data_2JGK
# 
_entry.id   2JGK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JGK         
PDBE  EBI-31418    
WWPDB D_1290031418 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JGK 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hornberg, A.'    1 
'Tunemalm, A.-K.' 2 
'Ekstrom, F.'     3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structures of Acetylcholinesterase in Complex with Organophosphorus Compounds Suggest that the Acyl Pocket Modulates the Aging Reaction by Precluding the Formation of the Trigonal Bipyramidal Transition State.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                4815 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17402711 
_citation.pdbx_database_id_DOI      10.1021/BI0621361 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hornberg, A.'    1 
primary 'Tunemalm, A.-K.' 2 
primary 'Ekstrom, F.'     3 
# 
_cell.entry_id           2JGK 
_cell.length_a           79.710 
_cell.length_b           111.260 
_cell.length_c           226.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JGK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE   60355.062 2  3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE 221.208   1  ?       ? ?                                   ? 
3 non-polymer syn 'HEXAETHYLENE GLYCOL'  282.331   1  ?       ? ?                                   ? 
4 water       nat water                  18.015    63 ?       ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SVZ)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SVZ n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PCDNA3.1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACES_MOUSE 1 ? ? P21836 ? 
2 PDB 2JGK       1 ? ? 2JGK   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JGK A 1   ? 543 ? P21836 32  ? 574 ? 1   543 
2 2 2JGK A 544 ? 548 ? 2JGK   544 ? 548 ? 544 548 
3 1 2JGK B 1   ? 543 ? P21836 32  ? 574 ? 1   543 
4 2 2JGK B 544 ? 548 ? 2JGK   544 ? 548 ? 544 548 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                              ?                            'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                             ?                            'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                           ?                            'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                      ?                            'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                             ?                            'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                            ?                            'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                      ?                            'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                              ?                            'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                            ?                            'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                ?                            'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                           ?                            'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                              ?                            'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                               ?                            'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                           ?                            'C5 H11 N O2 S'  
149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                               ?                            'C8 H15 N O6'    
221.208 
P6G non-polymer         . 'HEXAETHYLENE GLYCOL'                                'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     
282.331 
PHE 'L-peptide linking' y PHENYLALANINE                                        ?                            'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                              ?                            'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                               ?                            'C3 H7 N O3'     
105.093 
SVZ 'L-peptide linking' n 'O-[(S)-HYDROXY(ISOPROPYLAMINO)PHOSPHORYL]-L-SERINE' ?                            'C6 H15 N2 O5 P' 
226.167 
THR 'L-peptide linking' y THREONINE                                            ?                            'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                           ?                            'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                             ?                            'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                               ?                            'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          2JGK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.9 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '28% PEG 750MME, 0.1 M HEPES PH7.0, pH 7.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-04-04 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07962 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.07962 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JGK 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.900 
_reflns.number_obs                   45507 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.08000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.06 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.39000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.700 
_reflns_shell.pdbx_redundancy        7.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JGK 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     44550 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.93 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  890 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.892 
_refine.B_iso_mean                               54.61 
_refine.aniso_B[1][1]                            0.07000 
_refine.aniso_B[2][2]                            0.00000 
_refine.aniso_B[3][3]                            -0.06000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 2 CHAIN(S).
;
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.527 
_refine.pdbx_overall_ESU_R_Free                  0.321 
_refine.overall_SU_ML                            0.262 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             14.017 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8341 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             63 
_refine_hist.number_atoms_total               8437 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        19.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 8626  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.327  1.961  ? 11776 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.281  5.000  ? 1061  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.771 22.828 ? 396   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.232 15.000 ? 1260  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.425 15.000 ? 73    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 1266  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 6779  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.219  0.200  ? 4130  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.316  0.200  ? 5902  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.140  0.200  ? 244   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.208  0.200  ? 28    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.317  0.200  ? 6     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.663  1.500  ? 5405  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.199  2.000  ? 8564  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.251  3.000  ? 3672  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.153  4.500  ? 3212  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             3207 
_refine_ls_shell.R_factor_R_work                  0.3170 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3610 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2JGK 
_struct.title                     'Crystal structure of mouse acetylcholinesterase inhibited by aged fenamiphos' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JGK 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'AGING, SYNAPSE, MEMBRANE, HYDROLASE, NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN, SERINE ESTERASE, ALTERNATIVE SPLICING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SVZ A 203 ? SER A 215 ? SVZ A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 ALA A 241 ? GLY A 256 ? ALA A 241 GLY A 256 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 THR A 311 ? ASN A 317 ? THR A 311 ASN A 317 1 ? 7  
HELX_P HELX_P15 15 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P16 16 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 17 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 18 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 19 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 20 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 21 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 22 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23 23 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? LEU A 539 ? ARG A 534 LEU A 539 1 ? 6  
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SVZ B 203 ? LEU B 214 ? SVZ B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P40 40 GLU B 285 ? VAL B 288 ? GLU B 285 VAL B 288 5 ? 4  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? LEU B 540 ? ARG B 525 LEU B 540 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf2 disulf ? ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf3 disulf ? ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.099 ? 
disulf4 disulf ? ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5 disulf ? ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf6 disulf ? ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.055 ? 
covale1 covale ? ? A GLU 202 C   ? ? ? 1_555 A SVZ 203 N  ? ? A GLU 202 A SVZ 203  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale2 covale ? ? A SVZ 203 C   ? ? ? 1_555 A ALA 204 N  ? ? A SVZ 203 A ALA 204  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3 covale ? ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 1544 1_555 ? ? ? ? ? ? ? 1.460 ? 
covale4 covale ? ? B GLU 202 C   ? ? ? 1_555 B SVZ 203 N  ? ? B GLU 202 B SVZ 203  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale5 covale ? ? B SVZ 203 C   ? ? ? 1_555 B ALA 204 N  ? ? B SVZ 203 B ALA 204  1_555 ? ? ? ? ? ? ? 1.338 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -5.64 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 3.62  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -2.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
AD ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
AD 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
AD 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
AD 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BC 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
AD 1  2  O VAL A 239 ? O VAL A 239 N VAL A 303 ? N VAL A 303 
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE P6G B 1542'                           
AC2 Software ? ? ? ? 2 'Binding site for Mono-Saccharide NAG A1544 bound to ASN A 350' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 LEU A 380 ? LEU A 380 . ? 1_555 ? 
2  AC1 9 HIS A 381 ? HIS A 381 . ? 1_555 ? 
3  AC1 9 GLN A 527 ? GLN A 527 . ? 1_555 ? 
4  AC1 9 PHE A 535 ? PHE A 535 . ? 1_555 ? 
5  AC1 9 LEU B 380 ? LEU B 380 . ? 1_555 ? 
6  AC1 9 HIS B 381 ? HIS B 381 . ? 1_555 ? 
7  AC1 9 GLN B 527 ? GLN B 527 . ? 1_555 ? 
8  AC1 9 PHE B 531 ? PHE B 531 . ? 1_555 ? 
9  AC1 9 PHE B 535 ? PHE B 535 . ? 1_555 ? 
10 AC2 2 SER A 347 ? SER A 347 . ? 1_555 ? 
11 AC2 2 ASN A 350 ? ASN A 350 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JGK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JGK 
_atom_sites.fract_transf_matrix[1][1]   0.012545 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008988 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004405 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.927  14.785  56.053  1.00 77.38  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.566  15.002  55.484  1.00 77.42  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.798  15.951  56.388  1.00 76.87  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 29.878  17.168  56.227  1.00 76.95  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.804  13.671  55.334  1.00 77.64  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.596  12.526  54.648  1.00 78.39  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.787  11.225  54.479  1.00 78.07  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.638  11.121  54.982  1.00 77.88  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.315  10.300  53.827  1.00 78.71  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 29.066  15.380  57.344  1.00 76.32  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.317  16.150  58.327  1.00 75.34  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 27.080  16.776  57.732  1.00 74.74  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 26.036  16.122  57.629  1.00 74.38  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.228  18.038  57.315  1.00 74.18  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.118  18.872  56.833  1.00 73.73  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.639  18.636  55.381  1.00 72.95  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.455  18.813  55.105  1.00 73.21  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.398  20.366  57.089  1.00 74.02  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 25.664  20.956  58.325  1.00 75.60  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 26.454  20.816  59.668  1.00 77.45  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.646  20.637  60.901  1.00 78.55  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.330  20.368  60.977  1.00 78.86  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.572  20.245  59.887  1.00 79.67  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 23.755  20.214  62.165  1.00 77.24  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.542  18.245  54.474  1.00 71.74  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 26.221  17.946  53.062  1.00 70.35  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.935  17.159  52.812  1.00 69.10  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.556  16.302  53.605  1.00 68.87  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 27.364  17.157  52.426  1.00 70.68  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.351  18.000  51.649  1.00 72.10  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.778  17.503  51.804  1.00 73.19  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.160  17.121  52.932  1.00 73.94  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 30.521  17.504  50.806  1.00 72.83  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 24.290  17.439  51.683  1.00 67.59  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 23.151  16.660  51.230  1.00 66.13  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.614  15.223  51.035  1.00 65.60  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.467  14.965  50.191  1.00 65.62  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.629  17.241  49.914  1.00 65.91  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.365  16.548  49.401  1.00 64.67  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 21.010  15.449  49.868  1.00 63.06  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.724  17.117  48.494  1.00 63.84  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 23.062  14.281  51.824  1.00 65.12  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.465  12.862  51.755  1.00 64.43  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 23.182  12.197  50.406  1.00 63.50  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.850  11.225  50.043  1.00 63.96  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.621  12.196  52.852  1.00 64.56  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.442  13.105  53.041  1.00 65.18  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 22.006  14.496  52.834  1.00 65.35  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 22.217  12.722  49.664  1.00 62.06  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.846  12.139  48.387  1.00 60.90  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.885  12.382  47.282  1.00 59.56  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.753  11.874  46.167  1.00 59.53  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.474  12.665  47.972  1.00 61.29  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.823  11.890  46.822  1.00 63.70  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.620  10.402  47.118  1.00 66.02  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.983  9.550   46.305  1.00 66.04  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 19.025  10.087  48.282  1.00 67.20  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.927  13.141  47.609  1.00 57.92  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.859  13.653  46.613  1.00 56.17  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 26.291  13.197  46.837  1.00 55.65  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 27.206  13.684  46.173  1.00 55.79  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.808  15.184  46.592  1.00 55.68  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.536  15.822  46.054  1.00 54.06  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.570  17.310  46.273  1.00 53.98  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 23.387  15.512  44.588  1.00 53.85  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.493  12.290  47.790  1.00 54.79  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.817  11.713  48.022  1.00 53.70  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.801  10.281  47.520  1.00 52.84  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 27.029  9.443   48.017  1.00 52.65  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 28.210  11.766  49.498  1.00 53.74  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 28.089  13.123  50.203  1.00 54.61  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 28.232  12.997  51.719  1.00 54.58  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 29.094  14.129  49.659  1.00 55.99  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.619  10.027  46.499  1.00 51.49  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.773  8.694   45.929  1.00 50.29  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.257  8.316   45.917  1.00 49.91  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 31.134  9.194   45.831  1.00 49.47  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 28.176  8.617   44.509  1.00 50.13  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.298  7.220   43.930  1.00 49.65  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.732  9.018   44.537  1.00 49.55  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.527  7.015   46.054  1.00 49.35  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.882  6.486   45.899  1.00 48.67  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.981  5.651   44.638  1.00 48.20  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 31.066  4.894   44.314  1.00 48.36  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 32.294  5.648   47.104  1.00 48.79  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.610  4.888   46.913  1.00 48.54  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.999  4.074   48.157  1.00 48.63  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.524  4.916   49.229  1.00 47.13  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.767  5.375   49.253  1.00 46.95  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 36.173  6.149   50.257  1.00 45.97  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.593  5.070   48.253  1.00 46.26  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 33.097  5.810   43.933  1.00 47.45  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.423  5.008   42.766  1.00 46.75  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.815  4.415   42.965  1.00 46.62  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.529  4.817   43.882  1.00 46.94  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 33.383  5.852   41.478  1.00 46.65  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.945  6.182   41.094  1.00 45.77  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 34.221  7.121   41.640  1.00 46.17  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 35.210  3.484   42.097  1.00 46.20  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.513  2.808   42.189  1.00 45.77  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.719  3.730   42.433  1.00 46.22  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.699  3.320   43.025  1.00 46.59  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.716  1.931   40.957  1.00 45.28  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 38.085  1.290   40.768  1.00 44.62  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 38.437  0.212   41.770  1.00 41.51  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 39.598  0.635   42.536  1.00 41.55  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.754  -0.021  42.608  1.00 42.39  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.932  -1.172  41.981  1.00 41.93  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 41.739  0.473   43.339  1.00 43.36  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.645  4.976   41.993  1.00 46.76  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.760  5.889   42.147  1.00 47.24  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.683  6.672   43.434  1.00 47.97  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.642  7.348   43.817  1.00 48.23  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.538  6.601   44.104  1.00 48.44  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 37.323  7.397   45.311  1.00 49.09  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.952  8.032   45.435  1.00 49.56  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.980  7.563   44.844  1.00 49.69  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.894  9.119   46.200  1.00 50.01  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.649  9.766   46.582  1.00 50.36  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 34.304  10.975  45.721  1.00 50.22  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 35.179  11.766  45.374  1.00 50.65  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.765  10.233  48.026  1.00 50.89  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 34.437  9.181   49.082  1.00 52.91  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.941  9.582   50.464  1.00 55.31  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 36.145  9.823   50.660  1.00 55.91  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 34.025  9.648   51.431  1.00 55.45  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 33.018  11.135  45.414  1.00 49.88  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.535  12.263  44.612  1.00 49.24  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.441  13.019  45.331  1.00 49.16  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.578  12.408  45.960  1.00 49.45  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.951  11.756  43.300  1.00 48.98  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.840  10.857  42.457  1.00 48.17  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.976  10.069  41.512  1.00 47.59  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.879  11.691  41.719  1.00 47.07  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.461  14.341  45.227  1.00 48.89  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 30.327  15.134  45.675  1.00 48.98  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.634  15.747  44.472  1.00 48.90  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 30.256  16.491  43.705  1.00 48.93  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.750  16.219  46.662  1.00 48.84  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.578  17.027  47.216  1.00 49.44  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.991  18.046  48.274  1.00 49.50  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 31.187  18.781  47.875  1.00 51.55  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.391  18.657  48.436  1.00 51.70  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.611  17.833  49.457  1.00 49.66  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.390  19.377  47.959  1.00 53.61  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.349  15.427  44.317  1.00 48.78  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.564  15.877  43.176  1.00 48.93  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.744  17.107  43.479  1.00 49.15  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.943  17.754  44.502  1.00 49.28  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.812  17.417  42.586  1.00 49.50  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.998  18.618  42.696  1.00 49.99  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.526  18.352  42.348  1.00 50.87  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.205  17.682  41.347  1.00 50.70  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.585  19.771  41.841  1.00 49.85  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.842  21.073  42.107  1.00 49.75  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.571  19.440  40.343  1.00 49.37  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.696  22.290  41.933  1.00 50.08  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.642  18.865  43.205  1.00 51.79  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 21.205  18.755  43.014  1.00 52.73  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.824  19.889  42.103  1.00 52.99  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.846  21.054  42.505  1.00 53.11  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.476  18.875  44.354  1.00 53.15  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.957  18.861  44.275  1.00 55.42  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.325  19.751  45.356  1.00 60.28  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 17.146  20.437  44.813  1.00 65.33  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.875  20.212  45.176  1.00 67.18  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.584  19.321  46.133  1.00 67.36  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.886  20.892  44.579  1.00 66.81  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.512  19.542  40.861  1.00 53.49  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 20.152  20.526  39.844  1.00 53.93  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.647  20.629  39.732  1.00 54.62  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.934  19.635  39.922  1.00 54.77  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.727  20.134  38.478  1.00 53.63  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 22.232  20.098  38.214  1.00 52.43  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.434  19.748  36.769  1.00 53.07  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.912  21.415  38.519  1.00 51.99  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 18.167  21.827  39.413  1.00 55.50  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.732  22.053  39.264  1.00 56.61  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 16.324  21.736  37.827  1.00 56.38  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.968  22.175  36.877  1.00 56.45  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 16.347  23.485  39.711  1.00 57.40  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.900  23.951  39.402  1.00 59.88  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.808  23.169  40.188  1.00 63.13  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 12.370  23.522  39.706  1.00 62.04  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 11.353  22.478  40.100  1.00 61.90  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 15.292  20.915  37.685  1.00 56.18  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.709  20.623  36.387  1.00 56.27  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 13.227  21.034  36.395  1.00 56.52  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.631  21.167  37.472  1.00 56.62  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.860  19.157  36.069  1.00 56.03  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.632  21.261  35.202  1.00 56.60  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 11.230  21.689  35.096  1.00 56.48  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 10.282  21.023  36.090  1.00 56.16  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.696   21.722  36.907  1.00 56.45  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.863  21.318  33.661  1.00 56.72  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 12.147  21.504  32.915  1.00 56.68  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 13.262  21.156  33.870  1.00 56.61  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.158  19.698  36.049  1.00 55.82  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.202   18.991  36.909  1.00 55.25  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.738   18.397  38.205  1.00 54.94  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 9.102   17.518  38.792  1.00 54.94  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.897  18.873  38.662  1.00 54.54  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.523  18.356  39.885  1.00 53.74  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 13.044  18.350  39.826  1.00 53.11  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.618  18.811  38.848  1.00 53.28  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.711  17.814  40.874  1.00 52.57  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.175  17.863  40.961  1.00 51.77  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.861  16.639  40.354  1.00 51.20  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 15.247  15.568  40.243  1.00 51.28  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.428  17.896  42.467  1.00 51.61  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 14.126  17.446  43.124  1.00 51.84  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 13.139  17.121  42.042  1.00 52.49  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 17.119  16.811  39.949  1.00 50.40  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.948  15.696  39.467  1.00 49.50  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.298  15.723  40.160  1.00 49.14  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.680  16.753  40.730  1.00 49.24  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 18.180  15.735  37.939  1.00 49.34  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.869  15.609  37.189  1.00 48.70  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.932  16.994  37.529  1.00 49.05  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 20.016  14.603  40.114  1.00 48.31  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.395  14.567  40.601  1.00 47.64  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.374  14.688  39.438  1.00 46.85  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 22.221  14.005  38.419  1.00 47.00  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.671  13.260  41.344  1.00 47.95  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.906  13.147  42.524  1.00 48.69  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.383  15.542  39.581  1.00 45.49  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.460  15.561  38.602  1.00 44.28  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.845  15.405  39.238  1.00 43.79  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 26.213  16.129  40.167  1.00 43.64  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 24.393  16.799  37.774  1.00 44.24  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.602  14.438  38.735  1.00 42.91  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 28.004  14.299  39.072  1.00 41.93  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.757  14.619  37.811  1.00 41.54  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.755  13.808  36.877  1.00 41.81  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 28.281  12.879  39.524  1.00 41.94  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.487  12.487  40.713  1.00 41.88  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 26.218  11.936  40.559  1.00 41.51  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.978  12.722  41.993  1.00 41.35  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.466  11.596  41.652  1.00 41.33  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 27.233  12.397  43.102  1.00 41.48  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.970  11.828  42.936  1.00 42.19  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.351  15.814  37.766  1.00 40.70  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.926  16.350  36.530  1.00 40.21  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.431  16.415  36.618  1.00 40.02  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.980  16.747  37.657  1.00 40.19  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.377  17.752  36.227  1.00 40.06  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.856  18.020  36.183  1.00 40.18  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.600  19.509  35.995  1.00 39.75  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 27.103  17.209  35.120  1.00 38.91  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 32.106  16.098  35.525  1.00 39.77  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.547  16.215  35.499  1.00 39.73  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.288  15.165  36.312  1.00 39.93  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.387  15.433  36.827  1.00 39.79  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.706  13.969  36.419  1.00 39.78  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.414  12.818  36.996  1.00 39.82  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.559  12.362  36.082  1.00 40.37  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.329  12.052  34.915  1.00 40.64  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.482  11.628  37.168  1.00 39.67  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 32.264  12.020  38.016  1.00 38.50  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 34.271  10.413  37.708  1.00 39.06  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 31.092  11.118  37.831  1.00 36.58  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.794  12.298  36.607  1.00 40.73  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.920  11.913  35.749  1.00 40.87  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.866  10.417  35.474  1.00 40.83  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.554  9.641   36.381  1.00 41.53  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 39.137  12.248  36.615  1.00 40.93  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.643  12.047  38.016  1.00 40.55  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 37.222  12.546  37.995  1.00 40.61  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 38.150  10.006  34.247  1.00 40.41  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 38.109  8.585   33.950  1.00 40.31  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.445  8.054   33.417  1.00 40.53  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.616  6.847   33.205  1.00 40.76  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.907  8.221   33.063  1.00 39.61  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.965  8.780   31.656  1.00 39.60  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.415  7.990   30.595  1.00 38.57  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 36.516  10.076  31.375  1.00 39.56  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.446  8.484   29.279  1.00 37.40  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.541  10.574  30.060  1.00 39.30  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 37.011  9.772   29.013  1.00 38.29  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 40.395  8.961   33.245  1.00 40.54  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.706  8.605   32.738  1.00 40.89  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.778  9.563   33.226  1.00 41.20  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 42.501  10.729  33.543  1.00 41.10  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.686  8.598   31.241  1.00 41.22  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 44.009  9.066   33.282  1.00 41.46  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 45.142  9.915   33.628  1.00 41.53  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 45.252  10.941  32.521  1.00 41.06  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 45.112  10.590  31.355  1.00 41.46  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 46.420  9.088   33.791  1.00 41.51  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.495  8.385   35.140  1.00 42.78  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.579  9.366   36.294  1.00 45.89  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.386  10.306  36.192  1.00 47.93  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.841  9.220   37.299  1.00 47.33  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 45.451  12.213  32.877  1.00 40.71  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 45.397  13.235  31.831  1.00 40.93  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 46.353  12.893  30.685  1.00 41.37  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.536  12.620  30.924  1.00 41.85  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.841  14.517  32.545  1.00 40.94  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.595  14.261  34.019  1.00 41.04  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.737  12.765  34.214  1.00 40.58  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.846  12.882  29.443  1.00 41.30  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.678  12.517  28.307  1.00 41.37  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.661  13.618  27.916  1.00 41.67  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.749  13.992  26.755  1.00 41.63  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.652  12.279  27.199  1.00 41.33  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.516  13.133  27.557  1.00 41.10  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.466  13.202  29.044  1.00 41.02  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.402  14.131  28.877  1.00 42.45  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 49.303  15.229  28.582  1.00 43.95  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.777  14.808  28.455  1.00 44.87  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 51.147  13.670  28.768  1.00 45.14  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 49.135  16.387  29.603  1.00 44.09  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.688  16.873  29.611  1.00 44.23  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.574  15.971  30.997  1.00 43.93  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.609  15.737  27.992  1.00 45.78  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 53.061  15.527  27.953  1.00 47.04  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.430  14.332  27.113  1.00 47.77  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.993  14.216  25.967  1.00 48.30  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 54.218  13.430  27.685  1.00 48.47  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.596  12.193  26.987  1.00 49.07  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.391  11.328  26.613  1.00 49.13  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.523  10.394  25.815  1.00 49.20  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.546  11.368  27.854  1.00 49.19  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.959  11.120  29.125  1.00 49.68  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 52.227  11.631  27.191  1.00 49.26  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 51.041  10.804  26.978  1.00 49.68  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 50.252  11.185  25.735  1.00 48.83  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 49.328  10.464  25.344  1.00 48.97  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 50.148  10.761  28.216  1.00 50.20  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.875  10.233  29.448  1.00 54.45  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.974  9.412   30.391  1.00 61.47  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 50.551  9.319   31.746  1.00 66.42  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 51.512  8.465   32.132  1.00 68.22  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 52.038  7.576   31.286  1.00 69.39  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 51.949  8.492   33.384  1.00 68.30  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.649  12.289  25.102  1.00 47.94  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.987  12.801  23.900  1.00 47.21  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 50.060  11.807  22.741  1.00 47.26  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 51.119  11.240  22.469  1.00 47.60  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.587  14.151  23.498  1.00 46.94  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.921  14.838  22.320  1.00 45.28  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.767  16.002  21.853  1.00 43.05  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 50.454  17.248  22.551  1.00 41.94  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 51.029  18.420  22.284  1.00 40.59  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.969  18.507  21.347  1.00 39.82  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.672  19.503  22.957  1.00 38.24  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.923  11.611  22.069  1.00 47.00  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.777  10.675  20.946  1.00 46.59  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.661  9.225   21.395  1.00 46.81  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.424  8.337   20.577  1.00 46.60  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.917  10.795  19.923  1.00 46.24  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 50.195  12.194  19.460  1.00 45.29  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 49.202  12.962  18.864  1.00 44.17  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.475  12.730  19.587  1.00 44.60  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.473  14.254  18.422  1.00 44.20  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.760  14.023  19.150  1.00 44.71  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.757  14.788  18.561  1.00 44.56  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.811  8.992   22.693  1.00 47.46  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.853  7.637   23.236  1.00 48.11  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.535  7.209   23.841  1.00 48.03  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.770  8.054   24.296  1.00 47.72  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.944  7.538   24.289  1.00 48.32  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 51.302  7.677   23.704  1.00 50.38  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 52.238  6.192   24.054  1.00 57.57  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.540  4.989   22.938  1.00 55.65  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 47.275  5.885   23.871  1.00 48.41  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 46.059  5.356   24.478  1.00 48.79  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.873  5.877   25.899  1.00 49.29  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.850  6.256   26.549  1.00 49.38  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 46.307  3.844   24.482  1.00 48.40  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 47.151  3.626   23.315  1.00 47.73  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 48.103  4.788   23.340  1.00 48.34  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.624  5.925   26.371  1.00 49.78  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 44.414  6.500   27.685  1.00 50.54  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.716  5.480   28.759  1.00 51.51  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.477  4.286   28.554  1.00 51.97  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.929  6.851   27.683  1.00 50.28  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 42.314  5.948   26.670  1.00 50.38  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 43.376  5.465   25.741  1.00 49.76  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 45.273  5.935   29.875  1.00 52.33  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.436  5.071   31.031  1.00 53.49  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.364  5.412   32.057  1.00 53.49  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 44.062  6.594   32.256  1.00 53.70  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.817  5.244   31.646  1.00 53.92  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.933  4.596   30.849  1.00 57.05  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 49.321  5.122   31.239  1.00 60.72  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.451  6.347   31.522  1.00 59.97  ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 50.277  4.298   31.242  1.00 62.11  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.799  4.384   32.728  1.00 53.39  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.764  4.586   33.761  1.00 53.28  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 43.181  5.570   34.864  1.00 53.21  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 44.372  5.690   35.183  1.00 53.22  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.568  3.189   34.347  1.00 53.40  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 43.065  2.249   33.275  1.00 53.65  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 44.137  2.961   32.536  1.00 53.10  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 42.201  6.267   35.432  1.00 53.08  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.461  7.323   36.396  1.00 52.95  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.897  6.720   37.714  1.00 53.37  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 42.136  5.999   38.348  1.00 53.45  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 41.211  8.190   36.594  1.00 52.78  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.332  9.283   37.674  1.00 51.55  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.402  10.334  37.381  1.00 47.81  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 42.622  11.186  38.616  1.00 46.93  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 43.576  12.308  38.435  1.00 46.10  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 44.129  7.008   38.117  1.00 53.78  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.636  6.546   39.404  1.00 54.30  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.843  7.177   40.551  1.00 53.91  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 43.602  8.392   40.533  1.00 53.64  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 46.134  6.846   39.545  1.00 54.75  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 47.047  5.729   39.028  1.00 56.85  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 48.331  6.290   38.453  1.00 59.38  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.773  7.466   39.206  1.00 62.21  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.473  8.475   38.683  1.00 63.66  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.816  8.464   37.393  1.00 64.01  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.821  9.505   39.446  1.00 63.42  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 43.429  6.346   41.543  1.00 53.67  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.581  6.773   42.659  1.00 53.30  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 43.073  8.035   43.341  1.00 53.23  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 44.276  8.236   43.478  1.00 53.25  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.648  5.589   43.609  1.00 52.99  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.823  4.424   42.701  1.00 53.28  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.748  4.906   41.636  1.00 53.54  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 42.130  8.890   43.722  1.00 53.36  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.421  10.151  44.394  1.00 53.59  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 42.029  10.046  45.867  1.00 54.07  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 41.360  9.085   46.276  1.00 54.39  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.633  11.267  43.727  1.00 53.24  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 40.138  11.066  43.800  1.00 53.42  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 39.300  11.456  44.815  1.00 53.83  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.306  10.431  42.827  1.00 53.12  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 38.007  11.097  44.532  1.00 53.17  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.982  10.471  43.315  1.00 52.71  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.547  9.837   41.590  1.00 53.48  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.911  9.941   42.610  1.00 52.53  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.474  9.313   40.889  1.00 53.58  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 37.173  9.366   41.404  1.00 52.80  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.420  11.016  46.683  1.00 54.44  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.924  10.976  48.058  1.00 55.27  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 41.050  12.159  48.455  1.00 55.38  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 41.114  13.249  47.862  1.00 55.30  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 43.033  10.688  49.088  1.00 55.34  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 44.145  11.527  48.873  1.00 55.85  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 40.217  11.916  49.461  1.00 55.50  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.244  12.890  49.891  1.00 55.73  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 38.062  12.859  48.956  1.00 55.81  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.896  11.909  48.173  1.00 55.86  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 37.240  13.900  49.047  1.00 55.77  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 36.022  13.986  48.260  1.00 55.70  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 36.237  14.913  47.070  1.00 55.44  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.508  16.103  47.241  1.00 55.47  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.824  14.426  49.131  1.00 55.82  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.730  15.031  48.285  1.00 56.30  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.274  13.236  49.901  1.00 55.99  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 36.132  14.345  45.871  1.00 55.06  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.269  15.097  44.635  1.00 54.79  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 35.008  15.894  44.365  1.00 54.56  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.898  15.358  44.441  1.00 54.46  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.542  14.147  43.465  1.00 54.97  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.774  14.714  42.057  1.00 55.39  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.788  15.880  42.029  1.00 57.51  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 37.250  13.608  41.170  1.00 54.89  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 35.174  17.174  44.049  1.00 54.32  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 34.020  17.992  43.715  1.00 54.20  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.584  17.745  42.281  1.00 53.30  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.330  18.025  41.342  1.00 53.43  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.283  19.484  43.936  1.00 54.78  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 33.092  20.351  43.491  1.00 56.45  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.936  20.586  42.259  1.00 56.57  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.302  20.773  44.379  1.00 58.14  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.367  17.239  42.124  1.00 52.20  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.858  16.889  40.811  1.00 51.40  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.566  17.639  40.532  1.00 50.90  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.526  17.042  40.228  1.00 50.84  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.665  15.384  40.700  1.00 51.10  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.655  18.964  40.623  1.00 50.35  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.483  19.839  40.540  1.00 49.32  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.569  20.787  39.354  1.00 48.87  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.670  21.602  39.152  1.00 48.88  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.321  20.688  41.816  1.00 49.34  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.476  21.516  41.982  1.00 49.52  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.150  19.816  43.062  1.00 48.74  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.654  20.692  38.586  1.00 48.39  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.851  21.512  37.378  1.00 48.30  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.419  20.672  36.232  1.00 47.76  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 32.090  19.669  36.466  1.00 48.12  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.845  22.684  37.603  1.00 48.12  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 33.148  22.151  37.819  1.00 49.47  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 31.476  23.548  38.807  1.00 49.20  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 31.173  21.100  34.998  1.00 46.99  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.777  20.456  33.847  1.00 46.11  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 33.282  20.736  33.842  1.00 46.05  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.727  21.819  34.223  1.00 46.33  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 31.144  20.967  32.557  1.00 45.68  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.753  20.449  32.305  1.00 45.82  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.528  19.098  32.052  1.00 45.60  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.658  21.319  32.309  1.00 46.11  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 28.245  18.620  31.820  1.00 44.67  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.370  20.855  32.069  1.00 44.93  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 27.165  19.506  31.822  1.00 45.73  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 34.072  19.761  33.412  1.00 45.64  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.500  19.972  33.317  1.00 45.16  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.894  20.602  31.997  1.00 45.00  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 35.037  20.920  31.161  1.00 44.86  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 36.263  18.668  33.514  1.00 45.15  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.634  18.374  34.948  1.00 45.37  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.647  19.341  35.525  1.00 46.42  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 38.290  20.116  34.801  1.00 47.03  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.793  19.304  36.846  1.00 45.94  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 37.207  20.779  31.835  1.00 44.72  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.810  21.224  30.592  1.00 44.19  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 37.300  20.453  29.397  1.00 43.99  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.887  19.288  29.518  1.00 43.64  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 39.312  21.043  30.663  1.00 44.37  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.955  21.948  31.668  1.00 44.71  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.344  22.884  32.173  1.00 46.22  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 41.208  21.680  31.960  1.00 45.79  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 37.335  21.131  28.253  1.00 43.70  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.918  20.596  26.965  1.00 43.52  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 38.200  20.334  26.203  1.00 43.87  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 39.117  21.144  26.262  1.00 44.08  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 36.107  21.650  26.201  1.00 43.31  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.789  21.191  24.800  1.00 42.98  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.855  21.996  26.949  1.00 42.66  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 38.268  19.205  25.504  1.00 44.20  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 39.464  18.805  24.770  1.00 44.79  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.898  19.835  23.740  1.00 45.15  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 39.069  20.498  23.110  1.00 44.93  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 39.231  17.472  24.087  1.00 44.61  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.886  16.130  25.227  1.00 46.46  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 41.210  19.954  23.573  1.00 45.69  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.778  21.016  22.760  1.00 46.24  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 41.270  20.905  21.344  1.00 47.27  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 41.443  19.876  20.701  1.00 48.00  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 43.318  20.988  22.793  1.00 45.68  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.874  22.367  22.983  1.00 44.10  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 44.330  22.798  24.231  1.00 42.57  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.872  23.262  21.935  1.00 42.36  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.800  24.093  24.411  1.00 42.94  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 44.316  24.537  22.092  1.00 42.65  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.784  24.962  23.320  1.00 44.45  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 45.241  26.268  23.413  1.00 45.61  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.626  21.953  20.858  1.00 48.54  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 40.068  21.911  19.516  1.00 50.04  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 40.075  23.249  18.800  1.00 51.66  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 40.324  24.283  19.406  1.00 51.77  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.654  21.334  19.553  1.00 49.75  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.695  22.050  20.468  1.00 48.55  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.467  21.231  20.751  1.00 47.76  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 35.379  21.528  20.255  1.00 48.07  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.630  20.181  21.543  1.00 46.84  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.819  23.210  17.497  1.00 54.11  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.597  24.416  16.708  1.00 56.61  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 38.275  25.081  17.105  1.00 57.37  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 37.240  24.415  17.230  1.00 57.24  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 39.631  24.085  15.202  1.00 57.95  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 39.046  25.171  14.320  1.00 59.82  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.733  25.063  13.840  1.00 61.36  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.795  26.311  13.980  1.00 60.32  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 37.172  26.055  13.038  1.00 62.68  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.248  27.321  13.183  1.00 61.64  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.929  27.190  12.712  1.00 62.40  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.345  28.178  11.922  1.00 61.65  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 38.318  26.394  17.319  1.00 58.56  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 37.102  27.144  17.647  1.00 59.73  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.534  27.838  16.411  1.00 60.79  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 37.243  28.571  15.711  1.00 60.99  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 37.322  28.167  18.764  1.00 59.33  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 36.009  28.854  19.119  1.00 59.25  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.882  27.478  19.974  1.00 59.43  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 35.252  27.592  16.158  1.00 61.97  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.597  28.103  14.973  1.00 63.18  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 34.371  29.602  15.079  1.00 63.61  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.876  30.101  16.079  1.00 63.30  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 33.282  27.365  14.709  1.00 63.44  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.639  27.770  13.387  1.00 64.47  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 33.360  27.879  12.360  1.00 65.57  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.409  27.981  13.382  1.00 65.65  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.755  30.305  14.021  1.00 64.66  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.693  31.765  13.981  1.00 65.59  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 34.064  32.288  12.664  1.00 66.06  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 34.186  33.484  12.338  1.00 66.09  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 36.104  32.390  14.209  1.00 65.73  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 37.096  31.581  13.554  1.00 65.40  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.426  32.511  15.718  1.00 65.34  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 33.382  31.393  11.933  1.00 66.12  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.669  31.768  10.709  1.00 66.12  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.629  32.871  10.936  1.00 65.84  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.570  33.826  10.160  1.00 66.13  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 32.016  30.555  10.040  1.00 66.39  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 31.928  30.624  8.503   1.00 67.15  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 33.237  30.135  7.857   1.00 68.00  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.745  29.817  7.959   1.00 67.66  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.825  32.750  11.991  1.00 65.21  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.846  33.787  12.309  1.00 64.72  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.855  34.226  13.777  1.00 64.57  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.979  33.810  14.542  1.00 64.84  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.433  33.346  11.922  1.00 64.66  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 28.230  33.033  10.460  1.00 64.59  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 28.375  34.015  9.492   1.00 64.72  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.857  31.760  10.051  1.00 64.51  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 28.177  33.731  8.152   1.00 64.86  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.647  31.468  8.718   1.00 64.44  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.815  32.457  7.772   1.00 64.70  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.621  32.175  6.439   1.00 65.13  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.844  35.060  14.179  1.00 64.19  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.881  35.734  15.496  1.00 63.57  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.519  36.203  15.991  1.00 62.83  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.749  36.794  15.228  1.00 62.58  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.775  36.958  15.253  1.00 63.60  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.374  36.764  13.846  1.00 64.65  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 32.050  35.372  13.396  1.00 64.14  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 29.239  35.923  17.263  1.00 62.09  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.974  36.282  17.896  1.00 61.20  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.813  35.340  17.598  1.00 60.57  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.795  35.369  18.291  1.00 60.53  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.962  34.490  16.583  1.00 59.69  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.827  33.745  16.043  1.00 58.87  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.429  32.504  16.843  1.00 58.56  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 26.146  31.508  16.861  1.00 58.17  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 26.073  33.398  14.571  1.00 58.57  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.902  32.746  13.895  1.00 58.19  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.620  33.280  14.011  1.00 58.06  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 25.080  31.609  13.130  1.00 57.14  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.543  32.678  13.385  1.00 57.28  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 24.008  31.005  12.505  1.00 56.73  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.740  31.540  12.632  1.00 57.20  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 24.262  32.572  17.478  1.00 58.47  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.746  31.469  18.299  1.00 58.70  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.854  30.110  17.584  1.00 57.64  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.335  29.134  18.158  1.00 57.81  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.306  31.780  18.782  1.00 59.29  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.442  30.556  19.221  1.00 63.03  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.550  30.174  20.721  1.00 67.44  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 22.456  30.686  21.435  1.00 69.61  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 20.719  29.343  21.180  1.00 67.39  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.445  30.070  16.323  1.00 56.61  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.489  28.854  15.522  1.00 55.27  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.858  28.243  15.270  1.00 54.27  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.946  27.105  14.828  1.00 54.66  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.932  28.977  15.525  1.00 53.12  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 27.255  28.358  15.476  1.00 52.06  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.904  28.254  16.865  1.00 51.73  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.608  27.283  17.148  1.00 51.23  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 28.224  29.036  14.455  1.00 51.84  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 28.311  30.435  14.710  1.00 51.56  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.772  28.823  13.027  1.00 51.28  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.663  29.250  17.721  1.00 51.44  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 28.223  29.262  19.070  1.00 51.44  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.691  28.107  19.917  1.00 50.62  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 28.405  27.576  20.772  1.00 50.67  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.944  30.584  19.796  1.00 52.19  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.187  31.887  19.016  1.00 55.44  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.650  32.283  18.885  1.00 59.53  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.533  31.514  19.344  1.00 61.65  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.911  33.374  18.313  1.00 60.63  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.442  27.711  19.688  1.00 49.63  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.863  26.599  20.440  1.00 49.13  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.718  25.325  20.390  1.00 47.76  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.599  24.479  21.250  1.00 47.80  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.439  26.314  19.980  1.00 49.10  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 24.359  25.572  18.649  1.00 50.36  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.688  25.394  17.998  1.00 51.17  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.746  24.985  19.482  1.00 51.70  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.581  25.209  19.387  1.00 46.45  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 28.471  24.064  19.245  1.00 45.35  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.896  24.349  19.735  1.00 44.95  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.693  23.423  19.891  1.00 45.11  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 28.506  23.571  17.782  1.00 44.87  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 27.144  23.303  17.206  1.00 44.36  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.507  24.029  16.253  1.00 43.98  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 26.247  22.245  17.568  1.00 43.33  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 25.274  23.491  15.992  1.00 43.04  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 25.088  22.399  16.793  1.00 42.25  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 26.316  21.179  18.474  1.00 43.37  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 24.008  21.535  16.886  1.00 43.53  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 25.241  20.312  18.567  1.00 43.81  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 24.104  20.491  17.772  1.00 44.26  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 30.223  25.620  19.964  1.00 44.16  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.568  26.005  20.397  1.00 43.45  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.860  25.531  21.819  1.00 42.74  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.946  25.490  22.640  1.00 42.90  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.734  27.525  20.327  1.00 43.69  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 32.036  28.027  18.911  1.00 44.50  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.534  27.282  18.053  1.00 44.90  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.756  29.311  18.673  1.00 43.88  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 33.129  25.169  22.117  1.00 41.92  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.519  24.806  23.483  1.00 41.28  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.986  25.800  24.498  1.00 41.21  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.924  26.997  24.216  1.00 41.19  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 35.040  24.877  23.443  1.00 41.09  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 35.398  24.622  22.040  1.00 40.63  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 34.265  25.070  21.178  1.00 41.79  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.596  25.308  25.665  1.00 41.36  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.951  26.143  26.666  1.00 41.67  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.612  26.036  28.023  1.00 41.99  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 32.053  26.452  29.027  1.00 42.46  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 30.447  25.839  26.748  1.00 41.61  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 30.136  24.478  27.392  1.00 43.11  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 29.111  24.321  28.053  1.00 43.41  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 31.007  23.492  27.188  1.00 44.93  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.796  25.437  28.043  1.00 42.74  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.691  25.461  29.194  1.00 43.51  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 36.091  25.629  28.637  1.00 43.44  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 36.298  25.508  27.438  1.00 43.28  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.600  24.169  30.009  1.00 43.82  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 33.350  24.014  30.871  1.00 46.51  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 33.451  24.738  32.239  1.00 53.03  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 32.178  24.674  32.961  1.00 58.02  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 31.041  25.253  32.545  1.00 61.44  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 31.014  25.961  31.412  1.00 61.70  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.915  25.125  33.256  1.00 62.11  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 37.050  25.901  29.511  1.00 44.05  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.448  26.034  29.123  1.00 44.18  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.897  24.935  28.182  1.00 44.25  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.554  23.769  28.369  1.00 44.45  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 39.324  25.992  30.358  1.00 44.19  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.657  26.682  30.144  1.00 45.95  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.734  26.197  31.092  1.00 45.80  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 41.448  26.056  32.297  1.00 45.36  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.865  25.955  30.624  1.00 45.98  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.660  25.309  27.159  1.00 44.65  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 40.314  24.314  26.297  1.00 44.72  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.586  23.846  26.971  1.00 44.71  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.362  24.669  27.461  1.00 45.27  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.633  24.880  24.909  1.00 44.58  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.408  25.213  24.057  1.00 44.55  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.815  25.900  22.780  1.00 44.80  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.629  23.955  23.755  1.00 44.86  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.781  22.535  27.020  1.00 44.41  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.973  21.947  27.610  1.00 44.80  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 43.133  20.504  27.162  1.00 45.17  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 42.142  19.833  26.808  1.00 45.48  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.913  22.014  29.141  1.00 45.01  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.609  20.931  29.752  1.00 44.78  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 44.377  20.024  27.180  1.00 45.06  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.647  18.625  26.864  1.00 44.88  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 44.219  17.701  28.007  1.00 44.55  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.979  16.520  27.795  1.00 44.40  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 46.119  18.432  26.534  1.00 45.09  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 46.464  18.627  25.066  1.00 45.51  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.907  18.235  24.756  1.00 45.26  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 48.103  17.127  24.210  1.00 45.46  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.831  19.026  25.068  1.00 44.26  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 44.133  18.253  29.216  1.00 44.31  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.620  17.541  30.374  1.00 44.08  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 42.104  17.634  30.298  1.00 44.12  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.489  18.532  30.893  1.00 44.54  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 44.145  18.185  31.655  1.00 43.89  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.625  17.521  32.913  1.00 44.59  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 43.073  16.408  32.844  1.00 45.95  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.771  18.118  33.996  1.00 46.02  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.496  16.712  29.561  1.00 43.59  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 40.089  16.860  29.226  1.00 43.40  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 39.256  15.591  29.409  1.00 43.09  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 38.044  15.598  29.150  1.00 43.21  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.961  17.360  27.789  1.00 43.52  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.453  16.142  26.553  1.00 43.94  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.898  14.509  29.844  1.00 42.26  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 39.226  13.215  29.918  1.00 41.32  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 38.426  13.088  31.213  1.00 40.99  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.898  12.506  32.210  1.00 41.28  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 40.218  12.052  29.740  1.00 41.23  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.971  11.928  28.407  1.00 41.09  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.822  10.690  28.363  1.00 39.53  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 40.010  11.932  27.222  1.00 41.85  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 37.224  13.667  31.194  1.00 40.03  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 36.241  13.480  32.258  1.00 39.06  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.890  13.159  31.681  1.00 38.33  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.640  13.356  30.500  1.00 38.47  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 36.119  14.722  33.110  1.00 38.88  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.438  15.300  33.536  1.00 39.46  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.904  15.145  34.849  1.00 40.02  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 38.225  16.016  32.633  1.00 38.10  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 39.129  15.704  35.244  1.00 39.65  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.437  16.563  33.022  1.00 38.11  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.875  16.408  34.314  1.00 38.28  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 41.071  16.951  34.657  1.00 39.30  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 34.005  12.675  32.526  1.00 37.81  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.689  12.266  32.072  1.00 37.20  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.692  12.768  33.069  1.00 37.23  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 32.075  13.147  34.189  1.00 36.98  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.606  10.736  31.943  1.00 37.55  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 33.027  9.782   33.071  1.00 36.04  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.967  9.707   34.145  1.00 35.25  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 33.267  8.417   32.495  1.00 36.22  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 30.424  12.769  32.670  1.00 37.06  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 29.361  13.331  33.491  1.00 37.46  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 28.234  12.329  33.711  1.00 37.57  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.936  11.535  32.828  1.00 37.49  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.797  14.583  32.819  1.00 37.94  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.872  15.483  32.224  1.00 38.39  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.739  16.014  32.932  1.00 40.66  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.803  15.680  30.917  1.00 38.18  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.592  12.368  34.873  1.00 38.03  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 26.458  11.477  35.130  1.00 38.79  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 25.232  12.235  35.640  1.00 39.68  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 25.324  12.961  36.634  1.00 40.17  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.828  10.399  36.171  1.00 38.87  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.706  9.374   36.306  1.00 37.52  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 28.164  9.723   35.823  1.00 38.24  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 24.093  12.077  34.971  1.00 40.41  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.820  12.581  35.497  1.00 41.28  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.975  11.398  35.918  1.00 42.43  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.786  10.455  35.147  1.00 42.51  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 22.035  13.373  34.455  1.00 41.00  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.590  14.714  34.124  1.00 41.07  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 22.304  15.907  34.740  1.00 41.75  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.509  15.019  33.080  1.00 40.41  