM   7966 N NH1 . ARG B 1 493 ? -15.263 26.610  -41.884 1.00 84.98 ? 493  ARG B NH1 1 
ATOM   7967 N NH2 . ARG B 1 493 ? -15.870 28.812  -42.147 1.00 85.55 ? 493  ARG B NH2 1 
ATOM   7968 N N   . ASP B 1 494 ? -12.377 27.175  -34.423 1.00 77.28 ? 494  ASP B N   1 
ATOM   7969 C CA  . ASP B 1 494 ? -12.922 26.522  -33.239 1.00 77.44 ? 494  ASP B CA  1 
ATOM   7970 C C   . ASP B 1 494 ? -12.230 27.081  -31.995 1.00 77.38 ? 494  ASP B C   1 
ATOM   7971 O O   . ASP B 1 494 ? -11.032 26.853  -31.770 1.00 77.47 ? 494  ASP B O   1 
ATOM   7972 C CB  . ASP B 1 494 ? -12.782 24.990  -33.346 1.00 77.44 ? 494  ASP B CB  1 
ATOM   7973 C CG  . ASP B 1 494 ? -12.838 24.286  -31.991 1.00 77.81 ? 494  ASP B CG  1 
ATOM   7974 O OD1 . ASP B 1 494 ? -13.945 24.157  -31.417 1.00 77.45 ? 494  ASP B OD1 1 
ATOM   7975 O OD2 . ASP B 1 494 ? -11.765 23.843  -31.513 1.00 78.02 ? 494  ASP B OD2 1 
ATOM   7976 N N   . SER B 1 495 ? -12.991 27.860  -31.226 1.00 77.29 ? 495  SER B N   1 
ATOM   7977 C CA  . SER B 1 495 ? -12.601 28.253  -29.874 1.00 77.14 ? 495  SER B CA  1 
ATOM   7978 C C   . SER B 1 495 ? -12.795 27.062  -28.925 1.00 76.83 ? 495  SER B C   1 
ATOM   7979 O O   . SER B 1 495 ? -13.629 26.179  -29.189 1.00 77.04 ? 495  SER B O   1 
ATOM   7980 C CB  . SER B 1 495 ? -13.433 29.446  -29.405 1.00 77.25 ? 495  SER B CB  1 
ATOM   7981 O OG  . SER B 1 495 ? -13.350 29.591  -27.992 1.00 77.59 ? 495  SER B OG  1 
ATOM   7982 N N   . LYS B 1 496 ? -12.035 27.046  -27.826 1.00 76.10 ? 496  LYS B N   1 
ATOM   7983 C CA  . LYS B 1 496 ? -12.035 25.926  -26.868 1.00 75.24 ? 496  LYS B CA  1 
ATOM   7984 C C   . LYS B 1 496 ? -11.454 24.646  -27.483 1.00 74.41 ? 496  LYS B C   1 
ATOM   7985 O O   . LYS B 1 496 ? -11.858 24.221  -28.587 1.00 74.36 ? 496  LYS B O   1 
ATOM   7986 C CB  . LYS B 1 496 ? -13.453 25.642  -26.333 1.00 75.35 ? 496  LYS B CB  1 
ATOM   7987 C CG  . LYS B 1 496 ? -13.519 25.062  -24.906 1.00 76.26 ? 496  LYS B CG  1 
ATOM   7988 C CD  . LYS B 1 496 ? -13.182 26.110  -23.813 1.00 77.06 ? 496  LYS B CD  1 
ATOM   7989 C CE  . LYS B 1 496 ? -14.040 27.393  -23.911 1.00 77.69 ? 496  LYS B CE  1 
ATOM   7990 N NZ  . LYS B 1 496 ? -15.483 27.217  -23.538 1.00 77.29 ? 496  LYS B NZ  1 
ATOM   7991 N N   . SER B 1 497 ? -10.500 24.039  -26.770 1.00 72.79 ? 497  SER B N   1 
ATOM   7992 C CA  . SER B 1 497 ? -10.033 22.690  -27.119 1.00 70.84 ? 497  SER B CA  1 
ATOM   7993 C C   . SER B 1 497 ? -9.715  21.788  -25.895 1.00 68.50 ? 497  SER B C   1 
ATOM   7994 O O   . SER B 1 497 ? -10.297 20.701  -25.777 1.00 68.57 ? 497  SER B O   1 
ATOM   7995 C CB  . SER B 1 497 ? -8.882  22.734  -28.144 1.00 71.58 ? 497  SER B CB  1 
ATOM   7996 O OG  . SER B 1 497 ? -8.903  23.931  -28.920 1.00 73.33 ? 497  SER B OG  1 
ATOM   7997 N N   . PRO B 1 498 ? -8.799  22.213  -24.987 1.00 65.87 ? 498  PRO B N   1 
ATOM   7998 C CA  . PRO B 1 498 ? -7.914  23.393  -24.973 1.00 63.40 ? 498  PRO B CA  1 
ATOM   7999 C C   . PRO B 1 498 ? -6.857  23.276  -26.072 1.00 60.47 ? 498  PRO B C   1 
ATOM   8000 O O   . PRO B 1 498 ? -6.708  22.205  -26.659 1.00 59.86 ? 498  PRO B O   1 
ATOM   8001 C CB  . PRO B 1 498 ? -7.255  23.323  -23.591 1.00 63.95 ? 498  PRO B CB  1 
ATOM   8002 C CG  . PRO B 1 498 ? -7.313  21.852  -23.212 1.00 64.92 ? 498  PRO B CG  1 
ATOM   8003 C CD  . PRO B 1 498 ? -8.619  21.378  -23.778 1.00 65.61 ? 498  PRO B CD  1 
ATOM   8004 N N   . GLN B 1 499 ? -6.143  24.359  -26.355 1.00 56.99 ? 499  GLN B N   1 
ATOM   8005 C CA  . GLN B 1 499 ? -5.238  24.378  -27.504 1.00 53.62 ? 499  GLN B CA  1 
ATOM   8006 C C   . GLN B 1 499 ? -4.009  23.466  -27.336 1.00 50.62 ? 499  GLN B C   1 
ATOM   8007 O O   . GLN B 1 499 ? -3.515  23.243  -26.241 1.00 49.55 ? 499  GLN B O   1 
ATOM   8008 C CB  . GLN B 1 499 ? -4.824  25.818  -27.857 1.00 54.27 ? 499  GLN B CB  1 
ATOM   8009 C CG  . GLN B 1 499 ? -5.994  26.743  -28.245 1.00 55.48 ? 499  GLN B CG  1 
ATOM   8010 C CD  . GLN B 1 499 ? -6.338  26.716  -29.739 1.00 58.70 ? 499  GLN B CD  1 
ATOM   8011 O OE1 . GLN B 1 499 ? -7.429  26.265  -30.137 1.00 57.25 ? 499  GLN B OE1 1 
ATOM   8012 N NE2 . GLN B 1 499 ? -5.410  27.223  -30.577 1.00 59.57 ? 499  GLN B NE2 1 
ATOM   8013 N N   . TRP B 1 500 ? -3.562  22.926  -28.460 1.00 47.52 ? 500  TRP B N   1 
ATOM   8014 C CA  . TRP B 1 500 ? -2.336  22.169  -28.562 1.00 44.92 ? 500  TRP B CA  1 
ATOM   8015 C C   . TRP B 1 500 ? -1.174  23.155  -28.719 1.00 42.87 ? 500  TRP B C   1 
ATOM   8016 O O   . TRP B 1 500 ? -1.013  23.754  -29.780 1.00 42.45 ? 500  TRP B O   1 
ATOM   8017 C CB  . TRP B 1 500 ? -2.422  21.278  -29.803 1.00 44.76 ? 500  TRP B CB  1 
ATOM   8018 C CG  . TRP B 1 500 ? -1.336  20.276  -29.940 1.00 44.07 ? 500  TRP B CG  1 
ATOM   8019 C CD1 . TRP B 1 500 ? -0.099  20.314  -29.371 1.00 43.00 ? 500  TRP B CD1 1 
ATOM   8020 C CD2 . TRP B 1 500 ? -1.379  19.085  -30.736 1.00 44.27 ? 500  TRP B CD2 1 
ATOM   8021 N NE1 . TRP B 1 500 ? 0.623   19.211  -29.746 1.00 43.59 ? 500  TRP B NE1 1 
ATOM   8022 C CE2 . TRP B 1 500 ? -0.135  18.446  -30.592 1.00 44.11 ? 500  TRP B CE2 1 
ATOM   8023 C CE3 . TRP B 1 500 ? -2.355  18.496  -31.555 1.00 44.21 ? 500  TRP B CE3 1 
ATOM   8024 C CZ2 . TRP B 1 500 ? 0.164   17.235  -31.230 1.00 44.98 ? 500  TRP B CZ2 1 
ATOM   8025 C CZ3 . TRP B 1 500 ? -2.057  17.295  -32.190 1.00 43.79 ? 500  TRP B CZ3 1 
ATOM   8026 C CH2 . TRP B 1 500 ? -0.809  16.681  -32.025 1.00 43.93 ? 500  TRP B CH2 1 
ATOM   8027 N N   . PRO B 1 501 ? -0.358  23.325  -27.673 1.00 40.96 ? 501  PRO B N   1 
ATOM   8028 C CA  . PRO B 1 501 ? 0.701   24.312  -27.761 1.00 40.38 ? 501  PRO B CA  1 
ATOM   8029 C C   . PRO B 1 501 ? 1.975   23.771  -28.426 1.00 39.63 ? 501  PRO B C   1 
ATOM   8030 O O   . PRO B 1 501 ? 2.245   22.564  -28.361 1.00 38.77 ? 501  PRO B O   1 
ATOM   8031 C CB  . PRO B 1 501 ? 0.961   24.663  -26.296 1.00 39.61 ? 501  PRO B CB  1 
ATOM   8032 C CG  . PRO B 1 501 ? 0.650   23.430  -25.560 1.00 40.21 ? 501  PRO B CG  1 
ATOM   8033 C CD  . PRO B 1 501 ? -0.346  22.634  -26.375 1.00 41.06 ? 501  PRO B CD  1 
ATOM   8034 N N   . PRO B 1 502 ? 2.745   24.661  -29.073 1.00 39.22 ? 502  PRO B N   1 
ATOM   8035 C CA  . PRO B 1 502 ? 4.049   24.301  -29.639 1.00 38.92 ? 502  PRO B CA  1 
ATOM   8036 C C   . PRO B 1 502 ? 4.988   23.708  -28.593 1.00 38.66 ? 502  PRO B C   1 
ATOM   8037 O O   . PRO B 1 502 ? 4.982   24.128  -27.440 1.00 38.60 ? 502  PRO B O   1 
ATOM   8038 C CB  . PRO B 1 502 ? 4.591   25.635  -30.153 1.00 38.85 ? 502  PRO B CB  1 
ATOM   8039 C CG  . PRO B 1 502 ? 3.366   26.452  -30.453 1.00 39.37 ? 502  PRO B CG  1 
ATOM   8040 C CD  . PRO B 1 502 ? 2.389   26.063  -29.360 1.00 39.28 ? 502  PRO B CD  1 
ATOM   8041 N N   . TYR B 1 503 ? 5.765   22.711  -28.987 1.00 38.19 ? 503  TYR B N   1 
ATOM   8042 C CA  . TYR B 1 503 ? 6.800   22.193  -28.113 1.00 38.32 ? 503  TYR B CA  1 
ATOM   8043 C C   . TYR B 1 503 ? 8.013   23.114  -28.241 1.00 38.89 ? 503  TYR B C   1 
ATOM   8044 O O   . TYR B 1 503 ? 8.320   23.578  -29.339 1.00 38.57 ? 503  TYR B O   1 
ATOM   8045 C CB  . TYR B 1 503 ? 7.140   20.743  -28.473 1.00 37.22 ? 503  TYR B CB  1 
ATOM   8046 C CG  . TYR B 1 503 ? 8.283   20.134  -27.682 1.00 36.73 ? 503  TYR B CG  1 
ATOM   8047 C CD1 . TYR B 1 503 ? 9.612   20.341  -28.059 1.00 34.26 ? 503  TYR B CD1 1 
ATOM   8048 C CD2 . TYR B 1 503 ? 8.030   19.316  -26.575 1.00 35.94 ? 503  TYR B CD2 1 
ATOM   8049 C CE1 . TYR B 1 503 ? 10.646  19.772  -27.335 1.00 35.27 ? 503  TYR B CE1 1 
ATOM   8050 C CE2 . TYR B 1 503 ? 9.052   18.749  -25.852 1.00 35.56 ? 503  TYR B CE2 1 
ATOM   8051 C CZ  . TYR B 1 503 ? 10.358  18.971  -26.237 1.00 35.92 ? 503  TYR B CZ  1 
ATOM   8052 O OH  . TYR B 1 503 ? 11.373  18.388  -25.510 1.00 36.04 ? 503  TYR B OH  1 
ATOM   8053 N N   . THR B 1 504 ? 8.673   23.380  -27.110 1.00 39.77 ? 504  THR B N   1 
ATOM   8054 C CA  . THR B 1 504 ? 9.781   24.334  -27.004 1.00 41.06 ? 504  THR B CA  1 
ATOM   8055 C C   . THR B 1 504 ? 10.711  23.778  -25.949 1.00 42.27 ? 504  THR B C   1 
ATOM   8056 O O   . THR B 1 504 ? 10.253  23.042  -25.072 1.00 43.06 ? 504  THR B O   1 
ATOM   8057 C CB  . THR B 1 504 ? 9.322   25.727  -26.482 1.00 41.02 ? 504  THR B CB  1 
ATOM   8058 O OG1 . THR B 1 504 ? 8.796   25.587  -25.160 1.00 41.25 ? 504  THR B OG1 1 
ATOM   8059 C CG2 . THR B 1 504 ? 8.271   26.400  -27.393 1.00 40.47 ? 504  THR B CG2 1 
ATOM   8060 N N   . THR B 1 505 ? 11.995  24.130  -25.991 1.00 42.98 ? 505  THR B N   1 