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 23.005  16.936  34.147  1.00 40.57  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.748  16.412  33.122  1.00 40.85  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 24.160  14.252  32.113  1.00 40.53  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.609  17.044  32.232  1.00 41.59  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 25.008  14.878  31.235  1.00 41.22  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 25.226  16.262  31.294  1.00 41.77  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 21.471  11.448  37.145  1.00 43.97  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 20.570  10.426  37.676  1.00 45.25  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 19.413  11.111  38.388  1.00 46.25  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 19.572  12.231  38.884  1.00 46.34  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 21.278  9.528   38.714  1.00 45.33  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 21.512  10.279  39.911  1.00 45.86  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.600  9.023   38.188  1.00 45.03  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 18.244  10.449  38.442  1.00 47.47  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 17.105  10.875  39.260  1.00 48.66  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.468  11.382  40.659  1.00 50.13  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.580  11.156  41.152  1.00 50.28  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 16.275  9.600   39.370  1.00 48.43  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 16.490  8.931   38.043  1.00 48.15  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.915  9.248   37.646  1.00 47.67  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.525  12.082  41.281  1.00 51.89  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.693  12.545  42.648  1.00 53.49  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.424  12.259  43.449  1.00 54.84  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.346  12.748  43.105  1.00 55.14  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 17.037  14.031  42.684  1.00 53.23  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.459  14.548  44.048  1.00 53.32  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.805  14.772  44.349  1.00 53.52  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.515  14.835  45.029  1.00 53.45  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 19.194  15.267  45.594  1.00 53.44  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.895  15.328  46.277  1.00 53.46  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 18.227  15.540  46.550  1.00 53.26  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.584  16.017  47.782  1.00 53.12  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.545  11.441  44.509  1.00 56.16  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.756  10.699  44.910  1.00 57.21  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 17.162  9.654   43.868  1.00 58.35  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 16.323  9.266   43.041  1.00 58.76  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.323  9.999   46.199  1.00 57.08  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.812  9.976   46.149  1.00 56.72  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.421  11.219  45.437  1.00 56.10  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.424  9.214   43.893  1.00 59.37  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.881  8.122   43.013  1.00 60.25  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.966  6.928   43.224  1.00 60.85  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 17.649  6.600   44.359  1.00 61.15  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 20.333  7.726   43.292  1.00 60.23  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 21.316  8.892   43.334  1.00 61.15  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.746  8.400   43.440  1.00 62.38  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.928  7.367   44.462  1.00 62.72  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.429  7.585   45.677  1.00 63.33  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.804  8.803   46.050  1.00 63.57  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.557  6.579   46.531  1.00 63.96  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.559  6.266   42.137  1.00 61.78  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.408  5.350   42.112  1.00 62.61  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.520  4.098   42.999  1.00 63.32  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.621  3.721   43.420  1.00 63.18  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.340  4.937   40.639  1.00 62.89  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.772  5.084   40.150  1.00 62.29  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 18.236  6.327   40.827  1.00 62.01  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.371  3.467   43.253  1.00 64.09  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.275  2.227   44.057  1.00 64.75  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.967  1.009   43.400  1.00 64.76  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.017  0.543   43.860  1.00 64.38  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 13.773  1.900   44.355  1.00 64.91  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.341  0.510   42.333  1.00 64.72  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.828  -0.612  41.536  1.00 64.67  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.774  -0.121  40.430  1.00 64.20  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.798  1.073   40.129  1.00 64.33  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.626  -1.332  40.914  1.00 65.03  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.795  -0.416  40.208  1.00 65.72  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.528  -1.037  39.785  1.00 63.73  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.564  -0.509  38.892  1.00 63.03  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 18.000  -0.089  37.526  1.00 61.93  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 17.489  -0.919  36.766  1.00 61.95  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.567  -1.673  38.763  1.00 63.29  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.915  -2.888  39.471  1.00 63.63  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.486  -2.513  39.753  1.00 63.92  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.105  1.208   37.246  1.00 60.34  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.613  1.824   36.019  1.00 58.37  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.556  1.609   34.834  1.00 56.61  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.778  1.581   35.011  1.00 56.60  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.453  3.335   36.248  1.00 58.64  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.776  3.547   37.493  1.00 59.32  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.658  3.992   35.116  1.00 58.86  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.991  1.458   33.621  1.00 54.84  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.787  1.441   32.401  1.00 53.37  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.551  2.745   32.139  1.00 51.73  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 19.079  3.843   32.463  1.00 51.20  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.743  1.210   31.299  1.00 53.50  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.581  0.639   31.976  1.00 54.20  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.561  1.267   33.325  1.00 54.96  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.723  2.587   31.530  1.00 50.03  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.684  3.664   31.309  1.00 48.12  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.744  4.022   29.825  1.00 47.03  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.705  3.144   28.962  1.00 47.72  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 23.093  3.251   31.824  1.00 47.94  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 24.155  4.257   31.428  1.00 47.58  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 23.073  3.073   33.332  1.00 47.26  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.816  5.315   29.542  1.00 45.15  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 22.019  5.815   28.204  1.00 43.43  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 23.344  6.592   28.182  1.00 42.37  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.586  7.453   29.045  1.00 42.24  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.864  6.742   27.852  1.00 43.62  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.609  6.129   27.242  1.00 43.97  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.391  6.601   27.953  1.00 45.26  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.499  6.491   25.776  1.00 45.11  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 24.203  6.282   27.215  1.00 40.56  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.474  6.979   27.094  1.00 39.51  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.542  7.817   25.818  1.00 38.66  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.279  7.323   24.720  1.00 38.49  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.671  6.011   27.145  1.00 39.77  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.623  5.175   28.420  1.00 40.24  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.987  6.777   27.099  1.00 39.24  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.625  4.046   28.440  1.00 40.77  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.923  9.080   25.967  1.00 37.51  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.946  9.987   24.844  1.00 36.84  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 27.363  10.214  24.343  1.00 36.90  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 28.246  10.635  25.108  1.00 36.80  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 25.298  11.316  25.218  1.00 36.55  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.407  12.355  24.147  1.00 36.27  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 26.196  13.474  24.163  1.00 35.81  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.711  12.374  22.900  1.00 36.13  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 26.038  14.183  22.998  1.00 35.59  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 25.127  13.536  22.207  1.00 35.61  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.775  11.525  22.300  1.00 36.61  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.638  13.870  20.950  1.00 35.55  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 23.287  11.855  21.037  1.00 36.96  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.726  13.016  20.374  1.00 36.60  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.567  9.943   23.051  1.00 36.60  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.820  10.282  22.374  1.00 36.30  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.557  11.403  21.389  1.00 36.14  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.926  11.186  20.348  1.00 36.34  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 29.441  9.085   21.623  1.00 36.27  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.548  7.867   22.538  1.00 36.14  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.825  9.460   21.077  1.00 35.59  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.979  6.626   21.814  1.00 35.79  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 29.039  12.596  21.727  1.00 35.52  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.802  13.778  20.918  1.00 34.90  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.533  13.716  19.595  1.00 35.11  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.466  12.943  19.444  1.00 35.62  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 29.256  15.028  21.656  1.00 34.71  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.726  15.082  22.030  1.00 33.93  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.722  15.181  21.065  1.00 32.83  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 31.108  15.076  23.369  1.00 34.53  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 33.073  15.247  21.430  1.00 33.76  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.446  15.143  23.742  1.00 34.75  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.423  15.231  22.776  1.00 33.88  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.735  15.287  23.181  1.00 33.05  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 29.105  14.544  18.648  1.00 34.99  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.784  14.700  17.374  1.00 34.96  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.509  16.032  17.285  1.00 35.34  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.730  16.702  18.306  1.00 35.21  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.854  16.420  16.057  1.00 35.47  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.781  17.523  15.798  1.00 36.04  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.860  17.147  14.778  1.00 36.56  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.990  17.661  14.819  1.00 36.60  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.507  16.240  13.871  1.00 36.72  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.390  15.778  12.818  1.00 37.16  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.745  15.257  13.247  1.00 37.77  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.682  15.284  12.461  1.00 38.62  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.870  14.787  14.486  1.00 38.16  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 36.156  14.267  15.008  1.00 38.19  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 37.226  15.313  15.237  1.00 38.74  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 38.350  14.971  15.627  1.00 39.19  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.716  13.157  14.128  1.00 37.61  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.950  11.904  14.227  1.00 37.29  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.965  11.162  15.402  1.00 37.01  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 35.187  11.467  13.168  1.00 37.71  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 35.228  9.979   15.516  1.00 38.52  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.440  10.287  13.267  1.00 39.11  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 34.462  9.539   14.445  1.00 38.62  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.866  16.578  15.003  1.00 38.91  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.767  17.694  15.194  1.00 38.79  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 37.302  18.635  16.283  1.00 38.73  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 38.024  19.578  16.621  1.00 39.26  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.941  18.470  13.894  1.00 39.31  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.697  19.153  13.380  1.00 40.18  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.268  20.376  13.917  1.00 41.35  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.962  18.598  12.328  1.00 40.97  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.120  21.022  13.430  1.00 41.64  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.816  19.233  11.823  1.00 41.00  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.402  20.438  12.382  1.00 41.38  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.265  21.048  11.905  1.00 41.24  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 36.101  18.400  16.813  1.00 38.22  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 35.511  19.255  17.855  1.00 37.67  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 34.425  18.552  18.669  1.00 37.04  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.967  17.466  18.312  1.00 37.27  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.904  20.507  17.224  1.00 37.95  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.817  20.150  16.390  1.00 38.50  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 34.016  19.180  19.761  1.00 36.36  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.887  18.697  20.536  1.00 36.36  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 33.139  18.690  22.028  1.00 36.25  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 34.285  18.747  22.459  1.00 36.41  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 32.067  18.624  22.811  1.00 35.82  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 32.168  18.610  24.260  1.00 36.20  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.870  18.074  24.846  1.00 36.72  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.783  18.328  24.315  1.00 37.40  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 32.452  19.995  24.793  1.00 35.67  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.971  17.340  25.945  1.00 36.54  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.790  16.795  26.561  1.00 36.38  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 29.086  17.848  27.420  1.00 36.55  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.994  17.601  27.945  1.00 37.08  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 30.149  15.579  27.375  1.00 36.43  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.692  19.027  27.531  1.00 36.30  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 29.176  20.105  28.378  1.00 36.30  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 28.254  21.083  27.659  1.00 36.47  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.565  21.873  28.295  1.00 37.07  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 30.331  20.875  29.005  1.00 36.25  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 31.453  20.912  28.140  1.00 36.59  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 28.232  21.041  26.337  1.00 36.45  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 27.309  21.873  25.580  1.00 36.48  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.867  21.718  26.065  1.00 36.80  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 25.417  20.615  26.412  1.00 36.20  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 27.346  21.483  24.111  1.00 36.74  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.654  21.282  23.375  1.00 35.70  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.296  21.039  21.951  1.00 35.93  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 29.492  22.526  23.495  1.00 36.60  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 25.140  22.830  26.030  1.00 37.18  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.772  22.885  26.502  1.00 37.34  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.841  21.862  25.887  1.00 37.17  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 22.038  21.277  26.598  1.00 37.23  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 23.213  24.282  26.300  1.00 37.93  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.625  25.239  27.411  1.00 39.95  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 24.283  24.790  28.377  1.00 42.61  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.288  26.442  27.330  1.00 41.96  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.944  21.627  24.582  1.00 37.19  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 22.022  20.693  23.913  1.00 37.13  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 22.236  19.247  24.314  1.00 37.49  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 21.544  18.362  23.818  1.00 37.96  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 22.088  20.751  22.370  1.00 36.71  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 21.428  21.989  21.847  1.00 36.83  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.513  20.631  21.878  1.00 37.15  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 23.205  18.987  25.182  1.00 37.85  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.395  17.626  25.671  1.00 37.99  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 23.147  17.500  27.201  1.00 38.54  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.637  16.557  27.848  1.00 38.70  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.790  17.100  25.327  1.00 37.67  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.349  17.303  23.927  1.00 36.83  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.589  17.085  22.786  1.00 36.28  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.698  17.626  23.760  1.00 36.77  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 25.154  17.240  21.499  1.00 36.70  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 27.264  17.776  22.505  1.00 36.29  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.498  17.593  21.375  1.00 36.71  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 27.097  17.744  20.137  1.00 35.79  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 22.410  18.457  27.766  1.00 38.83  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 22.035  18.449  29.171  1.00 39.37  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 21.140  17.252  29.455  1.00 39.82  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 20.077  17.098  28.852  1.00 39.66  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 21.296  19.728  29.503  1.00 39.45  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.993  19.867  30.972  1.00 41.15  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 21.207  18.927  31.764  1.00 41.07  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.515  20.954  31.344  1.00 45.62  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.582  16.405  30.378  1.00 40.40  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.920  15.133  30.629  1.00 41.18  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.804  15.237  31.643  1.00 41.86  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 19.138  14.243  31.941  1.00 41.90  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.574  16.445  32.152  1.00 42.44  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.656  16.623  33.274  1.00 43.29  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 17.211  16.239  32.951  1.00 43.69  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.518  15.694  33.812  1.00 44.29  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.736  18.036  33.872  1.00 43.18  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 18.037  19.150  33.082  1.00 43.58  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 18.186  20.491  33.777  1.00 43.93  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.584  20.918  33.785  1.00 46.97  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 20.093  21.867  34.573  1.00 49.03  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 21.383  22.158  34.491  1.00 49.68  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 19.335  22.517  35.457  1.00 49.60  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.757  16.492  31.727  1.00 43.60  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 15.355  16.254  31.416  1.00 43.68  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 15.078  14.762  31.274  1.00 44.28  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 14.047  14.262  31.738  1.00 44.28  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.944  17.015  30.170  1.00 43.22  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 15.351  18.439  30.195  1.00 43.07  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.587  19.378  30.861  1.00 42.97  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.515  18.850  29.568  1.00 43.50  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.974  20.716  30.893  1.00 43.05  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.904  20.186  29.601  1.00 43.06  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 16.132  21.117  30.267  1.00 42.41  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 16.016  14.050  30.652  1.00 44.68  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.884  12.615  30.477  1.00 44.71  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.985  11.938  31.840  1.00 45.25  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 15.223  11.014  32.143  1.00 45.10  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.963  12.106  29.532  1.00 44.52  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.698  12.224  28.033  1.00 43.91  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 18.008  12.401  27.260  1.00 41.51  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.901  11.029  27.525  1.00 41.44  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.918  12.417  32.663  1.00 45.52  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 17.039  11.935  34.021  1.00 46.02  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.697  12.113  34.732  1.00 46.88  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 15.066  11.125  35.140  1.00 47.02  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 18.129  12.669  34.747  1.00 45.50  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 15.251  13.369  34.834  1.00 47.65  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 14.048  13.744  35.593  1.00 48.14  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.743  13.104  35.097  1.00 48.21  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.996  12.524  35.887  1.00 48.47  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.888  15.259  35.578  1.00 48.27  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 13.181  15.853  36.796  1.00 50.29  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.674  15.610  36.836  1.00 51.25  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.996  15.572  35.804  1.00 51.44  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 11.145  15.455  38.047  1.00 51.86  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 12.479  13.215  33.797  1.00 47.87  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 11.176  12.879  33.230  1.00 47.27  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 11.069  11.419  32.825  1.00 47.45  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.967   10.886  32.754  1.00 48.02  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.842  13.803  32.025  1.00 47.07  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.741   13.242  31.178  1.00 45.78  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.475  15.186  32.513  1.00 46.99  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 12.193  10.769  32.552  1.00 47.29  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 12.154  9.371   32.138  1.00 47.34  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.842  8.444   33.122  1.00 47.06  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 13.033  7.266   32.836  1.00 47.31  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.769  9.191   30.751  1.00 47.42  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.873  9.589   29.604  1.00 49.71  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.533  8.843   29.583  1.00 54.04  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 10.489  7.611   29.866  1.00 54.67  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.518   9.507   29.264  1.00 55.39  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 13.237  8.975   34.274  1.00 46.93  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.966  8.190   35.275  1.00 46.49  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 15.254  7.554   34.768  1.00 46.17  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.717  6.581   35.351  1.00 46.65  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.834  8.110   33.699  1.00 45.25  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 17.025  7.553   33.050  1.00 44.38  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 18.333  7.925   33.754  1.00 43.70  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.438  9.019   34.312  1.00 43.61  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 17.084  8.016   31.609  1.00 44.42  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 19.319  7.020   33.721  1.00 42.62  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.705  7.382   34.063  1.00 41.86  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 21.436  7.746   32.775  1.00 41.37  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.545  6.929   31.862  1.00 41.22  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 21.468  6.259   34.818  1.00 41.97  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.890  6.667   35.124  1.00 39.74  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.759  5.918   36.109  1.00 42.87  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.917  8.980   32.695  1.00 40.54  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.572  9.419   31.490  1.00 40.23  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 24.019  9.772   31.751  1.00 39.84  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 24.354  10.391  32.767  1.00 40.10  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.835  10.585  30.863  1.00 40.35  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 22.051  10.637  29.350  1.00 41.39  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.787  11.131  28.710  1.00 42.47  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 23.251  11.510  28.955  1.00 41.99  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.874  9.366   30.826  1.00 38.92  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 26.293  9.574   30.969  1.00 38.36  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.812  10.122  29.671  1.00 38.16  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 26.393  9.671   28.606  1.00 38.59  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 27.025  8.249   31.278  1.00 38.45  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.534  8.427   31.230  1.00 37.71  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.599  7.717   32.635  1.00 38.01  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.718  11.093  29.758  1.00 37.45  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 28.460  11.555  28.592  1.00 36.74  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.926  11.768  28.932  1.00 36.55  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 30.265  12.191  30.044  1.00 36.77  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.838  12.821  28.013  1.00 36.88  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.674  13.828  28.988  1.00 36.32  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.800  11.454  27.985  1.00 36.11  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 32.230  11.602  28.213  1.00 35.77  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.823  12.550  27.211  1.00 35.75  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 32.290  12.698  26.110  1.00 36.20  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.954  10.260  28.104  1.00 35.77  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 33.301  9.831   26.692  1.00 34.94  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.824  9.460   25.727  1.00 36.44  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.442  7.768   26.208  1.00 34.49  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.916  13.197  27.611  1.00 35.41  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.792  13.885  26.687  1.00 35.36  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.726  12.850  26.077  1.00 35.19  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 36.116  11.902  26.756  1.00 35.67  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.590  14.965  27.414  1.00 35.34  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.746  16.195  27.748  1.00 35.95  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.590  16.317  27.328  1.00 35.70  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 35.337  17.127  28.485  1.00 36.32  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 36.041  13.000  24.794  1.00 34.53  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 37.032  12.163  24.128  1.00 33.89  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.810  13.087  23.226  1.00 34.36  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 37.266  14.094  22.775  1.00 34.75  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.392  11.042  23.314  1.00 32.95  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.512  11.494  22.165  1.00 31.95  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 34.142  11.711  22.354  1.00 30.90  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 36.041  11.688  20.882  1.00 30.64  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 33.317  12.112  21.292  1.00 30.03  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 35.234  12.094  19.816  1.00 29.73  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.863  12.304  20.031  1.00 30.62  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 33.047  12.722  18.999  1.00 29.99  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 39.072  12.746  22.970  1.00 34.46  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.997  13.631  22.280  1.00 34.37  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.634  13.725  20.814  1.00 34.66  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 39.298  12.721  20.176  1.00 34.14  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.432  13.136  22.437  1.00 34.41  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 42.021  13.386  23.804  1.00 34.79  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.365  12.720  23.946  1.00 34.59  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 43.213  11.316  24.301  1.00 34.79  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 44.187  10.417  24.223  1.00 35.35  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.396  10.783  23.788  1.00 36.74  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.951  9.154   24.562  1.00 33.32  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.689  14.943  20.286  1.00 35.21  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 39.337  15.180  18.888  1.00 35.57  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.568  15.703  18.172  1.00 36.04  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.617  15.879  18.804  1.00 36.43  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 38.153  16.144  18.770  1.00 35.31  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.902  15.472  19.284  1.00 36.03  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.404  17.385  19.576  1.00 34.89  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.455  15.933  16.867  1.00 36.30  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.594  16.393  16.076  1.00 36.80  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.853  15.544  16.251  1.00 37.23  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.775  14.322  16.485  1.00 36.89  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 44.017  16.195  16.143  1.00 37.56  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 45.295  15.474  16.135  1.00 37.78  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 45.480  14.703  17.434  1.00 37.92  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.855  13.528  17.408  1.00 38.17  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.516  16.383  15.877  1.00 37.59  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 46.552  17.443  16.840  1.00 38.85  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.459  16.973  14.497  1.00 36.92  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 45.174  15.345  18.560  1.00 37.80  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 45.341  14.699  19.850  1.00 38.11  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 44.560  13.410  19.884  1.00 38.71  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 45.050  12.403  20.397  1.00 39.67  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.904  15.611  20.969  1.00 37.85  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 45.353  17.005  20.785  1.00 37.66  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.604  17.405  21.236  1.00 37.84  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 44.540  17.918  20.140  1.00 37.50  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 47.043  18.703  21.043  1.00 39.27  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.963  19.221  19.940  1.00 39.35  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 46.221  19.622  20.383  1.00 38.89  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 43.367  13.432  19.298  1.00 38.61  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.523  12.270  19.299  1.00 38.40  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.828  11.263  18.218  1.00 38.84  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.652  10.058  18.443  1.00 39.28  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 43.257  11.721  17.036  1.00 38.68  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 43.269  10.808  15.879  1.00 38.61  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.492  10.752  14.963  1.00 38.77  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.517  9.943   14.028  1.00 38.52  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.971  10.960  15.072  1.00 38.38  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.764  10.691  15.879  1.00 38.24  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 40.346  9.394   16.102  1.00 38.80  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 40.086  11.722  16.491  1.00 38.15  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 39.254  9.136   16.898  1.00 38.04  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.998  11.459  17.301  1.00 37.99  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.584  10.169  17.497  1.00 37.41  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.481  11.608  15.214  1.00 39.13  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.720  11.585  14.438  1.00 40.02  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 47.411  10.236  14.654  1.00 40.90  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.630  9.812   15.788  1.00 41.15  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.640  12.755  14.815  1.00 39.70  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 49.016  12.831  14.128  1.00 39.59  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 49.486  14.277  13.925  1.00 37.49  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 50.091  11.986  14.860  1.00 38.10  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.737  9.552   13.570  1.00 41.80  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 48.221  8.202   13.712  1.00 43.08  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.386  7.922   12.802  1.00 44.21  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.349  8.270   11.623  1.00 44.86  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 47.108  7.229   13.427  1.00 43.04  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.421  7.298   13.356  1.00 45.35  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.470  6.685   12.546  1.00 46.41  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 51.324  5.178   12.640  1.00 47.13  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 52.023  4.532   13.425  1.00 47.26  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.845  7.160   12.992  1.00 46.18  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 53.012  8.528   12.347  1.00 47.06  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.985  9.396   13.074  1.00 47.27  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.433  8.345   10.904  1.00 49.84  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 50.400  4.612   11.839  1.00 47.82  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.933  3.259   12.115  1.00 48.66  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 51.070  2.246   12.199  1.00 49.62  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.985  2.255   11.378  1.00 49.62  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.987  2.965   10.943  1.00 48.59  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.536  4.311   10.480  1.00 47.79  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.752  5.174   10.641  1.00 47.67  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 51.015  1.406   13.225  1.00 50.84  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 52.039  0.400   13.436  1.00 52.00  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 53.091  0.842   14.428  1.00 52.77  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.901  0.029   14.870  1.00 53.06  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 53.090  2.126   14.777  1.00 53.36  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 54.051  2.643   15.745  1.00 54.07  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.595  2.419   17.179  1.00 54.74  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 52.408  2.252   17.446  1.00 54.66  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 54.317  4.126   15.512  1.00 53.98  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 53.213  4.909   15.908  1.00 53.49  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 54.553  2.410   18.098  1.00 55.70  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 54.232  2.273   19.512  1.00 56.82  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.599  3.571   20.037  1.00 56.17  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.662  3.513   20.844  1.00 56.42  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 55.490  1.923   20.334  1.00 56.88  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 55.218  1.107   21.620  1.00 58.50  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 56.385  1.197   22.640  1.00 59.22  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 56.070  2.040   23.813  1.00 63.71  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.222  3.370   23.880  1.00 64.16  ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 56.688  4.064   22.841  1.00 64.91  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.910  4.014   25.000  1.00 63.11  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 54.093  4.716   19.540  1.00 55.16  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.890  6.036   20.163  1.00 54.17  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.663  6.839   19.706  1.00 52.69  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 52.241  7.780   20.391  1.00 52.93  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 55.139  6.908   19.985  1.00 54.78  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.437  6.305   20.506  1.00 57.56  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 57.259  5.564   19.424  1.00 62.26  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.687  5.060   18.409  1.00 63.09  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 58.499  5.482   19.614  1.00 63.22  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 52.124  6.490   18.544  1.00 50.50  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.918  7.102   18.012  1.00 48.38  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 50.154  6.041   17.207  1.00 47.32  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 50.149  6.054   15.964  1.00 47.07  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 51.279  8.272   17.149  1.00 48.41  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.516  5.099   17.917  1.00 46.00  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.933  3.926   17.284  1.00 45.34  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.663  4.176   16.475  1.00 45.00  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 47.242  3.291   15.711  1.00 45.23  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.621  3.023   18.471  1.00 45.38  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.452  3.950   19.617  1.00 44.94  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 49.344  5.090   19.379  1.00 45.50  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 47.059  5.355   16.651  1.00 44.37  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.744  5.679   16.056  1.00 43.19  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.555  5.413   16.972  1.00 42.24  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.690  4.759   18.014  1.00 42.27  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 43.396  5.939   16.576  1.00 41.41  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 42.084  5.693   17.231  1.00 40.17  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.971  5.993   18.744  1.00 39.65  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.994  5.588   19.391  1.00 39.82  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.563  4.287   16.889  1.00 39.47  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 41.371  4.091   15.386  1.00 40.40  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.970  5.015   14.679  1.00 42.20  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.668  2.897   14.890  1.00 39.97  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.938  6.724   19.304  1.00 38.38  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.948  6.918   20.751  1.00 37.23  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.690  7.647   21.259  1.00 36.96  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 41.279  7.454   22.401  1.00 37.18  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 44.288  7.528   21.300  1.00 37.07  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.475  6.810   20.713  1.00 36.59  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.393  9.002   21.025  1.00 36.68  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 41.072  8.467   20.412  1.00 36.38  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.810  9.115   20.767  1.00 35.56  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.734  8.077   21.014  1.00 35.16  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 38.003  8.145   21.995  1.00 34.72  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.651  7.105   20.113  1.00 35.03  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.773  5.966   20.296  1.00 35.10  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 38.146  5.183   21.565  1.00 35.64  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 37.270  4.686   22.295  1.00 36.17  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.806  5.072   19.058  1.00 34.46  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 37.183  5.677   17.796  1.00 34.05  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.578  4.890   16.555  1.00 32.10  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.646  5.791   17.901  1.00 34.00  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 39.442  5.095   21.844  1.00 35.70  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.897  4.415   23.045  1.00 35.87  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.571  5.156   24.336  1.00 36.53  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 39.472  4.519   25.379  1.00 37.06  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 41.394  4.099   22.970  1.00 35.69  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.806  2.982   22.005  1.00 35.04  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.263  2.659   22.160  1.00 32.21  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.945  1.720   22.194  1.00 34.61  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 39.430  6.487   24.276  1.00 37.12  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.990  7.284   25.431  1.00 37.26  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 37.547  6.942   25.654  1.00 37.60  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 37.114  6.751   26.784  1.00 38.10  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 39.075  8.790   25.182  1.00 37.21  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 40.484  9.272   24.887  1.00 37.89  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 41.463  8.613   25.305  1.00 38.32  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.610  10.329  24.228  1.00 37.61  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.803  6.853   24.558  1.00 37.81  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 35.379  6.565   24.625  1.00 38.12  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 35.201  5.221   25.285  1.00 38.10  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 34.314  5.054   26.127  1.00 37.99  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.745  6.566   23.227  1.00 37.76  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.703  7.932   22.567  1.00 37.61  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 34.160  7.879   21.152  1.00 39.03  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.579  6.877   20.737  1.00 41.55  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 34.342  8.958   20.401  1.00 39.20  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 36.066  4.278   24.907  1.00 38.34  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.977  2.905   25.406  1.00 38.78  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 36.247  2.807   26.908  1.00 38.65  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.519  2.110   27.630  1.00 38.88  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.901  1.955   24.641  1.00 38.75  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.616  0.492   24.978  1.00 39.64  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.706  -0.460  24.516  1.00 40.35  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 37.435  -0.939  23.167  1.00 41.46  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 38.366  -1.398  22.337  1.00 42.25  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 39.643  -1.454  22.733  1.00 42.98  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 38.019  -1.793  21.113  1.00 40.27  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 37.279  3.512   27.370  1.00 38.22  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.603  3.557   28.784  1.00 37.96  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 36.437  4.087   29.584  1.00 38.57  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 36.237  3.687   30.728  1.00 38.95  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.816  4.436   29.037  1.00 37.92  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 39.403  4.401   30.447  1.00 37.51  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.770  2.960   30.859  1.00 36.81  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.608  5.338   30.520  1.00 37.10  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.664  4.995   28.987  1.00 38.94  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 34.526  5.584   29.691  1.00 38.73  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 33.440  4.538   29.810  1.00 38.82  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.787  4.442   30.846  1.00 39.19  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 34.023  6.812   28.986  1.00 38.55  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 33.267  3.739   28.759  1.00 38.69  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 32.308  2.649   28.807  1.00 38.80  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.734  1.628   29.880  1.00 39.22  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.891  1.089   30.607  1.00 39.18  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 32.137  1.982   27.436  1.00 38.54  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.787  2.745   26.150  1.00 38.05  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 31.133  1.762   25.232  1.00 38.40  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.835  3.884   26.339  1.00 37.45  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 34.040  1.387   29.996  1.00 39.45  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 34.547  0.497   31.032  1.00 40.04  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 34.219  1.061   32.404  1.00 39.83  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.648  0.379   33.265  1.00 39.64  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 36.050  0.262   30.870  1.00 40.17  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 36.379  -1.058  30.185  1.00 41.90  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.586  -0.972  29.264  1.00 43.84  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.567  -0.265  29.540  1.00 45.51  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.525  -1.704  28.161  1.00 43.62  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 34.559  2.328   32.583  1.00 39.91  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 34.175  3.054   33.777  1.00 40.04  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.677  2.895   34.067  1.00 40.08  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 32.299  2.650   35.200  1.00 40.06  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 34.560  4.536   33.672  1.00 39.57  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 34.414  5.263   34.960  1.00 38.52  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 35.379  5.474   35.889  1.00 38.24  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 33.227  5.851   35.473  1.00 38.14  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.876  6.172   36.953  1.00 37.87  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 33.549  6.412   36.727  1.00 38.44  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.918  5.961   34.999  1.00 38.16  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 32.608  7.078   37.515  1.00 39.11  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.980  6.622   35.783  1.00 38.51  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 31.331  7.175   37.026  1.00 39.01  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.830  3.022   33.053  1.00 40.42  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 30.402  2.825   33.274  1.00 40.95  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 30.117  1.445   33.858  1.00 41.37  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 29.523  1.362   34.928  1.00 41.56  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 29.560  3.100   32.022  1.00 40.84  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 28.132  2.616   32.211  1.00 40.47  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 29.558  4.586   31.744  1.00 41.22  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.565  0.381   33.185  1.00 41.82  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.397  -0.991  33.696  1.00 42.29  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.776  -1.118  35.177  1.00 42.72  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.992  -1.601  35.992  1.00 43.16  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 31.183  -2.014  32.865  1.00 42.04  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.600  -2.300  31.498  1.00 42.28  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 29.314  -3.127  31.538  1.00 43.45  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 29.305  -4.282  31.976  1.00 43.51  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 28.224  -2.543  31.047  1.00 43.08  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.960  -0.657  35.544  1.00 43.15  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 32.405  -0.859  36.913  1.00 43.48  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.691  0.007   37.933  1.00 43.55  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 31.499  -0.408  39.071  1.00 44.51  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.909  -0.664  37.044  1.00 43.61  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 34.401  -0.913  38.456  1.00 44.62  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.892  -1.017  38.558  1.00 45.58  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 36.369  -1.423  39.634  1.00 46.17  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.583  -0.696  37.568  1.00 46.67  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 31.290  1.206   37.541  1.00 43.40  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.925  2.205   38.534  1.00 42.80  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 29.489  2.671   38.502  1.00 42.50  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.988  3.176   39.510  1.00 42.48  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.873  3.402   38.439  1.00 42.84  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 33.295  3.027   38.748  1.00 43.57  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.634  2.727   39.896  1.00 44.87  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 34.141  3.023   37.724  1.00 43.40  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.816  2.514   37.365  1.00 42.28  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 27.472  3.092   37.231  1.00 42.22  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 26.459  2.604   38.284  1.00 42.71  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 25.627  3.396   38.747  1.00 42.85  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.905  3.003   35.800  1.00 41.70  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.887  4.127   35.570  1.00 41.04  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 26.304  1.651   35.532  1.00 41.24  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.451  5.531   35.688  1.00 37.86  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.558  1.330   38.675  1.00 42.92  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.761  0.795   39.781  1.00 43.32  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.771  1.679   41.023  1.00 43.47  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.748  1.821   41.675  1.00 44.09  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 26.207  -0.601  40.135  1.00 43.60  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.903  2.297   41.339  1.00 43.42  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.977  3.198   42.487  1.00 43.70  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.954  4.342   42.419  1.00 44.15  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.658  4.979   43.430  1.00 44.79  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 28.388  3.746   42.656  1.00 43.18  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 25.419  4.603   41.229  1.00 44.56  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 24.433  5.664   41.033  1.00 44.55  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 23.065  5.042   40.709  1.00 45.15  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 22.126  5.748   40.323  1.00 45.67  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.847  6.596   39.889  1.00 43.91  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 26.256  7.115   39.978  1.00 43.12  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 27.335  6.342   39.542  1.00 43.35  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 26.509  8.390   40.446  1.00 42.73  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.648  6.826   39.605  1.00 41.45  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.820  8.886   40.508  1.00 41.91  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.883  8.098   40.086  1.00 42.07  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.953  3.725   40.851  1.00 45.11  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.703  3.046   40.562  1.00 45.67  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 21.540  2.727   39.090  1.00 46.27  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 20.412  2.636   38.569  1.00 46.27  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 22.667  2.539   38.415  1.00 46.50  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 22.635  2.210   37.002  1.00 47.27  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.733  0.718   36.806  1.00 47.82  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 23.396  0.034   37.581  1.00 47.97  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 22.070  0.221   35.768  1.00 48.26  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 22.102  -1.186  35.416  1.00 48.97  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 23.208  -1.446  34.392  1.00 49.16  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 23.038  -1.171  33.205  1.00 49.48  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.737  -1.582  34.845  1.00 49.29  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.562  -3.093  34.674  1.00 50.50  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.570  -3.843  34.661  1.00 51.51  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.388  -3.524  34.538  1.00 51.97  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 24.349  -1.988  34.832  1.00 49.39  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 25.412  -2.236  33.870  1.00 49.83  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 25.044  -3.292  32.844  1.00 50.31  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.863  -3.622  32.000  1.00 50.66  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.570  -2.730  34.742  1.00 49.64  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 26.260  -2.246  36.105  1.00 49.61  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.764  -2.368  36.186  1.00 49.57  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.824  -3.811  32.914  1.00 50.99  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.355  -4.829  31.966  1.00 52.00  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.309  -4.252  31.010  1.00 51.18  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.745  -4.966  30.177  1.00 51.08  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.803  -6.060  32.696  1.00 51.81  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.654  -6.523  33.865  1.00 53.19  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.470  -8.279  34.233  1.00 55.25  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 24.392  -9.036  32.871  1.00 56.28  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 22.075  -2.948  31.130  1.00 50.61  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 21.197  -2.230  30.226  1.00 49.70  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.850  -0.891  29.900  1.00 49.00  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 21.482  0.157   30.443  1.00 48.98  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.824  -2.036  30.857  1.00 49.90  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.797  -2.073  29.880  1.00 50.83  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.839  -0.957  29.012  1.00 47.93  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.589  0.207   28.533  1.00 46.70  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 23.359  0.398   27.023  1.00 45.65  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.801  -0.418  26.196  1.00 45.56  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 25.109  0.057   28.858  1.00 46.88  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.944  1.012   28.040  1.00 47.23  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.374  0.250   30.355  1.00 46.29  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.638  1.463   26.681  1.00 44.29  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 22.420  1.862   25.288  1.00 42.99  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 23.365  3.011   24.917  1.00 42.33  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.459  4.005   25.649  1.00 42.63  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.956  2.307   25.074  1.00 42.71  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 20.105  1.172   25.172  1.00 42.58  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.755  2.924   23.719  1.00 41.92  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 24.068  2.881   23.799  1.00 41.08  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.857  3.998   23.309  1.00 40.51  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 24.030  4.842   22.372  1.00 40.17  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 23.336  4.314   21.510  1.00 40.84  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 26.095  3.514   22.565  1.00 40.32  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 27.068  2.593   23.291  1.00 40.78  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 28.216  2.250   22.351  1.00 42.08  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.595  3.204   24.591  1.00 41.50  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 24.095  6.157   22.510  1.00 39.50  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.546  6.994   21.453  1.00 39.05  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.441  8.176   21.145  1.00 39.29  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 25.141  8.678   22.026  1.00 39.50  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 22.078  7.375   21.709  1.00 38.48  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.867  8.422   22.776  1.00 37.42  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.440  8.304   24.031  1.00 35.97  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 21.024  9.498   22.536  1.00 36.91  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 22.217  9.258   25.011  1.00 35.08  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.785  10.445  23.517  1.00 36.09  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 21.392  10.327  24.755  1.00 35.89  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.434  8.591   19.882  1.00 39.33  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 25.285  9.669   19.420  1.00 39.81  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.857  10.222  18.081  1.00 40.04  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.973  9.678   17.422  1.00 40.21  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 25.513  11.290  17.651  1.00 39.95  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 25.074  11.978  16.454  1.00 39.97  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 26.275  12.435  15.619  1.00 39.84  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 27.275  12.841  16.167  1.00 39.64  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 24.146  13.128  16.868  1.00 39.92  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.342  13.760  15.765  1.00 40.23  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.074  14.900  15.103  1.00 40.66  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 25.137  15.276  15.630  1.00 40.78  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.592  15.412  14.062  1.00 41.78  ? 202  GLU A OE2 1 
HETATM 1569 N N   . SVZ A 1 203 ? 26.158  12.354  14.294  1.00 40.27  ? 203  SVZ A N   1 
HETATM 1570 C CA  . SVZ A 1 203 ? 27.268  12.589  13.351  1.00 40.62  ? 203  SVZ A CA  1 
HETATM 1571 C C   . SVZ A 1 203 ? 28.520  11.774  13.725  1.00 40.11  ? 203  SVZ A C   1 
HETATM 1572 O O   . SVZ A 1 203 ? 28.450  10.554  13.763  1.00 40.61  ? 203  SVZ A O   1 
HETATM 1573 C CB  . SVZ A 1 203 ? 27.553  14.086  13.181  1.00 41.14  ? 203  SVZ A CB  1 
HETATM 1574 O OG  . SVZ A 1 203 ? 28.416  14.332  12.069  1.00 43.89  ? 203  SVZ A OG  1 
HETATM 1575 O O4  . SVZ A 1 203 ? 30.129  15.278  13.522  1.00 52.10  ? 203  SVZ A O4  1 
HETATM 1576 P P1  . SVZ A 1 203 ? 29.254  15.676  12.350  1.00 51.90  ? 203  SVZ A P1  1 
HETATM 1577 O O2  . SVZ A 1 203 ? 29.100  17.151  12.005  1.00 50.47  ? 203  SVZ A O2  1 
HETATM 1578 N N3  . SVZ A 1 203 ? 29.804  14.789  10.951  1.00 52.36  ? 203  SVZ A N3  1 
HETATM 1579 C C5  . SVZ A 1 203 ? 29.731  15.461  9.664   1.00 54.11  ? 203  SVZ A C5  1 
HETATM 1580 C C7  . SVZ A 1 203 ? 31.135  15.731  9.152   1.00 53.36  ? 203  SVZ A C7  1 
HETATM 1581 C C6  . SVZ A 1 203 ? 28.904  14.664  8.656   1.00 54.12  ? 203  SVZ A C6  1 
ATOM   1582 N N   . ALA A 1 204 ? 29.650  12.414  14.015  1.00 39.37  ? 204  ALA A N   1 
ATOM   1583 C CA  . ALA A 1 204 ? 30.861  11.660  14.343  1.00 38.92  ? 204  ALA A CA  1 
ATOM   1584 C C   . ALA A 1 204 ? 30.648  10.822  15.604  1.00 38.83  ? 204  ALA A C   1 
ATOM   1585 O O   . ALA A 1 204 ? 31.296  9.782   15.797  1.00 39.11  ? 204  ALA A O   1 
ATOM   1586 C CB  . ALA A 1 204 ? 32.058  12.579  14.500  1.00 38.77  ? 204  ALA A CB  1 
ATOM   1587 N N   . GLY A 1 205 ? 29.742  11.284  16.460  1.00 38.15  ? 205  GLY A N   1 
ATOM   1588 C CA  . GLY A 1 205 ? 29.315  10.510  17.615  1.00 37.57  ? 205  GLY A CA  1 
ATOM   1589 C C   . GLY A 1 205 ? 28.517  9.283   17.209  1.00 37.11  ? 205  GLY A C   1 
ATOM   1590 O O   . GLY A 1 205 ? 28.603  8.241   17.841  1.00 37.13  ? 205  GLY A O   1 
ATOM   1591 N N   . ALA A 1 206 ? 27.736  9.395   16.149  1.00 36.49  ? 206  ALA A N   1 
ATOM   1592 C CA  . ALA A 1 206 ? 26.980  8.256   15.696  1.00 36.15  ? 206  ALA A CA  1 
ATOM   1593 C C   . ALA A 1 206 ? 27.934  7.280   15.036  1.00 35.93  ? 206  ALA A C   1 
ATOM   1594 O O   . ALA A 1 206 ? 27.805  6.065   15.216  1.00 35.87  ? 206  ALA A O   1 
ATOM   1595 C CB  . ALA A 1 206 ? 25.869  8.671   14.752  1.00 36.28  ? 206  ALA A CB  1 
ATOM   1596 N N   . ALA A 1 207 ? 28.912  7.811   14.308  1.00 35.71  ? 207  ALA A N   1 
ATOM   1597 C CA  . ALA A 1 207 ? 29.948  6.982   13.687  1.00 35.79  ? 207  ALA A CA  1 
ATOM   1598 C C   . ALA A 1 207 ? 30.738  6.224   14.754  1.00 36.02  ? 207  ALA A C   1 
ATOM   1599 O O   . ALA A 1 207 ? 31.072  5.048   14.581  1.00 36.11  ? 207  ALA A O   1 
ATOM   1600 C CB  . ALA A 1 207 ? 30.871  7.830   12.871  1.00 35.95  ? 207  ALA A CB  1 
ATOM   1601 N N   . SER A 1 208 ? 31.023  6.912   15.860  1.00 36.00  ? 208  SER A N   1 
ATOM   1602 C CA  . SER A 1 208 ? 31.675  6.316   17.007  1.00 35.84  ? 208  SER A CA  1 
ATOM   1603 C C   . SER A 1 208 ? 30.868  5.112   17.491  1.00 36.23  ? 208  SER A C   1 
ATOM   1604 O O   . SER A 1 208 ? 31.414  4.017   17.631  1.00 36.80  ? 208  SER A O   1 
ATOM   1605 C CB  . SER A 1 208 ? 31.846  7.354   18.118  1.00 35.75  ? 208  SER A CB  1 
ATOM   1606 O OG  . SER A 1 208 ? 32.692  8.416   17.704  1.00 35.64  ? 208  SER A OG  1 
ATOM   1607 N N   . VAL A 1 209 ? 29.568  5.308   17.713  1.00 36.29  ? 209  VAL A N   1 
ATOM   1608 C CA  . VAL A 1 209 ? 28.682  4.247   18.177  1.00 36.09  ? 209  VAL A CA  1 
ATOM   1609 C C   . VAL A 1 209 ? 28.749  3.057   17.215  1.00 36.51  ? 209  VAL A C   1 
ATOM   1610 O O   . VAL A 1 209 ? 28.896  1.909   17.637  1.00 36.09  ? 209  VAL A O   1 
ATOM   1611 C CB  . VAL A 1 209 ? 27.248  4.777   18.337  1.00 36.04  ? 209  VAL A CB  1 
ATOM   1612 C CG1 . VAL A 1 209 ? 26.226  3.647   18.416  1.00 35.66  ? 209  VAL A CG1 1 
ATOM   1613 C CG2 . VAL A 1 209 ? 27.165  5.644   19.559  1.00 35.45  ? 209  VAL A CG2 1 
ATOM   1614 N N   . GLY A 1 210 ? 28.680  3.351   15.922  1.00 37.10  ? 210  GLY A N   1 
ATOM   1615 C CA  . GLY A 1 210 ? 28.856  2.342   14.883  1.00 38.03  ? 210  GLY A CA  1 
ATOM   1616 C C   . GLY A 1 210 ? 30.166  1.581   15.014  1.00 38.91  ? 210  GLY A C   1 
ATOM   1617 O O   . GLY A 1 210 ? 30.183  0.358   14.900  1.00 39.35  ? 210  GLY A O   1 
ATOM   1618 N N   . MET A 1 211 ? 31.268  2.276   15.274  1.00 39.21  ? 211  MET A N   1 
ATOM   1619 C CA  . MET A 1 211 ? 32.542  1.576   15.421  1.00 40.12  ? 211  MET A CA  1 
ATOM   1620 C C   . MET A 1 211 ? 32.659  0.712   16.672  1.00 40.41  ? 211  MET A C   1 
ATOM   1621 O O   . MET A 1 211 ? 33.360  -0.310  16.675  1.00 40.47  ? 211  MET A O   1 
ATOM   1622 C CB  . MET A 1 211 ? 33.702  2.539   15.337  1.00 40.22  ? 211  MET A CB  1 
ATOM   1623 C CG  . MET A 1 211 ? 34.017  2.856   13.918  1.00 40.31  ? 211  MET A CG  1 
ATOM   1624 S SD  . MET A 1 211 ? 34.637  4.504   13.862  1.00 41.23  ? 211  MET A SD  1 
ATOM   1625 C CE  . MET A 1 211 ? 34.566  4.808   12.108  1.00 41.53  ? 211  MET A CE  1 
ATOM   1626 N N   . HIS A 1 212 ? 31.978  1.109   17.736  1.00 40.50  ? 212  HIS A N   1 
ATOM   1627 C CA  . HIS A 1 212 ? 31.927  0.240   18.882  1.00 40.67  ? 212  HIS A CA  1 
ATOM   1628 C C   . HIS A 1 212 ? 31.140  -1.023  18.521  1.00 41.46  ? 212  HIS A C   1 
ATOM   1629 O O   . HIS A 1 212 ? 31.543  -2.125  18.907  1.00 42.22  ? 212  HIS A O   1 
ATOM   1630 C CB  . HIS A 1 212 ? 31.394  0.965   20.112  1.00 40.34  ? 212  HIS A CB  1 
ATOM   1631 C CG  . HIS A 1 212 ? 32.292  2.068   20.586  1.00 38.91  ? 212  HIS A CG  1 
ATOM   1632 N ND1 . HIS A 1 212 ? 33.490  1.829   21.219  1.00 37.06  ? 212  HIS A ND1 1 
ATOM   1633 C CD2 . HIS A 1 212 ? 32.174  3.415   20.509  1.00 37.28  ? 212  HIS A CD2 1 
ATOM   1634 C CE1 . HIS A 1 212 ? 34.067  2.979   21.523  1.00 36.12  ? 212  HIS A CE1 1 
ATOM   1635 N NE2 . HIS A 1 212 ? 33.290  3.956   21.102  1.00 36.31  ? 212  HIS A NE2 1 
ATOM   1636 N N   . ILE A 1 213 ? 30.064  -0.897  17.742  1.00 41.56  ? 213  ILE A N   1 
ATOM   1637 C CA  . ILE A 1 213 ? 29.366  -2.096  17.284  1.00 41.78  ? 213  ILE A CA  1 
ATOM   1638 C C   . ILE A 1 213 ? 30.337  -3.011  16.536  1.00 42.84  ? 213  ILE A C   1 
ATOM   1639 O O   . ILE A 1 213 ? 30.211  -4.226  16.603  1.00 43.49  ? 213  ILE A O   1 
ATOM   1640 C CB  . ILE A 1 213 ? 28.167  -1.777  16.379  1.00 41.40  ? 213  ILE A CB  1 
ATOM   1641 C CG1 . ILE A 1 213 ? 27.025  -1.199  17.190  1.00 40.55  ? 213  ILE A CG1 1 
ATOM   1642 C CG2 . ILE A 1 213 ? 27.671  -3.020  15.647  1.00 40.46  ? 213  ILE A CG2 1 
ATOM   1643 C CD1 . ILE A 1 213 ? 26.038  -0.447  16.325  1.00 40.35  ? 213  ILE A CD1 1 
ATOM   1644 N N   . LEU A 1 214 ? 31.311  -2.434  15.838  1.00 43.61  ? 214  LEU A N   1 
ATOM   1645 C CA  . LEU A 1 214 ? 32.170  -3.216  14.955  1.00 44.19  ? 214  LEU A CA  1 
ATOM   1646 C C   . LEU A 1 214 ? 33.490  -3.611  15.594  1.00 45.15  ? 214  LEU A C   1 
ATOM   1647 O O   . LEU A 1 214 ? 34.302  -4.295  14.962  1.00 45.56  ? 214  LEU A O   1 
ATOM   1648 C CB  . LEU A 1 214 ? 32.460  -2.440  13.671  1.00 43.94  ? 214  LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 214 ? 31.334  -1.946  12.765  1.00 43.55  ? 214  LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 214 ? 31.925  -1.110  11.659  1.00 42.77  ? 214  LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 214 ? 30.543  -3.085  12.172  1.00 43.60  ? 214  LEU A CD2 1 
ATOM   1652 N N   . SER A 1 215 ? 33.735  -3.162  16.821  1.00 46.13  ? 215  SER A N   1 
ATOM   1653 C CA  . SER A 1 215 ? 35.003  -3.468  17.478  1.00 47.32  ? 215  SER A CA  1 
ATOM   1654 C C   . SER A 1 215 ? 34.786  -4.429  18.633  1.00 48.47  ? 215  SER A C   1 
ATOM   1655 O O   . SER A 1 215 ? 34.172  -4.067  19.639  1.00 49.06  ? 215  SER A O   1 
ATOM   1656 C CB  . SER A 1 215 ? 35.675  -2.195  17.971  1.00 47.10  ? 215  SER A CB  1 
ATOM   1657 O OG  . SER A 1 215 ? 37.063  -2.398  18.162  1.00 46.90  ? 215  SER A OG  1 
ATOM   1658 N N   . LEU A 1 216 ? 35.291  -5.653  18.496  1.00 49.60  ? 216  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 216 ? 34.966  -6.730  19.450  1.00 50.66  ? 216  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 216 ? 35.164  -6.389  20.943  1.00 50.09  ? 216  LEU A C   1 
ATOM   1661 O O   . LEU A 1 216 ? 34.245  -6.584  21.747  1.00 49.78  ? 216  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 216 ? 35.692  -8.035  19.085  1.00 50.96  ? 216  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 216 ? 35.082  -9.277  19.753  1.00 53.11  ? 216  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 216 ? 33.727  -9.677  19.093  1.00 55.08  ? 216  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 216 ? 36.074  -10.469 19.790  1.00 52.34  ? 216  LEU A CD2 1 
ATOM   1666 N N   . PRO A 1 217 ? 36.347  -5.857  21.318  1.00 49.96  ? 217  PRO A N   1 
ATOM   1667 C CA  . PRO A 1 217 ? 36.472  -5.530  22.738  1.00 50.05  ? 217  PRO A CA  1 
ATOM   1668 C C   . PRO A 1 217 ? 35.395  -4.561  23.231  1.00 50.33  ? 217  PRO A C   1 
ATOM   1669 O O   . PRO A 1 217 ? 35.027  -4.593  24.401  1.00 50.96  ? 217  PRO A O   1 
ATOM   1670 C CB  . PRO A 1 217 ? 37.865  -4.905  22.839  1.00 49.64  ? 217  PRO A CB  1 
ATOM   1671 C CG  . PRO A 1 217 ? 38.599  -5.432  21.659  1.00 49.73  ? 217  PRO A CG  1 
ATOM   1672 C CD  . PRO A 1 217 ? 37.579  -5.541  20.574  1.00 49.52  ? 217  PRO A CD  1 
ATOM   1673 N N   . SER A 1 218 ? 34.876  -3.718  22.351  1.00 50.44  ? 218  SER A N   1 
ATOM   1674 C CA  . SER A 1 218 ? 33.875  -2.744  22.776  1.00 50.49  ? 218  SER A CA  1 
ATOM   1675 C C   . SER A 1 218 ? 32.467  -3.305  22.798  1.00 50.50  ? 218  SER A C   1 
ATOM   1676 O O   . SER A 1 218 ? 31.606  -2.751  23.467  1.00 50.08  ? 218  SER A O   1 
ATOM   1677 C CB  . SER A 1 218 ? 33.950  -1.478  21.925  1.00 50.56  ? 218  SER A CB  1 
ATOM   1678 O OG  . SER A 1 218 ? 35.207  -0.848  22.113  1.00 49.87  ? 218  SER A OG  1 
ATOM   1679 N N   . ARG A 1 219 ? 32.254  -4.415  22.084  1.00 51.13  ? 219  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 219 ? 30.944  -5.100  22.024  1.00 51.50  ? 219  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 219 ? 30.409  -5.586  23.374  1.00 51.05  ? 219  ARG A C   1 
ATOM   1682 O O   . ARG A 1 219 ? 29.194  -5.596  23.587  1.00 51.39  ? 219  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 219 ? 30.954  -6.283  21.045  1.00 51.68  ? 219  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 219 ? 30.387  -6.009  19.659  1.00 54.23  ? 219  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 219 ? 29.049  -5.242  19.675  1.00 59.26  ? 219  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 219 ? 27.841  -6.074  19.658  1.00 63.42  ? 219  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 219 ? 27.426  -6.820  18.622  1.00 66.44  ? 219  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 219 ? 28.131  -6.902  17.491  1.00 66.19  ? 219  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 219 ? 26.295  -7.518  18.726  1.00 67.75  ? 219  ARG A NH2 1 
ATOM   1690 N N   . SER A 1 220 ? 31.303  -5.988  24.276  1.00 50.35  ? 220  SER A N   1 
ATOM   1691 C CA  . SER A 1 220 ? 30.877  -6.540  25.566  1.00 49.60  ? 220  SER A CA  1 
ATOM   1692 C C   . SER A 1 220 ? 30.465  -5.461  26.569  1.00 49.07  ? 220  SER A C   1 
ATOM   1693 O O   . SER A 1 220 ? 30.131  -5.769  27.715  1.00 49.19  ? 220  SER A O   1 
ATOM   1694 C CB  . SER A 1 220 ? 31.974  -7.437  26.169  1.00 49.77  ? 220  SER A CB  1 
ATOM   1695 O OG  . SER A 1 220 ? 32.865  -6.709  27.008  1.00 48.85  ? 220  SER A OG  1 
ATOM   1696 N N   . LEU A 1 221 ? 30.485  -4.201  26.138  1.00 48.40  ? 221  LEU A N   1 
ATOM   1697 C CA  . LEU A 1 221 ? 30.342  -3.072  27.055  1.00 47.29  ? 221  LEU A CA  1 
ATOM   1698 C C   . LEU A 1 221 ? 29.021  -2.353  26.899  1.00 47.04  ? 221  LEU A C   1 
ATOM   1699 O O   . LEU A 1 221 ? 28.801  -1.356  27.592  1.00 47.51  ? 221  LEU A O   1 
ATOM   1700 C CB  . LEU A 1 221 ? 31.485  -2.070  26.871  1.00 46.97  ? 221  LEU A CB  1 
ATOM   1701 C CG  . LEU A 1 221 ? 32.918  -2.564  27.060  1.00 45.97  ? 221  LEU A CG  1 
ATOM   1702 C CD1 . LEU A 1 221 ? 33.893  -1.438  26.820  1.00 46.10  ? 221  LEU A CD1 1 
ATOM   1703 C CD2 . LEU A 1 221 ? 33.104  -3.105  28.441  1.00 44.65  ? 221  LEU A CD2 1 
ATOM   1704 N N   . PHE A 1 222 ? 28.158  -2.834  25.998  1.00 46.18  ? 222  PHE A N   1 
ATOM   1705 C CA  . PHE A 1 222 ? 26.827  -2.237  25.789  1.00 45.84  ? 222  PHE A CA  1 
ATOM   1706 C C   . PHE A 1 222 ? 25.895  -3.211  25.097  1.00 45.91  ? 222  PHE A C   1 
ATOM   1707 O O   . PHE A 1 222 ? 26.325  -4.243  24.605  1.00 45.85  ? 222  PHE A O   1 
ATOM   1708 C CB  . PHE A 1 222 ? 26.908  -0.928  24.980  1.00 45.57  ? 222  PHE A CB  1 
ATOM   1709 C CG  . PHE A 1 222 ? 27.372  -1.114  23.551  1.00 44.86  ? 222  PHE A CG  1 
ATOM   1710 C CD1 . PHE A 1 222 ? 28.721  -1.336  23.259  1.00 43.66  ? 222  PHE A CD1 1 
ATOM   1711 C CD2 . PHE A 1 222 ? 26.461  -1.070  22.501  1.00 43.49  ? 222  PHE A CD2 1 
ATOM   1712 C CE1 . PHE A 1 222 ? 29.152  -1.514  21.947  1.00 43.25  ? 222  PHE A CE1 1 
ATOM   1713 C CE2 . PHE A 1 222 ? 26.887  -1.243  21.185  1.00 43.57  ? 222  PHE A CE2 1 
ATOM   1714 C CZ  . PHE A 1 222 ? 28.237  -1.467  20.909  1.00 43.94  ? 222  PHE A CZ  1 
ATOM   1715 N N   . HIS A 1 223 ? 24.618  -2.861  25.023  1.00 46.20  ? 223  HIS A N   1 
ATOM   1716 C CA  . HIS A 1 223 ? 23.606  -3.816  24.587  1.00 46.36  ? 223  HIS A CA  1 
ATOM   1717 C C   . HIS A 1 223 ? 22.787  -3.297  23.422  1.00 46.26  ? 223  HIS A C   1 
ATOM   1718 O O   . HIS A 1 223 ? 22.429  -4.046  22.524  1.00 46.37  ? 223  HIS A O   1 
ATOM   1719 C CB  . HIS A 1 223 ? 22.723  -4.205  25.777  1.00 46.48  ? 223  HIS A CB  1 
ATOM   1720 C CG  . HIS A 1 223 ? 23.504  -4.437  27.038  1.00 46.94  ? 223  HIS A CG  1 
ATOM   1721 N ND1 . HIS A 1 223 ? 24.212  -5.597  27.276  1.00 47.48  ? 223  HIS A ND1 1 
ATOM   1722 C CD2 . HIS A 1 223 ? 23.733  -3.634  28.103  1.00 47.16  ? 223  HIS A CD2 1 
ATOM   1723 C CE1 . HIS A 1 223 ? 24.820  -5.510  28.447  1.00 47.79  ? 223  HIS A CE1 1 
ATOM   1724 N NE2 . HIS A 1 223 ? 24.546  -4.326  28.968  1.00 47.83  ? 223  HIS A NE2 1 
ATOM   1725 N N   . ARG A 1 224 ? 22.507  -2.005  23.426  1.00 46.42  ? 224  ARG A N   1 
ATOM   1726 C CA  . ARG A 1 224 ? 21.775  -1.388  22.325  1.00 46.69  ? 224  ARG A CA  1 
ATOM   1727 C C   . ARG A 1 224 ? 22.523  -0.163  21.801  1.00 46.00  ? 224  ARG A C   1 
ATOM   1728 O O   . ARG A 1 224 ? 23.403  0.382   22.475  1.00 46.12  ? 224  ARG A O   1 
ATOM   1729 C CB  . ARG A 1 224 ? 20.358  -1.023  22.779  1.00 47.10  ? 224  ARG A CB  1 
ATOM   1730 C CG  . ARG A 1 224 ? 19.442  -2.237  22.940  1.00 50.01  ? 224  ARG A CG  1 
ATOM   1731 C CD  . ARG A 1 224 ? 18.377  -2.023  24.021  1.00 55.15  ? 224  ARG A CD  1 
ATOM   1732 N NE  . ARG A 1 224 ? 18.871  -2.385  25.354  1.00 59.49  ? 224  ARG A NE  1 
ATOM   1733 C CZ  . ARG A 1 224 ? 18.781  -3.604  25.892  1.00 62.50  ? 224  ARG A CZ  1 
ATOM   1734 N NH1 . ARG A 1 224 ? 18.202  -4.600  25.218  1.00 64.17  ? 224  ARG A NH1 1 
ATOM   1735 N NH2 . ARG A 1 224 ? 19.273  -3.834  27.110  1.00 63.40  ? 224  ARG A NH2 1 
ATOM   1736 N N   . ALA A 1 225 ? 22.183  0.274   20.597  1.00 45.10  ? 225  ALA A N   1 
ATOM   1737 C CA  . ALA A 1 225 ? 22.830  1.443   20.041  1.00 44.06  ? 225  ALA A CA  1 
ATOM   1738 C C   . ALA A 1 225 ? 21.886  2.272   19.190  1.00 43.55  ? 225  ALA A C   1 
ATOM   1739 O O   . ALA A 1 225 ? 20.989  1.739   18.542  1.00 43.18  ? 225  ALA A O   1 
ATOM   1740 C CB  . ALA A 1 225 ? 24.046  1.041   19.255  1.00 44.21  ? 225  ALA A CB  1 
ATOM   1741 N N   . VAL A 1 226 ? 22.107  3.583   19.220  1.00 43.19  ? 226  VAL A N   1 
ATOM   1742 C CA  . VAL A 1 226 ? 21.335  4.559   18.464  1.00 43.03  ? 226  VAL A CA  1 
ATOM   1743 C C   . VAL A 1 226 ? 22.287  5.440   17.660  1.00 42.79  ? 226  VAL A C   1 
ATOM   1744 O O   . VAL A 1 226 ? 23.167  6.081   18.239  1.00 43.19  ? 226  VAL A O   1 
ATOM   1745 C CB  . VAL A 1 226 ? 20.510  5.441   19.414  1.00 42.99  ? 226  VAL A CB  1 
ATOM   1746 C CG1 . VAL A 1 226 ? 19.828  6.574   18.661  1.00 43.09  ? 226  VAL A CG1 1 
ATOM   1747 C CG2 . VAL A 1 226 ? 19.483  4.599   20.131  1.00 43.41  ? 226  VAL A CG2 1 
ATOM   1748 N N   . LEU A 1 227 ? 22.113  5.467   16.338  1.00 42.11  ? 227  LEU A N   1 
ATOM   1749 C CA  . LEU A 1 227 ? 22.965  6.260   15.454  1.00 41.59  ? 227  LEU A CA  1 
ATOM   1750 C C   . LEU A 1 227 ? 22.170  7.336   14.739  1.00 41.65  ? 227  LEU A C   1 
ATOM   1751 O O   . LEU A 1 227 ? 21.407  7.049   13.812  1.00 41.72  ? 227  LEU A O   1 
ATOM   1752 C CB  . LEU A 1 227 ? 23.635  5.377   14.406  1.00 41.55  ? 227  LEU A CB  1 
ATOM   1753 C CG  . LEU A 1 227 ? 24.708  4.388   14.828  1.00 40.76  ? 227  LEU A CG  1 
ATOM   1754 C CD1 . LEU A 1 227 ? 24.092  3.118   15.322  1.00 40.49  ? 227  LEU A CD1 1 
ATOM   1755 C CD2 . LEU A 1 227 ? 25.537  4.096   13.634  1.00 40.70  ? 227  LEU A CD2 1 
ATOM   1756 N N   . GLN A 1 228 ? 22.372  8.579   15.159  1.00 41.57  ? 228  GLN A N   1 
ATOM   1757 C CA  . GLN A 1 228 ? 21.659  9.706   14.590  1.00 41.54  ? 228  GLN A CA  1 
ATOM   1758 C C   . GLN A 1 228 ? 22.514  10.465  13.576  1.00 42.19  ? 228  GLN A C   1 
ATOM   1759 O O   . GLN A 1 228 ? 23.519  11.096  13.944  1.00 42.38  ? 228  GLN A O   1 
ATOM   1760 C CB  . GLN A 1 228 ? 21.227  10.653  15.702  1.00 41.20  ? 228  GLN A CB  1 
ATOM   1761 C CG  . GLN A 1 228 ? 20.552  9.981   16.867  1.00 40.01  ? 228  GLN A CG  1 
ATOM   1762 C CD  . GLN A 1 228 ? 20.343  10.928  18.012  1.00 39.87  ? 228  GLN A CD  1 
ATOM   1763 O OE1 . GLN A 1 228 ? 20.277  12.142  17.822  1.00 41.05  ? 228  GLN A OE1 1 
ATOM   1764 N NE2 . GLN A 1 228 ? 20.259  10.389  19.216  1.00 39.85  ? 228  GLN A NE2 1 
ATOM   1765 N N   . SER A 1 229 ? 22.109  10.407  12.307  1.00 42.28  ? 229  SER A N   1 
ATOM   1766 C CA  . SER A 1 229 ? 22.758  11.164  11.238  1.00 42.66  ? 229  SER A CA  1 
ATOM   1767 C C   . SER A 1 229 ? 24.253  10.892  11.157  1.00 43.11  ? 229  SER A C   1 
ATOM   1768 O O   . SER A 1 229 ? 25.041  11.820  11.021  1.00 43.56  ? 229  SER A O   1 
ATOM   1769 C CB  . SER A 1 229 ? 22.542  12.668  11.409  1.00 42.60  ? 229  SER A CB  1 
ATOM   1770 O OG  . SER A 1 229 ? 21.179  12.998  11.549  1.00 43.44  ? 229  SER A OG  1 
ATOM   1771 N N   . GLY A 1 230 ? 24.649  9.628   11.239  1.00 43.50  ? 230  GLY A N   1 
ATOM   1772 C CA  . GLY A 1 230 ? 26.058  9.262   11.073  1.00 43.93  ? 230  GLY A CA  1 
ATOM   1773 C C   . GLY A 1 230 ? 26.209  7.763   10.915  1.00 44.13  ? 230  GLY A C   1 
ATOM   1774 O O   . GLY A 1 230 ? 25.281  7.017   11.232  1.00 44.57  ? 230  GLY A O   1 
ATOM   1775 N N   . THR A 1 231 ? 27.369  7.323   10.427  1.00 43.81  ? 231  THR A N   1 
ATOM   1776 C CA  . THR A 1 231 ? 27.660  5.903   10.251  1.00 43.79  ? 231  THR A CA  1 
ATOM   1777 C C   . THR A 1 231 ? 29.161  5.643   10.280  1.00 43.75  ? 231  THR A C   1 
ATOM   1778 O O   . THR A 1 231 ? 29.939  6.512   9.916   1.00 43.63  ? 231  THR A O   1 
ATOM   1779 C CB  . THR A 1 231 ? 27.182  5.399   8.894   1.00 43.91  ? 231  THR A CB  1 
ATOM   1780 O OG1 . THR A 1 231 ? 27.525  6.357   7.889   1.00 44.50  ? 231  THR A OG1 1 
ATOM   1781 C CG2 . THR A 1 231 ? 25.684  5.149   8.886   1.00 44.10  ? 231  THR A CG2 1 
ATOM   1782 N N   . PRO A 1 232 ? 29.581  4.426   10.678  1.00 43.83  ? 232  PRO A N   1 
ATOM   1783 C CA  . PRO A 1 232 ? 31.025  4.185   10.634  1.00 43.50  ? 232  PRO A CA  1 
ATOM   1784 C C   . PRO A 1 232 ? 31.533  3.992   9.194   1.00 43.23  ? 232  PRO A C   1 
ATOM   1785 O O   . PRO A 1 232 ? 32.649  4.385   8.885   1.00 43.40  ? 232  PRO A O   1 
ATOM   1786 C CB  . PRO A 1 232 ? 31.200  2.924   11.489  1.00 43.35  ? 232  PRO A CB  1 
ATOM   1787 C CG  . PRO A 1 232 ? 29.889  2.215   11.424  1.00 43.34  ? 232  PRO A CG  1 
ATOM   1788 C CD  . PRO A 1 232 ? 28.822  3.243   11.146  1.00 43.84  ? 232  PRO A CD  1 
ATOM   1789 N N   . ASN A 1 233 ? 30.711  3.395   8.334   1.00 43.12  ? 233  ASN A N   1 
ATOM   1790 C CA  . ASN A 1 233 ? 30.956  3.338   6.888   1.00 42.98  ? 233  ASN A CA  1 
ATOM   1791 C C   . ASN A 1 233 ? 30.730  4.719   6.284   1.00 43.29  ? 233  ASN A C   1 
ATOM   1792 O O   . ASN A 1 233 ? 30.215  5.602   6.970   1.00 44.17  ? 233  ASN A O   1 
ATOM   1793 C CB  . ASN A 1 233 ? 29.978  2.357   6.240   1.00 42.81  ? 233  ASN A CB  1 
ATOM   1794 C CG  . ASN A 1 233 ? 28.539  2.704   6.540   1.00 41.39  ? 233  ASN A CG  1 
ATOM   1795 O OD1 . ASN A 1 233 ? 28.112  2.609   7.683   1.00 41.13  ? 233  ASN A OD1 1 
ATOM   1796 N ND2 . ASN A 1 233 ? 27.796  3.132   5.528   1.00 39.80  ? 233  ASN A ND2 1 
ATOM   1797 N N   . GLY A 1 234 ? 31.078  4.915   5.012   1.00 42.99  ? 234  GLY A N   1 
ATOM   1798 C CA  . GLY A 1 234 ? 30.874  6.223   4.368   1.00 42.71  ? 234  GLY A CA  1 
ATOM   1799 C C   . GLY A 1 234 ? 32.149  7.032   4.089   1.00 42.48  ? 234  GLY A C   1 
ATOM   1800 O O   . GLY A 1 234 ? 33.238  6.671   4.535   1.00 42.73  ? 234  GLY A O   1 
ATOM   1801 N N   . PRO A 1 235 ? 32.020  8.154   3.365   1.00 41.91  ? 235  PRO A N   1 
ATOM   1802 C CA  . PRO A 1 235 ? 33.217  8.812   2.870   1.00 41.19  ? 235  PRO A CA  1 
ATOM   1803 C C   . PRO A 1 235 ? 34.067  9.587   3.897   1.00 40.45  ? 235  PRO A C   1 
ATOM   1804 O O   . PRO A 1 235 ? 35.199  9.933   3.595   1.00 40.99  ? 235  PRO A O   1 
ATOM   1805 C CB  . PRO A 1 235 ? 32.663  9.751   1.798   1.00 41.34  ? 235  PRO A CB  1 
ATOM   1806 C CG  . PRO A 1 235 ? 31.261  10.064  2.254   1.00 41.73  ? 235  PRO A CG  1 
ATOM   1807 C CD  . PRO A 1 235 ? 30.778  8.863   2.980   1.00 42.01  ? 235  PRO A CD  1 
ATOM   1808 N N   . TRP A 1 236 ? 33.571  9.843   5.097   1.00 39.61  ? 236  TRP A N   1 
ATOM   1809 C CA  . TRP A 1 236 ? 34.271  10.778  5.988   1.00 38.82  ? 236  TRP A CA  1 
ATOM   1810 C C   . TRP A 1 236 ? 34.643  10.237  7.362   1.00 38.96  ? 236  TRP A C   1 
ATOM   1811 O O   . TRP A 1 236 ? 35.403  10.879  8.079   1.00 39.41  ? 236  TRP A O   1 
ATOM   1812 C CB  . TRP A 1 236 ? 33.449  12.065  6.167   1.00 38.05  ? 236  TRP A CB  1 
ATOM   1813 C CG  . TRP A 1 236 ? 32.107  11.779  6.740   1.00 37.64  ? 236  TRP A CG  1 
ATOM   1814 C CD1 . TRP A 1 236 ? 30.934  11.592  6.049   1.00 36.90  ? 236  TRP A CD1 1 
ATOM   1815 C CD2 . TRP A 1 236 ? 31.797  11.569  8.117   1.00 36.95  ? 236  TRP A CD2 1 
ATOM   1816 N NE1 . TRP A 1 236 ? 29.918  11.310  6.923   1.00 36.97  ? 236  TRP A NE1 1 
ATOM   1817 C CE2 . TRP A 1 236 ? 30.422  11.284  8.196   1.00 36.57  ? 236  TRP A CE2 1 
ATOM   1818 C CE3 . TRP A 1 236 ? 32.546  11.615  9.298   1.00 36.67  ? 236  TRP A CE3 1 
ATOM   1819 C CZ2 . TRP A 1 236 ? 29.787  11.043  9.403   1.00 37.24  ? 236  TRP A CZ2 1 
ATOM   1820 C CZ3 . TRP A 1 236 ? 31.914  11.378  10.491  1.00 36.50  ? 236  TRP A CZ3 1 
ATOM   1821 C CH2 . TRP A 1 236 ? 30.553  11.089  10.540  1.00 36.97  ? 236  TRP A CH2 1 
ATOM   1822 N N   . ALA A 1 237 ? 34.099  9.092   7.760   1.00 38.93  ? 237  ALA A N   1 
ATOM   1823 C CA  . ALA A 1 237 ? 34.355  8.613   9.119   1.00 39.01  ? 237  ALA A CA  1 
ATOM   1824 C C   . ALA A 1 237 ? 35.697  7.871   9.315   1.00 39.45  ? 237  ALA A C   1 
ATOM   1825 O O   . ALA A 1 237 ? 36.138  7.689   10.458  1.00 39.73  ? 237  ALA A O   1 
ATOM   1826 C CB  . ALA A 1 237 ? 33.174  7.778   9.647   1.00 38.49  ? 237  ALA A CB  1 
ATOM   1827 N N   . THR A 1 238 ? 36.347  7.422   8.239   1.00 39.47  ? 238  THR A N   1 
ATOM   1828 C CA  . THR A 1 238 ? 37.600  6.673   8.431   1.00 39.84  ? 238  THR A CA  1 
ATOM   1829 C C   . THR A 1 238 ? 38.698  7.010   7.450   1.00 40.17  ? 238  THR A C   1 
ATOM   1830 O O   . THR A 1 238 ? 38.468  7.728   6.485   1.00 40.65  ? 238  THR A O   1 
ATOM   1831 C CB  . THR A 1 238 ? 37.396  5.174   8.371   1.00 39.45  ? 238  THR A CB  1 
ATOM   1832 O OG1 . THR A 1 238 ? 36.709  4.865   7.164   1.00 40.20  ? 238  THR A OG1 1 
ATOM   1833 C CG2 . THR A 1 238 ? 36.596  4.708   9.542   1.00 38.64  ? 238  THR A CG2 1 
ATOM   1834 N N   . VAL A 1 239 ? 39.897  6.504   7.718   1.00 40.31  ? 239  VAL A N   1 
ATOM   1835 C CA  . VAL A 1 239 ? 41.001  6.631   6.777   1.00 40.73  ? 239  VAL A CA  1 
ATOM   1836 C C   . VAL A 1 239 ? 41.743  5.324   6.647   1.00 41.22  ? 239  VAL A C   1 
ATOM   1837 O O   . VAL A 1 239 ? 41.898  4.587   7.624   1.00 41.64  ? 239  VAL A O   1 
ATOM   1838 C CB  . VAL A 1 239 ? 42.041  7.732   7.175   1.00 40.54  ? 239  VAL A CB  1 
ATOM   1839 C CG1 . VAL A 1 239 ? 41.729  9.026   6.484   1.00 40.71  ? 239  VAL A CG1 1 
ATOM   1840 C CG2 . VAL A 1 239 ? 42.137  7.911   8.682   1.00 40.01  ? 239  VAL A CG2 1 
ATOM   1841 N N   . SER A 1 240 ? 42.217  5.047   5.439   1.00 41.61  ? 240  SER A N   1 
ATOM   1842 C CA  . SER A 1 240 ? 43.168  3.973   5.232   1.00 42.04  ? 240  SER A CA  1 
ATOM   1843 C C   . SER A 1 240 ? 44.419  4.266   6.058   1.00 42.32  ? 240  SER A C   1 
ATOM   1844 O O   . SER A 1 240 ? 44.788  5.429   6.259   1.00 42.14  ? 240  SER A O   1 
ATOM   1845 C CB  . SER A 1 240 ? 43.538  3.861   3.756   1.00 41.80  ? 240  SER A CB  1 
ATOM   1846 O OG  . SER A 1 240 ? 44.502  4.839   3.431   1.00 42.27  ? 240  SER A OG  1 
ATOM   1847 N N   . ALA A 1 241 ? 45.061  3.198   6.524   1.00 43.03  ? 241  ALA A N   1 
ATOM   1848 C CA  . ALA A 1 241 ? 46.310  3.289   7.284   1.00 43.37  ? 241  ALA A CA  1 
ATOM   1849 C C   . ALA A 1 241 ? 47.360  4.169   6.610   1.00 43.65  ? 241  ALA A C   1 
ATOM   1850 O O   . ALA A 1 241 ? 48.010  4.978   7.270   1.00 43.57  ? 241  ALA A O   1 
ATOM   1851 C CB  . ALA A 1 241 ? 46.868  1.905   7.528   1.00 43.03  ? 241  ALA A CB  1 
ATOM   1852 N N   . GLY A 1 242 ? 47.515  4.010   5.299   1.00 44.25  ? 242  GLY A N   1 
ATOM   1853 C CA  . GLY A 1 242 ? 48.562  4.710   4.563   1.00 45.24  ? 242  GLY A CA  1 
ATOM   1854 C C   . GLY A 1 242 ? 48.282  6.194   4.480   1.00 45.88  ? 242  GLY A C   1 
ATOM   1855 O O   . GLY A 1 242 ? 49.193  7.025   4.592   1.00 45.80  ? 242  GLY A O   1 
ATOM   1856 N N   . GLU A 1 243 ? 47.006  6.517   4.289   1.00 46.38  ? 243  GLU A N   1 
ATOM   1857 C CA  . GLU A 1 243 ? 46.588  7.885   4.140   1.00 47.03  ? 243  GLU A CA  1 
ATOM   1858 C C   . GLU A 1 243 ? 46.785  8.596   5.467   1.00 47.33  ? 243  GLU A C   1 
ATOM   1859 O O   . GLU A 1 243 ? 47.373  9.687   5.528   1.00 47.31  ? 243  GLU A O   1 
ATOM   1860 C CB  . GLU A 1 243 ? 45.138  7.935   3.667   1.00 47.09  ? 243  GLU A CB  1 
ATOM   1861 C CG  . GLU A 1 243 ? 44.523  9.335   3.608   1.00 48.95  ? 243  GLU A CG  1 
ATOM   1862 C CD  . GLU A 1 243 ? 45.256  10.328  2.692   1.00 50.48  ? 243  GLU A CD  1 
ATOM   1863 O OE1 . GLU A 1 243 ? 44.776  11.481  2.568   1.00 51.48  ? 243  GLU A OE1 1 
ATOM   1864 O OE2 . GLU A 1 243 ? 46.299  9.982   2.097   1.00 51.00  ? 243  GLU A OE2 1 
ATOM   1865 N N   . ALA A 1 244 ? 46.328  7.949   6.535   1.00 47.65  ? 244  ALA A N   1 
ATOM   1866 C CA  . ALA A 1 244 ? 46.510  8.476   7.875   1.00 48.08  ? 244  ALA A CA  1 
ATOM   1867 C C   . ALA A 1 244 ? 47.985  8.766   8.144   1.00 48.73  ? 244  ALA A C   1 
ATOM   1868 O O   . ALA A 1 244 ? 48.319  9.749   8.832   1.00 49.38  ? 244  ALA A O   1 
ATOM   1869 C CB  . ALA A 1 244 ? 45.970  7.520   8.886   1.00 47.82  ? 244  ALA A CB  1 
ATOM   1870 N N   . ARG A 1 245 ? 48.856  7.913   7.595   1.00 49.12  ? 245  ARG A N   1 
ATOM   1871 C CA  . ARG A 1 245 ? 50.303  8.051   7.753   1.00 49.28  ? 245  ARG A CA  1 
ATOM   1872 C C   . ARG A 1 245 ? 50.802  9.254   6.963   1.00 49.34  ? 245  ARG A C   1 
ATOM   1873 O O   . ARG A 1 245 ? 51.636  10.026  7.454   1.00 49.29  ? 245  ARG A O   1 
ATOM   1874 C CB  . ARG A 1 245 ? 51.013  6.774   7.307   1.00 49.31  ? 245  ARG A CB  1 
ATOM   1875 C CG  . ARG A 1 245 ? 52.539  6.835   7.355   1.00 49.54  ? 245  ARG A CG  1 
ATOM   1876 C CD  . ARG A 1 245 ? 53.158  5.452   7.197   1.00 49.70  ? 245  ARG A CD  1 
ATOM   1877 N NE  . ARG A 1 245 ? 53.243  4.756   8.475   1.00 51.83  ? 245  ARG A NE  1 
ATOM   1878 C CZ  . ARG A 1 245 ? 54.189  4.994   9.385   1.00 53.21  ? 245  ARG A CZ  1 
ATOM   1879 N NH1 . ARG A 1 245 ? 55.125  5.909   9.149   1.00 53.36  ? 245  ARG A NH1 1 
ATOM   1880 N NH2 . ARG A 1 245 ? 54.203  4.325   10.534  1.00 52.62  ? 245  ARG A NH2 1 
ATOM   1881 N N   . ARG A 1 246 ? 50.274  9.411   5.748   1.00 49.19  ? 246  ARG A N   1 
ATOM   1882 C CA  . ARG A 1 246 ? 50.632  10.531  4.892   1.00 49.04  ? 246  ARG A CA  1 
ATOM   1883 C C   . ARG A 1 246 ? 50.295  11.822  5.593   1.00 48.72  ? 246  ARG A C   1 
ATOM   1884 O O   . ARG A 1 246 ? 51.149  12.714  5.690   1.00 49.05  ? 246  ARG A O   1 
ATOM   1885 C CB  . ARG A 1 246 ? 49.886  10.473  3.568   1.00 49.22  ? 246  ARG A CB  1 
ATOM   1886 C CG  . ARG A 1 246 ? 50.565  11.258  2.473   1.00 50.91  ? 246  ARG A CG  1 
ATOM   1887 C CD  . ARG A 1 246 ? 49.601  11.590  1.335   1.00 54.30  ? 246  ARG A CD  1 
ATOM   1888 N NE  . ARG A 1 246 ? 49.044  12.941  1.481   1.00 57.23  ? 246  ARG A NE  1 
ATOM   1889 C CZ  . ARG A 1 246 ? 47.741  13.230  1.534   1.00 58.08  ? 246  ARG A CZ  1 
ATOM   1890 N NH1 . ARG A 1 246 ? 46.837  12.268  1.430   1.00 58.23  ? 246  ARG A NH1 1 
ATOM   1891 N NH2 . ARG A 1 246 ? 47.336  14.491  1.673   1.00 58.38  ? 246  ARG A NH2 1 
ATOM   1892 N N   . ARG A 1 247 ? 49.060  11.901  6.103   1.00 48.03  ? 247  ARG A N   1 
ATOM   1893 C CA  . ARG A 1 247 ? 48.538  13.119  6.721   1.00 47.23  ? 247  ARG A CA  1 
ATOM   1894 C C   . ARG A 1 247 ? 49.316  13.519  7.972   1.00 47.20  ? 247  ARG A C   1 
ATOM   1895 O O   . ARG A 1 247 ? 49.559  14.699  8.192   1.00 47.22  ? 247  ARG A O   1 
ATOM   1896 C CB  . ARG A 1 247 ? 47.057  12.966  7.063   1.00 47.23  ? 247  ARG A CB  1 
ATOM   1897 C CG  . ARG A 1 247 ? 46.139  12.814  5.878   1.00 46.33  ? 247  ARG A CG  1 
ATOM   1898 C CD  . ARG A 1 247 ? 44.730  12.527  6.320   1.00 45.65  ? 247  ARG A CD  1 
ATOM   1899 N NE  . ARG A 1 247 ? 43.876  12.253  5.170   1.00 46.44  ? 247  ARG A NE  1 
ATOM   1900 C CZ  . ARG A 1 247 ? 42.540  12.209  5.181   1.00 47.24  ? 247  ARG A CZ  1 
ATOM   1901 N NH1 . ARG A 1 247 ? 41.837  12.410  6.293   1.00 47.41  ? 247  ARG A NH1 1 
ATOM   1902 N NH2 . ARG A 1 247 ? 41.892  11.953  4.058   1.00 47.34  ? 247  ARG A NH2 1 
ATOM   1903 N N   . ALA A 1 248 ? 49.706  12.539  8.787   1.00 47.14  ? 248  ALA A N   1 
ATOM   1904 C CA  . ALA A 1 248 ? 50.432  12.803  10.027  1.00 47.06  ? 248  ALA A CA  1 
ATOM   1905 C C   . ALA A 1 248 ? 51.840  13.313  9.733   1.00 47.39  ? 248  ALA A C   1 
ATOM   1906 O O   . ALA A 1 248 ? 52.372  14.169  10.451  1.00 47.19  ? 248  ALA A O   1 
ATOM   1907 C CB  . ALA A 1 248 ? 50.486  11.554  10.876  1.00 46.99  ? 248  ALA A CB  1 
ATOM   1908 N N   . THR A 1 249 ? 52.440  12.786  8.667   1.00 47.89  ? 249  THR A N   1 
ATOM   1909 C CA  . THR A 1 249 ? 53.790  13.177  8.274   1.00 48.38  ? 249  THR A CA  1 
ATOM   1910 C C   . THR A 1 249 ? 53.745  14.602  7.763   1.00 48.76  ? 249  THR A C   1 
ATOM   1911 O O   . THR A 1 249 ? 54.622  15.421  8.108   1.00 48.74  ? 249  THR A O   1 
ATOM   1912 C CB  . THR A 1 249 ? 54.371  12.257  7.173   1.00 48.51  ? 249  THR A CB  1 
ATOM   1913 O OG1 . THR A 1 249 ? 54.205  10.881  7.555   1.00 48.80  ? 249  THR A OG1 1 
ATOM   1914 C CG2 . THR A 1 249 ? 55.849  12.564  6.941   1.00 47.25  ? 249  THR A CG2 1 
ATOM   1915 N N   . LEU A 1 250 ? 52.716  14.888  6.953   1.00 48.81  ? 250  LEU A N   1 
ATOM   1916 C CA  . LEU A 1 250 ? 52.533  16.223  6.403   1.00 48.92  ? 250  LEU A CA  1 
ATOM   1917 C C   . LEU A 1 250 ? 52.324  17.249  7.512   1.00 49.04  ? 250  LEU A C   1 
ATOM   1918 O O   . LEU A 1 250 ? 52.959  18.309  7.504   1.00 49.00  ? 250  LEU A O   1 
ATOM   1919 C CB  . LEU A 1 250 ? 51.413  16.270  5.362   1.00 48.79  ? 250  LEU A CB  1 
ATOM   1920 C CG  . LEU A 1 250 ? 51.062  17.638  4.734   1.00 49.26  ? 250  LEU A CG  1 
ATOM   1921 C CD1 . LEU A 1 250 ? 52.289  18.540  4.456   1.00 50.87  ? 250  LEU A CD1 1 
ATOM   1922 C CD2 . LEU A 1 250 ? 50.227  17.482  3.451   1.00 49.17  ? 250  LEU A CD2 1 
ATOM   1923 N N   . LEU A 1 251 ? 51.470  16.933  8.480   1.00 49.26  ? 251  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 251 ? 51.301  17.833  9.608   1.00 49.58  ? 251  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 251 ? 52.629  18.014  10.337  1.00 49.94  ? 251  LEU A C   1 
ATOM   1926 O O   . LEU A 1 251 ? 53.013  19.130  10.646  1.00 49.76  ? 251  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 251 ? 50.194  17.366  10.548  1.00 49.39  ? 251  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 251 ? 49.855  18.391  11.635  1.00 49.28  ? 251  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 251 ? 48.381  18.658  11.681  1.00 50.15  ? 251  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 251 ? 50.356  17.958  12.990  1.00 48.55  ? 251  LEU A CD2 1 
ATOM   1931 N N   . ALA A 1 252 ? 53.338  16.918  10.578  1.00 50.83  ? 252  ALA A N   1 
ATOM   1932 C CA  . ALA A 1 252 ? 54.654  16.990  11.215  1.00 51.99  ? 252  ALA A CA  1 
ATOM   1933 C C   . ALA A 1 252 ? 55.582  17.995  10.524  1.00 52.62  ? 252  ALA A C   1 
ATOM   1934 O O   . ALA A 1 252 ? 56.170  18.869  11.178  1.00 52.28  ? 252  ALA A O   1 
ATOM   1935 C CB  . ALA A 1 252 ? 55.290  15.628  11.260  1.00 51.99  ? 252  ALA A CB  1 
ATOM   1936 N N   . ARG A 1 253 ? 55.693  17.881  9.203   1.00 53.45  ? 253  ARG A N   1 
ATOM   1937 C CA  . ARG A 1 253 ? 56.458  18.859  8.434   1.00 54.91  ? 253  ARG A CA  1 
ATOM   1938 C C   . ARG A 1 253 ? 55.973  20.290  8.673   1.00 53.91  ? 253  ARG A C   1 
ATOM   1939 O O   . ARG A 1 253 ? 56.784  21.163  8.963   1.00 53.84  ? 253  ARG A O   1 
ATOM   1940 C CB  . ARG A 1 253 ? 56.509  18.511  6.935   1.00 54.74  ? 253  ARG A CB  1 
ATOM   1941 C CG  . ARG A 1 253 ? 57.492  17.366  6.614   1.00 57.62  ? 253  ARG A CG  1 
ATOM   1942 C CD  . ARG A 1 253 ? 57.981  17.336  5.151   1.00 58.24  ? 253  ARG A CD  1 
ATOM   1943 N NE  . ARG A 1 253 ? 56.897  17.004  4.215   1.00 65.89  ? 253  ARG A NE  1 
ATOM   1944 C CZ  . ARG A 1 253 ? 56.211  17.895  3.483   1.00 68.45  ? 253  ARG A CZ  1 
ATOM   1945 N NH1 . ARG A 1 253 ? 55.245  17.473  2.662   1.00 69.04  ? 253  ARG A NH1 1 
ATOM   1946 N NH2 . ARG A 1 253 ? 56.488  19.207  3.557   1.00 69.11  ? 253  ARG A NH2 1 
ATOM   1947 N N   . LEU A 1 254 ? 54.658  20.510  8.593   1.00 53.59  ? 254  LEU A N   1 
ATOM   1948 C CA  . LEU A 1 254 ? 54.082  21.854  8.729   1.00 53.14  ? 254  LEU A CA  1 
ATOM   1949 C C   . LEU A 1 254 ? 54.492  22.542  10.025  1.00 53.22  ? 254  LEU A C   1 
ATOM   1950 O O   . LEU A 1 254 ? 54.712  23.742  10.033  1.00 53.30  ? 254  LEU A O   1 
ATOM   1951 C CB  . LEU A 1 254 ? 52.551  21.867  8.547   1.00 52.75  ? 254  LEU A CB  1 
ATOM   1952 C CG  . LEU A 1 254 ? 51.998  21.416  7.183   1.00 52.92  ? 254  LEU A CG  1 
ATOM   1953 C CD1 . LEU A 1 254 ? 50.519  21.597  7.051   1.00 51.65  ? 254  LEU A CD1 1 
ATOM   1954 C CD2 . LEU A 1 254 ? 52.677  22.091  6.007   1.00 54.11  ? 254  LEU A CD2 1 
ATOM   1955 N N   . VAL A 1 255 ? 54.627  21.782  11.107  1.00 53.50  ? 255  VAL A N   1 
ATOM   1956 C CA  . VAL A 1 255 ? 55.046  22.353  12.388  1.00 53.87  ? 255  VAL A CA  1 
ATOM   1957 C C   . VAL A 1 255 ? 56.559  22.233  12.635  1.00 54.77  ? 255  VAL A C   1 
ATOM   1958 O O   . VAL A 1 255 ? 57.062  22.679  13.670  1.00 54.85  ? 255  VAL A O   1 
ATOM   1959 C CB  . VAL A 1 255 ? 54.274  21.744  13.554  1.00 53.42  ? 255  VAL A CB  1 
ATOM   1960 C CG1 . VAL A 1 255 ? 52.819  22.110  13.451  1.00 52.86  ? 255  VAL A CG1 1 
ATOM   1961 C CG2 . VAL A 1 255 ? 54.440  20.244  13.557  1.00 53.52  ? 255  VAL A CG2 1 
ATOM   1962 N N   . GLY A 1 256 ? 57.273  21.624  11.688  1.00 55.55  ? 256  GLY A N   1 
ATOM   1963 C CA  . GLY A 1 256 ? 58.740  21.616  11.702  1.00 56.53  ? 256  GLY A CA  1 
ATOM   1964 C C   . GLY A 1 256 ? 59.360  20.364  12.293  1.00 57.18  ? 256  GLY A C   1 
ATOM   1965 O O   . GLY A 1 256 ? 60.087  20.449  13.274  1.00 57.24  ? 256  GLY A O   1 
ATOM   1966 N N   . CYS A 1 257 ? 59.072  19.212  11.685  1.00 57.82  ? 257  CYS A N   1 
ATOM   1967 C CA  . CYS A 1 257 ? 59.515  17.902  12.165  1.00 58.41  ? 257  CYS A CA  1 
ATOM   1968 C C   . CYS A 1 257 ? 59.646  16.930  10.974  1.00 58.40  ? 257  CYS A C   1 
ATOM   1969 O O   . CYS A 1 257 ? 60.583  16.126  10.891  1.00 58.46  ? 257  CYS A O   1 
ATOM   1970 C CB  . CYS A 1 257 ? 58.526  17.340  13.217  1.00 58.52  ? 257  CYS A CB  1 
ATOM   1971 S SG  . CYS A 1 257 ? 57.982  18.443  14.658  1.00 60.07  ? 257  CYS A SG  1 
ATOM   1972 N N   . ASN A 1 265 ? 61.957  7.026   10.788  1.00 68.93  ? 265  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 265 ? 61.910  6.674   12.206  1.00 69.08  ? 265  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 265 ? 60.832  7.475   12.955  1.00 68.72  ? 265  ASN A C   1 
ATOM   1975 O O   . ASN A 1 265 ? 60.984  8.681   13.200  1.00 68.76  ? 265  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 265 ? 63.302  6.826   12.860  1.00 69.27  ? 265  ASN A CB  1 
ATOM   1977 C CG  . ASN A 1 265 ? 63.285  6.582   14.378  1.00 69.76  ? 265  ASN A CG  1 
ATOM   1978 O OD1 . ASN A 1 265 ? 63.346  7.532   15.162  1.00 70.35  ? 265  ASN A OD1 1 
ATOM   1979 N ND2 . ASN A 1 265 ? 63.202  5.313   14.790  1.00 69.25  ? 265  ASN A ND2 1 
ATOM   1980 N N   . ASP A 1 266 ? 59.758  6.774   13.325  1.00 68.14  ? 266  ASP A N   1 
ATOM   1981 C CA  . ASP A 1 266 ? 58.558  7.385   13.899  1.00 67.42  ? 266  ASP A CA  1 
ATOM   1982 C C   . ASP A 1 266 ? 58.770  8.032   15.259  1.00 67.26  ? 266  ASP A C   1 
ATOM   1983 O O   . ASP A 1 266 ? 58.225  9.107   15.522  1.00 67.37  ? 266  ASP A O   1 
ATOM   1984 C CB  . ASP A 1 266 ? 57.412  6.370   13.957  1.00 66.95  ? 266  ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 266 ? 56.826  6.079   12.584  1.00 66.67  ? 266  ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 266 ? 57.132  6.810   11.616  1.00 66.11  ? 266  ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 266 ? 56.054  5.111   12.461  1.00 66.50  ? 266  ASP A OD2 1 
ATOM   1988 N N   . THR A 1 267 ? 59.566  7.387   16.108  1.00 66.83  ? 267  THR A N   1 
ATOM   1989 C CA  . THR A 1 267 ? 59.797  7.854   17.472  1.00 66.40  ? 267  THR A CA  1 
ATOM   1990 C C   . THR A 1 267 ? 60.246  9.303   17.493  1.00 66.32  ? 267  THR A C   1 
ATOM   1991 O O   . THR A 1 267 ? 59.660  10.126  18.191  1.00 66.45  ? 267  THR A O   1 
ATOM   1992 C CB  . THR A 1 267 ? 60.860  7.006   18.160  1.00 66.37  ? 267  THR A CB  1 
ATOM   1993 O OG1 . THR A 1 267 ? 60.569  5.629   17.925  1.00 66.47  ? 267  THR A OG1 1 
ATOM   1994 C CG2 . THR A 1 267 ? 60.889  7.275   19.667  1.00 66.24  ? 267  THR A CG2 1 
ATOM   1995 N N   . GLU A 1 268 ? 61.287  9.594   16.714  1.00 66.12  ? 268  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 268 ? 61.880  10.930  16.581  1.00 65.98  ? 268  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 268 ? 60.839  11.986  16.151  1.00 64.35  ? 268  GLU A C   1 
ATOM   1998 O O   . GLU A 1 268 ? 60.854  13.126  16.638  1.00 63.78  ? 268  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 268 ? 63.024  10.841  15.554  1.00 66.15  ? 268  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 268 ? 64.079  11.965  15.574  1.00 67.95  ? 268  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 268 ? 64.924  11.994  14.277  1.00 68.39  ? 268  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 268 ? 64.926  10.972  13.539  1.00 71.53  ? 268  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 268 ? 65.576  13.035  13.993  1.00 70.34  ? 268  GLU A OE2 1 
ATOM   2004 N N   . LEU A 1 269 ? 59.942  11.577  15.247  1.00 62.96  ? 269  LEU A N   1 
ATOM   2005 C CA  . LEU A 1 269 ? 58.914  12.445  14.672  1.00 61.57  ? 269  LEU A CA  1 
ATOM   2006 C C   . LEU A 1 269 ? 57.884  12.870  15.708  1.00 60.75  ? 269  LEU A C   1 
ATOM   2007 O O   . LEU A 1 269 ? 57.689  14.061  15.963  1.00 60.60  ? 269  LEU A O   1 
ATOM   2008 C CB  . LEU A 1 269 ? 58.215  11.735  13.514  1.00 61.42  ? 269  LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 269 ? 57.417  12.625  12.558  1.00 61.22  ? 269  LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 269 ? 58.330  13.303  11.512  1.00 62.38  ? 269  LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 269 ? 56.353  11.814  11.873  1.00 60.39  ? 269  LEU A CD2 1 
ATOM   2012 N N   . ILE A 1 270 ? 57.234  11.874  16.299  1.00 59.69  ? 270  ILE A N   1 
ATOM   2013 C CA  . ILE A 1 270 ? 56.249  12.080  17.343  1.00 58.59  ? 270  ILE A CA  1 
ATOM   2014 C C   . ILE A 1 270 ? 56.859  12.777  18.551  1.00 58.28  ? 270  ILE A C   1 
ATOM   2015 O O   . ILE A 1 270 ? 56.219  13.630  19.156  1.00 58.69  ? 270  ILE A O   1 
ATOM   2016 C CB  . ILE A 1 270 ? 55.627  10.754  17.740  1.00 58.17  ? 270  ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 270 ? 54.900  10.186  16.545  1.00 57.63  ? 270  ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 270 ? 54.648  10.919  18.868  1.00 58.08  ? 270  ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 270 ? 55.127  8.738   16.395  1.00 59.36  ? 270  ILE A CD1 1 
ATOM   2020 N N   . ALA A 1 271 ? 58.092  12.431  18.898  1.00 57.70  ? 271  ALA A N   1 
ATOM   2021 C CA  . ALA A 1 271 ? 58.773  13.126  19.975  1.00 57.43  ? 271  ALA A CA  1 
ATOM   2022 C C   . ALA A 1 271 ? 58.768  14.632  19.696  1.00 57.45  ? 271  ALA A C   1 
ATOM   2023 O O   . ALA A 1 271 ? 58.422  15.427  20.571  1.00 57.55  ? 271  ALA A O   1 
ATOM   2024 C CB  . ALA A 1 271 ? 60.181  12.605  20.147  1.00 57.15  ? 271  ALA A CB  1 
ATOM   2025 N N   . CYS A 1 272 ? 59.128  15.015  18.470  1.00 57.69  ? 272  CYS A N   1 
ATOM   2026 C CA  . CYS A 1 272 ? 59.107  16.413  18.073  1.00 56.91  ? 272  CYS A CA  1 
ATOM   2027 C C   . CYS A 1 272 ? 57.685  16.955  18.235  1.00 56.07  ? 272  CYS A C   1 
ATOM   2028 O O   . CYS A 1 272 ? 57.475  17.896  19.000  1.00 56.20  ? 272  CYS A O   1 
ATOM   2029 C CB  . CYS A 1 272 ? 59.606  16.597  16.637  1.00 57.19  ? 272  CYS A CB  1 
ATOM   2030 S SG  . CYS A 1 272 ? 59.525  18.340  16.053  1.00 59.60  ? 272  CYS A SG  1 
ATOM   2031 N N   . LEU A 1 273 ? 56.716  16.348  17.543  1.00 54.69  ? 273  LEU A N   1 
ATOM   2032 C CA  . LEU A 1 273 ? 55.308  16.739  17.669  1.00 53.41  ? 273  LEU A CA  1 
ATOM   2033 C C   . LEU A 1 273 ? 54.905  17.028  19.110  1.00 53.01  ? 273  LEU A C   1 
ATOM   2034 O O   . LEU A 1 273 ? 54.270  18.047  19.398  1.00 53.10  ? 273  LEU A O   1 
ATOM   2035 C CB  . LEU A 1 273 ? 54.382  15.669  17.087  1.00 52.99  ? 273  LEU A CB  1 
ATOM   2036 C CG  . LEU A 1 273 ? 54.104  15.723  15.584  1.00 52.45  ? 273  LEU A CG  1 
ATOM   2037 C CD1 . LEU A 1 273 ? 53.270  14.537  15.127  1.00 51.90  ? 273  LEU A CD1 1 
ATOM   2038 C CD2 . LEU A 1 273 ? 53.427  17.015  15.185  1.00 51.73  ? 273  LEU A CD2 1 
ATOM   2039 N N   . ARG A 1 274 ? 55.296  16.137  20.017  1.00 52.40  ? 274  ARG A N   1 
ATOM   2040 C CA  . ARG A 1 274 ? 54.892  16.221  21.411  1.00 51.80  ? 274  ARG A CA  1 
ATOM   2041 C C   . ARG A 1 274 ? 55.421  17.445  22.114  1.00 51.30  ? 274  ARG A C   1 
ATOM   2042 O O   . ARG A 1 274 ? 54.923  17.811  23.173  1.00 51.42  ? 274  ARG A O   1 
ATOM   2043 C CB  . ARG A 1 274 ? 55.335  14.986  22.158  1.00 51.68  ? 274  ARG A CB  1 
ATOM   2044 C CG  . ARG A 1 274 ? 54.365  13.842  22.049  1.00 53.15  ? 274  ARG A CG  1 
ATOM   2045 C CD  . ARG A 1 274 ? 54.531  12.904  23.243  1.00 55.74  ? 274  ARG A CD  1 
ATOM   2046 N NE  . ARG A 1 274 ? 55.861  12.311  23.215  1.00 56.94  ? 274  ARG A NE  1 
ATOM   2047 C CZ  . ARG A 1 274 ? 56.125  11.100  22.744  1.00 57.61  ? 274  ARG A CZ  1 
ATOM   2048 N NH1 . ARG A 1 274 ? 55.123  10.319  22.298  1.00 58.09  ? 274  ARG A NH1 1 
ATOM   2049 N NH2 . ARG A 1 274 ? 57.388  10.677  22.739  1.00 55.89  ? 274  ARG A NH2 1 
ATOM   2050 N N   . THR A 1 275 ? 56.427  18.077  21.523  1.00 50.84  ? 275  THR A N   1 
ATOM   2051 C CA  . THR A 1 275 ? 57.047  19.247  22.124  1.00 50.33  ? 275  THR A CA  1 
ATOM   2052 C C   . THR A 1 275 ? 56.458  20.498  21.529  1.00 49.99  ? 275  THR A C   1 
ATOM   2053 O O   . THR A 1 275 ? 56.801  21.593  21.954  1.00 50.17  ? 275  THR A O   1 
ATOM   2054 C CB  . THR A 1 275 ? 58.578  19.288  21.928  1.00 50.31  ? 275  THR A CB  1 
ATOM   2055 O OG1 . THR A 1 275 ? 58.871  19.446  20.540  1.00 50.21  ? 275  THR A OG1 1 
ATOM   2056 C CG2 . THR A 1 275 ? 59.249  18.019  22.459  1.00 50.52  ? 275  THR A CG2 1 
ATOM   2057 N N   . ARG A 1 276 ? 55.583  20.338  20.542  1.00 49.68  ? 276  ARG A N   1 
ATOM   2058 C CA  . ARG A 1 276 ? 54.829  21.465  20.004  1.00 49.62  ? 276  ARG A CA  1 
ATOM   2059 C C   . ARG A 1 276 ? 53.648  21.808  20.901  1.00 48.77  ? 276  ARG A C   1 
ATOM   2060 O O   . ARG A 1 276 ? 53.004  20.920  21.464  1.00 48.83  ? 276  ARG A O   1 
ATOM   2061 C CB  . ARG A 1 276 ? 54.346  21.178  18.588  1.00 50.12  ? 276  ARG A CB  1 
ATOM   2062 C CG  . ARG A 1 276 ? 55.471  21.080  17.571  1.00 53.24  ? 276  ARG A CG  1 
ATOM   2063 C CD  . ARG A 1 276 ? 56.228  22.409  17.391  1.00 58.80  ? 276  ARG A CD  1 
ATOM   2064 N NE  . ARG A 1 276 ? 57.533  22.140  16.772  1.00 64.10  ? 276  ARG A NE  1 
ATOM   2065 C CZ  . ARG A 1 276 ? 58.705  22.104  17.419  1.00 65.98  ? 276  ARG A CZ  1 
ATOM   2066 N NH1 . ARG A 1 276 ? 58.769  22.353  18.734  1.00 65.65  ? 276  ARG A NH1 1 
ATOM   2067 N NH2 . ARG A 1 276 ? 59.826  21.833  16.740  1.00 65.87  ? 276  ARG A NH2 1 
ATOM   2068 N N   . PRO A 1 277 ? 53.384  23.106  21.076  1.00 48.06  ? 277  PRO A N   1 
ATOM   2069 C CA  . PRO A 1 277 ? 52.224  23.557  21.839  1.00 47.54  ? 277  PRO A CA  1 
ATOM   2070 C C   . PRO A 1 277 ? 50.931  23.078  21.216  1.00 46.78  ? 277  PRO A C   1 
ATOM   2071 O O   . PRO A 1 277 ? 50.858  22.922  20.010  1.00 46.69  ? 277  PRO A O   1 
ATOM   2072 C CB  . PRO A 1 277 ? 52.316  25.076  21.731  1.00 47.61  ? 277  PRO A CB  1 
ATOM   2073 C CG  . PRO A 1 277 ? 53.782  25.339  21.507  1.00 47.76  ? 277  PRO A CG  1 
ATOM   2074 C CD  . PRO A 1 277 ? 54.195  24.236  20.599  1.00 47.96  ? 277  PRO A CD  1 
ATOM   2075 N N   . ALA A 1 278 ? 49.920  22.849  22.042  1.00 46.30  ? 278  ALA A N   1 
ATOM   2076 C CA  . ALA A 1 278 ? 48.618  22.383  21.564  1.00 45.48  ? 278  ALA A CA  1 
ATOM   2077 C C   . ALA A 1 278 ? 48.101  23.268  20.448  1.00 45.13  ? 278  ALA A C   1 
ATOM   2078 O O   . ALA A 1 278 ? 47.812  22.783  19.358  1.00 44.92  ? 278  ALA A O   1 
ATOM   2079 C CB  . ALA A 1 278 ? 47.612  22.321  22.703  1.00 45.02  ? 278  ALA A CB  1 
ATOM   2080 N N   . GLN A 1 279 ? 48.016  24.569  20.712  1.00 44.90  ? 279  GLN A N   1 
ATOM   2081 C CA  . GLN A 1 279 ? 47.417  25.483  19.755  1.00 44.99  ? 279  GLN A CA  1 
ATOM   2082 C C   . GLN A 1 279 ? 48.110  25.410  18.405  1.00 45.64  ? 279  GLN A C   1 
ATOM   2083 O O   . GLN A 1 279 ? 47.462  25.445  17.353  1.00 45.82  ? 279  GLN A O   1 
ATOM   2084 C CB  . GLN A 1 279 ? 47.418  26.915  20.279  1.00 44.75  ? 279  GLN A CB  1 
ATOM   2085 C CG  . GLN A 1 279 ? 46.442  27.826  19.529  1.00 43.62  ? 279  GLN A CG  1 
ATOM   2086 C CD  . GLN A 1 279 ? 45.022  27.297  19.559  1.00 41.18  ? 279  GLN A CD  1 
ATOM   2087 O OE1 . GLN A 1 279 ? 44.496  26.953  20.611  1.00 39.83  ? 279  GLN A OE1 1 
ATOM   2088 N NE2 . GLN A 1 279 ? 44.405  27.217  18.398  1.00 41.16  ? 279  GLN A NE2 1 
ATOM   2089 N N   . ASP A 1 280 ? 49.434  25.308  18.459  1.00 46.28  ? 280  ASP A N   1 
ATOM   2090 C CA  . ASP A 1 280 ? 50.287  25.140  17.298  1.00 46.63  ? 280  ASP A CA  1 
ATOM   2091 C C   . ASP A 1 280 ? 49.764  24.048  16.354  1.00 46.46  ? 280  ASP A C   1 
ATOM   2092 O O   . ASP A 1 280 ? 49.647  24.270  15.152  1.00 46.37  ? 280  ASP A O   1 
ATOM   2093 C CB  . ASP A 1 280 ? 51.671  24.761  17.797  1.00 47.17  ? 280  ASP A CB  1 
ATOM   2094 C CG  . ASP A 1 280 ? 52.775  25.384  16.997  1.00 48.65  ? 280  ASP A CG  1 
ATOM   2095 O OD1 . ASP A 1 280 ? 53.609  26.079  17.621  1.00 51.76  ? 280  ASP A OD1 1 
ATOM   2096 O OD2 . ASP A 1 280 ? 52.822  25.179  15.765  1.00 49.07  ? 280  ASP A OD2 1 
ATOM   2097 N N   . LEU A 1 281 ? 49.444  22.878  16.904  1.00 46.37  ? 281  LEU A N   1 
ATOM   2098 C CA  . LEU A 1 281 ? 48.905  21.784  16.113  1.00 46.35  ? 281  LEU A CA  1 
ATOM   2099 C C   . LEU A 1 281 ? 47.538  22.145  15.581  1.00 46.78  ? 281  LEU A C   1 
ATOM   2100 O O   . LEU A 1 281 ? 47.238  21.916  14.418  1.00 46.87  ? 281  LEU A O   1 
ATOM   2101 C CB  . LEU A 1 281 ? 48.800  20.509  16.937  1.00 46.25  ? 281  LEU A CB  1 
ATOM   2102 C CG  . LEU A 1 281 ? 50.069  19.860  17.486  1.00 46.14  ? 281  LEU A CG  1 
ATOM   2103 C CD1 . LEU A 1 281 ? 49.701  18.638  18.285  1.00 45.77  ? 281  LEU A CD1 1 
ATOM   2104 C CD2 . LEU A 1 281 ? 51.016  19.484  16.371  1.00 46.49  ? 281  LEU A CD2 1 
ATOM   2105 N N   . VAL A 1 282 ? 46.703  22.723  16.432  1.00 47.53  ? 282  VAL A N   1 
ATOM   2106 C CA  . VAL A 1 282 ? 45.355  23.071  16.019  1.00 48.25  ? 282  VAL A CA  1 
ATOM   2107 C C   . VAL A 1 282 ? 45.421  24.067  14.866  1.00 49.20  ? 282  VAL A C   1 
ATOM   2108 O O   . VAL A 1 282 ? 44.610  23.987  13.940  1.00 49.94  ? 282  VAL A O   1 
ATOM   2109 C CB  . VAL A 1 282 ? 44.498  23.631  17.184  1.00 48.13  ? 282  VAL A CB  1 
ATOM   2110 C CG1 . VAL A 1 282 ? 43.093  23.969  16.708  1.00 47.44  ? 282  VAL A CG1 1 
ATOM   2111 C CG2 . VAL A 1 282 ? 44.435  22.643  18.326  1.00 47.71  ? 282  VAL A CG2 1 
ATOM   2112 N N   . ASP A 1 283 ? 46.389  24.985  14.904  1.00 49.81  ? 283  ASP A N   1 
ATOM   2113 C CA  . ASP A 1 283 ? 46.507  26.001  13.854  1.00 50.51  ? 283  ASP A CA  1 
ATOM   2114 C C   . ASP A 1 283 ? 46.800  25.420  12.481  1.00 51.05  ? 283  ASP A C   1 
ATOM   2115 O O   . ASP A 1 283 ? 46.547  26.063  11.480  1.00 51.48  ? 283  ASP A O   1 
ATOM   2116 C CB  . ASP A 1 283 ? 47.538  27.063  14.215  1.00 50.48  ? 283  ASP A CB  1 
ATOM   2117 C CG  . ASP A 1 283 ? 47.063  27.984  15.330  1.00 51.27  ? 283  ASP A CG  1 
ATOM   2118 O OD1 . ASP A 1 283 ? 45.891  27.860  15.756  1.00 52.44  ? 283  ASP A OD1 1 
ATOM   2119 O OD2 . ASP A 1 283 ? 47.862  28.830  15.788  1.00 50.80  ? 283  ASP A OD2 1 
ATOM   2120 N N   . HIS A 1 284 ? 47.295  24.192  12.424  1.00 51.86  ? 284  HIS A N   1 
ATOM   2121 C CA  . HIS A 1 284 ? 47.647  23.603  11.140  1.00 52.51  ? 284  HIS A CA  1 
ATOM   2122 C C   . HIS A 1 284 ? 46.790  22.442  10.693  1.00 53.43  ? 284  HIS A C   1 
ATOM   2123 O O   . HIS A 1 284 ? 46.901  22.022  9.541   1.00 53.31  ? 284  HIS A O   1 
ATOM   2124 C CB  . HIS A 1 284 ? 49.118  23.199  11.115  1.00 52.19  ? 284  HIS A CB  1 
ATOM   2125 C CG  . HIS A 1 284 ? 50.051  24.355  11.245  1.00 51.22  ? 284  HIS A CG  1 
ATOM   2126 N ND1 . HIS A 1 284 ? 50.591  24.739  12.451  1.00 50.36  ? 284  HIS A ND1 1 
ATOM   2127 C CD2 . HIS A 1 284 ? 50.519  25.230  10.326  1.00 51.22  ? 284  HIS A CD2 1 
ATOM   2128 C CE1 . HIS A 1 284 ? 51.366  25.792  12.270  1.00 50.47  ? 284  HIS A CE1 1 
ATOM   2129 N NE2 . HIS A 1 284 ? 51.336  26.114  10.990  1.00 51.06  ? 284  HIS A NE2 1 
ATOM   2130 N N   . GLU A 1 285 ? 45.943  21.916  11.579  1.00 54.77  ? 285  GLU A N   1 
ATOM   2131 C CA  . GLU A 1 285 ? 45.225  20.666  11.274  1.00 55.92  ? 285  GLU A CA  1 
ATOM   2132 C C   . GLU A 1 285 ? 44.368  20.779  10.022  1.00 56.76  ? 285  GLU A C   1 
ATOM   2133 O O   . GLU A 1 285 ? 44.081  19.783  9.373   1.00 56.62  ? 285  GLU A O   1 
ATOM   2134 C CB  . GLU A 1 285 ? 44.447  20.110  12.476  1.00 55.42  ? 285  GLU A CB  1 
ATOM   2135 C CG  . GLU A 1 285 ? 43.211  20.864  12.908  1.00 55.69  ? 285  GLU A CG  1 
ATOM   2136 C CD  . GLU A 1 285 ? 42.630  20.340  14.222  1.00 56.57  ? 285  GLU A CD  1 
ATOM   2137 O OE1 . GLU A 1 285 ? 43.320  19.540  14.916  1.00 57.56  ? 285  GLU A OE1 1 
ATOM   2138 O OE2 . GLU A 1 285 ? 41.484  20.740  14.572  1.00 57.34  ? 285  GLU A OE2 1 
ATOM   2139 N N   . TRP A 1 286 ? 44.015  22.006  9.658   1.00 58.41  ? 286  TRP A N   1 
ATOM   2140 C CA  . TRP A 1 286 ? 43.212  22.240  8.459   1.00 60.19  ? 286  TRP A CA  1 
ATOM   2141 C C   . TRP A 1 286 ? 44.030  22.308  7.172   1.00 61.79  ? 286  TRP A C   1 
ATOM   2142 O O   . TRP A 1 286 ? 43.511  22.033  6.087   1.00 62.14  ? 286  TRP A O   1 
ATOM   2143 C CB  . TRP A 1 286 ? 42.323  23.464  8.647   1.00 59.52  ? 286  TRP A CB  1 
ATOM   2144 C CG  . TRP A 1 286 ? 41.319  23.205  9.714   1.00 59.27  ? 286  TRP A CG  1 
ATOM   2145 C CD1 . TRP A 1 286 ? 41.341  23.669  11.008  1.00 59.26  ? 286  TRP A CD1 1 
ATOM   2146 C CD2 . TRP A 1 286 ? 40.168  22.361  9.609   1.00 58.60  ? 286  TRP A CD2 1 
ATOM   2147 N NE1 . TRP A 1 286 ? 40.255  23.179  11.702  1.00 59.08  ? 286  TRP A NE1 1 
ATOM   2148 C CE2 . TRP A 1 286 ? 39.520  22.376  10.864  1.00 58.64  ? 286  TRP A CE2 1 
ATOM   2149 C CE3 . TRP A 1 286 ? 39.618  21.596  8.572   1.00 58.31  ? 286  TRP A CE3 1 
ATOM   2150 C CZ2 . TRP A 1 286 ? 38.347  21.663  11.103  1.00 58.51  ? 286  TRP A CZ2 1 
ATOM   2151 C CZ3 . TRP A 1 286 ? 38.453  20.891  8.813   1.00 58.80  ? 286  TRP A CZ3 1 
ATOM   2152 C CH2 . TRP A 1 286 ? 37.828  20.934  10.066  1.00 58.90  ? 286  TRP A CH2 1 
ATOM   2153 N N   . HIS A 1 287 ? 45.312  22.638  7.308   1.00 63.80  ? 287  HIS A N   1 
ATOM   2154 C CA  . HIS A 1 287 ? 46.212  22.772  6.172   1.00 65.69  ? 287  HIS A CA  1 
ATOM   2155 C C   . HIS A 1 287 ? 46.676  21.468  5.559   1.00 67.17  ? 287  HIS A C   1 
ATOM   2156 O O   . HIS A 1 287 ? 47.310  21.484  4.513   1.00 67.49  ? 287  HIS A O   1 
ATOM   2157 C CB  . HIS A 1 287 ? 47.446  23.571  6.556   1.00 65.62  ? 287  HIS A CB  1 
ATOM   2158 C CG  . HIS A 1 287 ? 47.151  24.966  6.992   1.00 66.41  ? 287  HIS A CG  1 
ATOM   2159 N ND1 . HIS A 1 287 ? 45.993  25.628  6.638   1.00 67.19  ? 287  HIS A ND1 1 
ATOM   2160 C CD2 . HIS A 1 287 ? 47.873  25.835  7.737   1.00 66.42  ? 287  HIS A CD2 1 
ATOM   2161 C CE1 . HIS A 1 287 ? 46.008  26.839  7.162   1.00 67.71  ? 287  HIS A CE1 1 
ATOM   2162 N NE2 . HIS A 1 287 ? 47.138  26.990  7.832   1.00 67.37  ? 287  HIS A NE2 1 
ATOM   2163 N N   . VAL A 1 288 ? 46.378  20.344  6.192   1.00 69.32  ? 288  VAL A N   1 
ATOM   2164 C CA  . VAL A 1 288 ? 46.893  19.073  5.708   1.00 71.47  ? 288  VAL A CA  1 
ATOM   2165 C C   . VAL A 1 288 ? 46.234  18.685  4.376   1.00 73.60  ? 288  VAL A C   1 
ATOM   2166 O O   . VAL A 1 288 ? 46.872  18.077  3.520   1.00 73.93  ? 288  VAL A O   1 
ATOM   2167 C CB  . VAL A 1 288 ? 46.829  17.977  6.787   1.00 71.01  ? 288  VAL A CB  1 
ATOM   2168 C CG1 . VAL A 1 288 ? 47.272  16.671  6.233   1.00 71.12  ? 288  VAL A CG1 1 
ATOM   2169 C CG2 . VAL A 1 288 ? 47.738  18.336  7.939   1.00 70.60  ? 288  VAL A CG2 1 
ATOM   2170 N N   . LEU A 1 289 ? 44.976  19.070  4.180   1.00 76.37  ? 289  LEU A N   1 
ATOM   2171 C CA  . LEU A 1 289 ? 44.340  18.927  2.865   1.00 78.99  ? 289  LEU A CA  1 
ATOM   2172 C C   . LEU A 1 289 ? 43.987  20.294  2.272   1.00 81.32  ? 289  LEU A C   1 
ATOM   2173 O O   . LEU A 1 289 ? 42.856  20.775  2.476   1.00 81.70  ? 289  LEU A O   1 
ATOM   2174 C CB  . LEU A 1 289 ? 43.090  18.051  2.950   1.00 78.65  ? 289  LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 289 ? 43.265  16.689  3.617   1.00 78.64  ? 289  LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 289 ? 41.914  16.068  3.961   1.00 78.17  ? 289  LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 289 ? 44.106  15.761  2.748   1.00 78.28  ? 289  LEU A CD2 1 
ATOM   2178 N N   . PRO A 1 290 ? 44.952  20.943  1.554   1.00 83.55  ? 290  PRO A N   1 
ATOM   2179 C CA  . PRO A 1 290 ? 44.573  22.172  0.837   1.00 84.93  ? 290  PRO A CA  1 
ATOM   2180 C C   . PRO A 1 290 ? 43.348  21.833  0.002   1.00 86.22  ? 290  PRO A C   1 
ATOM   2181 O O   . PRO A 1 290 ? 42.387  22.611  -0.044  1.00 86.31  ? 290  PRO A O   1 
ATOM   2182 C CB  . PRO A 1 290 ? 45.799  22.463  -0.052  1.00 84.97  ? 290  PRO A CB  1 
ATOM   2183 C CG  . PRO A 1 290 ? 46.960  21.874  0.704   1.00 84.34  ? 290  PRO A CG  1 
ATOM   2184 C CD  . PRO A 1 290 ? 46.385  20.614  1.354   1.00 83.81  ? 290  PRO A CD  1 
ATOM   2185 N N   . GLN A 1 291 ? 43.407  20.644  -0.605  1.00 87.74  ? 291  GLN A N   1 
ATOM   2186 C CA  . GLN A 1 291 ? 42.281  19.942  -1.232  1.00 89.49  ? 291  GLN A CA  1 
ATOM   2187 C C   . GLN A 1 291 ? 40.908  20.458  -0.779  1.00 90.12  ? 291  GLN A C   1 
ATOM   2188 O O   . GLN A 1 291 ? 40.490  20.258  0.378   1.00 90.21  ? 291  GLN A O   1 
ATOM   2189 C CB  . GLN A 1 291 ? 42.412  18.431  -0.983  1.00 89.39  ? 291  GLN A CB  1 
ATOM   2190 C CG  . GLN A 1 291 ? 43.874  17.947  -0.967  1.00 90.17  ? 291  GLN A CG  1 
ATOM   2191 C CD  . GLN A 1 291 ? 44.027  16.424  -0.975  1.00 90.41  ? 291  GLN A CD  1 
ATOM   2192 O OE1 . GLN A 1 291 ? 43.161  15.689  -0.483  1.00 91.11  ? 291  GLN A OE1 1 
ATOM   2193 N NE2 . GLN A 1 291 ? 45.147  15.945  -1.528  1.00 91.03  ? 291  GLN A NE2 1 
ATOM   2194 N N   . GLU A 1 292 ? 40.236  21.147  -1.707  1.00 90.97  ? 292  GLU A N   1 
ATOM   2195 C CA  . GLU A 1 292 ? 38.928  21.765  -1.449  1.00 91.61  ? 292  GLU A CA  1 
ATOM   2196 C C   . GLU A 1 292 ? 37.837  20.711  -1.281  1.00 91.59  ? 292  GLU A C   1 
ATOM   2197 O O   . GLU A 1 292 ? 37.518  19.937  -2.201  1.00 91.76  ? 292  GLU A O   1 
ATOM   2198 C CB  . GLU A 1 292 ? 38.576  22.827  -2.503  1.00 91.70  ? 292  GLU A CB  1 
ATOM   2199 C CG  . GLU A 1 292 ? 39.114  24.205  -2.132  1.00 92.93  ? 292  GLU A CG  1 
ATOM   2200 C CD  . GLU A 1 292 ? 39.266  25.137  -3.322  1.00 94.51  ? 292  GLU A CD  1 
ATOM   2201 O OE1 . GLU A 1 292 ? 38.231  25.530  -3.912  1.00 95.05  ? 292  GLU A OE1 1 
ATOM   2202 O OE2 . GLU A 1 292 ? 40.425  25.489  -3.649  1.00 94.52  ? 292  GLU A OE2 1 
ATOM   2203 N N   . SER A 1 293 ? 37.285  20.704  -0.074  1.00 91.32  ? 293  SER A N   1 
ATOM   2204 C CA  . SER A 1 293 ? 36.517  19.593  0.439   1.00 91.16  ? 293  SER A CA  1 
ATOM   2205 C C   . SER A 1 293 ? 35.882  20.093  1.727   1.00 90.65  ? 293  SER A C   1 
ATOM   2206 O O   . SER A 1 293 ? 36.560  20.670  2.585   1.00 90.65  ? 293  SER A O   1 
ATOM   2207 C CB  . SER A 1 293 ? 37.462  18.400  0.706   1.00 91.41  ? 293  SER A CB  1 
ATOM   2208 O OG  . SER A 1 293 ? 36.857  17.376  1.485   1.00 92.10  ? 293  SER A OG  1 
ATOM   2209 N N   . ILE A 1 294 ? 34.576  19.896  1.857   1.00 89.90  ? 294  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 294 ? 33.896  20.300  3.079   1.00 89.13  ? 294  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 294 ? 34.427  19.422  4.217   1.00 88.44  ? 294  ILE A C   1 
ATOM   2212 O O   . ILE A 1 294 ? 34.920  19.915  5.253   1.00 88.29  ? 294  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 294 ? 32.354  20.174  2.953   1.00 89.30  ? 294  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 294 ? 31.900  20.324  1.495   1.00 88.92  ? 294  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 294 ? 31.653  21.170  3.908   1.00 89.56  ? 294  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 294 ? 30.447  20.017  1.274   1.00 88.91  ? 294  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 295 ? 34.354  18.115  3.968   1.00 87.38  ? 295  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 295 ? 34.796  17.076  4.892   1.00 86.06  ? 295  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 295 ? 36.267  16.779  4.668   1.00 84.98  ? 295  PHE A C   1 
ATOM   2220 O O   . PHE A 1 295 ? 36.695  15.629  4.492   1.00 84.60  ? 295  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 295 ? 33.907  15.866  4.720   1.00 86.06  ? 295  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 295 ? 32.476  16.198  4.879   1.00 86.31  ? 295  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 295 ? 31.948  17.309  4.243   1.00 86.09  ? 295  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 295 ? 31.653  15.432  5.677   1.00 88.05  ? 295  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 295 ? 30.627  17.653  4.389   1.00 87.49  ? 295  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 295 ? 30.306  15.765  5.828   1.00 88.61  ? 295  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 295 ? 29.795  16.879  5.183   1.00 87.78  ? 295  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 296 ? 37.021  17.876  4.677   1.00 83.53  ? 296  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 296 ? 38.465  17.856  4.605   1.00 82.05  ? 296  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 296 ? 39.101  17.713  5.999   1.00 80.40  ? 296  ARG A C   1 
ATOM   2231 O O   . ARG A 1 296 ? 40.253  18.167  6.207   1.00 80.73  ? 296  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 296 ? 38.989  19.118  3.892   1.00 82.41  ? 296  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 296 ? 38.615  20.445  4.541   1.00 83.10  ? 296  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 296 ? 39.603  21.500  4.098   1.00 85.47  ? 296  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 296 ? 39.093  22.853  4.294   1.00 87.50  ? 296  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 296 ? 38.857  23.720  3.310   1.00 89.06  ? 296  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 296 ? 39.091  23.389  2.037   1.00 89.68  ? 296  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 296 ? 38.396  24.931  3.601   1.00 89.22  ? 296  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 297 ? 38.371  17.099  6.947   1.00 77.43  ? 297  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 297 ? 38.956  16.832  8.270   1.00 74.24  ? 297  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 297 ? 39.876  15.633  8.193   1.00 71.38  ? 297  PHE A C   1 
ATOM   2242 O O   . PHE A 1 297 ? 39.500  14.558  7.728   1.00 70.69  ? 297  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 297 ? 37.929  16.709  9.391   1.00 74.69  ? 297  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 297 ? 36.627  16.124  8.959   1.00 75.65  ? 297  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 297 ? 35.518  16.947  8.760   1.00 76.53  ? 297  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 297 ? 36.497  14.753  8.761   1.00 76.54  ? 297  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 297 ? 34.305  16.420  8.375   1.00 76.24  ? 297  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 297 ? 35.292  14.209  8.378   1.00 76.79  ? 297  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 297 ? 34.189  15.044  8.183   1.00 76.71  ? 297  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 298 ? 41.091  15.867  8.661   1.00 68.00  ? 298  SER A N   1 
ATOM   2251 C CA  . SER A 1 298 ? 42.240  15.065  8.319   1.00 64.87  ? 298  SER A CA  1 
ATOM   2252 C C   . SER A 1 298 ? 42.477  13.945  9.309   1.00 62.31  ? 298  SER A C   1 
ATOM   2253 O O   . SER A 1 298 ? 43.085  12.935  8.965   1.00 62.17  ? 298  SER A O   1 
ATOM   2254 C CB  . SER A 1 298 ? 43.458  15.973  8.298   1.00 65.15  ? 298  SER A CB  1 
ATOM   2255 O OG  . SER A 1 298 ? 43.035  17.325  8.246   1.00 65.75  ? 298  SER A OG  1 
ATOM   2256 N N   . PHE A 1 299 ? 42.009  14.127  10.539  1.00 58.98  ? 299  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 299 ? 42.264  13.158  11.579  1.00 55.64  ? 299  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 299 ? 40.988  12.554  12.096  1.00 53.90  ? 299  PHE A C   1 
ATOM   2259 O O   . PHE A 1 299 ? 40.317  13.112  12.945  1.00 54.01  ? 299  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 299 ? 43.139  13.778  12.652  1.00 55.18  ? 299  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 299 ? 44.403  14.330  12.093  1.00 54.82  ? 299  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 299 ? 45.430  13.479  11.705  1.00 54.62  ? 299  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 299 ? 44.541  15.683  11.857  1.00 54.44  ? 299  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 299 ? 46.592  13.974  11.137  1.00 53.81  ? 299  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 299 ? 45.705  16.183  11.290  1.00 54.34  ? 299  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 299 ? 46.730  15.325  10.931  1.00 53.74  ? 299  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 300 ? 40.661  11.407  11.525  1.00 51.68  ? 300  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 300 ? 39.493  10.633  11.883  1.00 49.99  ? 300  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 300 ? 39.945  9.198   12.212  1.00 49.02  ? 300  VAL A C   1 
ATOM   2270 O O   . VAL A 1 300 ? 41.129  8.898   12.080  1.00 49.14  ? 300  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 300 ? 38.450  10.667  10.744  1.00 50.01  ? 300  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 300 ? 37.977  12.084  10.518  1.00 49.22  ? 300  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 300 ? 39.004  10.063  9.450   1.00 48.96  ? 300  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 301 ? 39.030  8.324   12.688  1.00 47.89  ? 301  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 301 ? 39.406  6.920   12.921  1.00 46.88  ? 301  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 301 ? 40.137  6.252   11.762  1.00 45.98  ? 301  PRO A C   1 
ATOM   2277 O O   . PRO A 1 301 ? 39.721  6.350   10.613  1.00 45.51  ? 301  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 301 ? 38.061  6.236   13.182  1.00 46.89  ? 301  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 301 ? 37.231  7.295   13.796  1.00 47.31  ? 301  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 301 ? 37.641  8.587   13.115  1.00 47.74  ? 301  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 302 ? 41.242  5.586   12.076  1.00 45.63  ? 302  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 302 ? 42.049  4.881   11.067  1.00 45.07  ? 302  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 302 ? 41.743  3.384   11.097  1.00 45.21  ? 302  VAL A C   1 
ATOM   2284 O O   . VAL A 1 302 ? 41.624  2.796   12.182  1.00 45.31  ? 302  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 302 ? 43.578  5.137   11.247  1.00 44.33  ? 302  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 302 ? 44.014  4.839   12.648  1.00 44.56  ? 302  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 302 ? 44.375  4.301   10.301  1.00 43.74  ? 302  VAL A CG2 1 
ATOM   2288 N N   . VAL A 1 303 ? 41.588  2.787   9.911   1.00 45.04  ? 303  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 303 ? 41.450  1.337   9.778   1.00 45.30  ? 303  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 303 ? 42.812  0.700   9.989   1.00 45.99  ? 303  VAL A C   1 
ATOM   2291 O O   . VAL A 1 303 ? 43.575  0.500   9.035   1.00 46.00  ? 303  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 303 ? 40.930  0.936   8.403   1.00 44.91  ? 303  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 303 ? 40.523  -0.524  8.397   1.00 44.27  ? 303  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 303 ? 39.766  1.802   8.019   1.00 45.41  ? 303  VAL A CG2 1 
ATOM   2295 N N   . ASP A 1 304 ? 43.107  0.378   11.243  1.00 46.79  ? 304  ASP A N   1 
ATOM   2296 C CA  . ASP A 1 304 ? 44.465  0.036   11.646  1.00 47.90  ? 304  ASP A CA  1 
ATOM   2297 C C   . ASP A 1 304 ? 44.711  -1.456  11.757  1.00 48.47  ? 304  ASP A C   1 
ATOM   2298 O O   . ASP A 1 304 ? 45.806  -1.865  12.141  1.00 48.55  ? 304  ASP A O   1 
ATOM   2299 C CB  . ASP A 1 304 ? 44.807  0.713   12.980  1.00 47.97  ? 304  ASP A CB  1 
ATOM   2300 C CG  . ASP A 1 304 ? 43.782  0.418   14.080  1.00 48.92  ? 304  ASP A CG  1 
ATOM   2301 O OD1 . ASP A 1 304 ? 42.689  -0.136  13.763  1.00 49.10  ? 304  ASP A OD1 1 
ATOM   2302 O OD2 . ASP A 1 304 ? 44.080  0.747   15.263  1.00 48.71  ? 304  ASP A OD2 1 
ATOM   2303 N N   . GLY A 1 305 ? 43.693  -2.256  11.433  1.00 49.05  ? 305  GLY A N   1 
ATOM   2304 C CA  . GLY A 1 305 ? 43.731  -3.705  11.634  1.00 49.68  ? 305  GLY A CA  1 
ATOM   2305 C C   . GLY A 1 305 ? 43.728  -4.109  13.110  1.00 50.40  ? 305  GLY A C   1 
ATOM   2306 O O   . GLY A 1 305 ? 44.017  -5.263  13.448  1.00 50.93  ? 305  GLY A O   1 
ATOM   2307 N N   . ASP A 1 306 ? 43.413  -3.163  13.993  1.00 50.48  ? 306  ASP A N   1 
ATOM   2308 C CA  . ASP A 1 306 ? 43.391  -3.419  15.434  1.00 50.37  ? 306  ASP A CA  1 
ATOM   2309 C C   . ASP A 1 306 ? 42.008  -3.104  16.007  1.00 50.20  ? 306  ASP A C   1 
ATOM   2310 O O   . ASP A 1 306 ? 41.210  -4.024  16.211  1.00 50.19  ? 306  ASP A O   1 
ATOM   2311 C CB  . ASP A 1 306 ? 44.494  -2.618  16.144  1.00 50.39  ? 306  ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 306 ? 44.573  -2.907  17.641  1.00 50.74  ? 306  ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 306 ? 43.931  -3.857  18.133  1.00 49.96  ? 306  ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 306 ? 45.297  -2.172  18.336  1.00 51.98  ? 306  ASP A OD2 1 
ATOM   2315 N N   . PHE A 1 307 ? 41.739  -1.816  16.260  1.00 49.84  ? 307  PHE A N   1 
ATOM   2316 C CA  . PHE A 1 307 ? 40.411  -1.354  16.679  1.00 49.42  ? 307  PHE A CA  1 
ATOM   2317 C C   . PHE A 1 307 ? 39.390  -1.640  15.593  1.00 49.70  ? 307  PHE A C   1 
ATOM   2318 O O   . PHE A 1 307 ? 38.304  -2.151  15.857  1.00 49.60  ? 307  PHE A O   1 
ATOM   2319 C CB  . PHE A 1 307 ? 40.419  0.138   16.974  1.00 48.72  ? 307  PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 307 ? 39.216  0.608   17.730  1.00 47.20  ? 307  PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 307 ? 37.976  0.672   17.122  1.00 46.36  ? 307  PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 307 ? 39.327  0.994   19.056  1.00 46.56  ? 307  PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 307 ? 36.861  1.110   17.824  1.00 46.39  ? 307  PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 307 ? 38.218  1.431   19.770  1.00 46.21  ? 307  PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 307 ? 36.985  1.487   19.155  1.00 46.49  ? 307  PHE A CZ  1 
ATOM   2326 N N   . LEU A 1 308 ? 39.749  -1.284  14.371  1.00 50.12  ? 308  LEU A N   1 
ATOM   2327 C CA  . LEU A 1 308 ? 38.976  -1.662  13.216  1.00 50.87  ? 308  LEU A CA  1 
ATOM   2328 C C   . LEU A 1 308 ? 39.782  -2.708  12.475  1.00 51.85  ? 308  LEU A C   1 
ATOM   2329 O O   . LEU A 1 308 ? 40.771  -2.379  11.815  1.00 52.49  ? 308  LEU A O   1 
ATOM   2330 C CB  . LEU A 1 308 ? 38.723  -0.447  12.326  1.00 50.44  ? 308  LEU A CB  1 
ATOM   2331 C CG  . LEU A 1 308 ? 37.801  0.630   12.894  1.00 49.46  ? 308  LEU A CG  1 
ATOM   2332 C CD1 . LEU A 1 308 ? 37.859  1.871   12.017  1.00 47.21  ? 308  LEU A CD1 1 
ATOM   2333 C CD2 . LEU A 1 308 ? 36.363  0.105   13.049  1.00 47.82  ? 308  LEU A CD2 1 
ATOM   2334 N N   . SER A 1 309 ? 39.380  -3.971  12.602  1.00 52.65  ? 309  SER A N   1 
ATOM   2335 C CA  . SER A 1 309 ? 40.117  -5.076  11.988  1.00 53.04  ? 309  SER A CA  1 
ATOM   2336 C C   . SER A 1 309 ? 40.121  -4.941  10.462  1.00 53.42  ? 309  SER A C   1 
ATOM   2337 O O   . SER A 1 309 ? 41.001  -5.460  9.782   1.00 53.89  ? 309  SER A O   1 
ATOM   2338 C CB  . SER A 1 309 ? 39.532  -6.429  12.425  1.00 53.02  ? 309  SER A CB  1 
ATOM   2339 O OG  . SER A 1 309 ? 38.298  -6.720  11.782  1.00 53.19  ? 309  SER A OG  1 
ATOM   2340 N N   . ASP A 1 310 ? 39.143  -4.216  9.935   1.00 53.62  ? 310  ASP A N   1 
ATOM   2341 C CA  . ASP A 1 310 ? 38.998  -4.024  8.500   1.00 53.83  ? 310  ASP A CA  1 
ATOM   2342 C C   . ASP A 1 310 ? 38.082  -2.803  8.265   1.00 53.78  ? 310  ASP A C   1 
ATOM   2343 O O   . ASP A 1 310 ? 37.533  -2.256  9.222   1.00 53.86  ? 310  ASP A O   1 
ATOM   2344 C CB  . ASP A 1 310 ? 38.429  -5.307  7.891   1.00 53.79  ? 310  ASP A CB  1 
ATOM   2345 C CG  . ASP A 1 310 ? 38.647  -5.398  6.399   1.00 54.87  ? 310  ASP A CG  1 
ATOM   2346 O OD1 . ASP A 1 310 ? 39.383  -4.553  5.835   1.00 56.38  ? 310  ASP A OD1 1 
ATOM   2347 O OD2 . ASP A 1 310 ? 38.067  -6.322  5.785   1.00 55.23  ? 310  ASP A OD2 1 
ATOM   2348 N N   . THR A 1 311 ? 37.928  -2.357  7.020   1.00 53.63  ? 311  THR A N   1 
ATOM   2349 C CA  . THR A 1 311 ? 37.079  -1.200  6.731   1.00 53.63  ? 311  THR A CA  1 
ATOM   2350 C C   . THR A 1 311 ? 35.683  -1.481  7.256   1.00 53.91  ? 311  THR A C   1 
ATOM   2351 O O   . THR A 1 311 ? 35.263  -2.627  7.229   1.00 53.87  ? 311  THR A O   1 
ATOM   2352 C CB  . THR A 1 311 ? 36.960  -0.909  5.210   1.00 53.66  ? 311  THR A CB  1 
ATOM   2353 O OG1 . THR A 1 311 ? 35.890  -1.680  4.641   1.00 53.16  ? 311  THR A OG1 1 
ATOM   2354 C CG2 . THR A 1 311 ? 38.267  -1.205  4.479   1.00 53.64  ? 311  THR A CG2 1 
ATOM   2355 N N   . PRO A 1 312 ? 34.956  -0.444  7.731   1.00 54.36  ? 312  PRO A N   1 
ATOM   2356 C CA  . PRO A 1 312 ? 33.587  -0.672  8.184   1.00 54.60  ? 312  PRO A CA  1 
ATOM   2357 C C   . PRO A 1 312 ? 32.719  -1.310  7.110   1.00 55.19  ? 312  PRO A C   1 
ATOM   2358 O O   . PRO A 1 312 ? 31.998  -2.252  7.405   1.00 55.05  ? 312  PRO A O   1 
ATOM   2359 C CB  . PRO A 1 312 ? 33.095  0.738   8.524   1.00 54.50  ? 312  PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 312 ? 34.309  1.472   8.884   1.00 53.98  ? 312  PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 312 ? 35.337  0.971   7.909   1.00 54.42  ? 312  PRO A CD  1 
ATOM   2362 N N   . GLU A 1 313 ? 32.810  -0.820  5.875   1.00 56.46  ? 313  GLU A N   1 
ATOM   2363 C CA  . GLU A 1 313 ? 32.066  -1.407  4.742   1.00 57.81  ? 313  GLU A CA  1 
ATOM   2364 C C   . GLU A 1 313 ? 32.208  -2.936  4.702   1.00 58.08  ? 313  GLU A C   1 
ATOM   2365 O O   . GLU A 1 313 ? 31.208  -3.657  4.624   1.00 57.83  ? 313  GLU A O   1 
ATOM   2366 C CB  . GLU A 1 313 ? 32.465  -0.769  3.391   1.00 57.96  ? 313  GLU A CB  1 
ATOM   2367 C CG  . GLU A 1 313 ? 31.815  0.616   3.107   1.00 60.39  ? 313  GLU A CG  1 
ATOM   2368 C CD  . GLU A 1 313 ? 32.727  1.854   3.395   1.00 63.08  ? 313  GLU A CD  1 
ATOM   2369 O OE1 . GLU A 1 313 ? 33.635  1.802   4.280   1.00 63.01  ? 313  GLU A OE1 1 
ATOM   2370 O OE2 . GLU A 1 313 ? 32.511  2.894   2.715   1.00 63.43  ? 313  GLU A OE2 1 
ATOM   2371 N N   . ALA A 1 314 ? 33.451  -3.415  4.782   1.00 58.65  ? 314  ALA A N   1 
ATOM   2372 C CA  . ALA A 1 314 ? 33.726  -4.841  4.812   1.00 59.36  ? 314  ALA A CA  1 
ATOM   2373 C C   . ALA A 1 314 ? 33.008  -5.515  5.981   1.00 60.07  ? 314  ALA A C   1 
ATOM   2374 O O   . ALA A 1 314 ? 32.309  -6.514  5.792   1.00 60.22  ? 314  ALA A O   1 
ATOM   2375 C CB  . ALA A 1 314 ? 35.211  -5.085  4.885   1.00 59.12  ? 314  ALA A CB  1 
ATOM   2376 N N   . LEU A 1 315 ? 33.162  -4.935  7.172   1.00 60.99  ? 315  LEU A N   1 
ATOM   2377 C CA  . LEU A 1 315 ? 32.662  -5.511  8.425   1.00 61.59  ? 315  LEU A CA  1 
ATOM   2378 C C   . LEU A 1 315 ? 31.138  -5.482  8.556   1.00 62.68  ? 315  LEU A C   1 
ATOM   2379 O O   . LEU A 1 315 ? 30.572  -6.300  9.283   1.00 63.51  ? 315  LEU A O   1 
ATOM   2380 C CB  . LEU A 1 315 ? 33.323  -4.857  9.655   1.00 60.98  ? 315  LEU A CB  1 
ATOM   2381 C CG  . LEU A 1 315 ? 34.854  -4.818  9.787   1.00 59.55  ? 315  LEU A CG  1 
ATOM   2382 C CD1 . LEU A 1 315 ? 35.251  -3.968  10.975  1.00 58.04  ? 315  LEU A CD1 1 
ATOM   2383 C CD2 . LEU A 1 315 ? 35.485  -6.197  9.900   1.00 58.01  ? 315  LEU A CD2 1 
ATOM   2384 N N   . ILE A 1 316 ? 30.464  -4.568  7.864   1.00 63.57  ? 316  ILE A N   1 
ATOM   2385 C CA  . ILE A 1 316 ? 29.003  -4.568  7.912   1.00 64.61  ? 316  ILE A CA  1 
ATOM   2386 C C   . ILE A 1 316 ? 28.400  -5.567  6.905   1.00 65.67  ? 316  ILE A C   1 
ATOM   2387 O O   . ILE A 1 316 ? 27.239  -5.967  7.042   1.00 66.12  ? 316  ILE A O   1 
ATOM   2388 C CB  . ILE A 1 316 ? 28.381  -3.138  7.804   1.00 64.50  ? 316  ILE A CB  1 
ATOM   2389 C CG1 . ILE A 1 316 ? 28.221  -2.686  6.349   1.00 64.91  ? 316  ILE A CG1 1 
ATOM   2390 C CG2 . ILE A 1 316 ? 29.182  -2.120  8.632   1.00 64.07  ? 316  ILE A CG2 1 
ATOM   2391 C CD1 . ILE A 1 316 ? 27.252  -1.502  6.167   1.00 64.83  ? 316  ILE A CD1 1 
ATOM   2392 N N   . ASN A 1 317 ? 29.202  -5.973  5.915   1.00 66.83  ? 317  ASN A N   1 
ATOM   2393 C CA  . ASN A 1 317 ? 28.826  -7.013  4.943   1.00 67.81  ? 317  ASN A CA  1 
ATOM   2394 C C   . ASN A 1 317 ? 29.235  -8.423  5.356   1.00 68.05  ? 317  ASN A C   1 
ATOM   2395 O O   . ASN A 1 317 ? 28.984  -9.360  4.618   1.00 68.30  ? 317  ASN A O   1 
ATOM   2396 C CB  . ASN A 1 317 ? 29.465  -6.764  3.563   1.00 68.20  ? 317  ASN A CB  1 
ATOM   2397 C CG  . ASN A 1 317 ? 29.140  -5.396  2.977   1.00 69.91  ? 317  ASN A CG  1 
ATOM   2398 O OD1 . ASN A 1 317 ? 28.209  -4.704  3.416   1.00 71.96  ? 317  ASN A OD1 1 
ATOM   2399 N ND2 . ASN A 1 317 ? 29.919  -4.998  1.968   1.00 70.30  ? 317  ASN A ND2 1 
ATOM   2400 N N   . THR A 1 318 ? 29.902  -8.595  6.489   1.00 68.41  ? 318  THR A N   1 
ATOM   2401 C CA  . THR A 1 318 ? 30.317  -9.944  6.876   1.00 69.15  ? 318  THR A CA  1 
ATOM   2402 C C   . THR A 1 318 ? 30.086  -10.251 8.355   1.00 69.52  ? 318  THR A C   1 
ATOM   2403 O O   . THR A 1 318 ? 30.477  -11.314 8.842   1.00 69.46  ? 318  THR A O   1 
ATOM   2404 C CB  . THR A 1 318 ? 31.809  -10.270 6.483   1.00 69.45  ? 318  THR A CB  1 
ATOM   2405 O OG1 . THR A 1 318 ? 32.723  -9.672  7.419   1.00 69.64  ? 318  THR A OG1 1 
ATOM   2406 C CG2 . THR A 1 318 ? 32.142  -9.821  5.041   1.00 69.43  ? 318  THR A CG2 1 
ATOM   2407 N N   . GLY A 1 319 ? 29.448  -9.325  9.064   1.00 69.97  ? 319  GLY A N   1 
ATOM   2408 C CA  . GLY A 1 319 ? 29.196  -9.493  10.495  1.00 70.50  ? 319  GLY A CA  1 
ATOM   2409 C C   . GLY A 1 319 ? 27.891  -10.201 10.842  1.00 70.92  ? 319  GLY A C   1 
ATOM   2410 O O   . GLY A 1 319 ? 26.931  -10.218 10.049  1.00 70.75  ? 319  GLY A O   1 
ATOM   2411 N N   . ASP A 1 320 ? 27.867  -10.776 12.045  1.00 71.23  ? 320  ASP A N   1 
ATOM   2412 C CA  . ASP A 1 320 ? 26.684  -11.421 12.602  1.00 71.57  ? 320  ASP A CA  1 
ATOM   2413 C C   . ASP A 1 320 ? 26.029  -10.507 13.652  1.00 71.56  ? 320  ASP A C   1 
ATOM   2414 O O   . ASP A 1 320 ? 26.489  -10.415 14.800  1.00 71.57  ? 320  ASP A O   1 
ATOM   2415 C CB  . ASP A 1 320 ? 27.079  -12.769 13.220  1.00 71.94  ? 320  ASP A CB  1 
ATOM   2416 C CG  . ASP A 1 320 ? 25.880  -13.571 13.720  1.00 72.74  ? 320  ASP A CG  1 
ATOM   2417 O OD1 . ASP A 1 320 ? 24.950  -13.829 12.921  1.00 73.32  ? 320  ASP A OD1 1 
ATOM   2418 O OD2 . ASP A 1 320 ? 25.882  -13.953 14.915  1.00 73.38  ? 320  ASP A OD2 1 
ATOM   2419 N N   . PHE A 1 321 ? 24.953  -9.830  13.253  1.00 71.48  ? 321  PHE A N   1 
ATOM   2420 C CA  . PHE A 1 321 ? 24.271  -8.878  14.142  1.00 71.09  ? 321  PHE A CA  1 
ATOM   2421 C C   . PHE A 1 321 ? 22.932  -9.415  14.636  1.00 71.11  ? 321  PHE A C   1 
ATOM   2422 O O   . PHE A 1 321 ? 21.979  -8.654  14.820  1.00 71.17  ? 321  PHE A O   1 
ATOM   2423 C CB  . PHE A 1 321 ? 24.134  -7.500  13.469  1.00 70.74  ? 321  PHE A CB  1 
ATOM   2424 C CG  . PHE A 1 321 ? 25.431  -6.979  12.909  1.00 70.24  ? 321  PHE A CG  1 
ATOM   2425 C CD1 . PHE A 1 321 ? 26.478  -6.618  13.757  1.00 69.60  ? 321  PHE A CD1 1 
ATOM   2426 C CD2 . PHE A 1 321 ? 25.624  -6.889  11.536  1.00 69.94  ? 321  PHE A CD2 1 
ATOM   2427 C CE1 . PHE A 1 321 ? 27.691  -6.156  13.245  1.00 69.13  ? 321  PHE A CE1 1 
ATOM   2428 C CE2 . PHE A 1 321 ? 26.837  -6.425  11.014  1.00 69.85  ? 321  PHE A CE2 1 
ATOM   2429 C CZ  . PHE A 1 321 ? 27.869  -6.058  11.873  1.00 69.45  ? 321  PHE A CZ  1 
ATOM   2430 N N   . GLN A 1 322 ? 22.902  -10.733 14.859  1.00 70.92  ? 322  GLN A N   1 
ATOM   2431 C CA  . GLN A 1 322 ? 21.755  -11.482 15.388  1.00 70.80  ? 322  GLN A CA  1 
ATOM   2432 C C   . GLN A 1 322 ? 21.172  -10.836 16.651  1.00 70.09  ? 322  GLN A C   1 
ATOM   2433 O O   . GLN A 1 322 ? 19.957  -10.701 16.817  1.00 69.69  ? 322  GLN A O   1 
ATOM   2434 C CB  . GLN A 1 322 ? 22.231  -12.903 15.736  1.00 71.42  ? 322  GLN A CB  1 
ATOM   2435 C CG  . GLN A 1 322 ? 21.278  -14.043 15.354  1.00 73.65  ? 322  GLN A CG  1 
ATOM   2436 C CD  . GLN A 1 322 ? 21.238  -14.285 13.838  1.00 76.77  ? 322  GLN A CD  1 
ATOM   2437 O OE1 . GLN A 1 322 ? 20.189  -14.113 13.192  1.00 77.67  ? 322  GLN A OE1 1 
ATOM   2438 N NE2 . GLN A 1 322 ? 22.387  -14.660 13.262  1.00 76.47  ? 322  GLN A NE2 1 
ATOM   2439 N N   . ASP A 1 323 ? 22.091  -10.415 17.511  1.00 69.43  ? 323  ASP A N   1 
ATOM   2440 C CA  . ASP A 1 323 ? 21.852  -10.048 18.899  1.00 68.73  ? 323  ASP A CA  1 
ATOM   2441 C C   . ASP A 1 323 ? 21.853  -8.532  19.113  1.00 67.54  ? 323  ASP A C   1 
ATOM   2442 O O   . ASP A 1 323 ? 22.199  -8.067  20.206  1.00 67.68  ? 323  ASP A O   1 
ATOM   2443 C CB  . ASP A 1 323 ? 23.009  -10.619 19.718  1.00 69.23  ? 323  ASP A CB  1 
ATOM   2444 C CG  . ASP A 1 323 ? 24.388  -10.203 19.151  1.00 70.76  ? 323  ASP A CG  1 
ATOM   2445 O OD1 . ASP A 1 323 ? 24.560  -10.180 17.900  1.00 71.76  ? 323  ASP A OD1 1 
ATOM   2446 O OD2 . ASP A 1 323 ? 25.299  -9.890  19.954  1.00 72.58  ? 323  ASP A OD2 1 
ATOM   2447 N N   . LEU A 1 324 ? 21.482  -7.769  18.085  1.00 65.78  ? 324  LEU A N   1 
ATOM   2448 C CA  . LEU A 1 324 ? 21.660  -6.315  18.112  1.00 63.68  ? 324  LEU A CA  1 
ATOM   2449 C C   . LEU A 1 324 ? 20.381  -5.565  17.779  1.00 62.18  ? 324  LEU A C   1 
ATOM   2450 O O   . LEU A 1 324 ? 19.768  -5.799  16.735  1.00 62.11  ? 324  LEU A O   1 
ATOM   2451 C CB  . LEU A 1 324 ? 22.775  -5.912  17.134  1.00 63.77  ? 324  LEU A CB  1 
ATOM   2452 C CG  . LEU A 1 324 ? 23.191  -4.441  17.032  1.00 63.72  ? 324  LEU A CG  1 
ATOM   2453 C CD1 . LEU A 1 324 ? 23.995  -4.018  18.249  1.00 63.97  ? 324  LEU A CD1 1 
ATOM   2454 C CD2 . LEU A 1 324 ? 23.986  -4.188  15.766  1.00 63.38  ? 324  LEU A CD2 1 
ATOM   2455 N N   . GLN A 1 325 ? 19.982  -4.663  18.665  1.00 60.28  ? 325  GLN A N   1 
ATOM   2456 C CA  . GLN A 1 325 ? 18.899  -3.734  18.344  1.00 58.62  ? 325  GLN A CA  1 
ATOM   2457 C C   . GLN A 1 325 ? 19.446  -2.328  18.117  1.00 57.17  ? 325  GLN A C   1 
ATOM   2458 O O   . GLN A 1 325 ? 20.142  -1.771  18.960  1.00 56.95  ? 325  GLN A O   1 
ATOM   2459 C CB  . GLN A 1 325 ? 17.811  -3.703  19.422  1.00 58.84  ? 325  GLN A CB  1 
ATOM   2460 C CG  . GLN A 1 325 ? 17.161  -5.032  19.751  1.00 58.75  ? 325  GLN A CG  1 
ATOM   2461 C CD  . GLN A 1 325 ? 17.698  -5.612  21.034  1.00 60.33  ? 325  GLN A CD  1 
ATOM   2462 O OE1 . GLN A 1 325 ? 17.746  -4.938  22.070  1.00 60.26  ? 325  GLN A OE1 1 
ATOM   2463 N NE2 . GLN A 1 325 ? 18.121  -6.871  20.976  1.00 62.19  ? 325  GLN A NE2 1 
ATOM   2464 N N   . VAL A 1 326 ? 19.111  -1.761  16.967  1.00 55.55  ? 326  VAL A N   1 
ATOM   2465 C CA  . VAL A 1 326 ? 19.668  -0.493  16.539  1.00 53.89  ? 326  VAL A CA  1 
ATOM   2466 C C   . VAL A 1 326 ? 18.555  0.451   16.154  1.00 52.90  ? 326  VAL A C   1 
ATOM   2467 O O   . VAL A 1 326 ? 17.603  0.059   15.482  1.00 52.75  ? 326  VAL A O   1 
ATOM   2468 C CB  . VAL A 1 326 ? 20.557  -0.653  15.295  1.00 53.75  ? 326  VAL A CB  1 
ATOM   2469 C CG1 . VAL A 1 326 ? 21.662  0.345   15.336  1.00 53.67  ? 326  VAL A CG1 1 
ATOM   2470 C CG2 . VAL A 1 326 ? 21.141  -2.026  15.223  1.00 53.56  ? 326  VAL A CG2 1 
ATOM   2471 N N   . LEU A 1 327 ? 18.690  1.700   16.576  1.00 51.72  ? 327  LEU A N   1 
ATOM   2472 C CA  . LEU A 1 327 ? 17.820  2.773   16.117  1.00 50.69  ? 327  LEU A CA  1 
ATOM   2473 C C   . LEU A 1 327 ? 18.646  3.707   15.248  1.00 50.02  ? 327  LEU A C   1 
ATOM   2474 O O   . LEU A 1 327 ? 19.708  4.160   15.666  1.00 50.51  ? 327  LEU A O   1 
ATOM   2475 C CB  . LEU A 1 327 ? 17.233  3.529   17.312  1.00 50.56  ? 327  LEU A CB  1 
ATOM   2476 C CG  . LEU A 1 327 ? 16.256  4.657   16.997  1.00 49.94  ? 327  LEU A CG  1 
ATOM   2477 C CD1 . LEU A 1 327 ? 15.028  4.090   16.405  1.00 50.28  ? 327  LEU A CD1 1 
ATOM   2478 C CD2 . LEU A 1 327 ? 15.897  5.369   18.249  1.00 50.17  ? 327  LEU A CD2 1 
ATOM   2479 N N   . VAL A 1 328 ? 18.186  3.991   14.039  1.00 48.94  ? 328  VAL A N   1 
ATOM   2480 C CA  . VAL A 1 328 ? 18.964  4.844   13.137  1.00 48.39  ? 328  VAL A CA  1 
ATOM   2481 C C   . VAL A 1 328 ? 18.079  5.843   12.425  1.00 47.95  ? 328  VAL A C   1 
ATOM   2482 O O   . VAL A 1 328 ? 16.918  5.561   12.150  1.00 48.12  ? 328  VAL A O   1 
ATOM   2483 C CB  . VAL A 1 328 ? 19.737  4.030   12.064  1.00 48.35  ? 328  VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 328 ? 20.862  3.232   12.687  1.00 48.40  ? 328  VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 328 ? 18.796  3.126   11.289  1.00 48.08  ? 328  VAL A CG2 1 
ATOM   2486 N N   . GLY A 1 329 ? 18.617  7.007   12.104  1.00 47.20  ? 329  GLY A N   1 
ATOM   2487 C CA  . GLY A 1 329 ? 17.817  7.954   11.364  1.00 46.64  ? 329  GLY A CA  1 
ATOM   2488 C C   . GLY A 1 329 ? 18.566  9.150   10.863  1.00 46.25  ? 329  GLY A C   1 
ATOM   2489 O O   . GLY A 1 329 ? 19.756  9.308   11.134  1.00 46.67  ? 329  GLY A O   1 
ATOM   2490 N N   . VAL A 1 330 ? 17.860  9.989   10.114  1.00 45.52  ? 330  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 330 ? 18.440  11.181  9.539   1.00 44.94  ? 330  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 330 ? 17.466  12.332  9.675   1.00 45.35  ? 330  VAL A C   1 
ATOM   2493 O O   . VAL A 1 330 ? 16.285  12.134  10.006  1.00 45.47  ? 330  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 330 ? 18.794  10.983  8.062   1.00 44.57  ? 330  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 330 ? 19.787  9.836   7.891   1.00 44.78  ? 330  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 330 ? 17.566  10.746  7.247   1.00 43.94  ? 330  VAL A CG2 1 
ATOM   2497 N N   . VAL A 1 331 ? 17.958  13.542  9.432   1.00 45.62  ? 331  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 331 ? 17.075  14.703  9.371   1.00 45.80  ? 331  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 331 ? 16.771  15.071  7.937   1.00 46.19  ? 331  VAL A C   1 
ATOM   2500 O O   . VAL A 1 331 ? 17.494  14.690  7.020   1.00 46.37  ? 331  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 331 ? 17.632  15.927  10.116  1.00 45.57  ? 331  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 331 ? 17.699  15.636  11.602  1.00 45.16  ? 331  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 331 ? 18.985  16.348  9.553   1.00 45.30  ? 331  VAL A CG2 1 
ATOM   2504 N N   . LYS A 1 332 ? 15.686  15.813  7.764   1.00 46.93  ? 332  LYS A N   1 
ATOM   2505 C CA  . LYS A 1 332 ? 15.234  16.278  6.455   1.00 47.82  ? 332  LYS A CA  1 
ATOM   2506 C C   . LYS A 1 332 ? 16.356  16.873  5.590   1.00 47.59  ? 332  LYS A C   1 
ATOM   2507 O O   . LYS A 1 332 ? 16.482  16.531  4.419   1.00 47.65  ? 332  LYS A O   1 
ATOM   2508 C CB  . LYS A 1 332 ? 14.113  17.301  6.638   1.00 48.23  ? 332  LYS A CB  1 
ATOM   2509 C CG  . LYS A 1 332 ? 13.339  17.591  5.393   1.00 50.43  ? 332  LYS A CG  1 
ATOM   2510 C CD  . LYS A 1 332 ? 12.388  16.452  5.041   1.00 55.97  ? 332  LYS A CD  1 
ATOM   2511 C CE  . LYS A 1 332 ? 11.400  16.906  3.962   1.00 59.36  ? 332  LYS A CE  1 
ATOM   2512 N NZ  . LYS A 1 332 ? 10.867  18.295  4.246   1.00 60.07  ? 332  LYS A NZ  1 
ATOM   2513 N N   . ASP A 1 333 ? 17.187  17.734  6.171   1.00 47.10  ? 333  ASP A N   1 
ATOM   2514 C CA  . ASP A 1 333 ? 18.173  18.449  5.373   1.00 46.69  ? 333  ASP A CA  1 
ATOM   2515 C C   . ASP A 1 333 ? 19.641  18.286  5.831   1.00 46.26  ? 333  ASP A C   1 
ATOM   2516 O O   . ASP A 1 333 ? 20.282  19.235  6.298   1.00 46.35  ? 333  ASP A O   1 
ATOM   2517 C CB  . ASP A 1 333 ? 17.746  19.912  5.290   1.00 46.86  ? 333  ASP A CB  1 
ATOM   2518 C CG  . ASP A 1 333 ? 16.522  20.101  4.419   1.00 47.10  ? 333  ASP A CG  1 
ATOM   2519 O OD1 . ASP A 1 333 ? 15.399  20.118  4.957   1.00 46.57  ? 333  ASP A OD1 1 
ATOM   2520 O OD2 . ASP A 1 333 ? 16.693  20.211  3.185   1.00 47.63  ? 333  ASP A OD2 1 
ATOM   2521 N N   . GLU A 1 334 ? 20.184  17.085  5.688   1.00 45.40  ? 334  GLU A N   1 
ATOM   2522 C CA  . GLU A 1 334 ? 21.524  16.842  6.189   1.00 44.83  ? 334  GLU A CA  1 
ATOM   2523 C C   . GLU A 1 334 ? 22.600  17.782  5.612   1.00 44.91  ? 334  GLU A C   1 
ATOM   2524 O O   . GLU A 1 334 ? 23.515  18.202  6.323   1.00 44.84  ? 334  GLU A O   1 
ATOM   2525 C CB  . GLU A 1 334 ? 21.920  15.382  5.986   1.00 44.62  ? 334  GLU A CB  1 
ATOM   2526 C CG  . GLU A 1 334 ? 21.038  14.383  6.714   1.00 44.17  ? 334  GLU A CG  1 
ATOM   2527 C CD  . GLU A 1 334 ? 21.336  14.267  8.205   1.00 44.32  ? 334  GLU A CD  1 
ATOM   2528 O OE1 . GLU A 1 334 ? 22.318  14.873  8.695   1.00 44.43  ? 334  GLU A OE1 1 
ATOM   2529 O OE2 . GLU A 1 334 ? 20.576  13.554  8.898   1.00 43.70  ? 334  GLU A OE2 1 
ATOM   2530 N N   . GLY A 1 335 ? 22.482  18.135  4.339   1.00 45.04  ? 335  GLY A N   1 
ATOM   2531 C CA  . GLY A 1 335 ? 23.577  18.808  3.648   1.00 45.43  ? 335  GLY A CA  1 
ATOM   2532 C C   . GLY A 1 335 ? 23.625  20.311  3.767   1.00 45.93  ? 335  GLY A C   1 
ATOM   2533 O O   . GLY A 1 335 ? 24.673  20.916  3.586   1.00 45.38  ? 335  GLY A O   1 
ATOM   2534 N N   . SER A 1 336 ? 22.488  20.916  4.077   1.00 46.83  ? 336  SER A N   1 
ATOM   2535 C CA  . SER A 1 336 ? 22.351  22.343  3.931   1.00 48.26  ? 336  SER A CA  1 
ATOM   2536 C C   . SER A 1 336 ? 23.405  23.073  4.753   1.00 49.56  ? 336  SER A C   1 
ATOM   2537 O O   . SER A 1 336 ? 24.148  23.913  4.240   1.00 49.48  ? 336  SER A O   1 
ATOM   2538 C CB  . SER A 1 336 ? 20.933  22.779  4.289   1.00 47.97  ? 336  SER A CB  1 
ATOM   2539 O OG  . SER A 1 336 ? 20.689  22.620  5.664   1.00 48.03  ? 336  SER A OG  1 
ATOM   2540 N N   . TYR A 1 337 ? 23.475  22.714  6.025   1.00 51.38  ? 337  TYR A N   1 
ATOM   2541 C CA  . TYR A 1 337 ? 24.462  23.236  6.968   1.00 53.25  ? 337  TYR A CA  1 
ATOM   2542 C C   . TYR A 1 337 ? 25.887  23.285  6.410   1.00 53.61  ? 337  TYR A C   1 
ATOM   2543 O O   . TYR A 1 337 ? 26.628  24.234  6.656   1.00 53.70  ? 337  TYR A O   1 
ATOM   2544 C CB  . TYR A 1 337 ? 24.430  22.347  8.213   1.00 54.55  ? 337  TYR A CB  1 
ATOM   2545 C CG  . TYR A 1 337 ? 25.226  22.809  9.403   1.00 55.49  ? 337  TYR A CG  1 
ATOM   2546 C CD1 . TYR A 1 337 ? 24.625  23.559  10.407  1.00 56.27  ? 337  TYR A CD1 1 
ATOM   2547 C CD2 . TYR A 1 337 ? 26.560  22.440  9.556   1.00 57.22  ? 337  TYR A CD2 1 
ATOM   2548 C CE1 . TYR A 1 337 ? 25.335  23.964  11.526  1.00 57.53  ? 337  TYR A CE1 1 
ATOM   2549 C CE2 . TYR A 1 337 ? 27.292  22.837  10.673  1.00 58.59  ? 337  TYR A CE2 1 
ATOM   2550 C CZ  . TYR A 1 337 ? 26.669  23.602  11.654  1.00 58.08  ? 337  TYR A CZ  1 
ATOM   2551 O OH  . TYR A 1 337 ? 27.379  24.004  12.764  1.00 58.30  ? 337  TYR A OH  1 
ATOM   2552 N N   . PHE A 1 338 ? 26.261  22.259  5.659   1.00 53.98  ? 338  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 338 ? 27.628  22.127  5.191   1.00 54.67  ? 338  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 338 ? 27.992  23.096  4.068   1.00 54.59  ? 338  PHE A C   1 
ATOM   2555 O O   . PHE A 1 338 ? 29.138  23.532  3.951   1.00 54.73  ? 338  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 338 ? 27.909  20.671  4.811   1.00 55.14  ? 338  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 338 ? 27.692  19.696  5.954   1.00 56.76  ? 338  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 338 ? 26.939  18.536  5.770   1.00 57.74  ? 338  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 338 ? 28.229  19.954  7.228   1.00 58.14  ? 338  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 338 ? 26.738  17.637  6.829   1.00 58.36  ? 338  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 338 ? 28.033  19.069  8.288   1.00 58.04  ? 338  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 338 ? 27.285  17.907  8.089   1.00 57.74  ? 338  PHE A CZ  1 
ATOM   2563 N N   . LEU A 1 339 ? 27.007  23.453  3.263   1.00 54.57  ? 339  LEU A N   1 
ATOM   2564 C CA  . LEU A 1 339 ? 27.222  24.345  2.144   1.00 54.68  ? 339  LEU A CA  1 
ATOM   2565 C C   . LEU A 1 339 ? 27.807  25.691  2.550   1.00 54.83  ? 339  LEU A C   1 
ATOM   2566 O O   . LEU A 1 339 ? 28.620  26.266  1.826   1.00 54.97  ? 339  LEU A O   1 
ATOM   2567 C CB  . LEU A 1 339 ? 25.912  24.569  1.407   1.00 54.78  ? 339  LEU A CB  1 
ATOM   2568 C CG  . LEU A 1 339 ? 25.115  23.305  1.110   1.00 55.10  ? 339  LEU A CG  1 
ATOM   2569 C CD1 . LEU A 1 339 ? 23.796  23.669  0.443   1.00 54.87  ? 339  LEU A CD1 1 
ATOM   2570 C CD2 . LEU A 1 339 ? 25.934  22.316  0.271   1.00 55.64  ? 339  LEU A CD2 1 
ATOM   2571 N N   . VAL A 1 340 ? 27.404  26.206  3.703   1.00 54.91  ? 340  VAL A N   1 
ATOM   2572 C CA  . VAL A 1 340 ? 27.854  27.539  4.085   1.00 54.97  ? 340  VAL A CA  1 
ATOM   2573 C C   . VAL A 1 340 ? 29.327  27.577  4.448   1.00 55.17  ? 340  VAL A C   1 
ATOM   2574 O O   . VAL A 1 340 ? 29.946  28.631  4.426   1.00 54.97  ? 340  VAL A O   1 
ATOM   2575 C CB  . VAL A 1 340 ? 26.987  28.159  5.193   1.00 54.76  ? 340  VAL A CB  1 
ATOM   2576 C CG1 . VAL A 1 340 ? 25.561  28.270  4.709   1.00 54.79  ? 340  VAL A CG1 1 
ATOM   2577 C CG2 . VAL A 1 340 ? 27.065  27.352  6.469   1.00 54.35  ? 340  VAL A CG2 1 
ATOM   2578 N N   . TYR A 1 341 ? 29.875  26.409  4.763   1.00 55.99  ? 341  TYR A N   1 
ATOM   2579 C CA  . TYR A 1 341 ? 31.277  26.269  5.136   1.00 56.99  ? 341  TYR A CA  1 
ATOM   2580 C C   . TYR A 1 341 ? 32.152  25.960  3.920   1.00 58.12  ? 341  TYR A C   1 
ATOM   2581 O O   . TYR A 1 341 ? 32.626  24.834  3.755   1.00 58.38  ? 341  TYR A O   1 
ATOM   2582 C CB  . TYR A 1 341 ? 31.429  25.183  6.199   1.00 56.44  ? 341  TYR A CB  1 
ATOM   2583 C CG  . TYR A 1 341 ? 30.998  25.607  7.583   1.00 56.02  ? 341  TYR A CG  1 
ATOM   2584 C CD1 . TYR A 1 341 ? 29.729  25.300  8.062   1.00 55.44  ? 341  TYR A CD1 1 
ATOM   2585 C CD2 . TYR A 1 341 ? 31.869  26.311  8.420   1.00 55.72  ? 341  TYR A CD2 1 
ATOM   2586 C CE1 . TYR A 1 341 ? 29.334  25.687  9.339   1.00 55.50  ? 341  TYR A CE1 1 
ATOM   2587 C CE2 . TYR A 1 341 ? 31.483  26.707  9.697   1.00 55.10  ? 341  TYR A CE2 1 
ATOM   2588 C CZ  . TYR A 1 341 ? 30.218  26.393  10.150  1.00 55.61  ? 341  TYR A CZ  1 
ATOM   2589 O OH  . TYR A 1 341 ? 29.838  26.771  11.420  1.00 55.81  ? 341  TYR A OH  1 
ATOM   2590 N N   . GLY A 1 342 ? 32.329  26.965  3.059   1.00 59.54  ? 342  GLY A N   1 
ATOM   2591 C CA  . GLY A 1 342 ? 33.183  26.869  1.862   1.00 60.83  ? 342  GLY A CA  1 
ATOM   2592 C C   . GLY A 1 342 ? 32.634  26.275  0.556   1.00 61.60  ? 342  GLY A C   1 
ATOM   2593 O O   . GLY A 1 342 ? 33.416  25.791  -0.280  1.00 62.02  ? 342  GLY A O   1 
ATOM   2594 N N   . VAL A 1 343 ? 31.317  26.283  0.351   1.00 61.88  ? 343  VAL A N   1 
ATOM   2595 C CA  . VAL A 1 343 ? 30.811  26.104  -1.016  1.00 62.11  ? 343  VAL A CA  1 
ATOM   2596 C C   . VAL A 1 343 ? 30.394  27.481  -1.537  1.00 62.59  ? 343  VAL A C   1 
ATOM   2597 O O   . VAL A 1 343 ? 29.447  28.086  -1.016  1.00 62.90  ? 343  VAL A O   1 
ATOM   2598 C CB  . VAL A 1 343 ? 29.677  25.070  -1.156  1.00 61.72  ? 343  VAL A CB  1 
ATOM   2599 C CG1 . VAL A 1 343 ? 29.278  24.944  -2.608  1.00 61.58  ? 343  VAL A CG1 1 
ATOM   2600 C CG2 . VAL A 1 343 ? 30.121  23.719  -0.645  1.00 61.82  ? 343  VAL A CG2 1 
ATOM   2601 N N   . PRO A 1 344 ? 31.137  28.004  -2.532  1.00 62.75  ? 344  PRO A N   1 
ATOM   2602 C CA  . PRO A 1 344 ? 30.868  29.357  -3.026  1.00 62.95  ? 344  PRO A CA  1 
ATOM   2603 C C   . PRO A 1 344 ? 29.432  29.522  -3.529  1.00 62.86  ? 344  PRO A C   1 
ATOM   2604 O O   . PRO A 1 344 ? 28.926  28.665  -4.257  1.00 62.66  ? 344  PRO A O   1 
ATOM   2605 C CB  . PRO A 1 344 ? 31.893  29.536  -4.158  1.00 62.91  ? 344  PRO A CB  1 
ATOM   2606 C CG  . PRO A 1 344 ? 32.990  28.576  -3.808  1.00 62.95  ? 344  PRO A CG  1 
ATOM   2607 C CD  . PRO A 1 344 ? 32.279  27.386  -3.229  1.00 62.60  ? 344  PRO A CD  1 
ATOM   2608 N N   . GLY A 1 345 ? 28.802  30.618  -3.110  1.00 62.86  ? 345  GLY A N   1 
ATOM   2609 C CA  . GLY A 1 345 ? 27.413  30.912  -3.429  1.00 62.93  ? 345  GLY A CA  1 
ATOM   2610 C C   . GLY A 1 345 ? 26.486  30.785  -2.228  1.00 62.99  ? 345  GLY A C   1 
ATOM   2611 O O   . GLY A 1 345 ? 25.395  31.367  -2.219  1.00 63.06  ? 345  GLY A O   1 
ATOM   2612 N N   . PHE A 1 346 ? 26.920  30.029  -1.216  1.00 62.68  ? 346  PHE A N   1 
ATOM   2613 C CA  . PHE A 1 346 ? 26.093  29.757  -0.041  1.00 62.38  ? 346  PHE A CA  1 
ATOM   2614 C C   . PHE A 1 346 ? 26.457  30.611  1.156   1.00 62.63  ? 346  PHE A C   1 
ATOM   2615 O O   . PHE A 1 346 ? 27.632  30.834  1.437   1.00 62.76  ? 346  PHE A O   1 
ATOM   2616 C CB  . PHE A 1 346 ? 26.159  28.276  0.329   1.00 62.11  ? 346  PHE A CB  1 
ATOM   2617 C CG  . PHE A 1 346 ? 25.567  27.374  -0.710  1.00 61.17  ? 346  PHE A CG  1 
ATOM   2618 C CD1 . PHE A 1 346 ? 26.358  26.837  -1.713  1.00 59.60  ? 346  PHE A CD1 1 
ATOM   2619 C CD2 . PHE A 1 346 ? 24.206  27.078  -0.694  1.00 60.43  ? 346  PHE A CD2 1 
ATOM   2620 C CE1 . PHE A 1 346 ? 25.807  26.013  -2.671  1.00 60.07  ? 346  PHE A CE1 1 
ATOM   2621 C CE2 . PHE A 1 346 ? 23.642  26.255  -1.652  1.00 59.60  ? 346  PHE A CE2 1 
ATOM   2622 C CZ  . PHE A 1 346 ? 24.437  25.721  -2.639  1.00 60.61  ? 346  PHE A CZ  1 
ATOM   2623 N N   . SER A 1 347 ? 25.428  31.093  1.852   1.00 62.97  ? 347  SER A N   1 
ATOM   2624 C CA  . SER A 1 347 ? 25.591  31.943  3.038   1.00 63.23  ? 347  SER A CA  1 
ATOM   2625 C C   . SER A 1 347 ? 24.357  31.866  3.933   1.00 63.43  ? 347  SER A C   1 
ATOM   2626 O O   . SER A 1 347 ? 23.256  31.593  3.446   1.00 63.69  ? 347  SER A O   1 
ATOM   2627 C CB  . SER A 1 347 ? 25.828  33.396  2.629   1.00 63.05  ? 347  SER A CB  1 
ATOM   2628 O OG  . SER A 1 347 ? 25.950  34.218  3.769   1.00 63.12  ? 347  SER A OG  1 
ATOM   2629 N N   . LYS A 1 348 ? 24.537  32.114  5.231   1.00 63.36  ? 348  LYS A N   1 
ATOM   2630 C CA  . LYS A 1 348 ? 23.410  32.164  6.155   1.00 63.62  ? 348  LYS A CA  1 
ATOM   2631 C C   . LYS A 1 348 ? 22.574  33.431  5.955   1.00 63.78  ? 348  LYS A C   1 
ATOM   2632 O O   . LYS A 1 348 ? 21.407  33.476  6.359   1.00 63.79  ? 348  LYS A O   1 
ATOM   2633 C CB  . LYS A 1 348 ? 23.888  32.071  7.611   1.00 63.66  ? 348  LYS A CB  1 
ATOM   2634 C CG  . LYS A 1 348 ? 24.380  33.388  8.219   1.00 63.90  ? 348  LYS A CG  1 
ATOM   2635 C CD  . LYS A 1 348 ? 24.633  33.270  9.713   1.00 63.78  ? 348  LYS A CD  1 
ATOM   2636 C CE  . LYS A 1 348 ? 24.894  34.631  10.346  1.00 64.54  ? 348  LYS A CE  1 
ATOM   2637 N NZ  . LYS A 1 348 ? 23.638  35.370  10.652  1.00 64.83  ? 348  LYS A NZ  1 
ATOM   2638 N N   . ASP A 1 349 ? 23.177  34.439  5.319   1.00 63.96  ? 349  ASP A N   1 
ATOM   2639 C CA  . ASP A 1 349 ? 22.634  35.806  5.289   1.00 64.22  ? 349  ASP A CA  1 
ATOM   2640 C C   . ASP A 1 349 ? 21.794  36.160  4.052   1.00 64.57  ? 349  ASP A C   1 
ATOM   2641 O O   . ASP A 1 349 ? 21.209  37.247  3.995   1.00 64.49  ? 349  ASP A O   1 
ATOM   2642 C CB  . ASP A 1 349 ? 23.757  36.835  5.502   1.00 64.04  ? 349  ASP A CB  1 
ATOM   2643 C CG  . ASP A 1 349 ? 24.347  36.780  6.910   1.00 63.54  ? 349  ASP A CG  1 
ATOM   2644 O OD1 . ASP A 1 349 ? 23.562  36.762  7.886   1.00 61.16  ? 349  ASP A OD1 1 
ATOM   2645 O OD2 . ASP A 1 349 ? 25.597  36.764  7.033   1.00 63.33  ? 349  ASP A OD2 1 
ATOM   2646 N N   . ASN A 1 350 ? 21.742  35.253  3.074   1.00 64.91  ? 350  ASN A N   1 
ATOM   2647 C CA  . ASN A 1 350 ? 20.805  35.370  1.949   1.00 65.29  ? 350  ASN A CA  1 
ATOM   2648 C C   . ASN A 1 350 ? 20.191  34.023  1.545   1.00 64.40  ? 350  ASN A C   1 
ATOM   2649 O O   . ASN A 1 350 ? 20.555  32.992  2.102   1.00 64.26  ? 350  ASN A O   1 
ATOM   2650 C CB  . ASN A 1 350 ? 21.437  36.110  0.752   1.00 65.90  ? 350  ASN A CB  1 
ATOM   2651 C CG  . ASN A 1 350 ? 22.642  35.391  0.168   1.00 69.56  ? 350  ASN A CG  1 
ATOM   2652 O OD1 . ASN A 1 350 ? 22.642  34.161  0.030   1.00 70.63  ? 350  ASN A OD1 1 
ATOM   2653 N ND2 . ASN A 1 350 ? 23.676  36.176  -0.211  1.00 75.60  ? 350  ASN A ND2 1 
ATOM   2654 N N   . GLU A 1 351 ? 19.272  34.047  0.576   1.00 63.57  ? 351  GLU A N   1 