ATOM   8061 C CA  . THR B 1 505 ? 12.947  23.518  -25.052 1.00 44.01 ? 505  THR B CA  1 
ATOM   8062 C C   . THR B 1 505 ? 12.759  24.010  -23.628 1.00 44.16 ? 505  THR B C   1 
ATOM   8063 O O   . THR B 1 505 ? 12.937  23.243  -22.686 1.00 44.68 ? 505  THR B O   1 
ATOM   8064 C CB  . THR B 1 505 ? 14.447  23.673  -25.473 1.00 44.50 ? 505  THR B CB  1 
ATOM   8065 O OG1 . THR B 1 505 ? 14.785  25.060  -25.601 1.00 44.85 ? 505  THR B OG1 1 
ATOM   8066 C CG2 . THR B 1 505 ? 14.715  22.955  -26.784 1.00 44.01 ? 505  THR B CG2 1 
ATOM   8067 N N   . ALA B 1 506 ? 12.397  25.279  -23.474 1.00 44.16 ? 506  ALA B N   1 
ATOM   8068 C CA  . ALA B 1 506 ? 12.062  25.814  -22.155 1.00 44.36 ? 506  ALA B CA  1 
ATOM   8069 C C   . ALA B 1 506 ? 10.901  25.038  -21.510 1.00 44.51 ? 506  ALA B C   1 
ATOM   8070 O O   . ALA B 1 506 ? 11.103  24.341  -20.505 1.00 44.98 ? 506  ALA B O   1 
ATOM   8071 C CB  . ALA B 1 506 ? 11.710  27.310  -22.252 1.00 44.35 ? 506  ALA B CB  1 
ATOM   8072 N N   . ALA B 1 507 ? 9.701   25.159  -22.100 1.00 43.51 ? 507  ALA B N   1 
ATOM   8073 C CA  . ALA B 1 507 ? 8.469   24.670  -21.490 1.00 42.82 ? 507  ALA B CA  1 
ATOM   8074 C C   . ALA B 1 507 ? 8.192   23.188  -21.750 1.00 42.48 ? 507  ALA B C   1 
ATOM   8075 O O   . ALA B 1 507 ? 7.531   22.543  -20.952 1.00 42.44 ? 507  ALA B O   1 
ATOM   8076 C CB  . ALA B 1 507 ? 7.281   25.521  -21.944 1.00 42.85 ? 507  ALA B CB  1 
ATOM   8077 N N   . GLN B 1 508 ? 8.681   22.667  -22.872 1.00 42.01 ? 508  GLN B N   1 
ATOM   8078 C CA  . GLN B 1 508 ? 8.566   21.227  -23.217 1.00 42.03 ? 508  GLN B CA  1 
ATOM   8079 C C   . GLN B 1 508 ? 7.139   20.656  -23.242 1.00 41.17 ? 508  GLN B C   1 
ATOM   8080 O O   . GLN B 1 508 ? 6.903   19.489  -22.896 1.00 40.89 ? 508  GLN B O   1 
ATOM   8081 C CB  . GLN B 1 508 ? 9.468   20.370  -22.331 1.00 41.85 ? 508  GLN B CB  1 
ATOM   8082 C CG  . GLN B 1 508 ? 10.948  20.620  -22.542 1.00 43.01 ? 508  GLN B CG  1 
ATOM   8083 C CD  . GLN B 1 508 ? 11.787  19.925  -21.491 1.00 44.68 ? 508  GLN B CD  1 
ATOM   8084 O OE1 . GLN B 1 508 ? 11.875  18.691  -21.470 1.00 45.39 ? 508  GLN B OE1 1 
ATOM   8085 N NE2 . GLN B 1 508 ? 12.387  20.708  -20.594 1.00 44.35 ? 508  GLN B NE2 1 
ATOM   8086 N N   . GLN B 1 509 ? 6.202   21.477  -23.688 1.00 40.13 ? 509  GLN B N   1 
ATOM   8087 C CA  . GLN B 1 509 ? 4.804   21.072  -23.717 1.00 39.21 ? 509  GLN B CA  1 
ATOM   8088 C C   . GLN B 1 509 ? 4.458   20.122  -24.856 1.00 38.90 ? 509  GLN B C   1 
ATOM   8089 O O   . GLN B 1 509 ? 4.902   20.289  -25.994 1.00 38.16 ? 509  GLN B O   1 
ATOM   8090 C CB  . GLN B 1 509 ? 3.915   22.295  -23.766 1.00 38.88 ? 509  GLN B CB  1 
ATOM   8091 C CG  . GLN B 1 509 ? 3.990   23.140  -22.518 1.00 38.52 ? 509  GLN B CG  1 
ATOM   8092 C CD  . GLN B 1 509 ? 3.320   24.474  -22.711 1.00 38.98 ? 509  GLN B CD  1 
ATOM   8093 O OE1 . GLN B 1 509 ? 3.680   25.249  -23.605 1.00 38.30 ? 509  GLN B OE1 1 
ATOM   8094 N NE2 . GLN B 1 509 ? 2.325   24.750  -21.880 1.00 39.56 ? 509  GLN B NE2 1 
ATOM   8095 N N   . TYR B 1 510 ? 3.635   19.135  -24.521 1.00 38.92 ? 510  TYR B N   1 
ATOM   8096 C CA  . TYR B 1 510 ? 3.161   18.126  -25.470 1.00 38.70 ? 510  TYR B CA  1 
ATOM   8097 C C   . TYR B 1 510 ? 1.793   17.594  -25.032 1.00 38.58 ? 510  TYR B C   1 
ATOM   8098 O O   . TYR B 1 510 ? 1.437   17.675  -23.870 1.00 38.65 ? 510  TYR B O   1 
ATOM   8099 C CB  . TYR B 1 510 ? 4.178   16.980  -25.574 1.00 38.34 ? 510  TYR B CB  1 
ATOM   8100 C CG  . TYR B 1 510 ? 4.212   16.076  -24.374 1.00 37.85 ? 510  TYR B CG  1 
ATOM   8101 C CD1 . TYR B 1 510 ? 5.021   16.371  -23.273 1.00 37.78 ? 510  TYR B CD1 1 
ATOM   8102 C CD2 . TYR B 1 510 ? 3.439   14.908  -24.332 1.00 38.26 ? 510  TYR B CD2 1 
ATOM   8103 C CE1 . TYR B 1 510 ? 5.053   15.532  -22.165 1.00 37.20 ? 510  TYR B CE1 1 
ATOM   8104 C CE2 . TYR B 1 510 ? 3.462   14.058  -23.214 1.00 37.31 ? 510  TYR B CE2 1 
ATOM   8105 C CZ  . TYR B 1 510 ? 4.270   14.379  -22.146 1.00 38.31 ? 510  TYR B CZ  1 
ATOM   8106 O OH  . TYR B 1 510 ? 4.298   13.538  -21.055 1.00 40.63 ? 510  TYR B OH  1 
ATOM   8107 N N   . VAL B 1 511 ? 1.024   17.038  -25.951 1.00 38.81 ? 511  VAL B N   1 
ATOM   8108 C CA  . VAL B 1 511 ? -0.315  16.625  -25.593 1.00 39.22 ? 511  VAL B CA  1 
ATOM   8109 C C   . VAL B 1 511 ? -0.522  15.122  -25.637 1.00 39.73 ? 511  VAL B C   1 
ATOM   8110 O O   . VAL B 1 511 ? 0.104   14.401  -26.411 1.00 39.27 ? 511  VAL B O   1 
ATOM   8111 C CB  . VAL B 1 511 ? -1.371  17.302  -26.475 1.00 39.35 ? 511  VAL B CB  1 
ATOM   8112 C CG1 . VAL B 1 511 ? -1.259  18.815  -26.401 1.00 37.93 ? 511  VAL B CG1 1 
ATOM   8113 C CG2 . VAL B 1 511 ? -1.257  16.820  -27.900 1.00 40.69 ? 511  VAL B CG2 1 
ATOM   8114 N N   . SER B 1 512 ? -1.425  14.650  -24.792 1.00 40.78 ? 512  SER B N   1 
ATOM   8115 C CA  . SER B 1 512 ? -1.873  13.266  -24.868 1.00 41.25 ? 512  SER B CA  1 
ATOM   8116 C C   . SER B 1 512 ? -3.060  13.163  -25.828 1.00 41.62 ? 512  SER B C   1 
ATOM   8117 O O   . SER B 1 512 ? -4.010  13.959  -25.758 1.00 41.02 ? 512  SER B O   1 
ATOM   8118 C CB  . SER B 1 512 ? -2.277  12.776  -23.494 1.00 40.95 ? 512  SER B CB  1 
ATOM   8119 O OG  . SER B 1 512 ? -3.318  13.600  -23.023 1.00 42.41 ? 512  SER B OG  1 
ATOM   8120 N N   . LEU B 1 513 ? -2.975  12.198  -26.744 1.00 42.61 ? 513  LEU B N   1 
ATOM   8121 C CA  . LEU B 1 513 ? -4.083  11.828  -27.623 1.00 43.29 ? 513  LEU B CA  1 
ATOM   8122 C C   . LEU B 1 513 ? -4.695  10.543  -27.106 1.00 44.16 ? 513  LEU B C   1 
ATOM   8123 O O   . LEU B 1 513 ? -4.039  9.485   -27.060 1.00 44.31 ? 513  LEU B O   1 
ATOM   8124 C CB  . LEU B 1 513 ? -3.602  11.639  -29.061 1.00 43.23 ? 513  LEU B CB  1 
ATOM   8125 C CG  . LEU B 1 513 ? -2.850  12.831  -29.643 1.00 43.08 ? 513  LEU B CG  1 
ATOM   8126 C CD1 . LEU B 1 513 ? -2.275  12.498  -31.003 1.00 41.39 ? 513  LEU B CD1 1 
ATOM   8127 C CD2 . LEU B 1 513 ? -3.807  14.019  -29.716 1.00 42.47 ? 513  LEU B CD2 1 
ATOM   8128 N N   . ASN B 1 514 ? -5.945  10.655  -26.676 1.00 45.29 ? 514  ASN B N   1 
ATOM   8129 C CA  . ASN B 1 514 ? -6.714  9.524   -26.165 1.00 46.57 ? 514  ASN B CA  1 
ATOM   8130 C C   . ASN B 1 514 ? -8.182  9.913   -26.228 1.00 47.13 ? 514  ASN B C   1 
ATOM   8131 O O   . ASN B 1 514 ? -8.508  10.931  -26.840 1.00 47.37 ? 514  ASN B O   1 
ATOM   8132 C CB  . ASN B 1 514 ? -6.264  9.121   -24.754 1.00 46.34 ? 514  ASN B CB  1 
ATOM   8133 C CG  . ASN B 1 514 ? -6.370  10.256  -23.759 1.00 47.87 ? 514  ASN B CG  1 
ATOM   8134 O OD1 . ASN B 1 514 ? -7.331  11.032  -23.778 1.00 50.57 ? 514  ASN B OD1 1 
ATOM   8135 N ND2 . ASN B 1 514 ? -5.378  10.365  -22.876 1.00 48.88 ? 514  ASN B ND2 1 
ATOM   8136 N N   . LEU B 1 515 ? -9.071  9.127   -25.622 1.00 48.18 ? 515  LEU B N   1 
ATOM   8137 C CA  . LEU B 1 515 ? -10.511 9.397   -25.777 1.00 49.06 ? 515  LEU B CA  1 
ATOM   8138 C C   . LEU B 1 515 ? -10.978 10.667  -25.041 1.00 49.60 ? 515  LEU B C   1 
ATOM   8139 O O   . LEU B 1 515 ? -11.907 11.339  -25.503 1.00 49.69 ? 515  LEU B O   1 
ATOM   8140 C CB  . LEU B 1 515 ? -11.347 8.193   -25.376 1.00 49.00 ? 515  LEU B CB  1 
ATOM   8141 C CG  . LEU B 1 515 ? -11.104 6.917   -26.190 1.00 50.20 ? 515  LEU B CG  1 
ATOM   8142 C CD1 . LEU B 1 515 ? -11.823 5.722   -25.550 1.00 50.08 ? 515  LEU B CD1 1 
ATOM   8143 C CD2 . LEU B 1 515 ? -11.490 7.078   -27.665 1.00 49.09 ? 515  LEU B CD2 1 
ATOM   8144 N N   . LYS B 1 516 ? -10.328 10.988  -23.918 1.00 50.01 ? 516  LYS B N   1 
ATOM   8145 C CA  . LYS B 1 516 ? -10.563 12.249  -23.188 1.00 50.93 ? 516  LYS B CA  1 
ATOM   8146 C C   . LYS B 1 516 ? -9.997  13.418  -24.012 1.00 50.59 ? 516  LYS B C   1 
ATOM   8147 O O   . LYS B 1 516 ? -9.070  13.217  -24.802 1.00 51.07 ? 516  LYS B O   1 
ATOM   8148 C CB  . LYS B 1 516 ? -9.915  12.205  -21.793 1.00 50.51 ? 516  LYS B CB  1 
ATOM   8149 C CG  . LYS B 1 516 ? -10.269 10.953  -20.958 1.00 51.80 ? 516  LYS B CG  1 
ATOM   8150 C CD  . LYS B 1 516 ? -9.670  10.994  -19.522 1.00 52.70 ? 516  LYS B CD  1 
ATOM   8151 C CE  . LYS B 1 516 ? -8.236  10.357  -19.436 1.00 56.17 ? 516  LYS B CE  1 
ATOM   8152 N NZ  . LYS B 1 516 ? -7.457  10.670  -18.165 1.00 54.32 ? 516  LYS B NZ  1 
ATOM   8153 N N   . PRO B 1 517 ? -10.552 14.633  -23.851 1.00 50.22 ? 517  PRO B N   1 
ATOM   8154 C CA  . PRO B 1 517 ? -10.008 15.820  -24.546 1.00 49.84 ? 517  PRO B CA  1 
ATOM   8155 C C   . PRO B 1 517 ? -8.507  16.064  -24.291 1.00 49.11 ? 517  PRO B C   1 