ATOM   2655 C CA  . GLU A 1 351 ? 18.543  32.852  0.105   1.00 62.63  ? 351  GLU A CA  1 
ATOM   2656 C C   . GLU A 1 351 ? 19.409  31.759  -0.553  1.00 61.33  ? 351  GLU A C   1 
ATOM   2657 O O   . GLU A 1 351 ? 18.908  30.678  -0.903  1.00 60.80  ? 351  GLU A O   1 
ATOM   2658 C CB  . GLU A 1 351 ? 17.439  33.264  -0.883  1.00 63.37  ? 351  GLU A CB  1 
ATOM   2659 C CG  . GLU A 1 351 ? 16.387  34.232  -0.353  1.00 64.98  ? 351  GLU A CG  1 
ATOM   2660 C CD  . GLU A 1 351 ? 15.714  33.746  0.923   1.00 67.34  ? 351  GLU A CD  1 
ATOM   2661 O OE1 . GLU A 1 351 ? 15.515  32.516  1.091   1.00 68.31  ? 351  GLU A OE1 1 
ATOM   2662 O OE2 . GLU A 1 351 ? 15.377  34.612  1.760   1.00 68.14  ? 351  GLU A OE2 1 
ATOM   2663 N N   . SER A 1 352 ? 20.690  32.071  -0.747  1.00 59.79  ? 352  SER A N   1 
ATOM   2664 C CA  . SER A 1 352 ? 21.665  31.164  -1.339  1.00 58.63  ? 352  SER A CA  1 
ATOM   2665 C C   . SER A 1 352 ? 21.244  30.524  -2.662  1.00 57.96  ? 352  SER A C   1 
ATOM   2666 O O   . SER A 1 352 ? 21.610  29.383  -2.935  1.00 57.98  ? 352  SER A O   1 
ATOM   2667 C CB  . SER A 1 352 ? 22.068  30.077  -0.341  1.00 58.65  ? 352  SER A CB  1 
ATOM   2668 O OG  . SER A 1 352 ? 22.868  30.601  0.701   1.00 58.80  ? 352  SER A OG  1 
ATOM   2669 N N   . LEU A 1 353 ? 20.491  31.249  -3.486  1.00 57.00  ? 353  LEU A N   1 
ATOM   2670 C CA  . LEU A 1 353 ? 20.179  30.784  -4.843  1.00 56.01  ? 353  LEU A CA  1 
ATOM   2671 C C   . LEU A 1 353 ? 21.446  30.765  -5.691  1.00 55.44  ? 353  LEU A C   1 
ATOM   2672 O O   . LEU A 1 353 ? 22.097  31.787  -5.862  1.00 56.02  ? 353  LEU A O   1 
ATOM   2673 C CB  . LEU A 1 353 ? 19.135  31.685  -5.502  1.00 55.77  ? 353  LEU A CB  1 
ATOM   2674 C CG  . LEU A 1 353 ? 17.836  32.013  -4.775  1.00 55.58  ? 353  LEU A CG  1 
ATOM   2675 C CD1 . LEU A 1 353 ? 16.964  32.812  -5.689  1.00 56.22  ? 353  LEU A CD1 1 
ATOM   2676 C CD2 . LEU A 1 353 ? 17.107  30.772  -4.355  1.00 56.07  ? 353  LEU A CD2 1 
ATOM   2677 N N   . ILE A 1 354 ? 21.806  29.607  -6.214  1.00 54.54  ? 354  ILE A N   1 
ATOM   2678 C CA  . ILE A 1 354 ? 23.043  29.485  -6.964  1.00 53.79  ? 354  ILE A CA  1 
ATOM   2679 C C   . ILE A 1 354 ? 22.781  29.291  -8.446  1.00 53.79  ? 354  ILE A C   1 
ATOM   2680 O O   . ILE A 1 354 ? 21.653  28.987  -8.852  1.00 53.93  ? 354  ILE A O   1 
ATOM   2681 C CB  . ILE A 1 354 ? 23.909  28.321  -6.442  1.00 53.91  ? 354  ILE A CB  1 
ATOM   2682 C CG1 . ILE A 1 354 ? 23.106  27.010  -6.383  1.00 53.19  ? 354  ILE A CG1 1 
ATOM   2683 C CG2 . ILE A 1 354 ? 24.499  28.677  -5.083  1.00 53.84  ? 354  ILE A CG2 1 
ATOM   2684 C CD1 . ILE A 1 354 ? 23.940  25.754  -6.568  1.00 52.10  ? 354  ILE A CD1 1 
ATOM   2685 N N   . SER A 1 355 ? 23.828  29.464  -9.250  1.00 53.47  ? 355  SER A N   1 
ATOM   2686 C CA  . SER A 1 355 ? 23.759  29.235  -10.693 1.00 53.37  ? 355  SER A CA  1 
ATOM   2687 C C   . SER A 1 355 ? 24.209  27.824  -11.051 1.00 53.20  ? 355  SER A C   1 
ATOM   2688 O O   . SER A 1 355 ? 24.864  27.157  -10.262 1.00 53.18  ? 355  SER A O   1 
ATOM   2689 C CB  . SER A 1 355 ? 24.658  30.226  -11.415 1.00 53.53  ? 355  SER A CB  1 
ATOM   2690 O OG  . SER A 1 355 ? 26.018  29.956  -11.122 1.00 53.98  ? 355  SER A OG  1 
ATOM   2691 N N   . ARG A 1 356 ? 23.882  27.383  -12.257 1.00 53.10  ? 356  ARG A N   1 
ATOM   2692 C CA  . ARG A 1 356 ? 24.280  26.059  -12.707 1.00 53.17  ? 356  ARG A CA  1 
ATOM   2693 C C   . ARG A 1 356 ? 25.798  25.883  -12.597 1.00 53.28  ? 356  ARG A C   1 
ATOM   2694 O O   . ARG A 1 356 ? 26.298  24.811  -12.213 1.00 53.16  ? 356  ARG A O   1 
ATOM   2695 C CB  . ARG A 1 356 ? 23.792  25.811  -14.137 1.00 53.17  ? 356  ARG A CB  1 
ATOM   2696 C CG  . ARG A 1 356 ? 24.080  24.408  -14.631 1.00 53.64  ? 356  ARG A CG  1 
ATOM   2697 C CD  . ARG A 1 356 ? 22.966  23.826  -15.478 1.00 53.29  ? 356  ARG A CD  1 
ATOM   2698 N NE  . ARG A 1 356 ? 23.246  22.411  -15.736 1.00 54.94  ? 356  ARG A NE  1 
ATOM   2699 C CZ  . ARG A 1 356 ? 22.749  21.388  -15.035 1.00 54.03  ? 356  ARG A CZ  1 
ATOM   2700 N NH1 . ARG A 1 356 ? 21.912  21.615  -14.024 1.00 54.28  ? 356  ARG A NH1 1 
ATOM   2701 N NH2 . ARG A 1 356 ? 23.078  20.138  -15.360 1.00 51.63  ? 356  ARG A NH2 1 
ATOM   2702 N N   . ALA A 1 357 ? 26.515  26.958  -12.922 1.00 53.25  ? 357  ALA A N   1 
ATOM   2703 C CA  . ALA A 1 357 ? 27.965  26.994  -12.826 1.00 52.96  ? 357  ALA A CA  1 
ATOM   2704 C C   . ALA A 1 357 ? 28.404  26.722  -11.389 1.00 52.75  ? 357  ALA A C   1 
ATOM   2705 O O   . ALA A 1 357 ? 29.311  25.903  -11.150 1.00 52.83  ? 357  ALA A O   1 
ATOM   2706 C CB  . ALA A 1 357 ? 28.494  28.340  -13.316 1.00 52.95  ? 357  ALA A CB  1 
ATOM   2707 N N   . GLN A 1 358 ? 27.744  27.394  -10.444 1.00 52.12  ? 358  GLN A N   1 
ATOM   2708 C CA  . GLN A 1 358 ? 28.022  27.208  -9.027  1.00 52.03  ? 358  GLN A CA  1 
ATOM   2709 C C   . GLN A 1 358 ? 27.640  25.808  -8.535  1.00 52.27  ? 358  GLN A C   1 
ATOM   2710 O O   . GLN A 1 358 ? 28.245  25.295  -7.584  1.00 52.39  ? 358  GLN A O   1 
ATOM   2711 C CB  . GLN A 1 358 ? 27.333  28.284  -8.200  1.00 51.74  ? 358  GLN A CB  1 
ATOM   2712 C CG  . GLN A 1 358 ? 27.897  29.670  -8.441  1.00 51.72  ? 358  GLN A CG  1 
ATOM   2713 C CD  . GLN A 1 358 ? 27.191  30.751  -7.644  1.00 52.21  ? 358  GLN A CD  1 
ATOM   2714 O OE1 . GLN A 1 358 ? 25.961  30.834  -7.626  1.00 53.52  ? 358  GLN A OE1 1 
ATOM   2715 N NE2 . GLN A 1 358 ? 27.969  31.598  -6.992  1.00 52.22  ? 358  GLN A NE2 1 
ATOM   2716 N N   . PHE A 1 359 ? 26.662  25.187  -9.201  1.00 52.32  ? 359  PHE A N   1 
ATOM   2717 C CA  . PHE A 1 359 ? 26.264  23.817  -8.899  1.00 52.14  ? 359  PHE A CA  1 
ATOM   2718 C C   . PHE A 1 359 ? 27.338  22.809  -9.300  1.00 52.64  ? 359  PHE A C   1 
ATOM   2719 O O   . PHE A 1 359 ? 27.772  22.030  -8.463  1.00 52.58  ? 359  PHE A O   1 
ATOM   2720 C CB  . PHE A 1 359 ? 24.907  23.482  -9.524  1.00 51.83  ? 359  PHE A CB  1 
ATOM   2721 C CG  . PHE A 1 359 ? 24.428  22.082  -9.242  1.00 50.92  ? 359  PHE A CG  1 
ATOM   2722 C CD1 . PHE A 1 359 ? 24.174  21.204  -10.279 1.00 49.97  ? 359  PHE A CD1 1 
ATOM   2723 C CD2 . PHE A 1 359 ? 24.235  21.642  -7.941  1.00 51.28  ? 359  PHE A CD2 1 
ATOM   2724 C CE1 . PHE A 1 359 ? 23.738  19.915  -10.032 1.00 49.53  ? 359  PHE A CE1 1 
ATOM   2725 C CE2 . PHE A 1 359 ? 23.799  20.344  -7.684  1.00 50.77  ? 359  PHE A CE2 1 
ATOM   2726 C CZ  . PHE A 1 359 ? 23.552  19.486  -8.736  1.00 50.58  ? 359  PHE A CZ  1 
ATOM   2727 N N   . LEU A 1 360 ? 27.792  22.831  -10.552 1.00 53.45  ? 360  LEU A N   1 
ATOM   2728 C CA  . LEU A 1 360 ? 28.854  21.894  -10.977 1.00 54.41  ? 360  LEU A CA  1 
ATOM   2729 C C   . LEU A 1 360 ? 30.117  22.093  -10.140 1.00 54.58  ? 360  LEU A C   1 
ATOM   2730 O O   . LEU A 1 360 ? 30.828  21.144  -9.842  1.00 54.35  ? 360  LEU A O   1 
ATOM   2731 C CB  . LEU A 1 360 ? 29.192  22.006  -12.478 1.00 54.51  ? 360  LEU A CB  1 
ATOM   2732 C CG  . LEU A 1 360 ? 28.177  22.380  -13.592 1.00 56.11  ? 360  LEU A CG  1 
ATOM   2733 C CD1 . LEU A 1 360 ? 28.836  22.328  -14.992 1.00 57.25  ? 360  LEU A CD1 1 
ATOM   2734 C CD2 . LEU A 1 360 ? 26.850  21.586  -13.612 1.00 55.87  ? 360  LEU A CD2 1 
ATOM   2735 N N   . ALA A 1 361 ? 30.372  23.342  -9.760  1.00 55.24  ? 361  ALA A N   1 
ATOM   2736 C CA  . ALA A 1 361 ? 31.527  23.703  -8.949  1.00 55.89  ? 361  ALA A CA  1 
ATOM   2737 C C   . ALA A 1 361 ? 31.410  23.168  -7.520  1.00 56.40  ? 361  ALA A C   1 
ATOM   2738 O O   . ALA A 1 361 ? 32.408  22.723  -6.937  1.00 56.59  ? 361  ALA A O   1 
ATOM   2739 C CB  . ALA A 1 361 ? 31.706  25.212  -8.935  1.00 55.74  ? 361  ALA A CB  1 
ATOM   2740 N N   . GLY A 1 362 ? 30.196  23.219  -6.965  1.00 56.74  ? 362  GLY A N   1 
ATOM   2741 C CA  . GLY A 1 362 ? 29.919  22.703  -5.623  1.00 57.02  ? 362  GLY A CA  1 
ATOM   2742 C C   . GLY A 1 362 ? 29.958  21.185  -5.539  1.00 57.47  ? 362  GLY A C   1 
ATOM   2743 O O   . GLY A 1 362 ? 30.274  20.621  -4.497  1.00 57.23  ? 362  GLY A O   1 
ATOM   2744 N N   . VAL A 1 363 ? 29.632  20.528  -6.647  1.00 58.15  ? 363  VAL A N   1 
ATOM   2745 C CA  . VAL A 1 363 ? 29.647  19.077  -6.725  1.00 58.73  ? 363  VAL A CA  1 
ATOM   2746 C C   . VAL A 1 363 ? 31.071  18.585  -6.691  1.00 59.60  ? 363  VAL A C   1 
ATOM   2747 O O   . VAL A 1 363 ? 31.343  17.558  -6.071  1.00 59.98  ? 363  VAL A O   1 
ATOM   2748 C CB  . VAL A 1 363 ? 28.920  18.559  -7.984  1.00 58.60  ? 363  VAL A CB  1 
ATOM   2749 C CG1 . VAL A 1 363 ? 29.266  17.107  -8.274  1.00 58.11  ? 363  VAL A CG1 1 
ATOM   2750 C CG2 . VAL A 1 363 ? 27.416  18.719  -7.820  1.00 58.66  ? 363  VAL A CG2 1 
ATOM   2751 N N   . ARG A 1 364 ? 31.978  19.317  -7.338  1.00 60.65  ? 364  ARG A N   1 
ATOM   2752 C CA  . ARG A 1 364 ? 33.403  18.986  -7.285  1.00 61.89  ? 364  ARG A CA  1 
ATOM   2753 C C   . ARG A 1 364 ? 33.922  19.079  -5.857  1.00 62.45  ? 364  ARG A C   1 
ATOM   2754 O O   . ARG A 1 364 ? 34.691  18.229  -5.415  1.00 62.81  ? 364  ARG A O   1 
ATOM   2755 C CB  . ARG A 1 364 ? 34.242  19.903  -8.178  1.00 62.13  ? 364  ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 364 ? 34.064  19.754  -9.694  1.00 64.22  ? 364  ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 364 ? 33.632  18.356  -10.139 1.00 68.16  ? 364  ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 364 ? 34.661  17.331  -9.960  1.00 70.98  ? 364  ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 364 ? 35.408  16.833  -10.947 1.00 71.95  ? 364  ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 364 ? 35.257  17.260  -12.201 1.00 71.55  ? 364  ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 364 ? 36.309  15.897  -10.676 1.00 72.54  ? 364  ARG A NH2 1 
ATOM   2762 N N   . ILE A 1 365 ? 33.491  20.107  -5.136  1.00 63.08  ? 365  ILE A N   1 
ATOM   2763 C CA  . ILE A 1 365 ? 33.943  20.322  -3.768  1.00 63.84  ? 365  ILE A CA  1 
ATOM   2764 C C   . ILE A 1 365 ? 33.301  19.343  -2.786  1.00 64.27  ? 365  ILE A C   1 
ATOM   2765 O O   . ILE A 1 365 ? 33.983  18.761  -1.938  1.00 64.41  ? 365  ILE A O   1 
ATOM   2766 C CB  . ILE A 1 365 ? 33.678  21.766  -3.322  1.00 63.81  ? 365  ILE A CB  1 
ATOM   2767 C CG1 . ILE A 1 365 ? 34.403  22.737  -4.251  1.00 64.37  ? 365  ILE A CG1 1 
ATOM   2768 C CG2 . ILE A 1 365 ? 34.119  21.978  -1.870  1.00 64.33  ? 365  ILE A CG2 1 
ATOM   2769 C CD1 . ILE A 1 365 ? 34.198  24.196  -3.898  1.00 65.90  ? 365  ILE A CD1 1 
ATOM   2770 N N   . GLY A 1 366 ? 31.988  19.173  -2.901  1.00 64.95  ? 366  GLY A N   1 
ATOM   2771 C CA  . GLY A 1 366 ? 31.244  18.241  -2.055  1.00 65.55  ? 366  GLY A CA  1 
ATOM   2772 C C   . GLY A 1 366 ? 31.675  16.796  -2.229  1.00 65.99  ? 366  GLY A C   1 
ATOM   2773 O O   . GLY A 1 366 ? 31.670  16.021  -1.277  1.00 66.16  ? 366  GLY A O   1 
ATOM   2774 N N   . VAL A 1 367 ? 32.055  16.427  -3.443  1.00 66.32  ? 367  VAL A N   1 
ATOM   2775 C CA  . VAL A 1 367 ? 32.470  15.064  -3.705  1.00 67.02  ? 367  VAL A CA  1 
ATOM   2776 C C   . VAL A 1 367 ? 33.903  15.079  -4.238  1.00 67.70  ? 367  VAL A C   1 
ATOM   2777 O O   . VAL A 1 367 ? 34.129  14.835  -5.423  1.00 67.97  ? 367  VAL A O   1 
ATOM   2778 C CB  . VAL A 1 367 ? 31.520  14.390  -4.715  1.00 66.99  ? 367  VAL A CB  1 
ATOM   2779 C CG1 . VAL A 1 367 ? 31.637  12.883  -4.629  1.00 66.94  ? 367  VAL A CG1 1 
ATOM   2780 C CG2 . VAL A 1 367 ? 30.074  14.823  -4.475  1.00 66.87  ? 367  VAL A CG2 1 
ATOM   2781 N N   . PRO A 1 368 ? 34.887  15.366  -3.366  1.00 68.30  ? 368  PRO A N   1 
ATOM   2782 C CA  . PRO A 1 368 ? 36.247  15.627  -3.864  1.00 68.68  ? 368  PRO A CA  1 
ATOM   2783 C C   . PRO A 1 368 ? 36.959  14.372  -4.376  1.00 69.27  ? 368  PRO A C   1 
ATOM   2784 O O   . PRO A 1 368 ? 37.912  14.469  -5.147  1.00 69.33  ? 368  PRO A O   1 
ATOM   2785 C CB  . PRO A 1 368 ? 36.960  16.205  -2.645  1.00 68.70  ? 368  PRO A CB  1 
ATOM   2786 C CG  . PRO A 1 368 ? 36.225  15.639  -1.471  1.00 68.61  ? 368  PRO A CG  1 
ATOM   2787 C CD  . PRO A 1 368 ? 34.804  15.441  -1.894  1.00 68.35  ? 368  PRO A CD  1 
ATOM   2788 N N   . GLN A 1 369 ? 36.482  13.204  -3.961  1.00 69.99  ? 369  GLN A N   1 
ATOM   2789 C CA  . GLN A 1 369 ? 36.998  11.926  -4.460  1.00 70.76  ? 369  GLN A CA  1 
ATOM   2790 C C   . GLN A 1 369 ? 36.488  11.573  -5.868  1.00 70.54  ? 369  GLN A C   1 
ATOM   2791 O O   . GLN A 1 369 ? 36.858  10.532  -6.419  1.00 70.76  ? 369  GLN A O   1 
ATOM   2792 C CB  . GLN A 1 369 ? 36.665  10.779  -3.480  1.00 71.32  ? 369  GLN A CB  1 
ATOM   2793 C CG  . GLN A 1 369 ? 35.184  10.691  -3.019  1.00 72.85  ? 369  GLN A CG  1 
ATOM   2794 C CD  . GLN A 1 369 ? 34.873  11.569  -1.794  1.00 75.92  ? 369  GLN A CD  1 
ATOM   2795 O OE1 . GLN A 1 369 ? 33.722  11.962  -1.576  1.00 76.83  ? 369  GLN A OE1 1 
ATOM   2796 N NE2 . GLN A 1 369 ? 35.902  11.876  -0.992  1.00 76.71  ? 369  GLN A NE2 1 
ATOM   2797 N N   . ALA A 1 370 ? 35.644  12.431  -6.440  1.00 70.14  ? 370  ALA A N   1 
ATOM   2798 C CA  . ALA A 1 370 ? 34.984  12.130  -7.710  1.00 69.72  ? 370  ALA A CA  1 
ATOM   2799 C C   . ALA A 1 370 ? 35.769  12.557  -8.952  1.00 69.48  ? 370  ALA A C   1 
ATOM   2800 O O   . ALA A 1 370 ? 36.178  13.715  -9.081  1.00 69.26  ? 370  ALA A O   1 
ATOM   2801 C CB  . ALA A 1 370 ? 33.578  12.711  -7.739  1.00 69.56  ? 370  ALA A CB  1 
ATOM   2802 N N   . SER A 1 371 ? 35.957  11.604  -9.863  1.00 69.18  ? 371  SER A N   1 
ATOM   2803 C CA  . SER A 1 371 ? 36.553  11.860  -11.168 1.00 68.87  ? 371  SER A CA  1 
ATOM   2804 C C   . SER A 1 371 ? 35.665  12.797  -11.979 1.00 68.65  ? 371  SER A C   1 
ATOM   2805 O O   . SER A 1 371 ? 34.581  13.192  -11.525 1.00 68.63  ? 371  SER A O   1 
ATOM   2806 C CB  . SER A 1 371 ? 36.731  10.540  -11.926 1.00 69.11  ? 371  SER A CB  1 
ATOM   2807 O OG  . SER A 1 371 ? 35.480  9.930   -12.208 1.00 68.55  ? 371  SER A OG  1 
ATOM   2808 N N   . ASP A 1 372 ? 36.115  13.147  -13.182 1.00 68.11  ? 372  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 372 ? 35.333  14.027  -14.040 1.00 67.42  ? 372  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 372 ? 34.028  13.349  -14.437 1.00 66.58  ? 372  ASP A C   1 
ATOM   2811 O O   . ASP A 1 372 ? 32.956  13.953  -14.357 1.00 66.55  ? 372  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 372 ? 36.141  14.473  -15.262 1.00 67.63  ? 372  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 372 ? 37.256  15.447  -14.900 1.00 68.41  ? 372  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 372 ? 37.891  15.279  -13.836 1.00 69.02  ? 372  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 372 ? 37.509  16.382  -15.684 1.00 69.86  ? 372  ASP A OD2 1 
ATOM   2816 N N   . LEU A 1 373 ? 34.125  12.079  -14.817 1.00 65.44  ? 373  LEU A N   1 
ATOM   2817 C CA  . LEU A 1 373 ? 32.962  11.309  -15.234 1.00 64.27  ? 373  LEU A CA  1 
ATOM   2818 C C   . LEU A 1 373 ? 31.937  11.127  -14.112 1.00 63.49  ? 373  LEU A C   1 
ATOM   2819 O O   . LEU A 1 373 ? 30.738  11.163  -14.359 1.00 63.43  ? 373  LEU A O   1 
ATOM   2820 C CB  . LEU A 1 373 ? 33.406  9.956   -15.781 1.00 64.33  ? 373  LEU A CB  1 
ATOM   2821 C CG  . LEU A 1 373 ? 32.335  8.955   -16.218 1.00 64.46  ? 373  LEU A CG  1 
ATOM   2822 C CD1 . LEU A 1 373 ? 31.462  9.503   -17.347 1.00 64.69  ? 373  LEU A CD1 1 
ATOM   2823 C CD2 . LEU A 1 373 ? 32.991  7.655   -16.632 1.00 64.27  ? 373  LEU A CD2 1 
ATOM   2824 N N   . ALA A 1 374 ? 32.408  10.933  -12.885 1.00 62.52  ? 374  ALA A N   1 
ATOM   2825 C CA  . ALA A 1 374 ? 31.512  10.758  -11.748 1.00 61.53  ? 374  ALA A CA  1 
ATOM   2826 C C   . ALA A 1 374 ? 30.768  12.055  -11.404 1.00 61.03  ? 374  ALA A C   1 
ATOM   2827 O O   . ALA A 1 374 ? 29.559  12.044  -11.164 1.00 60.81  ? 374  ALA A O   1 
ATOM   2828 C CB  . ALA A 1 374 ? 32.271  10.235  -10.554 1.00 61.32  ? 374  ALA A CB  1 
ATOM   2829 N N   . ALA A 1 375 ? 31.490  13.170  -11.392 1.00 60.46  ? 375  ALA A N   1 
ATOM   2830 C CA  . ALA A 1 375 ? 30.882  14.474  -11.150 1.00 60.03  ? 375  ALA A CA  1 
ATOM   2831 C C   . ALA A 1 375 ? 29.746  14.703  -12.139 1.00 59.66  ? 375  ALA A C   1 
ATOM   2832 O O   . ALA A 1 375 ? 28.684  15.223  -11.798 1.00 59.86  ? 375  ALA A O   1 
ATOM   2833 C CB  . ALA A 1 375 ? 31.926  15.571  -11.286 1.00 60.22  ? 375  ALA A CB  1 
ATOM   2834 N N   . GLU A 1 376 ? 29.993  14.302  -13.376 1.00 59.07  ? 376  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 376 ? 29.011  14.364  -14.425 1.00 58.47  ? 376  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 376 ? 27.809  13.499  -14.028 1.00 57.24  ? 376  GLU A C   1 
ATOM   2837 O O   . GLU A 1 376 ? 26.666  13.950  -14.070 1.00 57.05  ? 376  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 376 ? 29.679  13.901  -15.724 1.00 59.05  ? 376  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 376 ? 28.902  14.133  -17.013 1.00 62.34  ? 376  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 376 ? 28.463  15.579  -17.222 1.00 65.83  ? 376  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 376 ? 28.501  16.379  -16.249 1.00 65.85  ? 376  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 376 ? 28.058  15.901  -18.373 1.00 67.97  ? 376  GLU A OE2 1 
ATOM   2843 N N   . ALA A 1 377 ? 28.080  12.278  -13.583 1.00 55.90  ? 377  ALA A N   1 
ATOM   2844 C CA  . ALA A 1 377 ? 27.027  11.380  -13.128 1.00 54.80  ? 377  ALA A CA  1 
ATOM   2845 C C   . ALA A 1 377 ? 26.161  12.022  -12.049 1.00 53.94  ? 377  ALA A C   1 
ATOM   2846 O O   . ALA A 1 377 ? 24.936  12.006  -12.151 1.00 53.81  ? 377  ALA A O   1 
ATOM   2847 C CB  . ALA A 1 377 ? 27.616  10.067  -12.635 1.00 54.79  ? 377  ALA A CB  1 
ATOM   2848 N N   . VAL A 1 378 ? 26.811  12.595  -11.034 1.00 52.89  ? 378  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 378 ? 26.128  13.243  -9.903  1.00 51.72  ? 378  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 378 ? 25.243  14.393  -10.374 1.00 51.24  ? 378  VAL A C   1 
ATOM   2851 O O   . VAL A 1 378 ? 24.037  14.418  -10.112 1.00 50.54  ? 378  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 378 ? 27.135  13.769  -8.841  1.00 51.56  ? 378  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 378 ? 26.423  14.600  -7.785  1.00 50.88  ? 378  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 378 ? 27.881  12.622  -8.194  1.00 50.56  ? 378  VAL A CG2 1 
ATOM   2855 N N   . VAL A 1 379 ? 25.869  15.334  -11.074 1.00 50.95  ? 379  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 379 ? 25.182  16.479  -11.653 1.00 50.92  ? 379  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 379 ? 23.967  16.029  -12.465 1.00 50.85  ? 379  VAL A C   1 
ATOM   2858 O O   . VAL A 1 379 ? 22.874  16.575  -12.325 1.00 50.40  ? 379  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 379 ? 26.153  17.325  -12.507 1.00 50.64  ? 379  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 379 ? 25.407  18.142  -13.528 1.00 51.07  ? 379  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 379 ? 26.959  18.233  -11.618 1.00 50.55  ? 379  VAL A CG2 1 
ATOM   2862 N N   . LEU A 1 380 ? 24.165  15.007  -13.285 1.00 51.07  ? 380  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 380 ? 23.088  14.466  -14.080 1.00 51.71  ? 380  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 380 ? 21.931  13.892  -13.262 1.00 51.48  ? 380  LEU A C   1 
ATOM   2865 O O   . LEU A 1 380 ? 20.770  14.177  -13.554 1.00 51.51  ? 380  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 380 ? 23.634  13.439  -15.053 1.00 52.20  ? 380  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 380 ? 23.852  14.031  -16.451 1.00 54.69  ? 380  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 380 ? 25.008  15.069  -16.563 1.00 54.72  ? 380  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 380 ? 24.040  12.889  -17.446 1.00 57.12  ? 380  LEU A CD2 1 
ATOM   2870 N N   . HIS A 1 381 ? 22.246  13.103  -12.235 1.00 51.16  ? 381  HIS A N   1 
ATOM   2871 C CA  . HIS A 1 381 ? 21.223  12.521  -11.370 1.00 50.82  ? 381  HIS A CA  1 
ATOM   2872 C C   . HIS A 1 381 ? 20.441  13.571  -10.585 1.00 50.39  ? 381  HIS A C   1 
ATOM   2873 O O   . HIS A 1 381 ? 19.254  13.417  -10.360 1.00 50.37  ? 381  HIS A O   1 
ATOM   2874 C CB  . HIS A 1 381 ? 21.831  11.492  -10.421 1.00 50.95  ? 381  HIS A CB  1 
ATOM   2875 C CG  . HIS A 1 381 ? 20.832  10.845  -9.511  1.00 51.97  ? 381  HIS A CG  1 
ATOM   2876 N ND1 . HIS A 1 381 ? 19.981  9.845   -9.931  1.00 53.63  ? 381  HIS A ND1 1 
ATOM   2877 C CD2 . HIS A 1 381 ? 20.546  11.056  -8.203  1.00 52.81  ? 381  HIS A CD2 1 
ATOM   2878 C CE1 . HIS A 1 381 ? 19.220  9.462   -8.918  1.00 53.77  ? 381  HIS A CE1 1 
ATOM   2879 N NE2 . HIS A 1 381 ? 19.545  10.178  -7.856  1.00 52.60  ? 381  HIS A NE2 1 
ATOM   2880 N N   . TYR A 1 382 ? 21.103  14.649  -10.187 1.00 50.34  ? 382  TYR A N   1 
ATOM   2881 C CA  . TYR A 1 382 ? 20.452  15.679  -9.380  1.00 49.88  ? 382  TYR A CA  1 
ATOM   2882 C C   . TYR A 1 382 ? 19.810  16.828  -10.150 1.00 50.38  ? 382  TYR A C   1 
ATOM   2883 O O   . TYR A 1 382 ? 19.111  17.647  -9.546  1.00 50.64  ? 382  TYR A O   1 
ATOM   2884 C CB  . TYR A 1 382 ? 21.407  16.210  -8.318  1.00 49.04  ? 382  TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 382 ? 21.563  15.243  -7.186  1.00 47.99  ? 382  TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 382 ? 22.540  14.265  -7.222  1.00 46.92  ? 382  TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 382 ? 20.710  15.284  -6.088  1.00 47.09  ? 382  TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 382 ? 22.674  13.353  -6.187  1.00 47.36  ? 382  TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 382 ? 20.840  14.380  -5.046  1.00 46.92  ? 382  TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 382 ? 21.824  13.414  -5.103  1.00 47.20  ? 382  TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 382 ? 21.978  12.509  -4.080  1.00 47.30  ? 382  TYR A OH  1 
ATOM   2892 N N   . THR A 1 383 ? 20.026  16.894  -11.463 1.00 50.75  ? 383  THR A N   1 
ATOM   2893 C CA  . THR A 1 383 ? 19.440  17.959  -12.266 1.00 51.22  ? 383  THR A CA  1 
ATOM   2894 C C   . THR A 1 383 ? 17.985  17.669  -12.526 1.00 52.05  ? 383  THR A C   1 
ATOM   2895 O O   . THR A 1 383 ? 17.631  16.566  -12.931 1.00 52.53  ? 383  THR A O   1 
ATOM   2896 C CB  . THR A 1 383 ? 20.145  18.112  -13.598 1.00 50.91  ? 383  THR A CB  1 
ATOM   2897 O OG1 . THR A 1 383 ? 21.525  18.382  -13.362 1.00 51.50  ? 383  THR A OG1 1 
ATOM   2898 C CG2 . THR A 1 383 ? 19.565  19.255  -14.378 1.00 50.73  ? 383  THR A CG2 1 
ATOM   2899 N N   . ASP A 1 384 ? 17.142  18.660  -12.268 1.00 53.13  ? 384  ASP A N   1 
ATOM   2900 C CA  . ASP A 1 384 ? 15.736  18.602  -12.620 1.00 54.04  ? 384  ASP A CA  1 
ATOM   2901 C C   . ASP A 1 384 ? 15.682  19.089  -14.046 1.00 54.04  ? 384  ASP A C   1 
ATOM   2902 O O   . ASP A 1 384 ? 15.866  20.271  -14.298 1.00 53.86  ? 384  ASP A O   1 
ATOM   2903 C CB  . ASP A 1 384 ? 14.949  19.525  -11.682 1.00 54.76  ? 384  ASP A CB  1 
ATOM   2904 C CG  . ASP A 1 384 ? 13.583  19.946  -12.237 1.00 56.80  ? 384  ASP A CG  1 
ATOM   2905 O OD1 . ASP A 1 384 ? 12.879  19.115  -12.875 1.00 58.40  ? 384  ASP A OD1 1 
ATOM   2906 O OD2 . ASP A 1 384 ? 13.215  21.126  -11.995 1.00 58.52  ? 384  ASP A OD2 1 
ATOM   2907 N N   . TRP A 1 385 ? 15.455  18.177  -14.985 1.00 54.50  ? 385  TRP A N   1 
ATOM   2908 C CA  . TRP A 1 385 ? 15.561  18.534  -16.400 1.00 54.86  ? 385  TRP A CA  1 
ATOM   2909 C C   . TRP A 1 385 ? 14.380  19.341  -16.927 1.00 55.65  ? 385  TRP A C   1 
ATOM   2910 O O   . TRP A 1 385 ? 14.420  19.869  -18.036 1.00 56.03  ? 385  TRP A O   1 
ATOM   2911 C CB  . TRP A 1 385 ? 15.861  17.319  -17.255 1.00 54.16  ? 385  TRP A CB  1 
ATOM   2912 C CG  . TRP A 1 385 ? 17.146  16.748  -16.893 1.00 53.21  ? 385  TRP A CG  1 
ATOM   2913 C CD1 . TRP A 1 385 ? 17.364  15.711  -16.046 1.00 53.21  ? 385  TRP A CD1 1 
ATOM   2914 C CD2 . TRP A 1 385 ? 18.422  17.193  -17.325 1.00 52.59  ? 385  TRP A CD2 1 
ATOM   2915 N NE1 . TRP A 1 385 ? 18.706  15.462  -15.930 1.00 52.83  ? 385  TRP A NE1 1 
ATOM   2916 C CE2 . TRP A 1 385 ? 19.385  16.360  -16.706 1.00 52.93  ? 385  TRP A CE2 1 
ATOM   2917 C CE3 . TRP A 1 385 ? 18.854  18.208  -18.185 1.00 53.35  ? 385  TRP A CE3 1 
ATOM   2918 C CZ2 . TRP A 1 385 ? 20.762  16.509  -16.916 1.00 53.45  ? 385  TRP A CZ2 1 
ATOM   2919 C CZ3 . TRP A 1 385 ? 20.234  18.364  -18.397 1.00 53.84  ? 385  TRP A CZ3 1 
ATOM   2920 C CH2 . TRP A 1 385 ? 21.169  17.515  -17.759 1.00 53.90  ? 385  TRP A CH2 1 
ATOM   2921 N N   . LEU A 1 386 ? 13.335  19.445  -16.122 1.00 56.45  ? 386  LEU A N   1 
ATOM   2922 C CA  . LEU A 1 386 ? 12.270  20.379  -16.417 1.00 57.41  ? 386  LEU A CA  1 
ATOM   2923 C C   . LEU A 1 386 ? 12.735  21.816  -16.206 1.00 57.74  ? 386  LEU A C   1 
ATOM   2924 O O   . LEU A 1 386 ? 12.403  22.694  -16.999 1.00 57.97  ? 386  LEU A O   1 
ATOM   2925 C CB  . LEU A 1 386 ? 11.059  20.074  -15.554 1.00 57.61  ? 386  LEU A CB  1 
ATOM   2926 C CG  . LEU A 1 386 ? 10.143  19.059  -16.211 1.00 58.13  ? 386  LEU A CG  1 
ATOM   2927 C CD1 . LEU A 1 386 ? 9.827   17.893  -15.257 1.00 59.78  ? 386  LEU A CD1 1 
ATOM   2928 C CD2 . LEU A 1 386 ? 8.903   19.789  -16.658 1.00 58.72  ? 386  LEU A CD2 1 
ATOM   2929 N N   . HIS A 1 387 ? 13.500  22.049  -15.140 1.00 57.96  ? 387  HIS A N   1 
ATOM   2930 C CA  . HIS A 1 387 ? 14.054  23.380  -14.851 1.00 58.22  ? 387  HIS A CA  1 
ATOM   2931 C C   . HIS A 1 387 ? 15.537  23.271  -14.468 1.00 57.88  ? 387  HIS A C   1 
ATOM   2932 O O   . HIS A 1 387 ? 15.889  23.410  -13.296 1.00 58.08  ? 387  HIS A O   1 
ATOM   2933 C CB  . HIS A 1 387 ? 13.261  24.073  -13.734 1.00 58.40  ? 387  HIS A CB  1 
ATOM   2934 C CG  . HIS A 1 387 ? 11.781  23.860  -13.812 1.00 59.69  ? 387  HIS A CG  1 
ATOM   2935 N ND1 . HIS A 1 387 ? 11.175  22.690  -13.403 1.00 60.74  ? 387  HIS A ND1 1 
ATOM   2936 C CD2 . HIS A 1 387 ? 10.785  24.668  -14.246 1.00 60.79  ? 387  HIS A CD2 1 
ATOM   2937 C CE1 . HIS A 1 387 ? 9.869   22.785  -13.582 1.00 61.24  ? 387  HIS A CE1 1 
ATOM   2938 N NE2 . HIS A 1 387 ? 9.606   23.975  -14.092 1.00 61.69  ? 387  HIS A NE2 1 
ATOM   2939 N N   . PRO A 1 388 ? 16.410  22.985  -15.450 1.00 57.54  ? 388  PRO A N   1 
ATOM   2940 C CA  . PRO A 1 388 ? 17.836  22.782  -15.156 1.00 57.26  ? 388  PRO A CA  1 
ATOM   2941 C C   . PRO A 1 388 ? 18.606  24.055  -14.820 1.00 56.96  ? 388  PRO A C   1 
ATOM   2942 O O   . PRO A 1 388 ? 19.821  24.000  -14.597 1.00 57.15  ? 388  PRO A O   1 
ATOM   2943 C CB  . PRO A 1 388 ? 18.379  22.179  -16.454 1.00 57.34  ? 388  PRO A CB  1 
ATOM   2944 C CG  . PRO A 1 388 ? 17.456  22.681  -17.517 1.00 57.77  ? 388  PRO A CG  1 
ATOM   2945 C CD  . PRO A 1 388 ? 16.101  22.793  -16.880 1.00 57.51  ? 388  PRO A CD  1 
ATOM   2946 N N   . GLU A 1 389 ? 17.907  25.181  -14.770 1.00 56.42  ? 389  GLU A N   1 
ATOM   2947 C CA  . GLU A 1 389 ? 18.557  26.475  -14.628 1.00 56.16  ? 389  GLU A CA  1 
ATOM   2948 C C   . GLU A 1 389 ? 18.007  27.240  -13.441 1.00 55.38  ? 389  GLU A C   1 
ATOM   2949 O O   . GLU A 1 389 ? 18.407  28.382  -13.164 1.00 55.09  ? 389  GLU A O   1 
ATOM   2950 C CB  . GLU A 1 389 ? 18.353  27.282  -15.907 1.00 56.63  ? 389  GLU A CB  1 
ATOM   2951 C CG  . GLU A 1 389 ? 19.120  26.732  -17.116 1.00 58.83  ? 389  GLU A CG  1 
ATOM   2952 C CD  . GLU A 1 389 ? 20.498  27.355  -17.274 1.00 61.46  ? 389  GLU A CD  1 
ATOM   2953 O OE1 . GLU A 1 389 ? 21.317  27.316  -16.323 1.00 62.74  ? 389  GLU A OE1 1 
ATOM   2954 O OE2 . GLU A 1 389 ? 20.761  27.895  -18.364 1.00 63.32  ? 389  GLU A OE2 1 
ATOM   2955 N N   . ASP A 1 390 ? 17.084  26.594  -12.741 1.00 54.45  ? 390  ASP A N   1 
ATOM   2956 C CA  . ASP A 1 390 ? 16.343  27.231  -11.684 1.00 53.62  ? 390  ASP A CA  1 
ATOM   2957 C C   . ASP A 1 390 ? 17.197  27.229  -10.436 1.00 53.34  ? 390  ASP A C   1 
ATOM   2958 O O   . ASP A 1 390 ? 17.581  26.161  -9.951  1.00 53.55  ? 390  ASP A O   1 
ATOM   2959 C CB  . ASP A 1 390 ? 15.031  26.502  -11.453 1.00 53.30  ? 390  ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 390 ? 14.309  27.014  -10.265 1.00 53.75  ? 390  ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 390 ? 13.829  28.155  -10.303 1.00 56.20  ? 390  ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 390 ? 14.238  26.290  -9.264  1.00 55.79  ? 390  ASP A OD2 1 
ATOM   2963 N N   . PRO A 1 391 ? 17.508  28.423  -9.911  1.00 52.91  ? 391  PRO A N   1 
ATOM   2964 C CA  . PRO A 1 391 ? 18.453  28.570  -8.815  1.00 52.82  ? 391  PRO A CA  1 
ATOM   2965 C C   . PRO A 1 391 ? 17.933  27.971  -7.508  1.00 52.63  ? 391  PRO A C   1 
ATOM   2966 O O   . PRO A 1 391 ? 18.692  27.345  -6.774  1.00 52.62  ? 391  PRO A O   1 
ATOM   2967 C CB  . PRO A 1 391 ? 18.607  30.090  -8.686  1.00 52.99  ? 391  PRO A CB  1 
ATOM   2968 C CG  . PRO A 1 391 ? 18.020  30.663  -9.908  1.00 52.77  ? 391  PRO A CG  1 
ATOM   2969 C CD  . PRO A 1 391 ? 16.960  29.719  -10.321 1.00 52.88  ? 391  PRO A CD  1 
ATOM   2970 N N   . THR A 1 392 ? 16.646  28.158  -7.234  1.00 52.52  ? 392  THR A N   1 
ATOM   2971 C CA  . THR A 1 392 ? 16.007  27.565  -6.063  1.00 52.11  ? 392  THR A CA  1 
ATOM   2972 C C   . THR A 1 392 ? 16.136  26.036  -6.062  1.00 51.75  ? 392  THR A C   1 
ATOM   2973 O O   . THR A 1 392 ? 16.427  25.434  -5.022  1.00 51.61  ? 392  THR A O   1 
ATOM   2974 C CB  . THR A 1 392 ? 14.535  28.032  -5.931  1.00 52.18  ? 392  THR A CB  1 
ATOM   2975 O OG1 . THR A 1 392 ? 14.510  29.318  -5.308  1.00 52.33  ? 392  THR A OG1 1 
ATOM   2976 C CG2 . THR A 1 392 ? 13.715  27.082  -5.071  1.00 52.18  ? 392  THR A CG2 1 
ATOM   2977 N N   . HIS A 1 393 ? 15.944  25.401  -7.214  1.00 51.29  ? 393  HIS A N   1 
ATOM   2978 C CA  . HIS A 1 393 ? 16.158  23.968  -7.250  1.00 51.33  ? 393  HIS A CA  1 
ATOM   2979 C C   . HIS A 1 393 ? 17.625  23.577  -7.085  1.00 50.01  ? 393  HIS A C   1 
ATOM   2980 O O   . HIS A 1 393 ? 17.937  22.696  -6.275  1.00 50.19  ? 393  HIS A O   1 
ATOM   2981 C CB  . HIS A 1 393 ? 15.599  23.285  -8.488  1.00 52.07  ? 393  HIS A CB  1 
ATOM   2982 C CG  . HIS A 1 393 ? 15.991  21.841  -8.566  1.00 56.78  ? 393  HIS A CG  1 
ATOM   2983 N ND1 . HIS A 1 393 ? 15.520  20.893  -7.672  1.00 60.72  ? 393  HIS A ND1 1 
ATOM   2984 C CD2 . HIS A 1 393 ? 16.860  21.192  -9.383  1.00 60.20  ? 393  HIS A CD2 1 
ATOM   2985 C CE1 . HIS A 1 393 ? 16.054  19.716  -7.961  1.00 62.48  ? 393  HIS A CE1 1 
ATOM   2986 N NE2 . HIS A 1 393 ? 16.873  19.870  -8.992  1.00 62.43  ? 393  HIS A NE2 1 
ATOM   2987 N N   . LEU A 1 394 ? 18.516  24.216  -7.847  1.00 48.29  ? 394  LEU A N   1 
ATOM   2988 C CA  . LEU A 1 394 ? 19.940  23.865  -7.807  1.00 46.26  ? 394  LEU A CA  1 
ATOM   2989 C C   . LEU A 1 394 ? 20.473  24.017  -6.392  1.00 45.09  ? 394  LEU A C   1 
ATOM   2990 O O   . LEU A 1 394 ? 21.202  23.163  -5.895  1.00 44.42  ? 394  LEU A O   1 
ATOM   2991 C CB  . LEU A 1 394 ? 20.755  24.708  -8.790  1.00 46.23  ? 394  LEU A CB  1 
ATOM   2992 C CG  . LEU A 1 394 ? 20.419  24.667  -10.288 1.00 45.83  ? 394  LEU A CG  1 
ATOM   2993 C CD1 . LEU A 1 394 ? 21.162  25.758  -11.037 1.00 44.41  ? 394  LEU A CD1 1 
ATOM   2994 C CD2 . LEU A 1 394 ? 20.702  23.302  -10.916 1.00 46.53  ? 394  LEU A CD2 1 
ATOM   2995 N N   . ARG A 1 395 ? 20.073  25.094  -5.732  1.00 43.92  ? 395  ARG A N   1 
ATOM   2996 C CA  . ARG A 1 395 ? 20.424  25.274  -4.345  1.00 43.40  ? 395  ARG A CA  1 
ATOM   2997 C C   . ARG A 1 395 ? 20.059  24.028  -3.555  1.00 43.41  ? 395  ARG A C   1 
ATOM   2998 O O   . ARG A 1 395 ? 20.937  23.420  -2.942  1.00 43.86  ? 395  ARG A O   1 
ATOM   2999 C CB  . ARG A 1 395 ? 19.777  26.531  -3.778  1.00 43.19  ? 395  ARG A CB  1 
ATOM   3000 C CG  . ARG A 1 395 ? 20.020  26.763  -2.317  1.00 42.11  ? 395  ARG A CG  1 
ATOM   3001 C CD  . ARG A 1 395 ? 18.754  26.550  -1.577  1.00 43.30  ? 395  ARG A CD  1 
ATOM   3002 N NE  . ARG A 1 395 ? 17.960  27.768  -1.412  1.00 43.94  ? 395  ARG A NE  1 
ATOM   3003 C CZ  . ARG A 1 395 ? 16.629  27.788  -1.308  1.00 43.97  ? 395  ARG A CZ  1 
ATOM   3004 N NH1 . ARG A 1 395 ? 15.918  26.664  -1.396  1.00 42.12  ? 395  ARG A NH1 1 
ATOM   3005 N NH2 . ARG A 1 395 ? 15.999  28.943  -1.129  1.00 45.05  ? 395  ARG A NH2 1 
ATOM   3006 N N   . ASP A 1 396 ? 18.792  23.614  -3.616  1.00 43.14  ? 396  ASP A N   1 
ATOM   3007 C CA  . ASP A 1 396 ? 18.325  22.421  -2.893  1.00 42.61  ? 396  ASP A CA  1 
ATOM   3008 C C   . ASP A 1 396 ? 19.033  21.150  -3.349  1.00 41.93  ? 396  ASP A C   1 
ATOM   3009 O O   . ASP A 1 396 ? 19.282  20.259  -2.551  1.00 41.84  ? 396  ASP A O   1 
ATOM   3010 C CB  . ASP A 1 396 ? 16.803  22.271  -2.992  1.00 42.91  ? 396  ASP A CB  1 
ATOM   3011 C CG  . ASP A 1 396 ? 16.052  23.470  -2.410  1.00 43.89  ? 396  ASP A CG  1 
ATOM   3012 O OD1 . ASP A 1 396 ? 16.655  24.203  -1.594  1.00 45.29  ? 396  ASP A OD1 1 
ATOM   3013 O OD2 . ASP A 1 396 ? 14.861  23.682  -2.757  1.00 43.44  ? 396  ASP A OD2 1 
ATOM   3014 N N   . ALA A 1 397 ? 19.373  21.081  -4.624  1.00 41.41  ? 397  ALA A N   1 
ATOM   3015 C CA  . ALA A 1 397 ? 20.128  19.951  -5.144  1.00 41.67  ? 397  ALA A CA  1 
ATOM   3016 C C   . ALA A 1 397 ? 21.482  19.823  -4.446  1.00 41.86  ? 397  ALA A C   1 
ATOM   3017 O O   . ALA A 1 397 ? 21.832  18.762  -3.924  1.00 42.05  ? 397  ALA A O   1 
ATOM   3018 C CB  . ALA A 1 397 ? 20.311  20.076  -6.660  1.00 41.59  ? 397  ALA A CB  1 
ATOM   3019 N N   . MET A 1 398 ? 22.231  20.923  -4.433  1.00 41.89  ? 398  MET A N   1 
ATOM   3020 C CA  . MET A 1 398 ? 23.537  20.972  -3.809  1.00 41.02  ? 398  MET A CA  1 
ATOM   3021 C C   . MET A 1 398 ? 23.434  20.518  -2.368  1.00 40.66  ? 398  MET A C   1 
ATOM   3022 O O   . MET A 1 398 ? 24.302  19.809  -1.875  1.00 40.57  ? 398  MET A O   1 
ATOM   3023 C CB  . MET A 1 398 ? 24.083  22.390  -3.871  1.00 41.09  ? 398  MET A CB  1 
ATOM   3024 C CG  . MET A 1 398 ? 25.542  22.506  -3.498  1.00 41.08  ? 398  MET A CG  1 
ATOM   3025 S SD  . MET A 1 398 ? 26.558  21.668  -4.702  1.00 41.96  ? 398  MET A SD  1 
ATOM   3026 C CE  . MET A 1 398 ? 26.910  20.128  -3.867  1.00 41.82  ? 398  MET A CE  1 
ATOM   3027 N N   . SER A 1 399 ? 22.367  20.916  -1.690  1.00 40.13  ? 399  SER A N   1 
ATOM   3028 C CA  . SER A 1 399 ? 22.175  20.447  -0.338  1.00 40.19  ? 399  SER A CA  1 
ATOM   3029 C C   . SER A 1 399 ? 22.053  18.922  -0.315  1.00 40.59  ? 399  SER A C   1 
ATOM   3030 O O   . SER A 1 399 ? 22.746  18.254  0.465   1.00 40.93  ? 399  SER A O   1 
ATOM   3031 C CB  . SER A 1 399 ? 20.959  21.095  0.292   1.00 39.90  ? 399  SER A CB  1 
ATOM   3032 O OG  . SER A 1 399 ? 20.737  20.599  1.594   1.00 39.67  ? 399  SER A OG  1 
ATOM   3033 N N   . ALA A 1 400 ? 21.202  18.379  -1.188  1.00 40.46  ? 400  ALA A N   1 
ATOM   3034 C CA  . ALA A 1 400 ? 20.935  16.936  -1.223  1.00 40.26  ? 400  ALA A CA  1 
ATOM   3035 C C   . ALA A 1 400 ? 22.177  16.111  -1.559  1.00 40.04  ? 400  ALA A C   1 
ATOM   3036 O O   . ALA A 1 400 ? 22.410  15.053  -0.973  1.00 39.76  ? 400  ALA A O   1 
ATOM   3037 C CB  . ALA A 1 400 ? 19.800  16.616  -2.190  1.00 40.28  ? 400  ALA A CB  1 
ATOM   3038 N N   . VAL A 1 401 ? 22.978  16.610  -2.493  1.00 40.01  ? 401  VAL A N   1 
ATOM   3039 C CA  . VAL A 1 401 ? 24.200  15.923  -2.906  1.00 39.55  ? 401  VAL A CA  1 
ATOM   3040 C C   . VAL A 1 401 ? 25.095  15.708  -1.698  1.00 39.51  ? 401  VAL A C   1 
ATOM   3041 O O   . VAL A 1 401 ? 25.472  14.583  -1.399  1.00 39.73  ? 401  VAL A O   1 
ATOM   3042 C CB  . VAL A 1 401 ? 24.956  16.707  -3.976  1.00 39.28  ? 401  VAL A CB  1 
ATOM   3043 C CG1 . VAL A 1 401 ? 26.264  16.024  -4.298  1.00 39.43  ? 401  VAL A CG1 1 
ATOM   3044 C CG2 . VAL A 1 401 ? 24.103  16.858  -5.224  1.00 38.76  ? 401  VAL A CG2 1 
ATOM   3045 N N   . VAL A 1 402 ? 25.394  16.786  -0.988  1.00 39.35  ? 402  VAL A N   1 
ATOM   3046 C CA  . VAL A 1 402 ? 26.240  16.715  0.187   1.00 39.40  ? 402  VAL A CA  1 
ATOM   3047 C C   . VAL A 1 402 ? 25.584  15.854  1.274   1.00 39.63  ? 402  VAL A C   1 
ATOM   3048 O O   . VAL A 1 402 ? 26.207  14.935  1.826   1.00 39.49  ? 402  VAL A O   1 
ATOM   3049 C CB  . VAL A 1 402 ? 26.560  18.124  0.706   1.00 39.38  ? 402  VAL A CB  1 
ATOM   3050 C CG1 . VAL A 1 402 ? 27.239  18.054  2.045   1.00 39.92  ? 402  VAL A CG1 1 
ATOM   3051 C CG2 . VAL A 1 402 ? 27.436  18.852  -0.278  1.00 38.60  ? 402  VAL A CG2 1 
ATOM   3052 N N   . GLY A 1 403 ? 24.316  16.137  1.549   1.00 40.07  ? 403  GLY A N   1 
ATOM   3053 C CA  . GLY A 1 403 ? 23.524  15.353  2.508   1.00 40.51  ? 403  GLY A CA  1 
ATOM   3054 C C   . GLY A 1 403 ? 23.459  13.871  2.207   1.00 40.91  ? 403  GLY A C   1 
ATOM   3055 O O   . GLY A 1 403 ? 23.753  13.049  3.078   1.00 40.42  ? 403  GLY A O   1 
ATOM   3056 N N   . ASP A 1 404 ? 23.102  13.531  0.964   1.00 41.40  ? 404  ASP A N   1 
ATOM   3057 C CA  . ASP A 1 404 ? 22.930  12.133  0.576   1.00 41.77  ? 404  ASP A CA  1 
ATOM   3058 C C   . ASP A 1 404 ? 24.238  11.402  0.550   1.00 41.84  ? 404  ASP A C   1 
ATOM   3059 O O   . ASP A 1 404 ? 24.300  10.241  0.937   1.00 42.61  ? 404  ASP A O   1 
ATOM   3060 C CB  . ASP A 1 404 ? 22.251  11.989  -0.780  1.00 41.85  ? 404  ASP A CB  1 
ATOM   3061 C CG  . ASP A 1 404 ? 20.854  12.576  -0.805  1.00 43.60  ? 404  ASP A CG  1 
ATOM   3062 O OD1 . ASP A 1 404 ? 20.244  12.801  0.274   1.00 45.12  ? 404  ASP A OD1 1 
ATOM   3063 O OD2 . ASP A 1 404 ? 20.364  12.836  -1.925  1.00 45.88  ? 404  ASP A OD2 1 
ATOM   3064 N N   . HIS A 1 405 ? 25.289  12.067  0.095   1.00 41.87  ? 405  HIS A N   1 
ATOM   3065 C CA  . HIS A 1 405 ? 26.579  11.399  -0.047  1.00 41.79  ? 405  HIS A CA  1 
ATOM   3066 C C   . HIS A 1 405 ? 27.167  11.045  1.316   1.00 41.65  ? 405  HIS A C   1 
ATOM   3067 O O   . HIS A 1 405 ? 27.638  9.919   1.522   1.00 41.75  ? 405  HIS A O   1 
ATOM   3068 C CB  . HIS A 1 405 ? 27.536  12.284  -0.827  1.00 41.95  ? 405  HIS A CB  1 
ATOM   3069 C CG  . HIS A 1 405 ? 28.911  11.717  -0.970  1.00 42.99  ? 405  HIS A CG  1 
ATOM   3070 N ND1 . HIS A 1 405 ? 29.145  10.430  -1.409  1.00 43.84  ? 405  HIS A ND1 1 
ATOM   3071 C CD2 . HIS A 1 405 ? 30.127  12.271  -0.755  1.00 43.45  ? 405  HIS A CD2 1 
ATOM   3072 C CE1 . HIS A 1 405 ? 30.447  10.213  -1.453  1.00 44.54  ? 405  HIS A CE1 1 
ATOM   3073 N NE2 . HIS A 1 405 ? 31.065  11.315  -1.063  1.00 44.71  ? 405  HIS A NE2 1 
ATOM   3074 N N   . ASN A 1 406 ? 27.091  12.005  2.245   1.00 40.93  ? 406  ASN A N   1 
ATOM   3075 C CA  . ASN A 1 406 ? 27.705  11.883  3.566   1.00 40.08  ? 406  ASN A CA  1 
ATOM   3076 C C   . ASN A 1 406 ? 26.862  11.229  4.670   1.00 39.45  ? 406  ASN A C   1 
ATOM   3077 O O   . ASN A 1 406 ? 27.402  10.586  5.569   1.00 39.18  ? 406  ASN A O   1 
ATOM   3078 C CB  . ASN A 1 406 ? 28.202  13.254  4.024   1.00 39.92  ? 406  ASN A CB  1 
ATOM   3079 C CG  . ASN A 1 406 ? 29.379  13.737  3.214   1.00 39.69  ? 406  ASN A CG  1 
ATOM   3080 O OD1 . ASN A 1 406 ? 30.460  13.151  3.241   1.00 39.30  ? 406  ASN A OD1 1 
ATOM   3081 N ND2 . ASN A 1 406 ? 29.177  14.816  2.487   1.00 40.98  ? 406  ASN A ND2 1 
ATOM   3082 N N   . VAL A 1 407 ? 25.546  11.386  4.619   1.00 39.08  ? 407  VAL A N   1 
ATOM   3083 C CA  . VAL A 1 407 ? 24.720  10.856  5.705   1.00 38.82  ? 407  VAL A CA  1 
ATOM   3084 C C   . VAL A 1 407 ? 23.657  9.860   5.240   1.00 39.28  ? 407  VAL A C   1 
ATOM   3085 O O   . VAL A 1 407 ? 23.720  8.671   5.580   1.00 39.20  ? 407  VAL A O   1 
ATOM   3086 C CB  . VAL A 1 407 ? 24.079  11.980  6.562   1.00 38.40  ? 407  VAL A CB  1 
ATOM   3087 C CG1 . VAL A 1 407 ? 23.361  11.393  7.728   1.00 37.90  ? 407  VAL A CG1 1 
ATOM   3088 C CG2 . VAL A 1 407 ? 25.128  12.947  7.064   1.00 37.82  ? 407  VAL A CG2 1 
ATOM   3089 N N   . VAL A 1 408 ? 22.704  10.343  4.442   1.00 39.80  ? 408  VAL A N   1 
ATOM   3090 C CA  . VAL A 1 408 ? 21.506  9.573   4.122   1.00 39.56  ? 408  VAL A CA  1 
ATOM   3091 C C   . VAL A 1 408 ? 21.852  8.236   3.486   1.00 40.12  ? 408  VAL A C   1 
ATOM   3092 O O   . VAL A 1 408 ? 21.296  7.213   3.881   1.00 40.50  ? 408  VAL A O   1 
ATOM   3093 C CB  . VAL A 1 408 ? 20.515  10.342  3.249   1.00 38.96  ? 408  VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 408 ? 19.170  9.644   3.252   1.00 38.33  ? 408  VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 408 ? 20.349  11.741  3.766   1.00 39.02  ? 408  VAL A CG2 1 
ATOM   3096 N N   . CYS A 1 409 ? 22.770  8.220   2.530   1.00 40.32  ? 409  CYS A N   1 
ATOM   3097 C CA  . CYS A 1 409 ? 23.041  6.951   1.868   1.00 41.17  ? 409  CYS A CA  1 
ATOM   3098 C C   . CYS A 1 409 ? 23.864  5.980   2.708   1.00 41.11  ? 409  CYS A C   1 
ATOM   3099 O O   . CYS A 1 409 ? 23.510  4.801   2.790   1.00 41.57  ? 409  CYS A O   1 
ATOM   3100 C CB  . CYS A 1 409 ? 23.557  7.130   0.447   1.00 41.36  ? 409  CYS A CB  1 
ATOM   3101 S SG  . CYS A 1 409 ? 22.271  7.821   -0.633  1.00 43.55  ? 409  CYS A SG  1 
ATOM   3102 N N   . PRO A 1 410 ? 24.927  6.464   3.367   1.00 40.85  ? 410  PRO A N   1 
ATOM   3103 C CA  . PRO A 1 410 ? 25.575  5.608   4.359   1.00 40.63  ? 410  PRO A CA  1 
ATOM   3104 C C   . PRO A 1 410 ? 24.603  5.016   5.391   1.00 40.36  ? 410  PRO A C   1 
ATOM   3105 O O   . PRO A 1 410 ? 24.749  3.856   5.773   1.00 40.39  ? 410  PRO A O   1 
ATOM   3106 C CB  . PRO A 1 410 ? 26.564  6.553   5.028   1.00 40.50  ? 410  PRO A CB  1 
ATOM   3107 C CG  . PRO A 1 410 ? 26.895  7.513   3.957   1.00 41.16  ? 410  PRO A CG  1 
ATOM   3108 C CD  . PRO A 1 410 ? 25.622  7.752   3.225   1.00 40.75  ? 410  PRO A CD  1 
ATOM   3109 N N   . VAL A 1 411 ? 23.622  5.795   5.829   1.00 40.01  ? 411  VAL A N   1 
ATOM   3110 C CA  . VAL A 1 411 ? 22.664  5.305   6.802   1.00 39.89  ? 411  VAL A CA  1 
ATOM   3111 C C   . VAL A 1 411 ? 21.718  4.274   6.181   1.00 40.54  ? 411  VAL A C   1 
ATOM   3112 O O   . VAL A 1 411 ? 21.411  3.257   6.797   1.00 40.66  ? 411  VAL A O   1 
ATOM   3113 C CB  . VAL A 1 411 ? 21.901  6.456   7.472   1.00 39.69  ? 411  VAL A CB  1 
ATOM   3114 C CG1 . VAL A 1 411 ? 20.685  5.945   8.197   1.00 38.97  ? 411  VAL A CG1 1 
ATOM   3115 C CG2 . VAL A 1 411 ? 22.818  7.194   8.440   1.00 38.88  ? 411  VAL A CG2 1 
ATOM   3116 N N   . ALA A 1 412 ? 21.284  4.511   4.947   1.00 41.34  ? 412  ALA A N   1 
ATOM   3117 C CA  . ALA A 1 412 ? 20.384  3.575   4.265   1.00 41.59  ? 412  ALA A CA  1 
ATOM   3118 C C   . ALA A 1 412 ? 21.123  2.290   4.005   1.00 41.79  ? 412  ALA A C   1 
ATOM   3119 O O   . ALA A 1 412 ? 20.547  1.214   4.078   1.00 41.82  ? 412  ALA A O   1 
ATOM   3120 C CB  . ALA A 1 412 ? 19.863  4.158   2.964   1.00 41.69  ? 412  ALA A CB  1 
ATOM   3121 N N   . GLN A 1 413 ? 22.407  2.413   3.702   1.00 42.17  ? 413  GLN A N   1 
ATOM   3122 C CA  . GLN A 1 413 ? 23.240  1.249   3.527   1.00 43.08  ? 413  GLN A CA  1 
ATOM   3123 C C   . GLN A 1 413 ? 23.378  0.517   4.867   1.00 43.22  ? 413  GLN A C   1 
ATOM   3124 O O   . GLN A 1 413 ? 23.211  -0.707  4.937   1.00 43.46  ? 413  GLN A O   1 
ATOM   3125 C CB  . GLN A 1 413 ? 24.602  1.652   2.990   1.00 43.09  ? 413  GLN A CB  1 
ATOM   3126 C CG  . GLN A 1 413 ? 25.661  0.581   3.112   1.00 45.48  ? 413  GLN A CG  1 
ATOM   3127 C CD  . GLN A 1 413 ? 26.031  -0.033  1.775   1.00 49.52  ? 413  GLN A CD  1 
ATOM   3128 O OE1 . GLN A 1 413 ? 25.192  -0.634  1.078   1.00 50.64  ? 413  GLN A OE1 1 
ATOM   3129 N NE2 . GLN A 1 413 ? 27.308  0.113   1.404   1.00 51.24  ? 413  GLN A NE2 1 
ATOM   3130 N N   . LEU A 1 414 ? 23.679  1.265   5.927   1.00 43.28  ? 414  LEU A N   1 
ATOM   3131 C CA  . LEU A 1 414 ? 23.886  0.658   7.241   1.00 43.04  ? 414  LEU A CA  1 
ATOM   3132 C C   . LEU A 1 414 ? 22.639  -0.085  7.668   1.00 43.14  ? 414  LEU A C   1 
ATOM   3133 O O   . LEU A 1 414 ? 22.732  -1.254  8.034   1.00 42.88  ? 414  LEU A O   1 
ATOM   3134 C CB  . LEU A 1 414 ? 24.304  1.681   8.303   1.00 42.61  ? 414  LEU A CB  1 
ATOM   3135 C CG  . LEU A 1 414 ? 24.648  1.060   9.655   1.00 41.88  ? 414  LEU A CG  1 
ATOM   3136 C CD1 . LEU A 1 414 ? 25.977  0.318   9.592   1.00 41.15  ? 414  LEU A CD1 1 
ATOM   3137 C CD2 . LEU A 1 414 ? 24.682  2.102   10.738  1.00 41.30  ? 414  LEU A CD2 1 
ATOM   3138 N N   . ALA A 1 415 ? 21.483  0.582   7.583   1.00 43.57  ? 415  ALA A N   1 
ATOM   3139 C CA  . ALA A 1 415 ? 20.194  -0.054  7.875   1.00 44.25  ? 415  ALA A CA  1 
ATOM   3140 C C   . ALA A 1 415 ? 20.006  -1.322  7.033   1.00 45.07  ? 415  ALA A C   1 
ATOM   3141 O O   . ALA A 1 415 ? 19.768  -2.385  7.581   1.00 45.00  ? 415  ALA A O   1 
ATOM   3142 C CB  . ALA A 1 415 ? 19.051  0.907   7.674   1.00 43.59  ? 415  ALA A CB  1 
ATOM   3143 N N   . GLY A 1 416 ? 20.151  -1.212  5.714   1.00 46.33  ? 416  GLY A N   1 
ATOM   3144 C CA  . GLY A 1 416 ? 20.143  -2.375  4.817   1.00 48.16  ? 416  GLY A CA  1 
ATOM   3145 C C   . GLY A 1 416 ? 20.968  -3.581  5.276   1.00 49.57  ? 416  GLY A C   1 
ATOM   3146 O O   . GLY A 1 416 ? 20.413  -4.627  5.620   1.00 49.97  ? 416  GLY A O   1 
ATOM   3147 N N   . ARG A 1 417 ? 22.290  -3.451  5.297   1.00 50.60  ? 417  ARG A N   1 
ATOM   3148 C CA  . ARG A 1 417 ? 23.141  -4.581  5.667   1.00 51.92  ? 417  ARG A CA  1 
ATOM   3149 C C   . ARG A 1 417 ? 22.817  -5.157  7.048   1.00 52.01  ? 417  ARG A C   1 
ATOM   3150 O O   . ARG A 1 417 ? 22.693  -6.372  7.202   1.00 52.19  ? 417  ARG A O   1 
ATOM   3151 C CB  . ARG A 1 417 ? 24.629  -4.221  5.553   1.00 52.37  ? 417  ARG A CB  1 
ATOM   3152 C CG  . ARG A 1 417 ? 25.083  -3.742  4.149   1.00 55.77  ? 417  ARG A CG  1 
ATOM   3153 C CD  . ARG A 1 417 ? 24.461  -4.545  2.980   1.00 62.08  ? 417  ARG A CD  1 
ATOM   3154 N NE  . ARG A 1 417 ? 24.774  -5.972  3.065   1.00 66.99  ? 417  ARG A NE  1 
ATOM   3155 C CZ  . ARG A 1 417 ? 25.651  -6.603  2.285   1.00 69.92  ? 417  ARG A CZ  1 
ATOM   3156 N NH1 . ARG A 1 417 ? 26.299  -5.934  1.320   1.00 70.13  ? 417  ARG A NH1 1 
ATOM   3157 N NH2 . ARG A 1 417 ? 25.871  -7.909  2.466   1.00 70.48  ? 417  ARG A NH2 1 
ATOM   3158 N N   . LEU A 1 418 ? 22.662  -4.286  8.045   1.00 52.18  ? 418  LEU A N   1 
ATOM   3159 C CA  . LEU A 1 418 ? 22.369  -4.739  9.403   1.00 52.05  ? 418  LEU A CA  1 
ATOM   3160 C C   . LEU A 1 418 ? 21.070  -5.529  9.488   1.00 52.51  ? 418  LEU A C   1 
ATOM   3161 O O   . LEU A 1 418 ? 21.049  -6.610  10.052  1.00 52.71  ? 418  LEU A O   1 
ATOM   3162 C CB  . LEU A 1 418 ? 22.346  -3.579  10.398  1.00 51.54  ? 418  LEU A CB  1 
ATOM   3163 C CG  . LEU A 1 418 ? 23.622  -2.772  10.598  1.00 50.09  ? 418  LEU A CG  1 
ATOM   3164 C CD1 . LEU A 1 418 ? 23.527  -2.010  11.906  1.00 48.11  ? 418  LEU A CD1 1 
ATOM   3165 C CD2 . LEU A 1 418 ? 24.847  -3.645  10.576  1.00 48.12  ? 418  LEU A CD2 1 
ATOM   3166 N N   . ALA A 1 419 ? 19.992  -4.996  8.928   1.00 53.07  ? 419  ALA A N   1 
ATOM   3167 C CA  . ALA A 1 419 ? 18.716  -5.687  8.956   1.00 53.70  ? 419  ALA A CA  1 
ATOM   3168 C C   . ALA A 1 419 ? 18.889  -7.086  8.356   1.00 54.45  ? 419  ALA A C   1 
ATOM   3169 O O   . ALA A 1 419 ? 18.627  -8.110  9.010   1.00 54.57  ? 419  ALA A O   1 
ATOM   3170 C CB  . ALA A 1 419 ? 17.677  -4.895  8.195   1.00 53.45  ? 419  ALA A CB  1 
ATOM   3171 N N   . ALA A 1 420 ? 19.381  -7.108  7.122   1.00 55.11  ? 420  ALA A N   1 
ATOM   3172 C CA  . ALA A 1 420 ? 19.621  -8.335  6.379   1.00 55.59  ? 420  ALA A CA  1 
ATOM   3173 C C   . ALA A 1 420 ? 20.525  -9.309  7.120   1.00 56.02  ? 420  ALA A C   1 
ATOM   3174 O O   . ALA A 1 420 ? 20.450  -10.509 6.891   1.00 56.53  ? 420  ALA A O   1 
ATOM   3175 C CB  . ALA A 1 420 ? 20.212  -8.010  5.015   1.00 55.32  ? 420  ALA A CB  1 
ATOM   3176 N N   . GLN A 1 421 ? 21.380  -8.802  8.000   1.00 56.53  ? 421  GLN A N   1 
ATOM   3177 C CA  . GLN A 1 421 ? 22.357  -9.669  8.664   1.00 56.96  ? 421  GLN A CA  1 
ATOM   3178 C C   . GLN A 1 421 ? 22.064  -9.925  10.158  1.00 56.75  ? 421  GLN A C   1 
ATOM   3179 O O   . GLN A 1 421 ? 22.985  -10.075 10.987  1.00 56.52  ? 421  GLN A O   1 
ATOM   3180 C CB  . GLN A 1 421 ? 23.781  -9.198  8.365   1.00 57.07  ? 421  GLN A CB  1 
ATOM   3181 C CG  . GLN A 1 421 ? 24.044  -9.261  6.855   1.00 59.15  ? 421  GLN A CG  1 
ATOM   3182 C CD  . GLN A 1 421 ? 25.513  -9.129  6.469   1.00 62.36  ? 421  GLN A CD  1 
ATOM   3183 O OE1 . GLN A 1 421 ? 25.838  -8.646  5.364   1.00 62.28  ? 421  GLN A OE1 1 
ATOM   3184 N NE2 . GLN A 1 421 ? 26.413  -9.565  7.368   1.00 62.12  ? 421  GLN A NE2 1 
ATOM   3185 N N   . GLY A 1 422 ? 20.760  -9.974  10.466  1.00 56.28  ? 422  GLY A N   1 
ATOM   3186 C CA  . GLY A 1 422 ? 20.251  -10.425 11.757  1.00 55.74  ? 422  GLY A CA  1 
ATOM   3187 C C   . GLY A 1 422 ? 19.830  -9.392  12.787  1.00 55.51  ? 422  GLY A C   1 
ATOM   3188 O O   . GLY A 1 422 ? 19.379  -9.755  13.875  1.00 55.86  ? 422  GLY A O   1 
ATOM   3189 N N   . ALA A 1 423 ? 19.971  -8.110  12.476  1.00 55.08  ? 423  ALA A N   1 
ATOM   3190 C CA  . ALA A 1 423 ? 19.690  -7.073  13.470  1.00 54.58  ? 423  ALA A CA  1 
ATOM   3191 C C   . ALA A 1 423 ? 18.243  -6.641  13.449  1.00 54.10  ? 423  ALA A C   1 
ATOM   3192 O O   . ALA A 1 423 ? 17.580  -6.718  12.417  1.00 54.03  ? 423  ALA A O   1 
ATOM   3193 C CB  . ALA A 1 423 ? 20.597  -5.869  13.261  1.00 54.81  ? 423  ALA A CB  1 
ATOM   3194 N N   . ARG A 1 424 ? 17.757  -6.194  14.600  1.00 53.72  ? 424  ARG A N   1 
ATOM   3195 C CA  . ARG A 1 424 ? 16.494  -5.478  14.647  1.00 53.59  ? 424  ARG A CA  1 
ATOM   3196 C C   . ARG A 1 424 ? 16.838  -4.011  14.460  1.00 52.78  ? 424  ARG A C   1 
ATOM   3197 O O   . ARG A 1 424 ? 17.491  -3.411  15.318  1.00 52.63  ? 424  ARG A O   1 
ATOM   3198 C CB  . ARG A 1 424 ? 15.732  -5.717  15.963  1.00 53.95  ? 424  ARG A CB  1 
ATOM   3199 C CG  . ARG A 1 424 ? 14.308  -5.138  15.964  1.00 56.20  ? 424  ARG A CG  1 
ATOM   3200 C CD  . ARG A 1 424 ? 13.274  -6.062  16.640  1.00 61.19  ? 424  ARG A CD  1 
ATOM   3201 N NE  . ARG A 1 424 ? 12.967  -5.711  18.038  1.00 64.12  ? 424  ARG A NE  1 
ATOM   3202 C CZ  . ARG A 1 424 ? 13.450  -6.341  19.118  1.00 65.50  ? 424  ARG A CZ  1 
ATOM   3203 N NH1 . ARG A 1 424 ? 14.294  -7.371  18.998  1.00 65.37  ? 424  ARG A NH1 1 
ATOM   3204 N NH2 . ARG A 1 424 ? 13.089  -5.936  20.335  1.00 65.53  ? 424  ARG A NH2 1 
ATOM   3205 N N   . VAL A 1 425 ? 16.428  -3.456  13.318  1.00 51.73  ? 425  VAL A N   1 
ATOM   3206 C CA  . VAL A 1 425 ? 16.699  -2.061  12.998  1.00 50.62  ? 425  VAL A CA  1 
ATOM   3207 C C   . VAL A 1 425 ? 15.402  -1.264  12.979  1.00 49.79  ? 425  VAL A C   1 
ATOM   3208 O O   . VAL A 1 425 ? 14.413  -1.713  12.413  1.00 49.30  ? 425  VAL A O   1 
ATOM   3209 C CB  . VAL A 1 425 ? 17.434  -1.920  11.632  1.00 50.90  ? 425  VAL A CB  1 
ATOM   3210 C CG1 . VAL A 1 425 ? 17.539  -0.443  11.204  1.00 50.50  ? 425  VAL A CG1 1 
ATOM   3211 C CG2 . VAL A 1 425 ? 18.829  -2.584  11.675  1.00 50.59  ? 425  VAL A CG2 1 
ATOM   3212 N N   . TYR A 1 426 ? 15.422  -0.094  13.614  1.00 49.02  ? 426  TYR A N   1 
ATOM   3213 C CA  . TYR A 1 426 ? 14.327  0.866   13.538  1.00 48.59  ? 426  TYR A CA  1 
ATOM   3214 C C   . TYR A 1 426 ? 14.833  2.153   12.918  1.00 48.04  ? 426  TYR A C   1 
ATOM   3215 O O   . TYR A 1 426 ? 15.804  2.716   13.393  1.00 48.69  ? 426  TYR A O   1 
ATOM   3216 C CB  . TYR A 1 426 ? 13.777  1.167   14.923  1.00 48.76  ? 426  TYR A CB  1 
ATOM   3217 C CG  . TYR A 1 426 ? 13.020  0.025   15.555  1.00 49.33  ? 426  TYR A CG  1 
ATOM   3218 C CD1 . TYR A 1 426 ? 13.694  -0.970  16.264  1.00 49.28  ? 426  TYR A CD1 1 
ATOM   3219 C CD2 . TYR A 1 426 ? 11.631  -0.053  15.463  1.00 49.17  ? 426  TYR A CD2 1 
ATOM   3220 C CE1 . TYR A 1 426 ? 13.018  -2.020  16.863  1.00 50.03  ? 426  TYR A CE1 1 
ATOM   3221 C CE2 . TYR A 1 426 ? 10.934  -1.110  16.054  1.00 50.75  ? 426  TYR A CE2 1 
ATOM   3222 C CZ  . TYR A 1 426 ? 11.636  -2.095  16.759  1.00 50.80  ? 426  TYR A CZ  1 
ATOM   3223 O OH  . TYR A 1 426 ? 10.968  -3.157  17.357  1.00 50.48  ? 426  TYR A OH  1 
ATOM   3224 N N   . ALA A 1 427 ? 14.177  2.628   11.868  1.00 47.20  ? 427  ALA A N   1 
ATOM   3225 C CA  . ALA A 1 427 ? 14.668  3.781   11.130  1.00 46.30  ? 427  ALA A CA  1 
ATOM   3226 C C   . ALA A 1 427 ? 13.683  4.933   11.182  1.00 45.99  ? 427  ALA A C   1 
ATOM   3227 O O   . ALA A 1 427 ? 12.477  4.707   11.117  1.00 46.35  ? 427  ALA A O   1 
ATOM   3228 C CB  . ALA A 1 427 ? 14.950  3.395   9.703   1.00 46.09  ? 427  ALA A CB  1 
ATOM   3229 N N   . TYR A 1 428 ? 14.195  6.161   11.301  1.00 45.45  ? 428  TYR A N   1 
ATOM   3230 C CA  . TYR A 1 428 ? 13.355  7.372   11.303  1.00 44.90  ? 428  TYR A CA  1 
ATOM   3231 C C   . TYR A 1 428 ? 13.890  8.461   10.367  1.00 45.17  ? 428  TYR A C   1 
ATOM   3232 O O   . TYR A 1 428 ? 15.024  8.401   9.902   1.00 45.21  ? 428  TYR A O   1 
ATOM   3233 C CB  . TYR A 1 428 ? 13.230  7.941   12.713  1.00 44.13  ? 428  TYR A CB  1 
ATOM   3234 C CG  . TYR A 1 428 ? 14.527  8.478   13.237  1.00 43.71  ? 428  TYR A CG  1 
ATOM   3235 C CD1 . TYR A 1 428 ? 14.928  9.771   12.943  1.00 44.60  ? 428  TYR A CD1 1 
ATOM   3236 C CD2 . TYR A 1 428 ? 15.367  7.695   14.014  1.00 43.43  ? 428  TYR A CD2 1 
ATOM   3237 C CE1 . TYR A 1 428 ? 16.132  10.273  13.417  1.00 45.21  ? 428  TYR A CE1 1 
ATOM   3238 C CE2 . TYR A 1 428 ? 16.578  8.190   14.498  1.00 43.86  ? 428  TYR A CE2 1 
ATOM   3239 C CZ  . TYR A 1 428 ? 16.956  9.479   14.192  1.00 43.88  ? 428  TYR A CZ  1 
ATOM   3240 O OH  . TYR A 1 428 ? 18.145  9.994   14.645  1.00 42.85  ? 428  TYR A OH  1 
ATOM   3241 N N   . ILE A 1 429 ? 13.062  9.457   10.087  1.00 45.37  ? 429  ILE A N   1 
ATOM   3242 C CA  . ILE A 1 429 ? 13.547  10.693  9.479   1.00 45.60  ? 429  ILE A CA  1 
ATOM   3243 C C   . ILE A 1 429 ? 12.924  11.854  10.242  1.00 45.26  ? 429  ILE A C   1 
ATOM   3244 O O   . ILE A 1 429 ? 11.713  11.893  10.443  1.00 45.31  ? 429  ILE A O   1 
ATOM   3245 C CB  . ILE A 1 429 ? 13.249  10.781  7.970   1.00 45.81  ? 429  ILE A CB  1 
ATOM   3246 C CG1 . ILE A 1 429 ? 13.718  12.125  7.425   1.00 46.11  ? 429  ILE A CG1 1 
ATOM   3247 C CG2 . ILE A 1 429 ? 11.752  10.579  7.691   1.00 46.47  ? 429  ILE A CG2 1 
ATOM   3248 C CD1 . ILE A 1 429 ? 13.223  12.434  6.028   1.00 47.13  ? 429  ILE A CD1 1 
ATOM   3249 N N   . PHE A 1 430 ? 13.757  12.777  10.695  1.00 44.89  ? 430  PHE A N   1 
ATOM   3250 C CA  . PHE A 1 430 ? 13.299  13.841  11.582  1.00 44.64  ? 430  PHE A CA  1 
ATOM   3251 C C   . PHE A 1 430 ? 12.866  15.027  10.730  1.00 44.81  ? 430  PHE A C   1 
ATOM   3252 O O   . PHE A 1 430 ? 13.639  15.512  9.893   1.00 44.71  ? 430  PHE A O   1 
ATOM   3253 C CB  . PHE A 1 430 ? 14.446  14.213  12.514  1.00 44.42  ? 430  PHE A CB  1 
ATOM   3254 C CG  . PHE A 1 430 ? 14.073  15.146  13.614  1.00 43.16  ? 430  PHE A CG  1 
ATOM   3255 C CD1 . PHE A 1 430 ? 14.226  16.517  13.456  1.00 41.69  ? 430  PHE A CD1 1 
ATOM   3256 C CD2 . PHE A 1 430 ? 13.613  14.653  14.827  1.00 42.41  ? 430  PHE A CD2 1 
ATOM   3257 C CE1 . PHE A 1 430 ? 13.891  17.390  14.480  1.00 41.76  ? 430  PHE A CE1 1 
ATOM   3258 C CE2 . PHE A 1 430 ? 13.294  15.515  15.861  1.00 43.03  ? 430  PHE A CE2 1 
ATOM   3259 C CZ  . PHE A 1 430 ? 13.427  16.893  15.689  1.00 42.58  ? 430  PHE A CZ  1 
ATOM   3260 N N   . GLU A 1 431 ? 11.630  15.484  10.904  1.00 44.88  ? 431  GLU A N   1 
ATOM   3261 C CA  . GLU A 1 431 ? 11.100  16.470  9.959   1.00 45.33  ? 431  GLU A CA  1 
ATOM   3262 C C   . GLU A 1 431 ? 10.732  17.814  10.552  1.00 45.44  ? 431  GLU A C   1 
ATOM   3263 O O   . GLU A 1 431 ? 10.271  18.703  9.846   1.00 45.71  ? 431  GLU A O   1 
ATOM   3264 C CB  . GLU A 1 431 ? 9.937   15.893  9.165   1.00 45.23  ? 431  GLU A CB  1 
ATOM   3265 C CG  . GLU A 1 431 ? 10.392  15.064  7.982   1.00 47.39  ? 431  GLU A CG  1 
ATOM   3266 C CD  . GLU A 1 431 ? 9.273   14.245  7.341   1.00 50.10  ? 431  GLU A CD  1 
ATOM   3267 O OE1 . GLU A 1 431 ? 8.171   14.142  7.940   1.00 50.48  ? 431  GLU A OE1 1 
ATOM   3268 O OE2 . GLU A 1 431 ? 9.509   13.702  6.229   1.00 50.66  ? 431  GLU A OE2 1 
ATOM   3269 N N   . HIS A 1 432 ? 10.969  17.991  11.839  1.00 45.67  ? 432  HIS A N   1 
ATOM   3270 C CA  . HIS A 1 432 ? 10.538  19.216  12.480  1.00 45.76  ? 432  HIS A CA  1 
ATOM   3271 C C   . HIS A 1 432 ? 11.613  20.277  12.688  1.00 45.77  ? 432  HIS A C   1 
ATOM   3272 O O   . HIS A 1 432 ? 12.598  20.059  13.394  1.00 45.85  ? 432  HIS A O   1 
ATOM   3273 C CB  . HIS A 1 432 ? 9.883   18.904  13.806  1.00 45.81  ? 432  HIS A CB  1 
ATOM   3274 C CG  . HIS A 1 432 ? 9.393   20.119  14.503  1.00 45.55  ? 432  HIS A CG  1 
ATOM   3275 N ND1 . HIS A 1 432 ? 8.361   20.882  14.010  1.00 46.44  ? 432  HIS A ND1 1 
ATOM   3276 C CD2 . HIS A 1 432 ? 9.812   20.727  15.633  1.00 45.98  ? 432  HIS A CD2 1 
ATOM   3277 C CE1 . HIS A 1 432 ? 8.144   21.896  14.827  1.00 47.26  ? 432  HIS A CE1 1 
ATOM   3278 N NE2 . HIS A 1 432 ? 9.013   21.825  15.819  1.00 47.25  ? 432  HIS A NE2 1 
ATOM   3279 N N   . ARG A 1 433 ? 11.388  21.441  12.097  1.00 45.70  ? 433  ARG A N   1 
ATOM   3280 C CA  . ARG A 1 433 ? 12.280  22.576  12.280  1.00 45.74  ? 433  ARG A CA  1 
ATOM   3281 C C   . ARG A 1 433 ? 11.934  23.288  13.586  1.00 45.68  ? 433  ARG A C   1 
ATOM   3282 O O   . ARG A 1 433 ? 10.762  23.476  13.903  1.00 45.70  ? 433  ARG A O   1 
ATOM   3283 C CB  . ARG A 1 433 ? 12.196  23.512  11.067  1.00 45.64  ? 433  ARG A CB  1 
ATOM   3284 C CG  . ARG A 1 433 ? 12.453  24.970  11.362  1.00 47.10  ? 433  ARG A CG  1 
ATOM   3285 C CD  . ARG A 1 433 ? 12.292  25.831  10.135  1.00 48.58  ? 433  ARG A CD  1 
ATOM   3286 N NE  . ARG A 1 433 ? 13.571  26.219  9.535   1.00 49.52  ? 433  ARG A NE  1 
ATOM   3287 C CZ  . ARG A 1 433 ? 14.285  27.271  9.929   1.00 49.61  ? 433  ARG A CZ  1 
ATOM   3288 N NH1 . ARG A 1 433 ? 13.857  28.012  10.951  1.00 49.47  ? 433  ARG A NH1 1 
ATOM   3289 N NH2 . ARG A 1 433 ? 15.432  27.566  9.320   1.00 48.42  ? 433  ARG A NH2 1 
ATOM   3290 N N   . ALA A 1 434 ? 12.953  23.667  14.357  1.00 45.72  ? 434  ALA A N   1 
ATOM   3291 C CA  . ALA A 1 434 ? 12.715  24.352  15.628  1.00 45.44  ? 434  ALA A CA  1 
ATOM   3292 C C   . ALA A 1 434 ? 12.085  25.717  15.390  1.00 45.36  ? 434  ALA A C   1 
ATOM   3293 O O   . ALA A 1 434 ? 12.532  26.480  14.536  1.00 45.20  ? 434  ALA A O   1 
ATOM   3294 C CB  . ALA A 1 434 ? 14.002  24.476  16.436  1.00 45.29  ? 434  ALA A CB  1 
ATOM   3295 N N   . SER A 1 435 ? 11.019  26.003  16.131  1.00 45.59  ? 435  SER A N   1 
ATOM   3296 C CA  . SER A 1 435 ? 10.435  27.333  16.147  1.00 45.45  ? 435  SER A CA  1 
ATOM   3297 C C   . SER A 1 435 ? 11.525  28.335  16.503  1.00 45.91  ? 435  SER A C   1 
ATOM   3298 O O   . SER A 1 435 ? 11.482  29.485  16.078  1.00 46.11  ? 435  SER A O   1 
ATOM   3299 C CB  . SER A 1 435 ? 9.283   27.406  17.152  1.00 45.15  ? 435  SER A CB  1 
ATOM   3300 O OG  . SER A 1 435 ? 9.753   27.485  18.488  1.00 44.12  ? 435  SER A OG  1 
ATOM   3301 N N   . THR A 1 436 ? 12.513  27.873  17.266  1.00 46.52  ? 436  THR A N   1 
ATOM   3302 C CA  . THR A 1 436 ? 13.615  28.717  17.734  1.00 47.30  ? 436  THR A CA  1 
ATOM   3303 C C   . THR A 1 436 ? 14.850  28.701  16.839  1.00 47.56  ? 436  THR A C   1 
ATOM   3304 O O   . THR A 1 436 ? 15.837  29.341  17.170  1.00 48.19  ? 436  THR A O   1 
ATOM   3305 C CB  . THR A 1 436 ? 14.123  28.275  19.125  1.00 47.22  ? 436  THR A CB  1 
ATOM   3306 O OG1 . THR A 1 436 ? 14.657  26.948  19.040  1.00 47.34  ? 436  THR A OG1 1 
ATOM   3307 C CG2 . THR A 1 436 ? 13.008  28.303  20.139  1.00 48.10  ? 436  THR A CG2 1 
ATOM   3308 N N   . LEU A 1 437 ? 14.828  27.952  15.742  1.00 47.57  ? 437  LEU A N   1 
ATOM   3309 C CA  . LEU A 1 437 ? 16.030  27.781  14.939  1.00 47.63  ? 437  LEU A CA  1 
ATOM   3310 C C   . LEU A 1 437 ? 16.542  29.135  14.443  1.00 47.93  ? 437  LEU A C   1 
ATOM   3311 O O   . LEU A 1 437 ? 15.766  29.982  13.999  1.00 48.32  ? 437  LEU A O   1 
ATOM   3312 C CB  . LEU A 1 437 ? 15.770  26.835  13.764  1.00 47.49  ? 437  LEU A CB  1 
ATOM   3313 C CG  . LEU A 1 437 ? 17.002  26.226  13.093  1.00 47.54  ? 437  LEU A CG  1 
ATOM   3314 C CD1 . LEU A 1 437 ? 17.658  25.252  14.026  1.00 46.20  ? 437  LEU A CD1 1 
ATOM   3315 C CD2 . LEU A 1 437 ? 16.641  25.524  11.802  1.00 47.59  ? 437  LEU A CD2 1 
ATOM   3316 N N   . THR A 1 438 ? 17.846  29.355  14.534  1.00 47.83  ? 438  THR A N   1 
ATOM   3317 C CA  . THR A 1 438 ? 18.379  30.644  14.130  1.00 47.56  ? 438  THR A CA  1 
ATOM   3318 C C   . THR A 1 438 ? 19.004  30.609  12.732  1.00 47.56  ? 438  THR A C   1 
ATOM   3319 O O   . THR A 1 438 ? 19.572  31.601  12.289  1.00 47.95  ? 438  THR A O   1 
ATOM   3320 C CB  . THR A 1 438 ? 19.388  31.188  15.153  1.00 47.33  ? 438  THR A CB  1 
ATOM   3321 O OG1 . THR A 1 438 ? 20.585  30.417  15.087  1.00 48.13  ? 438  THR A OG1 1 
ATOM   3322 C CG2 . THR A 1 438 ? 18.835  31.097  16.561  1.00 47.09  ? 438  THR A CG2 1 
ATOM   3323 N N   . TRP A 1 439 ? 18.917  29.480  12.037  1.00 47.39  ? 439  TRP A N   1 
ATOM   3324 C CA  . TRP A 1 439 ? 19.403  29.435  10.660  1.00 47.23  ? 439  TRP A CA  1 
ATOM   3325 C C   . TRP A 1 439 ? 18.274  29.841  9.715   1.00 47.61  ? 439  TRP A C   1 
ATOM   3326 O O   . TRP A 1 439 ? 17.094  29.754  10.074  1.00 47.88  ? 439  TRP A O   1 
ATOM   3327 C CB  . TRP A 1 439 ? 19.930  28.053  10.292  1.00 46.73  ? 439  TRP A CB  1 
ATOM   3328 C CG  . TRP A 1 439 ? 21.130  27.640  11.067  1.00 46.62  ? 439  TRP A CG  1 
ATOM   3329 C CD1 . TRP A 1 439 ? 21.146  26.895  12.207  1.00 46.42  ? 439  TRP A CD1 1 
ATOM   3330 C CD2 . TRP A 1 439 ? 22.496  27.932  10.763  1.00 46.12  ? 439  TRP A CD2 1 
ATOM   3331 N NE1 . TRP A 1 439 ? 22.435  26.704  12.633  1.00 46.01  ? 439  TRP A NE1 1 
ATOM   3332 C CE2 . TRP A 1 439 ? 23.284  27.334  11.765  1.00 45.83  ? 439  TRP A CE2 1 
ATOM   3333 C CE3 . TRP A 1 439 ? 23.132  28.638  9.741   1.00 46.10  ? 439  TRP A CE3 1 
ATOM   3334 C CZ2 . TRP A 1 439 ? 24.673  27.423  11.776  1.00 45.94  ? 439  TRP A CZ2 1 
ATOM   3335 C CZ3 . TRP A 1 439 ? 24.514  28.724  9.753   1.00 45.89  ? 439  TRP A CZ3 1 
ATOM   3336 C CH2 . TRP A 1 439 ? 25.267  28.122  10.763  1.00 46.03  ? 439  TRP A CH2 1 
ATOM   3337 N N   . PRO A 1 440 ? 18.625  30.295  8.504   1.00 47.74  ? 440  PRO A N   1 
ATOM   3338 C CA  . PRO A 1 440 ? 17.604  30.747  7.582   1.00 48.00  ? 440  PRO A CA  1 
ATOM   3339 C C   . PRO A 1 440 ? 16.636  29.640  7.184   1.00 48.39  ? 440  PRO A C   1 
ATOM   3340 O O   . PRO A 1 440 ? 16.962  28.451  7.278   1.00 48.76  ? 440  PRO A O   1 
ATOM   3341 C CB  . PRO A 1 440 ? 18.413  31.208  6.366   1.00 47.95  ? 440  PRO A CB  1 
ATOM   3342 C CG  . PRO A 1 440 ? 19.704  30.503  6.475   1.00 47.76  ? 440  PRO A CG  1 
ATOM   3343 C CD  . PRO A 1 440 ? 19.973  30.432  7.929   1.00 48.05  ? 440  PRO A CD  1 
ATOM   3344 N N   . LEU A 1 441 ? 15.452  30.048  6.741   1.00 48.39  ? 441  LEU A N   1 
ATOM   3345 C CA  . LEU A 1 441 ? 14.453  29.129  6.242   1.00 48.17  ? 441  LEU A CA  1 
ATOM   3346 C C   . LEU A 1 441 ? 14.954  28.158  5.193   1.00 47.66  ? 441  LEU A C   1 
ATOM   3347 O O   . LEU A 1 441 ? 14.500  27.017  5.160   1.00 48.09  ? 441  LEU A O   1 
ATOM   3348 C CB  . LEU A 1 441 ? 13.288  29.911  5.671   1.00 48.55  ? 441  LEU A CB  1 
ATOM   3349 C CG  . LEU A 1 441 ? 12.336  30.281  6.797   1.00 50.54  ? 441  LEU A CG  1 
ATOM   3350 C CD1 . LEU A 1 441 ? 11.707  31.679  6.544   1.00 51.18  ? 441  LEU A CD1 1 
ATOM   3351 C CD2 . LEU A 1 441 ? 11.298  29.128  7.030   1.00 51.12  ? 441  LEU A CD2 1 
ATOM   3352 N N   . TRP A 1 442 ? 15.872  28.593  4.333   1.00 46.97  ? 442  TRP A N   1 
ATOM   3353 C CA  . TRP A 1 442 ? 16.275  27.752  3.212   1.00 46.46  ? 442  TRP A CA  1 
ATOM   3354 C C   . TRP A 1 442 ? 17.044  26.507  3.659   1.00 46.56  ? 442  TRP A C   1 
ATOM   3355 O O   . TRP A 1 442 ? 17.194  25.542  2.900   1.00 46.92  ? 442  TRP A O   1 
ATOM   3356 C CB  . TRP A 1 442 ? 17.048  28.538  2.152   1.00 45.87  ? 442  TRP A CB  1 
ATOM   3357 C CG  . TRP A 1 442 ? 18.458  28.899  2.512   1.00 46.05  ? 442  TRP A CG  1 
ATOM   3358 C CD1 . TRP A 1 442 ? 18.894  30.109  2.966   1.00 46.22  ? 442  TRP A CD1 1 
ATOM   3359 C CD2 . TRP A 1 442 ? 19.628  28.063  2.420   1.00 45.46  ? 442  TRP A CD2 1 
ATOM   3360 N NE1 . TRP A 1 442 ? 20.258  30.080  3.169   1.00 45.34  ? 442  TRP A NE1 1 
ATOM   3361 C CE2 . TRP A 1 442 ? 20.730  28.835  2.851   1.00 45.05  ? 442  TRP A CE2 1 
ATOM   3362 C CE3 . TRP A 1 442 ? 19.849  26.737  2.027   1.00 45.91  ? 442  TRP A CE3 1 
ATOM   3363 C CZ2 . TRP A 1 442 ? 22.032  28.330  2.897   1.00 45.12  ? 442  TRP A CZ2 1 
ATOM   3364 C CZ3 . TRP A 1 442 ? 21.156  26.231  2.082   1.00 45.72  ? 442  TRP A CZ3 1 
ATOM   3365 C CH2 . TRP A 1 442 ? 22.224  27.032  2.507   1.00 45.44  ? 442  TRP A CH2 1 
ATOM   3366 N N   . MET A 1 443 ? 17.532  26.522  4.889   1.00 46.04  ? 443  MET A N   1 
ATOM   3367 C CA  . MET A 1 443 ? 18.310  25.408  5.349   1.00 46.00  ? 443  MET A CA  1 
ATOM   3368 C C   . MET A 1 443 ? 17.469  24.257  5.866   1.00 45.80  ? 443  MET A C   1 
ATOM   3369 O O   . MET A 1 443 ? 17.991  23.162  6.104   1.00 45.87  ? 443  MET A O   1 
ATOM   3370 C CB  . MET A 1 443 ? 19.295  25.872  6.388   1.00 46.02  ? 443  MET A CB  1 
ATOM   3371 C CG  . MET A 1 443 ? 20.590  26.268  5.791   1.00 46.24  ? 443  MET A CG  1 
ATOM   3372 S SD  . MET A 1 443 ? 21.493  27.213  6.990   1.00 47.11  ? 443  MET A SD  1 
ATOM   3373 C CE  . MET A 1 443 ? 23.115  26.487  6.806   1.00 46.54  ? 443  MET A CE  1 
ATOM   3374 N N   . GLY A 1 444 ? 16.172  24.501  6.030   1.00 45.54  ? 444  GLY A N   1 
ATOM   3375 C CA  . GLY A 1 444 ? 15.227  23.454  6.420   1.00 45.38  ? 444  GLY A CA  1 
ATOM   3376 C C   . GLY A 1 444 ? 15.458  22.943  7.828   1.00 45.12  ? 444  GLY A C   1 
ATOM   3377 O O   . GLY A 1 444 ? 15.691  23.739  8.746   1.00 45.57  ? 444  GLY A O   1 
ATOM   3378 N N   . VAL A 1 445 ? 15.373  21.621  7.994   1.00 44.48  ? 445  VAL A N   1 
ATOM   3379 C CA  . VAL A 1 445 ? 15.712  20.948  9.255   1.00 43.86  ? 445  VAL A CA  1 
ATOM   3380 C C   . VAL A 1 445 ? 17.164  20.456  9.139   1.00 43.62  ? 445  VAL A C   1 
ATOM   3381 O O   . VAL A 1 445 ? 17.409  19.375  8.586   1.00 43.69  ? 445  VAL A O   1 
ATOM   3382 C CB  . VAL A 1 445 ? 14.804  19.721  9.520   1.00 43.82  ? 445  VAL A CB  1 
ATOM   3383 C CG1 . VAL A 1 445 ? 14.869  19.326  10.969  1.00 43.53  ? 445  VAL A CG1 1 
ATOM   3384 C CG2 . VAL A 1 445 ? 13.378  19.980  9.106   1.00 43.61  ? 445  VAL A CG2 1 
ATOM   3385 N N   . PRO A 1 446 ? 18.132  21.252  9.623   1.00 43.07  ? 446  PRO A N   1 
ATOM   3386 C CA  . PRO A 1 446 ? 19.523  20.954  9.348   1.00 42.83  ? 446  PRO A CA  1 
ATOM   3387 C C   . PRO A 1 446 ? 20.151  19.935  10.288  1.00 42.71  ? 446  PRO A C   1 
ATOM   3388 O O   . PRO A 1 446 ? 19.718  19.768  11.419  1.00 42.39  ? 446  PRO A O   1 
ATOM   3389 C CB  . PRO A 1 446 ? 20.210  22.313  9.525   1.00 42.82  ? 446  PRO A CB  1 
ATOM   3390 C CG  . PRO A 1 446 ? 19.110  23.290  9.841   1.00 42.67  ? 446  PRO A CG  1 
ATOM   3391 C CD  . PRO A 1 446 ? 18.019  22.483  10.411  1.00 43.00  ? 446  PRO A CD  1 
ATOM   3392 N N   . HIS A 1 447 ? 21.173  19.265  9.775   1.00 42.85  ? 447  HIS A N   1 
ATOM   3393 C CA  . HIS A 1 447 ? 22.049  18.375  10.524  1.00 42.92  ? 447  HIS A CA  1 
ATOM   3394 C C   . HIS A 1 447 ? 22.334  18.903  11.936  1.00 42.61  ? 447  HIS A C   1 
ATOM   3395 O O   . HIS A 1 447 ? 22.851  20.011  12.096  1.00 42.72  ? 447  HIS A O   1 
ATOM   3396 C CB  . HIS A 1 447 ? 23.338  18.216  9.710   1.00 43.24  ? 447  HIS A CB  1 
ATOM   3397 C CG  . HIS A 1 447 ? 24.375  17.364  10.355  1.00 44.71  ? 447  HIS A CG  1 
ATOM   3398 N ND1 . HIS A 1 447 ? 24.370  15.990  10.259  1.00 46.46  ? 447  HIS A ND1 1 
ATOM   3399 C CD2 . HIS A 1 447 ? 25.466  17.691  11.090  1.00 46.77  ? 447  HIS A CD2 1 
ATOM   3400 C CE1 . HIS A 1 447 ? 25.407  15.504  10.923  1.00 47.91  ? 447  HIS A CE1 1 
ATOM   3401 N NE2 . HIS A 1 447 ? 26.089  16.515  11.436  1.00 47.91  ? 447  HIS A NE2 1 
ATOM   3402 N N   . GLY A 1 448 ? 21.958  18.112  12.949  1.00 42.44  ? 448  GLY A N   1 
ATOM   3403 C CA  . GLY A 1 448 ? 22.155  18.462  14.362  1.00 41.80  ? 448  GLY A CA  1 
ATOM   3404 C C   . GLY A 1 448 ? 20.939  18.964  15.131  1.00 41.63  ? 448  GLY A C   1 
ATOM   3405 O O   . GLY A 1 448 ? 20.941  19.007  16.370  1.00 41.67  ? 448  GLY A O   1 
ATOM   3406 N N   . TYR A 1 449 ? 19.880  19.333  14.424  1.00 41.22  ? 449  TYR A N   1 
ATOM   3407 C CA  . TYR A 1 449 ? 18.787  20.004  15.103  1.00 41.15  ? 449  TYR A CA  1 
ATOM   3408 C C   . TYR A 1 449 ? 17.634  19.104  15.568  1.00 41.71  ? 449  TYR A C   1 
ATOM   3409 O O   . TYR A 1 449 ? 16.529  19.590  15.884  1.00 42.10  ? 449  TYR A O   1 
ATOM   3410 C CB  . TYR A 1 449 ? 18.370  21.271  14.344  1.00 40.33  ? 449  TYR A CB  1 
ATOM   3411 C CG  . TYR A 1 449 ? 19.444  22.335  14.496  1.00 40.53  ? 449  TYR A CG  1 
ATOM   3412 C CD1 . TYR A 1 449 ? 20.553  22.379  13.645  1.00 39.82  ? 449  TYR A CD1 1 
ATOM   3413 C CD2 . TYR A 1 449 ? 19.397  23.256  15.543  1.00 40.79  ? 449  TYR A CD2 1 
ATOM   3414 C CE1 . TYR A 1 449 ? 21.552  23.336  13.816  1.00 38.32  ? 449  TYR A CE1 1 
ATOM   3415 C CE2 . TYR A 1 449 ? 20.403  24.219  15.715  1.00 38.79  ? 449  TYR A CE2 1 
ATOM   3416 C CZ  . TYR A 1 449 ? 21.467  24.252  14.850  1.00 38.56  ? 449  TYR A CZ  1 
ATOM   3417 O OH  . TYR A 1 449 ? 22.451  25.205  15.028  1.00 38.78  ? 449  TYR A OH  1 
ATOM   3418 N N   . GLU A 1 450 ? 17.916  17.799  15.653  1.00 41.60  ? 450  GLU A N   1 
ATOM   3419 C CA  . GLU A 1 450 ? 17.024  16.865  16.325  1.00 41.83  ? 450  GLU A CA  1 
ATOM   3420 C C   . GLU A 1 450 ? 17.408  16.751  17.796  1.00 41.92  ? 450  GLU A C   1 
ATOM   3421 O O   . GLU A 1 450 ? 16.557  16.433  18.636  1.00 42.15  ? 450  GLU A O   1 
ATOM   3422 C CB  . GLU A 1 450 ? 17.067  15.491  15.677  1.00 41.59  ? 450  GLU A CB  1 
ATOM   3423 C CG  . GLU A 1 450 ? 18.175  14.606  16.202  1.00 43.99  ? 450  GLU A CG  1 
ATOM   3424 C CD  . GLU A 1 450 ? 19.447  14.656  15.351  1.00 48.80  ? 450  GLU A CD  1 
ATOM   3425 O OE1 . GLU A 1 450 ? 19.934  15.767  15.000  1.00 49.48  ? 450  GLU A OE1 1 
ATOM   3426 O OE2 . GLU A 1 450 ? 19.960  13.554  15.019  1.00 50.88  ? 450  GLU A OE2 1 
ATOM   3427 N N   . ILE A 1 451 ? 18.683  17.037  18.097  1.00 41.74  ? 451  ILE A N   1 
ATOM   3428 C CA  . ILE A 1 451 ? 19.299  16.729  19.402  1.00 41.22  ? 451  ILE A CA  1 
ATOM   3429 C C   . ILE A 1 451 ? 18.605  17.419  20.568  1.00 41.00  ? 451  ILE A C   1 
ATOM   3430 O O   . ILE A 1 451 ? 18.323  16.792  21.590  1.00 40.82  ? 451  ILE A O   1 
ATOM   3431 C CB  . ILE A 1 451 ? 20.816  17.071  19.426  1.00 41.08  ? 451  ILE A CB  1 
ATOM   3432 C CG1 . ILE A 1 451 ? 21.544  16.407  18.260  1.00 40.88  ? 451  ILE A CG1 1 
ATOM   3433 C CG2 . ILE A 1 451 ? 21.448  16.642  20.739  1.00 39.91  ? 451  ILE A CG2 1 
ATOM   3434 C CD1 . ILE A 1 451 ? 22.984  16.893  18.082  1.00 41.67  ? 451  ILE A CD1 1 
ATOM   3435 N N   . GLU A 1 452 ? 18.342  18.710  20.407  1.00 41.07  ? 452  GLU A N   1 
ATOM   3436 C CA  . GLU A 1 452 ? 17.619  19.488  21.413  1.00 41.54  ? 452  GLU A CA  1 
ATOM   3437 C C   . GLU A 1 452 ? 16.221  18.925  21.735  1.00 41.38  ? 452  GLU A C   1 
ATOM   3438 O O   . GLU A 1 452 ? 15.694  19.169  22.823  1.00 41.41  ? 452  GLU A O   1 
ATOM   3439 C CB  . GLU A 1 452 ? 17.542  20.964  21.010  1.00 41.35  ? 452  GLU A CB  1 
ATOM   3440 C CG  . GLU A 1 452 ? 16.964  21.205  19.623  1.00 42.14  ? 452  GLU A CG  1 
ATOM   3441 C CD  . GLU A 1 452 ? 17.135  22.637  19.149  1.00 42.59  ? 452  GLU A CD  1 
ATOM   3442 O OE1 . GLU A 1 452 ? 16.097  23.303  18.910  1.00 42.61  ? 452  GLU A OE1 1 
ATOM   3443 O OE2 . GLU A 1 452 ? 18.304  23.096  19.015  1.00 45.00  ? 452  GLU A OE2 1 
ATOM   3444 N N   . PHE A 1 453 ? 15.646  18.150  20.815  1.00 41.12  ? 453  PHE A N   1 
ATOM   3445 C CA  . PHE A 1 453 ? 14.358  17.509  21.060  1.00 41.26  ? 453  PHE A CA  1 
ATOM   3446 C C   . PHE A 1 453 ? 14.454  16.179  21.814  1.00 41.29  ? 453  PHE A C   1 
ATOM   3447 O O   . PHE A 1 453 ? 13.753  16.000  22.810  1.00 41.29  ? 453  PHE A O   1 
ATOM   3448 C CB  . PHE A 1 453 ? 13.540  17.385  19.766  1.00 41.54  ? 453  PHE A CB  1 
ATOM   3449 C CG  . PHE A 1 453 ? 13.003  18.705  19.264  1.00 42.21  ? 453  PHE A CG  1 
ATOM   3450 C CD1 . PHE A 1 453 ? 11.780  19.190  19.713  1.00 42.35  ? 453  PHE A CD1 1 
ATOM   3451 C CD2 . PHE A 1 453 ? 13.734  19.476  18.358  1.00 42.63  ? 453  PHE A CD2 1 
ATOM   3452 C CE1 . PHE A 1 453 ? 11.303  20.417  19.266  1.00 42.34  ? 453  PHE A CE1 1 
ATOM   3453 C CE2 . PHE A 1 453 ? 13.253  20.701  17.904  1.00 41.25  ? 453  PHE A CE2 1 
ATOM   3454 C CZ  . PHE A 1 453 ? 12.043  21.169  18.359  1.00 41.47  ? 453  PHE A CZ  1 
ATOM   3455 N N   . ILE A 1 454 ? 15.303  15.258  21.340  1.00 41.25  ? 454  ILE A N   1 
ATOM   3456 C CA  . ILE A 1 454 ? 15.638  14.013  22.056  1.00 41.11  ? 454  ILE A CA  1 
ATOM   3457 C C   . ILE A 1 454 ? 15.997  14.276  23.523  1.00 41.62  ? 454  ILE A C   1 
ATOM   3458 O O   . ILE A 1 454 ? 15.561  13.546  24.417  1.00 41.30  ? 454  ILE A O   1 
ATOM   3459 C CB  . ILE A 1 454 ? 16.868  13.317  21.439  1.00 41.09  ? 454  ILE A CB  1 
ATOM   3460 C CG1 . ILE A 1 454 ? 16.713  13.091  19.934  1.00 41.14  ? 454  ILE A CG1 1 
ATOM   3461 C CG2 . ILE A 1 454 ? 17.201  12.031  22.172  1.00 40.91  ? 454  ILE A CG2 1 
ATOM   3462 C CD1 . ILE A 1 454 ? 15.504  12.337  19.542  1.00 42.45  ? 454  ILE A CD1 1 
ATOM   3463 N N   . PHE A 1 455 ? 16.808  15.310  23.761  1.00 42.16  ? 455  PHE A N   1 
ATOM   3464 C CA  . PHE A 1 455 ? 17.256  15.655  25.117  1.00 42.92  ? 455  PHE A CA  1 
ATOM   3465 C C   . PHE A 1 455 ? 16.192  16.392  25.951  1.00 44.08  ? 455  PHE A C   1 
ATOM   3466 O O   . PHE A 1 455 ? 16.374  16.644  27.156  1.00 43.84  ? 455  PHE A O   1 
ATOM   3467 C CB  . PHE A 1 455 ? 18.548  16.463  25.051  1.00 42.25  ? 455  PHE A CB  1 
ATOM   3468 C CG  . PHE A 1 455 ? 19.767  15.624  25.039  1.00 40.90  ? 455  PHE A CG  1 
ATOM   3469 C CD1 . PHE A 1 455 ? 20.257  15.107  23.850  1.00 40.33  ? 455  PHE A CD1 1 
ATOM   3470 C CD2 . PHE A 1 455 ? 20.431  15.338  26.216  1.00 39.92  ? 455  PHE A CD2 1 
ATOM   3471 C CE1 . PHE A 1 455 ? 21.402  14.304  23.834  1.00 39.43  ? 455  PHE A CE1 1 
ATOM   3472 C CE2 . PHE A 1 455 ? 21.575  14.541  26.209  1.00 39.13  ? 455  PHE A CE2 1 
ATOM   3473 C CZ  . PHE A 1 455 ? 22.053  14.020  25.015  1.00 39.43  ? 455  PHE A CZ  1 
ATOM   3474 N N   . GLY A 1 456 ? 15.089  16.738  25.290  1.00 45.26  ? 456  GLY A N   1 
ATOM   3475 C CA  . GLY A 1 456 ? 13.943  17.334  25.950  1.00 46.45  ? 456  GLY A CA  1 
ATOM   3476 C C   . GLY A 1 456 ? 14.120  18.792  26.301  1.00 47.43  ? 456  GLY A C   1 
ATOM   3477 O O   . GLY A 1 456 ? 13.450  19.281  27.199  1.00 47.62  ? 456  GLY A O   1 
ATOM   3478 N N   . LEU A 1 457 ? 14.993  19.509  25.597  1.00 48.37  ? 457  LEU A N   1 
ATOM   3479 C CA  . LEU A 1 457 ? 15.156  20.937  25.897  1.00 49.73  ? 457  LEU A CA  1 
ATOM   3480 C C   . LEU A 1 457 ? 13.855  21.762  25.888  1.00 50.75  ? 457  LEU A C   1 
ATOM   3481 O O   . LEU A 1 457 ? 13.673  22.603  26.762  1.00 50.87  ? 457  LEU A O   1 
ATOM   3482 C CB  . LEU A 1 457 ? 16.245  21.612  25.054  1.00 49.60  ? 457  LEU A CB  1 
ATOM   3483 C CG  . LEU A 1 457 ? 17.726  21.202  25.175  1.00 49.89  ? 457  LEU A CG  1 
ATOM   3484 C CD1 . LEU A 1 457 ? 18.625  22.438  25.188  1.00 48.07  ? 457  LEU A CD1 1 
ATOM   3485 C CD2 . LEU A 1 457 ? 18.026  20.327  26.388  1.00 49.64  ? 457  LEU A CD2 1 
ATOM   3486 N N   . PRO A 1 458 ? 12.935  21.518  24.931  1.00 51.92  ? 458  PRO A N   1 
ATOM   3487 C CA  . PRO A 1 458 ? 11.713  22.316  24.956  1.00 52.95  ? 458  PRO A CA  1 
ATOM   3488 C C   . PRO A 1 458 ? 10.902  22.258  26.256  1.00 53.99  ? 458  PRO A C   1 
ATOM   3489 O O   . PRO A 1 458 ? 9.992   23.065  26.425  1.00 54.32  ? 458  PRO A O   1 
ATOM   3490 C CB  . PRO A 1 458 ? 10.900  21.741  23.790  1.00 52.86  ? 458  PRO A CB  1 
ATOM   3491 C CG  . PRO A 1 458 ? 11.904  21.208  22.877  1.00 52.07  ? 458  PRO A CG  1 
ATOM   3492 C CD  . PRO A 1 458 ? 12.912  20.589  23.790  1.00 52.07  ? 458  PRO A CD  1 
ATOM   3493 N N   . LEU A 1 459 ? 11.225  21.346  27.169  1.00 55.04  ? 459  LEU A N   1 
ATOM   3494 C CA  . LEU A 1 459 ? 10.518  21.319  28.450  1.00 56.13  ? 459  LEU A CA  1 
ATOM   3495 C C   . LEU A 1 459 ? 10.866  22.502  29.359  1.00 57.24  ? 459  LEU A C   1 
ATOM   3496 O O   . LEU A 1 459 ? 10.077  22.849  30.230  1.00 57.48  ? 459  LEU A O   1 
ATOM   3497 C CB  . LEU A 1 459 ? 10.700  19.985  29.195  1.00 55.84  ? 459  LEU A CB  1 
ATOM   3498 C CG  . LEU A 1 459 ? 10.432  18.642  28.503  1.00 55.70  ? 459  LEU A CG  1 
ATOM   3499 C CD1 . LEU A 1 459 ? 10.476  17.534  29.500  1.00 56.09  ? 459  LEU A CD1 1 
ATOM   3500 C CD2 . LEU A 1 459 ? 9.116   18.588  27.799  1.00 56.45  ? 459  LEU A CD2 1 
ATOM   3501 N N   . ASP A 1 460 ? 12.029  23.125  29.167  1.00 58.69  ? 460  ASP A N   1 
ATOM   3502 C CA  . ASP A 1 460 ? 12.379  24.325  29.944  1.00 60.25  ? 460  ASP A CA  1 
ATOM   3503 C C   . ASP A 1 460 ? 11.540  25.524  29.467  1.00 61.18  ? 460  ASP A C   1 
ATOM   3504 O O   . ASP A 1 460 ? 11.718  26.002  28.341  1.00 61.16  ? 460  ASP A O   1 
ATOM   3505 C CB  . ASP A 1 460 ? 13.891  24.621  29.864  1.00 60.34  ? 460  ASP A CB  1 
ATOM   3506 C CG  . ASP A 1 460 ? 14.347  25.747  30.821  1.00 61.78  ? 460  ASP A CG  1 
ATOM   3507 O OD1 . ASP A 1 460 ? 13.552  26.664  31.151  1.00 63.78  ? 460  ASP A OD1 1 
ATOM   3508 O OD2 . ASP A 1 460 ? 15.530  25.726  31.237  1.00 62.03  ? 460  ASP A OD2 1 
ATOM   3509 N N   . PRO A 1 461 ? 10.628  26.019  30.331  1.00 62.41  ? 461  PRO A N   1 
ATOM   3510 C CA  . PRO A 1 461 ? 9.714   27.129  29.987  1.00 63.07  ? 461  PRO A CA  1 
ATOM   3511 C C   . PRO A 1 461 ? 10.459  28.373  29.512  1.00 63.53  ? 461  PRO A C   1 
ATOM   3512 O O   . PRO A 1 461 ? 9.936   29.131  28.687  1.00 63.77  ? 461  PRO A O   1 
ATOM   3513 C CB  . PRO A 1 461 ? 9.002   27.437  31.314  1.00 63.26  ? 461  PRO A CB  1 
ATOM   3514 C CG  . PRO A 1 461 ? 9.085   26.157  32.109  1.00 63.60  ? 461  PRO A CG  1 
ATOM   3515 C CD  . PRO A 1 461 ? 10.428  25.551  31.719  1.00 62.89  ? 461  PRO A CD  1 
ATOM   3516 N N   . SER A 1 462 ? 11.678  28.565  30.010  1.00 63.61  ? 462  SER A N   1 
ATOM   3517 C CA  . SER A 1 462 ? 12.455  29.745  29.664  1.00 63.90  ? 462  SER A CA  1 
ATOM   3518 C C   . SER A 1 462 ? 13.049  29.709  28.256  1.00 63.58  ? 462  SER A C   1 
ATOM   3519 O O   . SER A 1 462 ? 13.779  30.634  27.879  1.00 63.46  ? 462  SER A O   1 
ATOM   3520 C CB  . SER A 1 462 ? 13.579  29.959  30.678  1.00 64.22  ? 462  SER A CB  1 
ATOM   3521 O OG  . SER A 1 462 ? 14.693  29.137  30.368  1.00 65.74  ? 462  SER A OG  1 
ATOM   3522 N N   . LEU A 1 463 ? 12.755  28.659  27.484  1.00 63.31  ? 463  LEU A N   1 
ATOM   3523 C CA  . LEU A 1 463 ? 13.378  28.511  26.151  1.00 62.86  ? 463  LEU A CA  1 
ATOM   3524 C C   . LEU A 1 463 ? 12.523  28.894  24.924  1.00 62.51  ? 463  LEU A C   1 
ATOM   3525 O O   . LEU A 1 463 ? 12.990  28.771  23.785  1.00 62.40  ? 463  LEU A O   1 
ATOM   3526 C CB  . LEU A 1 463 ? 14.056  27.141  25.981  1.00 62.66  ? 463  LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 463 ? 15.351  26.890  26.767  1.00 62.27  ? 463  LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 463 ? 15.892  25.530  26.383  1.00 62.71  ? 463  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 463 ? 16.425  27.970  26.567  1.00 60.54  ? 463  LEU A CD2 1 
ATOM   3530 N N   . ASN A 1 464 ? 11.296  29.366  25.162  1.00 62.14  ? 464  ASN A N   1 
ATOM   3531 C CA  . ASN A 1 464 ? 10.415  29.892  24.096  1.00 61.76  ? 464  ASN A CA  1 
ATOM   3532 C C   . ASN A 1 464 ? 9.998   28.848  23.046  1.00 61.34  ? 464  ASN A C   1 
ATOM   3533 O O   . ASN A 1 464 ? 9.717   29.205  21.897  1.00 61.74  ? 464  ASN A O   1 
ATOM   3534 C CB  . ASN A 1 464 ? 11.031  31.122  23.369  1.00 61.67  ? 464  ASN A CB  1 
ATOM   3535 C CG  . ASN A 1 464 ? 11.393  32.276  24.312  1.00 61.97  ? 464  ASN A CG  1 
ATOM   3536 O OD1 . ASN A 1 464 ? 10.781  32.464  25.369  1.00 61.93  ? 464  ASN A OD1 1 
ATOM   3537 N ND2 . ASN A 1 464 ? 12.390  33.065  23.912  1.00 60.96  ? 464  ASN A ND2 1 
ATOM   3538 N N   . TYR A 1 465 ? 9.968   27.568  23.405  1.00 60.46  ? 465  TYR A N   1 
ATOM   3539 C CA  . TYR A 1 465 ? 9.462   26.580  22.459  1.00 59.70  ? 465  TYR A CA  1 
ATOM   3540 C C   . TYR A 1 465 ? 7.940   26.602  22.523  1.00 59.54  ? 465  TYR A C   1 
ATOM   3541 O O   . TYR A 1 465 ? 7.381   26.911  23.572  1.00 59.37  ? 465  TYR A O   1 
ATOM   3542 C CB  . TYR A 1 465 ? 9.994   25.180  22.773  1.00 59.34  ? 465  TYR A CB  1 
ATOM   3543 C CG  . TYR A 1 465 ? 11.448  24.948  22.423  1.00 58.63  ? 465  TYR A CG  1 
ATOM   3544 C CD1 . TYR A 1 465 ? 11.815  24.400  21.202  1.00 58.98  ? 465  TYR A CD1 1 
ATOM   3545 C CD2 . TYR A 1 465 ? 12.455  25.258  23.324  1.00 58.82  ? 465  TYR A CD2 1 
ATOM   3546 C CE1 . TYR A 1 465 ? 13.155  24.179  20.884  1.00 58.96  ? 465  TYR A CE1 1 
ATOM   3547 C CE2 . TYR A 1 465 ? 13.794  25.039  23.022  1.00 58.47  ? 465  TYR A CE2 1 
ATOM   3548 C CZ  . TYR A 1 465 ? 14.139  24.500  21.806  1.00 58.55  ? 465  TYR A CZ  1 
ATOM   3549 O OH  . TYR A 1 465 ? 15.467  24.285  21.519  1.00 57.70  ? 465  TYR A OH  1 
ATOM   3550 N N   . THR A 1 466 ? 7.279   26.293  21.405  1.00 59.51  ? 466  THR A N   1 
ATOM   3551 C CA  . THR A 1 466 ? 5.821   26.163  21.363  1.00 59.49  ? 466  THR A CA  1 
ATOM   3552 C C   . THR A 1 466 ? 5.384   25.012  22.253  1.00 59.63  ? 466  THR A C   1 
ATOM   3553 O O   . THR A 1 466 ? 6.179   24.132  22.574  1.00 59.55  ? 466  THR A O   1 
ATOM   3554 C CB  . THR A 1 466 ? 5.260   25.855  19.940  1.00 59.54  ? 466  THR A CB  1 
ATOM   3555 O OG1 . THR A 1 466 ? 5.179   24.433  19.738  1.00 59.88  ? 466  THR A OG1 1 
ATOM   3556 C CG2 . THR A 1 466 ? 6.089   26.488  18.844  1.00 59.13  ? 466  THR A CG2 1 
ATOM   3557 N N   . THR A 1 467 ? 4.107   25.012  22.622  1.00 59.95  ? 467  THR A N   1 
ATOM   3558 C CA  . THR A 1 467 ? 3.523   23.923  23.402  1.00 60.12  ? 467  THR A CA  1 
ATOM   3559 C C   . THR A 1 467 ? 3.639   22.557  22.711  1.00 60.19  ? 467  THR A C   1 
ATOM   3560 O O   . THR A 1 467 ? 3.919   21.548  23.362  1.00 60.08  ? 467  THR A O   1 
ATOM   3561 C CB  . THR A 1 467 ? 2.051   24.226  23.775  1.00 59.98  ? 467  THR A CB  1 
ATOM   3562 O OG1 . THR A 1 467 ? 2.027   25.137  24.875  1.00 59.63  ? 467  THR A OG1 1 
ATOM   3563 C CG2 . THR A 1 467 ? 1.312   22.962  24.184  1.00 60.36  ? 467  THR A CG2 1 
ATOM   3564 N N   . GLU A 1 468 ? 3.443   22.525  21.400  1.00 60.30  ? 468  GLU A N   1 
ATOM   3565 C CA  . GLU A 1 468 ? 3.371   21.248  20.703  1.00 60.76  ? 468  GLU A CA  1 
ATOM   3566 C C   . GLU A 1 468 ? 4.769   20.652  20.613  1.00 60.22  ? 468  GLU A C   1 
ATOM   3567 O O   . GLU A 1 468 ? 4.941   19.430  20.625  1.00 59.98  ? 468  GLU A O   1 
ATOM   3568 C CB  . GLU A 1 468 ? 2.706   21.403  19.329  1.00 61.36  ? 468  GLU A CB  1 
ATOM   3569 C CG  . GLU A 1 468 ? 1.299   22.056  19.366  1.00 63.89  ? 468  GLU A CG  1 
ATOM   3570 C CD  . GLU A 1 468 ? 1.337   23.542  19.790  1.00 67.35  ? 468  GLU A CD  1 
ATOM   3571 O OE1 . GLU A 1 468 ? 0.896   23.855  20.925  1.00 68.02  ? 468  GLU A OE1 1 
ATOM   3572 O OE2 . GLU A 1 468 ? 1.832   24.388  19.003  1.00 67.88  ? 468  GLU A OE2 1 
ATOM   3573 N N   . GLU A 1 469 ? 5.759   21.543  20.565  1.00 59.87  ? 469  GLU A N   1 
ATOM   3574 C CA  . GLU A 1 469 ? 7.181   21.183  20.635  1.00 59.17  ? 469  GLU A CA  1 
ATOM   3575 C C   . GLU A 1 469 ? 7.554   20.514  21.969  1.00 58.91  ? 469  GLU A C   1 
ATOM   3576 O O   . GLU A 1 469 ? 8.291   19.529  21.995  1.00 58.65  ? 469  GLU A O   1 
ATOM   3577 C CB  . GLU A 1 469 ? 8.048   22.415  20.354  1.00 58.84  ? 469  GLU A CB  1 
ATOM   3578 C CG  . GLU A 1 469 ? 8.067   22.779  18.879  1.00 58.27  ? 469  GLU A CG  1 
ATOM   3579 C CD  . GLU A 1 469 ? 8.971   23.946  18.551  1.00 58.24  ? 469  GLU A CD  1 
ATOM   3580 O OE1 . GLU A 1 469 ? 8.988   24.921  19.323  1.00 59.30  ? 469  GLU A OE1 1 
ATOM   3581 O OE2 . GLU A 1 469 ? 9.659   23.903  17.509  1.00 57.65  ? 469  GLU A OE2 1 
ATOM   3582 N N   . ARG A 1 470 ? 7.017   21.054  23.058  1.00 58.78  ? 470  ARG A N   1 
ATOM   3583 C CA  . ARG A 1 470 ? 7.111   20.468  24.390  1.00 58.93  ? 470  ARG A CA  1 
ATOM   3584 C C   . ARG A 1 470 ? 6.461   19.069  24.451  1.00 58.41  ? 470  ARG A C   1 
ATOM   3585 O O   . ARG A 1 470 ? 6.909   18.212  25.212  1.00 58.55  ? 470  ARG A O   1 
ATOM   3586 C CB  . ARG A 1 470 ? 6.460   21.430  25.391  1.00 59.32  ? 470  ARG A CB  1 
ATOM   3587 C CG  . ARG A 1 470 ? 6.903   21.331  26.847  1.00 62.14  ? 470  ARG A CG  1 
ATOM   3588 C CD  . ARG A 1 470 ? 5.899   20.558  27.735  1.00 68.24  ? 470  ARG A CD  1 
ATOM   3589 N NE  . ARG A 1 470 ? 4.528   21.098  27.692  1.00 72.25  ? 470  ARG A NE  1 
ATOM   3590 C CZ  . ARG A 1 470 ? 3.418   20.380  27.894  1.00 73.54  ? 470  ARG A CZ  1 
ATOM   3591 N NH1 . ARG A 1 470 ? 3.492   19.072  28.160  1.00 73.22  ? 470  ARG A NH1 1 
ATOM   3592 N NH2 . ARG A 1 470 ? 2.226   20.971  27.814  1.00 73.96  ? 470  ARG A NH2 1 
ATOM   3593 N N   . ILE A 1 471 ? 5.419   18.837  23.648  1.00 57.74  ? 471  ILE A N   1 
ATOM   3594 C CA  . ILE A 1 471 ? 4.714   17.546  23.638  1.00 57.04  ? 471  ILE A CA  1 
ATOM   3595 C C   . ILE A 1 471 ? 5.487   16.557  22.778  1.00 56.72  ? 471  ILE A C   1 
ATOM   3596 O O   . ILE A 1 471 ? 5.637   15.376  23.118  1.00 56.60  ? 471  ILE A O   1 
ATOM   3597 C CB  . ILE A 1 471 ? 3.236   17.701  23.146  1.00 57.02  ? 471  ILE A CB  1 
ATOM   3598 C CG1 . ILE A 1 471 ? 2.386   18.341  24.240  1.00 57.23  ? 471  ILE A CG1 1 
ATOM   3599 C CG2 . ILE A 1 471 ? 2.602   16.358  22.742  1.00 56.19  ? 471  ILE A CG2 1 
ATOM   3600 C CD1 . ILE A 1 471 ? 1.218   19.151  23.703  1.00 58.38  ? 471  ILE A CD1 1 
ATOM   3601 N N   . PHE A 1 472 ? 5.974   17.070  21.656  1.00 56.43  ? 472  PHE A N   1 
ATOM   3602 C CA  . PHE A 1 472 ? 6.769   16.315  20.695  1.00 56.11  ? 472  PHE A CA  1 
ATOM   3603 C C   . PHE A 1 472 ? 8.076   15.839  21.340  1.00 56.14  ? 472  PHE A C   1 
ATOM   3604 O O   . PHE A 1 472 ? 8.455   14.674  21.197  1.00 56.05  ? 472  PHE A O   1 
ATOM   3605 C CB  . PHE A 1 472 ? 7.007   17.209  19.475  1.00 55.84  ? 472  PHE A CB  1 
ATOM   3606 C CG  . PHE A 1 472 ? 7.944   16.650  18.461  1.00 55.43  ? 472  PHE A CG  1 
ATOM   3607 C CD1 . PHE A 1 472 ? 7.681   15.443  17.837  1.00 55.58  ? 472  PHE A CD1 1 
ATOM   3608 C CD2 . PHE A 1 472 ? 9.075   17.374  18.087  1.00 55.38  ? 472  PHE A CD2 1 
ATOM   3609 C CE1 . PHE A 1 472 ? 8.556   14.936  16.879  1.00 56.45  ? 472  PHE A CE1 1 
ATOM   3610 C CE2 . PHE A 1 472 ? 9.949   16.892  17.127  1.00 55.30  ? 472  PHE A CE2 1 
ATOM   3611 C CZ  . PHE A 1 472 ? 9.695   15.668  16.518  1.00 56.05  ? 472  PHE A CZ  1 
ATOM   3612 N N   . ALA A 1 473 ? 8.729   16.737  22.080  1.00 56.03  ? 473  ALA A N   1 
ATOM   3613 C CA  . ALA A 1 473 ? 9.943   16.414  22.814  1.00 56.16  ? 473  ALA A CA  1 
ATOM   3614 C C   . ALA A 1 473 ? 9.718   15.233  23.744  1.00 56.42  ? 473  ALA A C   1 
ATOM   3615 O O   . ALA A 1 473 ? 10.487  14.273  23.751  1.00 56.50  ? 473  ALA A O   1 
ATOM   3616 C CB  . ALA A 1 473 ? 10.415  17.612  23.594  1.00 56.07  ? 473  ALA A CB  1 
ATOM   3617 N N   . GLN A 1 474 ? 8.644   15.310  24.519  1.00 56.81  ? 474  GLN A N   1 
ATOM   3618 C CA  . GLN A 1 474 ? 8.263   14.246  25.428  1.00 57.08  ? 474  GLN A CA  1 
ATOM   3619 C C   . GLN A 1 474 ? 8.074   12.953  24.669  1.00 56.63  ? 474  GLN A C   1 
ATOM   3620 O O   . GLN A 1 474 ? 8.485   11.892  25.128  1.00 56.79  ? 474  GLN A O   1 
ATOM   3621 C CB  . GLN A 1 474 ? 6.962   14.603  26.128  1.00 57.59  ? 474  GLN A CB  1 
ATOM   3622 C CG  . GLN A 1 474 ? 7.096   15.596  27.270  1.00 59.64  ? 474  GLN A CG  1 
ATOM   3623 C CD  . GLN A 1 474 ? 5.804   15.713  28.065  1.00 62.28  ? 474  GLN A CD  1 
ATOM   3624 O OE1 . GLN A 1 474 ? 4.799   16.248  27.570  1.00 64.53  ? 474  GLN A OE1 1 
ATOM   3625 N NE2 . GLN A 1 474 ? 5.818   15.204  29.298  1.00 61.53  ? 474  GLN A NE2 1 
ATOM   3626 N N   . ARG A 1 475 ? 7.457   13.056  23.497  1.00 56.42  ? 475  ARG A N   1 
ATOM   3627 C CA  . ARG A 1 475 ? 7.148   11.882  22.694  1.00 56.22  ? 475  ARG A CA  1 
ATOM   3628 C C   . ARG A 1 475 ? 8.435   11.223  22.214  1.00 55.57  ? 475  ARG A C   1 
ATOM   3629 O O   . ARG A 1 475 ? 8.545   9.991   22.205  1.00 55.46  ? 475  ARG A O   1 
ATOM   3630 C CB  . ARG A 1 475 ? 6.224   12.236  21.512  1.00 56.34  ? 475  ARG A CB  1 
ATOM   3631 C CG  . ARG A 1 475 ? 5.287   11.077  21.112  1.00 56.84  ? 475  ARG A CG  1 
ATOM   3632 C CD  . ARG A 1 475 ? 4.322   11.444  19.982  1.00 56.36  ? 475  ARG A CD  1 
ATOM   3633 N NE  . ARG A 1 475 ? 4.828   11.095  18.650  1.00 55.27  ? 475  ARG A NE  1 
ATOM   3634 C CZ  . ARG A 1 475 ? 5.049   11.972  17.671  1.00 55.51  ? 475  ARG A CZ  1 
ATOM   3635 N NH1 . ARG A 1 475 ? 4.806   13.270  17.863  1.00 54.65  ? 475  ARG A NH1 1 
ATOM   3636 N NH2 . ARG A 1 475 ? 5.505   11.553  16.490  1.00 55.40  ? 475  ARG A NH2 1 
ATOM   3637 N N   . LEU A 1 476 ? 9.408   12.057  21.846  1.00 54.80  ? 476  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 476 ? 10.684  11.570  21.345  1.00 54.07  ? 476  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 476 ? 11.483  10.920  22.453  1.00 54.13  ? 476  LEU A C   1 
ATOM   3640 O O   . LEU A 1 476 ? 12.071  9.848   22.255  1.00 54.25  ? 476  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 476 ? 11.484  12.691  20.691  1.00 53.57  ? 476  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 476 ? 10.990  13.136  19.315  1.00 52.77  ? 476  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 476 ? 11.867  14.218  18.782  1.00 51.22  ? 476  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 476 ? 10.980  11.978  18.349  1.00 52.89  ? 476  LEU A CD2 1 
ATOM   3645 N N   . MET A 1 477 ? 11.483  11.555  23.625  1.00 53.78  ? 477  MET A N   1 
ATOM   3646 C CA  . MET A 1 477 ? 12.202  11.027  24.770  1.00 53.57  ? 477  MET A CA  1 
ATOM   3647 C C   . MET A 1 477 ? 11.651  9.676   25.149  1.00 53.72  ? 477  MET A C   1 
ATOM   3648 O O   . MET A 1 477 ? 12.413  8.794   25.546  1.00 53.81  ? 477  MET A O   1 
ATOM   3649 C CB  . MET A 1 477 ? 12.102  11.957  25.954  1.00 53.21  ? 477  MET A CB  1 
ATOM   3650 C CG  . MET A 1 477 ? 12.846  13.218  25.776  1.00 53.24  ? 477  MET A CG  1 
ATOM   3651 S SD  . MET A 1 477 ? 12.206  14.423  26.924  1.00 54.31  ? 477  MET A SD  1 
ATOM   3652 C CE  . MET A 1 477 ? 13.270  14.104  28.339  1.00 53.25  ? 477  MET A CE  1 
ATOM   3653 N N   . LYS A 1 478 ? 10.332  9.517   25.022  1.00 53.74  ? 478  LYS A N   1 
ATOM   3654 C CA  . LYS A 1 478 ? 9.691   8.226   25.249  1.00 53.86  ? 478  LYS A CA  1 
ATOM   3655 C C   . LYS A 1 478 ? 10.239  7.166   24.297  1.00 53.45  ? 478  LYS A C   1 
ATOM   3656 O O   . LYS A 1 478 ? 10.612  6.092   24.741  1.00 53.09  ? 478  LYS A O   1 
ATOM   3657 C CB  . LYS A 1 478 ? 8.165   8.333   25.137  1.00 54.51  ? 478  LYS A CB  1 
ATOM   3658 C CG  . LYS A 1 478 ? 7.459   8.805   26.419  1.00 55.13  ? 478  LYS A CG  1 
ATOM   3659 C CD  . LYS A 1 478 ? 6.891   7.627   27.230  1.00 57.02  ? 478  LYS A CD  1 
ATOM   3660 C CE  . LYS A 1 478 ? 6.212   8.086   28.537  1.00 56.71  ? 478  LYS A CE  1 
ATOM   3661 N NZ  . LYS A 1 478 ? 6.996   7.730   29.760  1.00 56.78  ? 478  LYS A NZ  1 
ATOM   3662 N N   . TYR A 1 479 ? 10.320  7.484   23.004  1.00 53.38  ? 479  TYR A N   1 
ATOM   3663 C CA  . TYR A 1 479 ? 10.830  6.536   22.005  1.00 53.45  ? 479  TYR A CA  1 
ATOM   3664 C C   . TYR A 1 479 ? 12.234  6.072   22.335  1.00 53.49  ? 479  TYR A C   1 
ATOM   3665 O O   . TYR A 1 479 ? 12.500  4.864   22.411  1.00 53.29  ? 479  TYR A O   1 
ATOM   3666 C CB  . TYR A 1 479 ? 10.857  7.149   20.607  1.00 53.59  ? 479  TYR A CB  1 
ATOM   3667 C CG  . TYR A 1 479 ? 9.516   7.418   19.991  1.00 53.93  ? 479  TYR A CG  1 
ATOM   3668 C CD1 . TYR A 1 479 ? 8.472   6.495   20.102  1.00 54.30  ? 479  TYR A CD1 1 
ATOM   3669 C CD2 . TYR A 1 479 ? 9.295   8.587   19.270  1.00 54.13  ? 479  TYR A CD2 1 
ATOM   3670 C CE1 . TYR A 1 479 ? 7.227   6.743   19.530  1.00 54.60  ? 479  TYR A CE1 1 
ATOM   3671 C CE2 . TYR A 1 479 ? 8.057   8.848   18.688  1.00 55.39  ? 479  TYR A CE2 1 
ATOM   3672 C CZ  . TYR A 1 479 ? 7.021   7.919   18.821  1.00 55.08  ? 479  TYR A CZ  1 
ATOM   3673 O OH  . TYR A 1 479 ? 5.792   8.175   18.243  1.00 54.51  ? 479  TYR A OH  1 
ATOM   3674 N N   . TRP A 1 480 ? 13.129  7.046   22.517  1.00 53.47  ? 480  TRP A N   1 
ATOM   3675 C CA  . TRP A 1 480 ? 14.527  6.775   22.804  1.00 53.30  ? 480  TRP A CA  1 
ATOM   3676 C C   . TRP A 1 480 ? 14.690  5.913   24.054  1.00 53.60  ? 480  TRP A C   1 
ATOM   3677 O O   . TRP A 1 480 ? 15.293  4.839   23.985  1.00 53.88  ? 480  TRP A O   1 
ATOM   3678 C CB  . TRP A 1 480 ? 15.314  8.077   22.911  1.00 53.10  ? 480  TRP A CB  1 
ATOM   3679 C CG  . TRP A 1 480 ? 16.103  8.414   21.657  1.00 53.11  ? 480  TRP A CG  1 
ATOM   3680 C CD1 . TRP A 1 480 ? 17.468  8.504   21.539  1.00 52.37  ? 480  TRP A CD1 1 
ATOM   3681 C CD2 . TRP A 1 480 ? 15.574  8.702   20.360  1.00 51.99  ? 480  TRP A CD2 1 
ATOM   3682 N NE1 . TRP A 1 480 ? 17.809  8.829   20.255  1.00 51.62  ? 480  TRP A NE1 1 
ATOM   3683 C CE2 . TRP A 1 480 ? 16.668  8.960   19.512  1.00 51.71  ? 480  TRP A CE2 1 
ATOM   3684 C CE3 . TRP A 1 480 ? 14.279  8.763   19.833  1.00 51.72  ? 480  TRP A CE3 1 
ATOM   3685 C CZ2 . TRP A 1 480 ? 16.509  9.267   18.167  1.00 52.96  ? 480  TRP A CZ2 1 
ATOM   3686 C CZ3 . TRP A 1 480 ? 14.116  9.072   18.499  1.00 52.06  ? 480  TRP A CZ3 1 
ATOM   3687 C CH2 . TRP A 1 480 ? 15.224  9.321   17.677  1.00 53.02  ? 480  TRP A CH2 1 
ATOM   3688 N N   . THR A 1 481 ? 14.122  6.350   25.180  1.00 53.59  ? 481  THR A N   1 
ATOM   3689 C CA  . THR A 1 481 ? 14.250  5.595   26.426  1.00 53.39  ? 481  THR A CA  1 
ATOM   3690 C C   . THR A 1 481 ? 13.536  4.262   26.374  1.00 53.43  ? 481  THR A C   1 
ATOM   3691 O O   . THR A 1 481 ? 14.049  3.289   26.905  1.00 53.70  ? 481  THR A O   1 
ATOM   3692 C CB  . THR A 1 481 ? 13.780  6.366   27.650  1.00 53.25  ? 481  THR A CB  1 
ATOM   3693 O OG1 . THR A 1 481 ? 12.390  6.668   27.512  1.00 54.40  ? 481  THR A OG1 1 
ATOM   3694 C CG2 . THR A 1 481 ? 14.566  7.635   27.802  1.00 53.02  ? 481  THR A CG2 1 
ATOM   3695 N N   . ASN A 1 482 ? 12.369  4.191   25.739  1.00 53.66  ? 482  ASN A N   1 
ATOM   3696 C CA  . ASN A 1 482 ? 11.743  2.881   25.534  1.00 53.91  ? 482  ASN A CA  1 
ATOM   3697 C C   . ASN A 1 482 ? 12.693  1.957   24.804  1.00 53.89  ? 482  ASN A C   1 
ATOM   3698 O O   . ASN A 1 482 ? 12.850  0.801   25.188  1.00 53.89  ? 482  ASN A O   1 
ATOM   3699 C CB  . ASN A 1 482 ? 10.406  2.971   24.799  1.00 53.99  ? 482  ASN A CB  1 
ATOM   3700 C CG  . ASN A 1 482 ? 9.281   3.424   25.707  1.00 55.20  ? 482  ASN A CG  1 
ATOM   3701 O OD1 . ASN A 1 482 ? 9.411   3.380   26.935  1.00 56.77  ? 482  ASN A OD1 1 
ATOM   3702 N ND2 . ASN A 1 482 ? 8.175   3.876   25.114  1.00 55.58  ? 482  ASN A ND2 1 
ATOM   3703 N N   . PHE A 1 483 ? 13.357  2.482   23.777  1.00 53.87  ? 483  PHE A N   1 
ATOM   3704 C CA  . PHE A 1 483 ? 14.345  1.700   23.064  1.00 53.75  ? 483  PHE A CA  1 
ATOM   3705 C C   . PHE A 1 483 ? 15.519  1.263   23.966  1.00 54.39  ? 483  PHE A C   1 
ATOM   3706 O O   . PHE A 1 483 ? 15.941  0.098   23.930  1.00 54.30  ? 483  PHE A O   1 
ATOM   3707 C CB  . PHE A 1 483 ? 14.846  2.429   21.824  1.00 53.28  ? 483  PHE A CB  1 
ATOM   3708 C CG  . PHE A 1 483 ? 15.899  1.668   21.090  1.00 52.73  ? 483  PHE A CG  1 
ATOM   3709 C CD1 . PHE A 1 483 ? 15.547  0.687   20.174  1.00 51.85  ? 483  PHE A CD1 1 
ATOM   3710 C CD2 . PHE A 1 483 ? 17.247  1.895   21.352  1.00 51.53  ? 483  PHE A CD2 1 
ATOM   3711 C CE1 . PHE A 1 483 ? 16.522  -0.045  19.515  1.00 52.09  ? 483  PHE A CE1 1 
ATOM   3712 C CE2 . PHE A 1 483 ? 18.222  1.173   20.706  1.00 51.41  ? 483  PHE A CE2 1 
ATOM   3713 C CZ  . PHE A 1 483 ? 17.861  0.199   19.780  1.00 52.66  ? 483  PHE A CZ  1 
ATOM   3714 N N   . ALA A 1 484 ? 16.047  2.182   24.773  1.00 54.94  ? 484  ALA A N   1 
ATOM   3715 C CA  . ALA A 1 484 ? 17.111  1.817   25.703  1.00 55.61  ? 484  ALA A CA  1 
ATOM   3716 C C   . ALA A 1 484 ? 16.641  0.685   26.599  1.00 56.34  ? 484  ALA A C   1 
ATOM   3717 O O   . ALA A 1 484 ? 17.402  -0.231  26.897  1.00 56.56  ? 484  ALA A O   1 
ATOM   3718 C CB  . ALA A 1 484 ? 17.539  3.002   26.535  1.00 55.45  ? 484  ALA A CB  1 
ATOM   3719 N N   . ARG A 1 485 ? 15.372  0.749   26.996  1.00 57.28  ? 485  ARG A N   1 
ATOM   3720 C CA  . ARG A 1 485 ? 14.803  -0.162  27.983  1.00 58.35  ? 485  ARG A CA  1 
ATOM   3721 C C   . ARG A 1 485 ? 14.557  -1.549  27.434  1.00 58.23  ? 485  ARG A C   1 
ATOM   3722 O O   . ARG A 1 485 ? 14.907  -2.528  28.080  1.00 58.50  ? 485  ARG A O   1 
ATOM   3723 C CB  . ARG A 1 485 ? 13.484  0.390   28.540  1.00 58.55  ? 485  ARG A CB  1 
ATOM   3724 C CG  . ARG A 1 485 ? 13.588  1.175   29.855  1.00 59.76  ? 485  ARG A CG  1 
ATOM   3725 C CD  . ARG A 1 485 ? 12.193  1.520   30.399  1.00 59.83  ? 485  ARG A CD  1 
ATOM   3726 N NE  . ARG A 1 485 ? 11.551  2.573   29.596  1.00 63.50  ? 485  ARG A NE  1 
ATOM   3727 C CZ  . ARG A 1 485 ? 11.511  3.869   29.919  1.00 63.71  ? 485  ARG A CZ  1 
ATOM   3728 N NH1 . ARG A 1 485 ? 12.057  4.307   31.051  1.00 63.43  ? 485  ARG A NH1 1 
ATOM   3729 N NH2 . ARG A 1 485 ? 10.913  4.733   29.106  1.00 64.37  ? 485  ARG A NH2 1 
ATOM   3730 N N   . THR A 1 486 ? 13.964  -1.629  26.245  1.00 58.46  ? 486  THR A N   1 
ATOM   3731 C CA  . THR A 1 486 ? 13.371  -2.875  25.757  1.00 58.56  ? 486  THR A CA  1 
ATOM   3732 C C   . THR A 1 486 ? 13.931  -3.355  24.425  1.00 59.08  ? 486  THR A C   1 
ATOM   3733 O O   . THR A 1 486 ? 13.660  -4.477  24.017  1.00 59.42  ? 486  THR A O   1 
ATOM   3734 C CB  . THR A 1 486 ? 11.855  -2.720  25.544  1.00 58.36  ? 486  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 486 ? 11.630  -1.836  24.443  1.00 58.48  ? 486  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 486 ? 11.159  -2.167  26.780  1.00 57.51  ? 486  THR A CG2 1 
ATOM   3737 N N   . GLY A 1 487 ? 14.692  -2.507  23.742  1.00 59.75  ? 487  GLY A N   1 
ATOM   3738 C CA  . GLY A 1 487 ? 15.074  -2.757  22.353  1.00 60.19  ? 487  GLY A CA  1 
ATOM   3739 C C   . GLY A 1 487 ? 13.967  -2.412  21.365  1.00 60.79  ? 487  GLY A C   1 
ATOM   3740 O O   . GLY A 1 487 ? 14.036  -2.794  20.205  1.00 60.60  ? 487  GLY A O   1 
ATOM   3741 N N   . ASP A 1 488 ? 12.947  -1.683  21.823  1.00 61.82  ? 488  ASP A N   1 
ATOM   3742 C CA  . ASP A 1 488 ? 11.779  -1.338  21.002  1.00 62.99  ? 488  ASP A CA  1 
ATOM   3743 C C   . ASP A 1 488 ? 11.224  0.030   21.427  1.00 63.78  ? 488  ASP A C   1 
ATOM   3744 O O   . ASP A 1 488 ? 10.864  0.211   22.583  1.00 63.94  ? 488  ASP A O   1 
ATOM   3745 C CB  . ASP A 1 488 ? 10.727  -2.455  21.120  1.00 62.99  ? 488  ASP A CB  1 
ATOM   3746 C CG  . ASP A 1 488 ? 9.396   -2.121  20.453  1.00 63.72  ? 488  ASP A CG  1 
ATOM   3747 O OD1 . ASP A 1 488 ? 9.234   -1.047  19.852  1.00 64.67  ? 488  ASP A OD1 1 
ATOM   3748 O OD2 . ASP A 1 488 ? 8.478   -2.961  20.536  1.00 65.11  ? 488  ASP A OD2 1 
ATOM   3749 N N   . PRO A 1 489 ? 11.156  0.996   20.489  1.00 64.79  ? 489  PRO A N   1 
ATOM   3750 C CA  . PRO A 1 489 ? 10.712  2.370   20.751  1.00 65.99  ? 489  PRO A CA  1 
ATOM   3751 C C   . PRO A 1 489 ? 9.223   2.491   21.056  1.00 67.66  ? 489  PRO A C   1 
ATOM   3752 O O   . PRO A 1 489 ? 8.778   3.510   21.585  1.00 67.32  ? 489  PRO A O   1 
ATOM   3753 C CB  . PRO A 1 489 ? 10.995  3.073   19.426  1.00 65.74  ? 489  PRO A CB  1 
ATOM   3754 C CG  . PRO A 1 489 ? 10.871  2.002   18.420  1.00 64.95  ? 489  PRO A CG  1 
ATOM   3755 C CD  . PRO A 1 489 ? 11.502  0.814   19.070  1.00 64.69  ? 489  PRO A CD  1 
ATOM   3756 N N   . ASN A 1 490 ? 8.464   1.461   20.698  1.00 70.03  ? 490  ASN A N   1 
ATOM   3757 C CA  . ASN A 1 490 ? 7.026   1.465   20.863  1.00 72.42  ? 490  ASN A CA  1 
ATOM   3758 C C   . ASN A 1 490 ? 6.653   1.306   22.324  1.00 74.78  ? 490  ASN A C   1 
ATOM   3759 O O   . ASN A 1 490 ? 7.468   0.875   23.141  1.00 75.04  ? 490  ASN A O   1 
ATOM   3760 C CB  . ASN A 1 490 ? 6.394   0.344   20.036  1.00 71.91  ? 490  ASN A CB  1 
ATOM   3761 C CG  . ASN A 1 490 ? 6.541   0.557   18.541  1.00 70.56  ? 490  ASN A CG  1 
ATOM   3762 O OD1 . ASN A 1 490 ? 5.911   1.442   17.959  1.00 68.58  ? 490  ASN A OD1 1 
ATOM   3763 N ND2 . ASN A 1 490 ? 7.353   -0.276  17.908  1.00 69.09  ? 490  ASN A ND2 1 
ATOM   3764 N N   . ASP A 1 491 ? 5.416   1.663   22.643  1.00 77.86  ? 491  ASP A N   1 
ATOM   3765 C CA  . ASP A 1 491 ? 4.875   1.463   23.977  1.00 80.96  ? 491  ASP A CA  1 
ATOM   3766 C C   . ASP A 1 491 ? 4.114   0.126   24.078  1.00 82.98  ? 491  ASP A C   1 
ATOM   3767 O O   . ASP A 1 491 ? 3.131   -0.083  23.344  1.00 83.16  ? 491  ASP A O   1 
ATOM   3768 C CB  . ASP A 1 491 ? 3.949   2.621   24.327  1.00 81.13  ? 491  ASP A CB  1 
ATOM   3769 C CG  . ASP A 1 491 ? 3.894   2.884   25.808  1.00 82.53  ? 491  ASP A CG  1 
ATOM   3770 O OD1 . ASP A 1 491 ? 4.115   4.060   26.183  1.00 83.95  ? 491  ASP A OD1 1 
ATOM   3771 O OD2 . ASP A 1 491 ? 3.650   1.923   26.589  1.00 83.25  ? 491  ASP A OD2 1 
ATOM   3772 N N   . PRO A 1 492 ? 4.557   -0.779  24.988  1.00 85.01  ? 492  PRO A N   1 
ATOM   3773 C CA  . PRO A 1 492 ? 3.920   -2.105  25.139  1.00 86.53  ? 492  PRO A CA  1 
ATOM   3774 C C   . PRO A 1 492 ? 2.436   -2.008  25.509  1.00 87.92  ? 492  PRO A C   1 
ATOM   3775 O O   . PRO A 1 492 ? 1.624   -2.809  25.034  1.00 87.91  ? 492  PRO A O   1 
ATOM   3776 C CB  . PRO A 1 492 ? 4.717   -2.761  26.282  1.00 86.51  ? 492  PRO A CB  1 
ATOM   3777 C CG  . PRO A 1 492 ? 6.018   -2.026  26.323  1.00 85.97  ? 492  PRO A CG  1 
ATOM   3778 C CD  . PRO A 1 492 ? 5.678   -0.607  25.933  1.00 85.27  ? 492  PRO A CD  1 
ATOM   3779 N N   . ARG A 1 493 ? 2.101   -1.024  26.343  1.00 89.57  ? 493  ARG A N   1 
ATOM   3780 C CA  . ARG A 1 493 ? 0.717   -0.774  26.740  1.00 91.36  ? 493  ARG A CA  1 
ATOM   3781 C C   . ARG A 1 493 ? -0.019  -0.041  25.619  1.00 91.82  ? 493  ARG A C   1 
ATOM   3782 O O   . ARG A 1 493 ? -0.635  -0.688  24.764  1.00 92.01  ? 493  ARG A O   1 
ATOM   3783 C CB  . ARG A 1 493 ? 0.652   0.009   28.064  1.00 91.47  ? 493  ARG A CB  1 
ATOM   3784 C CG  . ARG A 1 493 ? 1.391   -0.664  29.240  1.00 92.56  ? 493  ARG A CG  1 
ATOM   3785 C CD  . ARG A 1 493 ? 1.530   0.293   30.416  1.00 92.63  ? 493  ARG A CD  1 
ATOM   3786 N NE  . ARG A 1 493 ? 2.916   0.375   30.884  1.00 95.00  ? 493  ARG A NE  1 
ATOM   3787 C CZ  . ARG A 1 493 ? 3.515   1.500   31.280  1.00 95.10  ? 493  ARG A CZ  1 
ATOM   3788 N NH1 . ARG A 1 493 ? 2.860   2.660   31.266  1.00 94.87  ? 493  ARG A NH1 1 
ATOM   3789 N NH2 . ARG A 1 493 ? 4.780   1.465   31.681  1.00 94.75  ? 493  ARG A NH2 1 
ATOM   3790 N N   . ASP A 1 494 ? 0.070   1.293   25.610  1.00 92.55  ? 494  ASP A N   1 
ATOM   3791 C CA  . ASP A 1 494 ? -0.590  2.126   24.587  1.00 93.13  ? 494  ASP A CA  1 
ATOM   3792 C C   . ASP A 1 494 ? -0.208  1.774   23.137  1.00 93.23  ? 494  ASP A C   1 
ATOM   3793 O O   . ASP A 1 494 ? 0.912   2.071   22.690  1.00 93.24  ? 494  ASP A O   1 
ATOM   3794 C CB  . ASP A 1 494 ? -0.337  3.619   24.850  1.00 93.29  ? 494  ASP A CB  1 
ATOM   3795 C CG  . ASP A 1 494 ? -0.871  4.514   23.727  1.00 93.90  ? 494  ASP A CG  1 
ATOM   3796 O OD1 . ASP A 1 494 ? -1.806  4.105   22.991  1.00 93.94  ? 494  ASP A OD1 1 
ATOM   3797 O OD2 . ASP A 1 494 ? -0.346  5.637   23.579  1.00 94.61  ? 494  ASP A OD2 1 
ATOM   3798 N N   . SER A 1 495 ? -1.152  1.162   22.412  1.00 93.30  ? 495  SER A N   1 
ATOM   3799 C CA  . SER A 1 495 ? -0.952  0.812   20.990  1.00 93.26  ? 495  SER A CA  1 
ATOM   3800 C C   . SER A 1 495 ? -2.082  1.319   20.062  1.00 92.86  ? 495  SER A C   1 
ATOM   3801 O O   . SER A 1 495 ? -2.155  0.946   18.879  1.00 92.87  ? 495  SER A O   1 
ATOM   3802 C CB  . SER A 1 495 ? -0.667  -0.697  20.802  1.00 93.34  ? 495  SER A CB  1 
ATOM   3803 O OG  . SER A 1 495 ? -1.842  -1.432  20.515  1.00 93.51  ? 495  SER A OG  1 
ATOM   3804 N N   . LYS A 1 496 ? -2.947  2.174   20.606  1.00 92.25  ? 496  LYS A N   1 
ATOM   3805 C CA  . LYS A 1 496 ? -3.945  2.891   19.796  1.00 91.53  ? 496  LYS A CA  1 
ATOM   3806 C C   . LYS A 1 496 ? -3.285  3.914   18.834  1.00 90.33  ? 496  LYS A C   1 
ATOM   3807 O O   . LYS A 1 496 ? -3.641  3.974   17.646  1.00 90.44  ? 496  LYS A O   1 
ATOM   3808 C CB  . LYS A 1 496 ? -5.024  3.524   20.695  1.00 91.96  ? 496  LYS A CB  1 
ATOM   3809 C CG  . LYS A 1 496 ? -6.035  2.487   21.210  1.00 92.81  ? 496  LYS A CG  1 
ATOM   3810 C CD  . LYS A 1 496 ? -6.489  2.752   22.650  1.00 94.11  ? 496  LYS A CD  1 
ATOM   3811 C CE  . LYS A 1 496 ? -7.288  1.560   23.218  1.00 93.42  ? 496  LYS A CE  1 
ATOM   3812 N NZ  . LYS A 1 496 ? -7.791  1.816   24.605  1.00 92.93  ? 496  LYS A NZ  1 
ATOM   3813 N N   . SER A 1 497 ? -2.322  4.691   19.350  1.00 88.42  ? 497  SER A N   1 
ATOM   3814 C CA  . SER A 1 497 ? -1.417  5.503   18.512  1.00 86.20  ? 497  SER A CA  1 
ATOM   3815 C C   . SER A 1 497 ? -0.492  4.581   17.691  1.00 84.27  ? 497  SER A C   1 
ATOM   3816 O O   . SER A 1 497 ? -0.064  3.534   18.192  1.00 84.15  ? 497  SER A O   1 
ATOM   3817 C CB  . SER A 1 497 ? -0.614  6.509   19.360  1.00 86.36  ? 497  SER A CB  1 
ATOM   3818 O OG  . SER A 1 497 ? -0.126  5.925   20.558  1.00 86.22  ? 497  SER A OG  1 
ATOM   3819 N N   . PRO A 1 498 ? -0.195  4.966   16.429  1.00 82.26  ? 498  PRO A N   1 
ATOM   3820 C CA  . PRO A 1 498 ? 0.387   4.033   15.438  1.00 80.52  ? 498  PRO A CA  1 
ATOM   3821 C C   . PRO A 1 498 ? 1.761   3.437   15.782  1.00 78.57  ? 498  PRO A C   1 
ATOM   3822 O O   . PRO A 1 498 ? 2.607   4.107   16.383  1.00 78.45  ? 498  PRO A O   1 
ATOM   3823 C CB  . PRO A 1 498 ? 0.452   4.866   14.144  1.00 80.67  ? 498  PRO A CB  1 
ATOM   3824 C CG  . PRO A 1 498 ? 0.362   6.290   14.580  1.00 81.37  ? 498  PRO A CG  1 
ATOM   3825 C CD  . PRO A 1 498 ? -0.408  6.315   15.866  1.00 82.15  ? 498  PRO A CD  1 
ATOM   3826 N N   . GLN A 1 499 ? 1.955   2.184   15.371  1.00 76.02  ? 499  GLN A N   1 
ATOM   3827 C CA  . GLN A 1 499 ? 3.173   1.408   15.624  1.00 73.28  ? 499  GLN A CA  1 
ATOM   3828 C C   . GLN A 1 499 ? 4.373   1.802   14.753  1.00 71.04  ? 499  GLN A C   1 
ATOM   3829 O O   . GLN A 1 499 ? 4.209   2.219   13.607  1.00 70.71  ? 499  GLN A O   1 
ATOM   3830 C CB  . GLN A 1 499 ? 2.865   -0.074  15.400  1.00 73.74  ? 499  GLN A CB  1 
ATOM   3831 C CG  . GLN A 1 499 ? 1.997   -0.696  16.482  1.00 74.32  ? 499  GLN A CG  1 
ATOM   3832 C CD  . GLN A 1 499 ? 2.785   -0.987  17.748  1.00 75.02  ? 499  GLN A CD  1 
ATOM   3833 O OE1 . GLN A 1 499 ? 3.764   -1.751  17.727  1.00 74.11  ? 499  GLN A OE1 1 
ATOM   3834 N NE2 . GLN A 1 499 ? 2.362   -0.380  18.861  1.00 74.66  ? 499  GLN A NE2 1 
ATOM   3835 N N   . TRP A 1 500 ? 5.577   1.650   15.306  1.00 68.18  ? 500  TRP A N   1 
ATOM   3836 C CA  . TRP A 1 500 ? 6.831   1.864   14.573  1.00 65.21  ? 500  TRP A CA  1 
ATOM   3837 C C   . TRP A 1 500 ? 7.401   0.486   14.195  1.00 63.72  ? 500  TRP A C   1 
ATOM   3838 O O   . TRP A 1 500 ? 7.914   -0.239  15.049  1.00 63.48  ? 500  TRP A O   1 
ATOM   3839 C CB  . TRP A 1 500 ? 7.809   2.680   15.437  1.00 64.30  ? 500  TRP A CB  1 
ATOM   3840 C CG  . TRP A 1 500 ? 9.145   3.066   14.812  1.00 63.26  ? 500  TRP A CG  1 
ATOM   3841 C CD1 . TRP A 1 500 ? 9.742   2.514   13.710  1.00 62.89  ? 500  TRP A CD1 1 
ATOM   3842 C CD2 . TRP A 1 500 ? 10.063  4.051   15.301  1.00 61.90  ? 500  TRP A CD2 1 
ATOM   3843 N NE1 . TRP A 1 500 ? 10.959  3.113   13.470  1.00 62.14  ? 500  TRP A NE1 1 
ATOM   3844 C CE2 . TRP A 1 500 ? 11.180  4.056   14.435  1.00 61.74  ? 500  TRP A CE2 1 
ATOM   3845 C CE3 . TRP A 1 500 ? 10.045  4.938   16.381  1.00 61.20  ? 500  TRP A CE3 1 
ATOM   3846 C CZ2 . TRP A 1 500 ? 12.258  4.911   14.613  1.00 61.83  ? 500  TRP A CZ2 1 
ATOM   3847 C CZ3 . TRP A 1 500 ? 11.114  5.787   16.555  1.00 61.97  ? 500  TRP A CZ3 1 
ATOM   3848 C CH2 . TRP A 1 500 ? 12.206  5.769   15.679  1.00 62.16  ? 500  TRP A CH2 1 
ATOM   3849 N N   . PRO A 1 501 ? 7.276   0.104   12.915  1.00 62.27  ? 501  PRO A N   1 
ATOM   3850 C CA  . PRO A 1 501 ? 7.735   -1.205  12.490  1.00 61.27  ? 501  PRO A CA  1 
ATOM   3851 C C   . PRO A 1 501 ? 9.228   -1.222  12.266  1.00 60.38  ? 501  PRO A C   1 
ATOM   3852 O O   . PRO A 1 501 ? 9.793   -0.209  11.874  1.00 60.82  ? 501  PRO A O   1 
ATOM   3853 C CB  . PRO A 1 501 ? 7.017   -1.406  11.159  1.00 61.31  ? 501  PRO A CB  1 
ATOM   3854 C CG  . PRO A 1 501 ? 6.792   -0.049  10.629  1.00 61.36  ? 501  PRO A CG  1 
ATOM   3855 C CD  . PRO A 1 501 ? 6.687   0.872   11.805  1.00 62.18  ? 501  PRO A CD  1 
ATOM   3856 N N   . PRO A 1 502 ? 9.880   -2.356  12.531  1.00 59.52  ? 502  PRO A N   1 
ATOM   3857 C CA  . PRO A 1 502 ? 11.272  -2.507  12.150  1.00 59.06  ? 502  PRO A CA  1 
ATOM   3858 C C   . PRO A 1 502 ? 11.506  -2.258  10.663  1.00 58.77  ? 502  PRO A C   1 
ATOM   3859 O O   . PRO A 1 502 ? 10.602  -2.459  9.844   1.00 58.70  ? 502  PRO A O   1 
ATOM   3860 C CB  . PRO A 1 502 ? 11.564  -3.966  12.476  1.00 58.95  ? 502  PRO A CB  1 
ATOM   3861 C CG  . PRO A 1 502 ? 10.629  -4.292  13.545  1.00 59.37  ? 502  PRO A CG  1 
ATOM   3862 C CD  . PRO A 1 502 ? 9.383   -3.537  13.246  1.00 59.68  ? 502  PRO A CD  1 
ATOM   3863 N N   . TYR A 1 503 ? 12.710  -1.798  10.336  1.00 58.19  ? 503  TYR A N   1 
ATOM   3864 C CA  . TYR A 1 503 ? 13.155  -1.681  8.963   1.00 57.59  ? 503  TYR A CA  1 
ATOM   3865 C C   . TYR A 1 503 ? 13.626  -3.055  8.517   1.00 57.49  ? 503  TYR A C   1 
ATOM   3866 O O   . TYR A 1 503 ? 14.420  -3.692  9.203   1.00 57.51  ? 503  TYR A O   1 
ATOM   3867 C CB  . TYR A 1 503 ? 14.290  -0.655  8.870   1.00 57.36  ? 503  TYR A CB  1 
ATOM   3868 C CG  . TYR A 1 503 ? 14.921  -0.478  7.492   1.00 56.85  ? 503  TYR A CG  1 
ATOM   3869 C CD1 . TYR A 1 503 ? 16.063  -1.197  7.118   1.00 55.66  ? 503  TYR A CD1 1 
ATOM   3870 C CD2 . TYR A 1 503 ? 14.389  0.425   6.577   1.00 56.59  ? 503  TYR A CD2 1 
ATOM   3871 C CE1 . TYR A 1 503 ? 16.641  -1.030  5.868   1.00 55.45  ? 503  TYR A CE1 1 
ATOM   3872 C CE2 . TYR A 1 503 ? 14.971  0.607   5.326   1.00 56.99  ? 503  TYR A CE2 1 
ATOM   3873 C CZ  . TYR A 1 503 ? 16.090  -0.124  4.976   1.00 56.49  ? 503  TYR A CZ  1 
ATOM   3874 O OH  . TYR A 1 503 ? 16.644  0.060   3.725   1.00 56.34  ? 503  TYR A OH  1 
ATOM   3875 N N   . THR A 1 504 ? 13.122  -3.511  7.374   1.00 57.66  ? 504  THR A N   1 
ATOM   3876 C CA  . THR A 1 504 ? 13.514  -4.799  6.800   1.00 58.02  ? 504  THR A CA  1 
ATOM   3877 C C   . THR A 1 504 ? 13.944  -4.611  5.353   1.00 58.04  ? 504  THR A C   1 
ATOM   3878 O O   . THR A 1 504 ? 13.578  -3.619  4.736   1.00 57.97  ? 504  THR A O   1 
ATOM   3879 C CB  . THR A 1 504 ? 12.340  -5.819  6.821   1.00 58.29  ? 504  THR A CB  1 
ATOM   3880 O OG1 . THR A 1 504 ? 11.241  -5.312  6.045   1.00 58.13  ? 504  THR A OG1 1 
ATOM   3881 C CG2 . THR A 1 504 ? 11.878  -6.111  8.257   1.00 57.90  ? 504  THR A CG2 1 
ATOM   3882 N N   . THR A 1 505 ? 14.714  -5.566  4.827   1.00 58.25  ? 505  THR A N   1 
ATOM   3883 C CA  . THR A 1 505 ? 15.038  -5.651  3.402   1.00 58.55  ? 505  THR A CA  1 
ATOM   3884 C C   . THR A 1 505 ? 13.757  -5.729  2.590   1.00 58.73  ? 505  THR A C   1 
ATOM   3885 O O   . THR A 1 505 ? 13.610  -5.020  1.596   1.00 58.81  ? 505  THR A O   1 
ATOM   3886 C CB  . THR A 1 505 ? 15.895  -6.900  3.115   1.00 58.70  ? 505  THR A CB  1 
ATOM   3887 O OG1 . THR A 1 505 ? 17.233  -6.659  3.558   1.00 59.84  ? 505  THR A OG1 1 
ATOM   3888 C CG2 . THR A 1 505 ? 15.915  -7.272  1.616   1.00 58.64  ? 505  THR A CG2 1 
ATOM   3889 N N   . ALA A 1 506 ? 12.835  -6.582  3.037   1.00 59.00  ? 506  ALA A N   1 
ATOM   3890 C CA  . ALA A 1 506 ? 11.496  -6.732  2.444   1.00 59.04  ? 506  ALA A CA  1 
ATOM   3891 C C   . ALA A 1 506 ? 10.727  -5.427  2.252   1.00 58.77  ? 506  ALA A C   1 
ATOM   3892 O O   . ALA A 1 506 ? 10.258  -5.143  1.154   1.00 58.96  ? 506  ALA A O   1 
ATOM   3893 C CB  . ALA A 1 506 ? 10.641  -7.714  3.283   1.00 59.43  ? 506  ALA A CB  1 
ATOM   3894 N N   . ALA A 1 507 ? 10.602  -4.639  3.316   1.00 58.37  ? 507  ALA A N   1 
ATOM   3895 C CA  . ALA A 1 507 ? 9.661   -3.517  3.325   1.00 58.02  ? 507  ALA A CA  1 
ATOM   3896 C C   . ALA A 1 507 ? 10.300  -2.137  3.425   1.00 57.60  ? 507  ALA A C   1 
ATOM   3897 O O   . ALA A 1 507 ? 9.649   -1.134  3.160   1.00 57.26  ? 507  ALA A O   1 
ATOM   3898 C CB  . ALA A 1 507 ? 8.639   -3.711  4.441   1.00 58.07  ? 507  ALA A CB  1 
ATOM   3899 N N   . GLN A 1 508 ? 11.566  -2.099  3.822   1.00 57.52  ? 508  GLN A N   1 
ATOM   3900 C CA  . GLN A 1 508 ? 12.315  -0.852  3.975   1.00 57.74  ? 508  GLN A CA  1 
ATOM   3901 C C   . GLN A 1 508 ? 11.471  0.242   4.627   1.00 57.72  ? 508  GLN A C   1 
ATOM   3902 O O   . GLN A 1 508 ? 11.427  1.385   4.155   1.00 57.81  ? 508  GLN A O   1 
ATOM   3903 C CB  . GLN A 1 508 ? 12.872  -0.368  2.630   1.00 57.59  ? 508  GLN A CB  1 
ATOM   3904 C CG  . GLN A 1 508 ? 13.638  -1.417  1.847   1.00 57.93  ? 508  GLN A CG  1 
ATOM   3905 C CD  . GLN A 1 508 ? 14.078  -0.911  0.489   1.00 58.37  ? 508  GLN A CD  1 
ATOM   3906 O OE1 . GLN A 1 508 ? 14.913  -0.012  0.391   1.00 59.91  ? 508  GLN A OE1 1 
ATOM   3907 N NE2 . GLN A 1 508 ? 13.521  -1.488  -0.569  1.00 59.05  ? 508  GLN A NE2 1 
ATOM   3908 N N   . GLN A 1 509 ? 10.802  -0.119  5.717   1.00 57.51  ? 509  GLN A N   1 
ATOM   3909 C CA  . GLN A 1 509 ? 9.912   0.801   6.411   1.00 57.40  ? 509  GLN A CA  1 
ATOM   3910 C C   . GLN A 1 509 ? 10.602  1.628   7.486   1.00 56.92  ? 509  GLN A C   1 
ATOM   3911 O O   . GLN A 1 509 ? 11.404  1.114   8.280   1.00 57.23  ? 509  GLN A O   1 
ATOM   3912 C CB  . GLN A 1 509 ? 8.771   0.042   7.066   1.00 57.72  ? 509  GLN A CB  1 
ATOM   3913 C CG  . GLN A 1 509 ? 7.800   -0.609  6.120   1.00 58.67  ? 509  GLN A CG  1 
ATOM   3914 C CD  . GLN A 1 509 ? 6.830   -1.481  6.869   1.00 59.79  ? 509  GLN A CD  1 
ATOM   3915 O OE1 . GLN A 1 509 ? 7.179   -2.585  7.289   1.00 59.93  ? 509  GLN A OE1 1 
ATOM   3916 N NE2 . GLN A 1 509 ? 5.606   -0.983  7.069   1.00 60.90  ? 509  GLN A NE2 1 
ATOM   3917 N N   . TYR A 1 510 ? 10.247  2.905   7.522   1.00 56.01  ? 510  TYR A N   1 
ATOM   3918 C CA  . TYR A 1 510 ? 10.731  3.824   8.533   1.00 55.37  ? 510  TYR A CA  1 
ATOM   3919 C C   . TYR A 1 510 ? 9.610   4.788   8.828   1.00 55.14  ? 510  TYR A C   1 
ATOM   3920 O O   . TYR A 1 510 ? 8.600   4.794   8.124   1.00 55.33  ? 510  TYR A O   1 
ATOM   3921 C CB  . TYR A 1 510 ? 11.947  4.589   8.025   1.00 55.48  ? 510  TYR A CB  1 
ATOM   3922 C CG  . TYR A 1 510 ? 11.687  5.478   6.823   1.00 55.38  ? 510  TYR A CG  1 
ATOM   3923 C CD1 . TYR A 1 510 ? 11.578  4.939   5.543   1.00 54.78  ? 510  TYR A CD1 1 
ATOM   3924 C CD2 . TYR A 1 510 ? 11.573  6.860   6.965   1.00 54.73  ? 510  TYR A CD2 1 
ATOM   3925 C CE1 . TYR A 1 510 ? 11.348  5.746   4.446   1.00 54.78  ? 510  TYR A CE1 1 
ATOM   3926 C CE2 . TYR A 1 510 ? 11.345  7.673   5.867   1.00 55.21  ? 510  TYR A CE2 1 
ATOM   3927 C CZ  . TYR A 1 510 ? 11.234  7.107   4.614   1.00 55.37  ? 510  TYR A CZ  1 
ATOM   3928 O OH  . TYR A 1 510 ? 11.004  7.905   3.521   1.00 56.26  ? 510  TYR A OH  1 
ATOM   3929 N N   . VAL A 1 511 ? 9.781   5.609   9.855   1.00 54.57  ? 511  VAL A N   1 
ATOM   3930 C CA  . VAL A 1 511 ? 8.717   6.507   10.263  1.00 53.99  ? 511  VAL A CA  1 
ATOM   3931 C C   . VAL A 1 511 ? 9.183   7.934   10.236  1.00 53.82  ? 511  VAL A C   1 
ATOM   3932 O O   . VAL A 1 511 ? 10.372  8.211   10.414  1.00 54.00  ? 511  VAL A O   1 
ATOM   3933 C CB  . VAL A 1 511 ? 8.206   6.199   11.682  1.00 54.12  ? 511  VAL A CB  1 
ATOM   3934 C CG1 . VAL A 1 511 ? 7.585   4.824   11.733  1.00 54.08  ? 511  VAL A CG1 1 
ATOM   3935 C CG2 . VAL A 1 511 ? 9.324   6.336   12.713  1.00 53.53  ? 511  VAL A CG2 1 
ATOM   3936 N N   . SER A 1 512 ? 8.237   8.839   10.022  1.00 53.31  ? 512  SER A N   1 
ATOM   3937 C CA  . SER A 1 512 ? 8.522   10.250  10.101  1.00 52.92  ? 512  SER A CA  1 
ATOM   3938 C C   . SER A 1 512 ? 8.369   10.727  11.533  1.00 52.67  ? 512  SER A C   1 
ATOM   3939 O O   . SER A 1 512 ? 7.436   10.346  12.235  1.00 52.72  ? 512  SER A O   1 
ATOM   3940 C CB  . SER A 1 512 ? 7.605   11.037  9.165   1.00 53.10  ? 512  SER A CB  1 
ATOM   3941 O OG  . SER A 1 512 ? 6.251   11.020  9.590   1.00 53.75  ? 512  SER A OG  1 
ATOM   3942 N N   . LEU A 1 513 ? 9.304   11.556  11.966  1.00 52.51  ? 513  LEU A N   1 
ATOM   3943 C CA  . LEU A 1 513 ? 9.183   12.231  13.237  1.00 52.35  ? 513  LEU A CA  1 
ATOM   3944 C C   . LEU A 1 513 ? 8.905   13.712  13.011  1.00 52.80  ? 513  LEU A C   1 
ATOM   3945 O O   . LEU A 1 513 ? 9.755   14.444  12.492  1.00 52.86  ? 513  LEU A O   1 
ATOM   3946 C CB  . LEU A 1 513 ? 10.453  12.032  14.057  1.00 52.01  ? 513  LEU A CB  1 
ATOM   3947 C CG  . LEU A 1 513 ? 10.788  10.604  14.458  1.00 50.83  ? 513  LEU A CG  1 
ATOM   3948 C CD1 . LEU A 1 513 ? 12.133  10.548  15.136  1.00 49.98  ? 513  LEU A CD1 1 
ATOM   3949 C CD2 . LEU A 1 513 ? 9.729   10.080  15.381  1.00 50.65  ? 513  LEU A CD2 1 
ATOM   3950 N N   . ASN A 1 514 ? 7.701   14.136  13.376  1.00 53.42  ? 514  ASN A N   1 
ATOM   3951 C CA  . ASN A 1 514 ? 7.308   15.546  13.343  1.00 54.61  ? 514  ASN A CA  1 
ATOM   3952 C C   . ASN A 1 514 ? 6.076   15.761  14.217  1.00 55.17  ? 514  ASN A C   1 
ATOM   3953 O O   . ASN A 1 514 ? 5.664   14.843  14.936  1.00 55.57  ? 514  ASN A O   1 
ATOM   3954 C CB  . ASN A 1 514 ? 7.033   16.000  11.915  1.00 54.91  ? 514  ASN A CB  1 
ATOM   3955 C CG  . ASN A 1 514 ? 5.910   15.229  11.280  1.00 55.95  ? 514  ASN A CG  1 
ATOM   3956 O OD1 . ASN A 1 514 ? 4.759   15.348  11.702  1.00 57.26  ? 514  ASN A OD1 1 
ATOM   3957 N ND2 . ASN A 1 514 ? 6.234   14.411  10.275  1.00 56.01  ? 514  ASN A ND2 1 
ATOM   3958 N N   . LEU A 1 515 ? 5.473   16.948  14.152  1.00 55.72  ? 515  LEU A N   1 
ATOM   3959 C CA  . LEU A 1 515 ? 4.414   17.305  15.120  1.00 56.38  ? 515  LEU A CA  1 
ATOM   3960 C C   . LEU A 1 515 ? 3.170   16.437  15.020  1.00 56.69  ? 515  LEU A C   1 
ATOM   3961 O O   . LEU A 1 515 ? 2.400   16.356  15.962  1.00 56.64  ? 515  LEU A O   1 
ATOM   3962 C CB  . LEU A 1 515 ? 4.042   18.793  15.054  1.00 56.11  ? 515  LEU A CB  1 
ATOM   3963 C CG  . LEU A 1 515 ? 5.183   19.801  15.229  1.00 56.12  ? 515  LEU A CG  1 
ATOM   3964 C CD1 . LEU A 1 515 ? 4.701   21.210  14.951  1.00 56.89  ? 515  LEU A CD1 1 
ATOM   3965 C CD2 . LEU A 1 515 ? 5.807   19.730  16.603  1.00 56.16  ? 515  LEU A CD2 1 
ATOM   3966 N N   . LYS A 1 516 ? 3.002   15.780  13.878  1.00 57.46  ? 516  LYS A N   1 
ATOM   3967 C CA  . LYS A 1 516 ? 1.871   14.886  13.630  1.00 58.32  ? 516  LYS A CA  1 
ATOM   3968 C C   . LYS A 1 516 ? 2.165   13.509  14.237  1.00 58.27  ? 516  LYS A C   1 
ATOM   3969 O O   . LYS A 1 516 ? 3.318   13.206  14.555  1.00 58.46  ? 516  LYS A O   1 
ATOM   3970 C CB  . LYS A 1 516 ? 1.606   14.771  12.116  1.00 58.13  ? 516  LYS A CB  1 
ATOM   3971 C CG  . LYS A 1 516 ? 1.095   16.070  11.433  1.00 59.01  ? 516  LYS A CG  1 
ATOM   3972 C CD  . LYS A 1 516 ? 1.183   16.008  9.874   1.00 59.73  ? 516  LYS A CD  1 
ATOM   3973 C CE  . LYS A 1 516 ? 0.238   14.933  9.227   1.00 62.37  ? 516  LYS A CE  1 
ATOM   3974 N NZ  . LYS A 1 516 ? 0.101   14.989  7.716   1.00 60.65  ? 516  LYS A NZ  1 
ATOM   3975 N N   . PRO A 1 517 ? 1.124   12.680  14.441  1.00 58.42  ? 517  PRO A N   1 
ATOM   3976 C CA  . PRO A 1 517 ? 1.365   11.276  14.816  1.00 58.25  ? 517  PRO A CA  1 
ATOM   3977 C C   . PRO A 1 517 ? 2.283   10.543  13.824  1.00 58.03  ? 517  PRO A C   1 
ATOM   3978 O O   . PRO A 1 517 ? 2.504   11.027  12.704  1.00 57.91  ? 517  PRO A O   1 
ATOM   3979 C CB  . PRO A 1 517 ? -0.043  10.662  14.799  1.00 58.16  ? 517  PRO A CB  1 
ATOM   3980 C CG  . PRO A 1 517 ? -0.947  11.809  15.089  1.00 58.54  ? 517  PRO A CG  1 
ATOM   3981 C CD  . PRO A 1 517 ? -0.317  13.002  14.407  1.00 58.45  ? 517  PRO A CD  1 
ATOM   3982 N N   . LEU A 1 518 ? 2.801   9.384   14.231  1.00 57.65  ? 518  LEU A N   1 
ATOM   3983 C CA  . LEU A 1 518 ? 3.720   8.632   13.388  1.00 57.52  ? 518  LEU A CA  1 
ATOM   3984 C C   . LEU A 1 518 ? 3.115   8.241   12.059  1.00 57.62  ? 518  LEU A C   1 
ATOM   3985 O O   . LEU A 1 518 ? 1.952   7.869   11.988  1.00 57.94  ? 518  LEU A O   1 
ATOM   3986 C CB  . LEU A 1 518 ? 4.238   7.380   14.098  1.00 57.56  ? 518  LEU A CB  1 
ATOM   3987 C CG  . LEU A 1 518 ? 5.415   7.486   15.068  1.00 57.02  ? 518  LEU A CG  1 
ATOM   3988 C CD1 . LEU A 1 518 ? 6.295   6.255   14.953  1.00 55.47  ? 518  LEU A CD1 1 
ATOM   3989 C CD2 . LEU A 1 518 ? 6.227   8.745   14.811  1.00 57.65  ? 518  LEU A CD2 1 
ATOM   3990 N N   . GLU A 1 519 ? 3.925   8.321   11.011  1.00 57.72  ? 519  GLU A N   1 
ATOM   3991 C CA  . GLU A 1 519 ? 3.533   7.911   9.671   1.00 57.92  ? 519  GLU A CA  1 
ATOM   3992 C C   . GLU A 1 519 ? 4.602   6.973   9.135   1.00 57.06  ? 519  GLU A C   1 
ATOM   3993 O O   . GLU A 1 519 ? 5.792   7.279   9.217   1.00 57.41  ? 519  GLU A O   1 
ATOM   3994 C CB  . GLU A 1 519 ? 3.400   9.147   8.779   1.00 57.62  ? 519  GLU A CB  1 
ATOM   3995 C CG  . GLU A 1 519 ? 3.288   8.867   7.274   1.00 59.02  ? 519  GLU A CG  1 
ATOM   3996 C CD  . GLU A 1 519 ? 3.052   10.145  6.458   1.00 59.82  ? 519  GLU A CD  1 
ATOM   3997 O OE1 . GLU A 1 519 ? 2.320   11.032  6.972   1.00 62.81  ? 519  GLU A OE1 1 
ATOM   3998 O OE2 . GLU A 1 519 ? 3.590   10.269  5.319   1.00 60.82  ? 519  GLU A OE2 1 
ATOM   3999 N N   . VAL A 1 520 ? 4.195   5.826   8.605   1.00 56.19  ? 520  VAL A N   1 
ATOM   4000 C CA  . VAL A 1 520 ? 5.165   4.911   8.003   1.00 55.28  ? 520  VAL A CA  1 
ATOM   4001 C C   . VAL A 1 520 ? 5.392   5.327   6.554   1.00 55.23  ? 520  VAL A C   1 
ATOM   4002 O O   . VAL A 1 520 ? 4.470   5.787   5.882   1.00 55.47  ? 520  VAL A O   1 
ATOM   4003 C CB  . VAL A 1 520 ? 4.733   3.422   8.131   1.00 55.04  ? 520  VAL A CB  1 
ATOM   4004 C CG1 . VAL A 1 520 ? 5.624   2.493   7.322   1.00 54.48  ? 520  VAL A CG1 1 
ATOM   4005 C CG2 . VAL A 1 520 ? 4.771   3.000   9.568   1.00 54.45  ? 520  VAL A CG2 1 
ATOM   4006 N N   . ARG A 1 521 ? 6.635   5.217   6.096   1.00 54.90  ? 521  ARG A N   1 
ATOM   4007 C CA  . ARG A 1 521 ? 6.969   5.419   4.693   1.00 54.53  ? 521  ARG A CA  1 
ATOM   4008 C C   . ARG A 1 521 ? 7.809   4.242   4.304   1.00 54.93  ? 521  ARG A C   1 
ATOM   4009 O O   . ARG A 1 521 ? 8.357   3.566   5.174   1.00 54.71  ? 521  ARG A O   1 
ATOM   4010 C CB  . ARG A 1 521 ? 7.761   6.704   4.480   1.00 54.28  ? 521  ARG A CB  1 
ATOM   4011 C CG  . ARG A 1 521 ? 7.284   7.864   5.311   1.00 52.92  ? 521  ARG A CG  1 
ATOM   4012 C CD  . ARG A 1 521 ? 7.206   9.123   4.518   1.00 51.49  ? 521  ARG A CD  1 
ATOM   4013 N NE  . ARG A 1 521 ? 6.547   10.139  5.320   1.00 51.21  ? 521  ARG A NE  1 
ATOM   4014 C CZ  . ARG A 1 521 ? 7.083   11.310  5.646   1.00 51.23  ? 521  ARG A CZ  1 
ATOM   4015 N NH1 . ARG A 1 521 ? 8.299   11.643  5.204   1.00 49.82  ? 521  ARG A NH1 1 
ATOM   4016 N NH2 . ARG A 1 521 ? 6.386   12.152  6.405   1.00 50.00  ? 521  ARG A NH2 1 
ATOM   4017 N N   . ARG A 1 522 ? 7.895   3.986   3.004   1.00 55.66  ? 522  ARG A N   1 
ATOM   4018 C CA  . ARG A 1 522 ? 8.680   2.869   2.486   1.00 57.02  ? 522  ARG A CA  1 
ATOM   4019 C C   . ARG A 1 522 ? 9.788   3.422   1.594   1.00 56.61  ? 522  ARG A C   1 
ATOM   4020 O O   . ARG A 1 522 ? 9.542   4.261   0.730   1.00 56.44  ? 522  ARG A O   1 
ATOM   4021 C CB  . ARG A 1 522 ? 7.806   1.872   1.695   1.00 56.99  ? 522  ARG A CB  1 
ATOM   4022 C CG  . ARG A 1 522 ? 6.675   1.127   2.477   1.00 58.68  ? 522  ARG A CG  1 
ATOM   4023 C CD  . ARG A 1 522 ? 6.210   -0.145  1.717   1.00 59.88  ? 522  ARG A CD  1 
ATOM   4024 N NE  . ARG A 1 522 ? 7.360   -0.875  1.139   1.00 67.43  ? 522  ARG A NE  1 
ATOM   4025 C CZ  . ARG A 1 522 ? 7.318   -1.726  0.102   1.00 69.60  ? 522  ARG A CZ  1 
ATOM   4026 N NH1 . ARG A 1 522 ? 6.168   -2.002  -0.515  1.00 71.43  ? 522  ARG A NH1 1 
ATOM   4027 N NH2 . ARG A 1 522 ? 8.439   -2.310  -0.327  1.00 69.28  ? 522  ARG A NH2 1 
ATOM   4028 N N   . GLY A 1 523 ? 11.011  2.958   1.814   1.00 56.83  ? 523  GLY A N   1 
ATOM   4029 C CA  . GLY A 1 523 ? 12.132  3.351   0.973   1.00 57.09  ? 523  GLY A CA  1 
ATOM   4030 C C   . GLY A 1 523 ? 12.818  4.626   1.418   1.00 57.20  ? 523  GLY A C   1 
ATOM   4031 O O   . GLY A 1 523 ? 12.245  5.715   1.347   1.00 57.41  ? 523  GLY A O   1 
ATOM   4032 N N   . LEU A 1 524 ? 14.060  4.472   1.864   1.00 57.20  ? 524  LEU A N   1 
ATOM   4033 C CA  . LEU A 1 524 ? 14.881  5.565   2.342   1.00 57.31  ? 524  LEU A CA  1 
ATOM   4034 C C   . LEU A 1 524 ? 15.732  6.077   1.197   1.00 57.21  ? 524  LEU A C   1 
ATOM   4035 O O   . LEU A 1 524 ? 16.753  5.466   0.866   1.00 57.00  ? 524  LEU A O   1 
ATOM   4036 C CB  . LEU A 1 524 ? 15.768  5.043   3.462   1.00 57.57  ? 524  LEU A CB  1 
ATOM   4037 C CG  . LEU A 1 524 ? 16.208  5.992   4.573   1.00 58.65  ? 524  LEU A CG  1 
ATOM   4038 C CD1 . LEU A 1 524 ? 15.380  7.290   4.605   1.00 59.83  ? 524  LEU A CD1 1 
ATOM   4039 C CD2 . LEU A 1 524 ? 16.120  5.235   5.898   1.00 59.32  ? 524  LEU A CD2 1 
ATOM   4040 N N   . ARG A 1 525 ? 15.304  7.193   0.601   1.00 57.36  ? 525  ARG A N   1 
ATOM   4041 C CA  . ARG A 1 525 ? 15.848  7.678   -0.675  1.00 57.87  ? 525  ARG A CA  1 
ATOM   4042 C C   . ARG A 1 525 ? 16.276  6.476   -1.504  1.00 57.55  ? 525  ARG A C   1 
ATOM   4043 O O   . ARG A 1 525 ? 17.458  6.325   -1.815  1.00 57.96  ? 525  ARG A O   1 
ATOM   4044 C CB  . ARG A 1 525 ? 17.063  8.616   -0.487  1.00 58.33  ? 525  ARG A CB  1 
ATOM   4045 C CG  . ARG A 1 525 ? 16.831  9.914   0.300   1.00 59.87  ? 525  ARG A CG  1 
ATOM   4046 C CD  . ARG A 1 525 ? 16.448  11.103  -0.572  1.00 61.69  ? 525  ARG A CD  1 
ATOM   4047 N NE  . ARG A 1 525 ? 16.819  12.374  0.059   1.00 63.83  ? 525  ARG A NE  1 
ATOM   4048 C CZ  . ARG A 1 525 ? 16.157  12.959  1.065   1.00 65.97  ? 525  ARG A CZ  1 
ATOM   4049 N NH1 . ARG A 1 525 ? 15.066  12.397  1.593   1.00 67.20  ? 525  ARG A NH1 1 
ATOM   4050 N NH2 . ARG A 1 525 ? 16.579  14.123  1.551   1.00 65.60  ? 525  ARG A NH2 1 
ATOM   4051 N N   . ALA A 1 526 ? 15.322  5.614   -1.846  1.00 57.18  ? 526  ALA A N   1 
ATOM   4052 C CA  . ALA A 1 526 ? 15.654  4.312   -2.424  1.00 56.52  ? 526  ALA A CA  1 
ATOM   4053 C C   . ALA A 1 526 ? 16.404  4.402   -3.747  1.00 56.09  ? 526  ALA A C   1 
ATOM   4054 O O   . ALA A 1 526 ? 17.497  3.834   -3.860  1.00 56.20  ? 526  ALA A O   1 
ATOM   4055 C CB  . ALA A 1 526 ? 14.423  3.440   -2.551  1.00 56.71  ? 526  ALA A CB  1 
ATOM   4056 N N   . GLN A 1 527 ? 15.841  5.126   -4.721  1.00 55.33  ? 527  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 527 ? 16.451  5.226   -6.057  1.00 54.74  ? 527  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 527 ? 17.850  5.830   -5.977  1.00 53.65  ? 527  GLN A C   1 
ATOM   4059 O O   . GLN A 1 527 ? 18.821  5.250   -6.460  1.00 53.07  ? 527  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 527 ? 15.582  6.050   -7.026  1.00 54.93  ? 527  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 527 ? 14.402  5.303   -7.684  1.00 57.26  ? 527  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 527 ? 14.782  3.964   -8.347  1.00 60.22  ? 527  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 527 ? 14.465  2.889   -7.819  1.00 62.09  ? 527  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 527 ? 15.447  4.027   -9.505  1.00 60.63  ? 527  GLN A NE2 1 
ATOM   4065 N N   . THR A 1 528 ? 17.924  6.998   -5.348  1.00 52.66  ? 528  THR A N   1 
ATOM   4066 C CA  . THR A 1 528 ? 19.144  7.776   -5.260  1.00 51.69  ? 528  THR A CA  1 
ATOM   4067 C C   . THR A 1 528 ? 20.222  7.017   -4.498  1.00 51.23  ? 528  THR A C   1 
ATOM   4068 O O   . THR A 1 528 ? 21.380  7.005   -4.914  1.00 51.12  ? 528  THR A O   1 
ATOM   4069 C CB  . THR A 1 528 ? 18.862  9.137   -4.601  1.00 51.61  ? 528  THR A CB  1 
ATOM   4070 O OG1 . THR A 1 528 ? 17.902  9.832   -5.393  1.00 51.69  ? 528  THR A OG1 1 
ATOM   4071 C CG2 . THR A 1 528 ? 20.109  9.980   -4.505  1.00 51.08  ? 528  THR A CG2 1 
ATOM   4072 N N   . CYS A 1 529 ? 19.858  6.367   -3.396  1.00 50.34  ? 529  CYS A N   1 
ATOM   4073 C CA  . CYS A 1 529 ? 20.881  5.685   -2.624  1.00 49.79  ? 529  CYS A CA  1 
ATOM   4074 C C   . CYS A 1 529 ? 21.426  4.506   -3.389  1.00 49.62  ? 529  CYS A C   1 
ATOM   4075 O O   . CYS A 1 529 ? 22.586  4.132   -3.223  1.00 49.59  ? 529  CYS A O   1 
ATOM   4076 C CB  . CYS A 1 529 ? 20.422  5.338   -1.216  1.00 49.17  ? 529  CYS A CB  1 
ATOM   4077 S SG  . CYS A 1 529 ? 20.499  6.817   -0.127  1.00 50.18  ? 529  CYS A SG  1 
ATOM   4078 N N   . ALA A 1 530 ? 20.600  3.965   -4.278  1.00 49.59  ? 530  ALA A N   1 
ATOM   4079 C CA  . ALA A 1 530 ? 21.073  2.960   -5.213  1.00 49.61  ? 530  ALA A CA  1 
ATOM   4080 C C   . ALA A 1 530 ? 22.190  3.535   -6.071  1.00 49.36  ? 530  ALA A C   1 
ATOM   4081 O O   . ALA A 1 530 ? 23.144  2.842   -6.402  1.00 49.72  ? 530  ALA A O   1 
ATOM   4082 C CB  . ALA A 1 530 ? 19.951  2.449   -6.072  1.00 49.62  ? 530  ALA A CB  1 
ATOM   4083 N N   . PHE A 1 531 ? 22.077  4.810   -6.408  1.00 49.00  ? 531  PHE A N   1 
ATOM   4084 C CA  . PHE A 1 531 ? 23.104  5.475   -7.182  1.00 48.76  ? 531  PHE A CA  1 
ATOM   4085 C C   . PHE A 1 531 ? 24.423  5.522   -6.409  1.00 48.65  ? 531  PHE A C   1 
ATOM   4086 O O   . PHE A 1 531 ? 25.446  5.050   -6.901  1.00 48.47  ? 531  PHE A O   1 
ATOM   4087 C CB  . PHE A 1 531 ? 22.629  6.874   -7.565  1.00 48.81  ? 531  PHE A CB  1 
ATOM   4088 C CG  . PHE A 1 531 ? 23.675  7.713   -8.213  1.00 48.70  ? 531  PHE A CG  1 
ATOM   4089 C CD1 . PHE A 1 531 ? 23.931  7.597   -9.566  1.00 48.43  ? 531  PHE A CD1 1 
ATOM   4090 C CD2 . PHE A 1 531 ? 24.398  8.632   -7.469  1.00 48.75  ? 531  PHE A CD2 1 
ATOM   4091 C CE1 . PHE A 1 531 ? 24.902  8.373   -10.171 1.00 48.63  ? 531  PHE A CE1 1 
ATOM   4092 C CE2 . PHE A 1 531 ? 25.369  9.412   -8.065  1.00 49.11  ? 531  PHE A CE2 1 
ATOM   4093 C CZ  . PHE A 1 531 ? 25.614  9.286   -9.423  1.00 49.20  ? 531  PHE A CZ  1 
ATOM   4094 N N   . TRP A 1 532 ? 24.381  6.065   -5.193  1.00 48.68  ? 532  TRP A N   1 
ATOM   4095 C CA  . TRP A 1 532 ? 25.580  6.268   -4.385  1.00 48.85  ? 532  TRP A CA  1 
ATOM   4096 C C   . TRP A 1 532 ? 26.187  4.972   -3.887  1.00 50.03  ? 532  TRP A C   1 
ATOM   4097 O O   . TRP A 1 532 ? 27.409  4.803   -3.934  1.00 50.22  ? 532  TRP A O   1 
ATOM   4098 C CB  . TRP A 1 532 ? 25.289  7.163   -3.195  1.00 47.71  ? 532  TRP A CB  1 
ATOM   4099 C CG  . TRP A 1 532 ? 24.959  8.566   -3.550  1.00 47.03  ? 532  TRP A CG  1 
ATOM   4100 C CD1 . TRP A 1 532 ? 23.713  9.133   -3.589  1.00 46.75  ? 532  TRP A CD1 1 
ATOM   4101 C CD2 . TRP A 1 532 ? 25.879  9.606   -3.896  1.00 46.29  ? 532  TRP A CD2 1 
ATOM   4102 N NE1 . TRP A 1 532 ? 23.801  10.461  -3.945  1.00 46.18  ? 532  TRP A NE1 1 
ATOM   4103 C CE2 . TRP A 1 532 ? 25.119  10.776  -4.139  1.00 45.95  ? 532  TRP A CE2 1 
ATOM   4104 C CE3 . TRP A 1 532 ? 27.275  9.665   -4.028  1.00 46.42  ? 532  TRP A CE3 1 
ATOM   4105 C CZ2 . TRP A 1 532 ? 25.704  11.982  -4.503  1.00 45.77  ? 532  TRP A CZ2 1 
ATOM   4106 C CZ3 . TRP A 1 532 ? 27.859  10.873  -4.386  1.00 46.03  ? 532  TRP A CZ3 1 
ATOM   4107 C CH2 . TRP A 1 532 ? 27.073  12.011  -4.621  1.00 46.65  ? 532  TRP A CH2 1 
ATOM   4108 N N   . ASN A 1 533 ? 25.343  4.059   -3.412  1.00 51.38  ? 533  ASN A N   1 
ATOM   4109 C CA  . ASN A 1 533 ? 25.821  2.804   -2.835  1.00 52.79  ? 533  ASN A CA  1 
ATOM   4110 C C   . ASN A 1 533 ? 26.177  1.713   -3.844  1.00 53.57  ? 533  ASN A C   1 
ATOM   4111 O O   . ASN A 1 533 ? 27.131  0.968   -3.644  1.00 53.45  ? 533  ASN A O   1 
ATOM   4112 C CB  . ASN A 1 533 ? 24.815  2.252   -1.842  1.00 52.91  ? 533  ASN A CB  1 
ATOM   4113 C CG  . ASN A 1 533 ? 24.511  3.216   -0.716  1.00 54.55  ? 533  ASN A CG  1 
ATOM   4114 O OD1 . ASN A 1 533 ? 25.079  4.311   -0.634  1.00 56.20  ? 533  ASN A OD1 1 
ATOM   4115 N ND2 . ASN A 1 533 ? 23.601  2.810   0.170   1.00 55.62  ? 533  ASN A ND2 1 
ATOM   4116 N N   . ARG A 1 534 ? 25.410  1.599   -4.919  1.00 54.67  ? 534  ARG A N   1 
ATOM   4117 C CA  . ARG A 1 534 ? 25.656  0.511   -5.864  1.00 55.74  ? 534  ARG A CA  1 
ATOM   4118 C C   . ARG A 1 534 ? 26.416  0.961   -7.095  1.00 56.44  ? 534  ARG A C   1 
ATOM   4119 O O   . ARG A 1 534 ? 27.420  0.351   -7.449  1.00 56.90  ? 534  ARG A O   1 
ATOM   4120 C CB  . ARG A 1 534 ? 24.359  -0.175  -6.278  1.00 55.52  ? 534  ARG A CB  1 
ATOM   4121 C CG  . ARG A 1 534 ? 23.619  -0.794  -5.137  1.00 55.94  ? 534  ARG A CG  1 
ATOM   4122 C CD  . ARG A 1 534 ? 22.105  -0.672  -5.343  1.00 56.21  ? 534  ARG A CD  1 
ATOM   4123 N NE  . ARG A 1 534 ? 21.358  -1.301  -4.253  1.00 56.96  ? 534  ARG A NE  1 
ATOM   4124 C CZ  . ARG A 1 534 ? 21.313  -2.618  -4.032  1.00 57.14  ? 534  ARG A CZ  1 
ATOM   4125 N NH1 . ARG A 1 534 ? 21.974  -3.465  -4.827  1.00 57.00  ? 534  ARG A NH1 1 
ATOM   4126 N NH2 . ARG A 1 534 ? 20.608  -3.092  -3.009  1.00 56.06  ? 534  ARG A NH2 1 
ATOM   4127 N N   . PHE A 1 535 ? 25.946  2.018   -7.749  1.00 57.08  ? 535  PHE A N   1 
ATOM   4128 C CA  . PHE A 1 535 ? 26.535  2.396   -9.012  1.00 57.69  ? 535  PHE A CA  1 
ATOM   4129 C C   . PHE A 1 535 ? 27.844  3.132   -8.847  1.00 58.66  ? 535  PHE A C   1 
ATOM   4130 O O   . PHE A 1 535 ? 28.855  2.737   -9.403  1.00 58.38  ? 535  PHE A O   1 
ATOM   4131 C CB  . PHE A 1 535 ? 25.575  3.211   -9.863  1.00 57.41  ? 535  PHE A CB  1 
ATOM   4132 C CG  . PHE A 1 535 ? 26.202  3.730   -11.112 1.00 56.91  ? 535  PHE A CG  1 
ATOM   4133 C CD1 . PHE A 1 535 ? 26.597  2.856   -12.114 1.00 56.38  ? 535  PHE A CD1 1 
ATOM   4134 C CD2 . PHE A 1 535 ? 26.437  5.092   -11.271 1.00 56.83  ? 535  PHE A CD2 1 
ATOM   4135 C CE1 . PHE A 1 535 ? 27.205  3.327   -13.264 1.00 56.84  ? 535  PHE A CE1 1 
ATOM   4136 C CE2 . PHE A 1 535 ? 27.041  5.582   -12.423 1.00 56.65  ? 535  PHE A CE2 1 
ATOM   4137 C CZ  . PHE A 1 535 ? 27.428  4.699   -13.423 1.00 56.99  ? 535  PHE A CZ  1 
ATOM   4138 N N   . LEU A 1 536 ? 27.827  4.209   -8.080  1.00 60.38  ? 536  LEU A N   1 
ATOM   4139 C CA  . LEU A 1 536 ? 28.981  5.076   -8.035  1.00 62.22  ? 536  LEU A CA  1 
ATOM   4140 C C   . LEU A 1 536 ? 30.300  4.355   -7.766  1.00 63.98  ? 536  LEU A C   1 
ATOM   4141 O O   . LEU A 1 536 ? 31.282  4.628   -8.456  1.00 64.23  ? 536  LEU A O   1 
ATOM   4142 C CB  . LEU A 1 536 ? 28.786  6.220   -7.059  1.00 62.05  ? 536  LEU A CB  1 
ATOM   4143 C CG  . LEU A 1 536 ? 29.517  7.436   -7.611  1.00 62.16  ? 536  LEU A CG  1 
ATOM   4144 C CD1 . LEU A 1 536 ? 28.691  8.023   -8.729  1.00 61.62  ? 536  LEU A CD1 1 
ATOM   4145 C CD2 . LEU A 1 536 ? 29.787  8.462   -6.525  1.00 62.55  ? 536  LEU A CD2 1 
ATOM   4146 N N   . PRO A 1 537 ? 30.341  3.440   -6.771  1.00 65.75  ? 537  PRO A N   1 
ATOM   4147 C CA  . PRO A 1 537 ? 31.600  2.722   -6.592  1.00 67.23  ? 537  PRO A CA  1 
ATOM   4148 C C   . PRO A 1 537 ? 32.142  2.198   -7.922  1.00 68.77  ? 537  PRO A C   1 
ATOM   4149 O O   . PRO A 1 537 ? 33.244  2.578   -8.317  1.00 68.93  ? 537  PRO A O   1 
ATOM   4150 C CB  . PRO A 1 537 ? 31.215  1.565   -5.663  1.00 67.11  ? 537  PRO A CB  1 
ATOM   4151 C CG  . PRO A 1 537 ? 30.115  2.114   -4.859  1.00 66.38  ? 537  PRO A CG  1 
ATOM   4152 C CD  . PRO A 1 537 ? 29.336  3.013   -5.777  1.00 65.89  ? 537  PRO A CD  1 
ATOM   4153 N N   . LYS A 1 538 ? 31.355  1.377   -8.618  1.00 70.50  ? 538  LYS A N   1 
ATOM   4154 C CA  . LYS A 1 538 ? 31.794  0.734   -9.860  1.00 72.42  ? 538  LYS A CA  1 
ATOM   4155 C C   . LYS A 1 538 ? 32.274  1.736   -10.908 1.00 73.66  ? 538  LYS A C   1 
ATOM   4156 O O   . LYS A 1 538 ? 33.079  1.396   -11.771 1.00 73.77  ? 538  LYS A O   1 
ATOM   4157 C CB  . LYS A 1 538 ? 30.704  -0.180  -10.428 1.00 72.25  ? 538  LYS A CB  1 
ATOM   4158 C CG  . LYS A 1 538 ? 29.900  -0.882  -9.348  1.00 73.65  ? 538  LYS A CG  1 
ATOM   4159 C CD  . LYS A 1 538 ? 29.661  -2.351  -9.646  1.00 75.89  ? 538  LYS A CD  1 
ATOM   4160 C CE  . LYS A 1 538 ? 29.310  -3.089  -8.354  1.00 77.00  ? 538  LYS A CE  1 
ATOM   4161 N NZ  . LYS A 1 538 ? 29.872  -4.467  -8.342  1.00 77.97  ? 538  LYS A NZ  1 
ATOM   4162 N N   . LEU A 1 539 ? 31.805  2.976   -10.817 1.00 75.55  ? 539  LEU A N   1 
ATOM   4163 C CA  . LEU A 1 539 ? 32.299  4.027   -11.697 1.00 77.48  ? 539  LEU A CA  1 
ATOM   4164 C C   . LEU A 1 539 ? 33.659  4.536   -11.213 1.00 79.08  ? 539  LEU A C   1 
ATOM   4165 O O   . LEU A 1 539 ? 34.068  5.662   -11.515 1.00 79.29  ? 539  LEU A O   1 
ATOM   4166 C CB  . LEU A 1 539 ? 31.286  5.164   -11.809 1.00 77.27  ? 539  LEU A CB  1 
ATOM   4167 C CG  . LEU A 1 539 ? 31.429  6.078   -13.026 1.00 77.37  ? 539  LEU A CG  1 
ATOM   4168 C CD1 . LEU A 1 539 ? 31.157  5.299   -14.299 1.00 77.16  ? 539  LEU A CD1 1 
ATOM   4169 C CD2 . LEU A 1 539 ? 30.503  7.283   -12.916 1.00 77.40  ? 539  LEU A CD2 1 
ATOM   4170 N N   . LEU A 1 540 ? 34.344  3.691   -10.444 1.00 81.03  ? 540  LEU A N   1 
ATOM   4171 C CA  . LEU A 1 540 ? 35.733  3.921   -10.029 1.00 82.82  ? 540  LEU A CA  1 
ATOM   4172 C C   . LEU A 1 540 ? 36.599  2.673   -10.289 1.00 83.74  ? 540  LEU A C   1 
ATOM   4173 O O   . LEU A 1 540 ? 37.827  2.768   -10.387 1.00 83.80  ? 540  LEU A O   1 
ATOM   4174 C CB  . LEU A 1 540 ? 35.808  4.418   -8.576  1.00 82.84  ? 540  LEU A CB  1 
ATOM   4175 C CG  . LEU A 1 540 ? 35.285  5.855   -8.385  1.00 83.74  ? 540  LEU A CG  1 
ATOM   4176 C CD1 . LEU A 1 540 ? 35.184  6.235   -6.906  1.00 84.26  ? 540  LEU A CD1 1 
ATOM   4177 C CD2 . LEU A 1 540 ? 36.124  6.896   -9.171  1.00 84.21  ? 540  LEU A CD2 1 
ATOM   4178 N N   . SER A 1 541 ? 35.944  1.514   -10.419 1.00 84.92  ? 541  SER A N   1 
ATOM   4179 C CA  . SER A 1 541 ? 36.518  0.354   -11.128 1.00 85.91  ? 541  SER A CA  1 
ATOM   4180 C C   . SER A 1 541 ? 36.526  0.667   -12.650 1.00 86.56  ? 541  SER A C   1 
ATOM   4181 O O   . SER A 1 541 ? 35.978  -0.095  -13.471 1.00 86.53  ? 541  SER A O   1 
ATOM   4182 C CB  . SER A 1 541 ? 35.729  -0.943  -10.834 1.00 85.89  ? 541  SER A CB  1 
ATOM   4183 O OG  . SER A 1 541 ? 35.521  -1.154  -9.443  1.00 85.44  ? 541  SER A OG  1 
ATOM   4184 N N   . ALA A 1 542 ? 37.136  1.812   -12.989 1.00 87.18  ? 542  ALA A N   1 
ATOM   4185 C CA  . ALA A 1 542 ? 37.222  2.357   -14.356 1.00 87.65  ? 542  ALA A CA  1 
ATOM   4186 C C   . ALA A 1 542 ? 38.306  3.441   -14.424 1.00 87.83  ? 542  ALA A C   1 
ATOM   4187 O O   . ALA A 1 542 ? 38.377  4.324   -13.562 1.00 87.99  ? 542  ALA A O   1 
ATOM   4188 C CB  . ALA A 1 542 ? 35.870  2.935   -14.813 1.00 87.58  ? 542  ALA A CB  1 
ATOM   4189 N N   . GLU B 1 4   ? -17.193 4.217   -68.862 1.00 78.80  ? 4    GLU B N   1 
ATOM   4190 C CA  . GLU B 1 4   ? -15.988 5.086   -68.696 1.00 78.60  ? 4    GLU B CA  1 
ATOM   4191 C C   . GLU B 1 4   ? -16.292 6.358   -67.875 1.00 78.30  ? 4    GLU B C   1 
ATOM   4192 O O   . GLU B 1 4   ? -16.628 7.416   -68.426 1.00 78.58  ? 4    GLU B O   1 
ATOM   4193 C CB  . GLU B 1 4   ? -15.359 5.419   -70.066 1.00 78.86  ? 4    GLU B CB  1 
ATOM   4194 C CG  . GLU B 1 4   ? -13.989 6.156   -70.026 1.00 79.57  ? 4    GLU B CG  1 
ATOM   4195 C CD  . GLU B 1 4   ? -12.859 5.354   -69.349 1.00 81.65  ? 4    GLU B CD  1 
ATOM   4196 O OE1 . GLU B 1 4   ? -12.660 5.498   -68.111 1.00 82.72  ? 4    GLU B OE1 1 
ATOM   4197 O OE2 . GLU B 1 4   ? -12.152 4.606   -70.063 1.00 81.01  ? 4    GLU B OE2 1 
ATOM   4198 N N   . ASP B 1 5   ? -16.174 6.226   -66.554 1.00 77.57  ? 5    ASP B N   1 
ATOM   4199 C CA  . ASP B 1 5   ? -16.357 7.318   -65.592 1.00 76.64  ? 5    ASP B CA  1 
ATOM   4200 C C   . ASP B 1 5   ? -15.205 8.321   -65.715 1.00 76.22  ? 5    ASP B C   1 
ATOM   4201 O O   . ASP B 1 5   ? -14.093 8.020   -65.297 1.00 76.35  ? 5    ASP B O   1 
ATOM   4202 C CB  . ASP B 1 5   ? -16.387 6.713   -64.181 1.00 76.41  ? 5    ASP B CB  1 
ATOM   4203 C CG  . ASP B 1 5   ? -16.733 7.719   -63.095 1.00 75.76  ? 5    ASP B CG  1 
ATOM   4204 O OD1 . ASP B 1 5   ? -17.068 7.241   -61.984 1.00 73.75  ? 5    ASP B OD1 1 
ATOM   4205 O OD2 . ASP B 1 5   ? -16.671 8.954   -63.331 1.00 75.11  ? 5    ASP B OD2 1 
ATOM   4206 N N   . PRO B 1 6   ? -15.468 9.526   -66.264 1.00 75.77  ? 6    PRO B N   1 
ATOM   4207 C CA  . PRO B 1 6   ? -14.356 10.440  -66.595 1.00 75.16  ? 6    PRO B CA  1 
ATOM   4208 C C   . PRO B 1 6   ? -13.629 10.951  -65.356 1.00 74.25  ? 6    PRO B C   1 
ATOM   4209 O O   . PRO B 1 6   ? -12.541 11.516  -65.470 1.00 74.24  ? 6    PRO B O   1 
ATOM   4210 C CB  . PRO B 1 6   ? -15.050 11.603  -67.316 1.00 75.22  ? 6    PRO B CB  1 
ATOM   4211 C CG  . PRO B 1 6   ? -16.439 11.598  -66.764 1.00 75.85  ? 6    PRO B CG  1 
ATOM   4212 C CD  . PRO B 1 6   ? -16.777 10.131  -66.569 1.00 75.93  ? 6    PRO B CD  1 
ATOM   4213 N N   . GLN B 1 7   ? -14.243 10.749  -64.191 1.00 72.95  ? 7    GLN B N   1 
ATOM   4214 C CA  . GLN B 1 7   ? -13.651 11.142  -62.921 1.00 71.63  ? 7    GLN B CA  1 
ATOM   4215 C C   . GLN B 1 7   ? -12.520 10.213  -62.531 1.00 70.63  ? 7    GLN B C   1 
ATOM   4216 O O   . GLN B 1 7   ? -11.620 10.610  -61.796 1.00 70.62  ? 7    GLN B O   1 
ATOM   4217 C CB  . GLN B 1 7   ? -14.713 11.170  -61.810 1.00 71.80  ? 7    GLN B CB  1 
ATOM   4218 C CG  . GLN B 1 7   ? -15.568 12.447  -61.774 1.00 71.58  ? 7    GLN B CG  1 
ATOM   4219 C CD  . GLN B 1 7   ? -14.790 13.666  -61.304 1.00 70.65  ? 7    GLN B CD  1 
ATOM   4220 O OE1 . GLN B 1 7   ? -14.826 14.004  -60.125 1.00 70.62  ? 7    GLN B OE1 1 
ATOM   4221 N NE2 . GLN B 1 7   ? -14.061 14.314  -62.221 1.00 69.59  ? 7    GLN B NE2 1 
ATOM   4222 N N   . LEU B 1 8   ? -12.581 8.979   -63.024 1.00 69.40  ? 8    LEU B N   1 
ATOM   4223 C CA  . LEU B 1 8   ? -11.584 7.955   -62.725 1.00 68.10  ? 8    LEU B CA  1 
ATOM   4224 C C   . LEU B 1 8   ? -10.546 7.837   -63.830 1.00 67.38  ? 8    LEU B C   1 
ATOM   4225 O O   . LEU B 1 8   ? -9.980  6.772   -64.029 1.00 67.43  ? 8    LEU B O   1 
ATOM   4226 C CB  . LEU B 1 8   ? -12.253 6.592   -62.536 1.00 67.89  ? 8    LEU B CB  1 
ATOM   4227 C CG  . LEU B 1 8   ? -13.354 6.400   -61.494 1.00 67.92  ? 8    LEU B CG  1 
ATOM   4228 C CD1 . LEU B 1 8   ? -13.814 4.933   -61.459 1.00 68.18  ? 8    LEU B CD1 1 
ATOM   4229 C CD2 . LEU B 1 8   ? -12.888 6.841   -60.120 1.00 68.50  ? 8    LEU B CD2 1 
ATOM   4230 N N   . LEU B 1 9   ? -10.294 8.927   -64.543 1.00 66.43  ? 9    LEU B N   1 
ATOM   4231 C CA  . LEU B 1 9   ? -9.418  8.893   -65.695 1.00 65.93  ? 9    LEU B CA  1 
ATOM   4232 C C   . LEU B 1 9   ? -8.501  10.106  -65.637 1.00 65.62  ? 9    LEU B C   1 
ATOM   4233 O O   . LEU B 1 9   ? -8.973  11.231  -65.660 1.00 65.75  ? 9    LEU B O   1 
ATOM   4234 C CB  . LEU B 1 9   ? -10.275 8.912   -66.964 1.00 65.84  ? 9    LEU B CB  1 
ATOM   4235 C CG  . LEU B 1 9   ? -9.713  8.546   -68.343 1.00 66.08  ? 9    LEU B CG  1 
ATOM   4236 C CD1 . LEU B 1 9   ? -9.699  7.048   -68.546 1.00 66.19  ? 9    LEU B CD1 1 
ATOM   4237 C CD2 . LEU B 1 9   ? -10.550 9.185   -69.440 1.00 66.26  ? 9    LEU B CD2 1 
ATOM   4238 N N   . VAL B 1 10  ? -7.195  9.892   -65.531 1.00 65.43  ? 10   VAL B N   1 
ATOM   4239 C CA  . VAL B 1 10  ? -6.265  11.016  -65.382 1.00 65.25  ? 10   VAL B CA  1 
ATOM   4240 C C   . VAL B 1 10  ? -5.096  10.898  -66.326 1.00 65.32  ? 10   VAL B C   1 
ATOM   4241 O O   . VAL B 1 10  ? -4.585  9.801   -66.538 1.00 65.33  ? 10   VAL B O   1 
ATOM   4242 C CB  . VAL B 1 10  ? -5.664  11.113  -63.961 1.00 65.24  ? 10   VAL B CB  1 
ATOM   4243 C CG1 . VAL B 1 10  ? -5.195  12.528  -63.698 1.00 65.21  ? 10   VAL B CG1 1 
ATOM   4244 C CG2 . VAL B 1 10  ? -6.661  10.699  -62.904 1.00 65.22  ? 10   VAL B CG2 1 
ATOM   4245 N N   . ARG B 1 11  ? -4.665  12.030  -66.873 1.00 65.53  ? 11   ARG B N   1 
ATOM   4246 C CA  . ARG B 1 11  ? -3.446  12.082  -67.676 1.00 66.31  ? 11   ARG B CA  1 
ATOM   4247 C C   . ARG B 1 11  ? -2.286  12.581  -66.824 1.00 65.94  ? 11   ARG B C   1 
ATOM   4248 O O   . ARG B 1 11  ? -2.243  13.755  -66.432 1.00 66.07  ? 11   ARG B O   1 
ATOM   4249 C CB  . ARG B 1 11  ? -3.623  12.952  -68.939 1.00 66.25  ? 11   ARG B CB  1 
ATOM   4250 C CG  . ARG B 1 11  ? -2.309  13.320  -69.671 1.00 67.42  ? 11   ARG B CG  1 
ATOM   4251 C CD  . ARG B 1 11  ? -2.520  13.736  -71.146 1.00 68.22  ? 11   ARG B CD  1 
ATOM   4252 N NE  . ARG B 1 11  ? -2.317  12.620  -72.082 1.00 72.38  ? 11   ARG B NE  1 
ATOM   4253 C CZ  . ARG B 1 11  ? -3.258  11.739  -72.440 1.00 74.31  ? 11   ARG B CZ  1 
ATOM   4254 N NH1 . ARG B 1 11  ? -4.498  11.822  -71.949 1.00 74.91  ? 11   ARG B NH1 1 
ATOM   4255 N NH2 . ARG B 1 11  ? -2.964  10.762  -73.294 1.00 75.00  ? 11   ARG B NH2 1 
ATOM   4256 N N   . VAL B 1 12  ? -1.363  11.670  -66.526 1.00 65.70  ? 12   VAL B N   1 
ATOM   4257 C CA  . VAL B 1 12  ? -0.092  12.018  -65.897 1.00 65.36  ? 12   VAL B CA  1 
ATOM   4258 C C   . VAL B 1 12  ? 0.979   12.090  -66.976 1.00 65.16  ? 12   VAL B C   1 
ATOM   4259 O O   . VAL B 1 12  ? 0.730   11.708  -68.120 1.00 65.20  ? 12   VAL B O   1 
ATOM   4260 C CB  . VAL B 1 12  ? 0.297   11.022  -64.789 1.00 65.33  ? 12   VAL B CB  1 
ATOM   4261 C CG1 . VAL B 1 12  ? -0.691  11.113  -63.636 1.00 65.20  ? 12   VAL B CG1 1 
ATOM   4262 C CG2 . VAL B 1 12  ? 0.336   9.614   -65.325 1.00 65.57  ? 12   VAL B CG2 1 
ATOM   4263 N N   . ARG B 1 13  ? 2.159   12.589  -66.618 1.00 65.06  ? 13   ARG B N   1 
ATOM   4264 C CA  . ARG B 1 13  ? 3.239   12.805  -67.583 1.00 64.94  ? 13   ARG B CA  1 
ATOM   4265 C C   . ARG B 1 13  ? 3.644   11.542  -68.323 1.00 64.29  ? 13   ARG B C   1 
ATOM   4266 O O   . ARG B 1 13  ? 4.116   11.610  -69.445 1.00 64.15  ? 13   ARG B O   1 
ATOM   4267 C CB  . ARG B 1 13  ? 4.462   13.397  -66.903 1.00 65.36  ? 13   ARG B CB  1 
ATOM   4268 C CG  . ARG B 1 13  ? 4.449   14.897  -66.799 1.00 68.18  ? 13   ARG B CG  1 
ATOM   4269 C CD  . ARG B 1 13  ? 5.871   15.427  -66.897 1.00 74.05  ? 13   ARG B CD  1 
ATOM   4270 N NE  . ARG B 1 13  ? 6.050   16.676  -66.151 1.00 78.90  ? 13   ARG B NE  1 
ATOM   4271 C CZ  . ARG B 1 13  ? 7.159   16.998  -65.477 1.00 81.02  ? 13   ARG B CZ  1 
ATOM   4272 N NH1 . ARG B 1 13  ? 8.197   16.154  -65.449 1.00 81.55  ? 13   ARG B NH1 1 
ATOM   4273 N NH2 . ARG B 1 13  ? 7.229   18.160  -64.823 1.00 80.82  ? 13   ARG B NH2 1 
ATOM   4274 N N   . GLY B 1 14  ? 3.468   10.390  -67.689 1.00 63.89  ? 14   GLY B N   1 
ATOM   4275 C CA  . GLY B 1 14  ? 3.737   9.115   -68.349 1.00 63.07  ? 14   GLY B CA  1 
ATOM   4276 C C   . GLY B 1 14  ? 2.616   8.644   -69.256 1.00 62.44  ? 14   GLY B C   1 
ATOM   4277 O O   . GLY B 1 14  ? 2.841   7.828   -70.146 1.00 62.32  ? 14   GLY B O   1 
ATOM   4278 N N   . GLY B 1 15  ? 1.408   9.156   -69.027 1.00 62.12  ? 15   GLY B N   1 
ATOM   4279 C CA  . GLY B 1 15  ? 0.230   8.762   -69.799 1.00 61.82  ? 15   GLY B CA  1 
ATOM   4280 C C   . GLY B 1 15  ? -1.096  8.797   -69.051 1.00 61.62  ? 15   GLY B C   1 
ATOM   4281 O O   . GLY B 1 15  ? -1.265  9.539   -68.088 1.00 61.49  ? 15   GLY B O   1 
ATOM   4282 N N   . GLN B 1 16  ? -2.041  7.987   -69.514 1.00 61.45  ? 16   GLN B N   1 
ATOM   4283 C CA  . GLN B 1 16  ? -3.373  7.929   -68.950 1.00 61.66  ? 16   GLN B CA  1 
ATOM   4284 C C   . GLN B 1 16  ? -3.503  6.780   -67.965 1.00 61.05  ? 16   GLN B C   1 
ATOM   4285 O O   . GLN B 1 16  ? -2.949  5.700   -68.184 1.00 60.88  ? 16   GLN B O   1 
ATOM   4286 C CB  . GLN B 1 16  ? -4.400  7.743   -70.063 1.00 61.67  ? 16   GLN B CB  1 
ATOM   4287 C CG  . GLN B 1 16  ? -4.688  8.983   -70.868 1.00 63.03  ? 16   GLN B CG  1 
ATOM   4288 C CD  . GLN B 1 16  ? -5.908  8.824   -71.777 1.00 63.75  ? 16   GLN B CD  1 
ATOM   4289 O OE1 . GLN B 1 16  ? -5.816  8.279   -72.884 1.00 65.49  ? 16   GLN B OE1 1 
ATOM   4290 N NE2 . GLN B 1 16  ? -7.061  9.313   -71.310 1.00 66.77  ? 16   GLN B NE2 1 
ATOM   4291 N N   . LEU B 1 17  ? -4.251  7.020   -66.891 1.00 60.71  ? 17   LEU B N   1 
ATOM   4292 C CA  . LEU B 1 17  ? -4.510  6.014   -65.874 1.00 60.61  ? 17   LEU B CA  1 
ATOM   4293 C C   . LEU B 1 17  ? -5.997  5.936   -65.633 1.00 60.74  ? 17   LEU B C   1 
ATOM   4294 O O   . LEU B 1 17  ? -6.688  6.952   -65.662 1.00 60.79  ? 17   LEU B O   1 
ATOM   4295 C CB  . LEU B 1 17  ? -3.855  6.389   -64.542 1.00 60.67  ? 17   LEU B CB  1 
ATOM   4296 C CG  . LEU B 1 17  ? -2.469  7.027   -64.482 1.00 61.22  ? 17   LEU B CG  1 
ATOM   4297 C CD1 . LEU B 1 17  ? -2.320  7.826   -63.222 1.00 61.14  ? 17   LEU B CD1 1 
ATOM   4298 C CD2 . LEU B 1 17  ? -1.379  5.968   -64.580 1.00 62.43  ? 17   LEU B CD2 1 
ATOM   4299 N N   . ARG B 1 18  ? -6.484  4.734   -65.364 1.00 60.83  ? 18   ARG B N   1 
ATOM   4300 C CA  . ARG B 1 18  ? -7.853  4.554   -64.945 1.00 61.24  ? 18   ARG B CA  1 
ATOM   4301 C C   . ARG B 1 18  ? -7.886  4.072   -63.500 1.00 60.79  ? 18   ARG B C   1 
ATOM   4302 O O   . ARG B 1 18  ? -7.269  3.067   -63.146 1.00 60.35  ? 18   ARG B O   1 
ATOM   4303 C CB  . ARG B 1 18  ? -8.584  3.591   -65.886 1.00 61.26  ? 18   ARG B CB  1 
ATOM   4304 C CG  . ARG B 1 18  ? -10.068 3.342   -65.554 1.00 62.26  ? 18   ARG B CG  1 
ATOM   4305 C CD  . ARG B 1 18  ? -10.806 2.588   -66.671 1.00 63.29  ? 18   ARG B CD  1 
ATOM   4306 N NE  . ARG B 1 18  ? -9.944  1.660   -67.417 1.00 68.31  ? 18   ARG B NE  1 
ATOM   4307 C CZ  . ARG B 1 18  ? -9.628  1.775   -68.714 1.00 69.73  ? 18   ARG B CZ  1 
ATOM   4308 N NH1 . ARG B 1 18  ? -10.106 2.773   -69.454 1.00 70.21  ? 18   ARG B NH1 1 
ATOM   4309 N NH2 . ARG B 1 18  ? -8.820  0.881   -69.277 1.00 71.06  ? 18   ARG B NH2 1 
ATOM   4310 N N   . GLY B 1 19  ? -8.606  4.820   -62.671 1.00 60.86  ? 19   GLY B N   1 
ATOM   4311 C CA  . GLY B 1 19  ? -8.793  4.475   -61.279 1.00 60.89  ? 19   GLY B CA  1 
ATOM   4312 C C   . GLY B 1 19  ? -10.032 3.635   -61.059 1.00 61.16  ? 19   GLY B C   1 
ATOM   4313 O O   . GLY B 1 19  ? -10.713 3.240   -62.005 1.00 61.08  ? 19   GLY B O   1 
ATOM   4314 N N   . ILE B 1 20  ? -10.306 3.353   -59.794 1.00 61.50  ? 20   ILE B N   1 
ATOM   4315 C CA  . ILE B 1 20  ? -11.490 2.630   -59.391 1.00 62.18  ? 20   ILE B CA  1 
ATOM   4316 C C   . ILE B 1 20  ? -12.216 3.473   -58.356 1.00 62.95  ? 20   ILE B C   1 
ATOM   4317 O O   . ILE B 1 20  ? -11.584 4.139   -57.545 1.00 63.16  ? 20   ILE B O   1 
ATOM   4318 C CB  . ILE B 1 20  ? -11.133 1.248   -58.812 1.00 62.01  ? 20   ILE B CB  1 
ATOM   4319 C CG1 . ILE B 1 20  ? -12.395 0.525   -58.321 1.00 62.09  ? 20   ILE B CG1 1 
ATOM   4320 C CG2 . ILE B 1 20  ? -10.078 1.368   -57.711 1.00 61.64  ? 20   ILE B CG2 1 
ATOM   4321 C CD1 . ILE B 1 20  ? -12.144 -0.853  -57.716 1.00 62.46  ? 20   ILE B CD1 1 
ATOM   4322 N N   . ARG B 1 21  ? -13.544 3.463   -58.397 1.00 63.98  ? 21   ARG B N   1 
ATOM   4323 C CA  . ARG B 1 21  ? -14.344 4.200   -57.430 1.00 64.73  ? 21   ARG B CA  1 
ATOM   4324 C C   . ARG B 1 21  ? -14.540 3.320   -56.218 1.00 64.75  ? 21   ARG B C   1 
ATOM   4325 O O   . ARG B 1 21  ? -15.295 2.352   -56.261 1.00 64.87  ? 21   ARG B O   1 
ATOM   4326 C CB  . ARG B 1 21  ? -15.690 4.580   -58.036 1.00 64.72  ? 21   ARG B CB  1 
ATOM   4327 C CG  . ARG B 1 21  ? -16.465 5.624   -57.246 1.00 65.67  ? 21   ARG B CG  1 
ATOM   4328 C CD  . ARG B 1 21  ? -17.881 5.883   -57.819 1.00 66.13  ? 21   ARG B CD  1 
ATOM   4329 N NE  . ARG B 1 21  ? -18.695 4.671   -57.968 1.00 68.54  ? 21   ARG B NE  1 
ATOM   4330 C CZ  . ARG B 1 21  ? -19.141 3.913   -56.965 1.00 70.05  ? 21   ARG B CZ  1 
ATOM   4331 N NH1 . ARG B 1 21  ? -18.861 4.190   -55.691 1.00 69.67  ? 21   ARG B NH1 1 
ATOM   4332 N NH2 . ARG B 1 21  ? -19.870 2.845   -57.246 1.00 72.17  ? 21   ARG B NH2 1 
ATOM   4333 N N   . LEU B 1 22  ? -13.838 3.645   -55.142 1.00 65.25  ? 22   LEU B N   1 
ATOM   4334 C CA  . LEU B 1 22  ? -13.922 2.847   -53.931 1.00 66.04  ? 22   LEU B CA  1 
ATOM   4335 C C   . LEU B 1 22  ? -14.970 3.423   -52.998 1.00 66.62  ? 22   LEU B C   1 
ATOM   4336 O O   . LEU B 1 22  ? -15.236 4.630   -53.008 1.00 66.70  ? 22   LEU B O   1 
ATOM   4337 C CB  . LEU B 1 22  ? -12.554 2.717   -53.234 1.00 66.15  ? 22   LEU B CB  1 
ATOM   4338 C CG  . LEU B 1 22  ? -11.414 1.935   -53.932 1.00 66.50  ? 22   LEU B CG  1 
ATOM   4339 C CD1 . LEU B 1 22  ? -10.100 2.074   -53.178 1.00 66.44  ? 22   LEU B CD1 1 
ATOM   4340 C CD2 . LEU B 1 22  ? -11.735 0.453   -54.151 1.00 66.32  ? 22   LEU B CD2 1 
ATOM   4341 N N   . LYS B 1 23  ? -15.570 2.543   -52.205 1.00 67.33  ? 23   LYS B N   1 
ATOM   4342 C CA  . LYS B 1 23  ? -16.640 2.911   -51.300 1.00 68.11  ? 23   LYS B CA  1 
ATOM   4343 C C   . LYS B 1 23  ? -16.105 3.102   -49.884 1.00 68.09  ? 23   LYS B C   1 
ATOM   4344 O O   . LYS B 1 23  ? -15.414 2.236   -49.348 1.00 68.19  ? 23   LYS B O   1 
ATOM   4345 C CB  . LYS B 1 23  ? -17.729 1.835   -51.322 1.00 68.57  ? 23   LYS B CB  1 
ATOM   4346 C CG  . LYS B 1 23  ? -18.939 2.123   -50.440 1.00 70.82  ? 23   LYS B CG  1 
ATOM   4347 C CD  . LYS B 1 23  ? -19.613 0.814   -50.005 1.00 74.70  ? 23   LYS B CD  1 
ATOM   4348 C CE  . LYS B 1 23  ? -20.133 0.910   -48.556 1.00 76.32  ? 23   LYS B CE  1 
ATOM   4349 N NZ  . LYS B 1 23  ? -20.699 -0.387  -48.065 1.00 76.51  ? 23   LYS B NZ  1 
ATOM   4350 N N   . ALA B 1 24  ? -16.432 4.253   -49.298 1.00 68.24  ? 24   ALA B N   1 
ATOM   4351 C CA  . ALA B 1 24  ? -16.136 4.572   -47.894 1.00 67.97  ? 24   ALA B CA  1 
ATOM   4352 C C   . ALA B 1 24  ? -17.425 4.975   -47.149 1.00 67.80  ? 24   ALA B C   1 
ATOM   4353 O O   . ALA B 1 24  ? -18.312 5.602   -47.743 1.00 67.89  ? 24   ALA B O   1 
ATOM   4354 C CB  . ALA B 1 24  ? -15.094 5.692   -47.814 1.00 67.92  ? 24   ALA B CB  1 
ATOM   4355 N N   . PRO B 1 25  ? -17.534 4.616   -45.851 1.00 67.44  ? 25   PRO B N   1 
ATOM   4356 C CA  . PRO B 1 25  ? -18.684 4.877   -44.978 1.00 67.09  ? 25   PRO B CA  1 
ATOM   4357 C C   . PRO B 1 25  ? -19.666 5.980   -45.413 1.00 66.68  ? 25   PRO B C   1 
ATOM   4358 O O   . PRO B 1 25  ? -20.837 5.680   -45.671 1.00 66.71  ? 25   PRO B O   1 
ATOM   4359 C CB  . PRO B 1 25  ? -18.010 5.221   -43.648 1.00 67.16  ? 25   PRO B CB  1 
ATOM   4360 C CG  . PRO B 1 25  ? -16.732 4.357   -43.661 1.00 67.29  ? 25   PRO B CG  1 
ATOM   4361 C CD  . PRO B 1 25  ? -16.490 3.898   -45.097 1.00 67.46  ? 25   PRO B CD  1 
ATOM   4362 N N   . GLY B 1 26  ? -19.199 7.224   -45.511 1.00 66.01  ? 26   GLY B N   1 
ATOM   4363 C CA  . GLY B 1 26  ? -20.085 8.347   -45.826 1.00 65.22  ? 26   GLY B CA  1 
ATOM   4364 C C   . GLY B 1 26  ? -19.993 8.928   -47.232 1.00 64.72  ? 26   GLY B C   1 
ATOM   4365 O O   . GLY B 1 26  ? -20.374 10.087  -47.456 1.00 64.64  ? 26   GLY B O   1 
ATOM   4366 N N   . GLY B 1 27  ? -19.495 8.134   -48.183 1.00 64.20  ? 27   GLY B N   1 
ATOM   4367 C CA  . GLY B 1 27  ? -19.333 8.589   -49.575 1.00 63.02  ? 27   GLY B CA  1 
ATOM   4368 C C   . GLY B 1 27  ? -18.352 7.766   -50.399 1.00 62.11  ? 27   GLY B C   1 
ATOM   4369 O O   . GLY B 1 27  ? -17.773 6.803   -49.901 1.00 61.79  ? 27   GLY B O   1 
ATOM   4370 N N   . PRO B 1 28  ? -18.179 8.130   -51.681 1.00 61.42  ? 28   PRO B N   1 
ATOM   4371 C CA  . PRO B 1 28  ? -17.221 7.480   -52.570 1.00 60.76  ? 28   PRO B CA  1 
ATOM   4372 C C   . PRO B 1 28  ? -15.857 8.196   -52.643 1.00 60.18  ? 28   PRO B C   1 
ATOM   4373 O O   . PRO B 1 28  ? -15.791 9.426   -52.481 1.00 60.47  ? 28   PRO B O   1 
ATOM   4374 C CB  . PRO B 1 28  ? -17.927 7.553   -53.926 1.00 60.84  ? 28   PRO B CB  1 
ATOM   4375 C CG  . PRO B 1 28  ? -18.956 8.679   -53.801 1.00 60.76  ? 28   PRO B CG  1 
ATOM   4376 C CD  . PRO B 1 28  ? -18.939 9.177   -52.387 1.00 61.37  ? 28   PRO B CD  1 
ATOM   4377 N N   . VAL B 1 29  ? -14.783 7.431   -52.880 1.00 59.01  ? 29   VAL B N   1 
ATOM   4378 C CA  . VAL B 1 29  ? -13.432 7.996   -53.110 1.00 57.47  ? 29   VAL B CA  1 
ATOM   4379 C C   . VAL B 1 29  ? -12.863 7.496   -54.444 1.00 56.75  ? 29   VAL B C   1 
ATOM   4380 O O   . VAL B 1 29  ? -13.289 6.454   -54.949 1.00 56.81  ? 29   VAL B O   1 
ATOM   4381 C CB  . VAL B 1 29  ? -12.448 7.708   -51.937 1.00 57.13  ? 29   VAL B CB  1 
ATOM   4382 C CG1 . VAL B 1 29  ? -13.128 7.919   -50.608 1.00 56.98  ? 29   VAL B CG1 1 
ATOM   4383 C CG2 . VAL B 1 29  ? -11.907 6.304   -51.997 1.00 56.81  ? 29   VAL B CG2 1 
ATOM   4384 N N   . SER B 1 30  ? -11.926 8.246   -55.017 1.00 55.64  ? 30   SER B N   1 
ATOM   4385 C CA  . SER B 1 30  ? -11.255 7.845   -56.250 1.00 54.75  ? 30   SER B CA  1 
ATOM   4386 C C   . SER B 1 30  ? -9.900  7.239   -55.918 1.00 54.34  ? 30   SER B C   1 
ATOM   4387 O O   . SER B 1 30  ? -9.010  7.950   -55.465 1.00 55.12  ? 30   SER B O   1 
ATOM   4388 C CB  . SER B 1 30  ? -11.013 9.061   -57.143 1.00 54.57  ? 30   SER B CB  1 
ATOM   4389 O OG  . SER B 1 30  ? -12.187 9.810   -57.362 1.00 54.61  ? 30   SER B OG  1 
ATOM   4390 N N   . ALA B 1 31  ? -9.723  5.943   -56.137 1.00 53.12  ? 31   ALA B N   1 
ATOM   4391 C CA  . ALA B 1 31  ? -8.408  5.339   -55.947 1.00 52.17  ? 31   ALA B CA  1 
ATOM   4392 C C   . ALA B 1 31  ? -7.600  5.274   -57.245 1.00 51.68  ? 31   ALA B C   1 
ATOM   4393 O O   . ALA B 1 31  ? -8.160  5.233   -58.329 1.00 51.86  ? 31   ALA B O   1 
ATOM   4394 C CB  . ALA B 1 31  ? -8.541  3.973   -55.343 1.00 52.16  ? 31   ALA B CB  1 
ATOM   4395 N N   . PHE B 1 32  ? -6.275  5.290   -57.124 1.00 51.14  ? 32   PHE B N   1 
ATOM   4396 C CA  . PHE B 1 32  ? -5.372  5.081   -58.262 1.00 50.13  ? 32   PHE B CA  1 
ATOM   4397 C C   . PHE B 1 32  ? -4.203  4.225   -57.811 1.00 49.43  ? 32   PHE B C   1 
ATOM   4398 O O   . PHE B 1 32  ? -3.146  4.730   -57.452 1.00 49.84  ? 32   PHE B O   1 
ATOM   4399 C CB  . PHE B 1 32  ? -4.887  6.408   -58.811 1.00 49.96  ? 32   PHE B CB  1 
ATOM   4400 C CG  . PHE B 1 32  ? -5.983  7.260   -59.318 1.00 50.86  ? 32   PHE B CG  1 
ATOM   4401 C CD1 . PHE B 1 32  ? -6.672  8.109   -58.459 1.00 52.05  ? 32   PHE B CD1 1 
ATOM   4402 C CD2 . PHE B 1 32  ? -6.365  7.191   -60.646 1.00 51.72  ? 32   PHE B CD2 1 
ATOM   4403 C CE1 . PHE B 1 32  ? -7.705  8.894   -58.925 1.00 52.18  ? 32   PHE B CE1 1 
ATOM   4404 C CE2 . PHE B 1 32  ? -7.396  7.971   -61.126 1.00 51.79  ? 32   PHE B CE2 1 
ATOM   4405 C CZ  . PHE B 1 32  ? -8.067  8.830   -60.266 1.00 51.82  ? 32   PHE B CZ  1 
ATOM   4406 N N   . LEU B 1 33  ? -4.403  2.918   -57.838 1.00 48.05  ? 33   LEU B N   1 
ATOM   4407 C CA  . LEU B 1 33  ? -3.501  2.018   -57.166 1.00 46.61  ? 33   LEU B CA  1 
ATOM   4408 C C   . LEU B 1 33  ? -2.478  1.375   -58.091 1.00 45.99  ? 33   LEU B C   1 
ATOM   4409 O O   . LEU B 1 33  ? -2.812  0.894   -59.177 1.00 46.33  ? 33   LEU B O   1 
ATOM   4410 C CB  . LEU B 1 33  ? -4.316  0.955   -56.443 1.00 46.52  ? 33   LEU B CB  1 
ATOM   4411 C CG  . LEU B 1 33  ? -5.545  1.471   -55.694 1.00 45.73  ? 33   LEU B CG  1 
ATOM   4412 C CD1 . LEU B 1 33  ? -6.288  0.306   -55.033 1.00 45.74  ? 33   LEU B CD1 1 
ATOM   4413 C CD2 . LEU B 1 33  ? -5.143  2.494   -54.663 1.00 45.30  ? 33   LEU B CD2 1 
ATOM   4414 N N   . GLY B 1 34  ? -1.225  1.367   -57.646 1.00 45.06  ? 34   GLY B N   1 
ATOM   4415 C CA  . GLY B 1 34  ? -0.146  0.712   -58.377 1.00 43.53  ? 34   GLY B CA  1 
ATOM   4416 C C   . GLY B 1 34  ? 0.342   1.477   -59.584 1.00 42.48  ? 34   GLY B C   1 
ATOM   4417 O O   . GLY B 1 34  ? 0.648   0.892   -60.611 1.00 42.30  ? 34   GLY B O   1 
ATOM   4418 N N   . ILE B 1 35  ? 0.404   2.792   -59.460 1.00 41.90  ? 35   ILE B N   1 
ATOM   4419 C CA  . ILE B 1 35  ? 1.033   3.632   -60.471 1.00 41.76  ? 35   ILE B CA  1 
ATOM   4420 C C   . ILE B 1 35  ? 2.561   3.449   -60.476 1.00 41.44  ? 35   ILE B C   1 
ATOM   4421 O O   . ILE B 1 35  ? 3.192   3.555   -59.435 1.00 41.76  ? 35   ILE B O   1 
ATOM   4422 C CB  . ILE B 1 35  ? 0.729   5.116   -60.208 1.00 41.90  ? 35   ILE B CB  1 
ATOM   4423 C CG1 . ILE B 1 35  ? -0.786  5.328   -60.058 1.00 40.91  ? 35   ILE B CG1 1 
ATOM   4424 C CG2 . ILE B 1 35  ? 1.394   6.003   -61.290 1.00 41.64  ? 35   ILE B CG2 1 
ATOM   4425 C CD1 . ILE B 1 35  ? -1.172  6.736   -59.687 1.00 39.97  ? 35   ILE B CD1 1 
ATOM   4426 N N   . PRO B 1 36  ? 3.157   3.161   -61.643 1.00 40.90  ? 36   PRO B N   1 
ATOM   4427 C CA  . PRO B 1 36  ? 4.615   3.032   -61.694 1.00 40.58  ? 36   PRO B CA  1 
ATOM   4428 C C   . PRO B 1 36  ? 5.312   4.378   -61.639 1.00 39.96  ? 36   PRO B C   1 
ATOM   4429 O O   . PRO B 1 36  ? 5.032   5.261   -62.438 1.00 39.92  ? 36   PRO B O   1 
ATOM   4430 C CB  . PRO B 1 36  ? 4.865   2.381   -63.061 1.00 40.87  ? 36   PRO B CB  1 
ATOM   4431 C CG  . PRO B 1 36  ? 3.683   2.775   -63.896 1.00 40.71  ? 36   PRO B CG  1 
ATOM   4432 C CD  . PRO B 1 36  ? 2.521   2.931   -62.954 1.00 40.81  ? 36   PRO B CD  1 
ATOM   4433 N N   . PHE B 1 37  ? 6.228   4.542   -60.708 1.00 39.68  ? 37   PHE B N   1 
ATOM   4434 C CA  . PHE B 1 37  ? 6.982   5.785   -60.685 1.00 39.78  ? 37   PHE B CA  1 
ATOM   4435 C C   . PHE B 1 37  ? 8.422   5.593   -61.140 1.00 39.81  ? 37   PHE B C   1 
ATOM   4436 O O   . PHE B 1 37  ? 9.153   6.551   -61.299 1.00 39.97  ? 37   PHE B O   1 
ATOM   4437 C CB  . PHE B 1 37  ? 6.885   6.504   -59.324 1.00 39.52  ? 37   PHE B CB  1 
ATOM   4438 C CG  . PHE B 1 37  ? 7.434   5.719   -58.151 1.00 38.42  ? 37   PHE B CG  1 
ATOM   4439 C CD1 . PHE B 1 37  ? 8.770   5.858   -57.765 1.00 38.18  ? 37   PHE B CD1 1 
ATOM   4440 C CD2 . PHE B 1 37  ? 6.605   4.889   -57.401 1.00 37.29  ? 37   PHE B CD2 1 
ATOM   4441 C CE1 . PHE B 1 37  ? 9.284   5.158   -56.661 1.00 37.57  ? 37   PHE B CE1 1 
ATOM   4442 C CE2 . PHE B 1 37  ? 7.103   4.183   -56.303 1.00 38.01  ? 37   PHE B CE2 1 
ATOM   4443 C CZ  . PHE B 1 37  ? 8.453   4.319   -55.932 1.00 38.20  ? 37   PHE B CZ  1 
ATOM   4444 N N   . ALA B 1 38  ? 8.800   4.346   -61.377 1.00 40.32  ? 38   ALA B N   1 
ATOM   4445 C CA  . ALA B 1 38  ? 10.157  3.997   -61.767 1.00 40.92  ? 38   ALA B CA  1 
ATOM   4446 C C   . ALA B 1 38  ? 10.215  2.719   -62.596 1.00 41.33  ? 38   ALA B C   1 
ATOM   4447 O O   . ALA B 1 38  ? 9.316   1.863   -62.552 1.00 41.13  ? 38   ALA B O   1 
ATOM   4448 C CB  . ALA B 1 38  ? 11.027  3.846   -60.532 1.00 41.09  ? 38   ALA B CB  1 
ATOM   4449 N N   . GLU B 1 39  ? 11.294  2.594   -63.351 1.00 41.97  ? 39   GLU B N   1 
ATOM   4450 C CA  . GLU B 1 39  ? 11.564  1.376   -64.093 1.00 42.70  ? 39   GLU B CA  1 
ATOM   4451 C C   . GLU B 1 39  ? 11.838  0.253   -63.096 1.00 42.80  ? 39   GLU B C   1 
ATOM   4452 O O   . GLU B 1 39  ? 12.503  0.471   -62.084 1.00 43.06  ? 39   GLU B O   1 
ATOM   4453 C CB  . GLU B 1 39  ? 12.753  1.610   -65.003 1.00 42.90  ? 39   GLU B CB  1 
ATOM   4454 C CG  . GLU B 1 39  ? 12.495  2.712   -66.002 1.00 44.66  ? 39   GLU B CG  1 
ATOM   4455 C CD  . GLU B 1 39  ? 11.802  2.184   -67.231 1.00 48.52  ? 39   GLU B CD  1 
ATOM   4456 O OE1 . GLU B 1 39  ? 12.482  1.476   -68.015 1.00 49.90  ? 39   GLU B OE1 1 
ATOM   4457 O OE2 . GLU B 1 39  ? 10.589  2.463   -67.415 1.00 50.71  ? 39   GLU B OE2 1 
ATOM   4458 N N   . PRO B 1 40  ? 11.295  -0.943  -63.341 1.00 42.94  ? 40   PRO B N   1 
ATOM   4459 C CA  . PRO B 1 40  ? 11.530  -1.980  -62.342 1.00 43.30  ? 40   PRO B CA  1 
ATOM   4460 C C   . PRO B 1 40  ? 13.028  -2.193  -62.093 1.00 43.76  ? 40   PRO B C   1 
ATOM   4461 O O   . PRO B 1 40  ? 13.781  -2.462  -63.031 1.00 43.91  ? 40   PRO B O   1 
ATOM   4462 C CB  . PRO B 1 40  ? 10.884  -3.219  -62.960 1.00 43.05  ? 40   PRO B CB  1 
ATOM   4463 C CG  . PRO B 1 40  ? 9.881   -2.677  -63.907 1.00 42.91  ? 40   PRO B CG  1 
ATOM   4464 C CD  . PRO B 1 40  ? 10.456  -1.415  -64.453 1.00 42.88  ? 40   PRO B CD  1 
ATOM   4465 N N   . PRO B 1 41  ? 13.458  -2.060  -60.832 1.00 44.12  ? 41   PRO B N   1 
ATOM   4466 C CA  . PRO B 1 41  ? 14.857  -2.109  -60.429 1.00 44.66  ? 41   PRO B CA  1 
ATOM   4467 C C   . PRO B 1 41  ? 15.354  -3.562  -60.408 1.00 45.52  ? 41   PRO B C   1 
ATOM   4468 O O   . PRO B 1 41  ? 15.798  -4.073  -59.361 1.00 45.42  ? 41   PRO B O   1 
ATOM   4469 C CB  . PRO B 1 41  ? 14.805  -1.542  -59.019 1.00 44.61  ? 41   PRO B CB  1 
ATOM   4470 C CG  . PRO B 1 41  ? 13.468  -1.991  -58.518 1.00 43.84  ? 41   PRO B CG  1 
ATOM   4471 C CD  . PRO B 1 41  ? 12.560  -1.884  -59.679 1.00 43.97  ? 41   PRO B CD  1 
ATOM   4472 N N   . VAL B 1 42  ? 15.268  -4.216  -61.569 1.00 46.12  ? 42   VAL B N   1 
ATOM   4473 C CA  . VAL B 1 42  ? 15.520  -5.649  -61.683 1.00 46.23  ? 42   VAL B CA  1 
ATOM   4474 C C   . VAL B 1 42  ? 16.694  -5.941  -62.598 1.00 46.73  ? 42   VAL B C   1 
ATOM   4475 O O   . VAL B 1 42  ? 17.068  -5.119  -63.444 1.00 46.16  ? 42   VAL B O   1 
ATOM   4476 C CB  . VAL B 1 42  ? 14.277  -6.408  -62.194 1.00 46.13  ? 42   VAL B CB  1 
ATOM   4477 C CG1 . VAL B 1 42  ? 13.112  -6.221  -61.239 1.00 46.33  ? 42   VAL B CG1 1 
ATOM   4478 C CG2 . VAL B 1 42  ? 13.902  -5.949  -63.586 1.00 45.41  ? 42   VAL B CG2 1 
ATOM   4479 N N   . GLY B 1 43  ? 17.271  -7.126  -62.416 1.00 47.64  ? 43   GLY B N   1 
ATOM   4480 C CA  . GLY B 1 43  ? 18.403  -7.564  -63.234 1.00 48.84  ? 43   GLY B CA  1 
ATOM   4481 C C   . GLY B 1 43  ? 19.665  -6.782  -62.943 1.00 49.35  ? 43   GLY B C   1 
ATOM   4482 O O   . GLY B 1 43  ? 20.226  -6.898  -61.861 1.00 49.53  ? 43   GLY B O   1 
ATOM   4483 N N   . SER B 1 44  ? 20.109  -5.983  -63.902 1.00 50.12  ? 44   SER B N   1 
ATOM   4484 C CA  . SER B 1 44  ? 21.330  -5.200  -63.727 1.00 51.18  ? 44   SER B CA  1 
ATOM   4485 C C   . SER B 1 44  ? 21.035  -3.958  -62.897 1.00 51.70  ? 44   SER B C   1 
ATOM   4486 O O   . SER B 1 44  ? 21.945  -3.200  -62.525 1.00 51.91  ? 44   SER B O   1 
ATOM   4487 C CB  . SER B 1 44  ? 21.928  -4.801  -65.087 1.00 51.33  ? 44   SER B CB  1 
ATOM   4488 O OG  . SER B 1 44  ? 21.417  -3.551  -65.532 1.00 51.00  ? 44   SER B OG  1 
ATOM   4489 N N   . ARG B 1 45  ? 19.753  -3.751  -62.619 1.00 52.36  ? 45   ARG B N   1 
ATOM   4490 C CA  . ARG B 1 45  ? 19.313  -2.551  -61.926 1.00 53.07  ? 45   ARG B CA  1 
ATOM   4491 C C   . ARG B 1 45  ? 19.170  -2.733  -60.416 1.00 52.73  ? 45   ARG B C   1 
ATOM   4492 O O   . ARG B 1 45  ? 18.964  -1.765  -59.687 1.00 53.15  ? 45   ARG B O   1 
ATOM   4493 C CB  . ARG B 1 45  ? 18.044  -1.988  -62.571 1.00 53.47  ? 45   ARG B CB  1 
ATOM   4494 C CG  . ARG B 1 45  ? 18.355  -0.870  -63.547 1.00 56.18  ? 45   ARG B CG  1 
ATOM   4495 C CD  . ARG B 1 45  ? 19.031  0.302   -62.797 1.00 62.77  ? 45   ARG B CD  1 
ATOM   4496 N NE  . ARG B 1 45  ? 19.985  1.049   -63.626 1.00 67.09  ? 45   ARG B NE  1 
ATOM   4497 C CZ  . ARG B 1 45  ? 20.453  2.274   -63.363 1.00 68.41  ? 45   ARG B CZ  1 
ATOM   4498 N NH1 . ARG B 1 45  ? 20.063  2.945   -62.281 1.00 69.55  ? 45   ARG B NH1 1 