ATOM   8156 O O   . PRO B 1 517 ? -7.972  15.646  -23.253 1.00 48.99 ? 517  PRO B O   1 
ATOM   8157 C CB  . PRO B 1 517 ? -10.808 16.992  -23.940 1.00 50.12 ? 517  PRO B CB  1 
ATOM   8158 C CG  . PRO B 1 517 ? -12.055 16.387  -23.401 1.00 50.10 ? 517  PRO B CG  1 
ATOM   8159 C CD  . PRO B 1 517 ? -11.715 14.966  -23.006 1.00 50.45 ? 517  PRO B CD  1 
ATOM   8160 N N   . LEU B 1 518 ? -7.858  16.747  -25.234 1.00 48.15 ? 518  LEU B N   1 
ATOM   8161 C CA  . LEU B 1 518 ? -6.454  17.128  -25.133 1.00 47.08 ? 518  LEU B CA  1 
ATOM   8162 C C   . LEU B 1 518 ? -6.078  17.618  -23.752 1.00 46.96 ? 518  LEU B C   1 
ATOM   8163 O O   . LEU B 1 518 ? -6.758  18.468  -23.166 1.00 46.58 ? 518  LEU B O   1 
ATOM   8164 C CB  . LEU B 1 518 ? -6.116  18.245  -26.126 1.00 46.99 ? 518  LEU B CB  1 
ATOM   8165 C CG  . LEU B 1 518 ? -5.870  17.963  -27.601 1.00 46.18 ? 518  LEU B CG  1 
ATOM   8166 C CD1 . LEU B 1 518 ? -5.380  19.233  -28.268 1.00 47.19 ? 518  LEU B CD1 1 
ATOM   8167 C CD2 . LEU B 1 518 ? -4.866  16.871  -27.786 1.00 45.22 ? 518  LEU B CD2 1 
ATOM   8168 N N   . GLU B 1 519 ? -4.969  17.087  -23.259 1.00 46.44 ? 519  GLU B N   1 
ATOM   8169 C CA  . GLU B 1 519 ? -4.397  17.485  -21.996 1.00 46.45 ? 519  GLU B CA  1 
ATOM   8170 C C   . GLU B 1 519 ? -2.935  17.886  -22.289 1.00 45.49 ? 519  GLU B C   1 
ATOM   8171 O O   . GLU B 1 519 ? -2.246  17.188  -23.035 1.00 45.60 ? 519  GLU B O   1 
ATOM   8172 C CB  . GLU B 1 519 ? -4.500  16.303  -21.040 1.00 46.09 ? 519  GLU B CB  1 
ATOM   8173 C CG  . GLU B 1 519 ? -3.720  16.413  -19.746 1.00 47.55 ? 519  GLU B CG  1 
ATOM   8174 C CD  . GLU B 1 519 ? -3.879  15.158  -18.891 1.00 48.61 ? 519  GLU B CD  1 
ATOM   8175 O OE1 . GLU B 1 519 ? -5.061  14.826  -18.564 1.00 52.16 ? 519  GLU B OE1 1 
ATOM   8176 O OE2 . GLU B 1 519 ? -2.836  14.510  -18.562 1.00 48.76 ? 519  GLU B OE2 1 
ATOM   8177 N N   . VAL B 1 520 ? -2.482  19.015  -21.743 1.00 44.41 ? 520  VAL B N   1 
ATOM   8178 C CA  . VAL B 1 520 ? -1.097  19.471  -21.944 1.00 43.67 ? 520  VAL B CA  1 
ATOM   8179 C C   . VAL B 1 520 ? -0.162  18.962  -20.837 1.00 43.29 ? 520  VAL B C   1 
ATOM   8180 O O   . VAL B 1 520 ? -0.395  19.204  -19.664 1.00 43.59 ? 520  VAL B O   1 
ATOM   8181 C CB  . VAL B 1 520 ? -0.993  21.025  -22.059 1.00 43.51 ? 520  VAL B CB  1 
ATOM   8182 C CG1 . VAL B 1 520 ? 0.451   21.446  -22.342 1.00 43.62 ? 520  VAL B CG1 1 
ATOM   8183 C CG2 . VAL B 1 520 ? -1.904  21.559  -23.157 1.00 42.03 ? 520  VAL B CG2 1 
ATOM   8184 N N   . ARG B 1 521 ? 0.884   18.239  -21.212 1.00 42.90 ? 521  ARG B N   1 
ATOM   8185 C CA  . ARG B 1 521 ? 1.881   17.778  -20.249 1.00 42.78 ? 521  ARG B CA  1 
ATOM   8186 C C   . ARG B 1 521 ? 3.218   18.423  -20.552 1.00 42.45 ? 521  ARG B C   1 
ATOM   8187 O O   . ARG B 1 521 ? 3.426   18.958  -21.641 1.00 42.62 ? 521  ARG B O   1 
ATOM   8188 C CB  . ARG B 1 521 ? 2.026   16.266  -20.303 1.00 43.07 ? 521  ARG B CB  1 
ATOM   8189 C CG  . ARG B 1 521 ? 0.910   15.513  -19.642 1.00 43.80 ? 521  ARG B CG  1 
ATOM   8190 C CD  . ARG B 1 521 ? 0.903   14.069  -20.083 1.00 44.78 ? 521  ARG B CD  1 
ATOM   8191 N NE  . ARG B 1 521 ? -0.419  13.457  -19.938 1.00 45.86 ? 521  ARG B NE  1 
ATOM   8192 C CZ  . ARG B 1 521 ? -0.683  12.166  -20.158 1.00 46.40 ? 521  ARG B CZ  1 
ATOM   8193 N NH1 . ARG B 1 521 ? 0.285   11.328  -20.531 1.00 43.83 ? 521  ARG B NH1 1 
ATOM   8194 N NH2 . ARG B 1 521 ? -1.923  11.710  -20.006 1.00 45.67 ? 521  ARG B NH2 1 
ATOM   8195 N N   . ARG B 1 522 ? 4.127   18.374  -19.593 1.00 42.41 ? 522  ARG B N   1 
ATOM   8196 C CA  . ARG B 1 522 ? 5.424   19.021  -19.759 1.00 43.09 ? 522  ARG B CA  1 
ATOM   8197 C C   . ARG B 1 522 ? 6.523   18.014  -19.514 1.00 42.69 ? 522  ARG B C   1 
ATOM   8198 O O   . ARG B 1 522 ? 6.544   17.350  -18.490 1.00 42.82 ? 522  ARG B O   1 
ATOM   8199 C CB  . ARG B 1 522 ? 5.578   20.246  -18.828 1.00 42.78 ? 522  ARG B CB  1 
ATOM   8200 C CG  . ARG B 1 522 ? 4.695   21.438  -19.193 1.00 43.67 ? 522  ARG B CG  1 
ATOM   8201 C CD  . ARG B 1 522 ? 4.824   22.638  -18.214 1.00 44.34 ? 522  ARG B CD  1 
ATOM   8202 N NE  . ARG B 1 522 ? 6.180   23.215  -18.196 1.00 46.67 ? 522  ARG B NE  1 
ATOM   8203 C CZ  . ARG B 1 522 ? 6.519   24.361  -17.595 1.00 47.32 ? 522  ARG B CZ  1 
ATOM   8204 N NH1 . ARG B 1 522 ? 5.602   25.090  -16.960 1.00 45.95 ? 522  ARG B NH1 1 
ATOM   8205 N NH2 . ARG B 1 522 ? 7.787   24.788  -17.637 1.00 46.97 ? 522  ARG B NH2 1 
ATOM   8206 N N   . GLY B 1 523 ? 7.420   17.890  -20.477 1.00 43.08 ? 523  GLY B N   1 
ATOM   8207 C CA  . GLY B 1 523 ? 8.598   17.060  -20.313 1.00 44.03 ? 523  GLY B CA  1 
ATOM   8208 C C   . GLY B 1 523 ? 8.276   15.655  -20.740 1.00 44.40 ? 523  GLY B C   1 
ATOM   8209 O O   . GLY B 1 523 ? 7.441   14.995  -20.140 1.00 44.58 ? 523  GLY B O   1 
ATOM   8210 N N   . LEU B 1 524 ? 8.938   15.213  -21.797 1.00 44.92 ? 524  LEU B N   1 
ATOM   8211 C CA  . LEU B 1 524 ? 8.655   13.934  -22.399 1.00 45.44 ? 524  LEU B CA  1 
ATOM   8212 C C   . LEU B 1 524 ? 9.679   12.932  -21.904 1.00 45.43 ? 524  LEU B C   1 
ATOM   8213 O O   . LEU B 1 524 ? 10.731  12.755  -22.523 1.00 46.11 ? 524  LEU B O   1 
ATOM   8214 C CB  . LEU B 1 524 ? 8.701   14.089  -23.916 1.00 45.21 ? 524  LEU B CB  1 
ATOM   8215 C CG  . LEU B 1 524 ? 8.224   12.958  -24.813 1.00 46.51 ? 524  LEU B CG  1 
ATOM   8216 C CD1 . LEU B 1 524 ? 6.901   12.360  -24.338 1.00 46.97 ? 524  LEU B CD1 1 
ATOM   8217 C CD2 . LEU B 1 524 ? 8.117   13.483  -26.240 1.00 46.48 ? 524  LEU B CD2 1 
ATOM   8218 N N   . ARG B 1 525 ? 9.380   12.297  -20.770 1.00 45.30 ? 525  ARG B N   1 
ATOM   8219 C CA  . ARG B 1 525 ? 10.335  11.425  -20.091 1.00 45.59 ? 525  ARG B CA  1 
ATOM   8220 C C   . ARG B 1 525 ? 11.644  12.173  -19.805 1.00 44.62 ? 525  ARG B C   1 
ATOM   8221 O O   . ARG B 1 525 ? 12.729  11.669  -20.091 1.00 44.83 ? 525  ARG B O   1 
ATOM   8222 C CB  . ARG B 1 525 ? 10.636  10.198  -20.956 1.00 46.39 ? 525  ARG B CB  1 
ATOM   8223 C CG  . ARG B 1 525 ? 9.486   9.273   -21.184 1.00 49.29 ? 525  ARG B CG  1 
ATOM   8224 C CD  . ARG B 1 525 ? 9.698   8.002   -20.407 1.00 55.05 ? 525  ARG B CD  1 
ATOM   8225 N NE  . ARG B 1 525 ? 9.199   6.822   -21.118 1.00 59.45 ? 525  ARG B NE  1 
ATOM   8226 C CZ  . ARG B 1 525 ? 7.914   6.574   -21.380 1.00 60.60 ? 525  ARG B CZ  1 
ATOM   8227 N NH1 . ARG B 1 525 ? 6.962   7.435   -21.022 1.00 62.05 ? 525  ARG B NH1 1 
ATOM   8228 N NH2 . ARG B 1 525 ? 7.583   5.460   -22.017 1.00 60.59 ? 525  ARG B NH2 1 
ATOM   8229 N N   . ALA B 1 526 ? 11.541  13.365  -19.232 1.00 44.05 ? 526  ALA B N   1 
ATOM   8230 C CA  . ALA B 1 526 ? 12.674  14.290  -19.175 1.00 43.35 ? 526  ALA B CA  1 
ATOM   8231 C C   . ALA B 1 526 ? 13.876  13.753  -18.398 1.00 42.87 ? 526  ALA B C   1 
ATOM   8232 O O   . ALA B 1 526 ? 15.006  13.880  -18.865 1.00 42.31 ? 526  ALA B O   1 
ATOM   8233 C CB  . ALA B 1 526 ? 12.244  15.635  -18.637 1.00 43.33 ? 526  ALA B CB  1 
ATOM   8234 N N   . GLN B 1 527 ? 13.627  13.148  -17.235 1.00 42.68 ? 527  GLN B N   1 
ATOM   8235 C CA  . GLN B 1 527 ? 14.701  12.589  -16.406 1.00 42.45 ? 527  GLN B CA  1 
ATOM   8236 C C   . GLN B 1 527 ? 15.315  11.378  -17.077 1.00 41.84 ? 527  GLN B C   1 
ATOM   8237 O O   . GLN B 1 527 ? 16.531  11.239  -17.112 1.00 41.76 ? 527  GLN B O   1 
ATOM   8238 C CB  . GLN B 1 527 ? 14.207  12.196  -15.004 1.00 42.54 ? 527  GLN B CB  1 
ATOM   8239 C CG  . GLN B 1 527 ? 13.864  13.353  -14.084 1.00 44.39 ? 527  GLN B CG  1 
ATOM   8240 C CD  . GLN B 1 527 ? 14.960  14.418  -14.029 1.00 47.30 ? 527  GLN B CD  1 
ATOM   8241 O OE1 . GLN B 1 527 ? 14.738  15.585  -14.399 1.00 48.23 ? 527  GLN B OE1 1 
ATOM   8242 N NE2 . GLN B 1 527 ? 16.144  14.021  -13.571 1.00 46.86 ? 527  GLN B NE2 1 
ATOM   8243 N N   . THR B 1 528 ? 14.469  10.506  -17.617 1.00 41.78 ? 528  THR B N   1 
ATOM   8244 C CA  . THR B 1 528 ? 14.945  9.274   -18.233 1.00 41.32 ? 528  THR B CA  1 
ATOM   8245 C C   . THR B 1 528 ? 15.650  9.559   -19.557 1.00 41.76 ? 528  THR B C   1 
ATOM   8246 O O   . THR B 1 528 ? 16.681  8.950   -19.842 1.00 41.97 ? 528  THR B O   1 
ATOM   8247 C CB  . THR B 1 528 ? 13.818  8.223   -18.355 1.00 41.06 ? 528  THR B CB  1 
ATOM   8248 O OG1 . THR B 1 528 ? 13.516  7.709   -17.052 1.00 40.10 ? 528  THR B OG1 1 
ATOM   8249 C CG2 . THR B 1 528 ? 14.227  7.062   -19.240 1.00 40.85 ? 528  THR B CG2 1 
ATOM   8250 N N   . CYS B 1 529 ? 15.142  10.508  -20.343 1.00 41.72 ? 529  CYS B N   1 
ATOM   8251 C CA  . CYS B 1 529 ? 15.822  10.842  -21.600 1.00 42.24 ? 529  CYS B CA  1 
ATOM   8252 C C   . CYS B 1 529 ? 17.145  11.573  -21.382 1.00 42.35 ? 529  CYS B C   1 
ATOM   8253 O O   . CYS B 1 529 ? 18.066  11.474  -22.196 1.00 42.25 ? 529  CYS B O   1 
ATOM   8254 C CB  . CYS B 1 529 ? 14.884  11.536  -22.605 1.00 42.08 ? 529  CYS B CB  1 
ATOM   8255 S SG  . CYS B 1 529 ? 13.626  10.334  -23.276 1.00 43.42 ? 529  CYS B SG  1 
ATOM   8256 N N   . ALA B 1 530 ? 17.254  12.273  -20.260 1.00 42.28 ? 530  ALA B N   1 
ATOM   8257 C CA  . ALA B 1 530 ? 18.531  12.846  -19.865 1.00 42.70 ? 530  ALA B CA  1 
ATOM   8258 C C   . ALA B 1 530 ? 19.576  11.736  -19.682 1.00 42.81 ? 530  ALA B C   1 
ATOM   8259 O O   . ALA B 1 530 ? 20.726  11.897  -20.080 1.00 42.99 ? 530  ALA B O   1 
ATOM   8260 C CB  . ALA B 1 530 ? 18.382  13.658  -18.587 1.00 42.66 ? 530  ALA B CB  1 
ATOM   8261 N N   . PHE B 1 531 ? 19.160  10.610  -19.102 1.00 42.40 ? 531  PHE B N   1 
ATOM   8262 C CA  . PHE B 1 531 ? 20.025  9.458   -18.970 1.00 42.64 ? 531  PHE B CA  1 
ATOM   8263 C C   . PHE B 1 531 ? 20.488  8.889   -20.323 1.00 43.16 ? 531  PHE B C   1 
ATOM   8264 O O   . PHE B 1 531 ? 21.692  8.676   -20.528 1.00 43.04 ? 531  PHE B O   1 
ATOM   8265 C CB  . PHE B 1 531 ? 19.335  8.386   -18.144 1.00 42.44 ? 531  PHE B CB  1 
ATOM   8266 C CG  . PHE B 1 531 ? 20.047  7.074   -18.141 1.00 42.13 ? 531  PHE B CG  1 
ATOM   8267 C CD1 . PHE B 1 531 ? 21.188  6.887   -17.372 1.00 43.93 ? 531  PHE B CD1 1 
ATOM   8268 C CD2 . PHE B 1 531 ? 19.568  6.011   -18.894 1.00 42.25 ? 531  PHE B CD2 1 
ATOM   8269 C CE1 . PHE B 1 531 ? 21.849  5.644   -17.357 1.00 44.34 ? 531  PHE B CE1 1 
ATOM   8270 C CE2 . PHE B 1 531 ? 20.216  4.765   -18.891 1.00 42.91 ? 531  PHE B CE2 1 
ATOM   8271 C CZ  . PHE B 1 531 ? 21.357  4.581   -18.126 1.00 43.36 ? 531  PHE B CZ  1 
ATOM   8272 N N   . TRP B 1 532 ? 19.536  8.642   -21.230 1.00 43.15 ? 532  TRP B N   1 
ATOM   8273 C CA  . TRP B 1 532 ? 19.844  8.144   -22.572 1.00 43.45 ? 532  TRP B CA  1 
ATOM   8274 C C   . TRP B 1 532 ? 20.556  9.174   -23.453 1.00 44.45 ? 532  TRP B C   1 
ATOM   8275 O O   . TRP B 1 532 ? 21.483  8.827   -24.172 1.00 44.58 ? 532  TRP B O   1 
ATOM   8276 C CB  . TRP B 1 532 ? 18.579  7.659   -23.289 1.00 42.46 ? 532  TRP B CB  1 
ATOM   8277 C CG  . TRP B 1 532 ? 17.999  6.387   -22.737 1.00 41.61 ? 532  TRP B CG  1 
ATOM   8278 C CD1 . TRP B 1 532 ? 16.861  6.259   -21.998 1.00 40.49 ? 532  TRP B CD1 1 
ATOM   8279 C CD2 . TRP B 1 532 ? 18.532  5.062   -22.891 1.00 40.85 ? 532  TRP B CD2 1 
ATOM   8280 N NE1 . TRP B 1 532 ? 16.643  4.935   -21.685 1.00 41.09 ? 532  TRP B NE1 1 
ATOM   8281 C CE2 . TRP B 1 532 ? 17.657  4.180   -22.218 1.00 40.92 ? 532  TRP B CE2 1 
ATOM   8282 C CE3 . TRP B 1 532 ? 19.657  4.534   -23.542 1.00 39.32 ? 532  TRP B CE3 1 
ATOM   8283 C CZ2 . TRP B 1 532 ? 17.877  2.797   -22.168 1.00 40.29 ? 532  TRP B CZ2 1 
ATOM   8284 C CZ3 . TRP B 1 532 ? 19.874  3.155   -23.491 1.00 40.32 ? 532  TRP B CZ3 1 
ATOM   8285 C CH2 . TRP B 1 532 ? 18.988  2.308   -22.808 1.00 40.61 ? 532  TRP B CH2 1 
ATOM   8286 N N   . ASN B 1 533 ? 20.122  10.430  -23.406 1.00 45.45 ? 533  ASN B N   1 
ATOM   8287 C CA  . ASN B 1 533 ? 20.640  11.426  -24.342 1.00 46.76 ? 533  ASN B CA  1 
ATOM   8288 C C   . ASN B 1 533 ? 21.918  12.138  -23.892 1.00 47.78 ? 533  ASN B C   1 
ATOM   8289 O O   . ASN B 1 533 ? 22.681  12.628  -24.736 1.00 47.66 ? 533  ASN B O   1 
ATOM   8290 C CB  . ASN B 1 533 ? 19.558  12.453  -24.712 1.00 46.76 ? 533  ASN B CB  1 
ATOM   8291 C CG  . ASN B 1 533 ? 18.381  11.832  -25.467 1.00 46.39 ? 533  ASN B CG  1 
ATOM   8292 O OD1 . ASN B 1 533 ? 18.462  10.709  -25.964 1.00 46.70 ? 533  ASN B OD1 1 
ATOM   8293 N ND2 . ASN B 1 533 ? 17.280  12.567  -25.548 1.00 45.46 ? 533  ASN B ND2 1 
ATOM   8294 N N   . ARG B 1 534 ? 22.158  12.193  -22.579 1.00 48.97 ? 534  ARG B N   1 
ATOM   8295 C CA  . ARG B 1 534 ? 23.285  12.971  -22.052 1.00 50.49 ? 534  ARG B CA  1 
ATOM   8296 C C   . ARG B 1 534 ? 24.358  12.139  -21.362 1.00 51.10 ? 534  ARG B C   1 
ATOM   8297 O O   . ARG B 1 534 ? 25.554  12.352  -21.596 1.00 51.11 ? 534  ARG B O   1 
ATOM   8298 C CB  . ARG B 1 534 ? 22.808  14.073  -21.105 1.00 50.60 ? 534  ARG B CB  1 
ATOM   8299 C CG  . ARG B 1 534 ? 22.245  15.305  -21.792 1.00 52.39 ? 534  ARG B CG  1 
ATOM   8300 C CD  . ARG B 1 534 ? 21.530  16.180  -20.767 1.00 55.31 ? 534  ARG B CD  1 
ATOM   8301 N NE  . ARG B 1 534 ? 20.365  16.871  -21.327 1.00 58.29 ? 534  ARG B NE  1 
ATOM   8302 C CZ  . ARG B 1 534 ? 20.376  18.130  -21.772 1.00 58.96 ? 534  ARG B CZ  1 
ATOM   8303 N NH1 . ARG B 1 534 ? 21.495  18.848  -21.712 1.00 57.52 ? 534  ARG B NH1 1 
ATOM   8304 N NH2 . ARG B 1 534 ? 19.265  18.674  -22.265 1.00 57.64 ? 534  ARG B NH2 1 
ATOM   8305 N N   . PHE B 1 535 ? 23.934  11.205  -20.513 1.00 51.88 ? 535  PHE B N   1 
ATOM   8306 C CA  . PHE B 1 535 ? 24.877  10.447  -19.716 1.00 52.55 ? 535  PHE B CA  1 
ATOM   8307 C C   . PHE B 1 535 ? 25.437  9.245   -20.444 1.00 53.99 ? 535  PHE B C   1 
ATOM   8308 O O   . PHE B 1 535 ? 26.658  9.086   -20.533 1.00 53.85 ? 535  PHE B O   1 
ATOM   8309 C CB  . PHE B 1 535 ? 24.294  10.013  -18.371 1.00 51.75 ? 535  PHE B CB  1 
ATOM   8310 C CG  . PHE B 1 535 ? 25.254  9.215   -17.559 1.00 50.48 ? 535  PHE B CG  1 
ATOM   8311 C CD1 . PHE B 1 535 ? 26.370  9.831   -16.983 1.00 49.38 ? 535  PHE B CD1 1 
ATOM   8312 C CD2 . PHE B 1 535 ? 25.092  7.841   -17.422 1.00 49.08 ? 535  PHE B CD2 1 
ATOM   8313 C CE1 . PHE B 1 535 ? 27.299  9.099   -16.258 1.00 48.94 ? 535  PHE B CE1 1 
ATOM   8314 C CE2 . PHE B 1 535 ? 26.009  7.094   -16.688 1.00 50.17 ? 535  PHE B CE2 1 
ATOM   8315 C CZ  . PHE B 1 535 ? 27.122  7.729   -16.099 1.00 49.65 ? 535  PHE B CZ  1 
ATOM   8316 N N   . LEU B 1 536 ? 24.553  8.393   -20.951 1.00 55.77 ? 536  LEU B N   1 
ATOM   8317 C CA  . LEU B 1 536 ? 24.994  7.176   -21.619 1.00 58.25 ? 536  LEU B CA  1 
ATOM   8318 C C   . LEU B 1 536 ? 26.075  7.385   -22.706 1.00 59.99 ? 536  LEU B C   1 
ATOM   8319 O O   . LEU B 1 536 ? 27.053  6.638   -22.729 1.00 59.76 ? 536  LEU B O   1 
ATOM   8320 C CB  . LEU B 1 536 ? 23.813  6.396   -22.181 1.00 58.29 ? 536  LEU B CB  1 
ATOM   8321 C CG  . LEU B 1 536 ? 24.116  4.909   -22.246 1.00 59.64 ? 536  LEU B CG  1 
ATOM   8322 C CD1 . LEU B 1 536 ? 23.872  4.286   -20.876 1.00 61.28 ? 536  LEU B CD1 1 
ATOM   8323 C CD2 . LEU B 1 536 ? 23.295  4.227   -23.336 1.00 61.05 ? 536  LEU B CD2 1 
ATOM   8324 N N   . PRO B 1 537 ? 25.899  8.382   -23.609 1.00 61.87 ? 537  PRO B N   1 
ATOM   8325 C CA  . PRO B 1 537 ? 26.960  8.656   -24.580 1.00 63.64 ? 537  PRO B CA  1 
ATOM   8326 C C   . PRO B 1 537 ? 28.344  8.869   -23.946 1.00 65.46 ? 537  PRO B C   1 
ATOM   8327 O O   . PRO B 1 537 ? 29.336  8.366   -24.479 1.00 65.64 ? 537  PRO B O   1 
ATOM   8328 C CB  . PRO B 1 537 ? 26.472  9.935   -25.278 1.00 63.62 ? 537  PRO B CB  1 
ATOM   8329 C CG  . PRO B 1 537 ? 24.985  9.835   -25.201 1.00 62.80 ? 537  PRO B CG  1 
ATOM   8330 C CD  . PRO B 1 537 ? 24.736  9.271   -23.830 1.00 62.00 ? 537  PRO B CD  1 
ATOM   8331 N N   . LYS B 1 538 ? 28.405  9.584   -22.819 1.00 67.53 ? 538  LYS B N   1 
ATOM   8332 C CA  . LYS B 1 538 ? 29.670  9.805   -22.101 1.00 69.42 ? 538  LYS B CA  1 
ATOM   8333 C C   . LYS B 1 538 ? 30.232  8.529   -21.492 1.00 70.38 ? 538  LYS B C   1 
ATOM   8334 O O   . LYS B 1 538 ? 31.442  8.377   -21.370 1.00 70.78 ? 538  LYS B O   1 
ATOM   8335 C CB  . LYS B 1 538 ? 29.523  10.883  -21.025 1.00 69.38 ? 538  LYS B CB  1 
ATOM   8336 C CG  . LYS B 1 538 ? 29.318  12.272  -21.594 1.00 71.69 ? 538  LYS B CG  1 
ATOM   8337 C CD  . LYS B 1 538 ? 29.608  13.377  -20.582 1.00 74.87 ? 538  LYS B CD  1 
ATOM   8338 C CE  . LYS B 1 538 ? 29.556  14.748  -21.272 1.00 76.54 ? 538  LYS B CE  1 
ATOM   8339 N NZ  . LYS B 1 538 ? 30.180  15.837  -20.453 1.00 78.14 ? 538  LYS B NZ  1 
ATOM   8340 N N   . LEU B 1 539 ? 29.350  7.610   -21.127 1.00 71.97 ? 539  LEU B N   1 
ATOM   8341 C CA  . LEU B 1 539 ? 29.756  6.358   -20.506 1.00 73.85 ? 539  LEU B CA  1 
ATOM   8342 C C   . LEU B 1 539 ? 30.442  5.401   -21.483 1.00 75.26 ? 539  LEU B C   1 
ATOM   8343 O O   . LEU B 1 539 ? 31.335  4.645   -21.097 1.00 75.48 ? 539  LEU B O   1 
ATOM   8344 C CB  . LEU B 1 539 ? 28.548  5.683   -19.859 1.00 73.61 ? 539  LEU B CB  1 