ATOM   4499 N NH2 . ARG B 1 45  ? 21.312  2.841   -64.201 1.00 69.16  ? 45   ARG B NH2 1 
ATOM   4500 N N   . ARG B 1 46  ? 19.319  -3.972  -59.958 1.00 52.20  ? 46   ARG B N   1 
ATOM   4501 C CA  . ARG B 1 46  ? 19.338  -4.298  -58.538 1.00 51.97  ? 46   ARG B CA  1 
ATOM   4502 C C   . ARG B 1 46  ? 20.475  -3.586  -57.812 1.00 52.30  ? 46   ARG B C   1 
ATOM   4503 O O   . ARG B 1 46  ? 21.617  -3.567  -58.299 1.00 52.98  ? 46   ARG B O   1 
ATOM   4504 C CB  . ARG B 1 46  ? 19.505  -5.793  -58.371 1.00 51.57  ? 46   ARG B CB  1 
ATOM   4505 C CG  . ARG B 1 46  ? 19.477  -6.251  -56.960 1.00 51.14  ? 46   ARG B CG  1 
ATOM   4506 C CD  . ARG B 1 46  ? 19.904  -7.684  -56.922 1.00 51.02  ? 46   ARG B CD  1 
ATOM   4507 N NE  . ARG B 1 46  ? 18.786  -8.616  -56.843 1.00 50.69  ? 46   ARG B NE  1 
ATOM   4508 C CZ  . ARG B 1 46  ? 18.931  -9.935  -56.878 1.00 50.36  ? 46   ARG B CZ  1 
ATOM   4509 N NH1 . ARG B 1 46  ? 20.147  -10.455 -57.011 1.00 50.38  ? 46   ARG B NH1 1 
ATOM   4510 N NH2 . ARG B 1 46  ? 17.872  -10.732 -56.784 1.00 49.35  ? 46   ARG B NH2 1 
ATOM   4511 N N   . PHE B 1 47  ? 20.161  -3.023  -56.644 1.00 51.99  ? 47   PHE B N   1 
ATOM   4512 C CA  . PHE B 1 47  ? 21.110  -2.250  -55.827 1.00 51.76  ? 47   PHE B CA  1 
ATOM   4513 C C   . PHE B 1 47  ? 21.366  -0.844  -56.366 1.00 52.14  ? 47   PHE B C   1 
ATOM   4514 O O   . PHE B 1 47  ? 22.166  -0.090  -55.795 1.00 52.41  ? 47   PHE B O   1 
ATOM   4515 C CB  . PHE B 1 47  ? 22.453  -2.975  -55.651 1.00 51.39  ? 47   PHE B CB  1 
ATOM   4516 C CG  . PHE B 1 47  ? 22.329  -4.389  -55.183 1.00 50.87  ? 47   PHE B CG  1 
ATOM   4517 C CD1 . PHE B 1 47  ? 21.514  -4.717  -54.109 1.00 50.98  ? 47   PHE B CD1 1 
ATOM   4518 C CD2 . PHE B 1 47  ? 23.046  -5.392  -55.804 1.00 49.70  ? 47   PHE B CD2 1 
ATOM   4519 C CE1 . PHE B 1 47  ? 21.410  -6.031  -53.676 1.00 50.75  ? 47   PHE B CE1 1 
ATOM   4520 C CE2 . PHE B 1 47  ? 22.947  -6.699  -55.381 1.00 48.93  ? 47   PHE B CE2 1 
ATOM   4521 C CZ  . PHE B 1 47  ? 22.130  -7.023  -54.317 1.00 50.00  ? 47   PHE B CZ  1 
ATOM   4522 N N   . MET B 1 48  ? 20.691  -0.471  -57.446 1.00 52.27  ? 48   MET B N   1 
ATOM   4523 C CA  . MET B 1 48  ? 20.973  0.816   -58.058 1.00 52.96  ? 48   MET B CA  1 
ATOM   4524 C C   . MET B 1 48  ? 19.895  1.891   -57.866 1.00 52.78  ? 48   MET B C   1 
ATOM   4525 O O   . MET B 1 48  ? 18.720  1.584   -57.607 1.00 52.54  ? 48   MET B O   1 
ATOM   4526 C CB  . MET B 1 48  ? 21.317  0.631   -59.530 1.00 53.10  ? 48   MET B CB  1 
ATOM   4527 C CG  . MET B 1 48  ? 22.654  -0.057  -59.732 1.00 54.01  ? 48   MET B CG  1 
ATOM   4528 S SD  . MET B 1 48  ? 23.665  0.807   -60.941 1.00 54.61  ? 48   MET B SD  1 
ATOM   4529 C CE  . MET B 1 48  ? 24.327  2.191   -60.009 1.00 53.99  ? 48   MET B CE  1 
ATOM   4530 N N   . PRO B 1 49  ? 20.303  3.169   -57.950 1.00 52.76  ? 49   PRO B N   1 
ATOM   4531 C CA  . PRO B 1 49  ? 19.332  4.246   -57.904 1.00 52.82  ? 49   PRO B CA  1 
ATOM   4532 C C   . PRO B 1 49  ? 18.207  3.993   -58.899 1.00 52.81  ? 49   PRO B C   1 
ATOM   4533 O O   . PRO B 1 49  ? 18.469  3.434   -59.967 1.00 53.14  ? 49   PRO B O   1 
ATOM   4534 C CB  . PRO B 1 49  ? 20.159  5.464   -58.318 1.00 52.78  ? 49   PRO B CB  1 
ATOM   4535 C CG  . PRO B 1 49  ? 21.504  5.158   -57.795 1.00 52.79  ? 49   PRO B CG  1 
ATOM   4536 C CD  . PRO B 1 49  ? 21.677  3.690   -58.046 1.00 52.83  ? 49   PRO B CD  1 
ATOM   4537 N N   . PRO B 1 50  ? 16.961  4.376   -58.543 1.00 52.57  ? 50   PRO B N   1 
ATOM   4538 C CA  . PRO B 1 50  ? 15.822  4.236   -59.433 1.00 52.36  ? 50   PRO B CA  1 
ATOM   4539 C C   . PRO B 1 50  ? 15.884  5.239   -60.559 1.00 52.38  ? 50   PRO B C   1 
ATOM   4540 O O   . PRO B 1 50  ? 16.394  6.336   -60.371 1.00 52.27  ? 50   PRO B O   1 
ATOM   4541 C CB  . PRO B 1 50  ? 14.643  4.570   -58.528 1.00 52.07  ? 50   PRO B CB  1 
ATOM   4542 C CG  . PRO B 1 50  ? 15.186  5.495   -57.554 1.00 52.32  ? 50   PRO B CG  1 
ATOM   4543 C CD  . PRO B 1 50  ? 16.555  4.973   -57.261 1.00 52.65  ? 50   PRO B CD  1 
ATOM   4544 N N   . GLU B 1 51  ? 15.374  4.855   -61.721 1.00 52.70  ? 51   GLU B N   1 
ATOM   4545 C CA  . GLU B 1 51  ? 15.239  5.773   -62.841 1.00 53.71  ? 51   GLU B CA  1 
ATOM   4546 C C   . GLU B 1 51  ? 13.759  6.037   -63.111 1.00 52.68  ? 51   GLU B C   1 
ATOM   4547 O O   . GLU B 1 51  ? 12.916  5.175   -62.855 1.00 52.38  ? 51   GLU B O   1 
ATOM   4548 C CB  . GLU B 1 51  ? 15.901  5.183   -64.086 1.00 53.72  ? 51   GLU B CB  1 
ATOM   4549 C CG  . GLU B 1 51  ? 17.431  5.083   -64.038 1.00 55.82  ? 51   GLU B CG  1 
ATOM   4550 C CD  . GLU B 1 51  ? 17.973  3.984   -64.984 1.00 57.15  ? 51   GLU B CD  1 
ATOM   4551 O OE1 . GLU B 1 51  ? 17.508  2.801   -64.904 1.00 61.17  ? 51   GLU B OE1 1 
ATOM   4552 O OE2 . GLU B 1 51  ? 18.868  4.308   -65.812 1.00 61.28  ? 51   GLU B OE2 1 
ATOM   4553 N N   . PRO B 1 52  ? 13.431  7.228   -63.633 1.00 52.55  ? 52   PRO B N   1 
ATOM   4554 C CA  . PRO B 1 52  ? 12.019  7.526   -63.958 1.00 52.65  ? 52   PRO B CA  1 
ATOM   4555 C C   . PRO B 1 52  ? 11.406  6.505   -64.926 1.00 52.65  ? 52   PRO B C   1 
ATOM   4556 O O   . PRO B 1 52  ? 12.082  6.043   -65.856 1.00 52.64  ? 52   PRO B O   1 
ATOM   4557 C CB  . PRO B 1 52  ? 12.072  8.918   -64.605 1.00 52.54  ? 52   PRO B CB  1 
ATOM   4558 C CG  . PRO B 1 52  ? 13.408  9.499   -64.215 1.00 52.77  ? 52   PRO B CG  1 
ATOM   4559 C CD  . PRO B 1 52  ? 14.340  8.348   -63.937 1.00 52.41  ? 52   PRO B CD  1 
ATOM   4560 N N   . LYS B 1 53  ? 10.145  6.145   -64.682 1.00 52.76  ? 53   LYS B N   1 
ATOM   4561 C CA  . LYS B 1 53  ? 9.429   5.163   -65.493 1.00 52.67  ? 53   LYS B CA  1 
ATOM   4562 C C   . LYS B 1 53  ? 9.224   5.790   -66.839 1.00 52.69  ? 53   LYS B C   1 
ATOM   4563 O O   . LYS B 1 53  ? 8.906   6.973   -66.918 1.00 52.86  ? 53   LYS B O   1 
ATOM   4564 C CB  . LYS B 1 53  ? 8.080   4.816   -64.857 1.00 52.84  ? 53   LYS B CB  1 
ATOM   4565 C CG  . LYS B 1 53  ? 7.077   4.071   -65.742 1.00 53.12  ? 53   LYS B CG  1 
ATOM   4566 C CD  . LYS B 1 53  ? 7.413   2.580   -65.850 1.00 54.79  ? 53   LYS B CD  1 
ATOM   4567 C CE  . LYS B 1 53  ? 6.387   1.781   -66.676 1.00 54.09  ? 53   LYS B CE  1 
ATOM   4568 N NZ  . LYS B 1 53  ? 6.209   2.325   -68.055 1.00 53.36  ? 53   LYS B NZ  1 
ATOM   4569 N N   . ARG B 1 54  ? 9.439   5.007   -67.893 1.00 52.70  ? 54   ARG B N   1 
ATOM   4570 C CA  . ARG B 1 54  ? 9.214   5.466   -69.268 1.00 52.53  ? 54   ARG B CA  1 
ATOM   4571 C C   . ARG B 1 54  ? 7.709   5.575   -69.569 1.00 52.31  ? 54   ARG B C   1 
ATOM   4572 O O   . ARG B 1 54  ? 6.908   4.793   -69.033 1.00 51.80  ? 54   ARG B O   1 
ATOM   4573 C CB  . ARG B 1 54  ? 9.902   4.525   -70.263 1.00 52.48  ? 54   ARG B CB  1 
ATOM   4574 C CG  . ARG B 1 54  ? 11.414  4.401   -70.056 1.00 52.70  ? 54   ARG B CG  1 
ATOM   4575 C CD  . ARG B 1 54  ? 12.033  3.258   -70.857 1.00 52.57  ? 54   ARG B CD  1 
ATOM   4576 N NE  . ARG B 1 54  ? 11.381  1.970   -70.601 1.00 52.41  ? 54   ARG B NE  1 
ATOM   4577 C CZ  . ARG B 1 54  ? 10.596  1.328   -71.466 1.00 52.25  ? 54   ARG B CZ  1 
ATOM   4578 N NH1 . ARG B 1 54  ? 10.063  0.167   -71.119 1.00 51.07  ? 54   ARG B NH1 1 
ATOM   4579 N NH2 . ARG B 1 54  ? 10.349  1.832   -72.679 1.00 52.03  ? 54   ARG B NH2 1 
ATOM   4580 N N   . PRO B 1 55  ? 7.328   6.548   -70.423 1.00 52.18  ? 55   PRO B N   1 
ATOM   4581 C CA  . PRO B 1 55  ? 5.932   6.799   -70.800 1.00 51.89  ? 55   PRO B CA  1 
ATOM   4582 C C   . PRO B 1 55  ? 5.260   5.546   -71.316 1.00 51.61  ? 55   PRO B C   1 
ATOM   4583 O O   . PRO B 1 55  ? 5.940   4.616   -71.731 1.00 51.89  ? 55   PRO B O   1 
ATOM   4584 C CB  . PRO B 1 55  ? 6.052   7.814   -71.934 1.00 51.90  ? 55   PRO B CB  1 
ATOM   4585 C CG  . PRO B 1 55  ? 7.339   8.529   -71.676 1.00 52.49  ? 55   PRO B CG  1 
ATOM   4586 C CD  . PRO B 1 55  ? 8.255   7.483   -71.092 1.00 52.42  ? 55   PRO B CD  1 
ATOM   4587 N N   . TRP B 1 56  ? 3.937   5.516   -71.291 1.00 51.40  ? 56   TRP B N   1 
ATOM   4588 C CA  . TRP B 1 56  ? 3.209   4.351   -71.774 1.00 51.28  ? 56   TRP B CA  1 
ATOM   4589 C C   . TRP B 1 56  ? 2.059   4.702   -72.724 1.00 51.38  ? 56   TRP B C   1 
ATOM   4590 O O   . TRP B 1 56  ? 1.377   5.716   -72.569 1.00 51.39  ? 56   TRP B O   1 
ATOM   4591 C CB  . TRP B 1 56  ? 2.683   3.547   -70.600 1.00 51.16  ? 56   TRP B CB  1 
ATOM   4592 C CG  . TRP B 1 56  ? 1.815   4.352   -69.703 1.00 51.47  ? 56   TRP B CG  1 
ATOM   4593 C CD1 . TRP B 1 56  ? 0.470   4.578   -69.842 1.00 52.03  ? 56   TRP B CD1 1 
ATOM   4594 C CD2 . TRP B 1 56  ? 2.217   5.055   -68.526 1.00 51.59  ? 56   TRP B CD2 1 
ATOM   4595 N NE1 . TRP B 1 56  ? 0.009   5.371   -68.817 1.00 52.12  ? 56   TRP B NE1 1 
ATOM   4596 C CE2 . TRP B 1 56  ? 1.061   5.677   -67.994 1.00 52.13  ? 56   TRP B CE2 1 
ATOM   4597 C CE3 . TRP B 1 56  ? 3.434   5.210   -67.860 1.00 51.06  ? 56   TRP B CE3 1 
ATOM   4598 C CZ2 . TRP B 1 56  ? 1.096   6.445   -66.834 1.00 51.03  ? 56   TRP B CZ2 1 
ATOM   4599 C CZ3 . TRP B 1 56  ? 3.467   5.971   -66.715 1.00 51.26  ? 56   TRP B CZ3 1 
ATOM   4600 C CH2 . TRP B 1 56  ? 2.304   6.582   -66.212 1.00 51.33  ? 56   TRP B CH2 1 
ATOM   4601 N N   . SER B 1 57  ? 1.860   3.842   -73.711 1.00 51.48  ? 57   SER B N   1 
ATOM   4602 C CA  . SER B 1 57  ? 0.765   3.960   -74.646 1.00 51.60  ? 57   SER B CA  1 
ATOM   4603 C C   . SER B 1 57  ? -0.553  3.554   -73.973 1.00 52.01  ? 57   SER B C   1 
ATOM   4604 O O   . SER B 1 57  ? -0.554  2.720   -73.062 1.00 52.00  ? 57   SER B O   1 
ATOM   4605 C CB  . SER B 1 57  ? 1.026   3.006   -75.799 1.00 51.52  ? 57   SER B CB  1 
ATOM   4606 O OG  . SER B 1 57  ? 0.790   1.666   -75.381 1.00 50.65  ? 57   SER B OG  1 
ATOM   4607 N N   . GLY B 1 58  ? -1.666  4.127   -74.435 1.00 52.14  ? 58   GLY B N   1 
ATOM   4608 C CA  . GLY B 1 58  ? -2.995  3.682   -74.017 1.00 52.22  ? 58   GLY B CA  1 
ATOM   4609 C C   . GLY B 1 58  ? -3.371  4.096   -72.608 1.00 52.56  ? 58   GLY B C   1 
ATOM   4610 O O   . GLY B 1 58  ? -2.866  5.093   -72.081 1.00 52.51  ? 58   GLY B O   1 
ATOM   4611 N N   . VAL B 1 59  ? -4.274  3.338   -71.993 1.00 52.73  ? 59   VAL B N   1 
ATOM   4612 C CA  . VAL B 1 59  ? -4.697  3.642   -70.630 1.00 52.82  ? 59   VAL B CA  1 
ATOM   4613 C C   . VAL B 1 59  ? -4.264  2.527   -69.713 1.00 53.14  ? 59   VAL B C   1 
ATOM   4614 O O   . VAL B 1 59  ? -4.756  1.406   -69.818 1.00 53.45  ? 59   VAL B O   1 
ATOM   4615 C CB  . VAL B 1 59  ? -6.220  3.868   -70.510 1.00 52.74  ? 59   VAL B CB  1 
ATOM   4616 C CG1 . VAL B 1 59  ? -6.616  4.100   -69.049 1.00 52.12  ? 59   VAL B CG1 1 
ATOM   4617 C CG2 . VAL B 1 59  ? -6.646  5.050   -71.372 1.00 52.75  ? 59   VAL B CG2 1 
ATOM   4618 N N   . LEU B 1 60  ? -3.339  2.861   -68.815 1.00 53.57  ? 60   LEU B N   1 
ATOM   4619 C CA  . LEU B 1 60  ? -2.736  1.922   -67.869 1.00 53.33  ? 60   LEU B CA  1 
ATOM   4620 C C   . LEU B 1 60  ? -3.678  1.670   -66.703 1.00 52.72  ? 60   LEU B C   1 
ATOM   4621 O O   . LEU B 1 60  ? -4.123  2.603   -66.065 1.00 52.73  ? 60   LEU B O   1 
ATOM   4622 C CB  . LEU B 1 60  ? -1.382  2.490   -67.407 1.00 53.56  ? 60   LEU B CB  1 
ATOM   4623 C CG  . LEU B 1 60  ? -0.501  1.948   -66.267 1.00 54.13  ? 60   LEU B CG  1 
ATOM   4624 C CD1 . LEU B 1 60  ? -0.518  0.424   -66.074 1.00 55.52  ? 60   LEU B CD1 1 
ATOM   4625 C CD2 . LEU B 1 60  ? 0.914   2.413   -66.512 1.00 53.89  ? 60   LEU B CD2 1 
ATOM   4626 N N   . ASP B 1 61  ? -3.984  0.405   -66.441 1.00 52.58  ? 61   ASP B N   1 
ATOM   4627 C CA  . ASP B 1 61  ? -4.944  0.029   -65.399 1.00 52.72  ? 61   ASP B CA  1 
ATOM   4628 C C   . ASP B 1 61  ? -4.401  0.241   -63.986 1.00 52.38  ? 61   ASP B C   1 
ATOM   4629 O O   . ASP B 1 61  ? -3.439  -0.404  -63.584 1.00 52.58  ? 61   ASP B O   1 
ATOM   4630 C CB  . ASP B 1 61  ? -5.372  -1.430  -65.572 1.00 52.96  ? 61   ASP B CB  1 
ATOM   4631 C CG  . ASP B 1 61  ? -6.156  -1.945  -64.384 1.00 54.91  ? 61   ASP B CG  1 
ATOM   4632 O OD1 . ASP B 1 61  ? -5.584  -2.713  -63.579 1.00 56.64  ? 61   ASP B OD1 1 
ATOM   4633 O OD2 . ASP B 1 61  ? -7.336  -1.554  -64.233 1.00 57.50  ? 61   ASP B OD2 1 
ATOM   4634 N N   . ALA B 1 62  ? -5.035  1.132   -63.231 1.00 52.13  ? 62   ALA B N   1 
ATOM   4635 C CA  . ALA B 1 62  ? -4.557  1.504   -61.896 1.00 51.83  ? 62   ALA B CA  1 
ATOM   4636 C C   . ALA B 1 62  ? -5.689  1.406   -60.897 1.00 51.52  ? 62   ALA B C   1 
ATOM   4637 O O   . ALA B 1 62  ? -6.172  2.413   -60.381 1.00 51.11  ? 62   ALA B O   1 
ATOM   4638 C CB  . ALA B 1 62  ? -3.965  2.916   -61.902 1.00 51.78  ? 62   ALA B CB  1 
ATOM   4639 N N   . THR B 1 63  ? -6.097  0.171   -60.633 1.00 51.46  ? 63   THR B N   1 
ATOM   4640 C CA  . THR B 1 63  ? -7.329  -0.106  -59.911 1.00 51.43  ? 63   THR B CA  1 
ATOM   4641 C C   . THR B 1 63  ? -7.058  -1.184  -58.901 1.00 51.54  ? 63   THR B C   1 
ATOM   4642 O O   . THR B 1 63  ? -7.958  -1.635  -58.184 1.00 51.97  ? 63   THR B O   1 
ATOM   4643 C CB  . THR B 1 63  ? -8.454  -0.616  -60.863 1.00 51.52  ? 63   THR B CB  1 
ATOM   4644 O OG1 . THR B 1 63  ? -8.053  -1.844  -61.490 1.00 50.80  ? 63   THR B OG1 1 
ATOM   4645 C CG2 . THR B 1 63  ? -8.777  0.414   -61.939 1.00 51.32  ? 63   THR B CG2 1 
ATOM   4646 N N   . THR B 1 64  ? -5.807  -1.614  -58.856 1.00 51.56  ? 64   THR B N   1 
ATOM   4647 C CA  . THR B 1 64  ? -5.420  -2.671  -57.949 1.00 51.60  ? 64   THR B CA  1 
ATOM   4648 C C   . THR B 1 64  ? -4.013  -2.402  -57.433 1.00 51.54  ? 64   THR B C   1 
ATOM   4649 O O   . THR B 1 64  ? -3.210  -1.759  -58.118 1.00 51.54  ? 64   THR B O   1 
ATOM   4650 C CB  . THR B 1 64  ? -5.561  -4.064  -58.619 1.00 51.44  ? 64   THR B CB  1 
ATOM   4651 O OG1 . THR B 1 64  ? -5.364  -5.077  -57.634 1.00 52.38  ? 64   THR B OG1 1 
ATOM   4652 C CG2 . THR B 1 64  ? -4.559  -4.258  -59.776 1.00 51.38  ? 64   THR B CG2 1 
ATOM   4653 N N   . PHE B 1 65  ? -3.737  -2.863  -56.214 1.00 51.66  ? 65   PHE B N   1 
ATOM   4654 C CA  . PHE B 1 65  ? -2.411  -2.730  -55.613 1.00 51.86  ? 65   PHE B CA  1 
ATOM   4655 C C   . PHE B 1 65  ? -1.389  -3.564  -56.351 1.00 52.06  ? 65   PHE B C   1 
ATOM   4656 O O   . PHE B 1 65  ? -1.685  -4.676  -56.788 1.00 52.36  ? 65   PHE B O   1 
ATOM   4657 C CB  . PHE B 1 65  ? -2.427  -3.159  -54.149 1.00 51.67  ? 65   PHE B CB  1 
ATOM   4658 C CG  . PHE B 1 65  ? -2.938  -2.108  -53.212 1.00 51.97  ? 65   PHE B CG  1 
ATOM   4659 C CD1 . PHE B 1 65  ? -2.419  -0.805  -53.248 1.00 52.73  ? 65   PHE B CD1 1 
ATOM   4660 C CD2 . PHE B 1 65  ? -3.916  -2.419  -52.268 1.00 51.96  ? 65   PHE B CD2 1 
ATOM   4661 C CE1 . PHE B 1 65  ? -2.886  0.179   -52.370 1.00 52.83  ? 65   PHE B CE1 1 
ATOM   4662 C CE2 . PHE B 1 65  ? -4.390  -1.454  -51.376 1.00 51.93  ? 65   PHE B CE2 1 
ATOM   4663 C CZ  . PHE B 1 65  ? -3.871  -0.150  -51.424 1.00 52.57  ? 65   PHE B CZ  1 
ATOM   4664 N N   . GLN B 1 66  ? -0.181  -3.032  -56.474 1.00 52.35  ? 66   GLN B N   1 
ATOM   4665 C CA  . GLN B 1 66  ? 0.904   -3.746  -57.144 1.00 52.83  ? 66   GLN B CA  1 
ATOM   4666 C C   . GLN B 1 66  ? 1.688   -4.700  -56.227 1.00 53.12  ? 66   GLN B C   1 
ATOM   4667 O O   . GLN B 1 66  ? 1.350   -4.879  -55.058 1.00 53.29  ? 66   GLN B O   1 
ATOM   4668 C CB  . GLN B 1 66  ? 1.841   -2.743  -57.811 1.00 52.80  ? 66   GLN B CB  1 
ATOM   4669 C CG  . GLN B 1 66  ? 1.386   -2.309  -59.181 1.00 53.03  ? 66   GLN B CG  1 
ATOM   4670 C CD  . GLN B 1 66  ? 1.698   -3.338  -60.245 1.00 54.69  ? 66   GLN B CD  1 
ATOM   4671 O OE1 . GLN B 1 66  ? 1.959   -4.510  -59.949 1.00 55.05  ? 66   GLN B OE1 1 
ATOM   4672 N NE2 . GLN B 1 66  ? 1.674   -2.906  -61.498 1.00 55.40  ? 66   GLN B NE2 1 
ATOM   4673 N N   . ASN B 1 67  ? 2.733   -5.319  -56.766 1.00 53.55  ? 67   ASN B N   1 
ATOM   4674 C CA  . ASN B 1 67  ? 3.633   -6.163  -55.970 1.00 53.95  ? 67   ASN B CA  1 
ATOM   4675 C C   . ASN B 1 67  ? 4.315   -5.475  -54.772 1.00 53.82  ? 67   ASN B C   1 
ATOM   4676 O O   . ASN B 1 67  ? 4.612   -4.278  -54.804 1.00 53.68  ? 67   ASN B O   1 
ATOM   4677 C CB  . ASN B 1 67  ? 4.713   -6.765  -56.870 1.00 54.37  ? 67   ASN B CB  1 
ATOM   4678 C CG  . ASN B 1 67  ? 4.160   -7.771  -57.873 1.00 55.18  ? 67   ASN B CG  1 
ATOM   4679 O OD1 . ASN B 1 67  ? 3.371   -8.659  -57.522 1.00 54.83  ? 67   ASN B OD1 1 
ATOM   4680 N ND2 . ASN B 1 67  ? 4.602   -7.649  -59.130 1.00 54.83  ? 67   ASN B ND2 1 
ATOM   4681 N N   . VAL B 1 68  ? 4.558   -6.258  -53.725 1.00 53.77  ? 68   VAL B N   1 
ATOM   4682 C CA  . VAL B 1 68  ? 5.300   -5.826  -52.546 1.00 53.69  ? 68   VAL B CA  1 
ATOM   4683 C C   . VAL B 1 68  ? 6.779   -6.033  -52.835 1.00 53.95  ? 68   VAL B C   1 
ATOM   4684 O O   . VAL B 1 68  ? 7.146   -7.042  -53.424 1.00 54.01  ? 68   VAL B O   1 
ATOM   4685 C CB  . VAL B 1 68  ? 4.889   -6.675  -51.313 1.00 53.50  ? 68   VAL B CB  1 
ATOM   4686 C CG1 . VAL B 1 68  ? 5.803   -6.436  -50.139 1.00 53.51  ? 68   VAL B CG1 1 
ATOM   4687 C CG2 . VAL B 1 68  ? 3.469   -6.376  -50.911 1.00 53.46  ? 68   VAL B CG2 1 
ATOM   4688 N N   . CYS B 1 69  ? 7.633   -5.097  -52.434 1.00 54.29  ? 69   CYS B N   1 
ATOM   4689 C CA  . CYS B 1 69  ? 9.071   -5.292  -52.616 1.00 54.91  ? 69   CYS B CA  1 
ATOM   4690 C C   . CYS B 1 69  ? 9.552   -6.541  -51.913 1.00 55.67  ? 69   CYS B C   1 
ATOM   4691 O O   . CYS B 1 69  ? 8.992   -6.922  -50.882 1.00 55.51  ? 69   CYS B O   1 
ATOM   4692 C CB  . CYS B 1 69  ? 9.852   -4.105  -52.096 1.00 54.59  ? 69   CYS B CB  1 
ATOM   4693 S SG  . CYS B 1 69  ? 9.514   -2.639  -52.995 1.00 54.17  ? 69   CYS B SG  1 
ATOM   4694 N N   . TYR B 1 70  ? 10.603  -7.161  -52.454 1.00 56.76  ? 70   TYR B N   1 
ATOM   4695 C CA  . TYR B 1 70  ? 11.034  -8.466  -51.957 1.00 57.73  ? 70   TYR B CA  1 
ATOM   4696 C C   . TYR B 1 70  ? 11.537  -8.391  -50.528 1.00 58.44  ? 70   TYR B C   1 
ATOM   4697 O O   . TYR B 1 70  ? 12.506  -7.681  -50.238 1.00 58.65  ? 70   TYR B O   1 
ATOM   4698 C CB  . TYR B 1 70  ? 12.062  -9.151  -52.874 1.00 57.87  ? 70   TYR B CB  1 
ATOM   4699 C CG  . TYR B 1 70  ? 11.903  -10.651 -52.804 1.00 57.86  ? 70   TYR B CG  1 
ATOM   4700 C CD1 . TYR B 1 70  ? 10.923  -11.296 -53.548 1.00 57.72  ? 70   TYR B CD1 1 
ATOM   4701 C CD2 . TYR B 1 70  ? 12.678  -11.412 -51.942 1.00 58.00  ? 70   TYR B CD2 1 
ATOM   4702 C CE1 . TYR B 1 70  ? 10.737  -12.659 -53.457 1.00 58.23  ? 70   TYR B CE1 1 
ATOM   4703 C CE2 . TYR B 1 70  ? 12.499  -12.784 -51.839 1.00 58.35  ? 70   TYR B CE2 1 
ATOM   4704 C CZ  . TYR B 1 70  ? 11.527  -13.402 -52.600 1.00 58.52  ? 70   TYR B CZ  1 
ATOM   4705 O OH  . TYR B 1 70  ? 11.334  -14.760 -52.498 1.00 58.58  ? 70   TYR B OH  1 
ATOM   4706 N N   . GLN B 1 71  ? 10.869  -9.120  -49.640 1.00 59.23  ? 71   GLN B N   1 
ATOM   4707 C CA  . GLN B 1 71  ? 11.171  -9.024  -48.219 1.00 60.52  ? 71   GLN B CA  1 
ATOM   4708 C C   . GLN B 1 71  ? 11.031  -10.323 -47.433 1.00 61.70  ? 71   GLN B C   1 
ATOM   4709 O O   . GLN B 1 71  ? 10.349  -11.252 -47.852 1.00 61.66  ? 71   GLN B O   1 
ATOM   4710 C CB  . GLN B 1 71  ? 10.310  -7.934  -47.577 1.00 60.34  ? 71   GLN B CB  1 
ATOM   4711 C CG  . GLN B 1 71  ? 8.814   -8.168  -47.677 1.00 60.07  ? 71   GLN B CG  1 
ATOM   4712 C CD  . GLN B 1 71  ? 8.008   -7.049  -47.051 1.00 60.07  ? 71   GLN B CD  1 
ATOM   4713 O OE1 . GLN B 1 71  ? 7.455   -7.199  -45.954 1.00 59.97  ? 71   GLN B OE1 1 
ATOM   4714 N NE2 . GLN B 1 71  ? 7.950   -5.912  -47.734 1.00 58.32  ? 71   GLN B NE2 1 
ATOM   4715 N N   . TYR B 1 72  ? 11.695  -10.376 -46.285 1.00 63.44  ? 72   TYR B N   1 
ATOM   4716 C CA  . TYR B 1 72  ? 11.490  -11.453 -45.336 1.00 65.17  ? 72   TYR B CA  1 
ATOM   4717 C C   . TYR B 1 72  ? 10.028  -11.462 -44.904 1.00 66.05  ? 72   TYR B C   1 
ATOM   4718 O O   . TYR B 1 72  ? 9.457   -10.415 -44.573 1.00 66.36  ? 72   TYR B O   1 
ATOM   4719 C CB  . TYR B 1 72  ? 12.405  -11.259 -44.123 1.00 65.75  ? 72   TYR B CB  1 
ATOM   4720 C CG  . TYR B 1 72  ? 12.193  -12.268 -43.017 1.00 66.73  ? 72   TYR B CG  1 
ATOM   4721 C CD1 . TYR B 1 72  ? 11.434  -11.942 -41.888 1.00 67.49  ? 72   TYR B CD1 1 
ATOM   4722 C CD2 . TYR B 1 72  ? 12.753  -13.550 -43.093 1.00 67.65  ? 72   TYR B CD2 1 
ATOM   4723 C CE1 . TYR B 1 72  ? 11.234  -12.870 -40.854 1.00 68.25  ? 72   TYR B CE1 1 
ATOM   4724 C CE2 . TYR B 1 72  ? 12.557  -14.490 -42.065 1.00 68.08  ? 72   TYR B CE2 1 
ATOM   4725 C CZ  . TYR B 1 72  ? 11.799  -14.138 -40.951 1.00 67.96  ? 72   TYR B CZ  1 
ATOM   4726 O OH  . TYR B 1 72  ? 11.590  -15.047 -39.941 1.00 67.75  ? 72   TYR B OH  1 
ATOM   4727 N N   . VAL B 1 73  ? 9.412   -12.638 -44.932 1.00 67.09  ? 73   VAL B N   1 
ATOM   4728 C CA  . VAL B 1 73  ? 8.046   -12.775 -44.443 1.00 68.03  ? 73   VAL B CA  1 
ATOM   4729 C C   . VAL B 1 73  ? 8.128   -13.322 -43.022 1.00 69.05  ? 73   VAL B C   1 
ATOM   4730 O O   . VAL B 1 73  ? 8.819   -14.319 -42.785 1.00 69.22  ? 73   VAL B O   1 
ATOM   4731 C CB  . VAL B 1 73  ? 7.189   -13.691 -45.353 1.00 67.78  ? 73   VAL B CB  1 
ATOM   4732 C CG1 . VAL B 1 73  ? 5.773   -13.820 -44.814 1.00 67.53  ? 73   VAL B CG1 1 
ATOM   4733 C CG2 . VAL B 1 73  ? 7.149   -13.147 -46.769 1.00 67.60  ? 73   VAL B CG2 1 
ATOM   4734 N N   . ASP B 1 74  ? 7.437   -12.665 -42.084 1.00 70.16  ? 74   ASP B N   1 
ATOM   4735 C CA  . ASP B 1 74  ? 7.477   -13.049 -40.666 1.00 71.28  ? 74   ASP B CA  1 
ATOM   4736 C C   . ASP B 1 74  ? 6.675   -14.314 -40.321 1.00 71.90  ? 74   ASP B C   1 
ATOM   4737 O O   . ASP B 1 74  ? 5.475   -14.419 -40.614 1.00 71.80  ? 74   ASP B O   1 
ATOM   4738 C CB  . ASP B 1 74  ? 7.029   -11.895 -39.771 1.00 71.32  ? 74   ASP B CB  1 
ATOM   4739 C CG  . ASP B 1 74  ? 7.335   -12.157 -38.312 1.00 72.36  ? 74   ASP B CG  1 
ATOM   4740 O OD1 . ASP B 1 74  ? 6.375   -12.356 -37.527 1.00 72.97  ? 74   ASP B OD1 1 
ATOM   4741 O OD2 . ASP B 1 74  ? 8.542   -12.204 -37.965 1.00 73.38  ? 74   ASP B OD2 1 
ATOM   4742 N N   . THR B 1 75  ? 7.344   -15.265 -39.675 1.00 72.71  ? 75   THR B N   1 
ATOM   4743 C CA  . THR B 1 75  ? 6.731   -16.561 -39.396 1.00 73.67  ? 75   THR B CA  1 
ATOM   4744 C C   . THR B 1 75  ? 6.750   -16.935 -37.916 1.00 74.34  ? 75   THR B C   1 
ATOM   4745 O O   . THR B 1 75  ? 6.519   -18.097 -37.563 1.00 74.67  ? 75   THR B O   1 
ATOM   4746 C CB  . THR B 1 75  ? 7.406   -17.690 -40.203 1.00 73.67  ? 75   THR B CB  1 
ATOM   4747 O OG1 . THR B 1 75  ? 8.824   -17.610 -40.023 1.00 73.63  ? 75   THR B OG1 1 
ATOM   4748 C CG2 . THR B 1 75  ? 7.053   -17.596 -41.710 1.00 73.91  ? 75   THR B CG2 1 
ATOM   4749 N N   . LEU B 1 76  ? 6.995   -15.957 -37.050 1.00 75.04  ? 76   LEU B N   1 
ATOM   4750 C CA  . LEU B 1 76  ? 7.121   -16.245 -35.629 1.00 75.76  ? 76   LEU B CA  1 
ATOM   4751 C C   . LEU B 1 76  ? 5.828   -16.764 -35.010 1.00 76.16  ? 76   LEU B C   1 
ATOM   4752 O O   . LEU B 1 76  ? 5.856   -17.740 -34.256 1.00 76.50  ? 76   LEU B O   1 
ATOM   4753 C CB  . LEU B 1 76  ? 7.618   -15.031 -34.857 1.00 75.89  ? 76   LEU B CB  1 
ATOM   4754 C CG  . LEU B 1 76  ? 8.302   -15.419 -33.546 1.00 76.29  ? 76   LEU B CG  1 
ATOM   4755 C CD1 . LEU B 1 76  ? 9.756   -15.895 -33.801 1.00 76.89  ? 76   LEU B CD1 1 
ATOM   4756 C CD2 . LEU B 1 76  ? 8.249   -14.244 -32.583 1.00 76.28  ? 76   LEU B CD2 1 
ATOM   4757 N N   . TYR B 1 77  ? 4.709   -16.112 -35.326 1.00 76.45  ? 77   TYR B N   1 
ATOM   4758 C CA  . TYR B 1 77  ? 3.402   -16.544 -34.841 1.00 76.58  ? 77   TYR B CA  1 
ATOM   4759 C C   . TYR B 1 77  ? 2.451   -16.768 -36.003 1.00 76.63  ? 77   TYR B C   1 
ATOM   4760 O O   . TYR B 1 77  ? 1.597   -15.917 -36.263 1.00 76.69  ? 77   TYR B O   1 
ATOM   4761 C CB  . TYR B 1 77  ? 2.805   -15.499 -33.912 1.00 76.71  ? 77   TYR B CB  1 
ATOM   4762 C CG  . TYR B 1 77  ? 3.473   -15.404 -32.573 1.00 76.95  ? 77   TYR B CG  1 
ATOM   4763 C CD1 . TYR B 1 77  ? 3.272   -16.384 -31.606 1.00 77.40  ? 77   TYR B CD1 1 
ATOM   4764 C CD2 . TYR B 1 77  ? 4.293   -14.321 -32.260 1.00 77.18  ? 77   TYR B CD2 1 
ATOM   4765 C CE1 . TYR B 1 77  ? 3.879   -16.295 -30.359 1.00 77.79  ? 77   TYR B CE1 1 
ATOM   4766 C CE2 . TYR B 1 77  ? 4.903   -14.217 -31.016 1.00 77.06  ? 77   TYR B CE2 1 
ATOM   4767 C CZ  . TYR B 1 77  ? 4.693   -15.207 -30.069 1.00 77.28  ? 77   TYR B CZ  1 
ATOM   4768 O OH  . TYR B 1 77  ? 5.292   -15.116 -28.833 1.00 77.04  ? 77   TYR B OH  1 
ATOM   4769 N N   . PRO B 1 78  ? 2.583   -17.916 -36.700 1.00 76.63  ? 78   PRO B N   1 
ATOM   4770 C CA  . PRO B 1 78  ? 1.819   -18.165 -37.935 1.00 76.39  ? 78   PRO B CA  1 
ATOM   4771 C C   . PRO B 1 78  ? 0.303   -18.125 -37.721 1.00 75.99  ? 78   PRO B C   1 
ATOM   4772 O O   . PRO B 1 78  ? -0.199  -18.707 -36.760 1.00 75.86  ? 78   PRO B O   1 
ATOM   4773 C CB  . PRO B 1 78  ? 2.276   -19.573 -38.354 1.00 76.45  ? 78   PRO B CB  1 
ATOM   4774 C CG  . PRO B 1 78  ? 3.599   -19.777 -37.671 1.00 76.62  ? 78   PRO B CG  1 
ATOM   4775 C CD  . PRO B 1 78  ? 3.456   -19.058 -36.359 1.00 76.69  ? 78   PRO B CD  1 
ATOM   4776 N N   . GLY B 1 79  ? -0.409  -17.418 -38.597 1.00 75.65  ? 79   GLY B N   1 
ATOM   4777 C CA  . GLY B 1 79  ? -1.866  -17.324 -38.516 1.00 75.57  ? 79   GLY B CA  1 
ATOM   4778 C C   . GLY B 1 79  ? -2.395  -16.390 -37.440 1.00 75.67  ? 79   GLY B C   1 
ATOM   4779 O O   . GLY B 1 79  ? -3.610  -16.229 -37.300 1.00 75.56  ? 79   GLY B O   1 
ATOM   4780 N N   . PHE B 1 80  ? -1.489  -15.784 -36.669 1.00 75.82  ? 80   PHE B N   1 
ATOM   4781 C CA  . PHE B 1 80  ? -1.852  -14.777 -35.664 1.00 75.68  ? 80   PHE B CA  1 
ATOM   4782 C C   . PHE B 1 80  ? -1.970  -13.403 -36.307 1.00 75.34  ? 80   PHE B C   1 
ATOM   4783 O O   . PHE B 1 80  ? -1.006  -12.893 -36.882 1.00 75.37  ? 80   PHE B O   1 
ATOM   4784 C CB  . PHE B 1 80  ? -0.842  -14.742 -34.504 1.00 75.93  ? 80   PHE B CB  1 
ATOM   4785 C CG  . PHE B 1 80  ? -1.088  -13.627 -33.507 1.00 76.44  ? 80   PHE B CG  1 
ATOM   4786 C CD1 . PHE B 1 80  ? -2.353  -13.440 -32.933 1.00 76.90  ? 80   PHE B CD1 1 
ATOM   4787 C CD2 . PHE B 1 80  ? -0.052  -12.771 -33.135 1.00 76.55  ? 80   PHE B CD2 1 
ATOM   4788 C CE1 . PHE B 1 80  ? -2.585  -12.412 -32.017 1.00 77.04  ? 80   PHE B CE1 1 
ATOM   4789 C CE2 . PHE B 1 80  ? -0.272  -11.747 -32.213 1.00 76.58  ? 80   PHE B CE2 1 
ATOM   4790 C CZ  . PHE B 1 80  ? -1.545  -11.568 -31.654 1.00 76.79  ? 80   PHE B CZ  1 
ATOM   4791 N N   . GLU B 1 81  ? -3.151  -12.807 -36.183 1.00 74.87  ? 81   GLU B N   1 
ATOM   4792 C CA  . GLU B 1 81  ? -3.478  -11.561 -36.860 1.00 74.82  ? 81   GLU B CA  1 
ATOM   4793 C C   . GLU B 1 81  ? -2.601  -10.400 -36.396 1.00 73.58  ? 81   GLU B C   1 
ATOM   4794 O O   . GLU B 1 81  ? -2.286  -9.499  -37.176 1.00 73.56  ? 81   GLU B O   1 
ATOM   4795 C CB  . GLU B 1 81  ? -4.945  -11.236 -36.635 1.00 74.92  ? 81   GLU B CB  1 
ATOM   4796 C CG  . GLU B 1 81  ? -5.583  -10.427 -37.757 1.00 76.67  ? 81   GLU B CG  1 
ATOM   4797 C CD  . GLU B 1 81  ? -7.032  -10.032 -37.447 1.00 77.13  ? 81   GLU B CD  1 
ATOM   4798 O OE1 . GLU B 1 81  ? -7.655  -10.652 -36.536 1.00 79.39  ? 81   GLU B OE1 1 
ATOM   4799 O OE2 . GLU B 1 81  ? -7.542  -9.099  -38.121 1.00 80.08  ? 81   GLU B OE2 1 
ATOM   4800 N N   . GLY B 1 82  ? -2.204  -10.435 -35.126 1.00 72.35  ? 82   GLY B N   1 
ATOM   4801 C CA  . GLY B 1 82  ? -1.277  -9.463  -34.581 1.00 70.75  ? 82   GLY B CA  1 
ATOM   4802 C C   . GLY B 1 82  ? -0.034  -9.303  -35.433 1.00 69.86  ? 82   GLY B C   1 
ATOM   4803 O O   . GLY B 1 82  ? 0.448   -8.182  -35.622 1.00 69.86  ? 82   GLY B O   1 
ATOM   4804 N N   . THR B 1 83  ? 0.482   -10.419 -35.951 1.00 68.79  ? 83   THR B N   1 
ATOM   4805 C CA  . THR B 1 83  ? 1.659   -10.388 -36.829 1.00 67.64  ? 83   THR B CA  1 
ATOM   4806 C C   . THR B 1 83  ? 1.333   -10.390 -38.332 1.00 66.64  ? 83   THR B C   1 
ATOM   4807 O O   . THR B 1 83  ? 2.071   -9.777  -39.113 1.00 66.62  ? 83   THR B O   1 
ATOM   4808 C CB  . THR B 1 83  ? 2.708   -11.499 -36.504 1.00 67.75  ? 83   THR B CB  1 
ATOM   4809 O OG1 . THR B 1 83  ? 2.109   -12.795 -36.610 1.00 68.72  ? 83   THR B OG1 1 
ATOM   4810 C CG2 . THR B 1 83  ? 3.279   -11.332 -35.110 1.00 67.61  ? 83   THR B CG2 1 
ATOM   4811 N N   . GLU B 1 84  ? 0.255   -11.067 -38.743 1.00 65.21  ? 84   GLU B N   1 
ATOM   4812 C CA  . GLU B 1 84  ? -0.041  -11.201 -40.181 1.00 64.12  ? 84   GLU B CA  1 
ATOM   4813 C C   . GLU B 1 84  ? -0.317  -9.843  -40.805 1.00 62.77  ? 84   GLU B C   1 
ATOM   4814 O O   . GLU B 1 84  ? 0.004   -9.621  -41.974 1.00 62.68  ? 84   GLU B O   1 
ATOM   4815 C CB  . GLU B 1 84  ? -1.229  -12.144 -40.484 1.00 64.63  ? 84   GLU B CB  1 
ATOM   4816 C CG  . GLU B 1 84  ? -1.114  -13.636 -40.043 1.00 66.58  ? 84   GLU B CG  1 
ATOM   4817 C CD  . GLU B 1 84  ? -0.015  -14.472 -40.743 1.00 68.87  ? 84   GLU B CD  1 
ATOM   4818 O OE1 . GLU B 1 84  ? 0.714   -13.958 -41.640 1.00 69.65  ? 84   GLU B OE1 1 
ATOM   4819 O OE2 . GLU B 1 84  ? 0.112   -15.667 -40.373 1.00 68.32  ? 84   GLU B OE2 1 
ATOM   4820 N N   . MET B 1 85  ? -0.902  -8.942  -40.013 1.00 60.93  ? 85   MET B N   1 
ATOM   4821 C CA  . MET B 1 85  ? -1.343  -7.627  -40.485 1.00 59.11  ? 85   MET B CA  1 
ATOM   4822 C C   . MET B 1 85  ? -0.185  -6.779  -41.010 1.00 58.03  ? 85   MET B C   1 
ATOM   4823 O O   . MET B 1 85  ? -0.381  -5.857  -41.812 1.00 57.64  ? 85   MET B O   1 
ATOM   4824 C CB  . MET B 1 85  ? -2.059  -6.885  -39.363 1.00 59.22  ? 85   MET B CB  1 
ATOM   4825 C CG  . MET B 1 85  ? -1.146  -6.530  -38.193 1.00 59.25  ? 85   MET B CG  1 
ATOM   4826 S SD  . MET B 1 85  ? -1.920  -5.574  -36.882 1.00 58.81  ? 85   MET B SD  1 
ATOM   4827 C CE  . MET B 1 85  ? -2.529  -4.153  -37.784 1.00 58.24  ? 85   MET B CE  1 
ATOM   4828 N N   . TRP B 1 86  ? 1.018   -7.105  -40.547 1.00 56.65  ? 86   TRP B N   1 
ATOM   4829 C CA  . TRP B 1 86  ? 2.232   -6.421  -40.974 1.00 55.40  ? 86   TRP B CA  1 
ATOM   4830 C C   . TRP B 1 86  ? 2.865   -7.106  -42.178 1.00 54.93  ? 86   TRP B C   1 
ATOM   4831 O O   . TRP B 1 86  ? 3.691   -6.505  -42.869 1.00 54.72  ? 86   TRP B O   1 
ATOM   4832 C CB  . TRP B 1 86  ? 3.234   -6.319  -39.815 1.00 54.69  ? 86   TRP B CB  1 
ATOM   4833 C CG  . TRP B 1 86  ? 2.675   -5.627  -38.595 1.00 53.76  ? 86   TRP B CG  1 
ATOM   4834 C CD1 . TRP B 1 86  ? 2.508   -6.170  -37.359 1.00 53.15  ? 86   TRP B CD1 1 
ATOM   4835 C CD2 . TRP B 1 86  ? 2.204   -4.271  -38.503 1.00 53.16  ? 86   TRP B CD2 1 
ATOM   4836 N NE1 . TRP B 1 86  ? 1.976   -5.246  -36.499 1.00 53.37  ? 86   TRP B NE1 1 
ATOM   4837 C CE2 . TRP B 1 86  ? 1.781   -4.068  -37.173 1.00 53.62  ? 86   TRP B CE2 1 
ATOM   4838 C CE3 . TRP B 1 86  ? 2.122   -3.201  -39.408 1.00 52.58  ? 86   TRP B CE3 1 
ATOM   4839 C CZ2 . TRP B 1 86  ? 1.267   -2.838  -36.725 1.00 53.50  ? 86   TRP B CZ2 1 
ATOM   4840 C CZ3 . TRP B 1 86  ? 1.608   -1.987  -38.967 1.00 52.97  ? 86   TRP B CZ3 1 
ATOM   4841 C CH2 . TRP B 1 86  ? 1.187   -1.817  -37.637 1.00 53.11  ? 86   TRP B CH2 1 
ATOM   4842 N N   . ASN B 1 87  ? 2.454   -8.355  -42.415 1.00 54.43  ? 87   ASN B N   1 
ATOM   4843 C CA  . ASN B 1 87  ? 2.993   -9.209  -43.476 1.00 54.00  ? 87   ASN B CA  1 
ATOM   4844 C C   . ASN B 1 87  ? 2.532   -8.815  -44.876 1.00 53.40  ? 87   ASN B C   1 
ATOM   4845 O O   . ASN B 1 87  ? 1.451   -8.246  -45.019 1.00 53.25  ? 87   ASN B O   1 
ATOM   4846 C CB  . ASN B 1 87  ? 2.624   -10.672 -43.212 1.00 54.22  ? 87   ASN B CB  1 
ATOM   4847 C CG  . ASN B 1 87  ? 3.698   -11.423 -42.437 1.00 54.93  ? 87   ASN B CG  1 
ATOM   4848 O OD1 . ASN B 1 87  ? 4.897   -11.137 -42.550 1.00 55.50  ? 87   ASN B OD1 1 
ATOM   4849 N ND2 . ASN B 1 87  ? 3.268   -12.404 -41.653 1.00 55.82  ? 87   ASN B ND2 1 
ATOM   4850 N N   . PRO B 1 88  ? 3.346   -9.131  -45.915 1.00 52.97  ? 88   PRO B N   1 
ATOM   4851 C CA  . PRO B 1 88  ? 3.001   -8.737  -47.283 1.00 52.62  ? 88   PRO B CA  1 
ATOM   4852 C C   . PRO B 1 88  ? 1.638   -9.280  -47.661 1.00 52.52  ? 88   PRO B C   1 
ATOM   4853 O O   . PRO B 1 88  ? 1.339   -10.445 -47.381 1.00 52.50  ? 88   PRO B O   1 
ATOM   4854 C CB  . PRO B 1 88  ? 4.093   -9.393  -48.138 1.00 52.30  ? 88   PRO B CB  1 
ATOM   4855 C CG  . PRO B 1 88  ? 5.210   -9.633  -47.217 1.00 52.33  ? 88   PRO B CG  1 
ATOM   4856 C CD  . PRO B 1 88  ? 4.623   -9.875  -45.870 1.00 52.93  ? 88   PRO B CD  1 
ATOM   4857 N N   . ASN B 1 89  ? 0.814   -8.433  -48.267 1.00 52.36  ? 89   ASN B N   1 
ATOM   4858 C CA  . ASN B 1 89  ? -0.535  -8.835  -48.640 1.00 52.32  ? 89   ASN B CA  1 
ATOM   4859 C C   . ASN B 1 89  ? -0.723  -8.899  -50.152 1.00 52.30  ? 89   ASN B C   1 
ATOM   4860 O O   . ASN B 1 89  ? -1.842  -8.909  -50.645 1.00 52.33  ? 89   ASN B O   1 
ATOM   4861 C CB  . ASN B 1 89  ? -1.599  -7.963  -47.935 1.00 52.33  ? 89   ASN B CB  1 
ATOM   4862 C CG  . ASN B 1 89  ? -1.715  -6.531  -48.502 1.00 52.04  ? 89   ASN B CG  1 
ATOM   4863 O OD1 . ASN B 1 89  ? -0.829  -6.013  -49.199 1.00 51.20  ? 89   ASN B OD1 1 
ATOM   4864 N ND2 . ASN B 1 89  ? -2.821  -5.883  -48.166 1.00 51.59  ? 89   ASN B ND2 1 
ATOM   4865 N N   . ARG B 1 90  ? 0.394   -8.926  -50.871 1.00 52.37  ? 90   ARG B N   1 
ATOM   4866 C CA  . ARG B 1 90  ? 0.412   -9.114  -52.321 1.00 52.57  ? 90   ARG B CA  1 
ATOM   4867 C C   . ARG B 1 90  ? 1.641   -9.932  -52.702 1.00 52.89  ? 90   ARG B C   1 
ATOM   4868 O O   . ARG B 1 90  ? 2.502   -10.207 -51.870 1.00 52.99  ? 90   ARG B O   1 
ATOM   4869 C CB  . ARG B 1 90  ? 0.443   -7.768  -53.063 1.00 52.33  ? 90   ARG B CB  1 
ATOM   4870 C CG  . ARG B 1 90  ? -0.827  -6.944  -53.000 1.00 51.49  ? 90   ARG B CG  1 
ATOM   4871 C CD  . ARG B 1 90  ? -1.978  -7.550  -53.791 1.00 51.73  ? 90   ARG B CD  1 
ATOM   4872 N NE  . ARG B 1 90  ? -3.184  -6.733  -53.673 1.00 52.55  ? 90   ARG B NE  1 
ATOM   4873 C CZ  . ARG B 1 90  ? -3.960  -6.673  -52.585 1.00 53.42  ? 90   ARG B CZ  1 
ATOM   4874 N NH1 . ARG B 1 90  ? -3.683  -7.382  -51.499 1.00 53.29  ? 90   ARG B NH1 1 
ATOM   4875 N NH2 . ARG B 1 90  ? -5.024  -5.884  -52.572 1.00 53.55  ? 90   ARG B NH2 1 
ATOM   4876 N N   . GLU B 1 91  ? 1.717   -10.326 -53.965 1.00 53.48  ? 91   GLU B N   1 
ATOM   4877 C CA  . GLU B 1 91  ? 2.882   -11.038 -54.475 1.00 53.93  ? 91   GLU B CA  1 
ATOM   4878 C C   . GLU B 1 91  ? 4.157   -10.261 -54.169 1.00 53.14  ? 91   GLU B C   1 
ATOM   4879 O O   . GLU B 1 91  ? 4.211   -9.044  -54.372 1.00 53.00  ? 91   GLU B O   1 
ATOM   4880 C CB  . GLU B 1 91  ? 2.752   -11.255 -55.998 1.00 54.89  ? 91   GLU B CB  1 
ATOM   4881 C CG  . GLU B 1 91  ? 1.831   -12.414 -56.423 1.00 57.16  ? 91   GLU B CG  1 
ATOM   4882 C CD  . GLU B 1 91  ? 2.269   -13.721 -55.793 1.00 60.30  ? 91   GLU B CD  1 
ATOM   4883 O OE1 . GLU B 1 91  ? 3.297   -14.277 -56.254 1.00 61.86  ? 91   GLU B OE1 1 
ATOM   4884 O OE2 . GLU B 1 91  ? 1.609   -14.166 -54.820 1.00 60.84  ? 91   GLU B OE2 1 
ATOM   4885 N N   . LEU B 1 92  ? 5.166   -10.967 -53.661 1.00 52.21  ? 92   LEU B N   1 
ATOM   4886 C CA  . LEU B 1 92  ? 6.504   -10.400 -53.521 1.00 51.38  ? 92   LEU B CA  1 
ATOM   4887 C C   . LEU B 1 92  ? 7.150   -10.346 -54.886 1.00 50.91  ? 92   LEU B C   1 
ATOM   4888 O O   . LEU B 1 92  ? 6.989   -11.272 -55.668 1.00 51.31  ? 92   LEU B O   1 
ATOM   4889 C CB  . LEU B 1 92  ? 7.373   -11.276 -52.633 1.00 51.22  ? 92   LEU B CB  1 
ATOM   4890 C CG  . LEU B 1 92  ? 7.026   -11.426 -51.167 1.00 50.94  ? 92   LEU B CG  1 
ATOM   4891 C CD1 . LEU B 1 92  ? 7.989   -12.403 -50.530 1.00 50.89  ? 92   LEU B CD1 1 
ATOM   4892 C CD2 . LEU B 1 92  ? 7.104   -10.084 -50.499 1.00 50.91  ? 92   LEU B CD2 1 
ATOM   4893 N N   . SER B 1 93  ? 7.898   -9.288  -55.166 1.00 50.19  ? 93   SER B N   1 
ATOM   4894 C CA  . SER B 1 93  ? 8.583   -9.166  -56.440 1.00 50.09  ? 93   SER B CA  1 
ATOM   4895 C C   . SER B 1 93  ? 9.557   -8.000  -56.410 1.00 50.04  ? 93   SER B C   1 
ATOM   4896 O O   . SER B 1 93  ? 9.215   -6.940  -55.914 1.00 50.45  ? 93   SER B O   1 
ATOM   4897 C CB  . SER B 1 93  ? 7.553   -8.970  -57.557 1.00 49.95  ? 93   SER B CB  1 
ATOM   4898 O OG  . SER B 1 93  ? 8.042   -8.134  -58.590 1.00 50.38  ? 93   SER B OG  1 
ATOM   4899 N N   . GLU B 1 94  ? 10.761  -8.181  -56.945 1.00 49.83  ? 94   GLU B N   1 
ATOM   4900 C CA  . GLU B 1 94  ? 11.716  -7.069  -57.045 1.00 49.89  ? 94   GLU B CA  1 
ATOM   4901 C C   . GLU B 1 94  ? 11.147  -5.928  -57.885 1.00 49.27  ? 94   GLU B C   1 
ATOM   4902 O O   . GLU B 1 94  ? 11.579  -4.772  -57.765 1.00 49.52  ? 94   GLU B O   1 
ATOM   4903 C CB  . GLU B 1 94  ? 13.061  -7.518  -57.628 1.00 49.78  ? 94   GLU B CB  1 
ATOM   4904 C CG  . GLU B 1 94  ? 13.972  -8.270  -56.678 1.00 50.13  ? 94   GLU B CG  1 
ATOM   4905 C CD  . GLU B 1 94  ? 15.401  -8.359  -57.207 1.00 51.48  ? 94   GLU B CD  1 
ATOM   4906 O OE1 . GLU B 1 94  ? 16.187  -7.404  -56.992 1.00 54.72  ? 94   GLU B OE1 1 
ATOM   4907 O OE2 . GLU B 1 94  ? 15.749  -9.379  -57.846 1.00 53.46  ? 94   GLU B OE2 1 
ATOM   4908 N N   . ASP B 1 95  ? 10.186  -6.250  -58.741 1.00 48.63  ? 95   ASP B N   1 
ATOM   4909 C CA  . ASP B 1 95  ? 9.479   -5.225  -59.478 1.00 48.51  ? 95   ASP B CA  1 
ATOM   4910 C C   . ASP B 1 95  ? 8.330   -4.700  -58.610 1.00 48.14  ? 95   ASP B C   1 
ATOM   4911 O O   . ASP B 1 95  ? 7.248   -5.294  -58.570 1.00 48.34  ? 95   ASP B O   1 
ATOM   4912 C CB  . ASP B 1 95  ? 8.969   -5.787  -60.800 1.00 48.61  ? 95   ASP B CB  1 
ATOM   4913 C CG  . ASP B 1 95  ? 8.146   -4.783  -61.584 1.00 49.67  ? 95   ASP B CG  1 
ATOM   4914 O OD1 . ASP B 1 95  ? 7.976   -3.628  -61.105 1.00 50.19  ? 95   ASP B OD1 1 
ATOM   4915 O OD2 . ASP B 1 95  ? 7.677   -5.158  -62.688 1.00 50.42  ? 95   ASP B OD2 1 
ATOM   4916 N N   . CYS B 1 96  ? 8.572   -3.582  -57.923 1.00 47.58  ? 96   CYS B N   1 
ATOM   4917 C CA  . CYS B 1 96  ? 7.663   -3.097  -56.869 1.00 46.96  ? 96   CYS B CA  1 
ATOM   4918 C C   . CYS B 1 96  ? 7.526   -1.572  -56.771 1.00 46.04  ? 96   CYS B C   1 
ATOM   4919 O O   . CYS B 1 96  ? 6.748   -1.064  -55.972 1.00 46.00  ? 96   CYS B O   1 
ATOM   4920 C CB  . CYS B 1 96  ? 8.072   -3.665  -55.499 1.00 46.99  ? 96   CYS B CB  1 
ATOM   4921 S SG  . CYS B 1 96  ? 9.727   -3.188  -54.951 1.00 48.74  ? 96   CYS B SG  1 
ATOM   4922 N N   . LEU B 1 97  ? 8.261   -0.835  -57.584 1.00 45.07  ? 97   LEU B N   1 
ATOM   4923 C CA  . LEU B 1 97  ? 8.266   0.609   -57.417 1.00 44.06  ? 97   LEU B CA  1 
ATOM   4924 C C   . LEU B 1 97  ? 6.981   1.252   -57.949 1.00 43.62  ? 97   LEU B C   1 
ATOM   4925 O O   . LEU B 1 97  ? 6.938   1.843   -59.035 1.00 43.42  ? 97   LEU B O   1 
ATOM   4926 C CB  . LEU B 1 97  ? 9.561   1.236   -57.966 1.00 43.70  ? 97   LEU B CB  1 
ATOM   4927 C CG  . LEU B 1 97  ? 10.829  0.667   -57.315 1.00 42.51  ? 97   LEU B CG  1 
ATOM   4928 C CD1 . LEU B 1 97  ? 12.063  1.382   -57.812 1.00 42.44  ? 97   LEU B CD1 1 
ATOM   4929 C CD2 . LEU B 1 97  ? 10.778  0.706   -55.800 1.00 41.52  ? 97   LEU B CD2 1 
ATOM   4930 N N   . TYR B 1 98  ? 5.936   1.126   -57.141 1.00 43.40  ? 98   TYR B N   1 
ATOM   4931 C CA  . TYR B 1 98  ? 4.617   1.645   -57.462 1.00 43.27  ? 98   TYR B CA  1 
ATOM   4932 C C   . TYR B 1 98  ? 4.070   2.447   -56.308 1.00 42.83  ? 98   TYR B C   1 
ATOM   4933 O O   . TYR B 1 98  ? 4.310   2.115   -55.148 1.00 42.98  ? 98   TYR B O   1 
ATOM   4934 C CB  . TYR B 1 98  ? 3.671   0.494   -57.786 1.00 43.69  ? 98   TYR B CB  1 
ATOM   4935 C CG  . TYR B 1 98  ? 4.136   -0.316  -58.975 1.00 45.01  ? 98   TYR B CG  1 
ATOM   4936 C CD1 . TYR B 1 98  ? 3.894   0.125   -60.286 1.00 45.41  ? 98   TYR B CD1 1 
ATOM   4937 C CD2 . TYR B 1 98  ? 4.849   -1.507  -58.799 1.00 45.18  ? 98   TYR B CD2 1 
ATOM   4938 C CE1 . TYR B 1 98  ? 4.339   -0.609  -61.380 1.00 44.87  ? 98   TYR B CE1 1 
ATOM   4939 C CE2 . TYR B 1 98  ? 5.289   -2.249  -59.894 1.00 44.66  ? 98   TYR B CE2 1 
ATOM   4940 C CZ  . TYR B 1 98  ? 5.031   -1.790  -61.171 1.00 44.65  ? 98   TYR B CZ  1 
ATOM   4941 O OH  . TYR B 1 98  ? 5.465   -2.510  -62.247 1.00 45.75  ? 98   TYR B OH  1 
ATOM   4942 N N   . LEU B 1 99  ? 3.335   3.504   -56.633 1.00 42.36  ? 99   LEU B N   1 
ATOM   4943 C CA  . LEU B 1 99  ? 2.653   4.313   -55.625 1.00 42.18  ? 99   LEU B CA  1 
ATOM   4944 C C   . LEU B 1 99  ? 1.129   4.335   -55.815 1.00 42.38  ? 99   LEU B C   1 
ATOM   4945 O O   . LEU B 1 99  ? 0.619   3.919   -56.844 1.00 42.55  ? 99   LEU B O   1 
ATOM   4946 C CB  . LEU B 1 99  ? 3.225   5.736   -55.607 1.00 41.79  ? 99   LEU B CB  1 
ATOM   4947 C CG  . LEU B 1 99  ? 3.198   6.532   -56.906 1.00 40.30  ? 99   LEU B CG  1 
ATOM   4948 C CD1 . LEU B 1 99  ? 1.826   7.102   -57.112 1.00 40.50  ? 99   LEU B CD1 1 
ATOM   4949 C CD2 . LEU B 1 99  ? 4.200   7.638   -56.849 1.00 38.75  ? 99   LEU B CD2 1 
ATOM   4950 N N   . ASN B 1 100 ? 0.416   4.828   -54.813 1.00 42.82  ? 100  ASN B N   1 
ATOM   4951 C CA  . ASN B 1 100 ? -1.037  4.938   -54.854 1.00 43.21  ? 100  ASN B CA  1 
ATOM   4952 C C   . ASN B 1 100 ? -1.503  6.309   -54.401 1.00 43.82  ? 100  ASN B C   1 
ATOM   4953 O O   . ASN B 1 100 ? -0.944  6.895   -53.477 1.00 43.79  ? 100  ASN B O   1 
ATOM   4954 C CB  . ASN B 1 100 ? -1.653  3.901   -53.943 1.00 42.94  ? 100  ASN B CB  1 
ATOM   4955 C CG  . ASN B 1 100 ? -0.765  2.730   -53.759 1.00 42.77  ? 100  ASN B CG  1 
ATOM   4956 O OD1 . ASN B 1 100 ? -0.495  2.004   -54.709 1.00 44.98  ? 100  ASN B OD1 1 
ATOM   4957 N ND2 . ASN B 1 100 ? -0.252  2.556   -52.553 1.00 41.78  ? 100  ASN B ND2 1 
ATOM   4958 N N   . VAL B 1 101 ? -2.545  6.799   -55.059 1.00 44.72  ? 101  VAL B N   1 
ATOM   4959 C CA  . VAL B 1 101 ? -3.169  8.070   -54.738 1.00 45.35  ? 101  VAL B CA  1 
ATOM   4960 C C   . VAL B 1 101 ? -4.644  7.816   -54.438 1.00 46.38  ? 101  VAL B C   1 
ATOM   4961 O O   . VAL B 1 101 ? -5.353  7.240   -55.265 1.00 46.21  ? 101  VAL B O   1 
ATOM   4962 C CB  . VAL B 1 101 ? -3.069  9.033   -55.924 1.00 44.72  ? 101  VAL B CB  1 
ATOM   4963 C CG1 . VAL B 1 101 ? -3.519  10.399  -55.524 1.00 45.51  ? 101  VAL B CG1 1 
ATOM   4964 C CG2 . VAL B 1 101 ? -1.663  9.101   -56.443 1.00 44.75  ? 101  VAL B CG2 1 
ATOM   4965 N N   . TRP B 1 102 ? -5.090  8.207   -53.245 1.00 47.93  ? 102  TRP B N   1 
ATOM   4966 C CA  . TRP B 1 102 ? -6.527  8.314   -52.938 1.00 49.60  ? 102  TRP B CA  1 
ATOM   4967 C C   . TRP B 1 102 ? -6.924  9.788   -52.993 1.00 50.97  ? 102  TRP B C   1 
ATOM   4968 O O   . TRP B 1 102 ? -6.192  10.643  -52.492 1.00 51.07  ? 102  TRP B O   1 
ATOM   4969 C CB  . TRP B 1 102 ? -6.855  7.780   -51.539 1.00 49.10  ? 102  TRP B CB  1 
ATOM   4970 C CG  . TRP B 1 102 ? -6.798  6.282   -51.352 1.00 48.84  ? 102  TRP B CG  1 
ATOM   4971 C CD1 . TRP B 1 102 ? -7.844  5.404   -51.417 1.00 48.51  ? 102  TRP B CD1 1 
ATOM   4972 C CD2 . TRP B 1 102 ? -5.646  5.502   -51.006 1.00 48.65  ? 102  TRP B CD2 1 
ATOM   4973 N NE1 . TRP B 1 102 ? -7.412  4.121   -51.154 1.00 48.29  ? 102  TRP B NE1 1 
ATOM   4974 C CE2 . TRP B 1 102 ? -6.066  4.155   -50.901 1.00 48.52  ? 102  TRP B CE2 1 
ATOM   4975 C CE3 . TRP B 1 102 ? -4.298  5.808   -50.778 1.00 48.16  ? 102  TRP B CE3 1 
ATOM   4976 C CZ2 . TRP B 1 102 ? -5.184  3.120   -50.590 1.00 48.60  ? 102  TRP B CZ2 1 
ATOM   4977 C CZ3 . TRP B 1 102 ? -3.425  4.777   -50.467 1.00 48.19  ? 102  TRP B CZ3 1 
ATOM   4978 C CH2 . TRP B 1 102 ? -3.870  3.451   -50.376 1.00 48.30  ? 102  TRP B CH2 1 
ATOM   4979 N N   . THR B 1 103 ? -8.064  10.094  -53.607 1.00 52.92  ? 103  THR B N   1 
ATOM   4980 C CA  . THR B 1 103 ? -8.634  11.448  -53.529 1.00 55.03  ? 103  THR B CA  1 
ATOM   4981 C C   . THR B 1 103 ? -10.139 11.377  -53.365 1.00 56.73  ? 103  THR B C   1 
ATOM   4982 O O   . THR B 1 103 ? -10.747 10.396  -53.774 1.00 56.94  ? 103  THR B O   1 
ATOM   4983 C CB  . THR B 1 103 ? -8.346  12.300  -54.766 1.00 54.73  ? 103  THR B CB  1 
ATOM   4984 O OG1 . THR B 1 103 ? -9.094  11.794  -55.873 1.00 55.36  ? 103  THR B OG1 1 
ATOM   4985 C CG2 . THR B 1 103 ? -6.882  12.292  -55.105 1.00 55.19  ? 103  THR B CG2 1 
ATOM   4986 N N   . PRO B 1 104 ? -10.743 12.401  -52.738 1.00 58.87  ? 104  PRO B N   1 
ATOM   4987 C CA  . PRO B 1 104 ? -12.201 12.557  -52.701 1.00 60.63  ? 104  PRO B CA  1 
ATOM   4988 C C   . PRO B 1 104 ? -12.915 12.514  -54.073 1.00 62.42  ? 104  PRO B C   1 
ATOM   4989 O O   . PRO B 1 104 ? -12.377 12.979  -55.088 1.00 62.40  ? 104  PRO B O   1 
ATOM   4990 C CB  . PRO B 1 104 ? -12.393 13.926  -52.034 1.00 60.65  ? 104  PRO B CB  1 
ATOM   4991 C CG  . PRO B 1 104 ? -11.030 14.573  -52.027 1.00 59.89  ? 104  PRO B CG  1 
ATOM   4992 C CD  . PRO B 1 104 ? -10.076 13.452  -51.951 1.00 59.19  ? 104  PRO B CD  1 
ATOM   4993 N N   . TYR B 1 105 ? -14.125 11.949  -54.061 1.00 64.39  ? 105  TYR B N   1 
ATOM   4994 C CA  . TYR B 1 105 ? -14.956 11.749  -55.244 1.00 66.08  ? 105  TYR B CA  1 
ATOM   4995 C C   . TYR B 1 105 ? -16.289 12.481  -55.072 1.00 66.90  ? 105  TYR B C   1 
ATOM   4996 O O   . TYR B 1 105 ? -17.072 12.141  -54.171 1.00 67.09  ? 105  TYR B O   1 
ATOM   4997 C CB  . TYR B 1 105 ? -15.218 10.257  -55.403 1.00 66.69  ? 105  TYR B CB  1 
ATOM   4998 C CG  . TYR B 1 105 ? -15.999 9.870   -56.630 1.00 68.00  ? 105  TYR B CG  1 
ATOM   4999 C CD1 . TYR B 1 105 ? -15.363 9.285   -57.727 1.00 69.43  ? 105  TYR B CD1 1 
ATOM   5000 C CD2 . TYR B 1 105 ? -17.372 10.070  -56.698 1.00 68.68  ? 105  TYR B CD2 1 
ATOM   5001 C CE1 . TYR B 1 105 ? -16.077 8.922   -58.864 1.00 69.81  ? 105  TYR B CE1 1 
ATOM   5002 C CE2 . TYR B 1 105 ? -18.094 9.711   -57.828 1.00 69.35  ? 105  TYR B CE2 1 
ATOM   5003 C CZ  . TYR B 1 105 ? -17.445 9.138   -58.902 1.00 69.17  ? 105  TYR B CZ  1 
ATOM   5004 O OH  . TYR B 1 105 ? -18.166 8.781   -60.013 1.00 69.14  ? 105  TYR B OH  1 
ATOM   5005 N N   . PRO B 1 106 ? -16.571 13.480  -55.933 1.00 67.61  ? 106  PRO B N   1 
ATOM   5006 C CA  . PRO B 1 106 ? -15.808 13.951  -57.094 1.00 68.12  ? 106  PRO B CA  1 
ATOM   5007 C C   . PRO B 1 106 ? -14.478 14.585  -56.704 1.00 68.50  ? 106  PRO B C   1 
ATOM   5008 O O   . PRO B 1 106 ? -14.340 15.106  -55.592 1.00 68.43  ? 106  PRO B O   1 
ATOM   5009 C CB  . PRO B 1 106 ? -16.730 15.015  -57.709 1.00 68.10  ? 106  PRO B CB  1 
ATOM   5010 C CG  . PRO B 1 106 ? -17.527 15.525  -56.554 1.00 68.17  ? 106  PRO B CG  1 
ATOM   5011 C CD  . PRO B 1 106 ? -17.794 14.283  -55.733 1.00 67.88  ? 106  PRO B CD  1 
ATOM   5012 N N   . ARG B 1 107 ? -13.514 14.550  -57.622 1.00 69.01  ? 107  ARG B N   1 
ATOM   5013 C CA  . ARG B 1 107 ? -12.149 14.969  -57.298 1.00 69.41  ? 107  ARG B CA  1 
ATOM   5014 C C   . ARG B 1 107 ? -11.988 16.485  -57.150 1.00 69.00  ? 107  ARG B C   1 
ATOM   5015 O O   . ARG B 1 107 ? -12.411 17.234  -58.017 1.00 69.03  ? 107  ARG B O   1 
ATOM   5016 C CB  . ARG B 1 107 ? -11.114 14.329  -58.242 1.00 69.82  ? 107  ARG B CB  1 
ATOM   5017 C CG  . ARG B 1 107 ? -10.801 15.042  -59.562 1.00 70.69  ? 107  ARG B CG  1 
ATOM   5018 C CD  . ARG B 1 107 ? -9.904  14.102  -60.347 1.00 72.22  ? 107  ARG B CD  1 
ATOM   5019 N NE  . ARG B 1 107 ? -9.432  14.649  -61.608 1.00 73.26  ? 107  ARG B NE  1 
ATOM   5020 C CZ  . ARG B 1 107 ? -9.282  13.924  -62.717 1.00 74.21  ? 107  ARG B CZ  1 
ATOM   5021 N NH1 . ARG B 1 107 ? -9.595  12.632  -62.711 1.00 74.14  ? 107  ARG B NH1 1 
ATOM   5022 N NH2 . ARG B 1 107 ? -8.835  14.487  -63.839 1.00 74.22  ? 107  ARG B NH2 1 
ATOM   5023 N N   . PRO B 1 108 ? -11.368 16.917  -56.034 1.00 68.71  ? 108  PRO B N   1 
ATOM   5024 C CA  . PRO B 1 108 ? -11.233 18.262  -55.482 1.00 68.20  ? 108  PRO B CA  1 
ATOM   5025 C C   . PRO B 1 108 ? -11.347 19.392  -56.486 1.00 67.72  ? 108  PRO B C   1 
ATOM   5026 O O   . PRO B 1 108 ? -10.624 19.409  -57.486 1.00 67.45  ? 108  PRO B O   1 
ATOM   5027 C CB  . PRO B 1 108 ? -9.815  18.246  -54.899 1.00 68.15  ? 108  PRO B CB  1 
ATOM   5028 C CG  . PRO B 1 108 ? -9.448  16.754  -54.755 1.00 68.76  ? 108  PRO B CG  1 
ATOM   5029 C CD  . PRO B 1 108 ? -10.642 15.957  -55.186 1.00 68.82  ? 108  PRO B CD  1 
ATOM   5030 N N   . ALA B 1 109 ? -12.240 20.336  -56.184 1.00 67.30  ? 109  ALA B N   1 
ATOM   5031 C CA  . ALA B 1 109 ? -12.471 21.532  -57.014 1.00 66.63  ? 109  ALA B CA  1 
ATOM   5032 C C   . ALA B 1 109 ? -11.261 22.494  -57.053 1.00 65.90  ? 109  ALA B C   1 
ATOM   5033 O O   . ALA B 1 109 ? -10.925 23.052  -58.103 1.00 65.90  ? 109  ALA B O   1 
ATOM   5034 C CB  . ALA B 1 109 ? -13.734 22.266  -56.540 1.00 66.82  ? 109  ALA B CB  1 
ATOM   5035 N N   . SER B 1 110 ? -10.628 22.694  -55.901 1.00 64.55  ? 110  SER B N   1 
ATOM   5036 C CA  . SER B 1 110 ? -9.397  23.468  -55.823 1.00 63.21  ? 110  SER B CA  1 
ATOM   5037 C C   . SER B 1 110 ? -8.296  22.621  -55.157 1.00 62.02  ? 110  SER B C   1 
ATOM   5038 O O   . SER B 1 110 ? -8.604  21.605  -54.516 1.00 62.02  ? 110  SER B O   1 
ATOM   5039 C CB  . SER B 1 110 ? -9.637  24.791  -55.089 1.00 63.16  ? 110  SER B CB  1 
ATOM   5040 O OG  . SER B 1 110 ? -10.452 24.580  -53.955 1.00 63.05  ? 110  SER B OG  1 
ATOM   5041 N N   . PRO B 1 111 ? -7.013  23.022  -55.330 1.00 60.60  ? 111  PRO B N   1 
ATOM   5042 C CA  . PRO B 1 111 ? -5.847  22.258  -54.851 1.00 59.16  ? 111  PRO B CA  1 
ATOM   5043 C C   . PRO B 1 111 ? -5.900  21.853  -53.376 1.00 57.58  ? 111  PRO B C   1 
ATOM   5044 O O   . PRO B 1 111 ? -5.948  22.710  -52.505 1.00 57.81  ? 111  PRO B O   1 
ATOM   5045 C CB  . PRO B 1 111 ? -4.680  23.220  -55.099 1.00 59.30  ? 111  PRO B CB  1 
ATOM   5046 C CG  . PRO B 1 111 ? -5.123  24.056  -56.258 1.00 59.82  ? 111  PRO B CG  1 
ATOM   5047 C CD  . PRO B 1 111 ? -6.599  24.253  -56.042 1.00 60.50  ? 111  PRO B CD  1 
ATOM   5048 N N   . THR B 1 112 ? -5.880  20.550  -53.119 1.00 55.58  ? 112  THR B N   1 
ATOM   5049 C CA  . THR B 1 112 ? -5.911  20.002  -51.768 1.00 53.87  ? 112  THR B CA  1 
ATOM   5050 C C   . THR B 1 112 ? -4.512  19.702  -51.251 1.00 52.20  ? 112  THR B C   1 
ATOM   5051 O O   . THR B 1 112 ? -3.693  19.154  -51.979 1.00 52.46  ? 112  THR B O   1 
ATOM   5052 C CB  . THR B 1 112 ? -6.670  18.683  -51.764 1.00 54.05  ? 112  THR B CB  1 
ATOM   5053 O OG1 . THR B 1 112 ? -7.930  18.876  -52.404 1.00 55.33  ? 112  THR B OG1 1 
ATOM   5054 C CG2 . THR B 1 112 ? -6.892  18.180  -50.345 1.00 54.28  ? 112  THR B CG2 1 
ATOM   5055 N N   . PRO B 1 113 ? -4.218  20.071  -49.998 1.00 50.46  ? 113  PRO B N   1 
ATOM   5056 C CA  . PRO B 1 113 ? -3.011  19.559  -49.368 1.00 49.05  ? 113  PRO B CA  1 
ATOM   5057 C C   . PRO B 1 113 ? -2.876  18.050  -49.519 1.00 47.46  ? 113  PRO B C   1 
ATOM   5058 O O   . PRO B 1 113 ? -3.863  17.322  -49.409 1.00 47.23  ? 113  PRO B O   1 
ATOM   5059 C CB  . PRO B 1 113 ? -3.196  19.930  -47.891 1.00 49.34  ? 113  PRO B CB  1 
ATOM   5060 C CG  . PRO B 1 113 ? -4.564  20.529  -47.782 1.00 49.74  ? 113  PRO B CG  1 
ATOM   5061 C CD  . PRO B 1 113 ? -4.913  21.026  -49.125 1.00 50.51  ? 113  PRO B CD  1 
ATOM   5062 N N   . VAL B 1 114 ? -1.651  17.608  -49.782 1.00 45.55  ? 114  VAL B N   1 
ATOM   5063 C CA  . VAL B 1 114 ? -1.346  16.215  -50.013 1.00 43.48  ? 114  VAL B CA  1 
ATOM   5064 C C   . VAL B 1 114 ? -0.617  15.657  -48.817 1.00 43.01  ? 114  VAL B C   1 
ATOM   5065 O O   . VAL B 1 114 ? 0.288   16.281  -48.278 1.00 43.30  ? 114  VAL B O   1 
ATOM   5066 C CB  . VAL B 1 114 ? -0.418  16.043  -51.200 1.00 43.14  ? 114  VAL B CB  1 
ATOM   5067 C CG1 . VAL B 1 114 ? -0.338  14.590  -51.569 1.00 43.41  ? 114  VAL B CG1 1 
ATOM   5068 C CG2 . VAL B 1 114 ? -0.883  16.853  -52.373 1.00 41.98  ? 114  VAL B CG2 1 
ATOM   5069 N N   . LEU B 1 115 ? -1.005  14.469  -48.395 1.00 42.35  ? 115  LEU B N   1 
ATOM   5070 C CA  . LEU B 1 115 ? -0.226  13.742  -47.407 1.00 41.65  ? 115  LEU B CA  1 
ATOM   5071 C C   . LEU B 1 115 ? 0.498   12.576  -48.103 1.00 41.50  ? 115  LEU B C   1 
ATOM   5072 O O   . LEU B 1 115 ? -0.109  11.837  -48.891 1.00 41.89  ? 115  LEU B O   1 
ATOM   5073 C CB  . LEU B 1 115 ? -1.136  13.231  -46.294 1.00 41.36  ? 115  LEU B CB  1 
ATOM   5074 C CG  . LEU B 1 115 ? -1.558  14.190  -45.183 1.00 40.13  ? 115  LEU B CG  1 
ATOM   5075 C CD1 . LEU B 1 115 ? -2.797  14.934  -45.580 1.00 40.22  ? 115  LEU B CD1 1 
ATOM   5076 C CD2 . LEU B 1 115 ? -1.818  13.417  -43.916 1.00 37.93  ? 115  LEU B CD2 1 
ATOM   5077 N N   . ILE B 1 116 ? 1.792   12.415  -47.848 1.00 40.44  ? 116  ILE B N   1 
ATOM   5078 C CA  . ILE B 1 116 ? 2.480   11.269  -48.416 1.00 39.58  ? 116  ILE B CA  1 
ATOM   5079 C C   . ILE B 1 116 ? 2.915   10.334  -47.308 1.00 39.22  ? 116  ILE B C   1 
ATOM   5080 O O   . ILE B 1 116 ? 3.690   10.720  -46.442 1.00 39.83  ? 116  ILE B O   1 
ATOM   5081 C CB  . ILE B 1 116 ? 3.681   11.667  -49.265 1.00 39.59  ? 116  ILE B CB  1 
ATOM   5082 C CG1 . ILE B 1 116 ? 3.324   12.830  -50.195 1.00 39.11  ? 116  ILE B CG1 1 
ATOM   5083 C CG2 . ILE B 1 116 ? 4.171   10.453  -50.066 1.00 39.70  ? 116  ILE B CG2 1 
ATOM   5084 C CD1 . ILE B 1 116 ? 4.472   13.297  -51.078 1.00 36.96  ? 116  ILE B CD1 1 
ATOM   5085 N N   . TRP B 1 117 ? 2.399   9.112   -47.321 1.00 38.39  ? 117  TRP B N   1 
ATOM   5086 C CA  . TRP B 1 117 ? 2.714   8.139   -46.283 1.00 37.91  ? 117  TRP B CA  1 
ATOM   5087 C C   . TRP B 1 117 ? 3.958   7.342   -46.650 1.00 38.24  ? 117  TRP B C   1 
ATOM   5088 O O   . TRP B 1 117 ? 4.210   7.081   -47.835 1.00 38.40  ? 117  TRP B O   1 
ATOM   5089 C CB  . TRP B 1 117 ? 1.524   7.202   -46.042 1.00 37.19  ? 117  TRP B CB  1 
ATOM   5090 C CG  . TRP B 1 117 ? 1.812   6.052   -45.108 1.00 36.28  ? 117  TRP B CG  1 
ATOM   5091 C CD1 . TRP B 1 117 ? 2.025   4.743   -45.454 1.00 35.35  ? 117  TRP B CD1 1 
ATOM   5092 C CD2 . TRP B 1 117 ? 1.931   6.113   -43.683 1.00 35.20  ? 117  TRP B CD2 1 
ATOM   5093 N NE1 . TRP B 1 117 ? 2.250   3.981   -44.326 1.00 34.36  ? 117  TRP B NE1 1 
ATOM   5094 C CE2 . TRP B 1 117 ? 2.201   4.792   -43.226 1.00 34.44  ? 117  TRP B CE2 1 
ATOM   5095 C CE3 . TRP B 1 117 ? 1.823   7.150   -42.743 1.00 34.28  ? 117  TRP B CE3 1 
ATOM   5096 C CZ2 . TRP B 1 117 ? 2.371   4.480   -41.866 1.00 34.93  ? 117  TRP B CZ2 1 
ATOM   5097 C CZ3 . TRP B 1 117 ? 1.992   6.845   -41.387 1.00 35.66  ? 117  TRP B CZ3 1 
ATOM   5098 C CH2 . TRP B 1 117 ? 2.271   5.513   -40.961 1.00 35.57  ? 117  TRP B CH2 1 
ATOM   5099 N N   . ILE B 1 118 ? 4.729   6.967   -45.629 1.00 38.27  ? 118  ILE B N   1 
ATOM   5100 C CA  . ILE B 1 118 ? 5.910   6.124   -45.790 1.00 38.57  ? 118  ILE B CA  1 
ATOM   5101 C C   . ILE B 1 118 ? 5.854   5.031   -44.733 1.00 39.43  ? 118  ILE B C   1 
ATOM   5102 O O   . ILE B 1 118 ? 5.959   5.323   -43.548 1.00 39.91  ? 118  ILE B O   1 
ATOM   5103 C CB  . ILE B 1 118 ? 7.235   6.932   -45.642 1.00 38.16  ? 118  ILE B CB  1 
ATOM   5104 C CG1 . ILE B 1 118 ? 7.402   7.914   -46.791 1.00 36.86  ? 118  ILE B CG1 1 
ATOM   5105 C CG2 . ILE B 1 118 ? 8.431   6.011   -45.623 1.00 37.78  ? 118  ILE B CG2 1 
ATOM   5106 C CD1 . ILE B 1 118 ? 8.398   8.980   -46.519 1.00 35.49  ? 118  ILE B CD1 1 
ATOM   5107 N N   . TYR B 1 119 ? 5.691   3.776   -45.148 1.00 40.43  ? 119  TYR B N   1 
ATOM   5108 C CA  . TYR B 1 119 ? 5.529   2.683   -44.185 1.00 41.20  ? 119  TYR B CA  1 
ATOM   5109 C C   . TYR B 1 119 ? 6.783   2.403   -43.394 1.00 41.99  ? 119  TYR B C   1 
ATOM   5110 O O   . TYR B 1 119 ? 7.892   2.660   -43.867 1.00 42.42  ? 119  TYR B O   1 
ATOM   5111 C CB  . TYR B 1 119 ? 5.058   1.392   -44.855 1.00 41.03  ? 119  TYR B CB  1 
ATOM   5112 C CG  . TYR B 1 119 ? 5.895   0.903   -46.023 1.00 41.34  ? 119  TYR B CG  1 
ATOM   5113 C CD1 . TYR B 1 119 ? 7.102   0.220   -45.820 1.00 40.56  ? 119  TYR B CD1 1 
ATOM   5114 C CD2 . TYR B 1 119 ? 5.450   1.083   -47.340 1.00 41.16  ? 119  TYR B CD2 1 
ATOM   5115 C CE1 . TYR B 1 119 ? 7.855   -0.254  -46.904 1.00 40.27  ? 119  TYR B CE1 1 
ATOM   5116 C CE2 . TYR B 1 119 ? 6.196   0.619   -48.429 1.00 40.82  ? 119  TYR B CE2 1 
ATOM   5117 C CZ  . TYR B 1 119 ? 7.393   -0.047  -48.206 1.00 40.64  ? 119  TYR B CZ  1 
ATOM   5118 O OH  . TYR B 1 119 ? 8.122   -0.482  -49.287 1.00 40.91  ? 119  TYR B OH  1 
ATOM   5119 N N   . GLY B 1 120 ? 6.589   1.886   -42.182 1.00 42.80  ? 120  GLY B N   1 
ATOM   5120 C CA  . GLY B 1 120 ? 7.682   1.332   -41.370 1.00 43.73  ? 120  GLY B CA  1 
ATOM   5121 C C   . GLY B 1 120 ? 8.031   -0.106  -41.732 1.00 44.12  ? 120  GLY B C   1 
ATOM   5122 O O   . GLY B 1 120 ? 7.793   -0.537  -42.852 1.00 44.77  ? 120  GLY B O   1 
ATOM   5123 N N   . GLY B 1 121 ? 8.579   -0.855  -40.783 1.00 44.30  ? 121  GLY B N   1 
ATOM   5124 C CA  . GLY B 1 121 ? 9.138   -2.173  -41.080 1.00 44.78  ? 121  GLY B CA  1 
ATOM   5125 C C   . GLY B 1 121 ? 10.654  -2.286  -40.923 1.00 45.29  ? 121  GLY B C   1 
ATOM   5126 O O   . GLY B 1 121 ? 11.276  -3.193  -41.474 1.00 45.60  ? 121  GLY B O   1 
ATOM   5127 N N   . GLY B 1 122 ? 11.254  -1.368  -40.169 1.00 45.45  ? 122  GLY B N   1 
ATOM   5128 C CA  . GLY B 1 122 ? 12.683  -1.413  -39.876 1.00 45.50  ? 122  GLY B CA  1 
ATOM   5129 C C   . GLY B 1 122 ? 13.623  -1.497  -41.068 1.00 45.51  ? 122  GLY B C   1 
ATOM   5130 O O   . GLY B 1 122 ? 14.766  -1.960  -40.935 1.00 45.79  ? 122  GLY B O   1 
ATOM   5131 N N   . PHE B 1 123 ? 13.152  -1.049  -42.230 1.00 45.21  ? 123  PHE B N   1 
ATOM   5132 C CA  . PHE B 1 123 ? 13.953  -1.089  -43.448 1.00 45.07  ? 123  PHE B CA  1 
ATOM   5133 C C   . PHE B 1 123 ? 14.213  -2.513  -43.941 1.00 45.04  ? 123  PHE B C   1 
ATOM   5134 O O   . PHE B 1 123 ? 15.106  -2.716  -44.769 1.00 45.30  ? 123  PHE B O   1 
ATOM   5135 C CB  . PHE B 1 123 ? 15.293  -0.357  -43.264 1.00 44.75  ? 123  PHE B CB  1 
ATOM   5136 C CG  . PHE B 1 123 ? 15.154  1.118   -43.026 1.00 44.84  ? 123  PHE B CG  1 
ATOM   5137 C CD1 . PHE B 1 123 ? 14.770  1.976   -44.063 1.00 44.26  ? 123  PHE B CD1 1 
ATOM   5138 C CD2 . PHE B 1 123 ? 15.410  1.657   -41.769 1.00 44.48  ? 123  PHE B CD2 1 
ATOM   5139 C CE1 . PHE B 1 123 ? 14.632  3.352   -43.849 1.00 43.53  ? 123  PHE B CE1 1 
ATOM   5140 C CE2 . PHE B 1 123 ? 15.280  3.030   -41.542 1.00 43.95  ? 123  PHE B CE2 1 
ATOM   5141 C CZ  . PHE B 1 123 ? 14.890  3.878   -42.584 1.00 43.97  ? 123  PHE B CZ  1 
ATOM   5142 N N   . TYR B 1 124 ? 13.441  -3.486  -43.441 1.00 44.58  ? 124  TYR B N   1 
ATOM   5143 C CA  . TYR B 1 124 ? 13.497  -4.861  -43.954 1.00 44.26  ? 124  TYR B CA  1 
ATOM   5144 C C   . TYR B 1 124 ? 12.133  -5.444  -44.378 1.00 43.88  ? 124  TYR B C   1 
ATOM   5145 O O   . TYR B 1 124 ? 12.068  -6.547  -44.931 1.00 44.35  ? 124  TYR B O   1 
ATOM   5146 C CB  . TYR B 1 124 ? 14.187  -5.789  -42.951 1.00 44.50  ? 124  TYR B CB  1 
ATOM   5147 C CG  . TYR B 1 124 ? 13.400  -6.008  -41.688 1.00 45.07  ? 124  TYR B CG  1 
ATOM   5148 C CD1 . TYR B 1 124 ? 12.353  -6.931  -41.652 1.00 45.77  ? 124  TYR B CD1 1 
ATOM   5149 C CD2 . TYR B 1 124 ? 13.695  -5.292  -40.524 1.00 45.67  ? 124  TYR B CD2 1 
ATOM   5150 C CE1 . TYR B 1 124 ? 11.608  -7.139  -40.486 1.00 46.79  ? 124  TYR B CE1 1 
ATOM   5151 C CE2 . TYR B 1 124 ? 12.959  -5.491  -39.343 1.00 46.14  ? 124  TYR B CE2 1 
ATOM   5152 C CZ  . TYR B 1 124 ? 11.917  -6.421  -39.335 1.00 46.45  ? 124  TYR B CZ  1 
ATOM   5153 O OH  . TYR B 1 124 ? 11.174  -6.634  -38.193 1.00 45.72  ? 124  TYR B OH  1 
ATOM   5154 N N   . SER B 1 125 ? 11.051  -4.719  -44.117 1.00 42.95  ? 125  SER B N   1 
ATOM   5155 C CA  . SER B 1 125 ? 9.713   -5.181  -44.460 1.00 42.01  ? 125  SER B CA  1 
ATOM   5156 C C   . SER B 1 125 ? 8.801   -4.011  -44.797 1.00 41.82  ? 125  SER B C   1 
ATOM   5157 O O   . SER B 1 125 ? 9.222   -2.861  -44.754 1.00 41.44  ? 125  SER B O   1 
ATOM   5158 C CB  . SER B 1 125 ? 9.117   -6.021  -43.323 1.00 41.93  ? 125  SER B CB  1 
ATOM   5159 O OG  . SER B 1 125 ? 9.124   -5.326  -42.085 1.00 41.27  ? 125  SER B OG  1 
ATOM   5160 N N   . GLY B 1 126 ? 7.557   -4.318  -45.163 1.00 41.96  ? 126  GLY B N   1 
ATOM   5161 C CA  . GLY B 1 126 ? 6.515   -3.306  -45.323 1.00 41.72  ? 126  GLY B CA  1 
ATOM   5162 C C   . GLY B 1 126 ? 6.025   -3.082  -46.736 1.00 41.57  ? 126  GLY B C   1 
ATOM   5163 O O   . GLY B 1 126 ? 6.738   -3.350  -47.709 1.00 41.71  ? 126  GLY B O   1 
ATOM   5164 N N   . ALA B 1 127 ? 4.810   -2.553  -46.839 1.00 41.47  ? 127  ALA B N   1 
ATOM   5165 C CA  . ALA B 1 127 ? 4.153   -2.315  -48.125 1.00 41.55  ? 127  ALA B CA  1 
ATOM   5166 C C   . ALA B 1 127 ? 3.186   -1.161  -47.990 1.00 41.21  ? 127  ALA B C   1 
ATOM   5167 O O   . ALA B 1 127 ? 2.630   -0.968  -46.925 1.00 41.37  ? 127  ALA B O   1 
ATOM   5168 C CB  . ALA B 1 127 ? 3.407   -3.557  -48.557 1.00 41.68  ? 127  ALA B CB  1 
ATOM   5169 N N   . ALA B 1 128 ? 2.978   -0.401  -49.055 1.00 41.07  ? 128  ALA B N   1 
ATOM   5170 C CA  . ALA B 1 128 ? 1.973   0.662   -49.035 1.00 41.68  ? 128  ALA B CA  1 
ATOM   5171 C C   . ALA B 1 128 ? 0.542   0.083   -49.029 1.00 42.22  ? 128  ALA B C   1 
ATOM   5172 O O   . ALA B 1 128 ? -0.434  0.794   -48.747 1.00 42.74  ? 128  ALA B O   1 
ATOM   5173 C CB  . ALA B 1 128 ? 2.162   1.615   -50.215 1.00 41.16  ? 128  ALA B CB  1 
ATOM   5174 N N   . SER B 1 129 ? 0.437   -1.213  -49.310 1.00 42.36  ? 129  SER B N   1 
ATOM   5175 C CA  . SER B 1 129 ? -0.823  -1.834  -49.662 1.00 42.58  ? 129  SER B CA  1 
ATOM   5176 C C   . SER B 1 129 ? -1.516  -2.465  -48.463 1.00 43.15  ? 129  SER B C   1 
ATOM   5177 O O   . SER B 1 129 ? -2.596  -3.038  -48.595 1.00 43.21  ? 129  SER B O   1 
ATOM   5178 C CB  . SER B 1 129 ? -0.596  -2.868  -50.778 1.00 42.61  ? 129  SER B CB  1 
ATOM   5179 O OG  . SER B 1 129 ? 0.310   -3.892  -50.395 1.00 41.93  ? 129  SER B OG  1 
ATOM   5180 N N   . LEU B 1 130 ? -0.898  -2.340  -47.294 1.00 43.75  ? 130  LEU B N   1 
ATOM   5181 C CA  . LEU B 1 130 ? -1.407  -2.946  -46.070 1.00 44.60  ? 130  LEU B CA  1 
ATOM   5182 C C   . LEU B 1 130 ? -2.725  -2.322  -45.660 1.00 45.28  ? 130  LEU B C   1 
ATOM   5183 O O   . LEU B 1 130 ? -3.017  -1.178  -46.034 1.00 45.56  ? 130  LEU B O   1 
ATOM   5184 C CB  . LEU B 1 130 ? -0.381  -2.799  -44.953 1.00 44.83  ? 130  LEU B CB  1 
ATOM   5185 C CG  . LEU B 1 130 ? 0.845   -3.710  -45.103 1.00 45.37  ? 130  LEU B CG  1 
ATOM   5186 C CD1 . LEU B 1 130 ? 1.917   -3.335  -44.091 1.00 45.02  ? 130  LEU B CD1 1 
ATOM   5187 C CD2 . LEU B 1 130 ? 0.431   -5.190  -44.946 1.00 46.48  ? 130  LEU B CD2 1 
ATOM   5188 N N   . ASP B 1 131 ? -3.528  -3.069  -44.901 1.00 45.81  ? 131  ASP B N   1 
ATOM   5189 C CA  . ASP B 1 131 ? -4.885  -2.616  -44.567 1.00 46.11  ? 131  ASP B CA  1 
ATOM   5190 C C   . ASP B 1 131 ? -4.882  -1.370  -43.706 1.00 45.69  ? 131  ASP B C   1 
ATOM   5191 O O   . ASP B 1 131 ? -5.734  -0.495  -43.868 1.00 45.81  ? 131  ASP B O   1 
ATOM   5192 C CB  . ASP B 1 131 ? -5.677  -3.721  -43.871 1.00 46.84  ? 131  ASP B CB  1 
ATOM   5193 C CG  . ASP B 1 131 ? -6.201  -4.765  -44.838 1.00 48.74  ? 131  ASP B CG  1 
ATOM   5194 O OD1 . ASP B 1 131 ? -6.142  -4.539  -46.074 1.00 51.83  ? 131  ASP B OD1 1 
ATOM   5195 O OD2 . ASP B 1 131 ? -6.674  -5.814  -44.357 1.00 49.44  ? 131  ASP B OD2 1 
ATOM   5196 N N   . VAL B 1 132 ? -3.907  -1.295  -42.805 1.00 45.21  ? 132  VAL B N   1 
ATOM   5197 C CA  . VAL B 1 132 ? -3.781  -0.176  -41.879 1.00 44.58  ? 132  VAL B CA  1 
ATOM   5198 C C   . VAL B 1 132 ? -3.282  1.109   -42.525 1.00 44.54  ? 132  VAL B C   1 
ATOM   5199 O O   . VAL B 1 132 ? -3.210  2.124   -41.849 1.00 44.84  ? 132  VAL B O   1 
ATOM   5200 C CB  . VAL B 1 132 ? -2.876  -0.512  -40.684 1.00 44.10  ? 132  VAL B CB  1 
ATOM   5201 C CG1 . VAL B 1 132 ? -3.576  -1.442  -39.766 1.00 44.19  ? 132  VAL B CG1 1 
ATOM   5202 C CG2 . VAL B 1 132 ? -1.578  -1.133  -41.145 1.00 44.28  ? 132  VAL B CG2 1 
ATOM   5203 N N   . TYR B 1 133 ? -2.921  1.084   -43.807 1.00 44.25  ? 133  TYR B N   1 
ATOM   5204 C CA  . TYR B 1 133 ? -2.538  2.331   -44.471 1.00 44.35  ? 133  TYR B CA  1 
ATOM   5205 C C   . TYR B 1 133 ? -3.545  2.702   -45.533 1.00 44.99  ? 133  TYR B C   1 
ATOM   5206 O O   . TYR B 1 133 ? -3.231  3.433   -46.474 1.00 45.13  ? 133  TYR B O   1 
ATOM   5207 C CB  . TYR B 1 133 ? -1.156  2.274   -45.117 1.00 43.69  ? 133  TYR B CB  1 
ATOM   5208 C CG  . TYR B 1 133 ? -0.067  1.590   -44.340 1.00 43.36  ? 133  TYR B CG  1 
ATOM   5209 C CD1 . TYR B 1 133 ? 0.104   1.793   -42.974 1.00 42.45  ? 133  TYR B CD1 1 
ATOM   5210 C CD2 . TYR B 1 133 ? 0.825   0.752   -44.993 1.00 43.03  ? 133  TYR B CD2 1 
ATOM   5211 C CE1 . TYR B 1 133 ? 1.122   1.146   -42.285 1.00 42.44  ? 133  TYR B CE1 1 
ATOM   5212 C CE2 . TYR B 1 133 ? 1.841   0.123   -44.318 1.00 42.56  ? 133  TYR B CE2 1 
ATOM   5213 C CZ  . TYR B 1 133 ? 1.990   0.318   -42.974 1.00 42.44  ? 133  TYR B CZ  1 
ATOM   5214 O OH  . TYR B 1 133 ? 3.018   -0.330  -42.345 1.00 42.43  ? 133  TYR B OH  1 
ATOM   5215 N N   . ASP B 1 134 ? -4.757  2.185   -45.388 1.00 45.73  ? 134  ASP B N   1 
ATOM   5216 C CA  . ASP B 1 134 ? -5.817  2.457   -46.339 1.00 46.13  ? 134  ASP B CA  1 
ATOM   5217 C C   . ASP B 1 134 ? -6.144  3.932   -46.321 1.00 45.97  ? 134  ASP B C   1 
ATOM   5218 O O   . ASP B 1 134 ? -6.518  4.480   -45.300 1.00 46.00  ? 134  ASP B O   1 
ATOM   5219 C CB  . ASP B 1 134 ? -7.040  1.646   -45.970 1.00 46.47  ? 134  ASP B CB  1 
ATOM   5220 C CG  . ASP B 1 134 ? -8.095  1.676   -47.029 1.00 48.37  ? 134  ASP B CG  1 
ATOM   5221 O OD1 . ASP B 1 134 ? -8.146  2.618   -47.865 1.00 50.01  ? 134  ASP B OD1 1 
ATOM   5222 O OD2 . ASP B 1 134 ? -8.902  0.733   -47.007 1.00 50.96  ? 134  ASP B OD2 1 
ATOM   5223 N N   . GLY B 1 135 ? -5.997  4.579   -47.462 1.00 46.37  ? 135  GLY B N   1 
ATOM   5224 C CA  . GLY B 1 135 ? -6.192  6.020   -47.537 1.00 47.03  ? 135  GLY B CA  1 
ATOM   5225 C C   . GLY B 1 135 ? -7.607  6.495   -47.798 1.00 47.31  ? 135  GLY B C   1 
ATOM   5226 O O   . GLY B 1 135 ? -7.829  7.686   -47.966 1.00 47.18  ? 135  GLY B O   1 
ATOM   5227 N N   . ARG B 1 136 ? -8.563  5.571   -47.814 1.00 47.94  ? 136  ARG B N   1 
ATOM   5228 C CA  . ARG B 1 136 ? -9.936  5.890   -48.215 1.00 48.73  ? 136  ARG B CA  1 
ATOM   5229 C C   . ARG B 1 136 ? -10.645 6.876   -47.247 1.00 48.43  ? 136  ARG B C   1 
ATOM   5230 O O   . ARG B 1 136 ? -11.228 7.870   -47.675 1.00 47.93  ? 136  ARG B O   1 
ATOM   5231 C CB  . ARG B 1 136 ? -10.734 4.589   -48.490 1.00 48.99  ? 136  ARG B CB  1 
ATOM   5232 C CG  . ARG B 1 136 ? -11.573 4.065   -47.358 1.00 51.08  ? 136  ARG B CG  1 
ATOM   5233 C CD  . ARG B 1 136 ? -11.437 2.569   -47.155 1.00 55.33  ? 136  ARG B CD  1 
ATOM   5234 N NE  . ARG B 1 136 ? -12.283 1.764   -48.033 1.00 58.41  ? 136  ARG B NE  1 
ATOM   5235 C CZ  . ARG B 1 136 ? -11.831 1.026   -49.047 1.00 60.25  ? 136  ARG B CZ  1 
ATOM   5236 N NH1 . ARG B 1 136 ? -10.524 0.992   -49.335 1.00 60.67  ? 136  ARG B NH1 1 
ATOM   5237 N NH2 . ARG B 1 136 ? -12.688 0.323   -49.783 1.00 60.13  ? 136  ARG B NH2 1 
ATOM   5238 N N   . PHE B 1 137 ? -10.539 6.615   -45.951 1.00 48.59  ? 137  PHE B N   1 
ATOM   5239 C CA  . PHE B 1 137 ? -11.166 7.445   -44.947 1.00 49.15  ? 137  PHE B CA  1 
ATOM   5240 C C   . PHE B 1 137 ? -10.583 8.841   -44.927 1.00 49.70  ? 137  PHE B C   1 
ATOM   5241 O O   . PHE B 1 137 ? -11.324 9.809   -45.047 1.00 49.98  ? 137  PHE B O   1 
ATOM   5242 C CB  . PHE B 1 137 ? -11.025 6.818   -43.573 1.00 49.24  ? 137  PHE B CB  1 
ATOM   5243 C CG  . PHE B 1 137 ? -11.235 5.348   -43.567 1.00 49.64  ? 137  PHE B CG  1 
ATOM   5244 C CD1 . PHE B 1 137 ? -12.522 4.817   -43.601 1.00 49.99  ? 137  PHE B CD1 1 
ATOM   5245 C CD2 . PHE B 1 137 ? -10.145 4.479   -43.540 1.00 49.65  ? 137  PHE B CD2 1 
ATOM   5246 C CE1 . PHE B 1 137 ? -12.718 3.432   -43.596 1.00 50.35  ? 137  PHE B CE1 1 
ATOM   5247 C CE2 . PHE B 1 137 ? -10.332 3.095   -43.539 1.00 49.57  ? 137  PHE B CE2 1 
ATOM   5248 C CZ  . PHE B 1 137 ? -11.617 2.570   -43.565 1.00 49.53  ? 137  PHE B CZ  1 
ATOM   5249 N N   . LEU B 1 138 ? -9.266  8.964   -44.782 1.00 50.38  ? 138  LEU B N   1 
ATOM   5250 C CA  . LEU B 1 138 ? -8.649  10.295  -44.810 1.00 51.02  ? 138  LEU B CA  1 
ATOM   5251 C C   . LEU B 1 138 ? -9.024  11.105  -46.056 1.00 51.66  ? 138  LEU B C   1 
ATOM   5252 O O   . LEU B 1 138 ? -9.093  12.334  -46.008 1.00 52.16  ? 138  LEU B O   1 
ATOM   5253 C CB  . LEU B 1 138 ? -7.131  10.223  -44.635 1.00 51.04  ? 138  LEU B CB  1 
ATOM   5254 C CG  . LEU B 1 138 ? -6.619  10.205  -43.191 1.00 51.22  ? 138  LEU B CG  1 
ATOM   5255 C CD1 . LEU B 1 138 ? -5.193  9.751   -43.127 1.00 51.18  ? 138  LEU B CD1 1 
ATOM   5256 C CD2 . LEU B 1 138 ? -6.743  11.564  -42.551 1.00 51.99  ? 138  LEU B CD2 1 
ATOM   5257 N N   . ALA B 1 139 ? -9.287  10.420  -47.166 1.00 52.23  ? 139  ALA B N   1 
ATOM   5258 C CA  . ALA B 1 139 ? -9.690  11.103  -48.391 1.00 52.55  ? 139  ALA B CA  1 
ATOM   5259 C C   . ALA B 1 139 ? -11.164 11.501  -48.355 1.00 52.84  ? 139  ALA B C   1 
ATOM   5260 O O   . ALA B 1 139 ? -11.498 12.626  -48.733 1.00 53.42  ? 139  ALA B O   1 
ATOM   5261 C CB  . ALA B 1 139 ? -9.389  10.256  -49.617 1.00 52.44  ? 139  ALA B CB  1 
ATOM   5262 N N   . GLN B 1 140 ? -12.032 10.588  -47.909 1.00 52.62  ? 140  GLN B N   1 
ATOM   5263 C CA  . GLN B 1 140 ? -13.473 10.834  -47.867 1.00 52.52  ? 140  GLN B CA  1 
ATOM   5264 C C   . GLN B 1 140 ? -13.832 11.893  -46.829 1.00 52.68  ? 140  GLN B C   1 
ATOM   5265 O O   . GLN B 1 140 ? -14.409 12.934  -47.152 1.00 52.75  ? 140  GLN B O   1 
ATOM   5266 C CB  . GLN B 1 140 ? -14.215 9.546   -47.518 1.00 52.49  ? 140  GLN B CB  1 
ATOM   5267 C CG  . GLN B 1 140 ? -15.670 9.486   -48.004 1.00 53.14  ? 140  GLN B CG  1 
ATOM   5268 C CD  . GLN B 1 140 ? -16.615 10.445  -47.285 1.00 52.39  ? 140  GLN B CD  1 
ATOM   5269 O OE1 . GLN B 1 140 ? -16.739 10.424  -46.064 1.00 52.94  ? 140  GLN B OE1 1 
ATOM   5270 N NE2 . GLN B 1 140 ? -17.296 11.276  -48.053 1.00 51.69  ? 140  GLN B NE2 1 
ATOM   5271 N N   . VAL B 1 141 ? -13.477 11.607  -45.581 1.00 52.58  ? 141  VAL B N   1 
ATOM   5272 C CA  . VAL B 1 141 ? -13.879 12.395  -44.428 1.00 52.20  ? 141  VAL B CA  1 
ATOM   5273 C C   . VAL B 1 141 ? -13.185 13.747  -44.317 1.00 52.21  ? 141  VAL B C   1 
ATOM   5274 O O   . VAL B 1 141 ? -13.752 14.674  -43.763 1.00 52.61  ? 141  VAL B O   1 
ATOM   5275 C CB  . VAL B 1 141 ? -13.599 11.613  -43.151 1.00 52.11  ? 141  VAL B CB  1 
ATOM   5276 C CG1 . VAL B 1 141 ? -14.209 12.315  -41.943 1.00 52.50  ? 141  VAL B CG1 1 
ATOM   5277 C CG2 . VAL B 1 141 ? -14.127 10.200  -43.293 1.00 51.69  ? 141  VAL B CG2 1 
ATOM   5278 N N   . GLU B 1 142 ? -11.960 13.866  -44.812 1.00 52.10  ? 142  GLU B N   1 
ATOM   5279 C CA  . GLU B 1 142 ? -11.213 15.118  -44.649 1.00 52.01  ? 142  GLU B CA  1 
ATOM   5280 C C   . GLU B 1 142 ? -10.855 15.747  -45.974 1.00 51.94  ? 142  GLU B C   1 
ATOM   5281 O O   . GLU B 1 142 ? -10.206 16.798  -46.015 1.00 52.00  ? 142  GLU B O   1 
ATOM   5282 C CB  . GLU B 1 142 ? -9.947  14.914  -43.816 1.00 51.87  ? 142  GLU B CB  1 
ATOM   5283 C CG  . GLU B 1 142 ? -10.193 14.723  -42.328 1.00 52.68  ? 142  GLU B CG  1 
ATOM   5284 C CD  . GLU B 1 142 ? -10.682 15.984  -41.630 1.00 54.43  ? 142  GLU B CD  1 
ATOM   5285 O OE1 . GLU B 1 142 ? -10.513 17.109  -42.178 1.00 54.79  ? 142  GLU B OE1 1 
ATOM   5286 O OE2 . GLU B 1 142 ? -11.231 15.837  -40.516 1.00 54.68  ? 142  GLU B OE2 1 
ATOM   5287 N N   . GLY B 1 143 ? -11.283 15.096  -47.053 1.00 51.89  ? 143  GLY B N   1 
ATOM   5288 C CA  . GLY B 1 143 ? -11.068 15.595  -48.409 1.00 51.72  ? 143  GLY B CA  1 
ATOM   5289 C C   . GLY B 1 143 ? -9.601  15.777  -48.743 1.00 51.76  ? 143  GLY B C   1 
ATOM   5290 O O   . GLY B 1 143 ? -9.238  16.730  -49.442 1.00 52.43  ? 143  GLY B O   1 
ATOM   5291 N N   . ALA B 1 144 ? -8.759  14.870  -48.242 1.00 50.90  ? 144  ALA B N   1 
ATOM   5292 C CA  . ALA B 1 144 ? -7.326  14.938  -48.467 1.00 49.81  ? 144  ALA B CA  1 
ATOM   5293 C C   . ALA B 1 144 ? -6.927  14.102  -49.671 1.00 49.21  ? 144  ALA B C   1 
ATOM   5294 O O   . ALA B 1 144 ? -7.500  13.042  -49.900 1.00 49.03  ? 144  ALA B O   1 
ATOM   5295 C CB  . ALA B 1 144 ? -6.600  14.450  -47.242 1.00 49.81  ? 144  ALA B CB  1 
ATOM   5296 N N   . VAL B 1 145 ? -5.950  14.588  -50.439 1.00 48.53  ? 145  VAL B N   1 
ATOM   5297 C CA  . VAL B 1 145 ? -5.233  13.746  -51.399 1.00 47.83  ? 145  VAL B CA  1 
ATOM   5298 C C   . VAL B 1 145 ? -4.175  12.994  -50.624 1.00 47.32  ? 145  VAL B C   1 
ATOM   5299 O O   . VAL B 1 145 ? -3.274  13.591  -50.065 1.00 47.33  ? 145  VAL B O   1 
ATOM   5300 C CB  . VAL B 1 145 ? -4.494  14.540  -52.497 1.00 47.65  ? 145  VAL B CB  1 
ATOM   5301 C CG1 . VAL B 1 145 ? -3.704  13.587  -53.374 1.00 47.48  ? 145  VAL B CG1 1 
ATOM   5302 C CG2 . VAL B 1 145 ? -5.451  15.326  -53.351 1.00 48.09  ? 145  VAL B CG2 1 
ATOM   5303 N N   . LEU B 1 146 ? -4.280  11.678  -50.599 1.00 47.06  ? 146  LEU B N   1 
ATOM   5304 C CA  . LEU B 1 146 ? -3.338  10.864  -49.852 1.00 46.73  ? 146  LEU B CA  1 
ATOM   5305 C C   . LEU B 1 146 ? -2.518  9.930   -50.770 1.00 46.15  ? 146  LEU B C   1 
ATOM   5306 O O   . LEU B 1 146 ? -3.077  9.167   -51.567 1.00 46.41  ? 146  LEU B O   1 
ATOM   5307 C CB  . LEU B 1 146 ? -4.089  10.092  -48.765 1.00 46.73  ? 146  LEU B CB  1 
ATOM   5308 C CG  . LEU B 1 146 ? -3.216  9.357   -47.753 1.00 47.78  ? 146  LEU B CG  1 
ATOM   5309 C CD1 . LEU B 1 146 ? -3.880  9.344   -46.394 1.00 48.05  ? 146  LEU B CD1 1 
ATOM   5310 C CD2 . LEU B 1 146 ? -2.912  7.934   -48.229 1.00 48.16  ? 146  LEU B CD2 1 
ATOM   5311 N N   . VAL B 1 147 ? -1.195  9.998   -50.645 1.00 45.18  ? 147  VAL B N   1 
ATOM   5312 C CA  . VAL B 1 147 ? -0.292  9.190   -51.458 1.00 44.27  ? 147  VAL B CA  1 
ATOM   5313 C C   . VAL B 1 147 ? 0.483   8.213   -50.583 1.00 43.86  ? 147  VAL B C   1 
ATOM   5314 O O   . VAL B 1 147 ? 0.915   8.594   -49.503 1.00 44.19  ? 147  VAL B O   1 
ATOM   5315 C CB  . VAL B 1 147 ? 0.718   10.071  -52.191 1.00 44.01  ? 147  VAL B CB  1 
ATOM   5316 C CG1 . VAL B 1 147 ? 1.574   9.235   -53.106 1.00 44.32  ? 147  VAL B CG1 1 
ATOM   5317 C CG2 . VAL B 1 147 ? 0.015   11.132  -52.992 1.00 43.89  ? 147  VAL B CG2 1 
ATOM   5318 N N   . SER B 1 148 ? 0.640   6.962   -51.023 1.00 43.07  ? 148  SER B N   1 
ATOM   5319 C CA  . SER B 1 148 ? 1.651   6.076   -50.427 1.00 42.69  ? 148  SER B CA  1 
ATOM   5320 C C   . SER B 1 148 ? 2.464   5.353   -51.502 1.00 42.47  ? 148  SER B C   1 
ATOM   5321 O O   . SER B 1 148 ? 1.954   5.107   -52.589 1.00 42.77  ? 148  SER B O   1 
ATOM   5322 C CB  . SER B 1 148 ? 1.055   5.109   -49.390 1.00 42.88  ? 148  SER B CB  1 
ATOM   5323 O OG  . SER B 1 148 ? 0.017   4.284   -49.896 1.00 42.94  ? 148  SER B OG  1 
ATOM   5324 N N   . MET B 1 149 ? 3.731   5.052   -51.219 1.00 41.89  ? 149  MET B N   1 
ATOM   5325 C CA  . MET B 1 149 ? 4.598   4.369   -52.193 1.00 41.46  ? 149  MET B CA  1 
ATOM   5326 C C   . MET B 1 149 ? 5.284   3.140   -51.619 1.00 41.49  ? 149  MET B C   1 
ATOM   5327 O O   . MET B 1 149 ? 5.510   3.063   -50.411 1.00 41.61  ? 149  MET B O   1 
ATOM   5328 C CB  . MET B 1 149 ? 5.674   5.315   -52.722 1.00 41.38  ? 149  MET B CB  1 
ATOM   5329 C CG  . MET B 1 149 ? 6.969   5.338   -51.920 1.00 40.37  ? 149  MET B CG  1 
ATOM   5330 S SD  . MET B 1 149 ? 6.764   6.085   -50.293 1.00 40.47  ? 149  MET B SD  1 
ATOM   5331 C CE  . MET B 1 149 ? 6.720   7.826   -50.740 1.00 38.91  ? 149  MET B CE  1 
ATOM   5332 N N   . ASN B 1 150 ? 5.611   2.183   -52.480 1.00 41.36  ? 150  ASN B N   1 
ATOM   5333 C CA  . ASN B 1 150 ? 6.544   1.135   -52.096 1.00 41.79  ? 150  ASN B CA  1 
ATOM   5334 C C   . ASN B 1 150 ? 7.965   1.649   -52.304 1.00 41.70  ? 150  ASN B C   1 
ATOM   5335 O O   . ASN B 1 150 ? 8.226   2.414   -53.242 1.00 41.55  ? 150  ASN B O   1 
ATOM   5336 C CB  . ASN B 1 150 ? 6.356   -0.127  -52.932 1.00 42.05  ? 150  ASN B CB  1 
ATOM   5337 C CG  . ASN B 1 150 ? 5.054   -0.831  -52.653 1.00 42.90  ? 150  ASN B CG  1 
ATOM   5338 O OD1 . ASN B 1 150 ? 4.407   -0.589  -51.640 1.00 45.26  ? 150  ASN B OD1 1 
ATOM   5339 N ND2 . ASN B 1 150 ? 4.663   -1.726  -53.557 1.00 43.29  ? 150  ASN B ND2 1 
ATOM   5340 N N   . TYR B 1 151 ? 8.868   1.242   -51.419 1.00 41.35  ? 151  TYR B N   1 
ATOM   5341 C CA  . TYR B 1 151 ? 10.288  1.495   -51.606 1.00 41.22  ? 151  TYR B CA  1 
ATOM   5342 C C   . TYR B 1 151 ? 11.038  0.207   -51.288 1.00 41.02  ? 151  TYR B C   1 
ATOM   5343 O O   . TYR B 1 151 ? 10.568  -0.606  -50.474 1.00 41.02  ? 151  TYR B O   1 
ATOM   5344 C CB  . TYR B 1 151 ? 10.769  2.674   -50.746 1.00 41.16  ? 151  TYR B CB  1 
ATOM   5345 C CG  . TYR B 1 151 ? 10.585  2.481   -49.261 1.00 41.26  ? 151  TYR B CG  1 
ATOM   5346 C CD1 . TYR B 1 151 ? 9.341   2.672   -48.661 1.00 41.05  ? 151  TYR B CD1 1 
ATOM   5347 C CD2 . TYR B 1 151 ? 11.662  2.121   -48.443 1.00 41.19  ? 151  TYR B CD2 1 
ATOM   5348 C CE1 . TYR B 1 151 ? 9.170   2.506   -47.277 1.00 40.73  ? 151  TYR B CE1 1 
ATOM   5349 C CE2 . TYR B 1 151 ? 11.500  1.943   -47.062 1.00 40.23  ? 151  TYR B CE2 1 
ATOM   5350 C CZ  . TYR B 1 151 ? 10.251  2.132   -46.496 1.00 40.94  ? 151  TYR B CZ  1 
ATOM   5351 O OH  . TYR B 1 151 ? 10.072  1.938   -45.150 1.00 42.02  ? 151  TYR B OH  1 
ATOM   5352 N N   . ARG B 1 152 ? 12.181  0.013   -51.944 1.00 40.32  ? 152  ARG B N   1 
ATOM   5353 C CA  . ARG B 1 152 ? 12.978  -1.193  -51.746 1.00 39.94  ? 152  ARG B CA  1 
ATOM   5354 C C   . ARG B 1 152 ? 13.482  -1.366  -50.319 1.00 39.89  ? 152  ARG B C   1 
ATOM   5355 O O   . ARG B 1 152 ? 14.000  -0.439  -49.725 1.00 39.80  ? 152  ARG B O   1 
ATOM   5356 C CB  . ARG B 1 152 ? 14.136  -1.213  -52.720 1.00 39.75  ? 152  ARG B CB  1 
ATOM   5357 C CG  . ARG B 1 152 ? 13.756  -1.773  -54.075 1.00 39.43  ? 152  ARG B CG  1 
ATOM   5358 C CD  . ARG B 1 152 ? 14.857  -1.562  -55.052 1.00 37.12  ? 152  ARG B CD  1 
ATOM   5359 N NE  . ARG B 1 152 ? 14.998  -0.160  -55.406 1.00 37.06  ? 152  ARG B NE  1 
ATOM   5360 C CZ  . ARG B 1 152 ? 16.040  0.322   -56.073 1.00 39.45  ? 152  ARG B CZ  1 
ATOM   5361 N NH1 . ARG B 1 152 ? 17.027  -0.498  -56.444 1.00 38.99  ? 152  ARG B NH1 1 
ATOM   5362 N NH2 . ARG B 1 152 ? 16.104  1.619   -56.370 1.00 39.46  ? 152  ARG B NH2 1 
ATOM   5363 N N   . VAL B 1 153 ? 13.312  -2.556  -49.768 1.00 40.08  ? 153  VAL B N   1 
ATOM   5364 C CA  . VAL B 1 153 ? 13.747  -2.811  -48.408 1.00 40.60  ? 153  VAL B CA  1 
ATOM   5365 C C   . VAL B 1 153 ? 14.823  -3.887  -48.382 1.00 41.00  ? 153  VAL B C   1 
ATOM   5366 O O   . VAL B 1 153 ? 15.091  -4.538  -49.405 1.00 41.46  ? 153  VAL B O   1 
ATOM   5367 C CB  . VAL B 1 153 ? 12.562  -3.189  -47.466 1.00 40.82  ? 153  VAL B CB  1 
ATOM   5368 C CG1 . VAL B 1 153 ? 11.468  -2.127  -47.516 1.00 41.34  ? 153  VAL B CG1 1 
ATOM   5369 C CG2 . VAL B 1 153 ? 11.984  -4.543  -47.816 1.00 40.65  ? 153  VAL B CG2 1 
ATOM   5370 N N   . GLY B 1 154 ? 15.439  -4.067  -47.214 1.00 41.36  ? 154  GLY B N   1 
ATOM   5371 C CA  . GLY B 1 154 ? 16.488  -5.081  -47.019 1.00 41.69  ? 154  GLY B CA  1 
ATOM   5372 C C   . GLY B 1 154 ? 17.713  -4.883  -47.899 1.00 41.85  ? 154  GLY B C   1 
ATOM   5373 O O   . GLY B 1 154 ? 18.114  -3.749  -48.192 1.00 41.91  ? 154  GLY B O   1 
ATOM   5374 N N   . THR B 1 155 ? 18.297  -5.990  -48.340 1.00 41.86  ? 155  THR B N   1 
ATOM   5375 C CA  . THR B 1 155 ? 19.496  -5.932  -49.160 1.00 42.03  ? 155  THR B CA  1 
ATOM   5376 C C   . THR B 1 155 ? 19.204  -5.260  -50.493 1.00 42.54  ? 155  THR B C   1 
ATOM   5377 O O   . THR B 1 155 ? 20.083  -4.627  -51.080 1.00 43.06  ? 155  THR B O   1 
ATOM   5378 C CB  . THR B 1 155 ? 20.062  -7.316  -49.429 1.00 41.84  ? 155  THR B CB  1 
ATOM   5379 O OG1 . THR B 1 155 ? 19.218  -7.978  -50.375 1.00 41.86  ? 155  THR B OG1 1 
ATOM   5380 C CG2 . THR B 1 155 ? 20.126  -8.131  -48.138 1.00 41.09  ? 155  THR B CG2 1 
ATOM   5381 N N   . PHE B 1 156 ? 17.968  -5.379  -50.968 1.00 42.77  ? 156  PHE B N   1 
ATOM   5382 C CA  . PHE B 1 156 ? 17.612  -4.801  -52.261 1.00 42.84  ? 156  PHE B CA  1 
ATOM   5383 C C   . PHE B 1 156 ? 17.569  -3.294  -52.204 1.00 42.87  ? 156  PHE B C   1 
ATOM   5384 O O   . PHE B 1 156 ? 17.750  -2.633  -53.218 1.00 42.83  ? 156  PHE B O   1 
ATOM   5385 C CB  . PHE B 1 156 ? 16.261  -5.298  -52.707 1.00 42.80  ? 156  PHE B CB  1 
ATOM   5386 C CG  . PHE B 1 156 ? 16.121  -6.772  -52.635 1.00 43.71  ? 156  PHE B CG  1 
ATOM   5387 C CD1 . PHE B 1 156 ? 16.453  -7.562  -53.726 1.00 43.16  ? 156  PHE B CD1 1 
ATOM   5388 C CD2 . PHE B 1 156 ? 15.653  -7.383  -51.468 1.00 45.43  ? 156  PHE B CD2 1 
ATOM   5389 C CE1 . PHE B 1 156 ? 16.323  -8.939  -53.659 1.00 44.32  ? 156  PHE B CE1 1 
ATOM   5390 C CE2 . PHE B 1 156 ? 15.512  -8.775  -51.390 1.00 44.88  ? 156  PHE B CE2 1 
ATOM   5391 C CZ  . PHE B 1 156 ? 15.850  -9.552  -52.484 1.00 44.13  ? 156  PHE B CZ  1 
ATOM   5392 N N   . GLY B 1 157 ? 17.314  -2.754  -51.019 1.00 42.91  ? 157  GLY B N   1 
ATOM   5393 C CA  . GLY B 1 157 ? 17.077  -1.332  -50.892 1.00 43.53  ? 157  GLY B CA  1 
ATOM   5394 C C   . GLY B 1 157 ? 18.211  -0.608  -50.221 1.00 44.23  ? 157  GLY B C   1 
ATOM   5395 O O   . GLY B 1 157 ? 18.398  0.604   -50.416 1.00 43.93  ? 157  GLY B O   1 
ATOM   5396 N N   . PHE B 1 158 ? 18.984  -1.352  -49.433 1.00 44.96  ? 158  PHE B N   1 
ATOM   5397 C CA  . PHE B 1 158 ? 19.936  -0.710  -48.547 1.00 45.36  ? 158  PHE B CA  1 
ATOM   5398 C C   . PHE B 1 158 ? 21.319  -1.292  -48.487 1.00 46.16  ? 158  PHE B C   1 
ATOM   5399 O O   . PHE B 1 158 ? 22.184  -0.697  -47.829 1.00 46.82  ? 158  PHE B O   1 
ATOM   5400 C CB  . PHE B 1 158 ? 19.333  -0.517  -47.156 1.00 44.66  ? 158  PHE B CB  1 
ATOM   5401 C CG  . PHE B 1 158 ? 18.171  0.417   -47.158 1.00 44.03  ? 158  PHE B CG  1 
ATOM   5402 C CD1 . PHE B 1 158 ? 18.365  1.778   -47.344 1.00 42.77  ? 158  PHE B CD1 1 
ATOM   5403 C CD2 . PHE B 1 158 ? 16.877  -0.062  -47.031 1.00 43.42  ? 158  PHE B CD2 1 
ATOM   5404 C CE1 . PHE B 1 158 ? 17.284  2.646   -47.373 1.00 42.32  ? 158  PHE B CE1 1 
ATOM   5405 C CE2 . PHE B 1 158 ? 15.797  0.803   -47.063 1.00 42.02  ? 158  PHE B CE2 1 
ATOM   5406 C CZ  . PHE B 1 158 ? 16.003  2.154   -47.236 1.00 42.28  ? 158  PHE B CZ  1 
ATOM   5407 N N   . LEU B 1 159 ? 21.543  -2.414  -49.180 1.00 46.86  ? 159  LEU B N   1 
ATOM   5408 C CA  . LEU B 1 159 ? 22.890  -2.999  -49.275 1.00 47.48  ? 159  LEU B CA  1 
ATOM   5409 C C   . LEU B 1 159 ? 23.849  -2.065  -50.006 1.00 48.57  ? 159  LEU B C   1 
ATOM   5410 O O   . LEU B 1 159 ? 23.682  -1.781  -51.192 1.00 48.63  ? 159  LEU B O   1 
ATOM   5411 C CB  . LEU B 1 159 ? 22.863  -4.349  -49.969 1.00 46.84  ? 159  LEU B CB  1 
ATOM   5412 C CG  . LEU B 1 159 ? 24.202  -5.068  -50.033 1.00 46.05  ? 159  LEU B CG  1 
ATOM   5413 C CD1 . LEU B 1 159 ? 23.980  -6.551  -49.867 1.00 45.37  ? 159  LEU B CD1 1 
ATOM   5414 C CD2 . LEU B 1 159 ? 24.932  -4.771  -51.319 1.00 44.85  ? 159  LEU B CD2 1 
ATOM   5415 N N   . ALA B 1 160 ? 24.854  -1.579  -49.289 1.00 50.05  ? 160  ALA B N   1 
ATOM   5416 C CA  . ALA B 1 160 ? 25.841  -0.693  -49.902 1.00 51.52  ? 160  ALA B CA  1 
ATOM   5417 C C   . ALA B 1 160 ? 27.256  -1.275  -49.906 1.00 52.39  ? 160  ALA B C   1 
ATOM   5418 O O   . ALA B 1 160 ? 27.633  -2.043  -49.015 1.00 52.63  ? 160  ALA B O   1 
ATOM   5419 C CB  . ALA B 1 160 ? 25.826  0.677   -49.239 1.00 51.24  ? 160  ALA B CB  1 
ATOM   5420 N N   . LEU B 1 161 ? 28.005  -0.922  -50.947 1.00 53.50  ? 161  LEU B N   1 
ATOM   5421 C CA  . LEU B 1 161 ? 29.454  -1.005  -50.945 1.00 54.66  ? 161  LEU B CA  1 
ATOM   5422 C C   . LEU B 1 161 ? 29.909  0.424   -51.179 1.00 55.48  ? 161  LEU B C   1 
ATOM   5423 O O   . LEU B 1 161 ? 30.275  0.794   -52.299 1.00 55.41  ? 161  LEU B O   1 
ATOM   5424 C CB  . LEU B 1 161 ? 29.957  -1.955  -52.033 1.00 54.67  ? 161  LEU B CB  1 
ATOM   5425 C CG  . LEU B 1 161 ? 29.834  -3.433  -51.642 1.00 55.52  ? 161  LEU B CG  1 