ATOM   8345 C CG  . LEU B 1 539 ? 28.787  4.453   -18.992 1.00 73.74 ? 539  LEU B CG  1 
ATOM   8346 C CD1 . LEU B 1 539 ? 29.838  4.759   -17.945 1.00 74.33 ? 539  LEU B CD1 1 
ATOM   8347 C CD2 . LEU B 1 539 ? 27.487  4.004   -18.339 1.00 73.87 ? 539  LEU B CD2 1 
ATOM   8348 N N   . LEU B 1 540 ? 30.008  5.426   -22.740 1.00 77.20 ? 540  LEU B N   1 
ATOM   8349 C CA  . LEU B 1 540 ? 30.619  4.607   -23.785 1.00 78.95 ? 540  LEU B CA  1 
ATOM   8350 C C   . LEU B 1 540 ? 31.826  5.323   -24.415 1.00 80.19 ? 540  LEU B C   1 
ATOM   8351 O O   . LEU B 1 540 ? 32.859  4.694   -24.645 1.00 80.27 ? 540  LEU B O   1 
ATOM   8352 C CB  . LEU B 1 540 ? 29.591  4.213   -24.859 1.00 78.87 ? 540  LEU B CB  1 
ATOM   8353 C CG  . LEU B 1 540 ? 28.357  3.375   -24.479 1.00 79.28 ? 540  LEU B CG  1 
ATOM   8354 C CD1 . LEU B 1 540 ? 27.201  3.610   -25.471 1.00 78.86 ? 540  LEU B CD1 1 
ATOM   8355 C CD2 . LEU B 1 540 ? 28.669  1.877   -24.352 1.00 79.33 ? 540  LEU B CD2 1 
ATOM   8356 N N   . SER B 1 541 ? 31.700  6.632   -24.664 1.00 81.66 ? 541  SER B N   1 
ATOM   8357 C CA  . SER B 1 541 ? 32.772  7.423   -25.301 1.00 83.20 ? 541  SER B CA  1 
ATOM   8358 C C   . SER B 1 541 ? 34.069  7.502   -24.472 1.00 84.42 ? 541  SER B C   1 
ATOM   8359 O O   . SER B 1 541 ? 35.112  7.965   -24.967 1.00 84.67 ? 541  SER B O   1 
ATOM   8360 C CB  . SER B 1 541 ? 32.284  8.832   -25.695 1.00 83.15 ? 541  SER B CB  1 
ATOM   8361 O OG  . SER B 1 541 ? 32.439  9.768   -24.639 1.00 82.81 ? 541  SER B OG  1 
ATOM   8362 N N   . ALA B 1 542 ? 34.000  7.054   -23.219 1.00 85.66 ? 542  ALA B N   1 
ATOM   8363 C CA  . ALA B 1 542 ? 35.189  6.950   -22.373 1.00 86.64 ? 542  ALA B CA  1 
ATOM   8364 C C   . ALA B 1 542 ? 35.644  5.490   -22.222 1.00 87.26 ? 542  ALA B C   1 
ATOM   8365 O O   . ALA B 1 542 ? 36.709  5.220   -21.651 1.00 87.67 ? 542  ALA B O   1 
ATOM   8366 C CB  . ALA B 1 542 ? 34.937  7.593   -21.008 1.00 86.55 ? 542  ALA B CB  1 
ATOM   8367 N N   . THR B 1 543 ? 34.853  4.561   -22.763 1.00 87.79 ? 543  THR B N   1 
ATOM   8368 C CA  . THR B 1 543 ? 35.082  3.122   -22.554 1.00 88.24 ? 543  THR B CA  1 
ATOM   8369 C C   . THR B 1 543 ? 35.042  2.301   -23.865 1.00 88.23 ? 543  THR B C   1 
ATOM   8370 O O   . THR B 1 543 ? 35.945  2.410   -24.707 1.00 88.15 ? 543  THR B O   1 
ATOM   8371 C CB  . THR B 1 543 ? 34.101  2.560   -21.473 1.00 88.42 ? 543  THR B CB  1 
ATOM   8372 O OG1 . THR B 1 543 ? 34.086  3.441   -20.338 1.00 88.39 ? 543  THR B OG1 1 
ATOM   8373 C CG2 . THR B 1 543 ? 34.506  1.146   -21.015 1.00 89.03 ? 543  THR B CG2 1 
ATOM   8374 N N   . ALA B 1 544 ? 34.129  1.508   -24.124 1.00 88.06 ? 544  ALA B N   1 
HETATM 8375 C C1  . NAG C 2 .   ? 24.344  35.485  -1.052  1.00 71.37 ? 1545 NAG A C1  1 
HETATM 8376 C C2  . NAG C 2 .   ? 24.581  35.821  -2.552  1.00 75.77 ? 1545 NAG A C2  1 
HETATM 8377 C C3  . NAG C 2 .   ? 25.930  35.296  -3.108  1.00 75.73 ? 1545 NAG A C3  1 
HETATM 8378 C C4  . NAG C 2 .   ? 27.098  35.578  -2.170  1.00 75.59 ? 1545 NAG A C4  1 
HETATM 8379 C C5  . NAG C 2 .   ? 26.764  35.054  -0.770  1.00 74.84 ? 1545 NAG A C5  1 
HETATM 8380 C C6  . NAG C 2 .   ? 27.919  35.304  0.215   1.00 75.84 ? 1545 NAG A C6  1 
HETATM 8381 C C7  . NAG C 2 .   ? 22.683  36.104  -4.148  1.00 80.67 ? 1545 NAG A C7  1 
HETATM 8382 C C8  . NAG C 2 .   ? 22.657  35.802  -5.627  1.00 80.49 ? 1545 NAG A C8  1 
HETATM 8383 N N2  . NAG C 2 .   ? 23.474  35.325  -3.378  1.00 78.50 ? 1545 NAG A N2  1 
HETATM 8384 O O3  . NAG C 2 .   ? 26.274  35.831  -4.374  1.00 74.80 ? 1545 NAG A O3  1 
HETATM 8385 O O4  . NAG C 2 .   ? 28.268  34.983  -2.701  1.00 76.07 ? 1545 NAG A O4  1 
HETATM 8386 O O5  . NAG C 2 .   ? 25.548  35.632  -0.289  1.00 73.25 ? 1545 NAG A O5  1 
HETATM 8387 O O6  . NAG C 2 .   ? 28.014  36.658  0.630   1.00 75.82 ? 1545 NAG A O6  1 
HETATM 8388 O O7  . NAG C 2 .   ? 21.984  37.028  -3.705  1.00 81.06 ? 1545 NAG A O7  1 
HETATM 8389 C C1  . NAG D 2 .   ? 12.029  33.940  25.406  1.00 76.38 ? 1546 NAG A C1  1 
HETATM 8390 C C2  . NAG D 2 .   ? 13.413  34.608  25.413  1.00 81.08 ? 1546 NAG A C2  1 
HETATM 8391 C C3  . NAG D 2 .   ? 13.467  35.722  26.466  1.00 82.51 ? 1546 NAG A C3  1 
HETATM 8392 C C4  . NAG D 2 .   ? 12.380  36.750  26.138  1.00 83.18 ? 1546 NAG A C4  1 
HETATM 8393 C C5  . NAG D 2 .   ? 10.999  36.055  26.100  1.00 82.88 ? 1546 NAG A C5  1 
HETATM 8394 C C6  . NAG D 2 .   ? 9.861   37.011  25.696  1.00 83.99 ? 1546 NAG A C6  1 
HETATM 8395 C C7  . NAG D 2 .   ? 15.232  33.157  24.612  1.00 81.82 ? 1546 NAG A C7  1 
HETATM 8396 C C8  . NAG D 2 .   ? 15.600  34.070  23.466  1.00 81.90 ? 1546 NAG A C8  1 
HETATM 8397 N N2  . NAG D 2 .   ? 14.490  33.648  25.613  1.00 81.16 ? 1546 NAG A N2  1 
HETATM 8398 O O3  . NAG D 2 .   ? 14.740  36.345  26.517  1.00 83.43 ? 1546 NAG A O3  1 
HETATM 8399 O O4  . NAG D 2 .   ? 12.437  37.822  27.065  1.00 84.07 ? 1546 NAG A O4  1 
HETATM 8400 O O5  . NAG D 2 .   ? 10.995  34.910  25.238  1.00 79.90 ? 1546 NAG A O5  1 
HETATM 8401 O O6  . NAG D 2 .   ? 10.064  37.580  24.413  1.00 84.37 ? 1546 NAG A O6  1 
HETATM 8402 O O7  . NAG D 2 .   ? 15.624  31.989  24.610  1.00 81.47 ? 1546 NAG A O7  1 
HETATM 8403 C C1  . AE3 E 3 .   ? 39.058  28.164  7.936   1.00 83.84 ? 1547 AE3 A C1  1 
HETATM 8404 C C2  . AE3 E 3 .   ? 38.270  27.055  7.235   1.00 83.91 ? 1547 AE3 A C2  1 
HETATM 8405 O O2  . AE3 E 3 .   ? 38.099  25.926  8.100   1.00 83.09 ? 1547 AE3 A O2  1 
HETATM 8406 C C3  . AE3 E 3 .   ? 36.900  25.186  7.803   1.00 82.14 ? 1547 AE3 A C3  1 
HETATM 8407 C C4  . AE3 E 3 .   ? 36.298  24.702  9.163   1.00 81.29 ? 1547 AE3 A C4  1 
HETATM 8408 O O3  . AE3 E 3 .   ? 35.669  23.408  8.911   1.00 80.39 ? 1547 AE3 A O3  1 
HETATM 8409 C C5  . AE3 E 3 .   ? 34.281  23.393  9.281   1.00 79.20 ? 1547 AE3 A C5  1 
HETATM 8410 C C6  . AE3 E 3 .   ? 33.632  22.062  8.749   1.00 77.98 ? 1547 AE3 A C6  1 
HETATM 8411 O O4  . AE3 E 3 .   ? 32.176  22.220  8.914   1.00 75.77 ? 1547 AE3 A O4  1 
HETATM 8412 O O1  . P6G F 4 .   ? 17.039  10.496  -12.285 1.00 68.55 ? 1546 P6G B O1  1 
HETATM 8413 C C2  . P6G F 4 .   ? 17.983  9.984   -13.077 1.00 68.15 ? 1546 P6G B C2  1 
HETATM 8414 C C3  . P6G F 4 .   ? 18.596  10.745  -13.982 1.00 67.62 ? 1546 P6G B C3  1 
HETATM 8415 O O4  . P6G F 4 .   ? 19.624  10.152  -14.828 1.00 67.98 ? 1546 P6G B O4  1 
HETATM 8416 C C5  . P6G F 4 .   ? 20.879  10.833  -15.155 1.00 66.62 ? 1546 P6G B C5  1 
HETATM 8417 C C6  . P6G F 4 .   ? 22.076  10.306  -14.862 1.00 66.05 ? 1546 P6G B C6  1 
HETATM 8418 O O7  . P6G F 4 .   ? 22.259  9.018   -14.185 1.00 65.13 ? 1546 P6G B O7  1 
HETATM 8419 C C8  . P6G F 4 .   ? 23.484  8.266   -14.426 1.00 64.31 ? 1546 P6G B C8  1 
HETATM 8420 C C9  . P6G F 4 .   ? 23.696  7.025   -13.996 1.00 62.34 ? 1546 P6G B C9  1 
HETATM 8421 O O10 . P6G F 4 .   ? 22.701  6.329   -13.221 1.00 62.87 ? 1546 P6G B O10 1 
HETATM 8422 C C11 . P6G F 4 .   ? 22.623  4.913   -13.310 1.00 64.68 ? 1546 P6G B C11 1 
HETATM 8423 C C12 . P6G F 4 .   ? 22.184  4.354   -11.962 1.00 66.34 ? 1546 P6G B C12 1 
HETATM 8424 O O13 . P6G F 4 .   ? 20.809  4.652   -11.715 1.00 67.34 ? 1546 P6G B O13 1 
HETATM 8425 C C14 . P6G F 4 .   ? 20.216  4.212   -10.459 1.00 67.27 ? 1546 P6G B C14 1 
HETATM 8426 C C15 . P6G F 4 .   ? 19.160  4.827   -9.912  1.00 67.33 ? 1546 P6G B C15 1 
HETATM 8427 O O16 . P6G F 4 .   ? 18.517  5.975   -10.534 1.00 66.30 ? 1546 P6G B O16 1 
HETATM 8428 C C17 . P6G F 4 .   ? 17.106  5.873   -10.837 1.00 67.09 ? 1546 P6G B C17 1 
HETATM 8429 C C18 . P6G F 4 .   ? 16.565  6.606   -11.804 1.00 68.01 ? 1546 P6G B C18 1 
HETATM 8430 O O19 . P6G F 4 .   ? 15.261  6.484   -12.057 1.00 68.68 ? 1546 P6G B O19 1 
HETATM 8431 O O   . HOH G 5 .   ? 28.034  4.451   47.202  1.00 37.72 ? 2001 HOH A O   1 
HETATM 8432 O O   . HOH G 5 .   ? 36.728  3.179   45.960  1.00 32.74 ? 2002 HOH A O   1 
HETATM 8433 O O   . HOH G 5 .   ? 39.874  15.293  39.157  1.00 23.14 ? 2003 HOH A O   1 
HETATM 8434 O O   . HOH G 5 .   ? 19.199  23.639  38.971  1.00 46.71 ? 2004 HOH A O   1 
HETATM 8435 O O   . HOH G 5 .   ? 10.954  17.730  34.160  1.00 41.45 ? 2005 HOH A O   1 
HETATM 8436 O O   . HOH G 5 .   ? 45.165  8.005   29.766  1.00 45.74 ? 2006 HOH A O   1 
HETATM 8437 O O   . HOH G 5 .   ? 56.467  15.005  25.988  1.00 48.99 ? 2007 HOH A O   1 
HETATM 8438 O O   . HOH G 5 .   ? 49.804  6.175   27.715  1.00 48.30 ? 2008 HOH A O   1 
HETATM 8439 O O   . HOH G 5 .   ? 47.328  7.617   17.890  1.00 35.73 ? 2009 HOH A O   1 
HETATM 8440 O O   . HOH G 5 .   ? 51.416  2.301   33.552  1.00 52.22 ? 2010 HOH A O   1 
HETATM 8441 O O   . HOH G 5 .   ? 39.572  14.946  45.886  1.00 52.60 ? 2011 HOH A O   1 
HETATM 8442 O O   . HOH G 5 .   ? 38.202  8.694   47.448  1.00 45.52 ? 2012 HOH A O   1 
HETATM 8443 O O   . HOH G 5 .   ? 36.866  16.531  38.375  1.00 36.89 ? 2013 HOH A O   1 
HETATM 8444 O O   . HOH G 5 .   ? 32.508  16.970  32.554  1.00 28.87 ? 2014 HOH A O   1 
HETATM 8445 O O   . HOH G 5 .   ? 38.377  3.336   37.957  1.00 38.01 ? 2015 HOH A O   1 
HETATM 8446 O O   . HOH G 5 .   ? 40.989  16.694  21.397  1.00 31.36 ? 2016 HOH A O   1 
HETATM 8447 O O   . HOH G 5 .   ? 34.106  23.359  18.558  1.00 41.41 ? 2017 HOH A O   1 
HETATM 8448 O O   . HOH G 5 .   ? 34.670  27.649  10.961  1.00 54.46 ? 2018 HOH A O   1 
HETATM 8449 O O   . HOH G 5 .   ? 40.312  27.402  17.117  1.00 45.47 ? 2019 HOH A O   1 
HETATM 8450 O O   . HOH G 5 .   ? 21.375  34.100  17.341  1.00 50.28 ? 2020 HOH A O   1 
HETATM 8451 O O   . HOH G 5 .   ? 24.316  23.982  23.311  1.00 35.90 ? 2021 HOH A O   1 
HETATM 8452 O O   . HOH G 5 .   ? 29.621  20.326  19.031  1.00 32.11 ? 2022 HOH A O   1 
HETATM 8453 O O   . HOH G 5 .   ? 53.359  11.091  2.369   1.00 37.58 ? 2023 HOH A O   1 
HETATM 8454 O O   . HOH G 5 .   ? 43.571  15.396  25.000  1.00 37.57 ? 2024 HOH A O   1 
HETATM 8455 O O   . HOH G 5 .   ? 46.102  21.068  27.975  1.00 44.09 ? 2025 HOH A O   1 
HETATM 8456 O O   . HOH G 5 .   ? 41.843  13.710  31.426  1.00 29.79 ? 2026 HOH A O   1 
HETATM 8457 O O   . HOH G 5 .   ? 40.613  12.683  33.416  1.00 38.86 ? 2027 HOH A O   1 
HETATM 8458 O O   . HOH G 5 .   ? 41.628  19.280  35.559  1.00 40.03 ? 2028 HOH A O   1 
HETATM 8459 O O   . HOH G 5 .   ? 11.649  13.221  43.940  1.00 39.39 ? 2029 HOH A O   1 
HETATM 8460 O O   . HOH G 5 .   ? 29.266  12.352  24.740  1.00 33.60 ? 2030 HOH A O   1 
HETATM 8461 O O   . HOH G 5 .   ? 35.357  17.427  24.495  1.00 31.27 ? 2031 HOH A O   1 
HETATM 8462 O O   . HOH G 5 .   ? 33.154  19.190  28.783  1.00 31.10 ? 2032 HOH A O   1 
HETATM 8463 O O   . HOH G 5 .   ? 25.130  18.805  28.737  1.00 41.56 ? 2033 HOH A O   1 
HETATM 8464 O O   . HOH G 5 .   ? 25.258  22.439  30.098  1.00 39.30 ? 2034 HOH A O   1 
HETATM 8465 O O   . HOH G 5 .   ? 29.977  25.129  -15.659 1.00 46.51 ? 2035 HOH A O   1 
HETATM 8466 O O   . HOH G 5 .   ? 25.839  15.608  18.478  1.00 27.98 ? 2036 HOH A O   1 
HETATM 8467 O O   . HOH G 5 .   ? 28.919  17.964  20.021  1.00 23.12 ? 2037 HOH A O   1 
HETATM 8468 O O   . HOH G 5 .   ? 31.988  16.938  29.757  1.00 36.17 ? 2038 HOH A O   1 
HETATM 8469 O O   . HOH G 5 .   ? 33.192  14.372  17.253  1.00 30.33 ? 2039 HOH A O   1 
HETATM 8470 O O   . HOH G 5 .   ? 46.119  12.340  22.405  1.00 30.98 ? 2040 HOH A O   1 
HETATM 8471 O O   . HOH G 5 .   ? 42.580  7.494   13.988  1.00 26.56 ? 2041 HOH A O   1 
HETATM 8472 O O   . HOH G 5 .   ? 13.744  21.506  0.552   1.00 43.25 ? 2042 HOH A O   1 
HETATM 8473 O O   . HOH G 5 .   ? 26.881  18.415  15.302  0.50 15.27 ? 2043 HOH A O   1 
HETATM 8474 O O   . HOH G 5 .   ? 40.300  1.722   26.029  1.00 32.74 ? 2044 HOH A O   1 
HETATM 8475 O O   . HOH G 5 .   ? 40.296  -2.094  23.761  1.00 52.18 ? 2045 HOH A O   1 
HETATM 8476 O O   . HOH G 5 .   ? 34.672  -3.205  32.138  1.00 47.72 ? 2046 HOH A O   1 
HETATM 8477 O O   . HOH G 5 .   ? 27.761  -1.230  37.427  1.00 25.49 ? 2047 HOH A O   1 
HETATM 8478 O O   . HOH G 5 .   ? 36.363  1.813   36.904  1.00 31.97 ? 2048 HOH A O   1 
HETATM 8479 O O   . HOH G 5 .   ? 0.414   10.750  18.413  1.00 45.89 ? 2049 HOH A O   1 
HETATM 8480 O O   . HOH G 5 .   ? 32.877  -7.339  13.827  1.00 45.00 ? 2050 HOH A O   1 
HETATM 8481 O O   . HOH G 5 .   ? 36.424  -4.866  14.061  1.00 44.27 ? 2051 HOH A O   1 
HETATM 8482 O O   . HOH G 5 .   ? 36.741  -6.316  16.167  1.00 41.61 ? 2052 HOH A O   1 
HETATM 8483 O O   . HOH G 5 .   ? 28.654  -0.280  29.499  1.00 25.99 ? 2053 HOH A O   1 
HETATM 8484 O O   . HOH G 5 .   ? 27.986  3.141   2.675   1.00 45.25 ? 2054 HOH A O   1 
HETATM 8485 O O   . HOH G 5 .   ? 33.443  5.004   6.433   1.00 31.86 ? 2055 HOH A O   1 
HETATM 8486 O O   . HOH G 5 .   ? 37.343  9.475   4.221   1.00 38.38 ? 2056 HOH A O   1 
HETATM 8487 O O   . HOH G 5 .   ? 36.156  5.890   2.993   1.00 41.34 ? 2057 HOH A O   1 
HETATM 8488 O O   . HOH G 5 .   ? 37.432  3.388   4.615   1.00 39.87 ? 2058 HOH A O   1 
HETATM 8489 O O   . HOH G 5 .   ? 43.087  5.863   0.221   1.00 41.72 ? 2059 HOH A O   1 
HETATM 8490 O O   . HOH G 5 .   ? 41.176  7.043   2.891   1.00 43.07 ? 2060 HOH A O   1 
HETATM 8491 O O   . HOH G 5 .   ? 42.954  0.634   5.538   1.00 45.73 ? 2061 HOH A O   1 
HETATM 8492 O O   . HOH G 5 .   ? 50.774  6.754   2.804   1.00 37.47 ? 2062 HOH A O   1 
HETATM 8493 O O   . HOH G 5 .   ? 46.130  1.792   3.118   1.00 52.61 ? 2063 HOH A O   1 
HETATM 8494 O O   . HOH G 5 .   ? 50.514  2.842   7.056   1.00 48.54 ? 2064 HOH A O   1 
HETATM 8495 O O   . HOH G 5 .   ? 52.106  13.109  3.244   1.00 47.43 ? 2065 HOH A O   1 
HETATM 8496 O O   . HOH G 5 .   ? 62.252  8.882   8.324   1.00 52.23 ? 2066 HOH A O   1 
HETATM 8497 O O   . HOH G 5 .   ? 52.632  16.283  24.171  1.00 39.99 ? 2067 HOH A O   1 
HETATM 8498 O O   . HOH G 5 .   ? 40.513  16.640  12.223  1.00 37.44 ? 2068 HOH A O   1 
HETATM 8499 O O   . HOH G 5 .   ? 38.789  15.633  0.736   1.00 40.12 ? 2069 HOH A O   1 
HETATM 8500 O O   . HOH G 5 .   ? 32.507  20.801  6.129   1.00 52.49 ? 2070 HOH A O   1 
HETATM 8501 O O   . HOH G 5 .   ? 36.837  11.993  -0.712  1.00 41.33 ? 2071 HOH A O   1 
HETATM 8502 O O   . HOH G 5 .   ? 36.579  12.805  6.742   1.00 40.09 ? 2072 HOH A O   1 
HETATM 8503 O O   . HOH G 5 .   ? 43.912  11.137  9.297   1.00 34.18 ? 2073 HOH A O   1 
HETATM 8504 O O   . HOH G 5 .   ? 38.271  15.167  12.422  1.00 34.52 ? 2074 HOH A O   1 
HETATM 8505 O O   . HOH G 5 .   ? 35.508  3.409   2.737   1.00 43.15 ? 2075 HOH A O   1 
HETATM 8506 O O   . HOH G 5 .   ? 23.236  -9.245  24.123  1.00 44.29 ? 2076 HOH A O   1 
HETATM 8507 O O   . HOH G 5 .   ? 21.895  20.457  7.415   1.00 41.27 ? 2077 HOH A O   1 
HETATM 8508 O O   . HOH G 5 .   ? 19.965  17.806  2.605   1.00 26.26 ? 2078 HOH A O   1 
HETATM 8509 O O   . HOH G 5 .   ? 29.435  27.294  -6.201  1.00 43.02 ? 2079 HOH A O   1 
HETATM 8510 O O   . HOH G 5 .   ? 31.240  25.540  -12.889 1.00 39.91 ? 2080 HOH A O   1 
HETATM 8511 O O   . HOH G 5 .   ? 38.764  13.099  -13.731 1.00 52.22 ? 2081 HOH A O   1 
HETATM 8512 O O   . HOH G 5 .   ? 13.643  29.670  -8.311  1.00 44.81 ? 2082 HOH A O   1 
HETATM 8513 O O   . HOH G 5 .   ? 11.663  28.646  1.853   1.00 44.20 ? 2083 HOH A O   1 
HETATM 8514 O O   . HOH G 5 .   ? 23.376  -1.738  -0.751  1.00 49.39 ? 2084 HOH A O   1 
HETATM 8515 O O   . HOH G 5 .   ? 6.054   19.776  11.804  1.00 45.81 ? 2085 HOH A O   1 
HETATM 8516 O O   . HOH G 5 .   ? 11.349  27.657  12.312  1.00 48.11 ? 2086 HOH A O   1 
HETATM 8517 O O   . HOH G 5 .   ? 9.264   29.436  19.572  1.00 47.52 ? 2087 HOH A O   1 
HETATM 8518 O O   . HOH G 5 .   ? 13.358  23.647  2.112   1.00 41.42 ? 2088 HOH A O   1 
HETATM 8519 O O   . HOH G 5 .   ? 25.481  20.154  13.824  1.00 44.89 ? 2089 HOH A O   1 
HETATM 8520 O O   . HOH G 5 .   ? 18.803  12.188  13.203  1.00 20.63 ? 2090 HOH A O   1 
HETATM 8521 O O   . HOH G 5 .   ? 19.299  20.350  18.551  1.00 32.97 ? 2091 HOH A O   1 
HETATM 8522 O O   . HOH G 5 .   ? 16.660  25.689  18.043  1.00 40.87 ? 2092 HOH A O   1 
HETATM 8523 O O   . HOH G 5 .   ? 17.449  15.176  28.897  1.00 37.60 ? 2093 HOH A O   1 
HETATM 8524 O O   . HOH G 5 .   ? 16.450  23.289  32.584  1.00 51.55 ? 2094 HOH A O   1 
HETATM 8525 O O   . HOH G 5 .   ? 3.344   6.842   18.100  1.00 38.03 ? 2095 HOH A O   1 
HETATM 8526 O O   . HOH G 5 .   ? 9.374   -2.782  6.869   1.00 38.98 ? 2096 HOH A O   1 
HETATM 8527 O O   . HOH G 5 .   ? 11.448  1.037   10.464  1.00 38.16 ? 2097 HOH A O   1 
HETATM 8528 O O   . HOH G 5 .   ? 1.953   8.944   17.058  1.00 46.95 ? 2098 HOH A O   1 
HETATM 8529 O O   . HOH G 5 .   ? 0.816   5.331   8.318   1.00 45.31 ? 2099 HOH A O   1 
HETATM 8530 O O   . HOH G 5 .   ? 9.664   10.895  3.482   1.00 42.94 ? 2100 HOH A O   1 
HETATM 8531 O O   . HOH G 5 .   ? 14.915  8.278   -4.454  1.00 42.38 ? 2101 HOH A O   1 
HETATM 8532 O O   . HOH H 5 .   ? 4.183   10.833  -65.271 1.00 40.36 ? 2001 HOH B O   1 
HETATM 8533 O O   . HOH H 5 .   ? -14.890 3.071   -61.397 1.00 42.48 ? 2002 HOH B O   1 
HETATM 8534 O O   . HOH H 5 .   ? -15.496 0.508   -53.111 1.00 39.27 ? 2003 HOH B O   1 