ATOM   5426 C CD1 . LEU B 1 161 ? 30.150  -4.367  -52.797 1.00 55.96  ? 161  LEU B CD1 1 
ATOM   5427 C CD2 . LEU B 1 161 ? 30.730  -3.744  -50.459 1.00 56.92  ? 161  LEU B CD2 1 
ATOM   5428 N N   . PRO B 1 162 ? 29.862  1.245   -50.113 1.00 56.49  ? 162  PRO B N   1 
ATOM   5429 C CA  . PRO B 1 162 ? 29.942  2.705   -50.245 1.00 57.46  ? 162  PRO B CA  1 
ATOM   5430 C C   . PRO B 1 162 ? 31.079  3.167   -51.135 1.00 58.43  ? 162  PRO B C   1 
ATOM   5431 O O   . PRO B 1 162 ? 32.151  2.568   -51.120 1.00 58.63  ? 162  PRO B O   1 
ATOM   5432 C CB  . PRO B 1 162 ? 30.137  3.172   -48.802 1.00 57.37  ? 162  PRO B CB  1 
ATOM   5433 C CG  . PRO B 1 162 ? 29.412  2.115   -47.994 1.00 56.73  ? 162  PRO B CG  1 
ATOM   5434 C CD  . PRO B 1 162 ? 29.734  0.830   -48.701 1.00 56.38  ? 162  PRO B CD  1 
ATOM   5435 N N   . GLY B 1 163 ? 30.822  4.202   -51.929 1.00 59.59  ? 163  GLY B N   1 
ATOM   5436 C CA  . GLY B 1 163 ? 31.849  4.779   -52.797 1.00 60.92  ? 163  GLY B CA  1 
ATOM   5437 C C   . GLY B 1 163 ? 31.952  4.128   -54.164 1.00 61.87  ? 163  GLY B C   1 
ATOM   5438 O O   . GLY B 1 163 ? 32.544  4.702   -55.083 1.00 61.77  ? 163  GLY B O   1 
ATOM   5439 N N   . SER B 1 164 ? 31.381  2.928   -54.294 1.00 62.85  ? 164  SER B N   1 
ATOM   5440 C CA  . SER B 1 164 ? 31.332  2.216   -55.573 1.00 63.81  ? 164  SER B CA  1 
ATOM   5441 C C   . SER B 1 164 ? 30.277  2.832   -56.472 1.00 64.51  ? 164  SER B C   1 
ATOM   5442 O O   . SER B 1 164 ? 29.469  3.640   -56.012 1.00 64.64  ? 164  SER B O   1 
ATOM   5443 C CB  . SER B 1 164 ? 31.028  0.732   -55.359 1.00 63.76  ? 164  SER B CB  1 
ATOM   5444 O OG  . SER B 1 164 ? 29.664  0.524   -55.060 1.00 63.60  ? 164  SER B OG  1 
ATOM   5445 N N   . ARG B 1 165 ? 30.283  2.454   -57.748 1.00 65.41  ? 165  ARG B N   1 
ATOM   5446 C CA  . ARG B 1 165 ? 29.312  2.991   -58.691 1.00 66.61  ? 165  ARG B CA  1 
ATOM   5447 C C   . ARG B 1 165 ? 28.080  2.100   -58.755 1.00 65.98  ? 165  ARG B C   1 
ATOM   5448 O O   . ARG B 1 165 ? 26.970  2.582   -59.004 1.00 66.15  ? 165  ARG B O   1 
ATOM   5449 C CB  . ARG B 1 165 ? 29.919  3.162   -60.085 1.00 66.61  ? 165  ARG B CB  1 
ATOM   5450 C CG  . ARG B 1 165 ? 29.220  4.235   -60.960 1.00 68.68  ? 165  ARG B CG  1 
ATOM   5451 C CD  . ARG B 1 165 ? 29.357  3.925   -62.489 1.00 69.29  ? 165  ARG B CD  1 
ATOM   5452 N NE  . ARG B 1 165 ? 28.160  3.287   -63.079 1.00 73.99  ? 165  ARG B NE  1 
ATOM   5453 C CZ  . ARG B 1 165 ? 27.825  1.989   -62.992 1.00 75.43  ? 165  ARG B CZ  1 
ATOM   5454 N NH1 . ARG B 1 165 ? 28.570  1.109   -62.320 1.00 75.94  ? 165  ARG B NH1 1 
ATOM   5455 N NH2 . ARG B 1 165 ? 26.712  1.563   -63.580 1.00 76.15  ? 165  ARG B NH2 1 
ATOM   5456 N N   . GLU B 1 166 ? 28.267  0.811   -58.501 1.00 65.47  ? 166  GLU B N   1 
ATOM   5457 C CA  . GLU B 1 166 ? 27.207  -0.158  -58.801 1.00 65.24  ? 166  GLU B CA  1 
ATOM   5458 C C   . GLU B 1 166 ? 26.382  -0.660  -57.600 1.00 63.95  ? 166  GLU B C   1 
ATOM   5459 O O   . GLU B 1 166 ? 25.498  -1.509  -57.766 1.00 64.03  ? 166  GLU B O   1 
ATOM   5460 C CB  . GLU B 1 166 ? 27.713  -1.307  -59.717 1.00 65.76  ? 166  GLU B CB  1 
ATOM   5461 C CG  . GLU B 1 166 ? 29.067  -1.958  -59.338 1.00 67.94  ? 166  GLU B CG  1 
ATOM   5462 C CD  . GLU B 1 166 ? 30.310  -1.131  -59.742 1.00 70.18  ? 166  GLU B CD  1 
ATOM   5463 O OE1 . GLU B 1 166 ? 30.540  -0.920  -60.960 1.00 70.55  ? 166  GLU B OE1 1 
ATOM   5464 O OE2 . GLU B 1 166 ? 31.066  -0.714  -58.829 1.00 70.70  ? 166  GLU B OE2 1 
ATOM   5465 N N   . ALA B 1 167 ? 26.675  -0.125  -56.413 1.00 62.27  ? 167  ALA B N   1 
ATOM   5466 C CA  . ALA B 1 167 ? 25.843  -0.290  -55.208 1.00 60.67  ? 167  ALA B CA  1 
ATOM   5467 C C   . ALA B 1 167 ? 26.194  0.814   -54.203 1.00 59.72  ? 167  ALA B C   1 
ATOM   5468 O O   . ALA B 1 167 ? 26.873  0.561   -53.201 1.00 59.31  ? 167  ALA B O   1 
ATOM   5469 C CB  . ALA B 1 167 ? 26.024  -1.658  -54.587 1.00 60.51  ? 167  ALA B CB  1 
ATOM   5470 N N   . PRO B 1 168 ? 25.710  2.046   -54.461 1.00 58.76  ? 168  PRO B N   1 
ATOM   5471 C CA  . PRO B 1 168 ? 26.197  3.221   -53.747 1.00 57.84  ? 168  PRO B CA  1 
ATOM   5472 C C   . PRO B 1 168 ? 25.452  3.444   -52.436 1.00 56.90  ? 168  PRO B C   1 
ATOM   5473 O O   . PRO B 1 168 ? 25.731  4.411   -51.721 1.00 56.72  ? 168  PRO B O   1 
ATOM   5474 C CB  . PRO B 1 168 ? 25.908  4.353   -54.725 1.00 57.85  ? 168  PRO B CB  1 
ATOM   5475 C CG  . PRO B 1 168 ? 24.690  3.892   -55.486 1.00 58.29  ? 168  PRO B CG  1 
ATOM   5476 C CD  . PRO B 1 168 ? 24.630  2.392   -55.409 1.00 58.72  ? 168  PRO B CD  1 
ATOM   5477 N N   . GLY B 1 169 ? 24.513  2.542   -52.143 1.00 55.85  ? 169  GLY B N   1 
ATOM   5478 C CA  . GLY B 1 169 ? 23.699  2.595   -50.936 1.00 54.08  ? 169  GLY B CA  1 
ATOM   5479 C C   . GLY B 1 169 ? 22.588  3.629   -50.938 1.00 52.71  ? 169  GLY B C   1 
ATOM   5480 O O   . GLY B 1 169 ? 22.611  4.601   -51.724 1.00 52.22  ? 169  GLY B O   1 
ATOM   5481 N N   . ASN B 1 170 ? 21.629  3.405   -50.032 1.00 51.39  ? 170  ASN B N   1 
ATOM   5482 C CA  . ASN B 1 170 ? 20.501  4.312   -49.776 1.00 49.99  ? 170  ASN B CA  1 
ATOM   5483 C C   . ASN B 1 170 ? 19.443  4.349   -50.879 1.00 49.35  ? 170  ASN B C   1 
ATOM   5484 O O   . ASN B 1 170 ? 18.679  5.312   -50.967 1.00 49.63  ? 170  ASN B O   1 
ATOM   5485 C CB  . ASN B 1 170 ? 20.982  5.746   -49.478 1.00 49.55  ? 170  ASN B CB  1 
ATOM   5486 C CG  . ASN B 1 170 ? 21.707  5.868   -48.153 1.00 48.75  ? 170  ASN B CG  1 
ATOM   5487 O OD1 . ASN B 1 170 ? 21.448  5.128   -47.204 1.00 47.66  ? 170  ASN B OD1 1 
ATOM   5488 N ND2 . ASN B 1 170 ? 22.619  6.822   -48.079 1.00 48.58  ? 170  ASN B ND2 1 
ATOM   5489 N N   . VAL B 1 171 ? 19.379  3.313   -51.709 1.00 48.39  ? 171  VAL B N   1 
ATOM   5490 C CA  . VAL B 1 171 ? 18.508  3.378   -52.875 1.00 47.57  ? 171  VAL B CA  1 
ATOM   5491 C C   . VAL B 1 171 ? 17.034  3.325   -52.483 1.00 47.37  ? 171  VAL B C   1 
ATOM   5492 O O   . VAL B 1 171 ? 16.196  3.929   -53.138 1.00 47.63  ? 171  VAL B O   1 
ATOM   5493 C CB  . VAL B 1 171 ? 18.864  2.335   -53.956 1.00 47.47  ? 171  VAL B CB  1 
ATOM   5494 C CG1 . VAL B 1 171 ? 20.212  2.657   -54.544 1.00 47.63  ? 171  VAL B CG1 1 
ATOM   5495 C CG2 . VAL B 1 171 ? 18.856  0.929   -53.402 1.00 47.01  ? 171  VAL B CG2 1 
ATOM   5496 N N   . GLY B 1 172 ? 16.729  2.625   -51.398 1.00 46.83  ? 172  GLY B N   1 
ATOM   5497 C CA  . GLY B 1 172 ? 15.384  2.616   -50.854 1.00 46.42  ? 172  GLY B CA  1 
ATOM   5498 C C   . GLY B 1 172 ? 14.922  4.013   -50.472 1.00 46.31  ? 172  GLY B C   1 
ATOM   5499 O O   . GLY B 1 172 ? 13.729  4.321   -50.523 1.00 46.68  ? 172  GLY B O   1 
ATOM   5500 N N   . LEU B 1 173 ? 15.860  4.867   -50.082 1.00 45.75  ? 173  LEU B N   1 
ATOM   5501 C CA  . LEU B 1 173 ? 15.512  6.249   -49.775 1.00 45.20  ? 173  LEU B CA  1 
ATOM   5502 C C   . LEU B 1 173 ? 15.348  7.051   -51.057 1.00 44.32  ? 173  LEU B C   1 
ATOM   5503 O O   . LEU B 1 173 ? 14.552  7.992   -51.127 1.00 44.12  ? 173  LEU B O   1 
ATOM   5504 C CB  . LEU B 1 173 ? 16.552  6.894   -48.838 1.00 45.54  ? 173  LEU B CB  1 
ATOM   5505 C CG  . LEU B 1 173 ? 16.637  6.360   -47.404 1.00 45.35  ? 173  LEU B CG  1 
ATOM   5506 C CD1 . LEU B 1 173 ? 17.658  7.110   -46.608 1.00 44.88  ? 173  LEU B CD1 1 
ATOM   5507 C CD2 . LEU B 1 173 ? 15.288  6.461   -46.718 1.00 46.73  ? 173  LEU B CD2 1 
ATOM   5508 N N   . LEU B 1 174 ? 16.108  6.671   -52.070 1.00 43.57  ? 174  LEU B N   1 
ATOM   5509 C CA  . LEU B 1 174 ? 16.035  7.343   -53.353 1.00 43.43  ? 174  LEU B CA  1 
ATOM   5510 C C   . LEU B 1 174 ? 14.737  7.048   -54.101 1.00 43.33  ? 174  LEU B C   1 
ATOM   5511 O O   . LEU B 1 174 ? 14.210  7.922   -54.797 1.00 43.16  ? 174  LEU B O   1 
ATOM   5512 C CB  . LEU B 1 174 ? 17.267  7.027   -54.190 1.00 43.41  ? 174  LEU B CB  1 
ATOM   5513 C CG  . LEU B 1 174 ? 18.422  7.965   -53.822 1.00 43.37  ? 174  LEU B CG  1 
ATOM   5514 C CD1 . LEU B 1 174 ? 19.766  7.382   -54.215 1.00 42.79  ? 174  LEU B CD1 1 
ATOM   5515 C CD2 . LEU B 1 174 ? 18.207  9.345   -54.456 1.00 44.26  ? 174  LEU B CD2 1 
ATOM   5516 N N   . ASP B 1 175 ? 14.242  5.817   -53.935 1.00 42.97  ? 175  ASP B N   1 
ATOM   5517 C CA  . ASP B 1 175 ? 12.909  5.413   -54.344 1.00 42.72  ? 175  ASP B CA  1 
ATOM   5518 C C   . ASP B 1 175 ? 11.873  6.364   -53.764 1.00 42.63  ? 175  ASP B C   1 
ATOM   5519 O O   . ASP B 1 175 ? 11.083  6.957   -54.495 1.00 42.62  ? 175  ASP B O   1 
ATOM   5520 C CB  . ASP B 1 175 ? 12.615  4.007   -53.828 1.00 42.82  ? 175  ASP B CB  1 
ATOM   5521 C CG  . ASP B 1 175 ? 13.474  2.946   -54.488 1.00 44.38  ? 175  ASP B CG  1 
ATOM   5522 O OD1 . ASP B 1 175 ? 14.152  3.265   -55.483 1.00 45.62  ? 175  ASP B OD1 1 
ATOM   5523 O OD2 . ASP B 1 175 ? 13.468  1.780   -54.022 1.00 46.31  ? 175  ASP B OD2 1 
ATOM   5524 N N   . GLN B 1 176 ? 11.882  6.497   -52.441 1.00 42.35  ? 176  GLN B N   1 
ATOM   5525 C CA  . GLN B 1 176 ? 11.000  7.412   -51.742 1.00 42.26  ? 176  GLN B CA  1 
ATOM   5526 C C   . GLN B 1 176 ? 11.102  8.804   -52.360 1.00 42.41  ? 176  GLN B C   1 
ATOM   5527 O O   . GLN B 1 176 ? 10.092  9.411   -52.716 1.00 42.80  ? 176  GLN B O   1 
ATOM   5528 C CB  . GLN B 1 176 ? 11.357  7.484   -50.252 1.00 42.26  ? 176  GLN B CB  1 
ATOM   5529 C CG  . GLN B 1 176 ? 11.200  6.185   -49.452 1.00 42.38  ? 176  GLN B CG  1 
ATOM   5530 C CD  . GLN B 1 176 ? 11.713  6.310   -48.014 1.00 42.44  ? 176  GLN B CD  1 
ATOM   5531 O OE1 . GLN B 1 176 ? 12.143  7.386   -47.590 1.00 42.15  ? 176  GLN B OE1 1 
ATOM   5532 N NE2 . GLN B 1 176 ? 11.665  5.207   -47.262 1.00 41.58  ? 176  GLN B NE2 1 
ATOM   5533 N N   . ARG B 1 177 ? 12.322  9.311   -52.502 1.00 42.34  ? 177  ARG B N   1 
ATOM   5534 C CA  . ARG B 1 177 ? 12.506  10.627  -53.080 1.00 42.06  ? 177  ARG B CA  1 
ATOM   5535 C C   . ARG B 1 177 ? 11.798  10.729  -54.412 1.00 41.99  ? 177  ARG B C   1 
ATOM   5536 O O   . ARG B 1 177 ? 11.040  11.651  -54.615 1.00 42.51  ? 177  ARG B O   1 
ATOM   5537 C CB  . ARG B 1 177 ? 13.979  10.940  -53.252 1.00 42.14  ? 177  ARG B CB  1 
ATOM   5538 C CG  . ARG B 1 177 ? 14.239  12.258  -53.919 1.00 42.53  ? 177  ARG B CG  1 
ATOM   5539 C CD  . ARG B 1 177 ? 15.704  12.556  -53.904 1.00 45.14  ? 177  ARG B CD  1 
ATOM   5540 N NE  . ARG B 1 177 ? 16.173  12.871  -52.553 1.00 48.87  ? 177  ARG B NE  1 
ATOM   5541 C CZ  . ARG B 1 177 ? 17.452  13.077  -52.232 1.00 50.36  ? 177  ARG B CZ  1 
ATOM   5542 N NH1 . ARG B 1 177 ? 18.391  13.000  -53.176 1.00 50.99  ? 177  ARG B NH1 1 
ATOM   5543 N NH2 . ARG B 1 177 ? 17.792  13.360  -50.974 1.00 48.35  ? 177  ARG B NH2 1 
ATOM   5544 N N   . LEU B 1 178 ? 12.025  9.774   -55.310 1.00 41.94  ? 178  LEU B N   1 
ATOM   5545 C CA  . LEU B 1 178 ? 11.427  9.821   -56.649 1.00 41.69  ? 178  LEU B CA  1 
ATOM   5546 C C   . LEU B 1 178 ? 9.899   9.870   -56.628 1.00 42.26  ? 178  LEU B C   1 
ATOM   5547 O O   . LEU B 1 178 ? 9.288   10.503  -57.486 1.00 42.50  ? 178  LEU B O   1 
ATOM   5548 C CB  . LEU B 1 178 ? 11.906  8.656   -57.518 1.00 41.55  ? 178  LEU B CB  1 
ATOM   5549 C CG  . LEU B 1 178 ? 11.592  8.692   -59.018 1.00 40.33  ? 178  LEU B CG  1 
ATOM   5550 C CD1 . LEU B 1 178 ? 12.233  9.881   -59.701 1.00 39.17  ? 178  LEU B CD1 1 
ATOM   5551 C CD2 . LEU B 1 178 ? 12.047  7.403   -59.667 1.00 40.64  ? 178  LEU B CD2 1 
ATOM   5552 N N   . ALA B 1 179 ? 9.286   9.199   -55.658 1.00 42.60  ? 179  ALA B N   1 
ATOM   5553 C CA  . ALA B 1 179 ? 7.846   9.310   -55.471 1.00 43.12  ? 179  ALA B CA  1 
ATOM   5554 C C   . ALA B 1 179 ? 7.495   10.764  -55.103 1.00 43.77  ? 179  ALA B C   1 
ATOM   5555 O O   . ALA B 1 179 ? 6.571   11.352  -55.665 1.00 43.65  ? 179  ALA B O   1 
ATOM   5556 C CB  . ALA B 1 179 ? 7.368   8.334   -54.427 1.00 42.51  ? 179  ALA B CB  1 
ATOM   5557 N N   . LEU B 1 180 ? 8.264   11.357  -54.198 1.00 44.53  ? 180  LEU B N   1 
ATOM   5558 C CA  . LEU B 1 180 ? 8.112   12.778  -53.925 1.00 45.58  ? 180  LEU B CA  1 
ATOM   5559 C C   . LEU B 1 180 ? 8.288   13.607  -55.201 1.00 46.58  ? 180  LEU B C   1 
ATOM   5560 O O   . LEU B 1 180 ? 7.442   14.457  -55.487 1.00 47.10  ? 180  LEU B O   1 
ATOM   5561 C CB  . LEU B 1 180 ? 9.052   13.244  -52.813 1.00 45.38  ? 180  LEU B CB  1 
ATOM   5562 C CG  . LEU B 1 180 ? 9.119   12.332  -51.577 1.00 45.60  ? 180  LEU B CG  1 
ATOM   5563 C CD1 . LEU B 1 180 ? 10.202  12.781  -50.601 1.00 45.25  ? 180  LEU B CD1 1 
ATOM   5564 C CD2 . LEU B 1 180 ? 7.778   12.222  -50.877 1.00 44.20  ? 180  LEU B CD2 1 
ATOM   5565 N N   . GLN B 1 181 ? 9.342   13.353  -55.984 1.00 47.38  ? 181  GLN B N   1 
ATOM   5566 C CA  . GLN B 1 181 ? 9.491   14.031  -57.277 1.00 48.94  ? 181  GLN B CA  1 
ATOM   5567 C C   . GLN B 1 181 ? 8.231   13.823  -58.138 1.00 48.38  ? 181  GLN B C   1 
ATOM   5568 O O   . GLN B 1 181 ? 7.718   14.766  -58.747 1.00 48.28  ? 181  GLN B O   1 
ATOM   5569 C CB  . GLN B 1 181 ? 10.753  13.578  -58.024 1.00 48.53  ? 181  GLN B CB  1 
ATOM   5570 C CG  . GLN B 1 181 ? 11.893  14.622  -58.114 1.00 51.24  ? 181  GLN B CG  1 
ATOM   5571 C CD  . GLN B 1 181 ? 13.345  13.997  -57.978 1.00 52.69  ? 181  GLN B CD  1 
ATOM   5572 O OE1 . GLN B 1 181 ? 13.623  12.862  -58.430 1.00 56.82  ? 181  GLN B OE1 1 
ATOM   5573 N NE2 . GLN B 1 181 ? 14.261  14.761  -57.351 1.00 56.38  ? 181  GLN B NE2 1 
ATOM   5574 N N   . TRP B 1 182 ? 7.714   12.597  -58.156 1.00 48.15  ? 182  TRP B N   1 
ATOM   5575 C CA  . TRP B 1 182 ? 6.564   12.279  -58.983 1.00 48.16  ? 182  TRP B CA  1 
ATOM   5576 C C   . TRP B 1 182 ? 5.351   13.122  -58.571 1.00 48.80  ? 182  TRP B C   1 
ATOM   5577 O O   . TRP B 1 182 ? 4.561   13.571  -59.414 1.00 48.74  ? 182  TRP B O   1 
ATOM   5578 C CB  . TRP B 1 182 ? 6.239   10.793  -58.877 1.00 47.65  ? 182  TRP B CB  1 
ATOM   5579 C CG  . TRP B 1 182 ? 5.098   10.350  -59.742 1.00 46.75  ? 182  TRP B CG  1 
ATOM   5580 C CD1 . TRP B 1 182 ? 5.173   9.897   -61.020 1.00 45.87  ? 182  TRP B CD1 1 
ATOM   5581 C CD2 . TRP B 1 182 ? 3.714   10.319  -59.386 1.00 46.51  ? 182  TRP B CD2 1 
ATOM   5582 N NE1 . TRP B 1 182 ? 3.926   9.584   -61.492 1.00 45.30  ? 182  TRP B NE1 1 
ATOM   5583 C CE2 . TRP B 1 182 ? 3.007   9.832   -60.511 1.00 46.29  ? 182  TRP B CE2 1 
ATOM   5584 C CE3 . TRP B 1 182 ? 2.999   10.656  -58.228 1.00 45.51  ? 182  TRP B CE3 1 
ATOM   5585 C CZ2 . TRP B 1 182 ? 1.618   9.670   -60.515 1.00 46.84  ? 182  TRP B CZ2 1 
ATOM   5586 C CZ3 . TRP B 1 182 ? 1.618   10.487  -58.227 1.00 45.97  ? 182  TRP B CZ3 1 
ATOM   5587 C CH2 . TRP B 1 182 ? 0.941   10.001  -59.366 1.00 46.71  ? 182  TRP B CH2 1 
ATOM   5588 N N   . VAL B 1 183 ? 5.218   13.326  -57.265 1.00 49.37  ? 183  VAL B N   1 
ATOM   5589 C CA  . VAL B 1 183 ? 4.114   14.082  -56.703 1.00 49.64  ? 183  VAL B CA  1 
ATOM   5590 C C   . VAL B 1 183 ? 4.238   15.558  -57.108 1.00 50.32  ? 183  VAL B C   1 
ATOM   5591 O O   . VAL B 1 183 ? 3.249   16.155  -57.512 1.00 50.42  ? 183  VAL B O   1 
ATOM   5592 C CB  . VAL B 1 183 ? 4.010   13.858  -55.170 1.00 49.42  ? 183  VAL B CB  1 
ATOM   5593 C CG1 . VAL B 1 183 ? 3.023   14.801  -54.526 1.00 48.93  ? 183  VAL B CG1 1 
ATOM   5594 C CG2 . VAL B 1 183 ? 3.603   12.431  -54.884 1.00 48.75  ? 183  VAL B CG2 1 
ATOM   5595 N N   . GLN B 1 184 ? 5.440   16.134  -57.046 1.00 51.06  ? 184  GLN B N   1 
ATOM   5596 C CA  . GLN B 1 184 ? 5.642   17.508  -57.545 1.00 52.06  ? 184  GLN B CA  1 
ATOM   5597 C C   . GLN B 1 184 ? 5.136   17.657  -58.972 1.00 52.70  ? 184  GLN B C   1 
ATOM   5598 O O   . GLN B 1 184 ? 4.453   18.628  -59.294 1.00 52.87  ? 184  GLN B O   1 
ATOM   5599 C CB  . GLN B 1 184 ? 7.115   17.949  -57.501 1.00 51.94  ? 184  GLN B CB  1 
ATOM   5600 C CG  . GLN B 1 184 ? 7.606   18.467  -56.170 1.00 52.22  ? 184  GLN B CG  1 
ATOM   5601 C CD  . GLN B 1 184 ? 6.591   19.341  -55.462 1.00 53.49  ? 184  GLN B CD  1 
ATOM   5602 O OE1 . GLN B 1 184 ? 6.328   20.472  -55.871 1.00 53.62  ? 184  GLN B OE1 1 
ATOM   5603 N NE2 . GLN B 1 184 ? 6.013   18.815  -54.385 1.00 54.32  ? 184  GLN B NE2 1 
ATOM   5604 N N   . GLU B 1 185 ? 5.468   16.676  -59.807 1.00 53.44  ? 185  GLU B N   1 
ATOM   5605 C CA  . GLU B 1 185 ? 5.168   16.705  -61.234 1.00 54.52  ? 185  GLU B CA  1 
ATOM   5606 C C   . GLU B 1 185 ? 3.736   16.336  -61.616 1.00 53.97  ? 185  GLU B C   1 
ATOM   5607 O O   . GLU B 1 185 ? 3.246   16.807  -62.632 1.00 54.23  ? 185  GLU B O   1 
ATOM   5608 C CB  . GLU B 1 185 ? 6.116   15.775  -61.986 1.00 54.40  ? 185  GLU B CB  1 
ATOM   5609 C CG  . GLU B 1 185 ? 7.561   16.238  -62.025 1.00 56.55  ? 185  GLU B CG  1 
ATOM   5610 C CD  . GLU B 1 185 ? 8.531   15.126  -62.443 1.00 56.94  ? 185  GLU B CD  1 
ATOM   5611 O OE1 . GLU B 1 185 ? 8.100   14.152  -63.121 1.00 59.95  ? 185  GLU B OE1 1 
ATOM   5612 O OE2 . GLU B 1 185 ? 9.730   15.233  -62.082 1.00 59.77  ? 185  GLU B OE2 1 
ATOM   5613 N N   . ASN B 1 186 ? 3.074   15.488  -60.835 1.00 53.70  ? 186  ASN B N   1 
ATOM   5614 C CA  . ASN B 1 186 ? 1.805   14.887  -61.279 1.00 53.64  ? 186  ASN B CA  1 
ATOM   5615 C C   . ASN B 1 186 ? 0.563   15.088  -60.400 1.00 53.23  ? 186  ASN B C   1 
ATOM   5616 O O   . ASN B 1 186 ? -0.560  14.922  -60.868 1.00 53.35  ? 186  ASN B O   1 
ATOM   5617 C CB  . ASN B 1 186 ? 2.001   13.388  -61.528 1.00 53.74  ? 186  ASN B CB  1 
ATOM   5618 C CG  . ASN B 1 186 ? 2.985   13.119  -62.633 1.00 54.69  ? 186  ASN B CG  1 
ATOM   5619 O OD1 . ASN B 1 186 ? 2.662   13.276  -63.811 1.00 55.79  ? 186  ASN B OD1 1 
ATOM   5620 N ND2 . ASN B 1 186 ? 4.202   12.721  -62.266 1.00 55.23  ? 186  ASN B ND2 1 
ATOM   5621 N N   . ILE B 1 187 ? 0.759   15.430  -59.134 1.00 52.74  ? 187  ILE B N   1 
ATOM   5622 C CA  . ILE B 1 187 ? -0.327  15.372  -58.164 1.00 52.02  ? 187  ILE B CA  1 
ATOM   5623 C C   . ILE B 1 187 ? -1.443  16.403  -58.421 1.00 52.13  ? 187  ILE B C   1 
ATOM   5624 O O   . ILE B 1 187 ? -2.605  16.162  -58.066 1.00 52.05  ? 187  ILE B O   1 
ATOM   5625 C CB  . ILE B 1 187 ? 0.204   15.432  -56.715 1.00 51.49  ? 187  ILE B CB  1 
ATOM   5626 C CG1 . ILE B 1 187 ? -0.757  14.718  -55.778 1.00 51.03  ? 187  ILE B CG1 1 
ATOM   5627 C CG2 . ILE B 1 187 ? 0.447   16.863  -56.272 1.00 51.23  ? 187  ILE B CG2 1 
ATOM   5628 C CD1 . ILE B 1 187 ? -0.721  13.217  -55.919 1.00 50.76  ? 187  ILE B CD1 1 
ATOM   5629 N N   . ALA B 1 188 ? -1.085  17.532  -59.046 1.00 51.83  ? 188  ALA B N   1 
ATOM   5630 C CA  . ALA B 1 188 ? -2.063  18.546  -59.455 1.00 51.37  ? 188  ALA B CA  1 
ATOM   5631 C C   . ALA B 1 188 ? -3.196  17.921  -60.261 1.00 51.01  ? 188  ALA B C   1 
ATOM   5632 O O   . ALA B 1 188 ? -4.360  18.123  -59.957 1.00 50.95  ? 188  ALA B O   1 
ATOM   5633 C CB  . ALA B 1 188 ? -1.394  19.639  -60.250 1.00 51.41  ? 188  ALA B CB  1 
ATOM   5634 N N   . ALA B 1 189 ? -2.833  17.129  -61.263 1.00 50.80  ? 189  ALA B N   1 
ATOM   5635 C CA  . ALA B 1 189 ? -3.787  16.434  -62.118 1.00 50.44  ? 189  ALA B CA  1 
ATOM   5636 C C   . ALA B 1 189 ? -4.836  15.621  -61.361 1.00 50.42  ? 189  ALA B C   1 
ATOM   5637 O O   . ALA B 1 189 ? -5.832  15.225  -61.961 1.00 50.81  ? 189  ALA B O   1 
ATOM   5638 C CB  . ALA B 1 189 ? -3.053  15.558  -63.113 1.00 50.25  ? 189  ALA B CB  1 
ATOM   5639 N N   . PHE B 1 190 ? -4.613  15.381  -60.065 1.00 50.18  ? 190  PHE B N   1 
ATOM   5640 C CA  . PHE B 1 190 ? -5.564  14.669  -59.197 1.00 49.97  ? 190  PHE B CA  1 
ATOM   5641 C C   . PHE B 1 190 ? -6.310  15.648  -58.267 1.00 50.57  ? 190  PHE B C   1 
ATOM   5642 O O   . PHE B 1 190 ? -7.243  15.264  -57.539 1.00 50.81  ? 190  PHE B O   1 
ATOM   5643 C CB  . PHE B 1 190 ? -4.830  13.651  -58.314 1.00 49.55  ? 190  PHE B CB  1 
ATOM   5644 C CG  . PHE B 1 190 ? -4.172  12.524  -59.062 1.00 48.65  ? 190  PHE B CG  1 
ATOM   5645 C CD1 . PHE B 1 190 ? -2.913  12.692  -59.644 1.00 47.00  ? 190  PHE B CD1 1 
ATOM   5646 C CD2 . PHE B 1 190 ? -4.792  11.269  -59.144 1.00 48.16  ? 190  PHE B CD2 1 
ATOM   5647 C CE1 . PHE B 1 190 ? -2.296  11.643  -60.323 1.00 46.21  ? 190  PHE B CE1 1 
ATOM   5648 C CE2 . PHE B 1 190 ? -4.185  10.209  -59.833 1.00 46.94  ? 190  PHE B CE2 1 
ATOM   5649 C CZ  . PHE B 1 190 ? -2.929  10.403  -60.416 1.00 47.45  ? 190  PHE B CZ  1 
ATOM   5650 N N   . GLY B 1 191 ? -5.874  16.905  -58.263 1.00 50.78  ? 191  GLY B N   1 
ATOM   5651 C CA  . GLY B 1 191 ? -6.442  17.913  -57.369 1.00 50.89  ? 191  GLY B CA  1 
ATOM   5652 C C   . GLY B 1 191 ? -5.563  18.192  -56.160 1.00 51.14  ? 191  GLY B C   1 
ATOM   5653 O O   . GLY B 1 191 ? -5.920  18.997  -55.289 1.00 51.38  ? 191  GLY B O   1 
ATOM   5654 N N   . GLY B 1 192 ? -4.414  17.518  -56.097 1.00 51.06  ? 192  GLY B N   1 
ATOM   5655 C CA  . GLY B 1 192 ? -3.437  17.751  -55.037 1.00 50.24  ? 192  GLY B CA  1 
ATOM   5656 C C   . GLY B 1 192 ? -2.746  19.080  -55.237 1.00 49.84  ? 192  GLY B C   1 
ATOM   5657 O O   . GLY B 1 192 ? -2.711  19.607  -56.348 1.00 49.56  ? 192  GLY B O   1 
ATOM   5658 N N   . ASP B 1 193 ? -2.210  19.624  -54.151 1.00 49.63  ? 193  ASP B N   1 
ATOM   5659 C CA  . ASP B 1 193 ? -1.440  20.854  -54.201 1.00 49.68  ? 193  ASP B CA  1 
ATOM   5660 C C   . ASP B 1 193 ? 0.038   20.537  -53.988 1.00 50.30  ? 193  ASP B C   1 
ATOM   5661 O O   . ASP B 1 193 ? 0.439   20.170  -52.884 1.00 50.91  ? 193  ASP B O   1 
ATOM   5662 C CB  . ASP B 1 193 ? -1.935  21.819  -53.127 1.00 49.34  ? 193  ASP B CB  1 
ATOM   5663 C CG  . ASP B 1 193 ? -1.253  23.170  -53.188 1.00 48.12  ? 193  ASP B CG  1 
ATOM   5664 O OD1 . ASP B 1 193 ? -0.699  23.523  -54.249 1.00 46.98  ? 193  ASP B OD1 1 
ATOM   5665 O OD2 . ASP B 1 193 ? -1.283  23.889  -52.171 1.00 46.54  ? 193  ASP B OD2 1 
ATOM   5666 N N   . PRO B 1 194 ? 0.863   20.678  -55.035 1.00 50.70  ? 194  PRO B N   1 
ATOM   5667 C CA  . PRO B 1 194 ? 2.266   20.351  -54.829 1.00 51.28  ? 194  PRO B CA  1 
ATOM   5668 C C   . PRO B 1 194 ? 2.925   21.323  -53.859 1.00 51.92  ? 194  PRO B C   1 
ATOM   5669 O O   . PRO B 1 194 ? 4.057   21.085  -53.429 1.00 52.36  ? 194  PRO B O   1 
ATOM   5670 C CB  . PRO B 1 194 ? 2.875   20.499  -56.226 1.00 51.30  ? 194  PRO B CB  1 
ATOM   5671 C CG  . PRO B 1 194 ? 1.959   21.427  -56.939 1.00 51.05  ? 194  PRO B CG  1 
ATOM   5672 C CD  . PRO B 1 194 ? 0.595   21.133  -56.410 1.00 50.67  ? 194  PRO B CD  1 
ATOM   5673 N N   . MET B 1 195 ? 2.213   22.394  -53.509 1.00 52.14  ? 195  MET B N   1 
ATOM   5674 C CA  . MET B 1 195 ? 2.739   23.424  -52.609 1.00 52.91  ? 195  MET B CA  1 
ATOM   5675 C C   . MET B 1 195 ? 2.379   23.189  -51.145 1.00 52.14  ? 195  MET B C   1 
ATOM   5676 O O   . MET B 1 195 ? 2.755   23.968  -50.259 1.00 51.85  ? 195  MET B O   1 
ATOM   5677 C CB  . MET B 1 195 ? 2.295   24.794  -53.073 1.00 52.38  ? 195  MET B CB  1 
ATOM   5678 C CG  . MET B 1 195 ? 2.578   24.976  -54.533 1.00 53.67  ? 195  MET B CG  1 
ATOM   5679 S SD  . MET B 1 195 ? 3.276   26.593  -54.871 1.00 56.30  ? 195  MET B SD  1 
ATOM   5680 C CE  . MET B 1 195 ? 1.834   27.663  -54.563 1.00 58.31  ? 195  MET B CE  1 
ATOM   5681 N N   . SER B 1 196 ? 1.685   22.081  -50.904 1.00 51.82  ? 196  SER B N   1 
ATOM   5682 C CA  . SER B 1 196 ? 1.284   21.687  -49.568 1.00 51.38  ? 196  SER B CA  1 
ATOM   5683 C C   . SER B 1 196 ? 1.415   20.171  -49.438 1.00 50.86  ? 196  SER B C   1 
ATOM   5684 O O   . SER B 1 196 ? 0.455   19.478  -49.088 1.00 51.40  ? 196  SER B O   1 
ATOM   5685 C CB  . SER B 1 196 ? -0.147  22.161  -49.273 1.00 51.47  ? 196  SER B CB  1 
ATOM   5686 O OG  . SER B 1 196 ? -0.453  22.116  -47.885 1.00 52.15  ? 196  SER B OG  1 
ATOM   5687 N N   . VAL B 1 197 ? 2.614   19.673  -49.732 1.00 49.81  ? 197  VAL B N   1 
ATOM   5688 C CA  . VAL B 1 197 ? 2.985   18.276  -49.489 1.00 48.73  ? 197  VAL B CA  1 
ATOM   5689 C C   . VAL B 1 197 ? 3.462   18.109  -48.056 1.00 47.77  ? 197  VAL B C   1 
ATOM   5690 O O   . VAL B 1 197 ? 4.390   18.788  -47.636 1.00 47.89  ? 197  VAL B O   1 
ATOM   5691 C CB  . VAL B 1 197 ? 4.151   17.841  -50.397 1.00 48.78  ? 197  VAL B CB  1 
ATOM   5692 C CG1 . VAL B 1 197 ? 4.645   16.487  -49.997 1.00 48.72  ? 197  VAL B CG1 1 
ATOM   5693 C CG2 . VAL B 1 197 ? 3.733   17.843  -51.856 1.00 49.22  ? 197  VAL B CG2 1 
ATOM   5694 N N   . THR B 1 198 ? 2.840   17.188  -47.327 1.00 46.63  ? 198  THR B N   1 
ATOM   5695 C CA  . THR B 1 198 ? 3.212   16.865  -45.949 1.00 45.66  ? 198  THR B CA  1 
ATOM   5696 C C   . THR B 1 198 ? 3.567   15.379  -45.876 1.00 44.75  ? 198  THR B C   1 
ATOM   5697 O O   . THR B 1 198 ? 2.788   14.544  -46.345 1.00 45.39  ? 198  THR B O   1 
ATOM   5698 C CB  . THR B 1 198 ? 2.023   17.125  -45.005 1.00 45.70  ? 198  THR B CB  1 
ATOM   5699 O OG1 . THR B 1 198 ? 1.204   18.170  -45.546 1.00 47.09  ? 198  THR B OG1 1 
ATOM   5700 C CG2 . THR B 1 198 ? 2.492   17.518  -43.642 1.00 44.86  ? 198  THR B CG2 1 
ATOM   5701 N N   . LEU B 1 199 ? 4.725   15.040  -45.313 1.00 43.27  ? 199  LEU B N   1 
ATOM   5702 C CA  . LEU B 1 199 ? 5.176   13.640  -45.269 1.00 42.00  ? 199  LEU B CA  1 
ATOM   5703 C C   . LEU B 1 199 ? 4.854   13.048  -43.935 1.00 41.70  ? 199  LEU B C   1 
ATOM   5704 O O   . LEU B 1 199 ? 5.159   13.646  -42.915 1.00 42.71  ? 199  LEU B O   1 
ATOM   5705 C CB  . LEU B 1 199 ? 6.691   13.526  -45.445 1.00 41.54  ? 199  LEU B CB  1 
ATOM   5706 C CG  . LEU B 1 199 ? 7.451   14.186  -46.593 1.00 41.10  ? 199  LEU B CG  1 
ATOM   5707 C CD1 . LEU B 1 199 ? 8.934   13.922  -46.419 1.00 39.90  ? 199  LEU B CD1 1 
ATOM   5708 C CD2 . LEU B 1 199 ? 6.964   13.705  -47.959 1.00 39.95  ? 199  LEU B CD2 1 
ATOM   5709 N N   . PHE B 1 200 ? 4.265   11.868  -43.896 1.00 40.82  ? 200  PHE B N   1 
ATOM   5710 C CA  . PHE B 1 200 ? 4.138   11.219  -42.601 1.00 40.18  ? 200  PHE B CA  1 
ATOM   5711 C C   . PHE B 1 200 ? 4.451   9.758   -42.718 1.00 40.40  ? 200  PHE B C   1 
ATOM   5712 O O   . PHE B 1 200 ? 4.257   9.167   -43.781 1.00 40.47  ? 200  PHE B O   1 
ATOM   5713 C CB  . PHE B 1 200 ? 2.784   11.503  -41.934 1.00 39.77  ? 200  PHE B CB  1 
ATOM   5714 C CG  . PHE B 1 200 ? 1.592   10.858  -42.601 1.00 38.82  ? 200  PHE B CG  1 
ATOM   5715 C CD1 . PHE B 1 200 ? 1.379   10.965  -43.974 1.00 37.42  ? 200  PHE B CD1 1 
ATOM   5716 C CD2 . PHE B 1 200 ? 0.645   10.193  -41.830 1.00 37.77  ? 200  PHE B CD2 1 
ATOM   5717 C CE1 . PHE B 1 200 ? 0.273   10.381  -44.569 1.00 37.04  ? 200  PHE B CE1 1 
ATOM   5718 C CE2 . PHE B 1 200 ? -0.475  9.620   -42.414 1.00 38.38  ? 200  PHE B CE2 1 
ATOM   5719 C CZ  . PHE B 1 200 ? -0.666  9.719   -43.788 1.00 38.19  ? 200  PHE B CZ  1 
ATOM   5720 N N   . GLY B 1 201 ? 4.978   9.194   -41.635 1.00 40.66  ? 201  GLY B N   1 
ATOM   5721 C CA  . GLY B 1 201 ? 5.467   7.817   -41.612 1.00 40.90  ? 201  GLY B CA  1 
ATOM   5722 C C   . GLY B 1 201 ? 5.683   7.359   -40.191 1.00 41.44  ? 201  GLY B C   1 
ATOM   5723 O O   . GLY B 1 201 ? 5.874   8.182   -39.279 1.00 41.85  ? 201  GLY B O   1 
ATOM   5724 N N   . GLU B 1 202 ? 5.651   6.049   -39.991 1.00 41.53  ? 202  GLU B N   1 
ATOM   5725 C CA  . GLU B 1 202 ? 5.866   5.466   -38.668 1.00 42.30  ? 202  GLU B CA  1 
ATOM   5726 C C   . GLU B 1 202 ? 7.164   4.625   -38.642 1.00 42.45  ? 202  GLU B C   1 
ATOM   5727 O O   . GLU B 1 202 ? 7.595   4.113   -39.668 1.00 42.44  ? 202  GLU B O   1 
ATOM   5728 C CB  . GLU B 1 202 ? 4.626   4.658   -38.280 1.00 42.52  ? 202  GLU B CB  1 
ATOM   5729 C CG  . GLU B 1 202 ? 4.497   4.267   -36.834 1.00 44.47  ? 202  GLU B CG  1 
ATOM   5730 C CD  . GLU B 1 202 ? 5.011   2.852   -36.562 1.00 48.80  ? 202  GLU B CD  1 
ATOM   5731 O OE1 . GLU B 1 202 ? 5.462   2.178   -37.528 1.00 49.09  ? 202  GLU B OE1 1 
ATOM   5732 O OE2 . GLU B 1 202 ? 4.969   2.418   -35.372 1.00 51.07  ? 202  GLU B OE2 1 
HETATM 5733 N N   . SVZ B 1 203 ? 7.805   4.527   -37.477 1.00 43.03  ? 203  SVZ B N   1 
HETATM 5734 C CA  . SVZ B 1 203 ? 9.046   3.751   -37.296 1.00 43.42  ? 203  SVZ B CA  1 
HETATM 5735 C C   . SVZ B 1 203 ? 10.122  4.050   -38.375 1.00 43.14  ? 203  SVZ B C   1 
HETATM 5736 O O   . SVZ B 1 203 ? 10.572  5.194   -38.503 1.00 43.16  ? 203  SVZ B O   1 
HETATM 5737 C CB  . SVZ B 1 203 ? 8.704   2.258   -37.209 1.00 43.57  ? 203  SVZ B CB  1 
HETATM 5738 O OG  . SVZ B 1 203 ? 9.809   1.481   -36.778 1.00 46.76  ? 203  SVZ B OG  1 
HETATM 5739 O O4  . SVZ B 1 203 ? 9.945   0.253   -38.492 1.00 54.17  ? 203  SVZ B O4  1 
HETATM 5740 P P1  . SVZ B 1 203 ? 9.959   -0.088  -37.013 1.00 53.95  ? 203  SVZ B P1  1 
HETATM 5741 O O2  . SVZ B 1 203 ? 9.351   -1.376  -36.500 1.00 53.16  ? 203  SVZ B O2  1 
HETATM 5742 N N3  . SVZ B 1 203 ? 11.662  -0.041  -36.615 1.00 55.72  ? 203  SVZ B N3  1 
HETATM 5743 C C5  . SVZ B 1 203 ? 12.160  -0.402  -35.304 1.00 57.11  ? 203  SVZ B C5  1 
HETATM 5744 C C7  . SVZ B 1 203 ? 13.628  -0.755  -35.444 1.00 57.43  ? 203  SVZ B C7  1 
HETATM 5745 C C6  . SVZ B 1 203 ? 12.038  0.752   -34.316 1.00 56.88  ? 203  SVZ B C6  1 
ATOM   5746 N N   . ALA B 1 204 ? 10.526  3.044   -39.159 1.00 42.68  ? 204  ALA B N   1 
ATOM   5747 C CA  . ALA B 1 204 ? 11.475  3.275   -40.259 1.00 41.96  ? 204  ALA B CA  1 
ATOM   5748 C C   . ALA B 1 204 ? 10.955  4.353   -41.223 1.00 41.68  ? 204  ALA B C   1 
ATOM   5749 O O   . ALA B 1 204 ? 11.745  5.153   -41.748 1.00 41.19  ? 204  ALA B O   1 
ATOM   5750 C CB  . ALA B 1 204 ? 11.778  1.986   -40.999 1.00 41.76  ? 204  ALA B CB  1 
ATOM   5751 N N   . GLY B 1 205 ? 9.629   4.360   -41.439 1.00 41.03  ? 205  GLY B N   1 
ATOM   5752 C CA  . GLY B 1 205 ? 8.947   5.413   -42.192 1.00 40.36  ? 205  GLY B CA  1 
ATOM   5753 C C   . GLY B 1 205 ? 9.151   6.787   -41.555 1.00 40.06  ? 205  GLY B C   1 
ATOM   5754 O O   . GLY B 1 205 ? 9.385   7.788   -42.251 1.00 39.89  ? 205  GLY B O   1 
ATOM   5755 N N   . ALA B 1 206 ? 9.088   6.834   -40.227 1.00 39.26  ? 206  ALA B N   1 
ATOM   5756 C CA  . ALA B 1 206 ? 9.411   8.055   -39.522 1.00 38.78  ? 206  ALA B CA  1 
ATOM   5757 C C   . ALA B 1 206 ? 10.866  8.463   -39.794 1.00 38.55  ? 206  ALA B C   1 
ATOM   5758 O O   . ALA B 1 206 ? 11.104  9.578   -40.245 1.00 38.30  ? 206  ALA B O   1 
ATOM   5759 C CB  . ALA B 1 206 ? 9.134   7.911   -38.046 1.00 38.78  ? 206  ALA B CB  1 
ATOM   5760 N N   . ALA B 1 207 ? 11.820  7.552   -39.573 1.00 38.21  ? 207  ALA B N   1 
ATOM   5761 C CA  . ALA B 1 207 ? 13.241  7.830   -39.835 1.00 38.01  ? 207  ALA B CA  1 
ATOM   5762 C C   . ALA B 1 207 ? 13.505  8.293   -41.272 1.00 38.05  ? 207  ALA B C   1 
ATOM   5763 O O   . ALA B 1 207 ? 14.329  9.193   -41.529 1.00 37.91  ? 207  ALA B O   1 
ATOM   5764 C CB  . ALA B 1 207 ? 14.066  6.623   -39.528 1.00 38.22  ? 207  ALA B CB  1 
ATOM   5765 N N   . SER B 1 208 ? 12.794  7.676   -42.210 1.00 37.89  ? 208  SER B N   1 
ATOM   5766 C CA  . SER B 1 208 ? 12.902  8.058   -43.602 1.00 37.49  ? 208  SER B CA  1 
ATOM   5767 C C   . SER B 1 208 ? 12.412  9.477   -43.729 1.00 37.39  ? 208  SER B C   1 
ATOM   5768 O O   . SER B 1 208 ? 13.116  10.313  -44.276 1.00 37.93  ? 208  SER B O   1 
ATOM   5769 C CB  . SER B 1 208 ? 12.079  7.136   -44.480 1.00 37.55  ? 208  SER B CB  1 
ATOM   5770 O OG  . SER B 1 208 ? 12.260  5.781   -44.102 1.00 38.06  ? 208  SER B OG  1 
ATOM   5771 N N   . VAL B 1 209 ? 11.225  9.771   -43.199 1.00 36.80  ? 209  VAL B N   1 
ATOM   5772 C CA  . VAL B 1 209 ? 10.736  11.151  -43.219 1.00 36.30  ? 209  VAL B CA  1 
ATOM   5773 C C   . VAL B 1 209 ? 11.861  12.052  -42.714 1.00 36.91  ? 209  VAL B C   1 
ATOM   5774 O O   . VAL B 1 209 ? 12.220  13.023  -43.363 1.00 36.97  ? 209  VAL B O   1 
ATOM   5775 C CB  . VAL B 1 209 ? 9.444   11.340  -42.378 1.00 35.76  ? 209  VAL B CB  1 
ATOM   5776 C CG1 . VAL B 1 209 ? 9.269   12.767  -41.977 1.00 34.91  ? 209  VAL B CG1 1 
ATOM   5777 C CG2 . VAL B 1 209 ? 8.243   10.887  -43.143 1.00 34.44  ? 209  VAL B CG2 1 
ATOM   5778 N N   . GLY B 1 210 ? 12.452  11.681  -41.580 1.00 37.55  ? 210  GLY B N   1 
ATOM   5779 C CA  . GLY B 1 210 ? 13.488  12.481  -40.945 1.00 38.54  ? 210  GLY B CA  1 
ATOM   5780 C C   . GLY B 1 210 ? 14.727  12.624  -41.807 1.00 39.29  ? 210  GLY B C   1 
ATOM   5781 O O   . GLY B 1 210 ? 15.379  13.669  -41.806 1.00 39.26  ? 210  GLY B O   1 
ATOM   5782 N N   . MET B 1 211 ? 15.048  11.574  -42.554 1.00 39.72  ? 211  MET B N   1 
ATOM   5783 C CA  . MET B 1 211 ? 16.155  11.646  -43.494 1.00 40.56  ? 211  MET B CA  1 
ATOM   5784 C C   . MET B 1 211 ? 15.909  12.579  -44.676 1.00 40.56  ? 211  MET B C   1 
ATOM   5785 O O   . MET B 1 211 ? 16.836  13.195  -45.212 1.00 41.04  ? 211  MET B O   1 
ATOM   5786 C CB  . MET B 1 211 ? 16.561  10.259  -43.930 1.00 40.29  ? 211  MET B CB  1 
ATOM   5787 C CG  . MET B 1 211 ? 17.371  9.652   -42.836 1.00 40.96  ? 211  MET B CG  1 
ATOM   5788 S SD  . MET B 1 211 ? 17.596  7.911   -43.008 1.00 42.11  ? 211  MET B SD  1 
ATOM   5789 C CE  . MET B 1 211 ? 17.594  7.431   -41.283 1.00 41.56  ? 211  MET B CE  1 
ATOM   5790 N N   . HIS B 1 212 ? 14.653  12.714  -45.067 1.00 40.59  ? 212  HIS B N   1 
ATOM   5791 C CA  . HIS B 1 212 ? 14.335  13.660  -46.105 1.00 40.21  ? 212  HIS B CA  1 
ATOM   5792 C C   . HIS B 1 212 ? 14.434  15.057  -45.549 1.00 40.55  ? 212  HIS B C   1 
ATOM   5793 O O   . HIS B 1 212 ? 14.717  15.991  -46.294 1.00 40.92  ? 212  HIS B O   1 
ATOM   5794 C CB  . HIS B 1 212 ? 12.969  13.378  -46.683 1.00 39.88  ? 212  HIS B CB  1 
ATOM   5795 C CG  . HIS B 1 212 ? 12.902  12.084  -47.424 1.00 37.87  ? 212  HIS B CG  1 
ATOM   5796 N ND1 . HIS B 1 212 ? 13.373  11.945  -48.709 1.00 35.14  ? 212  HIS B ND1 1 
ATOM   5797 C CD2 . HIS B 1 212 ? 12.431  10.869  -47.057 1.00 36.14  ? 212  HIS B CD2 1 
ATOM   5798 C CE1 . HIS B 1 212 ? 13.196  10.695  -49.104 1.00 35.37  ? 212  HIS B CE1 1 
ATOM   5799 N NE2 . HIS B 1 212 ? 12.621  10.024  -48.122 1.00 35.60  ? 212  HIS B NE2 1 
ATOM   5800 N N   . ILE B 1 213 ? 14.237  15.200  -44.241 1.00 40.69  ? 213  ILE B N   1 
ATOM   5801 C CA  . ILE B 1 213 ? 14.454  16.494  -43.599 1.00 41.27  ? 213  ILE B CA  1 
ATOM   5802 C C   . ILE B 1 213 ? 15.948  16.831  -43.618 1.00 41.93  ? 213  ILE B C   1 
ATOM   5803 O O   . ILE B 1 213 ? 16.348  17.981  -43.819 1.00 41.90  ? 213  ILE B O   1 
ATOM   5804 C CB  . ILE B 1 213 ? 13.880  16.548  -42.162 1.00 41.26  ? 213  ILE B CB  1 
ATOM   5805 C CG1 . ILE B 1 213 ? 12.353  16.386  -42.193 1.00 41.14  ? 213  ILE B CG1 1 
ATOM   5806 C CG2 . ILE B 1 213 ? 14.236  17.877  -41.477 1.00 40.68  ? 213  ILE B CG2 1 
ATOM   5807 C CD1 . ILE B 1 213 ? 11.703  16.241  -40.833 1.00 40.79  ? 213  ILE B CD1 1 
ATOM   5808 N N   . LEU B 1 214 ? 16.767  15.802  -43.457 1.00 42.86  ? 214  LEU B N   1 
ATOM   5809 C CA  . LEU B 1 214 ? 18.209  15.975  -43.326 1.00 43.22  ? 214  LEU B CA  1 
ATOM   5810 C C   . LEU B 1 214 ? 18.929  15.900  -44.659 1.00 44.03  ? 214  LEU B C   1 
ATOM   5811 O O   . LEU B 1 214 ? 20.158  16.014  -44.702 1.00 43.93  ? 214  LEU B O   1 
ATOM   5812 C CB  . LEU B 1 214 ? 18.779  14.948  -42.343 1.00 42.71  ? 214  LEU B CB  1 
ATOM   5813 C CG  . LEU B 1 214 ? 18.260  15.056  -40.906 1.00 41.33  ? 214  LEU B CG  1 
ATOM   5814 C CD1 . LEU B 1 214 ? 18.865  13.992  -40.051 1.00 39.93  ? 214  LEU B CD1 1 
ATOM   5815 C CD2 . LEU B 1 214 ? 18.543  16.419  -40.317 1.00 40.55  ? 214  LEU B CD2 1 
ATOM   5816 N N   . SER B 1 215 ? 18.170  15.719  -45.743 1.00 44.93  ? 215  SER B N   1 
ATOM   5817 C CA  . SER B 1 215 ? 18.783  15.680  -47.069 1.00 46.24  ? 215  SER B CA  1 
ATOM   5818 C C   . SER B 1 215 ? 18.346  16.813  -48.006 1.00 47.02  ? 215  SER B C   1 
ATOM   5819 O O   . SER B 1 215 ? 17.185  16.926  -48.382 1.00 47.10  ? 215  SER B O   1 
ATOM   5820 C CB  . SER B 1 215 ? 18.595  14.324  -47.726 1.00 46.16  ? 215  SER B CB  1 
ATOM   5821 O OG  . SER B 1 215 ? 19.420  14.232  -48.868 1.00 46.84  ? 215  SER B OG  1 
ATOM   5822 N N   . LEU B 1 216 ? 19.304  17.645  -48.388 1.00 48.16  ? 216  LEU B N   1 
ATOM   5823 C CA  . LEU B 1 216 ? 19.002  18.853  -49.138 1.00 49.17  ? 216  LEU B CA  1 
ATOM   5824 C C   . LEU B 1 216 ? 18.171  18.654  -50.421 1.00 49.36  ? 216  LEU B C   1 
ATOM   5825 O O   . LEU B 1 216 ? 17.179  19.365  -50.606 1.00 49.78  ? 216  LEU B O   1 
ATOM   5826 C CB  . LEU B 1 216 ? 20.277  19.637  -49.437 1.00 49.69  ? 216  LEU B CB  1 
ATOM   5827 C CG  . LEU B 1 216 ? 20.133  21.109  -49.057 1.00 51.53  ? 216  LEU B CG  1 
ATOM   5828 C CD1 . LEU B 1 216 ? 20.870  21.393  -47.704 1.00 52.34  ? 216  LEU B CD1 1 
ATOM   5829 C CD2 . LEU B 1 216 ? 20.623  22.009  -50.212 1.00 52.07  ? 216  LEU B CD2 1 
ATOM   5830 N N   . PRO B 1 217 ? 18.564  17.710  -51.316 1.00 49.37  ? 217  PRO B N   1 
ATOM   5831 C CA  . PRO B 1 217 ? 17.730  17.478  -52.510 1.00 49.27  ? 217  PRO B CA  1 
ATOM   5832 C C   . PRO B 1 217 ? 16.254  17.123  -52.223 1.00 49.52  ? 217  PRO B C   1 
ATOM   5833 O O   . PRO B 1 217 ? 15.396  17.491  -53.021 1.00 50.24  ? 217  PRO B O   1 
ATOM   5834 C CB  . PRO B 1 217 ? 18.421  16.307  -53.207 1.00 49.02  ? 217  PRO B CB  1 
ATOM   5835 C CG  . PRO B 1 217 ? 19.802  16.333  -52.714 1.00 48.99  ? 217  PRO B CG  1 
ATOM   5836 C CD  . PRO B 1 217 ? 19.751  16.834  -51.314 1.00 49.24  ? 217  PRO B CD  1 
ATOM   5837 N N   . SER B 1 218 ? 15.961  16.433  -51.111 1.00 49.18  ? 218  SER B N   1 
ATOM   5838 C CA  . SER B 1 218 ? 14.578  16.128  -50.714 1.00 48.80  ? 218  SER B CA  1 
ATOM   5839 C C   . SER B 1 218 ? 13.779  17.363  -50.287 1.00 49.33  ? 218  SER B C   1 
ATOM   5840 O O   . SER B 1 218 ? 12.558  17.424  -50.492 1.00 49.15  ? 218  SER B O   1 
ATOM   5841 C CB  . SER B 1 218 ? 14.538  15.108  -49.578 1.00 48.53  ? 218  SER B CB  1 
ATOM   5842 O OG  . SER B 1 218 ? 14.727  13.793  -50.044 1.00 47.38  ? 218  SER B OG  1 
ATOM   5843 N N   . ARG B 1 219 ? 14.467  18.340  -49.699 1.00 49.75  ? 219  ARG B N   1 
ATOM   5844 C CA  . ARG B 1 219 ? 13.797  19.451  -49.023 1.00 50.39  ? 219  ARG B CA  1 
ATOM   5845 C C   . ARG B 1 219 ? 12.805  20.246  -49.882 1.00 50.35  ? 219  ARG B C   1 
ATOM   5846 O O   . ARG B 1 219 ? 11.751  20.691  -49.395 1.00 50.59  ? 219  ARG B O   1 
ATOM   5847 C CB  . ARG B 1 219 ? 14.805  20.385  -48.350 1.00 50.62  ? 219  ARG B CB  1 
ATOM   5848 C CG  . ARG B 1 219 ? 15.409  19.844  -47.047 1.00 52.92  ? 219  ARG B CG  1 
ATOM   5849 C CD  . ARG B 1 219 ? 14.387  19.703  -45.892 1.00 56.55  ? 219  ARG B CD  1 
ATOM   5850 N NE  . ARG B 1 219 ? 14.081  20.971  -45.226 1.00 59.16  ? 219  ARG B NE  1 
ATOM   5851 C CZ  . ARG B 1 219 ? 14.893  21.588  -44.366 1.00 61.52  ? 219  ARG B CZ  1 
ATOM   5852 N NH1 . ARG B 1 219 ? 16.078  21.058  -44.063 1.00 62.87  ? 219  ARG B NH1 1 
ATOM   5853 N NH2 . ARG B 1 219 ? 14.531  22.747  -43.812 1.00 61.69  ? 219  ARG B NH2 1 
ATOM   5854 N N   . SER B 1 220 ? 13.112  20.419  -51.157 1.00 49.98  ? 220  SER B N   1 
ATOM   5855 C CA  . SER B 1 220 ? 12.199  21.188  -52.001 1.00 49.57  ? 220  SER B CA  1 
ATOM   5856 C C   . SER B 1 220 ? 11.014  20.345  -52.489 1.00 48.52  ? 220  SER B C   1 
ATOM   5857 O O   . SER B 1 220 ? 10.322  20.745  -53.423 1.00 48.39  ? 220  SER B O   1 
ATOM   5858 C CB  . SER B 1 220 ? 12.958  21.809  -53.186 1.00 50.02  ? 220  SER B CB  1 
ATOM   5859 O OG  . SER B 1 220 ? 13.576  20.793  -53.977 1.00 51.82  ? 220  SER B OG  1 
ATOM   5860 N N   . LEU B 1 221 ? 10.787  19.184  -51.873 1.00 47.45  ? 221  LEU B N   1 
ATOM   5861 C CA  . LEU B 1 221 ? 9.737   18.262  -52.337 1.00 46.36  ? 221  LEU B CA  1 
ATOM   5862 C C   . LEU B 1 221 ? 8.596   18.109  -51.348 1.00 45.75  ? 221  LEU B C   1 
ATOM   5863 O O   . LEU B 1 221 ? 7.593   17.472  -51.651 1.00 45.79  ? 221  LEU B O   1 
ATOM   5864 C CB  . LEU B 1 221 ? 10.314  16.887  -52.668 1.00 46.29  ? 221  LEU B CB  1 
ATOM   5865 C CG  . LEU B 1 221 ? 11.402  16.772  -53.735 1.00 45.97  ? 221  LEU B CG  1 
ATOM   5866 C CD1 . LEU B 1 221 ? 11.996  15.367  -53.683 1.00 46.05  ? 221  LEU B CD1 1 
ATOM   5867 C CD2 . LEU B 1 221 ? 10.853  17.055  -55.116 1.00 45.08  ? 221  LEU B CD2 1 
ATOM   5868 N N   . PHE B 1 222 ? 8.766   18.688  -50.163 1.00 45.14  ? 222  PHE B N   1 
ATOM   5869 C CA  . PHE B 1 222 ? 7.737   18.711  -49.129 1.00 44.22  ? 222  PHE B CA  1 
ATOM   5870 C C   . PHE B 1 222 ? 7.852   19.958  -48.266 1.00 43.67  ? 222  PHE B C   1 
ATOM   5871 O O   . PHE B 1 222 ? 8.792   20.734  -48.397 1.00 43.55  ? 222  PHE B O   1 
ATOM   5872 C CB  . PHE B 1 222 ? 7.804   17.453  -48.268 1.00 44.21  ? 222  PHE B CB  1 
ATOM   5873 C CG  . PHE B 1 222 ? 9.081   17.299  -47.500 1.00 44.46  ? 222  PHE B CG  1 
ATOM   5874 C CD1 . PHE B 1 222 ? 10.274  16.955  -48.150 1.00 44.54  ? 222  PHE B CD1 1 
ATOM   5875 C CD2 . PHE B 1 222 ? 9.091   17.457  -46.115 1.00 44.43  ? 222  PHE B CD2 1 
ATOM   5876 C CE1 . PHE B 1 222 ? 11.464  16.792  -47.432 1.00 44.16  ? 222  PHE B CE1 1 
ATOM   5877 C CE2 . PHE B 1 222 ? 10.271  17.288  -45.384 1.00 44.16  ? 222  PHE B CE2 1 
ATOM   5878 C CZ  . PHE B 1 222 ? 11.463  16.955  -46.045 1.00 44.34  ? 222  PHE B CZ  1 
ATOM   5879 N N   . HIS B 1 223 ? 6.885   20.144  -47.380 1.00 43.17  ? 223  HIS B N   1 
ATOM   5880 C CA  . HIS B 1 223 ? 6.775   21.378  -46.626 1.00 42.68  ? 223  HIS B CA  1 
ATOM   5881 C C   . HIS B 1 223 ? 6.718   21.144  -45.117 1.00 42.35  ? 223  HIS B C   1 
ATOM   5882 O O   . HIS B 1 223 ? 7.179   21.980  -44.332 1.00 42.87  ? 223  HIS B O   1 
ATOM   5883 C CB  . HIS B 1 223 ? 5.559   22.165  -47.105 1.00 42.45  ? 223  HIS B CB  1 
ATOM   5884 C CG  . HIS B 1 223 ? 5.466   22.268  -48.598 1.00 42.94  ? 223  HIS B CG  1 
ATOM   5885 N ND1 . HIS B 1 223 ? 6.005   23.320  -49.310 1.00 42.52  ? 223  HIS B ND1 1 
ATOM   5886 C CD2 . HIS B 1 223 ? 4.907   21.442  -49.515 1.00 42.78  ? 223  HIS B CD2 1 
ATOM   5887 C CE1 . HIS B 1 223 ? 5.770   23.145  -50.599 1.00 42.47  ? 223  HIS B CE1 1 
ATOM   5888 N NE2 . HIS B 1 223 ? 5.105   22.013  -50.750 1.00 42.49  ? 223  HIS B NE2 1 
ATOM   5889 N N   . ARG B 1 224 ? 6.157   20.010  -44.712 1.00 41.39  ? 224  ARG B N   1 
ATOM   5890 C CA  . ARG B 1 224 ? 6.000   19.683  -43.298 1.00 40.38  ? 224  ARG B CA  1 
ATOM   5891 C C   . ARG B 1 224 ? 6.267   18.192  -43.119 1.00 39.22  ? 224  ARG B C   1 
ATOM   5892 O O   . ARG B 1 224 ? 6.392   17.468  -44.099 1.00 39.11  ? 224  ARG B O   1 
ATOM   5893 C CB  . ARG B 1 224 ? 4.587   20.054  -42.828 1.00 40.71  ? 224  ARG B CB  1 
ATOM   5894 C CG  . ARG B 1 224 ? 4.366   21.537  -42.635 1.00 42.13  ? 224  ARG B CG  1 
ATOM   5895 C CD  . ARG B 1 224 ? 2.883   21.891  -42.542 1.00 45.80  ? 224  ARG B CD  1 
ATOM   5896 N NE  . ARG B 1 224 ? 2.240   22.004  -43.852 1.00 48.07  ? 224  ARG B NE  1 
ATOM   5897 C CZ  . ARG B 1 224 ? 2.484   22.968  -44.741 1.00 49.24  ? 224  ARG B CZ  1 
ATOM   5898 N NH1 . ARG B 1 224 ? 3.371   23.927  -44.486 1.00 50.27  ? 224  ARG B NH1 1 
ATOM   5899 N NH2 . ARG B 1 224 ? 1.849   22.968  -45.905 1.00 49.79  ? 224  ARG B NH2 1 
ATOM   5900 N N   . ALA B 1 225 ? 6.358   17.731  -41.879 1.00 37.97  ? 225  ALA B N   1 
ATOM   5901 C CA  . ALA B 1 225 ? 6.656   16.332  -41.626 1.00 36.97  ? 225  ALA B CA  1 
ATOM   5902 C C   . ALA B 1 225 ? 6.075   15.858  -40.303 1.00 36.49  ? 225  ALA B C   1 
ATOM   5903 O O   . ALA B 1 225 ? 5.857   16.647  -39.386 1.00 36.77  ? 225  ALA B O   1 
ATOM   5904 C CB  . ALA B 1 225 ? 8.145   16.100  -41.656 1.00 36.97  ? 225  ALA B CB  1 
ATOM   5905 N N   . VAL B 1 226 ? 5.817   14.559  -40.221 1.00 35.41  ? 226  VAL B N   1 
ATOM   5906 C CA  . VAL B 1 226 ? 5.236   13.948  -39.051 1.00 34.18  ? 226  VAL B CA  1 
ATOM   5907 C C   . VAL B 1 226 ? 6.069   12.710  -38.915 1.00 34.36  ? 226  VAL B C   1 
ATOM   5908 O O   . VAL B 1 226 ? 6.233   11.976  -39.889 1.00 34.65  ? 226  VAL B O   1 
ATOM   5909 C CB  . VAL B 1 226 ? 3.762   13.538  -39.302 1.00 34.10  ? 226  VAL B CB  1 
ATOM   5910 C CG1 . VAL B 1 226 ? 3.083   13.047  -38.026 1.00 32.00  ? 226  VAL B CG1 1 
ATOM   5911 C CG2 . VAL B 1 226 ? 2.981   14.672  -39.942 1.00 33.08  ? 226  VAL B CG2 1 
ATOM   5912 N N   . LEU B 1 227 ? 6.629   12.492  -37.733 1.00 34.32  ? 227  LEU B N   1 
ATOM   5913 C CA  . LEU B 1 227 ? 7.478   11.337  -37.486 1.00 34.57  ? 227  LEU B CA  1 
ATOM   5914 C C   . LEU B 1 227 ? 6.858   10.643  -36.311 1.00 35.45  ? 227  LEU B C   1 
ATOM   5915 O O   . LEU B 1 227 ? 6.963   11.110  -35.177 1.00 35.75  ? 227  LEU B O   1 
ATOM   5916 C CB  . LEU B 1 227 ? 8.912   11.748  -37.138 1.00 34.12  ? 227  LEU B CB  1 
ATOM   5917 C CG  . LEU B 1 227 ? 9.819   12.396  -38.180 1.00 33.42  ? 227  LEU B CG  1 
ATOM   5918 C CD1 . LEU B 1 227 ? 9.481   13.849  -38.399 1.00 32.37  ? 227  LEU B CD1 1 
ATOM   5919 C CD2 . LEU B 1 227 ? 11.256  12.295  -37.731 1.00 34.36  ? 227  LEU B CD2 1 
ATOM   5920 N N   . GLN B 1 228 ? 6.169   9.546   -36.575 1.00 36.42  ? 228  GLN B N   1 
ATOM   5921 C CA  . GLN B 1 228 ? 5.525   8.831   -35.506 1.00 37.39  ? 228  GLN B CA  1 
ATOM   5922 C C   . GLN B 1 228 ? 6.431   7.671   -35.129 1.00 38.37  ? 228  GLN B C   1 
ATOM   5923 O O   . GLN B 1 228 ? 6.780   6.859   -35.981 1.00 38.80  ? 228  GLN B O   1 
ATOM   5924 C CB  . GLN B 1 228 ? 4.175   8.304   -35.964 1.00 37.44  ? 228  GLN B CB  1 
ATOM   5925 C CG  . GLN B 1 228 ? 3.285   9.293   -36.695 1.00 37.26  ? 228  GLN B CG  1 
ATOM   5926 C CD  . GLN B 1 228 ? 2.107   8.594   -37.377 1.00 37.54  ? 228  GLN B CD  1 
ATOM   5927 O OE1 . GLN B 1 228 ? 1.499   9.128   -38.310 1.00 36.72  ? 228  GLN B OE1 1 
ATOM   5928 N NE2 . GLN B 1 228 ? 1.788   7.380   -36.909 1.00 38.04  ? 228  GLN B NE2 1 
ATOM   5929 N N   . SER B 1 229 ? 6.824   7.615   -33.861 1.00 39.14  ? 229  SER B N   1 
ATOM   5930 C CA  . SER B 1 229 ? 7.602   6.508   -33.290 1.00 39.94  ? 229  SER B CA  1 
ATOM   5931 C C   . SER B 1 229 ? 8.887   6.127   -34.019 1.00 40.57  ? 229  SER B C   1 
ATOM   5932 O O   . SER B 1 229 ? 9.246   4.944   -34.046 1.00 40.86  ? 229  SER B O   1 
ATOM   5933 C CB  . SER B 1 229 ? 6.726   5.268   -33.102 1.00 40.07  ? 229  SER B CB  1 
ATOM   5934 O OG  . SER B 1 229 ? 5.717   5.495   -32.129 1.00 41.30  ? 229  SER B OG  1 
ATOM   5935 N N   . GLY B 1 230 ? 9.588   7.115   -34.584 1.00 40.92  ? 230  GLY B N   1 
ATOM   5936 C CA  . GLY B 1 230 ? 10.899  6.868   -35.208 1.00 41.21  ? 230  GLY B CA  1 
ATOM   5937 C C   . GLY B 1 230 ? 11.671  8.142   -35.499 1.00 41.55  ? 230  GLY B C   1 
ATOM   5938 O O   . GLY B 1 230 ? 11.093  9.240   -35.483 1.00 41.59  ? 230  GLY B O   1 
ATOM   5939 N N   . THR B 1 231 ? 12.969  7.994   -35.784 1.00 41.61  ? 231  THR B N   1 
ATOM   5940 C CA  . THR B 1 231 ? 13.898  9.136   -35.929 1.00 41.69  ? 231  THR B CA  1 
ATOM   5941 C C   . THR B 1 231 ? 15.113  8.776   -36.782 1.00 41.54  ? 231  THR B C   1 
ATOM   5942 O O   . THR B 1 231 ? 15.500  7.619   -36.838 1.00 41.50  ? 231  THR B O   1 
ATOM   5943 C CB  . THR B 1 231 ? 14.466  9.580   -34.554 1.00 41.81  ? 231  THR B CB  1 
ATOM   5944 O OG1 . THR B 1 231 ? 15.223  8.508   -33.980 1.00 42.35  ? 231  THR B OG1 1 
ATOM   5945 C CG2 . THR B 1 231 ? 13.372  9.977   -33.579 1.00 41.68  ? 231  THR B CG2 1 
ATOM   5946 N N   . PRO B 1 232 ? 15.743  9.766   -37.429 1.00 41.75  ? 232  PRO B N   1 
ATOM   5947 C CA  . PRO B 1 232 ? 16.991  9.465   -38.151 1.00 42.11  ? 232  PRO B CA  1 
ATOM   5948 C C   . PRO B 1 232 ? 18.139  9.141   -37.188 1.00 42.57  ? 232  PRO B C   1 
ATOM   5949 O O   . PRO B 1 232 ? 18.947  8.232   -37.439 1.00 42.41  ? 232  PRO B O   1 
ATOM   5950 C CB  . PRO B 1 232 ? 17.296  10.763  -38.906 1.00 42.04  ? 232  PRO B CB  1 
ATOM   5951 C CG  . PRO B 1 232 ? 16.073  11.624  -38.788 1.00 41.69  ? 232  PRO B CG  1 
ATOM   5952 C CD  . PRO B 1 232 ? 15.361  11.183  -37.546 1.00 41.91  ? 232  PRO B CD  1 
ATOM   5953 N N   . ASN B 1 233 ? 18.192  9.879   -36.080 1.00 43.14  ? 233  ASN B N   1 
ATOM   5954 C CA  . ASN B 1 233 ? 19.142  9.599   -35.011 1.00 43.36  ? 233  ASN B CA  1 
ATOM   5955 C C   . ASN B 1 233 ? 18.799  8.310   -34.296 1.00 43.93  ? 233  ASN B C   1 
ATOM   5956 O O   . ASN B 1 233 ? 17.828  7.619   -34.659 1.00 44.26  ? 233  ASN B O   1 
ATOM   5957 C CB  . ASN B 1 233 ? 19.210  10.759  -34.024 1.00 43.18  ? 233  ASN B CB  1 
ATOM   5958 C CG  . ASN B 1 233 ? 17.862  11.143  -33.479 1.00 43.00  ? 233  ASN B CG  1 
ATOM   5959 O OD1 . ASN B 1 233 ? 16.987  11.575  -34.220 1.00 42.93  ? 233  ASN B OD1 1 
ATOM   5960 N ND2 . ASN B 1 233 ? 17.692  11.011  -32.163 1.00 43.92  ? 233  ASN B ND2 1 
ATOM   5961 N N   . GLY B 1 234 ? 19.602  7.969   -33.295 1.00 44.39  ? 234  GLY B N   1 
ATOM   5962 C CA  . GLY B 1 234 ? 19.367  6.750   -32.533 1.00 45.30  ? 234  GLY B CA  1 
ATOM   5963 C C   . GLY B 1 234 ? 20.028  5.510   -33.115 1.00 46.07  ? 234  GLY B C   1 
ATOM   5964 O O   . GLY B 1 234 ? 20.552  5.534   -34.239 1.00 45.99  ? 234  GLY B O   1 
ATOM   5965 N N   . PRO B 1 235 ? 19.995  4.414   -32.345 1.00 46.65  ? 235  PRO B N   1 
ATOM   5966 C CA  . PRO B 1 235 ? 20.809  3.210   -32.498 1.00 47.42  ? 235  PRO B CA  1 
ATOM   5967 C C   . PRO B 1 235 ? 20.560  2.322   -33.719 1.00 48.33  ? 235  PRO B C   1 
ATOM   5968 O O   . PRO B 1 235 ? 21.463  1.577   -34.112 1.00 48.97  ? 235  PRO B O   1 
ATOM   5969 C CB  . PRO B 1 235 ? 20.498  2.422   -31.230 1.00 47.26  ? 235  PRO B CB  1 
ATOM   5970 C CG  . PRO B 1 235 ? 19.179  2.908   -30.797 1.00 47.05  ? 235  PRO B CG  1 
ATOM   5971 C CD  . PRO B 1 235 ? 19.101  4.328   -31.180 1.00 46.68  ? 235  PRO B CD  1 
ATOM   5972 N N   . TRP B 1 236 ? 19.376  2.381   -34.315 1.00 49.04  ? 236  TRP B N   1 
ATOM   5973 C CA  . TRP B 1 236 ? 19.008  1.380   -35.317 1.00 49.65  ? 236  TRP B CA  1 
ATOM   5974 C C   . TRP B 1 236 ? 18.858  1.893   -36.738 1.00 50.25  ? 236  TRP B C   1 
ATOM   5975 O O   . TRP B 1 236 ? 18.927  1.109   -37.679 1.00 50.67  ? 236  TRP B O   1 
ATOM   5976 C CB  . TRP B 1 236 ? 17.705  0.721   -34.914 1.00 49.75  ? 236  TRP B CB  1 
ATOM   5977 C CG  . TRP B 1 236 ? 16.618  1.699   -34.759 1.00 50.16  ? 236  TRP B CG  1 
ATOM   5978 C CD1 . TRP B 1 236 ? 16.285  2.372   -33.623 1.00 50.97  ? 236  TRP B CD1 1 
ATOM   5979 C CD2 . TRP B 1 236 ? 15.716  2.145   -35.775 1.00 50.66  ? 236  TRP B CD2 1 
ATOM   5980 N NE1 . TRP B 1 236 ? 15.218  3.203   -33.863 1.00 51.83  ? 236  TRP B NE1 1 
ATOM   5981 C CE2 . TRP B 1 236 ? 14.847  3.082   -35.177 1.00 51.23  ? 236  TRP B CE2 1 
ATOM   5982 C CE3 . TRP B 1 236 ? 15.543  1.832   -37.132 1.00 50.69  ? 236  TRP B CE3 1 
ATOM   5983 C CZ2 . TRP B 1 236 ? 13.824  3.718   -35.890 1.00 50.83  ? 236  TRP B CZ2 1 
ATOM   5984 C CZ3 . TRP B 1 236 ? 14.526  2.466   -37.842 1.00 50.62  ? 236  TRP B CZ3 1 
ATOM   5985 C CH2 . TRP B 1 236 ? 13.683  3.398   -37.220 1.00 50.53  ? 236  TRP B CH2 1 
ATOM   5986 N N   . ALA B 1 237 ? 18.632  3.197   -36.885 1.00 50.74  ? 237  ALA B N   1 
ATOM   5987 C CA  . ALA B 1 237 ? 18.227  3.797   -38.160 1.00 50.79  ? 237  ALA B CA  1 
ATOM   5988 C C   . ALA B 1 237 ? 19.321  3.986   -39.194 1.00 51.06  ? 237  ALA B C   1 
ATOM   5989 O O   . ALA B 1 237 ? 19.000  4.188   -40.357 1.00 51.39  ? 237  ALA B O   1 
ATOM   5990 C CB  . ALA B 1 237 ? 17.520  5.125   -37.918 1.00 50.81  ? 237  ALA B CB  1 
ATOM   5991 N N   . THR B 1 238 ? 20.593  3.984   -38.790 1.00 51.35  ? 238  THR B N   1 
ATOM   5992 C CA  . THR B 1 238 ? 21.699  4.236   -39.739 1.00 51.71  ? 238  THR B CA  1 
ATOM   5993 C C   . THR B 1 238 ? 22.949  3.401   -39.470 1.00 52.23  ? 238  THR B C   1 
ATOM   5994 O O   . THR B 1 238 ? 23.118  2.849   -38.388 1.00 52.47  ? 238  THR B O   1 
ATOM   5995 C CB  . THR B 1 238 ? 22.110  5.751   -39.844 1.00 51.56  ? 238  THR B CB  1 
ATOM   5996 O OG1 . THR B 1 238 ? 22.607  6.220   -38.590 1.00 51.38  ? 238  THR B OG1 1 
ATOM   5997 C CG2 . THR B 1 238 ? 20.951  6.633   -40.284 1.00 51.21  ? 238  THR B CG2 1 
ATOM   5998 N N   . VAL B 1 239 ? 23.813  3.305   -40.477 1.00 52.92  ? 239  VAL B N   1 
ATOM   5999 C CA  . VAL B 1 239 ? 25.111  2.642   -40.349 1.00 53.66  ? 239  VAL B CA  1 
ATOM   6000 C C   . VAL B 1 239 ? 26.207  3.488   -40.964 1.00 54.26  ? 239  VAL B C   1 
ATOM   6001 O O   . VAL B 1 239 ? 25.934  4.395   -41.765 1.00 54.20  ? 239  VAL B O   1 
ATOM   6002 C CB  . VAL B 1 239 ? 25.140  1.255   -41.021 1.00 53.58  ? 239  VAL B CB  1 
ATOM   6003 C CG1 . VAL B 1 239 ? 24.478  0.213   -40.128 1.00 53.99  ? 239  VAL B CG1 1 
ATOM   6004 C CG2 . VAL B 1 239 ? 24.492  1.305   -42.396 1.00 53.25  ? 239  VAL B CG2 1 
ATOM   6005 N N   . SER B 1 240 ? 27.449  3.185   -40.591 1.00 55.07  ? 240  SER B N   1 
ATOM   6006 C CA  . SER B 1 240 ? 28.608  3.905   -41.127 1.00 55.75  ? 240  SER B CA  1 
ATOM   6007 C C   . SER B 1 240 ? 29.057  3.239   -42.413 1.00 55.94  ? 240  SER B C   1 
ATOM   6008 O O   . SER B 1 240 ? 28.802  2.048   -42.608 1.00 55.85  ? 240  SER B O   1 
ATOM   6009 C CB  . SER B 1 240 ? 29.747  3.912   -40.112 1.00 55.77  ? 240  SER B CB  1 
ATOM   6010 O OG  . SER B 1 240 ? 30.076  2.586   -39.735 1.00 56.18  ? 240  SER B OG  1 
ATOM   6011 N N   . ALA B 1 241 ? 29.708  4.009   -43.290 1.00 56.58  ? 241  ALA B N   1 
ATOM   6012 C CA  . ALA B 1 241 ? 30.270  3.462   -44.536 1.00 57.06  ? 241  ALA B CA  1 
ATOM   6013 C C   . ALA B 1 241 ? 31.018  2.162   -44.252 1.00 57.59  ? 241  ALA B C   1 
ATOM   6014 O O   . ALA B 1 241 ? 30.637  1.107   -44.769 1.00 58.01  ? 241  ALA B O   1 
ATOM   6015 C CB  . ALA B 1 241 ? 31.174  4.466   -45.229 1.00 56.77  ? 241  ALA B CB  1 
ATOM   6016 N N   . GLY B 1 242 ? 32.036  2.238   -43.389 1.00 57.85  ? 242  GLY B N   1 
ATOM   6017 C CA  . GLY B 1 242 ? 32.810  1.073   -42.973 1.00 58.08  ? 242  GLY B CA  1 
ATOM   6018 C C   . GLY B 1 242 ? 31.988  -0.165  -42.645 1.00 58.22  ? 242  GLY B C   1 
ATOM   6019 O O   . GLY B 1 242 ? 32.254  -1.256  -43.156 1.00 58.15  ? 242  GLY B O   1 
ATOM   6020 N N   . GLU B 1 243 ? 30.984  0.002   -41.796 1.00 58.38  ? 243  GLU B N   1 
ATOM   6021 C CA  . GLU B 1 243 ? 30.210  -1.136  -41.314 1.00 58.74  ? 243  GLU B CA  1 
ATOM   6022 C C   . GLU B 1 243 ? 29.289  -1.730  -42.388 1.00 58.76  ? 243  GLU B C   1 
ATOM   6023 O O   . GLU B 1 243 ? 29.076  -2.943  -42.420 1.00 58.84  ? 243  GLU B O   1 
ATOM   6024 C CB  . GLU B 1 243 ? 29.446  -0.751  -40.036 1.00 58.91  ? 243  GLU B CB  1 
ATOM   6025 C CG  . GLU B 1 243 ? 28.562  -1.841  -39.406 1.00 59.68  ? 243  GLU B CG  1 
ATOM   6026 C CD  . GLU B 1 243 ? 29.298  -3.136  -39.054 1.00 60.60  ? 243  GLU B CD  1 
ATOM   6027 O OE1 . GLU B 1 243 ? 28.612  -4.147  -38.788 1.00 59.91  ? 243  GLU B OE1 1 
ATOM   6028 O OE2 . GLU B 1 243 ? 30.551  -3.155  -39.040 1.00 62.64  ? 243  GLU B OE2 1 
ATOM   6029 N N   . ALA B 1 244 ? 28.767  -0.884  -43.276 1.00 58.81  ? 244  ALA B N   1 
ATOM   6030 C CA  . ALA B 1 244 ? 27.882  -1.348  -44.350 1.00 58.91  ? 244  ALA B CA  1 
ATOM   6031 C C   . ALA B 1 244 ? 28.642  -2.227  -45.336 1.00 58.98  ? 244  ALA B C   1 
ATOM   6032 O O   . ALA B 1 244 ? 28.137  -3.256  -45.790 1.00 59.07  ? 244  ALA B O   1 
ATOM   6033 C CB  . ALA B 1 244 ? 27.242  -0.170  -45.069 1.00 58.81  ? 244  ALA B CB  1 
ATOM   6034 N N   . ARG B 1 245 ? 29.863  -1.795  -45.647 1.00 59.09  ? 245  ARG B N   1 
ATOM   6035 C CA  . ARG B 1 245 ? 30.782  -2.488  -46.555 1.00 58.98  ? 245  ARG B CA  1 
ATOM   6036 C C   . ARG B 1 245 ? 31.140  -3.871  -46.005 1.00 59.14  ? 245  ARG B C   1 
ATOM   6037 O O   . ARG B 1 245 ? 31.298  -4.836  -46.762 1.00 59.07  ? 245  ARG B O   1 
ATOM   6038 C CB  . ARG B 1 245 ? 32.045  -1.629  -46.767 1.00 58.81  ? 245  ARG B CB  1 
ATOM   6039 C CG  . ARG B 1 245 ? 33.131  -2.268  -47.614 1.00 58.47  ? 245  ARG B CG  1 
ATOM   6040 C CD  . ARG B 1 245 ? 34.240  -1.283  -47.925 1.00 58.58  ? 245  ARG B CD  1 
ATOM   6041 N NE  . ARG B 1 245 ? 33.908  -0.361  -49.011 1.00 58.11  ? 245  ARG B NE  1 
ATOM   6042 C CZ  . ARG B 1 245 ? 33.840  -0.708  -50.299 1.00 58.61  ? 245  ARG B CZ  1 
ATOM   6043 N NH1 . ARG B 1 245 ? 33.544  0.204   -51.218 1.00 58.28  ? 245  ARG B NH1 1 
ATOM   6044 N NH2 . ARG B 1 245 ? 34.052  -1.968  -50.680 1.00 57.67  ? 245  ARG B NH2 1 
ATOM   6045 N N   . ARG B 1 246 ? 31.253  -3.948  -44.682 1.00 59.24  ? 246  ARG B N   1 
ATOM   6046 C CA  . ARG B 1 246 ? 31.601  -5.173  -44.004 1.00 59.65  ? 246  ARG B CA  1 
ATOM   6047 C C   . ARG B 1 246 ? 30.410  -6.125  -44.069 1.00 59.75  ? 246  ARG B C   1 
ATOM   6048 O O   . ARG B 1 246 ? 30.572  -7.325  -44.341 1.00 59.48  ? 246  ARG B O   1 
ATOM   6049 C CB  . ARG B 1 246 ? 31.979  -4.869  -42.555 1.00 59.94  ? 246  ARG B CB  1 
ATOM   6050 C CG  . ARG B 1 246 ? 32.836  -5.931  -41.872 1.00 61.03  ? 246  ARG B CG  1 
ATOM   6051 C CD  . ARG B 1 246 ? 32.441  -6.081  -40.402 1.00 61.93  ? 246  ARG B CD  1 
ATOM   6052 N NE  . ARG B 1 246 ? 31.376  -7.068  -40.215 1.00 62.76  ? 246  ARG B NE  1 
ATOM   6053 C CZ  . ARG B 1 246 ? 30.485  -7.030  -39.226 1.00 63.85  ? 246  ARG B CZ  1 
ATOM   6054 N NH1 . ARG B 1 246 ? 30.523  -6.049  -38.336 1.00 64.46  ? 246  ARG B NH1 1 
ATOM   6055 N NH2 . ARG B 1 246 ? 29.543  -7.965  -39.127 1.00 63.68  ? 246  ARG B NH2 1 
ATOM   6056 N N   . ARG B 1 247 ? 29.215  -5.574  -43.843 1.00 59.86  ? 247  ARG B N   1 
ATOM   6057 C CA  . ARG B 1 247 ? 27.983  -6.358  -43.859 1.00 60.10  ? 247  ARG B CA  1 
ATOM   6058 C C   . ARG B 1 247 ? 27.659  -6.852  -45.267 1.00 60.38  ? 247  ARG B C   1 
ATOM   6059 O O   . ARG B 1 247 ? 27.127  -7.954  -45.453 1.00 60.09  ? 247  ARG B O   1 
ATOM   6060 C CB  . ARG B 1 247 ? 26.815  -5.544  -43.305 1.00 60.24  ? 247  ARG B CB  1 
ATOM   6061 C CG  . ARG B 1 247 ? 26.905  -5.237  -41.825 1.00 60.41  ? 247  ARG B CG  1 
ATOM   6062 C CD  . ARG B 1 247 ? 25.669  -4.529  -41.313 1.00 59.97  ? 247  ARG B CD  1 
ATOM   6063 N NE  . ARG B 1 247 ? 25.988  -3.742  -40.126 1.00 61.30  ? 247  ARG B NE  1 
ATOM   6064 C CZ  . ARG B 1 247 ? 25.100  -3.253  -39.263 1.00 62.51  ? 247  ARG B CZ  1 
ATOM   6065 N NH1 . ARG B 1 247 ? 23.799  -3.461  -39.424 1.00 64.08  ? 247  ARG B NH1 1 
ATOM   6066 N NH2 . ARG B 1 247 ? 25.516  -2.553  -38.220 1.00 62.61  ? 247  ARG B NH2 1 
ATOM   6067 N N   . ALA B 1 248 ? 27.987  -6.027  -46.257 1.00 60.88  ? 248  ALA B N   1 
ATOM   6068 C CA  . ALA B 1 248 ? 27.781  -6.390  -47.643 1.00 61.44  ? 248  ALA B CA  1 
ATOM   6069 C C   . ALA B 1 248 ? 28.685  -7.557  -47.999 1.00 62.05  ? 248  ALA B C   1 
ATOM   6070 O O   . ALA B 1 248 ? 28.187  -8.603  -48.436 1.00 62.11  ? 248  ALA B O   1 
ATOM   6071 C CB  . ALA B 1 248 ? 28.038  -5.212  -48.552 1.00 61.40  ? 248  ALA B CB  1 
ATOM   6072 N N   . THR B 1 249 ? 29.998  -7.395  -47.781 1.00 62.66  ? 249  THR B N   1 
ATOM   6073 C CA  . THR B 1 249 ? 30.969  -8.442  -48.155 1.00 63.27  ? 249  THR B CA  1 
ATOM   6074 C C   . THR B 1 249 ? 30.699  -9.743  -47.401 1.00 63.62  ? 249  THR B C   1 
ATOM   6075 O O   . THR B 1 249 ? 30.917  -10.826 -47.942 1.00 63.66  ? 249  THR B O   1 
ATOM   6076 C CB  . THR B 1 249 ? 32.473  -8.026  -48.000 1.00 63.02  ? 249  THR B CB  1 
ATOM   6077 O OG1 . THR B 1 249 ? 32.822  -7.970  -46.616 1.00 63.75  ? 249  THR B OG1 1 
ATOM   6078 C CG2 . THR B 1 249 ? 32.775  -6.679  -48.661 1.00 62.82  ? 249  THR B CG2 1 
ATOM   6079 N N   . LEU B 1 250 ? 30.210  -9.631  -46.167 1.00 64.28  ? 250  LEU B N   1 
ATOM   6080 C CA  . LEU B 1 250 ? 29.826  -10.813 -45.399 1.00 64.94  ? 250  LEU B CA  1 
ATOM   6081 C C   . LEU B 1 250 ? 28.574  -11.480 -45.981 1.00 65.68  ? 250  LEU B C   1 
ATOM   6082 O O   . LEU B 1 250 ? 28.478  -12.715 -45.991 1.00 65.67  ? 250  LEU B O   1 
ATOM   6083 C CB  . LEU B 1 250 ? 29.654  -10.495 -43.900 1.00 65.01  ? 250  LEU B CB  1 
ATOM   6084 C CG  . LEU B 1 250 ? 29.140  -11.584 -42.933 1.00 64.59  ? 250  LEU B CG  1 
ATOM   6085 C CD1 . LEU B 1 250 ? 29.916  -12.904 -43.053 1.00 65.39  ? 250  LEU B CD1 1 
ATOM   6086 C CD2 . LEU B 1 250 ? 29.152  -11.110 -41.493 1.00 64.58  ? 250  LEU B CD2 1 
ATOM   6087 N N   . LEU B 1 251 ? 27.622  -10.682 -46.472 1.00 66.45  ? 251  LEU B N   1 
ATOM   6088 C CA  . LEU B 1 251 ? 26.464  -11.275 -47.134 1.00 67.15  ? 251  LEU B CA  1 
ATOM   6089 C C   . LEU B 1 251 ? 26.921  -12.016 -48.381 1.00 67.80  ? 251  LEU B C   1 
ATOM   6090 O O   . LEU B 1 251 ? 26.534  -13.162 -48.598 1.00 68.12  ? 251  LEU B O   1 
ATOM   6091 C CB  . LEU B 1 251 ? 25.383  -10.254 -47.483 1.00 66.94  ? 251  LEU B CB  1 
ATOM   6092 C CG  . LEU B 1 251 ? 24.165  -10.935 -48.134 1.00 66.70  ? 251  LEU B CG  1 
ATOM   6093 C CD1 . LEU B 1 251 ? 23.261  -11.630 -47.112 1.00 65.53  ? 251  LEU B CD1 1 
ATOM   6094 C CD2 . LEU B 1 251 ? 23.366  -9.968  -48.987 1.00 66.41  ? 251  LEU B CD2 1 
ATOM   6095 N N   . ALA B 1 252 ? 27.766  -11.358 -49.170 1.00 68.56  ? 252  ALA B N   1 
ATOM   6096 C CA  . ALA B 1 252 ? 28.304  -11.921 -50.402 1.00 69.48  ? 252  ALA B CA  1 
ATOM   6097 C C   . ALA B 1 252 ? 29.056  -13.235 -50.172 1.00 70.35  ? 252  ALA B C   1 
ATOM   6098 O O   . ALA B 1 252 ? 28.927  -14.184 -50.954 1.00 70.45  ? 252  ALA B O   1 
ATOM   6099 C CB  . ALA B 1 252 ? 29.203  -10.909 -51.071 1.00 69.54  ? 252  ALA B CB  1 
ATOM   6100 N N   . ARG B 1 253 ? 29.841  -13.281 -49.098 1.00 71.22  ? 253  ARG B N   1 
ATOM   6101 C CA  . ARG B 1 253 ? 30.556  -14.490 -48.726 1.00 72.29  ? 253  ARG B CA  1 
ATOM   6102 C C   . ARG B 1 253 ? 29.548  -15.585 -48.360 1.00 71.98  ? 253  ARG B C   1 
ATOM   6103 O O   . ARG B 1 253 ? 29.726  -16.733 -48.740 1.00 72.35  ? 253  ARG B O   1 
ATOM   6104 C CB  . ARG B 1 253 ? 31.532  -14.224 -47.568 1.00 72.27  ? 253  ARG B CB  1 
ATOM   6105 C CG  . ARG B 1 253 ? 32.957  -14.774 -47.787 1.00 73.64  ? 253  ARG B CG  1 
ATOM   6106 C CD  . ARG B 1 253 ? 33.709  -15.028 -46.463 1.00 74.31  ? 253  ARG B CD  1 
ATOM   6107 N NE  . ARG B 1 253 ? 33.274  -16.263 -45.786 1.00 78.96  ? 253  ARG B NE  1 
ATOM   6108 C CZ  . ARG B 1 253 ? 32.697  -16.326 -44.579 1.00 80.11  ? 253  ARG B CZ  1 
ATOM   6109 N NH1 . ARG B 1 253 ? 32.479  -15.220 -43.868 1.00 80.79  ? 253  ARG B NH1 1 
ATOM   6110 N NH2 . ARG B 1 253 ? 32.341  -17.505 -44.071 1.00 79.65  ? 253  ARG B NH2 1 
ATOM   6111 N N   . LEU B 1 254 ? 28.480  -15.225 -47.653 1.00 71.86  ? 254  LEU B N   1 
ATOM   6112 C CA  . LEU B 1 254 ? 27.480  -16.203 -47.220 1.00 71.66  ? 254  LEU B CA  1 
ATOM   6113 C C   . LEU B 1 254 ? 26.697  -16.791 -48.380 1.00 71.48  ? 254  LEU B C   1 
ATOM   6114 O O   . LEU B 1 254 ? 26.008  -17.800 -48.219 1.00 71.15  ? 254  LEU B O   1 
ATOM   6115 C CB  . LEU B 1 254 ? 26.514  -15.587 -46.208 1.00 71.95  ? 254  LEU B CB  1 
ATOM   6116 C CG  . LEU B 1 254 ? 26.829  -15.651 -44.709 1.00 72.23  ? 254  LEU B CG  1 
ATOM   6117 C CD1 . LEU B 1 254 ? 26.278  -14.407 -44.035 1.00 72.97  ? 254  LEU B CD1 1 
ATOM   6118 C CD2 . LEU B 1 254 ? 26.275  -16.918 -44.040 1.00 71.95  ? 254  LEU B CD2 1 
ATOM   6119 N N   . VAL B 1 255 ? 26.788  -16.149 -49.542 1.00 71.56  ? 255  VAL B N   1 
ATOM   6120 C CA  . VAL B 1 255 ? 26.219  -16.719 -50.770 1.00 71.86  ? 255  VAL B CA  1 
ATOM   6121 C C   . VAL B 1 255 ? 27.306  -17.038 -51.805 1.00 72.02  ? 255  VAL B C   1 
ATOM   6122 O O   . VAL B 1 255 ? 27.018  -17.388 -52.942 1.00 72.06  ? 255  VAL B O   1 
ATOM   6123 C CB  . VAL B 1 255 ? 25.038  -15.874 -51.370 1.00 71.84  ? 255  VAL B CB  1 
ATOM   6124 C CG1 . VAL B 1 255 ? 23.744  -16.134 -50.599 1.00 71.37  ? 255  VAL B CG1 1 
ATOM   6125 C CG2 . VAL B 1 255 ? 25.364  -14.385 -51.421 1.00 71.14  ? 255  VAL B CG2 1 
ATOM   6126 N N   . GLY B 1 256 ? 28.556  -16.916 -51.380 1.00 72.45  ? 256  GLY B N   1 
ATOM   6127 C CA  . GLY B 1 256 ? 29.708  -17.290 -52.189 1.00 73.02  ? 256  GLY B CA  1 
ATOM   6128 C C   . GLY B 1 256 ? 29.908  -16.366 -53.369 1.00 73.35  ? 256  GLY B C   1 
ATOM   6129 O O   . GLY B 1 256 ? 29.262  -16.545 -54.392 1.00 73.32  ? 256  GLY B O   1 
ATOM   6130 N N   . CYS B 1 257 ? 30.795  -15.378 -53.225 1.00 73.79  ? 257  CYS B N   1 
ATOM   6131 C CA  . CYS B 1 257 ? 31.129  -14.469 -54.328 1.00 74.12  ? 257  CYS B CA  1 
ATOM   6132 C C   . CYS B 1 257 ? 32.613  -14.070 -54.388 1.00 74.12  ? 257  CYS B C   1 
ATOM   6133 O O   . CYS B 1 257 ? 33.055  -13.129 -53.721 1.00 74.03  ? 257  CYS B O   1 
ATOM   6134 C CB  . CYS B 1 257 ? 30.198  -13.244 -54.313 1.00 74.17  ? 257  CYS B CB  1 
ATOM   6135 S SG  . CYS B 1 257 ? 28.464  -13.605 -54.862 1.00 74.78  ? 257  CYS B SG  1 
ATOM   6136 N N   . ASN B 1 265 ? 37.647  -6.630  -55.477 1.00 84.75  ? 265  ASN B N   1 
ATOM   6137 C CA  . ASN B 1 265 ? 37.059  -5.794  -56.524 1.00 84.91  ? 265  ASN B CA  1 
ATOM   6138 C C   . ASN B 1 265 ? 35.551  -5.611  -56.330 1.00 84.53  ? 265  ASN B C   1 
ATOM   6139 O O   . ASN B 1 265 ? 34.799  -6.593  -56.217 1.00 84.44  ? 265  ASN B O   1 
ATOM   6140 C CB  . ASN B 1 265 ? 37.351  -6.375  -57.920 1.00 85.26  ? 265  ASN B CB  1 
ATOM   6141 C CG  . ASN B 1 265 ? 36.987  -5.411  -59.061 1.00 86.25  ? 265  ASN B CG  1 
ATOM   6142 O OD1 . ASN B 1 265 ? 36.520  -5.837  -60.125 1.00 87.22  ? 265  ASN B OD1 1 
ATOM   6143 N ND2 . ASN B 1 265 ? 37.211  -4.112  -58.844 1.00 86.52  ? 265  ASN B ND2 1 
ATOM   6144 N N   . ASP B 1 266 ? 35.122  -4.349  -56.299 1.00 83.89  ? 266  ASP B N   1 
ATOM   6145 C CA  . ASP B 1 266 ? 33.725  -4.009  -56.029 1.00 83.22  ? 266  ASP B CA  1 
ATOM   6146 C C   . ASP B 1 266 ? 32.773  -4.498  -57.113 1.00 82.72  ? 266  ASP B C   1 
ATOM   6147 O O   . ASP B 1 266 ? 31.724  -5.077  -56.802 1.00 82.52  ? 266  ASP B O   1 
ATOM   6148 C CB  . ASP B 1 266 ? 33.558  -2.498  -55.817 1.00 83.27  ? 266  ASP B CB  1 
ATOM   6149 C CG  . ASP B 1 266 ? 33.606  -2.100  -54.347 1.00 83.28  ? 266  ASP B CG  1 
ATOM   6150 O OD1 . ASP B 1 266 ? 33.296  -2.944  -53.476 1.00 82.69  ? 266  ASP B OD1 1 
ATOM   6151 O OD2 . ASP B 1 266 ? 33.945  -0.933  -54.060 1.00 83.34  ? 266  ASP B OD2 1 
ATOM   6152 N N   . THR B 1 267 ? 33.150  -4.278  -58.374 1.00 81.94  ? 267  THR B N   1 
ATOM   6153 C CA  . THR B 1 267 ? 32.275  -4.581  -59.506 1.00 81.22  ? 267  THR B CA  1 
ATOM   6154 C C   . THR B 1 267 ? 31.974  -6.072  -59.588 1.00 80.84  ? 267  THR B C   1 
ATOM   6155 O O   . THR B 1 267 ? 30.836  -6.471  -59.839 1.00 80.73  ? 267  THR B O   1 
ATOM   6156 C CB  . THR B 1 267 ? 32.859  -4.070  -60.842 1.00 81.18  ? 267  THR B CB  1 
ATOM   6157 O OG1 . THR B 1 267 ? 33.360  -2.744  -60.663 1.00 80.68  ? 267  THR B OG1 1 
ATOM   6158 C CG2 . THR B 1 267 ? 31.788  -4.049  -61.930 1.00 81.00  ? 267  THR B CG2 1 
ATOM   6159 N N   . GLU B 1 268 ? 32.997  -6.882  -59.348 1.00 80.34  ? 268  GLU B N   1 
ATOM   6160 C CA  . GLU B 1 268 ? 32.872  -8.326  -59.423 1.00 80.37  ? 268  GLU B CA  1 
ATOM   6161 C C   . GLU B 1 268 ? 31.991  -8.883  -58.312 1.00 79.08  ? 268  GLU B C   1 
ATOM   6162 O O   . GLU B 1 268 ? 31.228  -9.824  -58.528 1.00 78.89  ? 268  GLU B O   1 
ATOM   6163 C CB  . GLU B 1 268 ? 34.257  -8.981  -59.384 1.00 80.67  ? 268  GLU B CB  1 
ATOM   6164 C CG  . GLU B 1 268 ? 34.995  -9.013  -60.744 1.00 82.30  ? 268  GLU B CG  1 
ATOM   6165 C CD  . GLU B 1 268 ? 36.393  -9.665  -60.668 1.00 82.53  ? 268  GLU B CD  1 
ATOM   6166 O OE1 . GLU B 1 268 ? 36.667  -10.423 -59.693 1.00 84.31  ? 268  GLU B OE1 1 
ATOM   6167 O OE2 . GLU B 1 268 ? 37.216  -9.413  -61.592 1.00 84.89  ? 268  GLU B OE2 1 
ATOM   6168 N N   . LEU B 1 269 ? 32.097  -8.294  -57.126 1.00 78.08  ? 269  LEU B N   1 
ATOM   6169 C CA  . LEU B 1 269 ? 31.313  -8.733  -55.974 1.00 76.96  ? 269  LEU B CA  1 
ATOM   6170 C C   . LEU B 1 269 ? 29.820  -8.538  -56.232 1.00 76.09  ? 269  LEU B C   1 
ATOM   6171 O O   . LEU B 1 269 ? 29.009  -9.436  -55.979 1.00 75.61  ? 269  LEU B O   1 
ATOM   6172 C CB  . LEU B 1 269 ? 31.755  -7.982  -54.707 1.00 77.09  ? 269  LEU B CB  1 
ATOM   6173 C CG  . LEU B 1 269 ? 31.401  -8.548  -53.323 1.00 77.02  ? 269  LEU B CG  1 
ATOM   6174 C CD1 . LEU B 1 269 ? 32.116  -9.867  -53.040 1.00 77.94  ? 269  LEU B CD1 1 
ATOM   6175 C CD2 . LEU B 1 269 ? 31.737  -7.550  -52.248 1.00 76.84  ? 269  LEU B CD2 1 
ATOM   6176 N N   . ILE B 1 270 ? 29.478  -7.365  -56.762 1.00 75.20  ? 270  ILE B N   1 
ATOM   6177 C CA  . ILE B 1 270 ? 28.089  -7.011  -57.050 1.00 74.48  ? 270  ILE B CA  1 
ATOM   6178 C C   . ILE B 1 270 ? 27.521  -7.823  -58.209 1.00 73.73  ? 270  ILE B C   1 
ATOM   6179 O O   . ILE B 1 270 ? 26.447  -8.419  -58.072 1.00 73.72  ? 270  ILE B O   1 
ATOM   6180 C CB  . ILE B 1 270 ? 27.929  -5.503  -57.300 1.00 74.56  ? 270  ILE B CB  1 
ATOM   6181 C CG1 . ILE B 1 270 ? 28.176  -4.750  -56.001 1.00 75.10  ? 270  ILE B CG1 1 
ATOM   6182 C CG2 . ILE B 1 270 ? 26.537  -5.169  -57.796 1.00 74.22  ? 270  ILE B CG2 1 
ATOM   6183 C CD1 . ILE B 1 270 ? 28.785  -3.389  -56.214 1.00 77.43  ? 270  ILE B CD1 1 
ATOM   6184 N N   . ALA B 1 271 ? 28.240  -7.860  -59.333 1.00 72.63  ? 271  ALA B N   1 
ATOM   6185 C CA  . ALA B 1 271 ? 27.827  -8.679  -60.468 1.00 71.68  ? 271  ALA B CA  1 
ATOM   6186 C C   . ALA B 1 271 ? 27.416  -10.076 -59.999 1.00 71.25  ? 271  ALA B C   1 
ATOM   6187 O O   . ALA B 1 271 ? 26.414  -10.617 -60.452 1.00 71.42  ? 271  ALA B O   1 
ATOM   6188 C CB  . ALA B 1 271 ? 28.920  -8.757  -61.498 1.00 71.40  ? 271  ALA B CB  1 
ATOM   6189 N N   . CYS B 1 272 ? 28.169  -10.645 -59.064 1.00 70.83  ? 272  CYS B N   1 
ATOM   6190 C CA  . CYS B 1 272 ? 27.845  -11.960 -58.531 1.00 69.98  ? 272  CYS B CA  1 
ATOM   6191 C C   . CYS B 1 272 ? 26.547  -11.949 -57.710 1.00 68.97  ? 272  CYS B C   1 
ATOM   6192 O O   . CYS B 1 272 ? 25.724  -12.872 -57.800 1.00 68.93  ? 272  CYS B O   1 
ATOM   6193 C CB  . CYS B 1 272 ? 29.011  -12.509 -57.705 1.00 70.25  ? 272  CYS B CB  1 
ATOM   6194 S SG  . CYS B 1 272 ? 28.630  -14.086 -56.872 1.00 72.04  ? 272  CYS B SG  1 
ATOM   6195 N N   . LEU B 1 273 ? 26.369  -10.912 -56.901 1.00 67.65  ? 273  LEU B N   1 
ATOM   6196 C CA  . LEU B 1 273 ? 25.137  -10.763 -56.137 1.00 66.42  ? 273  LEU B CA  1 
ATOM   6197 C C   . LEU B 1 273 ? 23.933  -10.593 -57.064 1.00 65.77  ? 273  LEU B C   1 
ATOM   6198 O O   . LEU B 1 273 ? 22.887  -11.231 -56.870 1.00 65.35  ? 273  LEU B O   1 
ATOM   6199 C CB  . LEU B 1 273 ? 25.243  -9.582  -55.174 1.00 66.20  ? 273  LEU B CB  1 
ATOM   6200 C CG  . LEU B 1 273 ? 26.079  -9.792  -53.916 1.00 65.04  ? 273  LEU B CG  1 
ATOM   6201 C CD1 . LEU B 1 273 ? 26.252  -8.468  -53.202 1.00 64.67  ? 273  LEU B CD1 1 
ATOM   6202 C CD2 . LEU B 1 273 ? 25.450  -10.825 -52.996 1.00 63.62  ? 273  LEU B CD2 1 
ATOM   6203 N N   . ARG B 1 274 ? 24.112  -9.750  -58.082 1.00 64.94  ? 274  ARG B N   1 
ATOM   6204 C CA  . ARG B 1 274 ? 23.080  -9.463  -59.076 1.00 64.43  ? 274  ARG B CA  1 
ATOM   6205 C C   . ARG B 1 274 ? 22.535  -10.708 -59.758 1.00 64.27  ? 274  ARG B C   1 
ATOM   6206 O O   . ARG B 1 274 ? 21.370  -10.744 -60.163 1.00 64.51  ? 274  ARG B O   1 
ATOM   6207 C CB  . ARG B 1 274 ? 23.608  -8.500  -60.120 1.00 64.08  ? 274  ARG B CB  1 
ATOM   6208 C CG  . ARG B 1 274 ? 23.675  -7.090  -59.631 1.00 64.35  ? 274  ARG B CG  1 
ATOM   6209 C CD  . ARG B 1 274 ? 23.368  -6.159  -60.746 1.00 65.40  ? 274  ARG B CD  1 
ATOM   6210 N NE  . ARG B 1 274 ? 24.535  -5.438  -61.219 1.00 66.90  ? 274  ARG B NE  1 
ATOM   6211 C CZ  . ARG B 1 274 ? 24.808  -4.183  -60.871 1.00 69.69  ? 274  ARG B CZ  1 
ATOM   6212 N NH1 . ARG B 1 274 ? 24.006  -3.519  -60.032 1.00 70.04  ? 274  ARG B NH1 1 
ATOM   6213 N NH2 . ARG B 1 274 ? 25.888  -3.584  -61.354 1.00 70.79  ? 274  ARG B NH2 1 
ATOM   6214 N N   . THR B 1 275 ? 23.379  -11.729 -59.857 1.00 63.88  ? 275  THR B N   1 
ATOM   6215 C CA  . THR B 1 275 ? 23.045  -12.962 -60.554 1.00 63.44  ? 275  THR B CA  1 
ATOM   6216 C C   . THR B 1 275 ? 22.311  -13.948 -59.670 1.00 62.94  ? 275  THR B C   1 
ATOM   6217 O O   . THR B 1 275 ? 22.059  -15.067 -60.093 1.00 62.92  ? 275  THR B O   1 
ATOM   6218 C CB  . THR B 1 275 ? 24.312  -13.663 -61.048 1.00 63.54  ? 275  THR B CB  1 
ATOM   6219 O OG1 . THR B 1 275 ? 25.116  -14.025 -59.919 1.00 63.82  ? 275  THR B OG1 1 
ATOM   6220 C CG2 . THR B 1 275 ? 25.119  -12.755 -61.999 1.00 63.89  ? 275  THR B CG2 1 
ATOM   6221 N N   . ARG B 1 276 ? 21.974  -13.540 -58.449 1.00 62.46  ? 276  ARG B N   1 
ATOM   6222 C CA  . ARG B 1 276 ? 21.403  -14.458 -57.462 1.00 62.13  ? 276  ARG B CA  1 
ATOM   6223 C C   . ARG B 1 276 ? 19.906  -14.272 -57.244 1.00 61.50  ? 276  ARG B C   1 
ATOM   6224 O O   . ARG B 1 276 ? 19.457  -13.156 -57.026 1.00 61.75  ? 276  ARG B O   1 
ATOM   6225 C CB  . ARG B 1 276 ? 22.145  -14.323 -56.129 1.00 62.15  ? 276  ARG B CB  1 
ATOM   6226 C CG  . ARG B 1 276 ? 23.457  -15.078 -56.084 1.00 63.37  ? 276  ARG B CG  1 
ATOM   6227 C CD  . ARG B 1 276 ? 23.282  -16.519 -55.556 1.00 65.01  ? 276  ARG B CD  1 
ATOM   6228 N NE  . ARG B 1 276 ? 24.411  -17.427 -55.830 1.00 66.06  ? 276  ARG B NE  1 
ATOM   6229 C CZ  . ARG B 1 276 ? 25.676  -17.075 -56.104 1.00 66.63  ? 276  ARG B CZ  1 
ATOM   6230 N NH1 . ARG B 1 276 ? 26.068  -15.801 -56.153 1.00 65.82  ? 276  ARG B NH1 1 
ATOM   6231 N NH2 . ARG B 1 276 ? 26.571  -18.026 -56.327 1.00 66.70  ? 276  ARG B NH2 1 
ATOM   6232 N N   . PRO B 1 277 ? 19.124  -15.363 -57.297 1.00 61.01  ? 277  PRO B N   1 
ATOM   6233 C CA  . PRO B 1 277 ? 17.700  -15.259 -56.953 1.00 60.93  ? 277  PRO B CA  1 
ATOM   6234 C C   . PRO B 1 277 ? 17.453  -14.407 -55.699 1.00 60.73  ? 277  PRO B C   1 
ATOM   6235 O O   . PRO B 1 277 ? 18.226  -14.472 -54.742 1.00 60.60  ? 277  PRO B O   1 
ATOM   6236 C CB  . PRO B 1 277 ? 17.271  -16.717 -56.706 1.00 60.74  ? 277  PRO B CB  1 
ATOM   6237 C CG  . PRO B 1 277 ? 18.442  -17.576 -57.059 1.00 60.94  ? 277  PRO B CG  1 
ATOM   6238 C CD  . PRO B 1 277 ? 19.492  -16.725 -57.709 1.00 61.03  ? 277  PRO B CD  1 
ATOM   6239 N N   . ALA B 1 278 ? 16.387  -13.609 -55.722 1.00 60.61  ? 278  ALA B N   1 
ATOM   6240 C CA  . ALA B 1 278 ? 16.062  -12.701 -54.621 1.00 60.26  ? 278  ALA B CA  1 
ATOM   6241 C C   . ALA B 1 278 ? 15.970  -13.445 -53.300 1.00 60.24  ? 278  ALA B C   1 
ATOM   6242 O O   . ALA B 1 278 ? 16.533  -13.006 -52.304 1.00 60.30  ? 278  ALA B O   1 
ATOM   6243 C CB  . ALA B 1 278 ? 14.768  -11.948 -54.902 1.00 59.97  ? 278  ALA B CB  1 
ATOM   6244 N N   . GLN B 1 279 ? 15.286  -14.584 -53.301 1.00 60.42  ? 279  GLN B N   1 
ATOM   6245 C CA  . GLN B 1 279 ? 15.029  -15.323 -52.070 1.00 60.51  ? 279  GLN B CA  1 
ATOM   6246 C C   . GLN B 1 279 ? 16.307  -15.820 -51.424 1.00 60.87  ? 279  GLN B C   1 
ATOM   6247 O O   . GLN B 1 279 ? 16.336  -16.036 -50.218 1.00 61.05  ? 279  GLN B O   1 
ATOM   6248 C CB  . GLN B 1 279 ? 14.059  -16.481 -52.316 1.00 60.40  ? 279  GLN B CB  1 
ATOM   6249 C CG  . GLN B 1 279 ? 13.662  -17.257 -51.066 1.00 60.08  ? 279  GLN B CG  1 
ATOM   6250 C CD  . GLN B 1 279 ? 13.208  -16.369 -49.924 1.00 60.46  ? 279  GLN B CD  1 
ATOM   6251 O OE1 . GLN B 1 279 ? 12.314  -15.524 -50.073 1.00 60.28  ? 279  GLN B OE1 1 
ATOM   6252 N NE2 . GLN B 1 279 ? 13.821  -16.563 -48.768 1.00 60.74  ? 279  GLN B NE2 1 
ATOM   6253 N N   . ASP B 1 280 ? 17.360  -15.988 -52.221 1.00 61.37  ? 280  ASP B N   1 
ATOM   6254 C CA  . ASP B 1 280 ? 18.661  -16.393 -51.686 1.00 62.07  ? 280  ASP B CA  1 
ATOM   6255 C C   . ASP B 1 280 ? 19.247  -15.364 -50.716 1.00 62.41  ? 280  ASP B C   1 
ATOM   6256 O O   . ASP B 1 280 ? 19.714  -15.738 -49.635 1.00 62.58  ? 280  ASP B O   1 
ATOM   6257 C CB  . ASP B 1 280 ? 19.662  -16.721 -52.803 1.00 62.14  ? 280  ASP B CB  1 
ATOM   6258 C CG  . ASP B 1 280 ? 19.435  -18.100 -53.419 1.00 62.34  ? 280  ASP B CG  1 
ATOM   6259 O OD1 . ASP B 1 280 ? 18.466  -18.802 -53.030 1.00 62.18  ? 280  ASP B OD1 1 
ATOM   6260 O OD2 . ASP B 1 280 ? 20.233  -18.473 -54.306 1.00 62.25  ? 280  ASP B OD2 1 
ATOM   6261 N N   . LEU B 1 281 ? 19.209  -14.084 -51.096 1.00 62.61  ? 281  LEU B N   1 
ATOM   6262 C CA  . LEU B 1 281 ? 19.687  -12.997 -50.237 1.00 62.87  ? 281  LEU B CA  1 
ATOM   6263 C C   . LEU B 1 281 ? 18.881  -12.849 -48.948 1.00 63.52  ? 281  LEU B C   1 
ATOM   6264 O O   . LEU B 1 281 ? 19.427  -12.511 -47.909 1.00 63.53  ? 281  LEU B O   1 
ATOM   6265 C CB  . LEU B 1 281 ? 19.690  -11.684 -50.993 1.00 62.38  ? 281  LEU B CB  1 
ATOM   6266 C CG  . LEU B 1 281 ? 20.409  -11.750 -52.331 1.00 62.18  ? 281  LEU B CG  1 
ATOM   6267 C CD1 . LEU B 1 281 ? 20.158  -10.485 -53.134 1.00 62.91  ? 281  LEU B CD1 1 
ATOM   6268 C CD2 . LEU B 1 281 ? 21.888  -11.963 -52.127 1.00 62.24  ? 281  LEU B CD2 1 
ATOM   6269 N N   . VAL B 1 282 ? 17.586  -13.119 -49.020 1.00 64.49  ? 282  VAL B N   1 
ATOM   6270 C CA  . VAL B 1 282 ? 16.712  -13.040 -47.853 1.00 65.52  ? 282  VAL B CA  1 
ATOM   6271 C C   . VAL B 1 282 ? 16.999  -14.147 -46.822 1.00 66.71  ? 282  VAL B C   1 
ATOM   6272 O O   . VAL B 1 282 ? 16.755  -13.958 -45.634 1.00 66.87  ? 282  VAL B O   1 
ATOM   6273 C CB  . VAL B 1 282 ? 15.214  -12.998 -48.284 1.00 65.18  ? 282  VAL B CB  1 
ATOM   6274 C CG1 . VAL B 1 282 ? 14.273  -13.348 -47.138 1.00 64.84  ? 282  VAL B CG1 1 
ATOM   6275 C CG2 . VAL B 1 282 ? 14.882  -11.638 -48.853 1.00 64.52  ? 282  VAL B CG2 1 
ATOM   6276 N N   . ASP B 1 283 ? 17.514  -15.290 -47.278 1.00 68.36  ? 283  ASP B N   1 
ATOM   6277 C CA  . ASP B 1 283 ? 17.922  -16.387 -46.376 1.00 69.93  ? 283  ASP B CA  1 
ATOM   6278 C C   . ASP B 1 283 ? 19.037  -15.954 -45.417 1.00 70.88  ? 283  ASP B C   1 
ATOM   6279 O O   . ASP B 1 283 ? 18.926  -16.138 -44.207 1.00 70.78  ? 283  ASP B O   1 
ATOM   6280 C CB  . ASP B 1 283 ? 18.416  -17.610 -47.162 1.00 70.00  ? 283  ASP B CB  1 
ATOM   6281 C CG  . ASP B 1 283 ? 17.341  -18.244 -48.042 1.00 70.25  ? 283  ASP B CG  1 
ATOM   6282 O OD1 . ASP B 1 283 ? 16.139  -18.203 -47.693 1.00 70.05  ? 283  ASP B OD1 1 
ATOM   6283 O OD2 . ASP B 1 283 ? 17.724  -18.818 -49.087 1.00 70.92  ? 283  ASP B OD2 1 
ATOM   6284 N N   . HIS B 1 284 ? 20.100  -15.375 -45.976 1.00 72.29  ? 284  HIS B N   1 
ATOM   6285 C CA  . HIS B 1 284 ? 21.279  -14.970 -45.208 1.00 73.94  ? 284  HIS B CA  1 
ATOM   6286 C C   . HIS B 1 284 ? 21.248  -13.504 -44.730 1.00 75.02  ? 284  HIS B C   1 
ATOM   6287 O O   . HIS B 1 284 ? 22.241  -12.973 -44.222 1.00 75.27  ? 284  HIS B O   1 
ATOM   6288 C CB  . HIS B 1 284 ? 22.544  -15.275 -46.011 1.00 73.79  ? 284  HIS B CB  1 
ATOM   6289 C CG  . HIS B 1 284 ? 22.604  -16.684 -46.505 1.00 74.51  ? 284  HIS B CG  1 
ATOM   6290 N ND1 . HIS B 1 284 ? 22.709  -17.766 -45.656 1.00 75.19  ? 284  HIS B ND1 1 
ATOM   6291 C CD2 . HIS B 1 284 ? 22.550  -17.194 -47.759 1.00 75.24  ? 284  HIS B CD2 1 
ATOM   6292 C CE1 . HIS B 1 284 ? 22.723  -18.879 -46.366 1.00 75.35  ? 284  HIS B CE1 1 
ATOM   6293 N NE2 . HIS B 1 284 ? 22.630  -18.560 -47.645 1.00 75.49  ? 284  HIS B NE2 1 
ATOM   6294 N N   . GLU B 1 285 ? 20.087  -12.875 -44.883 1.00 76.27  ? 285  GLU B N   1 
ATOM   6295 C CA  . GLU B 1 285 ? 19.846  -11.486 -44.511 1.00 77.29  ? 285  GLU B CA  1 
ATOM   6296 C C   . GLU B 1 285 ? 20.063  -11.295 -43.010 1.00 78.31  ? 285  GLU B C   1 
ATOM   6297 O O   . GLU B 1 285 ? 20.702  -10.334 -42.566 1.00 77.90  ? 285  GLU B O   1 
ATOM   6298 C CB  . GLU B 1 285 ? 18.399  -11.163 -44.895 1.00 77.14  ? 285  GLU B CB  1 
ATOM   6299 C CG  . GLU B 1 285 ? 17.979  -9.721  -44.827 1.00 76.91  ? 285  GLU B CG  1 
ATOM   6300 C CD  . GLU B 1 285 ? 16.627  -9.516  -45.464 1.00 76.47  ? 285  GLU B CD  1 
ATOM   6301 O OE1 . GLU B 1 285 ? 16.576  -9.328  -46.696 1.00 76.93  ? 285  GLU B OE1 1 
ATOM   6302 O OE2 . GLU B 1 285 ? 15.612  -9.544  -44.739 1.00 76.74  ? 285  GLU B OE2 1 
ATOM   6303 N N   . TRP B 1 286 ? 19.534  -12.244 -42.246 1.00 79.91  ? 286  TRP B N   1 
ATOM   6304 C CA  . TRP B 1 286 ? 19.556  -12.188 -40.802 1.00 81.69  ? 286  TRP B CA  1 
ATOM   6305 C C   . TRP B 1 286 ? 20.769  -12.905 -40.201 1.00 82.70  ? 286  TRP B C   1 
ATOM   6306 O O   . TRP B 1 286 ? 20.770  -13.245 -39.020 1.00 82.81  ? 286  TRP B O   1 
ATOM   6307 C CB  . TRP B 1 286 ? 18.275  -12.813 -40.256 1.00 82.07  ? 286  TRP B CB  1 
ATOM   6308 C CG  . TRP B 1 286 ? 17.005  -12.078 -40.592 1.00 82.83  ? 286  TRP B CG  1 
ATOM   6309 C CD1 . TRP B 1 286 ? 16.093  -12.418 -41.553 1.00 83.42  ? 286  TRP B CD1 1 
ATOM   6310 C CD2 . TRP B 1 286 ? 16.486  -10.900 -39.948 1.00 83.50  ? 286  TRP B CD2 1 
ATOM   6311 N NE1 . TRP B 1 286 ? 15.046  -11.522 -41.555 1.00 83.40  ? 286  TRP B NE1 1 
ATOM   6312 C CE2 . TRP B 1 286 ? 15.260  -10.583 -40.581 1.00 83.18  ? 286  TRP B CE2 1 
ATOM   6313 C CE3 . TRP B 1 286 ? 16.941  -10.079 -38.903 1.00 83.87  ? 286  TRP B CE3 1 
ATOM   6314 C CZ2 . TRP B 1 286 ? 14.481  -9.483  -40.203 1.00 83.01  ? 286  TRP B CZ2 1 
ATOM   6315 C CZ3 . TRP B 1 286 ? 16.163  -8.980  -38.526 1.00 83.50  ? 286  TRP B CZ3 1 
ATOM   6316 C CH2 . TRP B 1 286 ? 14.945  -8.697  -39.176 1.00 83.32  ? 286  TRP B CH2 1 
ATOM   6317 N N   . HIS B 1 287 ? 21.799  -13.139 -41.004 1.00 84.12  ? 287  HIS B N   1 
ATOM   6318 C CA  . HIS B 1 287 ? 22.979  -13.845 -40.521 1.00 85.51  ? 287  HIS B CA  1 
ATOM   6319 C C   . HIS B 1 287 ? 24.225  -12.987 -40.614 1.00 86.49  ? 287  HIS B C   1 
ATOM   6320 O O   . HIS B 1 287 ? 25.336  -13.481 -40.453 1.00 86.58  ? 287  HIS B O   1 
ATOM   6321 C CB  . HIS B 1 287 ? 23.189  -15.151 -41.292 1.00 85.49  ? 287  HIS B CB  1 
ATOM   6322 C CG  . HIS B 1 287 ? 22.075  -16.138 -41.133 1.00 86.30  ? 287  HIS B CG  1 
ATOM   6323 N ND1 . HIS B 1 287 ? 21.960  -17.258 -41.929 1.00 87.33  ? 287  HIS B ND1 1 
ATOM   6324 C CD2 . HIS B 1 287 ? 21.022  -16.172 -40.281 1.00 86.93  ? 287  HIS B CD2 1 
ATOM   6325 C CE1 . HIS B 1 287 ? 20.890  -17.946 -41.567 1.00 87.89  ? 287  HIS B CE1 1 
ATOM   6326 N NE2 . HIS B 1 287 ? 20.300  -17.305 -40.572 1.00 87.91  ? 287  HIS B NE2 1 
ATOM   6327 N N   . VAL B 1 288 ? 24.040  -11.700 -40.878 1.00 88.02  ? 288  VAL B N   1 
ATOM   6328 C CA  . VAL B 1 288 ? 25.170  -10.784 -41.014 1.00 89.58  ? 288  VAL B CA  1 
ATOM   6329 C C   . VAL B 1 288 ? 25.550  -10.213 -39.644 1.00 91.03  ? 288  VAL B C   1 
ATOM   6330 O O   . VAL B 1 288 ? 26.722  -9.943  -39.370 1.00 91.25  ? 288  VAL B O   1 
ATOM   6331 C CB  . VAL B 1 288 ? 24.876  -9.673  -42.030 1.00 89.33  ? 288  VAL B CB  1 
ATOM   6332 C CG1 . VAL B 1 288 ? 26.130  -8.911  -42.344 1.00 89.12  ? 288  VAL B CG1 1 
ATOM   6333 C CG2 . VAL B 1 288 ? 24.312  -10.268 -43.307 1.00 89.13  ? 288  VAL B CG2 1 
ATOM   6334 N N   . LEU B 1 289 ? 24.546  -10.033 -38.791 1.00 92.79  ? 289  LEU B N   1 
ATOM   6335 C CA  . LEU B 1 289 ? 24.766  -9.836  -37.367 1.00 94.46  ? 289  LEU B CA  1 
ATOM   6336 C C   . LEU B 1 289 ? 24.151  -11.047 -36.659 1.00 95.85  ? 289  LEU B C   1 
ATOM   6337 O O   . LEU B 1 289 ? 22.948  -11.041 -36.366 1.00 96.01  ? 289  LEU B O   1 
ATOM   6338 C CB  . LEU B 1 289 ? 24.110  -8.542  -36.884 1.00 94.35  ? 289  LEU B CB  1 
ATOM   6339 C CG  . LEU B 1 289 ? 24.302  -7.269  -37.712 1.00 94.76  ? 289  LEU B CG  1 
ATOM   6340 C CD1 . LEU B 1 289 ? 23.508  -6.112  -37.112 1.00 94.78  ? 289  LEU B CD1 1 
ATOM   6341 C CD2 . LEU B 1 289 ? 25.779  -6.901  -37.857 1.00 95.23  ? 289  LEU B CD2 1 
ATOM   6342 N N   . PRO B 1 290 ? 24.959  -12.106 -36.407 1.00 97.25  ? 290  PRO B N   1 
ATOM   6343 C CA  . PRO B 1 290 ? 24.415  -13.263 -35.657 1.00 98.31  ? 290  PRO B CA  1 
ATOM   6344 C C   . PRO B 1 290 ? 24.001  -12.792 -34.253 1.00 99.19  ? 290  PRO B C   1 
ATOM   6345 O O   . PRO B 1 290 ? 22.892  -13.104 -33.774 1.00 99.16  ? 290  PRO B O   1 
ATOM   6346 C CB  . PRO B 1 290 ? 25.598  -14.255 -35.599 1.00 98.42  ? 290  PRO B CB  1 
ATOM   6347 C CG  . PRO B 1 290 ? 26.580  -13.787 -36.672 1.00 97.98  ? 290  PRO B CG  1 
ATOM   6348 C CD  . PRO B 1 290 ? 26.381  -12.289 -36.773 1.00 97.38  ? 290  PRO B CD  1 
ATOM   6349 N N   . GLN B 1 291 ? 24.926  -12.053 -33.632 1.00 100.04 ? 291  GLN B N   1 
ATOM   6350 C CA  . GLN B 1 291 ? 24.707  -11.156 -32.486 1.00 100.81 ? 291  GLN B CA  1 
ATOM   6351 C C   . GLN B 1 291 ? 23.260  -11.078 -31.974 1.00 101.16 ? 291  GLN B C   1 
ATOM   6352 O O   . GLN B 1 291 ? 22.444  -10.277 -32.474 1.00 101.14 ? 291  GLN B O   1 