HETATM 8535 O O   . HOH H 5 .   ? 9.469   1.259   -68.260 1.00 29.34 ? 2004 HOH B O   1 
HETATM 8536 O O   . HOH H 5 .   ? 15.717  5.233   -69.192 1.00 45.60 ? 2005 HOH B O   1 
HETATM 8537 O O   . HOH H 5 .   ? -0.675  7.471   -72.876 1.00 40.38 ? 2006 HOH B O   1 
HETATM 8538 O O   . HOH H 5 .   ? 12.424  -5.252  -54.345 1.00 50.79 ? 2007 HOH B O   1 
HETATM 8539 O O   . HOH H 5 .   ? 14.332  -7.288  -48.805 1.00 46.31 ? 2008 HOH B O   1 
HETATM 8540 O O   . HOH H 5 .   ? 7.103   -8.214  -44.892 1.00 34.65 ? 2009 HOH B O   1 
HETATM 8541 O O   . HOH H 5 .   ? 3.392   -14.000 -38.308 1.00 48.14 ? 2010 HOH B O   1 
HETATM 8542 O O   . HOH H 5 .   ? 4.503   -3.908  -42.673 1.00 36.16 ? 2011 HOH B O   1 
HETATM 8543 O O   . HOH H 5 .   ? -0.791  -11.164 -45.679 1.00 50.08 ? 2012 HOH B O   1 
HETATM 8544 O O   . HOH H 5 .   ? -5.112  -6.842  -47.633 1.00 45.90 ? 2013 HOH B O   1 
HETATM 8545 O O   . HOH H 5 .   ? 2.837   -11.695 -51.107 1.00 50.88 ? 2014 HOH B O   1 
HETATM 8546 O O   . HOH H 5 .   ? 4.771   -13.035 -53.516 1.00 54.07 ? 2015 HOH B O   1 
HETATM 8547 O O   . HOH H 5 .   ? 10.264  -5.939  -64.638 1.00 30.97 ? 2016 HOH B O   1 
HETATM 8548 O O   . HOH H 5 .   ? 4.473   4.724   -48.430 1.00 37.19 ? 2017 HOH B O   1 
HETATM 8549 O O   . HOH H 5 .   ? 10.618  0.079   -43.964 1.00 38.63 ? 2018 HOH B O   1 
HETATM 8550 O O   . HOH H 5 .   ? 6.922   -2.486  -50.421 1.00 53.25 ? 2019 HOH B O   1 
HETATM 8551 O O   . HOH H 5 .   ? -5.557  -2.406  -48.985 1.00 41.32 ? 2020 HOH B O   1 
HETATM 8552 O O   . HOH H 5 .   ? -3.241  1.083   -48.517 1.00 36.63 ? 2021 HOH B O   1 
HETATM 8553 O O   . HOH H 5 .   ? -8.815  -0.251  -45.396 1.00 47.93 ? 2022 HOH B O   1 
HETATM 8554 O O   . HOH H 5 .   ? 1.616   0.070   -53.148 1.00 38.56 ? 2023 HOH B O   1 
HETATM 8555 O O   . HOH H 5 .   ? 16.787  -8.134  -48.557 1.00 46.03 ? 2024 HOH B O   1 
HETATM 8556 O O   . HOH H 5 .   ? 21.876  2.195   -47.547 1.00 46.77 ? 2025 HOH B O   1 
HETATM 8557 O O   . HOH H 5 .   ? 1.764   19.351  -59.939 1.00 49.32 ? 2026 HOH B O   1 
HETATM 8558 O O   . HOH H 5 .   ? 0.232   19.733  -47.238 1.00 31.77 ? 2027 HOH B O   1 
HETATM 8559 O O   . HOH H 5 .   ? 4.419   2.134   -40.814 1.00 29.58 ? 2028 HOH B O   1 
HETATM 8560 O O   . HOH H 5 .   ? 5.623   -1.705  -38.852 1.00 50.67 ? 2029 HOH B O   1 
HETATM 8561 O O   . HOH H 5 .   ? 22.613  15.566  -45.775 1.00 39.62 ? 2030 HOH B O   1 
HETATM 8562 O O   . HOH H 5 .   ? 22.234  17.494  -47.731 1.00 46.45 ? 2031 HOH B O   1 
HETATM 8563 O O   . HOH H 5 .   ? 12.826  21.153  -56.641 1.00 49.84 ? 2032 HOH B O   1 
HETATM 8564 O O   . HOH H 5 .   ? 6.464   16.744  -53.507 1.00 43.99 ? 2033 HOH B O   1 
HETATM 8565 O O   . HOH H 5 .   ? 10.073  24.021  -49.982 1.00 45.04 ? 2034 HOH B O   1 
HETATM 8566 O O   . HOH H 5 .   ? 13.574  6.736   -33.479 1.00 34.08 ? 2035 HOH B O   1 
HETATM 8567 O O   . HOH H 5 .   ? 17.149  5.668   -34.900 1.00 40.30 ? 2036 HOH B O   1 
HETATM 8568 O O   . HOH H 5 .   ? 22.572  1.326   -36.413 1.00 45.95 ? 2037 HOH B O   1 
HETATM 8569 O O   . HOH H 5 .   ? 30.134  1.136   -36.110 1.00 38.99 ? 2038 HOH B O   1 
HETATM 8570 O O   . HOH H 5 .   ? 25.326  -2.823  -46.733 1.00 45.75 ? 2039 HOH B O   1 
HETATM 8571 O O   . HOH H 5 .   ? 33.558  2.525   -47.357 1.00 53.68 ? 2040 HOH B O   1 
HETATM 8572 O O   . HOH H 5 .   ? 13.543  -7.898  -46.454 1.00 39.26 ? 2041 HOH B O   1 
HETATM 8573 O O   . HOH H 5 .   ? 13.215  -6.405  -33.350 1.00 49.37 ? 2042 HOH B O   1 
HETATM 8574 O O   . HOH H 5 .   ? 19.022  -1.038  -37.411 1.00 44.10 ? 2043 HOH B O   1 
HETATM 8575 O O   . HOH H 5 .   ? 16.512  -3.134  -42.784 1.00 35.34 ? 2044 HOH B O   1 
HETATM 8576 O O   . HOH H 5 .   ? 31.851  9.431   -45.790 1.00 48.20 ? 2045 HOH B O   1 
HETATM 8577 O O   . HOH H 5 .   ? 31.137  11.015  -43.931 1.00 43.32 ? 2046 HOH B O   1 
HETATM 8578 O O   . HOH H 5 .   ? 6.542   4.284   -24.933 1.00 40.18 ? 2047 HOH B O   1 
HETATM 8579 O O   . HOH H 5 .   ? 1.428   -1.280  -19.596 1.00 51.41 ? 2048 HOH B O   1 
HETATM 8580 O O   . HOH H 5 .   ? 12.097  -18.271 -24.434 1.00 46.65 ? 2049 HOH B O   1 
HETATM 8581 O O   . HOH H 5 .   ? 6.790   -18.186 -21.859 1.00 46.52 ? 2050 HOH B O   1 
HETATM 8582 O O   . HOH H 5 .   ? 23.605  -8.804  -26.864 1.00 39.72 ? 2051 HOH B O   1 
HETATM 8583 O O   . HOH H 5 .   ? 24.103  1.865   -32.673 1.00 42.11 ? 2052 HOH B O   1 
HETATM 8584 O O   . HOH H 5 .   ? 32.023  -4.704  -21.434 1.00 53.21 ? 2053 HOH B O   1 
HETATM 8585 O O   . HOH H 5 .   ? 10.920  -7.175  -5.095  1.00 48.62 ? 2054 HOH B O   1 
HETATM 8586 O O   . HOH H 5 .   ? 22.587  10.730  -28.200 1.00 53.29 ? 2055 HOH B O   1 
HETATM 8587 O O   . HOH H 5 .   ? -0.281  26.972  -32.550 1.00 32.04 ? 2056 HOH B O   1 
HETATM 8588 O O   . HOH H 5 .   ? 3.365   7.873   -33.269 1.00 33.89 ? 2057 HOH B O   1 
HETATM 8589 O O   . HOH H 5 .   ? 3.733   3.769   -33.827 1.00 38.52 ? 2058 HOH B O   1 
HETATM 8590 O O   . HOH H 5 .   ? -6.645  -3.040  -34.189 1.00 49.40 ? 2059 HOH B O   1 
HETATM 8591 O O   . HOH H 5 .   ? -2.678  0.965   -36.812 1.00 39.81 ? 2060 HOH B O   1 
HETATM 8592 O O   . HOH H 5 .   ? -13.437 -8.061  -37.964 1.00 46.02 ? 2061 HOH B O   1 
HETATM 8593 O O   . HOH H 5 .   ? -8.025  19.718  -47.618 1.00 54.48 ? 2062 HOH B O   1 
HETATM 8594 O O   . HOH H 5 .   ? 3.614   20.206  -28.443 1.00 38.27 ? 2063 HOH B O   1 
HETATM 8595 O O   . HOH H 5 .   ? 8.306   24.813  -31.501 1.00 37.64 ? 2064 HOH B O   1 
HETATM 8596 O O   . HOH H 5 .   ? 6.390   24.305  -25.018 1.00 31.10 ? 2065 HOH B O   1 
HETATM 8597 O O   . HOH H 5 .   ? 12.315  26.616  -27.911 1.00 42.44 ? 2066 HOH B O   1 
HETATM 8598 O O   . HOH H 5 .   ? 12.064  27.413  -25.347 1.00 49.89 ? 2067 HOH B O   1 
HETATM 8599 O O   . HOH H 5 .   ? 10.945  16.800  -23.145 1.00 45.48 ? 2068 HOH B O   1 
HETATM 8600 O O   . HOH H 5 .   ? 1.573   23.471  -19.695 1.00 52.74 ? 2069 HOH B O   1 
HETATM 8601 O O   . HOH H 5 .   ? -8.578  6.972   -23.724 1.00 47.88 ? 2070 HOH B O   1 
HETATM 8602 O O   . HOH H 5 .   ? -8.518  15.802  -20.546 1.00 47.53 ? 2071 HOH B O   1 
HETATM 8603 O O   . HOH H 5 .   ? -4.283  21.218  -20.416 1.00 34.73 ? 2072 HOH B O   1 
HETATM 8604 O O   . HOH H 5 .   ? 12.633  15.081  -22.763 1.00 40.34 ? 2073 HOH B O   1 
HETATM 8605 O O   . HOH H 5 .   ? 6.624   11.938  -19.341 1.00 40.94 ? 2074 HOH B O   1 
HETATM 8606 O O   . HOH H 5 .   ? 31.870  14.868  -18.288 1.00 49.44 ? 2075 HOH B O   1 
HETATM 8607 O O   . HOH H 5 .   ? 13.551  8.047   -13.289 1.00 53.09 ? 2076 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SVV 203 203 203 SVV SVV A . y 
A 1 203 SVW 203 203 203 SVW SVW A . y 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SVV 203 203 203 SVV SVV B . y 
B 1 203 SVW 203 203 203 SVW SVW B . y 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
B 1 544 ALA 544 544 544 ALA ALA B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLU 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   1545 1545 NAG NAG A . 
D 2 NAG 1   1546 1546 NAG NAG A . 
E 3 AE3 1   1547 1547 AE3 AE3 A . 
F 4 P6G 1   1546 1546 P6G P6G B . 
G 5 HOH 1   2001 2001 HOH HOH A . 
G 5 HOH 2   2002 2002 HOH HOH A . 
G 5 HOH 3   2003 2003 HOH HOH A . 
G 5 HOH 4   2004 2004 HOH HOH A . 
G 5 HOH 5   2005 2005 HOH HOH A . 
G 5 HOH 6   2006 2006 HOH HOH A . 
G 5 HOH 7   2007 2007 HOH HOH A . 
G 5 HOH 8   2008 2008 HOH HOH A . 
G 5 HOH 9   2009 2009 HOH HOH A . 
G 5 HOH 10  2010 2010 HOH HOH A . 
G 5 HOH 11  2011 2011 HOH HOH A . 
G 5 HOH 12  2012 2012 HOH HOH A . 
G 5 HOH 13  2013 2013 HOH HOH A . 
G 5 HOH 14  2014 2014 HOH HOH A . 
G 5 HOH 15  2015 2015 HOH HOH A . 
G 5 HOH 16  2016 2016 HOH HOH A . 
G 5 HOH 17  2017 2017 HOH HOH A . 
G 5 HOH 18  2018 2018 HOH HOH A . 
G 5 HOH 19  2019 2019 HOH HOH A . 
G 5 HOH 20  2020 2020 HOH HOH A . 
G 5 HOH 21  2021 2021 HOH HOH A . 
G 5 HOH 22  2022 2022 HOH HOH A . 
G 5 HOH 23  2023 2023 HOH HOH A . 
G 5 HOH 24  2024 2024 HOH HOH A . 
G 5 HOH 25  2025 2025 HOH HOH A . 
G 5 HOH 26  2026 2026 HOH HOH A . 
G 5 HOH 27  2027 2027 HOH HOH A . 
G 5 HOH 28  2028 2028 HOH HOH A . 
G 5 HOH 29  2029 2029 HOH HOH A . 
G 5 HOH 30  2030 2030 HOH HOH A . 
G 5 HOH 31  2031 2031 HOH HOH A . 
G 5 HOH 32  2032 2032 HOH HOH A . 
G 5 HOH 33  2033 2033 HOH HOH A . 
G 5 HOH 34  2034 2034 HOH HOH A . 
G 5 HOH 35  2035 2035 HOH HOH A . 
G 5 HOH 36  2036 2036 HOH HOH A . 
G 5 HOH 37  2037 2037 HOH HOH A . 
G 5 HOH 38  2038 2038 HOH HOH A . 
G 5 HOH 39  2039 2039 HOH HOH A . 
G 5 HOH 40  2040 2040 HOH HOH A . 
G 5 HOH 41  2041 2041 HOH HOH A . 
G 5 HOH 42  2042 2042 HOH HOH A . 
G 5 HOH 43  2043 2043 HOH HOH A . 
G 5 HOH 44  2044 2044 HOH HOH A . 
G 5 HOH 45  2045 2045 HOH HOH A . 
G 5 HOH 46  2046 2046 HOH HOH A . 
G 5 HOH 47  2047 2047 HOH HOH A . 
G 5 HOH 48  2048 2048 HOH HOH A . 
G 5 HOH 49  2049 2049 HOH HOH A . 
G 5 HOH 50  2050 2050 HOH HOH A . 
G 5 HOH 51  2051 2051 HOH HOH A . 
G 5 HOH 52  2052 2052 HOH HOH A . 
G 5 HOH 53  2053 2053 HOH HOH A . 
G 5 HOH 54  2054 2054 HOH HOH A . 
G 5 HOH 55  2055 2055 HOH HOH A . 
G 5 HOH 56  2056 2056 HOH HOH A . 
G 5 HOH 57  2057 2057 HOH HOH A . 
G 5 HOH 58  2058 2058 HOH HOH A . 
G 5 HOH 59  2059 2059 HOH HOH A . 
G 5 HOH 60  2060 2060 HOH HOH A . 
G 5 HOH 61  2061 2061 HOH HOH A . 
G 5 HOH 62  2062 2062 HOH HOH A . 
G 5 HOH 63  2063 2063 HOH HOH A . 
G 5 HOH 64  2064 2064 HOH HOH A . 
G 5 HOH 65  2065 2065 HOH HOH A . 
G 5 HOH 66  2066 2066 HOH HOH A . 
G 5 HOH 67  2067 2067 HOH HOH A . 
G 5 HOH 68  2068 2068 HOH HOH A . 
G 5 HOH 69  2069 2069 HOH HOH A . 
G 5 HOH 70  2070 2070 HOH HOH A . 
G 5 HOH 71  2071 2071 HOH HOH A . 
G 5 HOH 72  2072 2072 HOH HOH A . 
G 5 HOH 73  2073 2073 HOH HOH A . 
G 5 HOH 74  2074 2074 HOH HOH A . 
G 5 HOH 75  2075 2075 HOH HOH A . 
G 5 HOH 76  2076 2076 HOH HOH A . 
G 5 HOH 77  2077 2077 HOH HOH A . 
G 5 HOH 78  2078 2078 HOH HOH A . 
G 5 HOH 79  2079 2079 HOH HOH A . 
G 5 HOH 80  2080 2080 HOH HOH A . 
G 5 HOH 81  2081 2081 HOH HOH A . 
G 5 HOH 82  2082 2082 HOH HOH A . 
G 5 HOH 83  2083 2083 HOH HOH A . 
G 5 HOH 84  2084 2084 HOH HOH A . 
G 5 HOH 85  2085 2085 HOH HOH A . 
G 5 HOH 86  2086 2086 HOH HOH A . 
G 5 HOH 87  2087 2087 HOH HOH A . 
G 5 HOH 88  2088 2088 HOH HOH A . 
G 5 HOH 89  2089 2089 HOH HOH A . 
G 5 HOH 90  2090 2090 HOH HOH A . 
G 5 HOH 91  2091 2091 HOH HOH A . 
G 5 HOH 92  2092 2092 HOH HOH A . 
G 5 HOH 93  2093 2093 HOH HOH A . 
G 5 HOH 94  2094 2094 HOH HOH A . 
G 5 HOH 95  2095 2095 HOH HOH A . 
G 5 HOH 96  2096 2096 HOH HOH A . 
G 5 HOH 97  2097 2097 HOH HOH A . 
G 5 HOH 98  2098 2098 HOH HOH A . 
G 5 HOH 99  2099 2099 HOH HOH A . 
G 5 HOH 100 2100 2100 HOH HOH A . 
G 5 HOH 101 2101 2101 HOH HOH A . 
H 5 HOH 1   2001 2001 HOH HOH B . 
H 5 HOH 2   2002 2002 HOH HOH B . 
H 5 HOH 3   2003 2003 HOH HOH B . 
H 5 HOH 4   2004 2004 HOH HOH B . 
H 5 HOH 5   2005 2005 HOH HOH B . 
H 5 HOH 6   2006 2006 HOH HOH B . 
H 5 HOH 7   2007 2007 HOH HOH B . 
H 5 HOH 8   2008 2008 HOH HOH B . 
H 5 HOH 9   2009 2009 HOH HOH B . 
H 5 HOH 10  2010 2010 HOH HOH B . 
H 5 HOH 11  2011 2011 HOH HOH B . 
H 5 HOH 12  2012 2012 HOH HOH B . 
H 5 HOH 13  2013 2013 HOH HOH B . 
H 5 HOH 14  2014 2014 HOH HOH B . 
H 5 HOH 15  2015 2015 HOH HOH B . 
H 5 HOH 16  2016 2016 HOH HOH B . 
H 5 HOH 17  2017 2017 HOH HOH B . 
H 5 HOH 18  2018 2018 HOH HOH B . 
H 5 HOH 19  2019 2019 HOH HOH B . 
H 5 HOH 20  2020 2020 HOH HOH B . 
H 5 HOH 21  2021 2021 HOH HOH B . 
H 5 HOH 22  2022 2022 HOH HOH B . 
H 5 HOH 23  2023 2023 HOH HOH B . 
H 5 HOH 24  2024 2024 HOH HOH B . 
H 5 HOH 25  2025 2025 HOH HOH B . 
H 5 HOH 26  2026 2026 HOH HOH B . 
H 5 HOH 27  2027 2027 HOH HOH B . 
H 5 HOH 28  2028 2028 HOH HOH B . 
H 5 HOH 29  2029 2029 HOH HOH B . 
H 5 HOH 30  2030 2030 HOH HOH B . 
H 5 HOH 31  2031 2031 HOH HOH B . 
H 5 HOH 32  2032 2032 HOH HOH B . 
H 5 HOH 33  2033 2033 HOH HOH B . 
H 5 HOH 34  2034 2034 HOH HOH B . 
H 5 HOH 35  2035 2035 HOH HOH B . 
H 5 HOH 36  2036 2036 HOH HOH B . 
H 5 HOH 37  2037 2037 HOH HOH B . 
H 5 HOH 38  2038 2038 HOH HOH B . 
H 5 HOH 39  2039 2039 HOH HOH B . 
H 5 HOH 40  2040 2040 HOH HOH B . 
H 5 HOH 41  2041 2041 HOH HOH B . 
H 5 HOH 42  2042 2042 HOH HOH B . 
H 5 HOH 43  2043 2043 HOH HOH B . 
H 5 HOH 44  2044 2044 HOH HOH B . 
H 5 HOH 45  2045 2045 HOH HOH B . 
H 5 HOH 46  2046 2046 HOH HOH B . 
H 5 HOH 47  2047 2047 HOH HOH B . 
H 5 HOH 48  2048 2048 HOH HOH B . 
H 5 HOH 49  2049 2049 HOH HOH B . 
H 5 HOH 50  2050 2050 HOH HOH B . 
H 5 HOH 51  2051 2051 HOH HOH B . 
H 5 HOH 52  2052 2052 HOH HOH B . 
H 5 HOH 53  2053 2053 HOH HOH B . 
H 5 HOH 54  2054 2054 HOH HOH B . 
H 5 HOH 55  2055 2055 HOH HOH B . 
H 5 HOH 56  2056 2056 HOH HOH B . 
H 5 HOH 57  2057 2057 HOH HOH B . 
H 5 HOH 58  2058 2058 HOH HOH B . 
H 5 HOH 59  2059 2059 HOH HOH B . 
H 5 HOH 60  2060 2060 HOH HOH B . 
H 5 HOH 61  2061 2061 HOH HOH B . 
H 5 HOH 62  2062 2062 HOH HOH B . 
H 5 HOH 63  2063 2063 HOH HOH B . 
H 5 HOH 64  2064 2064 HOH HOH B . 
H 5 HOH 65  2065 2065 HOH HOH B . 
H 5 HOH 66  2066 2066 HOH HOH B . 
H 5 HOH 67  2067 2067 HOH HOH B . 
H 5 HOH 68  2068 2068 HOH HOH B . 
H 5 HOH 69  2069 2069 HOH HOH B . 
H 5 HOH 70  2070 2070 HOH HOH B . 
H 5 HOH 71  2071 2071 HOH HOH B . 
H 5 HOH 72  2072 2072 HOH HOH B . 
H 5 HOH 73  2073 2073 HOH HOH B . 
H 5 HOH 74  2074 2074 HOH HOH B . 
H 5 HOH 75  2075 2075 HOH HOH B . 
H 5 HOH 76  2076 2076 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 A SVV 203 A SVV 203 ? SER ?                    
4 A SVW 203 A SVW 203 ? SER ?                    
5 B SVV 203 B SVV 203 ? SER ?                    
6 B SVW 203 B SVW 203 ? SER ?                    
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3510  ? 
1 MORE         1     ? 
1 'SSA (A^2)'  38420 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-17 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-17 
5 'Structure model' 1 4 2020-07-29 
6 'Structure model' 1 5 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Structure summary'         
7 6 'Structure model' 'Derived calculations'      
8 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_source             
2  5 'Structure model' chem_comp                 
3  5 'Structure model' entity                    
4  5 'Structure model' pdbx_chem_comp_identifier 
5  5 'Structure model' pdbx_entity_nonpoly       
6  5 'Structure model' struct_conn               
7  5 'Structure model' struct_site               
8  5 'Structure model' struct_site_gen           
9  6 'Structure model' chem_comp                 
10 6 'Structure model' pdbx_struct_assembly      
11 6 'Structure model' pdbx_struct_assembly_gen  
12 6 'Structure model' pdbx_struct_assembly_prop 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 5 'Structure model' '_chem_comp.name'                      
3 5 'Structure model' '_chem_comp.type'                      
4 5 'Structure model' '_entity.pdbx_description'             
5 5 'Structure model' '_pdbx_entity_nonpoly.name'            
6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
7 5 'Structure model' '_struct_conn.pdbx_role'               
8 6 'Structure model' '_chem_comp.pdbx_synonyms'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
CCP4   phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id                 2JGJ 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       'P6G REPRESENTS PEG600 THAT WAS USED IN CRYSTALLIZATION.' 
_pdbx_entry_details.sequence_details         
;GAP BETWEEN RESIDUES 257 AND 265 (MONOMER A AND B), START
AT RESIDUE 4
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 76.41   -9.32   
2  1 PRO A 49  ? ? -49.62  153.71  
3  1 ALA A 62  ? ? -118.93 50.47   
4  1 ASN A 67  ? ? -47.36  153.12  
5  1 CYS A 96  ? ? -143.31 -0.65   
6  1 ALA A 127 ? ? -176.00 144.63  
7  1 PHE A 158 ? ? -142.69 -3.24   
8  1 ALA A 167 ? ? -168.28 69.09   
9  1 SVV A 203 ? A 58.11   -113.93 
10 1 SVW A 203 ? B 58.11   -113.93 
11 1 ASP A 306 ? ? -131.20 -86.53  
12 1 TYR A 341 ? ? -99.07  30.98   
13 1 SER A 371 ? ? -68.10  -170.37 
14 1 VAL A 407 ? ? -122.47 -63.83  
15 1 ARG A 493 ? ? -63.32  -86.94  
16 1 ASP A 494 ? ? -33.35  93.66   
17 1 LEU A 518 ? ? -37.20  124.87  
18 1 SER A 541 ? ? -94.16  48.56   
19 1 PRO B 111 ? ? -37.23  127.14  
20 1 ALA B 127 ? ? -170.70 145.51  
21 1 ALA B 167 ? ? -161.20 60.38   
22 1 SVV B 203 ? A 53.16   -116.14 
23 1 SVW B 203 ? B 53.16   -116.14 
24 1 ASP B 306 ? ? -115.87 -86.45  
25 1 ASP B 323 ? ? -97.43  36.29   
26 1 VAL B 407 ? ? -127.23 -63.36  
27 1 PRO B 458 ? ? -55.18  -8.33   
28 1 LYS B 496 ? ? 66.75   129.32  
29 1 SER B 497 ? ? -142.32 -57.38  
30 1 ASN B 514 ? ? -160.88 -169.66 
31 1 THR B 543 ? ? -131.76 -110.42 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B ALA 544 ? CA ? B ALA 544 CA 
2 1 Y 1 B ALA 544 ? C  ? B ALA 544 C  
3 1 Y 1 B ALA 544 ? O  ? B ALA 544 O  
4 1 Y 1 B ALA 544 ? CB ? B ALA 544 CB 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 A ALA 544 ? A ALA 544 
10 1 Y 1 A THR 545 ? A THR 545 
11 1 Y 1 A GLU 546 ? A GLU 546 
12 1 Y 1 A ALA 547 ? A ALA 547 
13 1 Y 1 A PRO 548 ? A PRO 548 
14 1 Y 1 B GLU 1   ? B GLU 1   
15 1 Y 1 B GLY 2   ? B GLY 2   
16 1 Y 1 B ARG 3   ? B ARG 3   
17 1 Y 1 B PRO 258 ? B PRO 258 
18 1 Y 1 B PRO 259 ? B PRO 259 
19 1 Y 1 B GLY 260 ? B GLY 260 
20 1 Y 1 B GLY 261 ? B GLY 261 
21 1 Y 1 B ALA 262 ? B ALA 262 
22 1 Y 1 B GLY 263 ? B GLY 263 
23 1 Y 1 B GLY 264 ? B GLY 264 
24 1 Y 1 B THR 545 ? B THR 545 
25 1 Y 1 B GLU 546 ? B GLU 546 
26 1 Y 1 B ALA 547 ? B ALA 547 
27 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 '2-(2-ETHOXYETHOXY)ETHANOL'              AE3 
4 'HEXAETHYLENE GLYCOL'                    P6G 
5 water                                    HOH 
#