ATOM   6353 C CB  . GLN B 1 291 ? 25.242  -9.760  -32.841 1.00 100.84 ? 291  GLN B CB  1 
ATOM   6354 C CG  . GLN B 1 291 ? 26.429  -9.817  -33.809 1.00 101.26 ? 291  GLN B CG  1 
ATOM   6355 C CD  . GLN B 1 291 ? 27.072  -8.473  -34.031 1.00 102.21 ? 291  GLN B CD  1 
ATOM   6356 O OE1 . GLN B 1 291 ? 26.539  -7.626  -34.745 1.00 103.01 ? 291  GLN B OE1 1 
ATOM   6357 N NE2 . GLN B 1 291 ? 28.236  -8.271  -33.427 1.00 102.56 ? 291  GLN B NE2 1 
ATOM   6358 N N   . GLU B 1 292 ? 22.975  -11.936 -30.984 1.00 101.39 ? 292  GLU B N   1 
ATOM   6359 C CA  . GLU B 1 292 ? 21.677  -12.040 -30.303 1.00 101.52 ? 292  GLU B CA  1 
ATOM   6360 C C   . GLU B 1 292 ? 21.184  -10.693 -29.777 1.00 100.98 ? 292  GLU B C   1 
ATOM   6361 O O   . GLU B 1 292 ? 21.385  -10.351 -28.610 1.00 101.26 ? 292  GLU B O   1 
ATOM   6362 C CB  . GLU B 1 292 ? 21.753  -13.040 -29.138 1.00 101.55 ? 292  GLU B CB  1 
ATOM   6363 C CG  . GLU B 1 292 ? 21.376  -14.485 -29.481 1.00 102.43 ? 292  GLU B CG  1 
ATOM   6364 C CD  . GLU B 1 292 ? 21.337  -15.407 -28.248 1.00 102.38 ? 292  GLU B CD  1 
ATOM   6365 O OE1 . GLU B 1 292 ? 21.060  -14.912 -27.125 1.00 103.09 ? 292  GLU B OE1 1 
ATOM   6366 O OE2 . GLU B 1 292 ? 21.578  -16.630 -28.411 1.00 102.76 ? 292  GLU B OE2 1 
ATOM   6367 N N   . SER B 1 293 ? 20.561  -9.927  -30.662 1.00 100.19 ? 293  SER B N   1 
ATOM   6368 C CA  . SER B 1 293 ? 19.844  -8.719  -30.293 1.00 99.27  ? 293  SER B CA  1 
ATOM   6369 C C   . SER B 1 293 ? 18.512  -8.787  -31.035 1.00 98.54  ? 293  SER B C   1 
ATOM   6370 O O   . SER B 1 293 ? 18.176  -9.820  -31.626 1.00 98.55  ? 293  SER B O   1 
ATOM   6371 C CB  . SER B 1 293 ? 20.654  -7.465  -30.658 1.00 99.40  ? 293  SER B CB  1 
ATOM   6372 O OG  . SER B 1 293 ? 21.381  -7.625  -31.874 1.00 99.67  ? 293  SER B OG  1 
ATOM   6373 N N   . ILE B 1 294 ? 17.738  -7.716  -30.998 1.00 97.46  ? 294  ILE B N   1 
ATOM   6374 C CA  . ILE B 1 294 ? 16.508  -7.688  -31.774 1.00 96.44  ? 294  ILE B CA  1 
ATOM   6375 C C   . ILE B 1 294 ? 16.813  -6.984  -33.100 1.00 95.55  ? 294  ILE B C   1 
ATOM   6376 O O   . ILE B 1 294 ? 16.491  -7.486  -34.193 1.00 95.52  ? 294  ILE B O   1 
ATOM   6377 C CB  . ILE B 1 294 ? 15.346  -6.961  -31.017 1.00 96.57  ? 294  ILE B CB  1 
ATOM   6378 C CG1 . ILE B 1 294 ? 15.559  -6.963  -29.491 1.00 96.06  ? 294  ILE B CG1 1 
ATOM   6379 C CG2 . ILE B 1 294 ? 13.979  -7.525  -31.445 1.00 96.45  ? 294  ILE B CG2 1 
ATOM   6380 C CD1 . ILE B 1 294 ? 16.479  -5.848  -28.990 1.00 94.74  ? 294  ILE B CD1 1 
ATOM   6381 N N   . PHE B 1 295 ? 17.472  -5.832  -32.970 1.00 94.09  ? 295  PHE B N   1 
ATOM   6382 C CA  . PHE B 1 295 ? 17.768  -4.927  -34.073 1.00 92.54  ? 295  PHE B CA  1 
ATOM   6383 C C   . PHE B 1 295 ? 19.066  -5.353  -34.705 1.00 91.60  ? 295  PHE B C   1 
ATOM   6384 O O   . PHE B 1 295 ? 20.019  -4.573  -34.837 1.00 91.67  ? 295  PHE B O   1 
ATOM   6385 C CB  . PHE B 1 295 ? 17.813  -3.498  -33.559 1.00 92.35  ? 295  PHE B CB  1 
ATOM   6386 C CG  . PHE B 1 295 ? 16.544  -3.084  -32.911 1.00 92.02  ? 295  PHE B CG  1 
ATOM   6387 C CD1 . PHE B 1 295 ? 15.645  -4.042  -32.461 1.00 91.52  ? 295  PHE B CD1 1 
ATOM   6388 C CD2 . PHE B 1 295 ? 16.235  -1.758  -32.739 1.00 92.76  ? 295  PHE B CD2 1 
ATOM   6389 C CE1 . PHE B 1 295 ? 14.461  -3.698  -31.858 1.00 92.16  ? 295  PHE B CE1 1 
ATOM   6390 C CE2 . PHE B 1 295 ? 15.030  -1.390  -32.132 1.00 93.53  ? 295  PHE B CE2 1 
ATOM   6391 C CZ  . PHE B 1 295 ? 14.144  -2.368  -31.689 1.00 92.77  ? 295  PHE B CZ  1 
ATOM   6392 N N   . ARG B 1 296 ? 19.068  -6.631  -35.077 1.00 90.02  ? 296  ARG B N   1 
ATOM   6393 C CA  . ARG B 1 296 ? 20.146  -7.258  -35.815 1.00 88.32  ? 296  ARG B CA  1 
ATOM   6394 C C   . ARG B 1 296 ? 19.841  -7.262  -37.323 1.00 86.46  ? 296  ARG B C   1 
ATOM   6395 O O   . ARG B 1 296 ? 20.399  -8.084  -38.076 1.00 86.39  ? 296  ARG B O   1 
ATOM   6396 C CB  . ARG B 1 296 ? 20.402  -8.676  -35.278 1.00 88.54  ? 296  ARG B CB  1 
ATOM   6397 C CG  . ARG B 1 296 ? 19.163  -9.574  -35.211 1.00 88.80  ? 296  ARG B CG  1 
ATOM   6398 C CD  . ARG B 1 296 ? 19.452  -10.825 -34.387 1.00 89.14  ? 296  ARG B CD  1 
ATOM   6399 N NE  . ARG B 1 296 ? 18.564  -11.934 -34.738 1.00 91.09  ? 296  ARG B NE  1 
ATOM   6400 C CZ  . ARG B 1 296 ? 18.892  -12.934 -35.557 1.00 91.61  ? 296  ARG B CZ  1 
ATOM   6401 N NH1 . ARG B 1 296 ? 20.101  -12.978 -36.114 1.00 91.51  ? 296  ARG B NH1 1 
ATOM   6402 N NH2 . ARG B 1 296 ? 18.009  -13.895 -35.821 1.00 91.22  ? 296  ARG B NH2 1 
ATOM   6403 N N   . PHE B 1 297 ? 18.956  -6.350  -37.758 1.00 83.83  ? 297  PHE B N   1 
ATOM   6404 C CA  . PHE B 1 297 ? 18.738  -6.130  -39.197 1.00 80.90  ? 297  PHE B CA  1 
ATOM   6405 C C   . PHE B 1 297 ? 19.914  -5.346  -39.750 1.00 78.12  ? 297  PHE B C   1 
ATOM   6406 O O   . PHE B 1 297 ? 20.293  -4.296  -39.221 1.00 77.89  ? 297  PHE B O   1 
ATOM   6407 C CB  . PHE B 1 297 ? 17.396  -5.468  -39.524 1.00 81.39  ? 297  PHE B CB  1 
ATOM   6408 C CG  . PHE B 1 297 ? 17.007  -4.354  -38.590 1.00 82.70  ? 297  PHE B CG  1 
ATOM   6409 C CD1 . PHE B 1 297 ? 15.868  -4.477  -37.784 1.00 83.96  ? 297  PHE B CD1 1 
ATOM   6410 C CD2 . PHE B 1 297 ? 17.750  -3.177  -38.527 1.00 83.55  ? 297  PHE B CD2 1 
ATOM   6411 C CE1 . PHE B 1 297 ? 15.476  -3.454  -36.929 1.00 83.32  ? 297  PHE B CE1 1 
ATOM   6412 C CE2 . PHE B 1 297 ? 17.375  -2.149  -37.675 1.00 83.99  ? 297  PHE B CE2 1 
ATOM   6413 C CZ  . PHE B 1 297 ? 16.230  -2.289  -36.874 1.00 83.53  ? 297  PHE B CZ  1 
ATOM   6414 N N   . SER B 1 298 ? 20.500  -5.886  -40.805 1.00 74.35  ? 298  SER B N   1 
ATOM   6415 C CA  . SER B 1 298 ? 21.829  -5.492  -41.196 1.00 70.85  ? 298  SER B CA  1 
ATOM   6416 C C   . SER B 1 298 ? 21.813  -4.337  -42.174 1.00 68.00  ? 298  SER B C   1 
ATOM   6417 O O   . SER B 1 298 ? 22.759  -3.567  -42.234 1.00 67.85  ? 298  SER B O   1 
ATOM   6418 C CB  . SER B 1 298 ? 22.559  -6.689  -41.805 1.00 71.27  ? 298  SER B CB  1 
ATOM   6419 O OG  . SER B 1 298 ? 22.048  -7.920  -41.297 1.00 71.95  ? 298  SER B OG  1 
ATOM   6420 N N   . PHE B 1 299 ? 20.736  -4.207  -42.935 1.00 64.45  ? 299  PHE B N   1 
ATOM   6421 C CA  . PHE B 1 299 ? 20.736  -3.301  -44.074 1.00 60.83  ? 299  PHE B CA  1 
ATOM   6422 C C   . PHE B 1 299 ? 19.762  -2.161  -43.937 1.00 58.90  ? 299  PHE B C   1 
ATOM   6423 O O   . PHE B 1 299 ? 18.561  -2.326  -44.124 1.00 58.76  ? 299  PHE B O   1 
ATOM   6424 C CB  . PHE B 1 299 ? 20.524  -4.093  -45.355 1.00 60.40  ? 299  PHE B CB  1 
ATOM   6425 C CG  . PHE B 1 299 ? 21.582  -5.113  -45.576 1.00 59.20  ? 299  PHE B CG  1 
ATOM   6426 C CD1 . PHE B 1 299 ? 22.831  -4.736  -46.059 1.00 58.31  ? 299  PHE B CD1 1 
ATOM   6427 C CD2 . PHE B 1 299 ? 21.364  -6.436  -45.239 1.00 58.04  ? 299  PHE B CD2 1 
ATOM   6428 C CE1 . PHE B 1 299 ? 23.824  -5.662  -46.230 1.00 57.30  ? 299  PHE B CE1 1 
ATOM   6429 C CE2 . PHE B 1 299 ? 22.358  -7.372  -45.417 1.00 57.65  ? 299  PHE B CE2 1 
ATOM   6430 C CZ  . PHE B 1 299 ? 23.586  -6.987  -45.915 1.00 57.63  ? 299  PHE B CZ  1 
ATOM   6431 N N   . VAL B 1 300 ? 20.321  -1.006  -43.599 1.00 56.49  ? 300  VAL B N   1 
ATOM   6432 C CA  . VAL B 1 300 ? 19.579  0.195   -43.249 1.00 54.25  ? 300  VAL B CA  1 
ATOM   6433 C C   . VAL B 1 300 ? 20.273  1.350   -43.957 1.00 53.25  ? 300  VAL B C   1 
ATOM   6434 O O   . VAL B 1 300 ? 21.344  1.145   -44.528 1.00 53.49  ? 300  VAL B O   1 
ATOM   6435 C CB  . VAL B 1 300 ? 19.575  0.429   -41.709 1.00 54.15  ? 300  VAL B CB  1 
ATOM   6436 C CG1 . VAL B 1 300 ? 18.864  -0.705  -40.964 1.00 53.41  ? 300  VAL B CG1 1 
ATOM   6437 C CG2 . VAL B 1 300 ? 20.978  0.603   -41.179 1.00 53.36  ? 300  VAL B CG2 1 
ATOM   6438 N N   . PRO B 1 301 ? 19.676  2.564   -43.951 1.00 52.10  ? 301  PRO B N   1 
ATOM   6439 C CA  . PRO B 1 301 ? 20.366  3.699   -44.565 1.00 51.24  ? 301  PRO B CA  1 
ATOM   6440 C C   . PRO B 1 301 ? 21.785  3.839   -44.058 1.00 50.58  ? 301  PRO B C   1 
ATOM   6441 O O   . PRO B 1 301 ? 22.050  3.559   -42.903 1.00 50.22  ? 301  PRO B O   1 
ATOM   6442 C CB  . PRO B 1 301 ? 19.535  4.888   -44.113 1.00 50.98  ? 301  PRO B CB  1 
ATOM   6443 C CG  . PRO B 1 301 ? 18.210  4.359   -43.981 1.00 51.21  ? 301  PRO B CG  1 
ATOM   6444 C CD  . PRO B 1 301 ? 18.362  2.970   -43.435 1.00 51.77  ? 301  PRO B CD  1 
ATOM   6445 N N   . VAL B 1 302 ? 22.690  4.261   -44.928 1.00 50.54  ? 302  VAL B N   1 
ATOM   6446 C CA  . VAL B 1 302 ? 24.108  4.359   -44.584 1.00 50.45  ? 302  VAL B CA  1 
ATOM   6447 C C   . VAL B 1 302 ? 24.608  5.792   -44.676 1.00 50.38  ? 302  VAL B C   1 
ATOM   6448 O O   . VAL B 1 302 ? 24.328  6.493   -45.659 1.00 50.27  ? 302  VAL B O   1 
ATOM   6449 C CB  . VAL B 1 302 ? 24.978  3.464   -45.490 1.00 50.32  ? 302  VAL B CB  1 
ATOM   6450 C CG1 . VAL B 1 302 ? 25.029  4.012   -46.913 1.00 50.15  ? 302  VAL B CG1 1 
ATOM   6451 C CG2 . VAL B 1 302 ? 26.367  3.358   -44.933 1.00 50.82  ? 302  VAL B CG2 1 
ATOM   6452 N N   . VAL B 1 303 ? 25.341  6.228   -43.653 1.00 50.36  ? 303  VAL B N   1 
ATOM   6453 C CA  . VAL B 1 303 ? 25.965  7.551   -43.700 1.00 50.61  ? 303  VAL B CA  1 
ATOM   6454 C C   . VAL B 1 303 ? 27.058  7.475   -44.769 1.00 50.96  ? 303  VAL B C   1 
ATOM   6455 O O   . VAL B 1 303 ? 28.047  6.733   -44.618 1.00 51.27  ? 303  VAL B O   1 
ATOM   6456 C CB  . VAL B 1 303 ? 26.533  8.001   -42.341 1.00 50.24  ? 303  VAL B CB  1 
ATOM   6457 C CG1 . VAL B 1 303 ? 26.833  9.470   -42.363 1.00 49.59  ? 303  VAL B CG1 1 
ATOM   6458 C CG2 . VAL B 1 303 ? 25.548  7.713   -41.241 1.00 50.65  ? 303  VAL B CG2 1 
ATOM   6459 N N   . ASP B 1 304 ? 26.852  8.227   -45.849 1.00 50.79  ? 304  ASP B N   1 
ATOM   6460 C CA  . ASP B 1 304 ? 27.575  8.001   -47.095 1.00 50.81  ? 304  ASP B CA  1 
ATOM   6461 C C   . ASP B 1 304 ? 28.288  9.239   -47.638 1.00 50.82  ? 304  ASP B C   1 
ATOM   6462 O O   . ASP B 1 304 ? 28.851  9.215   -48.729 1.00 50.53  ? 304  ASP B O   1 
ATOM   6463 C CB  . ASP B 1 304 ? 26.588  7.473   -48.138 1.00 50.66  ? 304  ASP B CB  1 
ATOM   6464 C CG  . ASP B 1 304 ? 25.505  8.488   -48.498 1.00 50.54  ? 304  ASP B CG  1 
ATOM   6465 O OD1 . ASP B 1 304 ? 25.270  9.458   -47.739 1.00 50.52  ? 304  ASP B OD1 1 
ATOM   6466 O OD2 . ASP B 1 304 ? 24.885  8.308   -49.561 1.00 50.29  ? 304  ASP B OD2 1 
ATOM   6467 N N   . GLY B 1 305 ? 28.236  10.324  -46.882 1.00 51.22  ? 305  GLY B N   1 
ATOM   6468 C CA  . GLY B 1 305 ? 28.687  11.623  -47.360 1.00 51.83  ? 305  GLY B CA  1 
ATOM   6469 C C   . GLY B 1 305 ? 27.927  12.145  -48.569 1.00 52.27  ? 305  GLY B C   1 
ATOM   6470 O O   . GLY B 1 305 ? 28.321  13.156  -49.154 1.00 52.45  ? 305  GLY B O   1 
ATOM   6471 N N   . ASP B 1 306 ? 26.850  11.461  -48.956 1.00 52.63  ? 306  ASP B N   1 
ATOM   6472 C CA  . ASP B 1 306 ? 26.090  11.845  -50.146 1.00 52.99  ? 306  ASP B CA  1 
ATOM   6473 C C   . ASP B 1 306 ? 24.659  12.161  -49.762 1.00 53.16  ? 306  ASP B C   1 
ATOM   6474 O O   . ASP B 1 306 ? 24.326  13.335  -49.526 1.00 53.20  ? 306  ASP B O   1 
ATOM   6475 C CB  . ASP B 1 306 ? 26.152  10.752  -51.219 1.00 53.19  ? 306  ASP B CB  1 
ATOM   6476 C CG  . ASP B 1 306 ? 25.519  11.174  -52.551 1.00 54.00  ? 306  ASP B CG  1 
ATOM   6477 O OD1 . ASP B 1 306 ? 24.820  12.207  -52.607 1.00 53.72  ? 306  ASP B OD1 1 
ATOM   6478 O OD2 . ASP B 1 306 ? 25.718  10.447  -53.555 1.00 55.15  ? 306  ASP B OD2 1 
ATOM   6479 N N   . PHE B 1 307 ? 23.820  11.123  -49.685 1.00 53.23  ? 307  PHE B N   1 
ATOM   6480 C CA  . PHE B 1 307 ? 22.420  11.317  -49.351 1.00 53.22  ? 307  PHE B CA  1 
ATOM   6481 C C   . PHE B 1 307 ? 22.362  11.893  -47.955 1.00 53.31  ? 307  PHE B C   1 
ATOM   6482 O O   . PHE B 1 307 ? 21.654  12.874  -47.699 1.00 53.05  ? 307  PHE B O   1 
ATOM   6483 C CB  . PHE B 1 307 ? 21.623  10.019  -49.426 1.00 53.09  ? 307  PHE B CB  1 
ATOM   6484 C CG  . PHE B 1 307 ? 20.115  10.229  -49.301 1.00 54.14  ? 307  PHE B CG  1 
ATOM   6485 C CD1 . PHE B 1 307 ? 19.521  10.486  -48.059 1.00 53.44  ? 307  PHE B CD1 1 
ATOM   6486 C CD2 . PHE B 1 307 ? 19.295  10.184  -50.425 1.00 54.60  ? 307  PHE B CD2 1 
ATOM   6487 C CE1 . PHE B 1 307 ? 18.163  10.684  -47.944 1.00 53.34  ? 307  PHE B CE1 1 
ATOM   6488 C CE2 . PHE B 1 307 ? 17.925  10.380  -50.311 1.00 53.85  ? 307  PHE B CE2 1 
ATOM   6489 C CZ  . PHE B 1 307 ? 17.361  10.628  -49.069 1.00 53.68  ? 307  PHE B CZ  1 
ATOM   6490 N N   . LEU B 1 308 ? 23.107  11.261  -47.057 1.00 53.57  ? 308  LEU B N   1 
ATOM   6491 C CA  . LEU B 1 308 ? 23.332  11.806  -45.733 1.00 54.21  ? 308  LEU B CA  1 
ATOM   6492 C C   . LEU B 1 308 ? 24.749  12.380  -45.692 1.00 55.07  ? 308  LEU B C   1 
ATOM   6493 O O   . LEU B 1 308 ? 25.723  11.624  -45.721 1.00 55.05  ? 308  LEU B O   1 
ATOM   6494 C CB  . LEU B 1 308 ? 23.149  10.724  -44.668 1.00 53.55  ? 308  LEU B CB  1 
ATOM   6495 C CG  . LEU B 1 308 ? 21.779  10.069  -44.555 1.00 52.51  ? 308  LEU B CG  1 
ATOM   6496 C CD1 . LEU B 1 308 ? 21.861  8.872   -43.638 1.00 51.16  ? 308  LEU B CD1 1 
ATOM   6497 C CD2 . LEU B 1 308 ? 20.713  11.058  -44.074 1.00 52.07  ? 308  LEU B CD2 1 
ATOM   6498 N N   . SER B 1 309 ? 24.862  13.710  -45.644 1.00 55.95  ? 309  SER B N   1 
ATOM   6499 C CA  . SER B 1 309 ? 26.177  14.362  -45.685 1.00 56.92  ? 309  SER B CA  1 
ATOM   6500 C C   . SER B 1 309 ? 27.060  14.043  -44.470 1.00 57.33  ? 309  SER B C   1 
ATOM   6501 O O   . SER B 1 309 ? 28.278  14.022  -44.591 1.00 57.71  ? 309  SER B O   1 
ATOM   6502 C CB  . SER B 1 309 ? 26.052  15.881  -45.910 1.00 57.05  ? 309  SER B CB  1 
ATOM   6503 O OG  . SER B 1 309 ? 25.807  16.602  -44.711 1.00 58.06  ? 309  SER B OG  1 
ATOM   6504 N N   . ASP B 1 310 ? 26.439  13.768  -43.322 1.00 57.66  ? 310  ASP B N   1 
ATOM   6505 C CA  . ASP B 1 310 ? 27.138  13.458  -42.067 1.00 58.02  ? 310  ASP B CA  1 
ATOM   6506 C C   . ASP B 1 310 ? 26.134  12.691  -41.191 1.00 58.12  ? 310  ASP B C   1 
ATOM   6507 O O   . ASP B 1 310 ? 24.952  12.700  -41.514 1.00 58.55  ? 310  ASP B O   1 
ATOM   6508 C CB  . ASP B 1 310 ? 27.558  14.767  -41.390 1.00 58.17  ? 310  ASP B CB  1 
ATOM   6509 C CG  . ASP B 1 310 ? 28.700  14.590  -40.397 1.00 58.50  ? 310  ASP B CG  1 
ATOM   6510 O OD1 . ASP B 1 310 ? 28.795  13.542  -39.721 1.00 58.31  ? 310  ASP B OD1 1 
ATOM   6511 O OD2 . ASP B 1 310 ? 29.502  15.534  -40.280 1.00 59.19  ? 310  ASP B OD2 1 
ATOM   6512 N N   . THR B 1 311 ? 26.561  12.045  -40.100 1.00 57.86  ? 311  THR B N   1 
ATOM   6513 C CA  . THR B 1 311 ? 25.617  11.293  -39.248 1.00 57.92  ? 311  THR B CA  1 
ATOM   6514 C C   . THR B 1 311 ? 24.416  12.148  -38.848 1.00 58.02  ? 311  THR B C   1 
ATOM   6515 O O   . THR B 1 311 ? 24.563  13.344  -38.635 1.00 58.19  ? 311  THR B O   1 
ATOM   6516 C CB  . THR B 1 311 ? 26.264  10.723  -37.950 1.00 58.02  ? 311  THR B CB  1 
ATOM   6517 O OG1 . THR B 1 311 ? 26.514  11.774  -37.006 1.00 57.99  ? 311  THR B OG1 1 
ATOM   6518 C CG2 . THR B 1 311 ? 27.554  9.959   -38.248 1.00 58.44  ? 311  THR B CG2 1 
ATOM   6519 N N   . PRO B 1 312 ? 23.219  11.545  -38.738 1.00 58.24  ? 312  PRO B N   1 
ATOM   6520 C CA  . PRO B 1 312 ? 22.059  12.356  -38.366 1.00 58.53  ? 312  PRO B CA  1 
ATOM   6521 C C   . PRO B 1 312 ? 22.304  13.186  -37.106 1.00 58.86  ? 312  PRO B C   1 
ATOM   6522 O O   . PRO B 1 312 ? 21.878  14.339  -37.046 1.00 58.64  ? 312  PRO B O   1 
ATOM   6523 C CB  . PRO B 1 312 ? 20.965  11.315  -38.112 1.00 58.41  ? 312  PRO B CB  1 
ATOM   6524 C CG  . PRO B 1 312 ? 21.353  10.169  -38.918 1.00 58.29  ? 312  PRO B CG  1 
ATOM   6525 C CD  . PRO B 1 312 ? 22.853  10.133  -38.935 1.00 58.22  ? 312  PRO B CD  1 
ATOM   6526 N N   . GLU B 1 313 ? 22.991  12.604  -36.123 1.00 59.39  ? 313  GLU B N   1 
ATOM   6527 C CA  . GLU B 1 313 ? 23.331  13.315  -34.896 1.00 60.10  ? 313  GLU B CA  1 
ATOM   6528 C C   . GLU B 1 313 ? 24.038  14.614  -35.247 1.00 60.14  ? 313  GLU B C   1 
ATOM   6529 O O   . GLU B 1 313 ? 23.530  15.702  -34.954 1.00 59.96  ? 313  GLU B O   1 
ATOM   6530 C CB  . GLU B 1 313 ? 24.187  12.449  -33.968 1.00 60.47  ? 313  GLU B CB  1 
ATOM   6531 C CG  . GLU B 1 313 ? 23.387  11.377  -33.162 1.00 62.47  ? 313  GLU B CG  1 
ATOM   6532 C CD  . GLU B 1 313 ? 23.243  9.986   -33.861 1.00 63.93  ? 313  GLU B CD  1 
ATOM   6533 O OE1 . GLU B 1 313 ? 23.865  9.718   -34.930 1.00 62.92  ? 313  GLU B OE1 1 
ATOM   6534 O OE2 . GLU B 1 313 ? 22.490  9.151   -33.303 1.00 64.22  ? 313  GLU B OE2 1 
ATOM   6535 N N   . ALA B 1 314 ? 25.182  14.503  -35.918 1.00 60.26  ? 314  ALA B N   1 
ATOM   6536 C CA  . ALA B 1 314 ? 25.883  15.683  -36.409 1.00 60.63  ? 314  ALA B CA  1 
ATOM   6537 C C   . ALA B 1 314 ? 24.916  16.605  -37.140 1.00 61.04  ? 314  ALA B C   1 
ATOM   6538 O O   . ALA B 1 314 ? 24.932  17.813  -36.926 1.00 61.42  ? 314  ALA B O   1 
ATOM   6539 C CB  . ALA B 1 314 ? 27.043  15.295  -37.320 1.00 60.42  ? 314  ALA B CB  1 
ATOM   6540 N N   . LEU B 1 315 ? 24.057  16.017  -37.974 1.00 61.43  ? 315  LEU B N   1 
ATOM   6541 C CA  . LEU B 1 315 ? 23.190  16.771  -38.868 1.00 61.64  ? 315  LEU B CA  1 
ATOM   6542 C C   . LEU B 1 315 ? 22.058  17.506  -38.164 1.00 62.20  ? 315  LEU B C   1 
ATOM   6543 O O   . LEU B 1 315 ? 21.771  18.658  -38.493 1.00 62.32  ? 315  LEU B O   1 
ATOM   6544 C CB  . LEU B 1 315 ? 22.630  15.869  -39.967 1.00 61.43  ? 315  LEU B CB  1 
ATOM   6545 C CG  . LEU B 1 315 ? 23.492  15.686  -41.213 1.00 60.59  ? 315  LEU B CG  1 
ATOM   6546 C CD1 . LEU B 1 315 ? 22.706  14.908  -42.234 1.00 60.10  ? 315  LEU B CD1 1 
ATOM   6547 C CD2 . LEU B 1 315 ? 23.912  17.015  -41.796 1.00 59.99  ? 315  LEU B CD2 1 
ATOM   6548 N N   . ILE B 1 316 ? 21.406  16.862  -37.203 1.00 62.75  ? 316  ILE B N   1 
ATOM   6549 C CA  . ILE B 1 316 ? 20.362  17.570  -36.470 1.00 63.53  ? 316  ILE B CA  1 
ATOM   6550 C C   . ILE B 1 316 ? 20.977  18.582  -35.524 1.00 64.16  ? 316  ILE B C   1 
ATOM   6551 O O   . ILE B 1 316 ? 20.328  19.557  -35.177 1.00 64.69  ? 316  ILE B O   1 
ATOM   6552 C CB  . ILE B 1 316 ? 19.334  16.653  -35.731 1.00 63.10  ? 316  ILE B CB  1 
ATOM   6553 C CG1 . ILE B 1 316 ? 20.001  15.780  -34.678 1.00 63.80  ? 316  ILE B CG1 1 
ATOM   6554 C CG2 . ILE B 1 316 ? 18.598  15.790  -36.709 1.00 63.12  ? 316  ILE B CG2 1 
ATOM   6555 C CD1 . ILE B 1 316 ? 19.019  14.995  -33.831 1.00 63.94  ? 316  ILE B CD1 1 
ATOM   6556 N N   . ASN B 1 317 ? 22.231  18.365  -35.127 1.00 64.93  ? 317  ASN B N   1 
ATOM   6557 C CA  . ASN B 1 317 ? 22.904  19.271  -34.187 1.00 65.47  ? 317  ASN B CA  1 
ATOM   6558 C C   . ASN B 1 317 ? 23.270  20.631  -34.767 1.00 65.40  ? 317  ASN B C   1 
ATOM   6559 O O   . ASN B 1 317 ? 23.229  21.628  -34.049 1.00 65.32  ? 317  ASN B O   1 
ATOM   6560 C CB  . ASN B 1 317 ? 24.132  18.609  -33.556 1.00 65.72  ? 317  ASN B CB  1 
ATOM   6561 C CG  . ASN B 1 317 ? 23.770  17.693  -32.382 1.00 67.15  ? 317  ASN B CG  1 
ATOM   6562 O OD1 . ASN B 1 317 ? 22.629  17.689  -31.889 1.00 68.12  ? 317  ASN B OD1 1 
ATOM   6563 N ND2 . ASN B 1 317 ? 24.750  16.908  -31.927 1.00 67.93  ? 317  ASN B ND2 1 
ATOM   6564 N N   . THR B 1 318 ? 23.598  20.671  -36.058 1.00 65.30  ? 318  THR B N   1 
ATOM   6565 C CA  . THR B 1 318 ? 24.052  21.907  -36.700 1.00 65.63  ? 318  THR B CA  1 
ATOM   6566 C C   . THR B 1 318 ? 23.039  22.499  -37.681 1.00 65.50  ? 318  THR B C   1 
ATOM   6567 O O   . THR B 1 318 ? 23.195  23.636  -38.127 1.00 65.68  ? 318  THR B O   1 
ATOM   6568 C CB  . THR B 1 318 ? 25.417  21.733  -37.444 1.00 65.84  ? 318  THR B CB  1 
ATOM   6569 O OG1 . THR B 1 318 ? 25.210  21.116  -38.725 1.00 65.95  ? 318  THR B OG1 1 
ATOM   6570 C CG2 . THR B 1 318 ? 26.412  20.896  -36.619 1.00 66.67  ? 318  THR B CG2 1 
ATOM   6571 N N   . GLY B 1 319 ? 22.009  21.735  -38.023 1.00 65.29  ? 319  GLY B N   1 
ATOM   6572 C CA  . GLY B 1 319 ? 21.053  22.162  -39.049 1.00 64.80  ? 319  GLY B CA  1 
ATOM   6573 C C   . GLY B 1 319 ? 20.294  23.433  -38.717 1.00 64.40  ? 319  GLY B C   1 
ATOM   6574 O O   . GLY B 1 319 ? 20.133  23.789  -37.546 1.00 64.12  ? 319  GLY B O   1 
ATOM   6575 N N   . ASP B 1 320 ? 19.844  24.124  -39.761 1.00 64.31  ? 320  ASP B N   1 
ATOM   6576 C CA  . ASP B 1 320 ? 18.962  25.276  -39.605 1.00 64.26  ? 320  ASP B CA  1 
ATOM   6577 C C   . ASP B 1 320 ? 17.548  24.900  -40.057 1.00 64.00  ? 320  ASP B C   1 
ATOM   6578 O O   . ASP B 1 320 ? 17.263  24.767  -41.256 1.00 64.05  ? 320  ASP B O   1 
ATOM   6579 C CB  . ASP B 1 320 ? 19.488  26.482  -40.377 1.00 64.46  ? 320  ASP B CB  1 
ATOM   6580 C CG  . ASP B 1 320 ? 18.410  27.513  -40.652 1.00 65.36  ? 320  ASP B CG  1 
ATOM   6581 O OD1 . ASP B 1 320 ? 17.835  28.066  -39.687 1.00 65.36  ? 320  ASP B OD1 1 
ATOM   6582 O OD2 . ASP B 1 320 ? 18.134  27.761  -41.848 1.00 67.13  ? 320  ASP B OD2 1 
ATOM   6583 N N   . PHE B 1 321 ? 16.665  24.720  -39.083 1.00 63.36  ? 321  PHE B N   1 
ATOM   6584 C CA  . PHE B 1 321 ? 15.361  24.163  -39.362 1.00 62.86  ? 321  PHE B CA  1 
ATOM   6585 C C   . PHE B 1 321 ? 14.295  25.239  -39.294 1.00 62.95  ? 321  PHE B C   1 
ATOM   6586 O O   . PHE B 1 321 ? 13.163  24.989  -38.896 1.00 62.93  ? 321  PHE B O   1 
ATOM   6587 C CB  . PHE B 1 321 ? 15.097  22.989  -38.424 1.00 62.38  ? 321  PHE B CB  1 
ATOM   6588 C CG  . PHE B 1 321 ? 16.119  21.887  -38.548 1.00 61.68  ? 321  PHE B CG  1 
ATOM   6589 C CD1 . PHE B 1 321 ? 16.274  21.190  -39.742 1.00 61.33  ? 321  PHE B CD1 1 
ATOM   6590 C CD2 . PHE B 1 321 ? 16.932  21.547  -37.481 1.00 61.48  ? 321  PHE B CD2 1 
ATOM   6591 C CE1 . PHE B 1 321 ? 17.220  20.173  -39.865 1.00 60.69  ? 321  PHE B CE1 1 
ATOM   6592 C CE2 . PHE B 1 321 ? 17.874  20.520  -37.597 1.00 60.76  ? 321  PHE B CE2 1 
ATOM   6593 C CZ  . PHE B 1 321 ? 18.015  19.838  -38.791 1.00 60.59  ? 321  PHE B CZ  1 
ATOM   6594 N N   . GLN B 1 322 ? 14.677  26.422  -39.764 1.00 62.96  ? 322  GLN B N   1 
ATOM   6595 C CA  . GLN B 1 322 ? 13.927  27.650  -39.568 1.00 63.13  ? 322  GLN B CA  1 
ATOM   6596 C C   . GLN B 1 322 ? 12.504  27.578  -40.105 1.00 62.55  ? 322  GLN B C   1 
ATOM   6597 O O   . GLN B 1 322 ? 11.551  27.779  -39.351 1.00 62.62  ? 322  GLN B O   1 
ATOM   6598 C CB  . GLN B 1 322 ? 14.681  28.836  -40.192 1.00 63.75  ? 322  GLN B CB  1 
ATOM   6599 C CG  . GLN B 1 322 ? 14.294  30.220  -39.639 1.00 66.07  ? 322  GLN B CG  1 
ATOM   6600 C CD  . GLN B 1 322 ? 14.721  30.418  -38.184 1.00 68.85  ? 322  GLN B CD  1 
ATOM   6601 O OE1 . GLN B 1 322 ? 15.891  30.228  -37.832 1.00 70.64  ? 322  GLN B OE1 1 
ATOM   6602 N NE2 . GLN B 1 322 ? 13.772  30.807  -37.336 1.00 69.06  ? 322  GLN B NE2 1 
ATOM   6603 N N   . ASP B 1 323 ? 12.354  27.299  -41.397 1.00 61.74  ? 323  ASP B N   1 
ATOM   6604 C CA  . ASP B 1 323 ? 11.016  27.286  -41.999 1.00 61.01  ? 323  ASP B CA  1 
ATOM   6605 C C   . ASP B 1 323 ? 10.478  25.867  -42.155 1.00 59.24  ? 323  ASP B C   1 
ATOM   6606 O O   . ASP B 1 323 ? 10.398  25.345  -43.267 1.00 59.52  ? 323  ASP B O   1 
ATOM   6607 C CB  . ASP B 1 323 ? 10.992  28.067  -43.330 1.00 61.96  ? 323  ASP B CB  1 
ATOM   6608 C CG  . ASP B 1 323 ? 10.640  29.556  -43.138 1.00 64.67  ? 323  ASP B CG  1 
ATOM   6609 O OD1 . ASP B 1 323 ? 9.712   29.844  -42.335 1.00 67.46  ? 323  ASP B OD1 1 
ATOM   6610 O OD2 . ASP B 1 323 ? 11.279  30.434  -43.787 1.00 66.65  ? 323  ASP B OD2 1 
ATOM   6611 N N   . LEU B 1 324 ? 10.118  25.254  -41.027 1.00 56.57  ? 324  LEU B N   1 
ATOM   6612 C CA  . LEU B 1 324 ? 9.745   23.845  -40.984 1.00 54.38  ? 324  LEU B CA  1 
ATOM   6613 C C   . LEU B 1 324 ? 8.880   23.587  -39.789 1.00 52.51  ? 324  LEU B C   1 
ATOM   6614 O O   . LEU B 1 324 ? 9.194   24.034  -38.682 1.00 52.32  ? 324  LEU B O   1 
ATOM   6615 C CB  . LEU B 1 324 ? 10.994  22.953  -40.865 1.00 54.92  ? 324  LEU B CB  1 
ATOM   6616 C CG  . LEU B 1 324 ? 10.801  21.423  -40.766 1.00 55.36  ? 324  LEU B CG  1 
ATOM   6617 C CD1 . LEU B 1 324 ? 10.498  20.826  -42.133 1.00 54.11  ? 324  LEU B CD1 1 
ATOM   6618 C CD2 . LEU B 1 324 ? 12.013  20.746  -40.159 1.00 54.15  ? 324  LEU B CD2 1 
ATOM   6619 N N   . GLN B 1 325 ? 7.801   22.850  -40.015 1.00 50.24  ? 325  GLN B N   1 
ATOM   6620 C CA  . GLN B 1 325 ? 6.931   22.410  -38.932 1.00 48.29  ? 325  GLN B CA  1 
ATOM   6621 C C   . GLN B 1 325 ? 6.965   20.897  -38.826 1.00 46.82  ? 325  GLN B C   1 
ATOM   6622 O O   . GLN B 1 325 ? 6.966   20.197  -39.837 1.00 46.72  ? 325  GLN B O   1 
ATOM   6623 C CB  . GLN B 1 325 ? 5.498   22.882  -39.143 1.00 48.32  ? 325  GLN B CB  1 
ATOM   6624 C CG  . GLN B 1 325 ? 5.362   24.362  -39.337 1.00 48.60  ? 325  GLN B CG  1 
ATOM   6625 C CD  . GLN B 1 325 ? 5.412   24.726  -40.790 1.00 49.77  ? 325  GLN B CD  1 
ATOM   6626 O OE1 . GLN B 1 325 ? 6.483   24.986  -41.331 1.00 52.69  ? 325  GLN B OE1 1 
ATOM   6627 N NE2 . GLN B 1 325 ? 4.260   24.714  -41.448 1.00 49.21  ? 325  GLN B NE2 1 
ATOM   6628 N N   . VAL B 1 326 ? 7.000   20.388  -37.605 1.00 44.89  ? 326  VAL B N   1 
ATOM   6629 C CA  . VAL B 1 326 ? 7.114   18.963  -37.419 1.00 43.76  ? 326  VAL B CA  1 
ATOM   6630 C C   . VAL B 1 326 ? 6.194   18.516  -36.313 1.00 42.89  ? 326  VAL B C   1 
ATOM   6631 O O   . VAL B 1 326 ? 6.166   19.138  -35.252 1.00 43.00  ? 326  VAL B O   1 
ATOM   6632 C CB  . VAL B 1 326 ? 8.560   18.542  -37.054 1.00 43.86  ? 326  VAL B CB  1 
ATOM   6633 C CG1 . VAL B 1 326 ? 8.672   17.039  -36.955 1.00 43.42  ? 326  VAL B CG1 1 
ATOM   6634 C CG2 . VAL B 1 326 ? 9.546   19.041  -38.089 1.00 44.54  ? 326  VAL B CG2 1 
ATOM   6635 N N   . LEU B 1 327 ? 5.452   17.436  -36.564 1.00 41.71  ? 327  LEU B N   1 
ATOM   6636 C CA  . LEU B 1 327 ? 4.683   16.756  -35.528 1.00 40.70  ? 327  LEU B CA  1 
ATOM   6637 C C   . LEU B 1 327 ? 5.394   15.462  -35.154 1.00 40.13  ? 327  LEU B C   1 
ATOM   6638 O O   . LEU B 1 327 ? 5.647   14.641  -36.015 1.00 40.45  ? 327  LEU B O   1 
ATOM   6639 C CB  . LEU B 1 327 ? 3.267   16.477  -36.024 1.00 40.38  ? 327  LEU B CB  1 
ATOM   6640 C CG  . LEU B 1 327 ? 2.416   15.548  -35.163 1.00 40.66  ? 327  LEU B CG  1 
ATOM   6641 C CD1 . LEU B 1 327 ? 2.185   16.151  -33.803 1.00 41.92  ? 327  LEU B CD1 1 
ATOM   6642 C CD2 . LEU B 1 327 ? 1.091   15.265  -35.831 1.00 41.08  ? 327  LEU B CD2 1 
ATOM   6643 N N   . VAL B 1 328 ? 5.757   15.281  -33.895 1.00 39.50  ? 328  VAL B N   1 
ATOM   6644 C CA  . VAL B 1 328 ? 6.423   14.043  -33.507 1.00 39.49  ? 328  VAL B CA  1 
ATOM   6645 C C   . VAL B 1 328 ? 5.749   13.463  -32.302 1.00 39.85  ? 328  VAL B C   1 
ATOM   6646 O O   . VAL B 1 328 ? 5.166   14.194  -31.501 1.00 40.31  ? 328  VAL B O   1 
ATOM   6647 C CB  . VAL B 1 328 ? 7.932   14.208  -33.160 1.00 39.21  ? 328  VAL B CB  1 
ATOM   6648 C CG1 . VAL B 1 328 ? 8.674   14.863  -34.265 1.00 39.06  ? 328  VAL B CG1 1 
ATOM   6649 C CG2 . VAL B 1 328 ? 8.116   14.986  -31.894 1.00 39.25  ? 328  VAL B CG2 1 
ATOM   6650 N N   . GLY B 1 329 ? 5.839   12.152  -32.146 1.00 39.82  ? 329  GLY B N   1 
ATOM   6651 C CA  . GLY B 1 329 ? 5.253   11.544  -30.977 1.00 40.20  ? 329  GLY B CA  1 
ATOM   6652 C C   . GLY B 1 329 ? 5.611   10.097  -30.829 1.00 40.51  ? 329  GLY B C   1 
ATOM   6653 O O   . GLY B 1 329 ? 6.256   9.533   -31.704 1.00 40.74  ? 329  GLY B O   1 
ATOM   6654 N N   . VAL B 1 330 ? 5.190   9.518   -29.707 1.00 40.77  ? 330  VAL B N   1 
ATOM   6655 C CA  . VAL B 1 330 ? 5.415   8.114   -29.380 1.00 41.17  ? 330  VAL B CA  1 
ATOM   6656 C C   . VAL B 1 330 ? 4.129   7.493   -28.820 1.00 41.83  ? 330  VAL B C   1 
ATOM   6657 O O   . VAL B 1 330 ? 3.157   8.197   -28.522 1.00 41.57  ? 330  VAL B O   1 
ATOM   6658 C CB  . VAL B 1 330 ? 6.564   7.952   -28.362 1.00 41.15  ? 330  VAL B CB  1 
ATOM   6659 C CG1 . VAL B 1 330 ? 7.935   8.209   -29.021 1.00 41.17  ? 330  VAL B CG1 1 
ATOM   6660 C CG2 . VAL B 1 330 ? 6.350   8.861   -27.164 1.00 40.71  ? 330  VAL B CG2 1 
ATOM   6661 N N   . VAL B 1 331 ? 4.117   6.173   -28.709 1.00 42.80  ? 331  VAL B N   1 
ATOM   6662 C CA  . VAL B 1 331 ? 2.999   5.465   -28.078 1.00 44.03  ? 331  VAL B CA  1 
ATOM   6663 C C   . VAL B 1 331 ? 3.392   5.069   -26.645 1.00 45.46  ? 331  VAL B C   1 
ATOM   6664 O O   . VAL B 1 331 ? 4.579   5.166   -26.265 1.00 45.61  ? 331  VAL B O   1 
ATOM   6665 C CB  . VAL B 1 331 ? 2.557   4.216   -28.882 1.00 43.81  ? 331  VAL B CB  1 
ATOM   6666 C CG1 . VAL B 1 331 ? 1.955   4.619   -30.199 1.00 43.53  ? 331  VAL B CG1 1 
ATOM   6667 C CG2 . VAL B 1 331 ? 3.719   3.232   -29.090 1.00 42.74  ? 331  VAL B CG2 1 
ATOM   6668 N N   . LYS B 1 332 ? 2.418   4.614   -25.857 1.00 46.50  ? 332  LYS B N   1 
ATOM   6669 C CA  . LYS B 1 332 ? 2.655   4.448   -24.430 1.00 48.22  ? 332  LYS B CA  1 
ATOM   6670 C C   . LYS B 1 332 ? 3.695   3.360   -24.118 1.00 48.95  ? 332  LYS B C   1 
ATOM   6671 O O   . LYS B 1 332 ? 4.408   3.446   -23.117 1.00 49.06  ? 332  LYS B O   1 
ATOM   6672 C CB  . LYS B 1 332 ? 1.341   4.228   -23.675 1.00 48.00  ? 332  LYS B CB  1 
ATOM   6673 C CG  . LYS B 1 332 ? 1.483   4.273   -22.145 1.00 49.38  ? 332  LYS B CG  1 
ATOM   6674 C CD  . LYS B 1 332 ? 0.140   4.065   -21.401 1.00 49.71  ? 332  LYS B CD  1 
ATOM   6675 C CE  . LYS B 1 332 ? 0.293   3.078   -20.228 1.00 52.87  ? 332  LYS B CE  1 
ATOM   6676 N NZ  . LYS B 1 332 ? 0.486   1.640   -20.697 1.00 54.04  ? 332  LYS B NZ  1 
ATOM   6677 N N   . ASP B 1 333 ? 3.806   2.360   -24.991 1.00 50.10  ? 333  ASP B N   1 
ATOM   6678 C CA  . ASP B 1 333 ? 4.620   1.181   -24.700 1.00 50.98  ? 333  ASP B CA  1 
ATOM   6679 C C   . ASP B 1 333 ? 5.443   0.728   -25.900 1.00 51.42  ? 333  ASP B C   1 
ATOM   6680 O O   . ASP B 1 333 ? 5.272   -0.389  -26.373 1.00 51.45  ? 333  ASP B O   1 
ATOM   6681 C CB  . ASP B 1 333 ? 3.715   0.033   -24.245 1.00 51.15  ? 333  ASP B CB  1 
ATOM   6682 C CG  . ASP B 1 333 ? 3.026   0.312   -22.926 1.00 52.38  ? 333  ASP B CG  1 
ATOM   6683 O OD1 . ASP B 1 333 ? 1.782   0.515   -22.916 1.00 52.60  ? 333  ASP B OD1 1 
ATOM   6684 O OD2 . ASP B 1 333 ? 3.737   0.332   -21.898 1.00 53.48  ? 333  ASP B OD2 1 
ATOM   6685 N N   . GLU B 1 334 ? 6.337   1.585   -26.388 1.00 52.30  ? 334  GLU B N   1 
ATOM   6686 C CA  . GLU B 1 334 ? 7.113   1.278   -27.593 1.00 52.87  ? 334  GLU B CA  1 
ATOM   6687 C C   . GLU B 1 334 ? 7.699   -0.120  -27.524 1.00 53.62  ? 334  GLU B C   1 
ATOM   6688 O O   . GLU B 1 334 ? 7.387   -0.974  -28.356 1.00 54.29  ? 334  GLU B O   1 
ATOM   6689 C CB  . GLU B 1 334 ? 8.215   2.309   -27.845 1.00 52.61  ? 334  GLU B CB  1 
ATOM   6690 C CG  . GLU B 1 334 ? 7.711   3.730   -28.111 1.00 53.03  ? 334  GLU B CG  1 
ATOM   6691 C CD  . GLU B 1 334 ? 7.027   3.887   -29.469 1.00 53.61  ? 334  GLU B CD  1 
ATOM   6692 O OE1 . GLU B 1 334 ? 7.291   3.055   -30.365 1.00 54.12  ? 334  GLU B OE1 1 
ATOM   6693 O OE2 . GLU B 1 334 ? 6.234   4.845   -29.648 1.00 52.31  ? 334  GLU B OE2 1 
ATOM   6694 N N   . GLY B 1 335 ? 8.484   -0.378  -26.489 1.00 54.38  ? 335  GLY B N   1 
ATOM   6695 C CA  . GLY B 1 335 ? 9.318   -1.578  -26.439 1.00 55.03  ? 335  GLY B CA  1 
ATOM   6696 C C   . GLY B 1 335 ? 8.689   -2.944  -26.232 1.00 55.43  ? 335  GLY B C   1 
ATOM   6697 O O   . GLY B 1 335 ? 9.368   -3.955  -26.425 1.00 55.39  ? 335  GLY B O   1 
ATOM   6698 N N   . SER B 1 336 ? 7.415   -3.000  -25.848 1.00 56.04  ? 336  SER B N   1 
ATOM   6699 C CA  . SER B 1 336 ? 6.786   -4.293  -25.538 1.00 56.92  ? 336  SER B CA  1 
ATOM   6700 C C   . SER B 1 336 ? 6.810   -5.246  -26.741 1.00 57.84  ? 336  SER B C   1 
ATOM   6701 O O   . SER B 1 336 ? 7.157   -6.421  -26.612 1.00 57.75  ? 336  SER B O   1 
ATOM   6702 C CB  . SER B 1 336 ? 5.364   -4.121  -24.977 1.00 56.59  ? 336  SER B CB  1 
ATOM   6703 O OG  . SER B 1 336 ? 4.440   -3.739  -25.977 1.00 55.80  ? 336  SER B OG  1 
ATOM   6704 N N   . TYR B 1 337 ? 6.467   -4.716  -27.908 1.00 59.14  ? 337  TYR B N   1 
ATOM   6705 C CA  . TYR B 1 337 ? 6.470   -5.478  -29.149 1.00 60.54  ? 337  TYR B CA  1 
ATOM   6706 C C   . TYR B 1 337 ? 7.766   -6.230  -29.397 1.00 60.81  ? 337  TYR B C   1 
ATOM   6707 O O   . TYR B 1 337 ? 7.748   -7.420  -29.649 1.00 61.06  ? 337  TYR B O   1 
ATOM   6708 C CB  . TYR B 1 337 ? 6.224   -4.531  -30.308 1.00 61.54  ? 337  TYR B CB  1 
ATOM   6709 C CG  . TYR B 1 337 ? 5.916   -5.208  -31.613 1.00 62.54  ? 337  TYR B CG  1 
ATOM   6710 C CD1 . TYR B 1 337 ? 4.605   -5.548  -31.937 1.00 63.00  ? 337  TYR B CD1 1 
ATOM   6711 C CD2 . TYR B 1 337 ? 6.929   -5.471  -32.544 1.00 63.79  ? 337  TYR B CD2 1 
ATOM   6712 C CE1 . TYR B 1 337 ? 4.298   -6.148  -33.149 1.00 64.36  ? 337  TYR B CE1 1 
ATOM   6713 C CE2 . TYR B 1 337 ? 6.642   -6.077  -33.769 1.00 64.99  ? 337  TYR B CE2 1 
ATOM   6714 C CZ  . TYR B 1 337 ? 5.314   -6.419  -34.062 1.00 64.65  ? 337  TYR B CZ  1 
ATOM   6715 O OH  . TYR B 1 337 ? 4.991   -7.021  -35.262 1.00 64.12  ? 337  TYR B OH  1 
ATOM   6716 N N   . PHE B 1 338 ? 8.887   -5.527  -29.318 1.00 61.13  ? 338  PHE B N   1 
ATOM   6717 C CA  . PHE B 1 338 ? 10.175  -6.072  -29.709 1.00 61.71  ? 338  PHE B CA  1 
ATOM   6718 C C   . PHE B 1 338 ? 10.707  -7.137  -28.771 1.00 61.92  ? 338  PHE B C   1 
ATOM   6719 O O   . PHE B 1 338 ? 11.625  -7.876  -29.126 1.00 61.90  ? 338  PHE B O   1 
ATOM   6720 C CB  . PHE B 1 338 ? 11.199  -4.947  -29.825 1.00 62.16  ? 338  PHE B CB  1 
ATOM   6721 C CG  . PHE B 1 338 ? 10.756  -3.831  -30.706 1.00 62.79  ? 338  PHE B CG  1 
ATOM   6722 C CD1 . PHE B 1 338 ? 10.340  -2.626  -30.157 1.00 63.36  ? 338  PHE B CD1 1 
ATOM   6723 C CD2 . PHE B 1 338 ? 10.730  -3.991  -32.090 1.00 63.89  ? 338  PHE B CD2 1 
ATOM   6724 C CE1 . PHE B 1 338 ? 9.920   -1.585  -30.968 1.00 63.81  ? 338  PHE B CE1 1 
ATOM   6725 C CE2 . PHE B 1 338 ? 10.307  -2.961  -32.913 1.00 64.39  ? 338  PHE B CE2 1 
ATOM   6726 C CZ  . PHE B 1 338 ? 9.900   -1.749  -32.348 1.00 64.01  ? 338  PHE B CZ  1 
ATOM   6727 N N   . LEU B 1 339 ? 10.144  -7.202  -27.572 1.00 62.22  ? 339  LEU B N   1 
ATOM   6728 C CA  . LEU B 1 339 ? 10.580  -8.177  -26.593 1.00 62.46  ? 339  LEU B CA  1 
ATOM   6729 C C   . LEU B 1 339 ? 10.268  -9.594  -27.052 1.00 63.06  ? 339  LEU B C   1 
ATOM   6730 O O   . LEU B 1 339 ? 11.120  -10.473 -26.955 1.00 63.28  ? 339  LEU B O   1 
ATOM   6731 C CB  . LEU B 1 339 ? 9.940   -7.896  -25.242 1.00 62.24  ? 339  LEU B CB  1 
ATOM   6732 C CG  . LEU B 1 339 ? 10.324  -6.568  -24.600 1.00 61.18  ? 339  LEU B CG  1 
ATOM   6733 C CD1 . LEU B 1 339 ? 9.486   -6.344  -23.364 1.00 59.94  ? 339  LEU B CD1 1 
ATOM   6734 C CD2 . LEU B 1 339 ? 11.800  -6.547  -24.265 1.00 60.41  ? 339  LEU B CD2 1 
ATOM   6735 N N   . VAL B 1 340 ? 9.065   -9.807  -27.584 1.00 63.63  ? 340  VAL B N   1 
ATOM   6736 C CA  . VAL B 1 340 ? 8.639   -11.147 -27.999 1.00 64.25  ? 340  VAL B CA  1 
ATOM   6737 C C   . VAL B 1 340 ? 9.521   -11.709 -29.126 1.00 64.97  ? 340  VAL B C   1 
ATOM   6738 O O   . VAL B 1 340 ? 9.531   -12.914 -29.366 1.00 65.01  ? 340  VAL B O   1 
ATOM   6739 C CB  . VAL B 1 340 ? 7.103   -11.240 -28.362 1.00 64.05  ? 340  VAL B CB  1 
ATOM   6740 C CG1 . VAL B 1 340 ? 6.240   -10.405 -27.416 1.00 63.55  ? 340  VAL B CG1 1 
ATOM   6741 C CG2 . VAL B 1 340 ? 6.848   -10.833 -29.784 1.00 63.72  ? 340  VAL B CG2 1 
ATOM   6742 N N   . TYR B 1 341 ? 10.263  -10.834 -29.800 1.00 65.96  ? 341  TYR B N   1 
ATOM   6743 C CA  . TYR B 1 341 ? 11.219  -11.256 -30.829 1.00 67.28  ? 341  TYR B CA  1 
ATOM   6744 C C   . TYR B 1 341 ? 12.626  -11.513 -30.258 1.00 68.31  ? 341  TYR B C   1 
ATOM   6745 O O   . TYR B 1 341 ? 13.409  -10.578 -30.030 1.00 68.62  ? 341  TYR B O   1 
ATOM   6746 C CB  . TYR B 1 341 ? 11.270  -10.238 -31.975 1.00 67.05  ? 341  TYR B CB  1 
ATOM   6747 C CG  . TYR B 1 341 ? 10.043  -10.245 -32.853 1.00 66.78  ? 341  TYR B CG  1 
ATOM   6748 C CD1 . TYR B 1 341 ? 8.840   -9.699  -32.404 1.00 66.01  ? 341  TYR B CD1 1 
ATOM   6749 C CD2 . TYR B 1 341 ? 10.085  -10.793 -34.137 1.00 66.60  ? 341  TYR B CD2 1 
ATOM   6750 C CE1 . TYR B 1 341 ? 7.706   -9.705  -33.202 1.00 66.21  ? 341  TYR B CE1 1 
ATOM   6751 C CE2 . TYR B 1 341 ? 8.954   -10.801 -34.949 1.00 66.79  ? 341  TYR B CE2 1 
ATOM   6752 C CZ  . TYR B 1 341 ? 7.768   -10.257 -34.470 1.00 66.87  ? 341  TYR B CZ  1 
ATOM   6753 O OH  . TYR B 1 341 ? 6.643   -10.255 -35.259 1.00 67.16  ? 341  TYR B OH  1 
ATOM   6754 N N   . GLY B 1 342 ? 12.928  -12.787 -30.017 1.00 69.40  ? 342  GLY B N   1 
ATOM   6755 C CA  . GLY B 1 342 ? 14.230  -13.215 -29.480 1.00 70.83  ? 342  GLY B CA  1 
ATOM   6756 C C   . GLY B 1 342 ? 14.676  -12.749 -28.084 1.00 71.66  ? 342  GLY B C   1 
ATOM   6757 O O   . GLY B 1 342 ? 15.885  -12.759 -27.785 1.00 72.05  ? 342  GLY B O   1 
ATOM   6758 N N   . VAL B 1 343 ? 13.739  -12.341 -27.222 1.00 71.81  ? 343  VAL B N   1 
ATOM   6759 C CA  . VAL B 1 343 ? 14.110  -11.942 -25.853 1.00 71.96  ? 343  VAL B CA  1 
ATOM   6760 C C   . VAL B 1 343 ? 13.591  -12.935 -24.807 1.00 71.83  ? 343  VAL B C   1 
ATOM   6761 O O   . VAL B 1 343 ? 12.378  -13.032 -24.586 1.00 71.87  ? 343  VAL B O   1 
ATOM   6762 C CB  . VAL B 1 343 ? 13.696  -10.484 -25.518 1.00 72.04  ? 343  VAL B CB  1 
ATOM   6763 C CG1 . VAL B 1 343 ? 14.313  -10.030 -24.185 1.00 71.65  ? 343  VAL B CG1 1 
ATOM   6764 C CG2 . VAL B 1 343 ? 14.129  -9.555  -26.644 1.00 72.71  ? 343  VAL B CG2 1 
ATOM   6765 N N   . PRO B 1 344 ? 14.515  -13.684 -24.169 1.00 71.69  ? 344  PRO B N   1 
ATOM   6766 C CA  . PRO B 1 344 ? 14.135  -14.768 -23.257 1.00 71.62  ? 344  PRO B CA  1 
ATOM   6767 C C   . PRO B 1 344 ? 13.105  -14.312 -22.229 1.00 71.39  ? 344  PRO B C   1 
ATOM   6768 O O   . PRO B 1 344 ? 13.248  -13.226 -21.665 1.00 71.42  ? 344  PRO B O   1 
ATOM   6769 C CB  . PRO B 1 344 ? 15.459  -15.144 -22.571 1.00 71.69  ? 344  PRO B CB  1 
ATOM   6770 C CG  . PRO B 1 344 ? 16.514  -14.746 -23.549 1.00 71.97  ? 344  PRO B CG  1 
ATOM   6771 C CD  . PRO B 1 344 ? 15.981  -13.539 -24.280 1.00 71.76  ? 344  PRO B CD  1 
ATOM   6772 N N   . GLY B 1 345 ? 12.068  -15.127 -22.023 1.00 71.06  ? 345  GLY B N   1 
ATOM   6773 C CA  . GLY B 1 345 ? 11.059  -14.885 -20.995 1.00 70.54  ? 345  GLY B CA  1 
ATOM   6774 C C   . GLY B 1 345 ? 9.824   -14.185 -21.522 1.00 70.51  ? 345  GLY B C   1 
ATOM   6775 O O   . GLY B 1 345 ? 8.792   -14.117 -20.839 1.00 70.51  ? 345  GLY B O   1 
ATOM   6776 N N   . PHE B 1 346 ? 9.915   -13.664 -22.739 1.00 70.37  ? 346  PHE B N   1 
ATOM   6777 C CA  . PHE B 1 346 ? 8.826   -12.860 -23.276 1.00 70.53  ? 346  PHE B CA  1 
ATOM   6778 C C   . PHE B 1 346 ? 8.084   -13.565 -24.403 1.00 70.66  ? 346  PHE B C   1 
ATOM   6779 O O   . PHE B 1 346 ? 8.698   -14.095 -25.335 1.00 70.98  ? 346  PHE B O   1 
ATOM   6780 C CB  . PHE B 1 346 ? 9.330   -11.478 -23.719 1.00 70.47  ? 346  PHE B CB  1 
ATOM   6781 C CG  . PHE B 1 346 ? 9.769   -10.597 -22.579 1.00 69.97  ? 346  PHE B CG  1 
ATOM   6782 C CD1 . PHE B 1 346 ? 11.083  -10.645 -22.108 1.00 68.87  ? 346  PHE B CD1 1 
ATOM   6783 C CD2 . PHE B 1 346 ? 8.867   -9.720  -21.976 1.00 69.80  ? 346  PHE B CD2 1 
ATOM   6784 C CE1 . PHE B 1 346 ? 11.496  -9.838  -21.051 1.00 68.72  ? 346  PHE B CE1 1 
ATOM   6785 C CE2 . PHE B 1 346 ? 9.268   -8.903  -20.914 1.00 69.83  ? 346  PHE B CE2 1 
ATOM   6786 C CZ  . PHE B 1 346 ? 10.591  -8.963  -20.452 1.00 69.71  ? 346  PHE B CZ  1 
ATOM   6787 N N   . SER B 1 347 ? 6.758   -13.560 -24.303 1.00 70.48  ? 347  SER B N   1 
ATOM   6788 C CA  . SER B 1 347 ? 5.893   -14.205 -25.276 1.00 70.50  ? 347  SER B CA  1 
ATOM   6789 C C   . SER B 1 347 ? 4.483   -13.614 -25.250 1.00 70.37  ? 347  SER B C   1 
ATOM   6790 O O   . SER B 1 347 ? 4.032   -13.099 -24.224 1.00 70.25  ? 347  SER B O   1 
ATOM   6791 C CB  . SER B 1 347 ? 5.836   -15.705 -24.996 1.00 70.62  ? 347  SER B CB  1 
ATOM   6792 O OG  . SER B 1 347 ? 4.510   -16.195 -25.115 1.00 71.33  ? 347  SER B OG  1 
ATOM   6793 N N   . LYS B 1 348 ? 3.782   -13.709 -26.375 1.00 70.27  ? 348  LYS B N   1 
ATOM   6794 C CA  . LYS B 1 348 ? 2.415   -13.212 -26.449 1.00 70.44  ? 348  LYS B CA  1 
ATOM   6795 C C   . LYS B 1 348 ? 1.448   -14.150 -25.738 1.00 70.55  ? 348  LYS B C   1 
ATOM   6796 O O   . LYS B 1 348 ? 0.255   -13.850 -25.618 1.00 70.48  ? 348  LYS B O   1 
ATOM   6797 C CB  . LYS B 1 348 ? 1.976   -13.004 -27.905 1.00 70.53  ? 348  LYS B CB  1 
ATOM   6798 C CG  . LYS B 1 348 ? 1.629   -14.278 -28.670 1.00 71.02  ? 348  LYS B CG  1 
ATOM   6799 C CD  . LYS B 1 348 ? 0.350   -14.113 -29.491 1.00 72.39  ? 348  LYS B CD  1 
ATOM   6800 C CE  . LYS B 1 348 ? 0.141   -15.277 -30.450 1.00 72.79  ? 348  LYS B CE  1 
ATOM   6801 N NZ  . LYS B 1 348 ? 0.087   -16.604 -29.763 1.00 73.12  ? 348  LYS B NZ  1 
ATOM   6802 N N   . ASP B 1 349 ? 1.970   -15.279 -25.260 1.00 70.75  ? 349  ASP B N   1 
ATOM   6803 C CA  . ASP B 1 349 ? 1.124   -16.363 -24.753 1.00 70.96  ? 349  ASP B CA  1 
ATOM   6804 C C   . ASP B 1 349 ? 0.980   -16.411 -23.217 1.00 71.22  ? 349  ASP B C   1 
ATOM   6805 O O   . ASP B 1 349 ? -0.100  -16.713 -22.724 1.00 71.33  ? 349  ASP B O   1 
ATOM   6806 C CB  . ASP B 1 349 ? 1.528   -17.729 -25.365 1.00 70.90  ? 349  ASP B CB  1 
ATOM   6807 C CG  . ASP B 1 349 ? 1.157   -17.858 -26.867 1.00 69.99  ? 349  ASP B CG  1 
ATOM   6808 O OD1 . ASP B 1 349 ? -0.023  -17.643 -27.235 1.00 68.06  ? 349  ASP B OD1 1 
ATOM   6809 O OD2 . ASP B 1 349 ? 2.050   -18.192 -27.678 1.00 68.88  ? 349  ASP B OD2 1 
ATOM   6810 N N   . ASN B 1 350 ? 2.041   -16.110 -22.466 1.00 71.57  ? 350  ASN B N   1 
ATOM   6811 C CA  . ASN B 1 350 ? 1.891   -15.876 -21.016 1.00 72.00  ? 350  ASN B CA  1 
ATOM   6812 C C   . ASN B 1 350 ? 2.023   -14.398 -20.628 1.00 72.24  ? 350  ASN B C   1 
ATOM   6813 O O   . ASN B 1 350 ? 2.323   -13.552 -21.478 1.00 72.24  ? 350  ASN B O   1 
ATOM   6814 C CB  . ASN B 1 350 ? 2.809   -16.777 -20.164 1.00 71.99  ? 350  ASN B CB  1 
ATOM   6815 C CG  . ASN B 1 350 ? 4.225   -16.887 -20.719 1.00 72.84  ? 350  ASN B CG  1 
ATOM   6816 O OD1 . ASN B 1 350 ? 4.809   -15.906 -21.174 1.00 73.86  ? 350  ASN B OD1 1 
ATOM   6817 N ND2 . ASN B 1 350 ? 4.786   -18.093 -20.670 1.00 73.56  ? 350  ASN B ND2 1 
ATOM   6818 N N   . GLU B 1 351 ? 1.782   -14.092 -19.350 1.00 72.48  ? 351  GLU B N   1 
ATOM   6819 C CA  . GLU B 1 351 ? 1.875   -12.722 -18.827 1.00 72.56  ? 351  GLU B CA  1 
ATOM   6820 C C   . GLU B 1 351 ? 3.316   -12.182 -18.759 1.00 72.08  ? 351  GLU B C   1 
ATOM   6821 O O   . GLU B 1 351 ? 3.534   -11.010 -18.453 1.00 72.12  ? 351  GLU B O   1 
ATOM   6822 C CB  . GLU B 1 351 ? 1.203   -12.630 -17.459 1.00 72.49  ? 351  GLU B CB  1 
ATOM   6823 C CG  . GLU B 1 351 ? -0.282  -12.294 -17.506 1.00 73.12  ? 351  GLU B CG  1 
ATOM   6824 C CD  . GLU B 1 351 ? -0.907  -12.144 -16.107 1.00 73.81  ? 351  GLU B CD  1 
ATOM   6825 O OE1 . GLU B 1 351 ? -0.267  -12.516 -15.092 1.00 74.52  ? 351  GLU B OE1 1 
ATOM   6826 O OE2 . GLU B 1 351 ? -2.055  -11.654 -16.019 1.00 76.38  ? 351  GLU B OE2 1 
ATOM   6827 N N   . SER B 1 352 ? 4.286   -13.050 -19.041 1.00 71.69  ? 352  SER B N   1 
ATOM   6828 C CA  . SER B 1 352 ? 5.697   -12.677 -19.199 1.00 71.32  ? 352  SER B CA  1 
ATOM   6829 C C   . SER B 1 352 ? 6.354   -12.081 -17.950 1.00 70.99  ? 352  SER B C   1 
ATOM   6830 O O   . SER B 1 352 ? 7.267   -11.269 -18.056 1.00 70.95  ? 352  SER B O   1 
ATOM   6831 C CB  . SER B 1 352 ? 5.878   -11.748 -20.404 1.00 71.43  ? 352  SER B CB  1 
ATOM   6832 O OG  . SER B 1 352 ? 5.157   -12.229 -21.528 1.00 71.68  ? 352  SER B OG  1 
ATOM   6833 N N   . LEU B 1 353 ? 5.897   -12.503 -16.773 1.00 70.60  ? 353  LEU B N   1 
ATOM   6834 C CA  . LEU B 1 353 ? 6.505   -12.096 -15.514 1.00 70.14  ? 353  LEU B CA  1 
ATOM   6835 C C   . LEU B 1 353 ? 7.893   -12.720 -15.435 1.00 70.07  ? 353  LEU B C   1 
ATOM   6836 O O   . LEU B 1 353 ? 8.033   -13.927 -15.504 1.00 69.85  ? 353  LEU B O   1 
ATOM   6837 C CB  . LEU B 1 353 ? 5.630   -12.523 -14.328 1.00 69.98  ? 353  LEU B CB  1 
ATOM   6838 C CG  . LEU B 1 353 ? 4.129   -12.165 -14.337 1.00 70.18  ? 353  LEU B CG  1 
ATOM   6839 C CD1 . LEU B 1 353 ? 3.352   -12.960 -13.282 1.00 70.77  ? 353  LEU B CD1 1 
ATOM   6840 C CD2 . LEU B 1 353 ? 3.849   -10.667 -14.173 1.00 69.78  ? 353  LEU B CD2 1 
ATOM   6841 N N   . ILE B 1 354 ? 8.923   -11.891 -15.311 1.00 70.35  ? 354  ILE B N   1 
ATOM   6842 C CA  . ILE B 1 354 ? 10.303  -12.379 -15.396 1.00 70.49  ? 354  ILE B CA  1 
ATOM   6843 C C   . ILE B 1 354 ? 11.132  -12.281 -14.108 1.00 70.86  ? 354  ILE B C   1 
ATOM   6844 O O   . ILE B 1 354 ? 10.835  -11.494 -13.210 1.00 70.67  ? 354  ILE B O   1 
ATOM   6845 C CB  . ILE B 1 354 ? 11.072  -11.694 -16.539 1.00 70.47  ? 354  ILE B CB  1 
ATOM   6846 C CG1 . ILE B 1 354 ? 10.960  -10.165 -16.429 1.00 70.11  ? 354  ILE B CG1 1 
ATOM   6847 C CG2 . ILE B 1 354 ? 10.560  -12.189 -17.873 1.00 70.27  ? 354  ILE B CG2 1 
ATOM   6848 C CD1 . ILE B 1 354 ? 12.173  -9.413  -16.944 1.00 69.13  ? 354  ILE B CD1 1 
ATOM   6849 N N   . SER B 1 355 ? 12.177  -13.100 -14.049 1.00 71.49  ? 355  SER B N   1 
ATOM   6850 C CA  . SER B 1 355 ? 13.125  -13.116 -12.944 1.00 72.15  ? 355  SER B CA  1 
ATOM   6851 C C   . SER B 1 355 ? 14.124  -11.989 -13.131 1.00 72.66  ? 355  SER B C   1 
ATOM   6852 O O   . SER B 1 355 ? 14.390  -11.572 -14.266 1.00 72.81  ? 355  SER B O   1 
ATOM   6853 C CB  . SER B 1 355 ? 13.892  -14.442 -12.927 1.00 72.27  ? 355  SER B CB  1 
ATOM   6854 O OG  . SER B 1 355 ? 14.992  -14.417 -13.835 1.00 72.27  ? 355  SER B OG  1 
ATOM   6855 N N   . ARG B 1 356 ? 14.705  -11.526 -12.027 1.00 73.06  ? 356  ARG B N   1 
ATOM   6856 C CA  . ARG B 1 356 ? 15.758  -10.525 -12.104 1.00 73.44  ? 356  ARG B CA  1 
ATOM   6857 C C   . ARG B 1 356 ? 16.917  -10.983 -12.996 1.00 73.65  ? 356  ARG B C   1 
ATOM   6858 O O   . ARG B 1 356 ? 17.425  -10.202 -13.794 1.00 73.92  ? 356  ARG B O   1 
ATOM   6859 C CB  . ARG B 1 356 ? 16.256  -10.120 -10.712 1.00 73.55  ? 356  ARG B CB  1 
ATOM   6860 C CG  . ARG B 1 356 ? 17.361  -9.064  -10.748 1.00 73.69  ? 356  ARG B CG  1 
ATOM   6861 C CD  . ARG B 1 356 ? 17.254  -8.053  -9.613  1.00 73.81  ? 356  ARG B CD  1 
ATOM   6862 N NE  . ARG B 1 356 ? 18.256  -7.000  -9.772  1.00 74.08  ? 356  ARG B NE  1 
ATOM   6863 C CZ  . ARG B 1 356 ? 17.999  -5.766  -10.198 1.00 74.61  ? 356  ARG B CZ  1 
ATOM   6864 N NH1 . ARG B 1 356 ? 16.757  -5.400  -10.492 1.00 75.11  ? 356  ARG B NH1 1 
ATOM   6865 N NH2 . ARG B 1 356 ? 18.987  -4.888  -10.319 1.00 74.87  ? 356  ARG B NH2 1 
ATOM   6866 N N   . ALA B 1 357 ? 17.326  -12.241 -12.886 1.00 73.91  ? 357  ALA B N   1 
ATOM   6867 C CA  . ALA B 1 357 ? 18.447  -12.711 -13.702 1.00 74.23  ? 357  ALA B CA  1 
ATOM   6868 C C   . ALA B 1 357 ? 18.130  -12.591 -15.201 1.00 74.23  ? 357  ALA B C   1 
ATOM   6869 O O   . ALA B 1 357 ? 18.975  -12.144 -15.991 1.00 74.06  ? 357  ALA B O   1 
ATOM   6870 C CB  . ALA B 1 357 ? 18.847  -14.132 -13.321 1.00 74.36  ? 357  ALA B CB  1 
ATOM   6871 N N   . GLN B 1 358 ? 16.899  -12.962 -15.566 1.00 74.26  ? 358  GLN B N   1 
ATOM   6872 C CA  . GLN B 1 358 ? 16.382  -12.804 -16.934 1.00 74.24  ? 358  GLN B CA  1 
ATOM   6873 C C   . GLN B 1 358 ? 16.512  -11.350 -17.429 1.00 74.00  ? 358  GLN B C   1 
ATOM   6874 O O   . GLN B 1 358 ? 16.908  -11.100 -18.580 1.00 73.84  ? 358  GLN B O   1 
ATOM   6875 C CB  . GLN B 1 358 ? 14.916  -13.263 -17.007 1.00 74.15  ? 358  GLN B CB  1 
ATOM   6876 C CG  . GLN B 1 358 ? 14.729  -14.781 -16.962 1.00 74.21  ? 358  GLN B CG  1 
ATOM   6877 C CD  . GLN B 1 358 ? 13.260  -15.204 -16.924 1.00 74.34  ? 358  GLN B CD  1 
ATOM   6878 O OE1 . GLN B 1 358 ? 12.544  -14.919 -15.966 1.00 74.12  ? 358  GLN B OE1 1 
ATOM   6879 N NE2 . GLN B 1 358 ? 12.814  -15.900 -17.968 1.00 74.15  ? 358  GLN B NE2 1 
ATOM   6880 N N   . PHE B 1 359 ? 16.191  -10.415 -16.532 1.00 73.49  ? 359  PHE B N   1 
ATOM   6881 C CA  . PHE B 1 359 ? 16.207  -8.986  -16.811 1.00 72.97  ? 359  PHE B CA  1 
ATOM   6882 C C   . PHE B 1 359 ? 17.610  -8.471  -17.091 1.00 72.80  ? 359  PHE B C   1 
ATOM   6883 O O   . PHE B 1 359 ? 17.783  -7.588  -17.916 1.00 72.68  ? 359  PHE B O   1 
ATOM   6884 C CB  . PHE B 1 359 ? 15.553  -8.214  -15.654 1.00 72.83  ? 359  PHE B CB  1 
ATOM   6885 C CG  . PHE B 1 359 ? 15.640  -6.711  -15.777 1.00 72.88  ? 359  PHE B CG  1 
ATOM   6886 C CD1 . PHE B 1 359 ? 16.599  -5.994  -15.062 1.00 72.60  ? 359  PHE B CD1 1 
ATOM   6887 C CD2 . PHE B 1 359 ? 14.759  -6.010  -16.593 1.00 72.91  ? 359  PHE B CD2 1 
ATOM   6888 C CE1 . PHE B 1 359 ? 16.688  -4.604  -15.168 1.00 72.01  ? 359  PHE B CE1 1 
ATOM   6889 C CE2 . PHE B 1 359 ? 14.844  -4.618  -16.708 1.00 72.53  ? 359  PHE B CE2 1 
ATOM   6890 C CZ  . PHE B 1 359 ? 15.809  -3.918  -15.991 1.00 72.06  ? 359  PHE B CZ  1 
ATOM   6891 N N   . LEU B 1 360 ? 18.612  -9.022  -16.422 1.00 72.91  ? 360  LEU B N   1 
ATOM   6892 C CA  . LEU B 1 360 ? 19.967  -8.508  -16.603 1.00 73.33  ? 360  LEU B CA  1 
ATOM   6893 C C   . LEU B 1 360 ? 20.529  -8.972  -17.926 1.00 73.26  ? 360  LEU B C   1 
ATOM   6894 O O   . LEU B 1 360 ? 21.256  -8.230  -18.583 1.00 73.18  ? 360  LEU B O   1 
ATOM   6895 C CB  . LEU B 1 360 ? 20.905  -8.896  -15.450 1.00 73.56  ? 360  LEU B CB  1 
ATOM   6896 C CG  . LEU B 1 360 ? 20.438  -8.761  -13.985 1.00 74.37  ? 360  LEU B CG  1 
ATOM   6897 C CD1 . LEU B 1 360 ? 21.596  -9.030  -13.026 1.00 75.84  ? 360  LEU B CD1 1 
ATOM   6898 C CD2 . LEU B 1 360 ? 19.793  -7.418  -13.650 1.00 74.30  ? 360  LEU B CD2 1 
ATOM   6899 N N   . ALA B 1 361 ? 20.179  -10.197 -18.314 1.00 73.31  ? 361  ALA B N   1 
ATOM   6900 C CA  . ALA B 1 361 ? 20.590  -10.735 -19.604 1.00 73.48  ? 361  ALA B CA  1 
ATOM   6901 C C   . ALA B 1 361 ? 19.766  -10.089 -20.706 1.00 73.60  ? 361  ALA B C   1 
ATOM   6902 O O   . ALA B 1 361 ? 20.262  -9.876  -21.820 1.00 73.46  ? 361  ALA B O   1 
ATOM   6903 C CB  . ALA B 1 361 ? 20.440  -12.242 -19.638 1.00 73.51  ? 361  ALA B CB  1 
ATOM   6904 N N   . GLY B 1 362 ? 18.509  -9.777  -20.374 1.00 73.73  ? 362  GLY B N   1 
ATOM   6905 C CA  . GLY B 1 362 ? 17.593  -9.061  -21.270 1.00 73.71  ? 362  GLY B CA  1 
ATOM   6906 C C   . GLY B 1 362 ? 18.107  -7.689  -21.678 1.00 73.77  ? 362  GLY B C   1 
ATOM   6907 O O   . GLY B 1 362 ? 17.892  -7.252  -22.809 1.00 73.73  ? 362  GLY B O   1 
ATOM   6908 N N   . VAL B 1 363 ? 18.788  -7.015  -20.749 1.00 73.88  ? 363  VAL B N   1 
ATOM   6909 C CA  . VAL B 1 363 ? 19.409  -5.712  -20.999 1.00 73.76  ? 363  VAL B CA  1 
ATOM   6910 C C   . VAL B 1 363 ? 20.661  -5.838  -21.872 1.00 73.98  ? 363  VAL B C   1 
ATOM   6911 O O   . VAL B 1 363 ? 20.890  -4.999  -22.740 1.00 73.92  ? 363  VAL B O   1 
ATOM   6912 C CB  . VAL B 1 363 ? 19.714  -4.966  -19.677 1.00 73.57  ? 363  VAL B CB  1 
ATOM   6913 C CG1 . VAL B 1 363 ? 20.666  -3.814  -19.902 1.00 73.84  ? 363  VAL B CG1 1 
ATOM   6914 C CG2 . VAL B 1 363 ? 18.437  -4.452  -19.064 1.00 73.30  ? 363  VAL B CG2 1 
ATOM   6915 N N   . ARG B 1 364 ? 21.458  -6.886  -21.654 1.00 74.44  ? 364  ARG B N   1 
ATOM   6916 C CA  . ARG B 1 364 ? 22.640  -7.129  -22.488 1.00 74.90  ? 364  ARG B CA  1 
ATOM   6917 C C   . ARG B 1 364 ? 22.201  -7.386  -23.917 1.00 75.08  ? 364  ARG B C   1 
ATOM   6918 O O   . ARG B 1 364 ? 22.938  -7.126  -24.857 1.00 75.21  ? 364  ARG B O   1 
ATOM   6919 C CB  . ARG B 1 364 ? 23.472  -8.315  -21.987 1.00 74.99  ? 364  ARG B CB  1 
ATOM   6920 C CG  . ARG B 1 364 ? 24.077  -8.206  -20.573 1.00 75.94  ? 364  ARG B CG  1 
ATOM   6921 C CD  . ARG B 1 364 ? 24.871  -6.924  -20.319 1.00 77.85  ? 364  ARG B CD  1 
ATOM   6922 N NE  . ARG B 1 364 ? 26.158  -6.836  -21.021 1.00 80.23  ? 364  ARG B NE  1 
ATOM   6923 C CZ  . ARG B 1 364 ? 27.351  -6.683  -20.429 1.00 81.52  ? 364  ARG B CZ  1 
ATOM   6924 N NH1 . ARG B 1 364 ? 27.453  -6.610  -19.104 1.00 82.43  ? 364  ARG B NH1 1 
ATOM   6925 N NH2 . ARG B 1 364 ? 28.458  -6.601  -21.162 1.00 81.37  ? 364  ARG B NH2 1 
ATOM   6926 N N   . ILE B 1 365 ? 20.981  -7.885  -24.069 1.00 75.57  ? 365  ILE B N   1 
ATOM   6927 C CA  . ILE B 1 365 ? 20.419  -8.176  -25.385 1.00 76.09  ? 365  ILE B CA  1 
ATOM   6928 C C   . ILE B 1 365 ? 19.758  -6.939  -26.017 1.00 76.33  ? 365  ILE B C   1 
ATOM   6929 O O   . ILE B 1 365 ? 20.013  -6.630  -27.190 1.00 76.71  ? 365  ILE B O   1 
ATOM   6930 C CB  . ILE B 1 365 ? 19.499  -9.441  -25.333 1.00 76.14  ? 365  ILE B CB  1 
ATOM   6931 C CG1 . ILE B 1 365 ? 20.368  -10.697 -25.475 1.00 76.81  ? 365  ILE B CG1 1 
ATOM   6932 C CG2 . ILE B 1 365 ? 18.425  -9.431  -26.420 1.00 75.95  ? 365  ILE B CG2 1 
ATOM   6933 C CD1 . ILE B 1 365 ? 19.865  -11.926 -24.719 1.00 78.42  ? 365  ILE B CD1 1 
ATOM   6934 N N   . GLY B 1 366 ? 18.944  -6.227  -25.234 1.00 76.36  ? 366  GLY B N   1 
ATOM   6935 C CA  . GLY B 1 366 ? 18.255  -5.010  -25.695 1.00 76.32  ? 366  GLY B CA  1 
ATOM   6936 C C   . GLY B 1 366 ? 19.170  -3.830  -25.990 1.00 76.33  ? 366  GLY B C   1 
ATOM   6937 O O   . GLY B 1 366 ? 18.912  -3.034  -26.897 1.00 76.52  ? 366  GLY B O   1 
ATOM   6938 N N   . VAL B 1 367 ? 20.235  -3.705  -25.211 1.00 76.23  ? 367  VAL B N   1 
ATOM   6939 C CA  . VAL B 1 367 ? 21.252  -2.709  -25.479 1.00 76.24  ? 367  VAL B CA  1 
ATOM   6940 C C   . VAL B 1 367 ? 22.525  -3.478  -25.771 1.00 76.44  ? 367  VAL B C   1 
ATOM   6941 O O   . VAL B 1 367 ? 23.378  -3.646  -24.898 1.00 76.48  ? 367  VAL B O   1 
ATOM   6942 C CB  . VAL B 1 367 ? 21.448  -1.752  -24.294 1.00 76.21  ? 367  VAL B CB  1 
ATOM   6943 C CG1 . VAL B 1 367 ? 22.271  -0.539  -24.718 1.00 75.83  ? 367  VAL B CG1 1 
ATOM   6944 C CG2 . VAL B 1 367 ? 20.098  -1.314  -23.741 1.00 76.16  ? 367  VAL B CG2 1 
ATOM   6945 N N   . PRO B 1 368 ? 22.650  -3.974  -27.007 1.00 76.68  ? 368  PRO B N   1 
ATOM   6946 C CA  . PRO B 1 368 ? 23.788  -4.829  -27.316 1.00 76.82  ? 368  PRO B CA  1 
ATOM   6947 C C   . PRO B 1 368 ? 25.070  -4.022  -27.514 1.00 76.83  ? 368  PRO B C   1 
ATOM   6948 O O   . PRO B 1 368 ? 26.153  -4.595  -27.544 1.00 76.47  ? 368  PRO B O   1 
ATOM   6949 C CB  . PRO B 1 368 ? 23.358  -5.531  -28.605 1.00 76.90  ? 368  PRO B CB  1 
ATOM   6950 C CG  . PRO B 1 368 ? 22.403  -4.578  -29.253 1.00 76.97  ? 368  PRO B CG  1 
ATOM   6951 C CD  . PRO B 1 368 ? 21.770  -3.758  -28.171 1.00 76.72  ? 368  PRO B CD  1 
ATOM   6952 N N   . GLN B 1 369 ? 24.935  -2.704  -27.628 1.00 77.12  ? 369  GLN B N   1 
ATOM   6953 C CA  . GLN B 1 369 ? 26.089  -1.817  -27.715 1.00 77.74  ? 369  GLN B CA  1 
ATOM   6954 C C   . GLN B 1 369 ? 26.772  -1.704  -26.354 1.00 77.60  ? 369  GLN B C   1 
ATOM   6955 O O   . GLN B 1 369 ? 27.959  -1.373  -26.281 1.00 77.71  ? 369  GLN B O   1 
ATOM   6956 C CB  . GLN B 1 369 ? 25.693  -0.408  -28.190 1.00 78.02  ? 369  GLN B CB  1 
ATOM   6957 C CG  . GLN B 1 369 ? 24.742  -0.345  -29.394 1.00 80.14  ? 369  GLN B CG  1 
ATOM   6958 C CD  . GLN B 1 369 ? 23.278  -0.175  -28.982 1.00 82.30  ? 369  GLN B CD  1 
ATOM   6959 O OE1 . GLN B 1 369 ? 22.964  0.603   -28.075 1.00 82.73  ? 369  GLN B OE1 1 
ATOM   6960 N NE2 . GLN B 1 369 ? 22.377  -0.896  -29.656 1.00 82.68  ? 369  GLN B NE2 1 
ATOM   6961 N N   . ALA B 1 370 ? 26.020  -1.995  -25.287 1.00 77.28  ? 370  ALA B N   1 
ATOM   6962 C CA  . ALA B 1 370 ? 26.435  -1.708  -23.902 1.00 76.80  ? 370  ALA B CA  1 
ATOM   6963 C C   . ALA B 1 370 ? 27.643  -2.492  -23.378 1.00 76.64  ? 370  ALA B C   1 
ATOM   6964 O O   . ALA B 1 370 ? 27.695  -3.725  -23.487 1.00 76.65  ? 370  ALA B O   1 
ATOM   6965 C CB  . ALA B 1 370 ? 25.253  -1.873  -22.957 1.00 76.59  ? 370  ALA B CB  1 
ATOM   6966 N N   . SER B 1 371 ? 28.601  -1.765  -22.798 1.00 76.29  ? 371  SER B N   1 
ATOM   6967 C CA  . SER B 1 371 ? 29.727  -2.377  -22.087 1.00 76.07  ? 371  SER B CA  1 
ATOM   6968 C C   . SER B 1 371 ? 29.244  -2.923  -20.743 1.00 75.85  ? 371  SER B C   1 
ATOM   6969 O O   . SER B 1 371 ? 28.096  -2.665  -20.349 1.00 75.90  ? 371  SER B O   1 
ATOM   6970 C CB  . SER B 1 371 ? 30.862  -1.363  -21.884 1.00 76.22  ? 371  SER B CB  1 
ATOM   6971 O OG  . SER B 1 371 ? 30.478  -0.299  -21.024 1.00 76.46  ? 371  SER B OG  1 
ATOM   6972 N N   . ASP B 1 372 ? 30.101  -3.671  -20.042 1.00 75.26  ? 372  ASP B N   1 
ATOM   6973 C CA  . ASP B 1 372 ? 29.742  -4.205  -18.721 1.00 74.76  ? 372  ASP B CA  1 
ATOM   6974 C C   . ASP B 1 372 ? 29.125  -3.121  -17.845 1.00 73.61  ? 372  ASP B C   1 
ATOM   6975 O O   . ASP B 1 372 ? 28.019  -3.271  -17.315 1.00 73.37  ? 372  ASP B O   1 
ATOM   6976 C CB  . ASP B 1 372 ? 30.968  -4.792  -18.023 1.00 75.39  ? 372  ASP B CB  1 
ATOM   6977 C CG  . ASP B 1 372 ? 31.394  -6.127  -18.615 1.00 77.38  ? 372  ASP B CG  1 
ATOM   6978 O OD1 . ASP B 1 372 ? 30.654  -7.127  -18.433 1.00 78.88  ? 372  ASP B OD1 1 
ATOM   6979 O OD2 . ASP B 1 372 ? 32.475  -6.172  -19.256 1.00 79.18  ? 372  ASP B OD2 1 
ATOM   6980 N N   . LEU B 1 373 ? 29.851  -2.016  -17.743 1.00 72.26  ? 373  LEU B N   1 
ATOM   6981 C CA  . LEU B 1 373 ? 29.475  -0.889  -16.916 1.00 71.05  ? 373  LEU B CA  1 
ATOM   6982 C C   . LEU B 1 373 ? 28.130  -0.269  -17.291 1.00 70.30  ? 373  LEU B C   1 
ATOM   6983 O O   . LEU B 1 373 ? 27.253  -0.120  -16.441 1.00 70.16  ? 373  LEU B O   1 
ATOM   6984 C CB  . LEU B 1 373 ? 30.581  0.158   -16.988 1.00 71.01  ? 373  LEU B CB  1 
ATOM   6985 C CG  . LEU B 1 373 ? 30.660  1.221   -15.904 1.00 70.72  ? 373  LEU B CG  1 
ATOM   6986 C CD1 . LEU B 1 373 ? 30.365  0.646   -14.518 1.00 70.26  ? 373  LEU B CD1 1 
ATOM   6987 C CD2 . LEU B 1 373 ? 32.044  1.835   -15.962 1.00 70.83  ? 373  LEU B CD2 1 
ATOM   6988 N N   . ALA B 1 374 ? 27.974  0.093   -18.562 1.00 69.34  ? 374  ALA B N   1 
ATOM   6989 C CA  . ALA B 1 374 ? 26.753  0.745   -19.038 1.00 68.35  ? 374  ALA B CA  1 
ATOM   6990 C C   . ALA B 1 374 ? 25.526  -0.152  -18.896 1.00 67.68  ? 374  ALA B C   1 
ATOM   6991 O O   . ALA B 1 374 ? 24.425  0.340   -18.678 1.00 67.61  ? 374  ALA B O   1 
ATOM   6992 C CB  . ALA B 1 374 ? 26.916  1.207   -20.470 1.00 68.35  ? 374  ALA B CB  1 
ATOM   6993 N N   . ALA B 1 375 ? 25.721  -1.463  -19.019 1.00 66.71  ? 375  ALA B N   1 
ATOM   6994 C CA  . ALA B 1 375 ? 24.668  -2.411  -18.725 1.00 65.81  ? 375  ALA B CA  1 
ATOM   6995 C C   . ALA B 1 375 ? 24.281  -2.216  -17.277 1.00 65.53  ? 375  ALA B C   1 
ATOM   6996 O O   . ALA B 1 375 ? 23.104  -2.048  -16.952 1.00 65.67  ? 375  ALA B O   1 
ATOM   6997 C CB  . ALA B 1 375 ? 25.150  -3.808  -18.946 1.00 65.63  ? 375  ALA B CB  1 
ATOM   6998 N N   . GLU B 1 376 ? 25.291  -2.204  -16.411 1.00 65.05  ? 376  GLU B N   1 
ATOM   6999 C CA  . GLU B 1 376 ? 25.073  -2.071  -14.981 1.00 64.58  ? 376  GLU B CA  1 
ATOM   7000 C C   . GLU B 1 376 ? 24.327  -0.767  -14.690 1.00 63.63  ? 376  GLU B C   1 
ATOM   7001 O O   . GLU B 1 376 ? 23.354  -0.750  -13.930 1.00 63.39  ? 376  GLU B O   1 
ATOM   7002 C CB  . GLU B 1 376 ? 26.411  -2.171  -14.229 1.00 64.75  ? 376  GLU B CB  1 
ATOM   7003 C CG  . GLU B 1 376 ? 26.315  -2.675  -12.783 1.00 67.61  ? 376  GLU B CG  1 
ATOM   7004 C CD  . GLU B 1 376 ? 25.375  -3.888  -12.608 1.00 72.13  ? 376  GLU B CD  1 
ATOM   7005 O OE1 . GLU B 1 376 ? 25.554  -4.918  -13.319 1.00 73.70  ? 376  GLU B OE1 1 
ATOM   7006 O OE2 . GLU B 1 376 ? 24.453  -3.809  -11.751 1.00 72.95  ? 376  GLU B OE2 1 
ATOM   7007 N N   . ALA B 1 377 ? 24.760  0.311   -15.337 1.00 62.62  ? 377  ALA B N   1 
ATOM   7008 C CA  . ALA B 1 377 ? 24.103  1.599   -15.199 1.00 61.68  ? 377  ALA B CA  1 
ATOM   7009 C C   . ALA B 1 377 ? 22.631  1.476   -15.574 1.00 61.06  ? 377  ALA B C   1 
ATOM   7010 O O   . ALA B 1 377 ? 21.761  1.850   -14.797 1.00 61.16  ? 377  ALA B O   1 
ATOM   7011 C CB  . ALA B 1 377 ? 24.794  2.642   -16.055 1.00 61.61  ? 377  ALA B CB  1 
ATOM   7012 N N   . VAL B 1 378 ? 22.365  0.920   -16.752 1.00 60.15  ? 378  VAL B N   1 
ATOM   7013 C CA  . VAL B 1 378 ? 21.008  0.760   -17.239 1.00 59.29  ? 378  VAL B CA  1 
ATOM   7014 C C   . VAL B 1 378 ? 20.213  -0.078  -16.269 1.00 58.89  ? 378  VAL B C   1 
ATOM   7015 O O   . VAL B 1 378 ? 19.091  0.273   -15.912 1.00 59.07  ? 378  VAL B O   1 
ATOM   7016 C CB  . VAL B 1 378 ? 20.965  0.134   -18.649 1.00 59.28  ? 378  VAL B CB  1 
ATOM   7017 C CG1 . VAL B 1 378 ? 19.557  -0.395  -18.982 1.00 58.88  ? 378  VAL B CG1 1 
ATOM   7018 C CG2 . VAL B 1 378 ? 21.388  1.169   -19.673 1.00 59.20  ? 378  VAL B CG2 1 
ATOM   7019 N N   . VAL B 1 379 ? 20.796  -1.180  -15.829 1.00 58.26  ? 379  VAL B N   1 
ATOM   7020 C CA  . VAL B 1 379 ? 20.115  -2.028  -14.878 1.00 57.99  ? 379  VAL B CA  1 
ATOM   7021 C C   . VAL B 1 379 ? 19.770  -1.223  -13.631 1.00 57.82  ? 379  VAL B C   1 
ATOM   7022 O O   . VAL B 1 379 ? 18.609  -1.196  -13.197 1.00 58.11  ? 379  VAL B O   1 
ATOM   7023 C CB  . VAL B 1 379 ? 20.951  -3.260  -14.520 1.00 58.01  ? 379  VAL B CB  1 
ATOM   7024 C CG1 . VAL B 1 379 ? 20.460  -3.874  -13.229 1.00 58.05  ? 379  VAL B CG1 1 
ATOM   7025 C CG2 . VAL B 1 379 ? 20.889  -4.273  -15.651 1.00 58.06  ? 379  VAL B CG2 1 
ATOM   7026 N N   . LEU B 1 380 ? 20.762  -0.530  -13.082 1.00 57.26  ? 380  LEU B N   1 
ATOM   7027 C CA  . LEU B 1 380 ? 20.561  0.144   -11.811 1.00 56.98  ? 380  LEU B CA  1 
ATOM   7028 C C   . LEU B 1 380 ? 19.589  1.300   -11.919 1.00 56.19  ? 380  LEU B C   1 
ATOM   7029 O O   . LEU B 1 380 ? 18.841  1.569   -10.983 1.00 56.41  ? 380  LEU B O   1 
ATOM   7030 C CB  . LEU B 1 380 ? 21.891  0.567   -11.181 1.00 57.42  ? 380  LEU B CB  1 
ATOM   7031 C CG  . LEU B 1 380 ? 22.868  -0.583  -10.841 1.00 58.70  ? 380  LEU B CG  1 
ATOM   7032 C CD1 . LEU B 1 380 ? 24.067  -0.072  -10.050 1.00 59.78  ? 380  LEU B CD1 1 
ATOM   7033 C CD2 . LEU B 1 380 ? 22.221  -1.791  -10.112 1.00 58.76  ? 380  LEU B CD2 1 
ATOM   7034 N N   . HIS B 1 381 ? 19.582  1.960   -13.070 1.00 55.23  ? 381  HIS B N   1 
ATOM   7035 C CA  . HIS B 1 381 ? 18.661  3.065   -13.317 1.00 54.37  ? 381  HIS B CA  1 
ATOM   7036 C C   . HIS B 1 381 ? 17.219  2.599   -13.374 1.00 53.45  ? 381  HIS B C   1 
ATOM   7037 O O   . HIS B 1 381 ? 16.338  3.203   -12.766 1.00 53.01  ? 381  HIS B O   1 
ATOM   7038 C CB  . HIS B 1 381 ? 18.997  3.787   -14.626 1.00 54.60  ? 381  HIS B CB  1 
ATOM   7039 C CG  . HIS B 1 381 ? 17.991  4.830   -15.003 1.00 55.22  ? 381  HIS B CG  1 
ATOM   7040 N ND1 . HIS B 1 381 ? 18.101  6.147   -14.607 1.00 56.66  ? 381  HIS B ND1 1 
ATOM   7041 C CD2 . HIS B 1 381 ? 16.842  4.745   -15.713 1.00 55.15  ? 381  HIS B CD2 1 
ATOM   7042 C CE1 . HIS B 1 381 ? 17.065  6.829   -15.066 1.00 56.48  ? 381  HIS B CE1 1 
ATOM   7043 N NE2 . HIS B 1 381 ? 16.287  6.002   -15.743 1.00 55.66  ? 381  HIS B NE2 1 
ATOM   7044 N N   . TYR B 1 382 ? 16.998  1.525   -14.120 1.00 52.69  ? 382  TYR B N   1 
ATOM   7045 C CA  . TYR B 1 382 ? 15.657  1.067   -14.434 1.00 52.05  ? 382  TYR B CA  1 
ATOM   7046 C C   . TYR B 1 382 ? 15.050  0.144   -13.381 1.00 52.53  ? 382  TYR B C   1 
ATOM   7047 O O   . TYR B 1 382 ? 13.854  -0.161  -13.440 1.00 52.55  ? 382  TYR B O   1 
ATOM   7048 C CB  . TYR B 1 382 ? 15.629  0.402   -15.807 1.00 51.00  ? 382  TYR B CB  1 
ATOM   7049 C CG  . TYR B 1 382 ? 15.414  1.349   -16.962 1.00 49.24  ? 382  TYR B CG  1 
ATOM   7050 C CD1 . TYR B 1 382 ? 16.488  1.836   -17.692 1.00 48.17  ? 382  TYR B CD1 1 
ATOM   7051 C CD2 . TYR B 1 382 ? 14.132  1.744   -17.336 1.00 47.74  ? 382  TYR B CD2 1 
ATOM   7052 C CE1 . TYR B 1 382 ? 16.298  2.701   -18.768 1.00 47.93  ? 382  TYR B CE1 1 
ATOM   7053 C CE2 . TYR B 1 382 ? 13.930  2.614   -18.400 1.00 47.57  ? 382  TYR B CE2 1 
ATOM   7054 C CZ  . TYR B 1 382 ? 15.018  3.087   -19.117 1.00 48.59  ? 382  TYR B CZ  1 
ATOM   7055 O OH  . TYR B 1 382 ? 14.832  3.941   -20.189 1.00 48.80  ? 382  TYR B OH  1 
ATOM   7056 N N   . THR B 1 383 ? 15.859  -0.296  -12.420 1.00 52.81  ? 383  THR B N   1 
ATOM   7057 C CA  . THR B 1 383 ? 15.346  -1.115  -11.336 1.00 53.24  ? 383  THR B CA  1 
ATOM   7058 C C   . THR B 1 383 ? 14.481  -0.289  -10.390 1.00 54.25  ? 383  THR B C   1 
ATOM   7059 O O   . THR B 1 383 ? 14.847  0.831   -10.033 1.00 54.45  ? 383  THR B O   1 
ATOM   7060 C CB  . THR B 1 383 ? 16.488  -1.754  -10.573 1.00 53.00  ? 383  THR B CB  1 
ATOM   7061 O OG1 . THR B 1 383 ? 17.232  -2.585  -11.469 1.00 52.14  ? 383  THR B OG1 1 
ATOM   7062 C CG2 . THR B 1 383 ? 15.967  -2.585  -9.406  1.00 52.68  ? 383  THR B CG2 1 
ATOM   7063 N N   . ASP B 1 384 ? 13.320  -0.824  -10.017 1.00 55.47  ? 384  ASP B N   1 
ATOM   7064 C CA  . ASP B 1 384 ? 12.513  -0.214  -8.961  1.00 56.84  ? 384  ASP B CA  1 
ATOM   7065 C C   . ASP B 1 384 ? 13.071  -0.691  -7.628  1.00 57.63  ? 384  ASP B C   1 
ATOM   7066 O O   . ASP B 1 384 ? 12.756  -1.789  -7.161  1.00 57.57  ? 384  ASP B O   1 
ATOM   7067 C CB  . ASP B 1 384 ? 11.023  -0.572  -9.084  1.00 57.02  ? 384  ASP B CB  1 
ATOM   7068 C CG  . ASP B 1 384 ? 10.141  0.181   -8.071  1.00 58.01  ? 384  ASP B CG  1 
ATOM   7069 O OD1 . ASP B 1 384 ? 10.505  0.259   -6.877  1.00 59.39  ? 384  ASP B OD1 1 
ATOM   7070 O OD2 . ASP B 1 384 ? 9.071   0.697   -8.459  1.00 58.77  ? 384  ASP B OD2 1 
ATOM   7071 N N   . TRP B 1 385 ? 13.883  0.157   -7.010  1.00 58.67  ? 385  TRP B N   1 
ATOM   7072 C CA  . TRP B 1 385 ? 14.624  -0.222  -5.815  1.00 59.73  ? 385  TRP B CA  1 
ATOM   7073 C C   . TRP B 1 385 ? 13.783  -0.462  -4.555  1.00 61.05  ? 385  TRP B C   1 
ATOM   7074 O O   . TRP B 1 385 ? 14.307  -0.851  -3.504  1.00 61.31  ? 385  TRP B O   1 
ATOM   7075 C CB  . TRP B 1 385 ? 15.761  0.766   -5.581  1.00 59.05  ? 385  TRP B CB  1 
ATOM   7076 C CG  . TRP B 1 385 ? 16.832  0.511   -6.544  1.00 57.95  ? 385  TRP B CG  1 
ATOM   7077 C CD1 . TRP B 1 385 ? 17.186  1.284   -7.611  1.00 57.45  ? 385  TRP B CD1 1 
ATOM   7078 C CD2 . TRP B 1 385 ? 17.661  -0.641  -6.585  1.00 57.25  ? 385  TRP B CD2 1 
ATOM   7079 N NE1 . TRP B 1 385 ? 18.220  0.696   -8.303  1.00 57.00  ? 385  TRP B NE1 1 
ATOM   7080 C CE2 . TRP B 1 385 ? 18.527  -0.494  -7.697  1.00 57.84  ? 385  TRP B CE2 1 
ATOM   7081 C CE3 . TRP B 1 385 ? 17.767  -1.787  -5.784  1.00 56.37  ? 385  TRP B CE3 1 
ATOM   7082 C CZ2 . TRP B 1 385 ? 19.489  -1.454  -8.031  1.00 58.13  ? 385  TRP B CZ2 1 
ATOM   7083 C CZ3 . TRP B 1 385 ? 18.719  -2.738  -6.112  1.00 57.26  ? 385  TRP B CZ3 1 
ATOM   7084 C CH2 . TRP B 1 385 ? 19.574  -2.566  -7.226  1.00 57.80  ? 385  TRP B CH2 1 
ATOM   7085 N N   . LEU B 1 386 ? 12.477  -0.264  -4.678  1.00 62.53  ? 386  LEU B N   1 
ATOM   7086 C CA  . LEU B 1 386 ? 11.567  -0.537  -3.589  1.00 64.02  ? 386  LEU B CA  1 
ATOM   7087 C C   . LEU B 1 386 ? 11.027  -1.941  -3.745  1.00 64.76  ? 386  LEU B C   1 
ATOM   7088 O O   . LEU B 1 386 ? 10.757  -2.622  -2.763  1.00 65.07  ? 386  LEU B O   1 
ATOM   7089 C CB  . LEU B 1 386 ? 10.415  0.447   -3.627  1.00 64.33  ? 386  LEU B CB  1 
ATOM   7090 C CG  . LEU B 1 386 ? 10.051  1.059   -2.284  1.00 65.74  ? 386  LEU B CG  1 
ATOM   7091 C CD1 . LEU B 1 386 ? 10.543  2.517   -2.290  1.00 66.40  ? 386  LEU B CD1 1 
ATOM   7092 C CD2 . LEU B 1 386 ? 8.518   0.967   -2.057  1.00 66.82  ? 386  LEU B CD2 1 
ATOM   7093 N N   . HIS B 1 387 ? 10.846  -2.355  -4.993  1.00 65.91  ? 387  HIS B N   1 
ATOM   7094 C CA  . HIS B 1 387 ? 10.406  -3.708  -5.313  1.00 67.03  ? 387  HIS B CA  1 
ATOM   7095 C C   . HIS B 1 387 ? 11.399  -4.274  -6.334  1.00 67.35  ? 387  HIS B C   1 
ATOM   7096 O O   . HIS B 1 387 ? 11.064  -4.456  -7.509  1.00 67.26  ? 387  HIS B O   1 
ATOM   7097 C CB  . HIS B 1 387 ? 8.969   -3.724  -5.870  1.00 67.20  ? 387  HIS B CB  1 
ATOM   7098 C CG  . HIS B 1 387 ? 8.050   -2.714  -5.248  1.00 68.51  ? 387  HIS B CG  1 
ATOM   7099 N ND1 . HIS B 1 387 ? 7.601   -1.599  -5.928  1.00 69.73  ? 387  HIS B ND1 1 
ATOM   7100 C CD2 . HIS B 1 387 ? 7.484   -2.656  -4.017  1.00 69.83  ? 387  HIS B CD2 1 
ATOM   7101 C CE1 . HIS B 1 387 ? 6.805   -0.893  -5.141  1.00 70.03  ? 387  HIS B CE1 1 
ATOM   7102 N NE2 . HIS B 1 387 ? 6.714   -1.515  -3.978  1.00 70.54  ? 387  HIS B NE2 1 
ATOM   7103 N N   . PRO B 1 388 ? 12.636  -4.553  -5.884  1.00 67.90  ? 388  PRO B N   1 
ATOM   7104 C CA  . PRO B 1 388 ? 13.727  -4.899  -6.801  1.00 68.44  ? 388  PRO B CA  1 
ATOM   7105 C C   . PRO B 1 388 ? 13.548  -6.252  -7.495  1.00 69.16  ? 388  PRO B C   1 
ATOM   7106 O O   . PRO B 1 388 ? 14.198  -6.511  -8.515  1.00 69.20  ? 388  PRO B O   1 
ATOM   7107 C CB  . PRO B 1 388 ? 14.960  -4.937  -5.887  1.00 68.19  ? 388  PRO B CB  1 
ATOM   7108 C CG  . PRO B 1 388 ? 14.533  -4.294  -4.598  1.00 68.16  ? 388  PRO B CG  1 
ATOM   7109 C CD  . PRO B 1 388 ? 13.080  -4.584  -4.479  1.00 67.99  ? 388  PRO B CD  1 
ATOM   7110 N N   . GLU B 1 389 ? 12.668  -7.091  -6.947  1.00 69.94  ? 389  GLU B N   1 
ATOM   7111 C CA  . GLU B 1 389 ? 12.510  -8.478  -7.395  1.00 70.69  ? 389  GLU B CA  1 
ATOM   7112 C C   . GLU B 1 389 ? 11.171  -8.728  -8.084  1.00 70.55  ? 389  GLU B C   1 
ATOM   7113 O O   . GLU B 1 389 ? 10.998  -9.778  -8.710  1.00 70.72  ? 389  GLU B O   1 
ATOM   7114 C CB  . GLU B 1 389 ? 12.664  -9.467  -6.219  1.00 71.09  ? 389  GLU B CB  1 
ATOM   7115 C CG  . GLU B 1 389 ? 13.969  -9.343  -5.399  1.00 73.26  ? 389  GLU B CG  1 
ATOM   7116 C CD  . GLU B 1 389 ? 15.145  -10.129 -5.988  1.00 75.69  ? 389  GLU B CD  1 
ATOM   7117 O OE1 . GLU B 1 389 ? 15.384  -10.042 -7.217  1.00 77.01  ? 389  GLU B OE1 1 
ATOM   7118 O OE2 . GLU B 1 389 ? 15.836  -10.830 -5.212  1.00 76.09  ? 389  GLU B OE2 1 
ATOM   7119 N N   . ASP B 1 390 ? 10.231  -7.786  -7.966  1.00 70.24  ? 390  ASP B N   1 
ATOM   7120 C CA  . ASP B 1 390 ? 8.884   -7.993  -8.495  1.00 70.06  ? 390  ASP B CA  1 
ATOM   7121 C C   . ASP B 1 390 ? 8.924   -8.196  -10.000 1.00 69.93  ? 390  ASP B C   1 
ATOM   7122 O O   . ASP B 1 390 ? 9.366   -7.315  -10.735 1.00 69.96  ? 390  ASP B O   1 
ATOM   7123 C CB  . ASP B 1 390 ? 7.940   -6.846  -8.132  1.00 70.17  ? 390  ASP B CB  1 
ATOM   7124 C CG  . ASP B 1 390 ? 6.521   -7.062  -8.650  1.00 70.80  ? 390  ASP B CG  1 
ATOM   7125 O OD1 . ASP B 1 390 ? 6.137   -8.218  -8.924  1.00 72.28  ? 390  ASP B OD1 1 
ATOM   7126 O OD2 . ASP B 1 390 ? 5.773   -6.073  -8.780  1.00 71.14  ? 390  ASP B OD2 1 
ATOM   7127 N N   . PRO B 1 391 ? 8.470   -9.373  -10.458 1.00 69.85  ? 391  PRO B N   1 
ATOM   7128 C CA  . PRO B 1 391 ? 8.501   -9.737  -11.871 1.00 69.66  ? 391  PRO B CA  1 
ATOM   7129 C C   . PRO B 1 391 ? 7.664   -8.815  -12.778 1.00 69.49  ? 391  PRO B C   1 
ATOM   7130 O O   . PRO B 1 391 ? 8.050   -8.596  -13.927 1.00 69.48  ? 391  PRO B O   1 
ATOM   7131 C CB  . PRO B 1 391 ? 7.969   -11.169 -11.871 1.00 69.55  ? 391  PRO B CB  1 
ATOM   7132 C CG  . PRO B 1 391 ? 7.139   -11.254 -10.625 1.00 70.05  ? 391  PRO B CG  1 
ATOM   7133 C CD  . PRO B 1 391 ? 7.895   -10.451 -9.634  1.00 69.86  ? 391  PRO B CD  1 
ATOM   7134 N N   . THR B 1 392 ? 6.552   -8.276  -12.275 1.00 69.20  ? 392  THR B N   1 
ATOM   7135 C CA  . THR B 1 392 ? 5.770   -7.289  -13.034 1.00 69.19  ? 392  THR B CA  1 
ATOM   7136 C C   . THR B 1 392 ? 6.623   -6.057  -13.379 1.00 69.25  ? 392  THR B C   1 
ATOM   7137 O O   . THR B 1 392 ? 6.628   -5.600  -14.525 1.00 69.33  ? 392  THR B O   1 
ATOM   7138 C CB  . THR B 1 392 ? 4.500   -6.839  -12.272 1.00 69.21  ? 392  THR B CB  1 
ATOM   7139 O OG1 . THR B 1 392 ? 3.906   -7.968  -11.626 1.00 69.92  ? 392  THR B OG1 1 
ATOM   7140 C CG2 . THR B 1 392 ? 3.477   -6.202  -13.215 1.00 68.57  ? 392  THR B CG2 1 
ATOM   7141 N N   . HIS B 1 393 ? 7.349   -5.534  -12.391 1.00 69.17  ? 393  HIS B N   1 
ATOM   7142 C CA  . HIS B 1 393 ? 8.197   -4.355  -12.602 1.00 68.88  ? 393  HIS B CA  1 
ATOM   7143 C C   . HIS B 1 393 ? 9.383   -4.643  -13.496 1.00 67.61  ? 393  HIS B C   1 
ATOM   7144 O O   . HIS B 1 393 ? 9.760   -3.792  -14.282 1.00 67.87  ? 393  HIS B O   1 
ATOM   7145 C CB  . HIS B 1 393 ? 8.675   -3.737  -11.282 1.00 69.47  ? 393  HIS B CB  1 
ATOM   7146 C CG  . HIS B 1 393 ? 7.649   -2.871  -10.617 1.00 72.31  ? 393  HIS B CG  1 
ATOM   7147 N ND1 . HIS B 1 393 ? 6.735   -3.362  -9.704  1.00 74.27  ? 393  HIS B ND1 1 
ATOM   7148 C CD2 . HIS B 1 393 ? 7.382   -1.547  -10.739 1.00 74.46  ? 393  HIS B CD2 1 
ATOM   7149 C CE1 . HIS B 1 393 ? 5.959   -2.377  -9.284  1.00 74.47  ? 393  HIS B CE1 1 
ATOM   7150 N NE2 . HIS B 1 393 ? 6.332   -1.265  -9.895  1.00 74.99  ? 393  HIS B NE2 1 
ATOM   7151 N N   . LEU B 1 394 ? 9.971   -5.827  -13.386 1.00 65.97  ? 394  LEU B N   1 
ATOM   7152 C CA  . LEU B 1 394 ? 11.119  -6.149  -14.221 1.00 64.64  ? 394  LEU B CA  1 
ATOM   7153 C C   . LEU B 1 394 ? 10.682  -6.396  -15.667 1.00 63.77  ? 394  LEU B C   1 
ATOM   7154 O O   . LEU B 1 394 ? 11.405  -6.053  -16.616 1.00 63.57  ? 394  LEU B O   1 
ATOM   7155 C CB  . LEU B 1 394 ? 11.865  -7.362  -13.679 1.00 64.83  ? 394  LEU B CB  1 
ATOM   7156 C CG  . LEU B 1 394 ? 12.417  -7.340  -12.255 1.00 64.37  ? 394  LEU B CG  1 
ATOM   7157 C CD1 . LEU B 1 394 ? 12.380  -8.746  -11.693 1.00 64.23  ? 394  LEU B CD1 1 
ATOM   7158 C CD2 . LEU B 1 394 ? 13.827  -6.783  -12.228 1.00 63.97  ? 394  LEU B CD2 1 
ATOM   7159 N N   . ARG B 1 395 ? 9.498   -6.993  -15.821 1.00 62.39  ? 395  ARG B N   1 
ATOM   7160 C CA  . ARG B 1 395 ? 8.886   -7.203  -17.130 1.00 61.09  ? 395  ARG B CA  1 
ATOM   7161 C C   . ARG B 1 395 ? 8.589   -5.843  -17.766 1.00 60.19  ? 395  ARG B C   1 
ATOM   7162 O O   . ARG B 1 395 ? 9.045   -5.567  -18.874 1.00 60.22  ? 395  ARG B O   1 
ATOM   7163 C CB  . ARG B 1 395 ? 7.628   -8.086  -17.002 1.00 61.23  ? 395  ARG B CB  1 
ATOM   7164 C CG  . ARG B 1 395 ? 6.832   -8.344  -18.280 1.00 60.98  ? 395  ARG B CG  1 
ATOM   7165 C CD  . ARG B 1 395 ? 5.610   -7.465  -18.338 1.00 61.97  ? 395  ARG B CD  1 
ATOM   7166 N NE  . ARG B 1 395 ? 4.434   -8.075  -17.730 1.00 63.75  ? 395  ARG B NE  1 
ATOM   7167 C CZ  . ARG B 1 395 ? 3.411   -7.399  -17.187 1.00 65.69  ? 395  ARG B CZ  1 
ATOM   7168 N NH1 . ARG B 1 395 ? 3.412   -6.069  -17.140 1.00 65.60  ? 395  ARG B NH1 1 
ATOM   7169 N NH2 . ARG B 1 395 ? 2.373   -8.057  -16.673 1.00 65.98  ? 395  ARG B NH2 1 
ATOM   7170 N N   . ASP B 1 396 ? 7.863   -4.984  -17.051 1.00 58.85  ? 396  ASP B N   1 
ATOM   7171 C CA  . ASP B 1 396 ? 7.564   -3.635  -17.545 1.00 57.73  ? 396  ASP B CA  1 
ATOM   7172 C C   . ASP B 1 396 ? 8.815   -2.771  -17.766 1.00 56.82  ? 396  ASP B C   1 
ATOM   7173 O O   . ASP B 1 396 ? 8.837   -1.914  -18.664 1.00 56.77  ? 396  ASP B O   1 
ATOM   7174 C CB  . ASP B 1 396 ? 6.555   -2.923  -16.636 1.00 57.65  ? 396  ASP B CB  1 
ATOM   7175 C CG  . ASP B 1 396 ? 5.142   -3.462  -16.799 1.00 57.56  ? 396  ASP B CG  1 
ATOM   7176 O OD1 . ASP B 1 396 ? 4.822   -4.007  -17.879 1.00 57.82  ? 396  ASP B OD1 1 
ATOM   7177 O OD2 . ASP B 1 396 ? 4.345   -3.341  -15.850 1.00 56.89  ? 396  ASP B OD2 1 
ATOM   7178 N N   . ALA B 1 397 ? 9.845   -3.009  -16.953 1.00 55.38  ? 397  ALA B N   1 
ATOM   7179 C CA  . ALA B 1 397 ? 11.113  -2.312  -17.074 1.00 54.13  ? 397  ALA B CA  1 
ATOM   7180 C C   . ALA B 1 397 ? 11.823  -2.692  -18.365 1.00 53.51  ? 397  ALA B C   1 
ATOM   7181 O O   . ALA B 1 397 ? 12.282  -1.818  -19.101 1.00 53.60  ? 397  ALA B O   1 
ATOM   7182 C CB  . ALA B 1 397 ? 11.993  -2.597  -15.883 1.00 53.97  ? 397  ALA B CB  1 
ATOM   7183 N N   . MET B 1 398 ? 11.908  -3.989  -18.649 1.00 52.64  ? 398  MET B N   1 
ATOM   7184 C CA  . MET B 1 398 ? 12.520  -4.446  -19.892 1.00 51.85  ? 398  MET B CA  1 
ATOM   7185 C C   . MET B 1 398 ? 11.894  -3.764  -21.108 1.00 51.11  ? 398  MET B C   1 
ATOM   7186 O O   . MET B 1 398 ? 12.609  -3.287  -21.991 1.00 50.90  ? 398  MET B O   1 
ATOM   7187 C CB  . MET B 1 398 ? 12.402  -5.955  -20.024 1.00 52.15  ? 398  MET B CB  1 
ATOM   7188 C CG  . MET B 1 398 ? 13.379  -6.558  -21.011 1.00 53.61  ? 398  MET B CG  1 
ATOM   7189 S SD  . MET B 1 398 ? 15.113  -6.241  -20.577 1.00 57.69  ? 398  MET B SD  1 
ATOM   7190 C CE  . MET B 1 398 ? 15.531  -4.941  -21.747 1.00 57.91  ? 398  MET B CE  1 
ATOM   7191 N N   . SER B 1 399 ? 10.561  -3.718  -21.138 1.00 50.17  ? 399  SER B N   1 
ATOM   7192 C CA  . SER B 1 399 ? 9.824   -2.991  -22.158 1.00 49.36  ? 399  SER B CA  1 
ATOM   7193 C C   . SER B 1 399 ? 10.286  -1.543  -22.238 1.00 49.00  ? 399  SER B C   1 
ATOM   7194 O O   . SER B 1 399 ? 10.528  -1.025  -23.327 1.00 49.22  ? 399  SER B O   1 
ATOM   7195 C CB  . SER B 1 399 ? 8.330   -3.054  -21.872 1.00 49.49  ? 399  SER B CB  1 
ATOM   7196 O OG  . SER B 1 399 ? 7.611   -2.103  -22.638 1.00 49.98  ? 399  SER B OG  1 
ATOM   7197 N N   . ALA B 1 400 ? 10.430  -0.904  -21.081 1.00 48.28  ? 400  ALA B N   1 
ATOM   7198 C CA  . ALA B 1 400 ? 10.821  0.492   -21.027 1.00 47.45  ? 400  ALA B CA  1 
ATOM   7199 C C   . ALA B 1 400 ? 12.206  0.699   -21.608 1.00 47.17  ? 400  ALA B C   1 
ATOM   7200 O O   . ALA B 1 400 ? 12.380  1.556   -22.465 1.00 47.57  ? 400  ALA B O   1 
ATOM   7201 C CB  . ALA B 1 400 ? 10.755  1.003   -19.624 1.00 47.33  ? 400  ALA B CB  1 
ATOM   7202 N N   . VAL B 1 401 ? 13.180  -0.090  -21.158 1.00 46.54  ? 401  VAL B N   1 
ATOM   7203 C CA  . VAL B 1 401 ? 14.565  0.022   -21.634 1.00 46.17  ? 401  VAL B CA  1 
ATOM   7204 C C   . VAL B 1 401 ? 14.628  0.008   -23.151 1.00 46.14  ? 401  VAL B C   1 
ATOM   7205 O O   . VAL B 1 401 ? 15.293  0.836   -23.774 1.00 45.90  ? 401  VAL B O   1 
ATOM   7206 C CB  . VAL B 1 401 ? 15.434  -1.151  -21.126 1.00 46.09  ? 401  VAL B CB  1 
ATOM   7207 C CG1 . VAL B 1 401 ? 16.781  -1.165  -21.808 1.00 46.09  ? 401  VAL B CG1 1 
ATOM   7208 C CG2 . VAL B 1 401 ? 15.607  -1.080  -19.636 1.00 46.00  ? 401  VAL B CG2 1 
ATOM   7209 N N   . VAL B 1 402 ? 13.925  -0.943  -23.746 1.00 46.30  ? 402  VAL B N   1 
ATOM   7210 C CA  . VAL B 1 402 ? 14.001  -1.125  -25.186 1.00 46.52  ? 402  VAL B CA  1 
ATOM   7211 C C   . VAL B 1 402 ? 13.239  -0.018  -25.924 1.00 46.62  ? 402  VAL B C   1 
ATOM   7212 O O   . VAL B 1 402 ? 13.745  0.550   -26.907 1.00 46.60  ? 402  VAL B O   1 
ATOM   7213 C CB  . VAL B 1 402 ? 13.620  -2.567  -25.585 1.00 46.42  ? 402  VAL B CB  1 
ATOM   7214 C CG1 . VAL B 1 402 ? 13.113  -2.643  -27.009 1.00 45.96  ? 402  VAL B CG1 1 
ATOM   7215 C CG2 . VAL B 1 402 ? 14.849  -3.464  -25.400 1.00 46.45  ? 402  VAL B CG2 1 
ATOM   7216 N N   . GLY B 1 403 ? 12.049  0.303   -25.418 1.00 46.39  ? 403  GLY B N   1 
ATOM   7217 C CA  . GLY B 1 403 ? 11.282  1.436   -25.916 1.00 46.15  ? 403  GLY B CA  1 
ATOM   7218 C C   . GLY B 1 403 ? 12.052  2.737   -25.859 1.00 46.11  ? 403  GLY B C   1 
ATOM   7219 O O   . GLY B 1 403 ? 12.204  3.405   -26.879 1.00 46.19  ? 403  GLY B O   1 
ATOM   7220 N N   . ASP B 1 404 ? 12.556  3.080   -24.676 1.00 46.00  ? 404  ASP B N   1 
ATOM   7221 C CA  . ASP B 1 404 ? 13.260  4.340   -24.471 1.00 46.39  ? 404  ASP B CA  1 
ATOM   7222 C C   . ASP B 1 404 ? 14.513  4.471   -25.318 1.00 46.33  ? 404  ASP B C   1 
ATOM   7223 O O   . ASP B 1 404 ? 14.702  5.463   -26.018 1.00 46.43  ? 404  ASP B O   1 
ATOM   7224 C CB  . ASP B 1 404 ? 13.625  4.541   -22.999 1.00 46.56  ? 404  ASP B CB  1 
ATOM   7225 C CG  . ASP B 1 404 ? 12.408  4.589   -22.083 1.00 48.37  ? 404  ASP B CG  1 
ATOM   7226 O OD1 . ASP B 1 404 ? 11.245  4.700   -22.572 1.00 48.38  ? 404  ASP B OD1 1 
ATOM   7227 O OD2 . ASP B 1 404 ? 12.632  4.510   -20.849 1.00 49.97  ? 404  ASP B OD2 1 
ATOM   7228 N N   . HIS B 1 405 ? 15.372  3.468   -25.253 1.00 46.57  ? 405  HIS B N   1 
ATOM   7229 C CA  . HIS B 1 405 ? 16.649  3.526   -25.940 1.00 47.01  ? 405  HIS B CA  1 
ATOM   7230 C C   . HIS B 1 405 ? 16.485  3.742   -27.448 1.00 47.26  ? 405  HIS B C   1 
ATOM   7231 O O   . HIS B 1 405 ? 17.204  4.543   -28.040 1.00 47.79  ? 405  HIS B O   1 
ATOM   7232 C CB  . HIS B 1 405 ? 17.437  2.248   -25.649 1.00 47.10  ? 405  HIS B CB  1 
ATOM   7233 C CG  . HIS B 1 405 ? 18.668  2.075   -26.486 1.00 47.64  ? 405  HIS B CG  1 
ATOM   7234 N ND1 . HIS B 1 405 ? 19.676  3.017   -26.540 1.00 47.98  ? 405  HIS B ND1 1 
ATOM   7235 C CD2 . HIS B 1 405 ? 19.068  1.047   -27.273 1.00 47.65  ? 405  HIS B CD2 1 
ATOM   7236 C CE1 . HIS B 1 405 ? 20.636  2.583   -27.336 1.00 48.41  ? 405  HIS B CE1 1 
ATOM   7237 N NE2 . HIS B 1 405 ? 20.295  1.387   -27.788 1.00 48.82  ? 405  HIS B NE2 1 
ATOM   7238 N N   . ASN B 1 406 ? 15.524  3.046   -28.050 1.00 47.18  ? 406  ASN B N   1 
ATOM   7239 C CA  . ASN B 1 406 ? 15.364  3.020   -29.500 1.00 47.06  ? 406  ASN B CA  1 
ATOM   7240 C C   . ASN B 1 406 ? 14.356  4.018   -30.041 1.00 46.85  ? 406  ASN B C   1 
ATOM   7241 O O   . ASN B 1 406 ? 14.476  4.480   -31.178 1.00 46.89  ? 406  ASN B O   1 
ATOM   7242 C CB  . ASN B 1 406 ? 14.998  1.609   -29.968 1.00 47.03  ? 406  ASN B CB  1 
ATOM   7243 C CG  . ASN B 1 406 ? 16.149  0.638   -29.825 1.00 47.34  ? 406  ASN B CG  1 
ATOM   7244 O OD1 . ASN B 1 406 ? 17.041  0.597   -30.666 1.00 47.94  ? 406  ASN B OD1 1 
ATOM   7245 N ND2 . ASN B 1 406 ? 16.135  -0.154  -28.758 1.00 48.34  ? 406  ASN B ND2 1 
ATOM   7246 N N   . VAL B 1 407 ? 13.351  4.351   -29.248 1.00 46.53  ? 407  VAL B N   1 
ATOM   7247 C CA  . VAL B 1 407 ? 12.328  5.236   -29.770 1.00 46.49  ? 407  VAL B CA  1 
ATOM   7248 C C   . VAL B 1 407 ? 12.143  6.515   -28.944 1.00 46.64  ? 407  VAL B C   1 
ATOM   7249 O O   . VAL B 1 407 ? 12.345  7.626   -29.460 1.00 46.75  ? 407  VAL B O   1 
ATOM   7250 C CB  . VAL B 1 407 ? 10.978  4.494   -30.017 1.00 46.58  ? 407  VAL B CB  1 
ATOM   7251 C CG1 . VAL B 1 407 ? 9.960   5.441   -30.613 1.00 46.68  ? 407  VAL B CG1 1 
ATOM   7252 C CG2 . VAL B 1 407 ? 11.171  3.294   -30.953 1.00 45.29  ? 407  VAL B CG2 1 
ATOM   7253 N N   . VAL B 1 408 ? 11.782  6.370   -27.670 1.00 46.44  ? 408  VAL B N   1 
ATOM   7254 C CA  . VAL B 1 408 ? 11.333  7.523   -26.884 1.00 46.09  ? 408  VAL B CA  1 
ATOM   7255 C C   . VAL B 1 408 ? 12.417  8.587   -26.767 1.00 46.12  ? 408  VAL B C   1 
ATOM   7256 O O   . VAL B 1 408 ? 12.171  9.757   -27.055 1.00 45.78  ? 408  VAL B O   1 
ATOM   7257 C CB  . VAL B 1 408 ? 10.820  7.123   -25.498 1.00 45.75  ? 408  VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 408 ? 9.952   8.212   -24.936 1.00 45.24  ? 408  VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 408 ? 10.018  5.851   -25.594 1.00 46.33  ? 408  VAL B CG2 1 
ATOM   7260 N N   . CYS B 1 409 ? 13.618  8.173   -26.376 1.00 46.32  ? 409  CYS B N   1 
ATOM   7261 C CA  . CYS B 1 409 ? 14.700  9.127   -26.165 1.00 46.79  ? 409  CYS B CA  1 
ATOM   7262 C C   . CYS B 1 409 ? 15.240  9.718   -27.462 1.00 46.53  ? 409  CYS B C   1 
ATOM   7263 O O   . CYS B 1 409 ? 15.467  10.934  -27.532 1.00 46.83  ? 409  CYS B O   1 
ATOM   7264 C CB  . CYS B 1 409 ? 15.804  8.547   -25.291 1.00 47.05  ? 409  CYS B CB  1 
ATOM   7265 S SG  . CYS B 1 409 ? 15.241  8.233   -23.598 1.00 49.11  ? 409  CYS B SG  1 
ATOM   7266 N N   . PRO B 1 410 ? 15.440  8.883   -28.493 1.00 45.91  ? 410  PRO B N   1 
ATOM   7267 C CA  . PRO B 1 410 ? 15.689  9.511   -29.774 1.00 45.65  ? 410  PRO B CA  1 
ATOM   7268 C C   . PRO B 1 410 ? 14.615  10.534  -30.159 1.00 45.54  ? 410  PRO B C   1 
ATOM   7269 O O   . PRO B 1 410 ? 14.963  11.591  -30.684 1.00 45.85  ? 410  PRO B O   1 
ATOM   7270 C CB  . PRO B 1 410 ? 15.715  8.329   -30.742 1.00 45.55  ? 410  PRO B CB  1 
ATOM   7271 C CG  . PRO B 1 410 ? 16.183  7.202   -29.916 1.00 45.55  ? 410  PRO B CG  1 
ATOM   7272 C CD  . PRO B 1 410 ? 15.529  7.418   -28.582 1.00 45.83  ? 410  PRO B CD  1 
ATOM   7273 N N   . VAL B 1 411 ? 13.338  10.247  -29.890 1.00 45.33  ? 411  VAL B N   1 
ATOM   7274 C CA  . VAL B 1 411 ? 12.262  11.185  -30.265 1.00 45.05  ? 411  VAL B CA  1 
ATOM   7275 C C   . VAL B 1 411 ? 12.307  12.455  -29.428 1.00 45.32  ? 411  VAL B C   1 
ATOM   7276 O O   . VAL B 1 411 ? 12.006  13.536  -29.920 1.00 45.25  ? 411  VAL B O   1 
ATOM   7277 C CB  . VAL B 1 411 ? 10.862  10.560  -30.173 1.00 44.84  ? 411  VAL B CB  1 
ATOM   7278 C CG1 . VAL B 1 411 ? 9.779   11.639  -30.124 1.00 43.71  ? 411  VAL B CG1 1 
ATOM   7279 C CG2 . VAL B 1 411 ? 10.637  9.665   -31.340 1.00 44.91  ? 411  VAL B CG2 1 
ATOM   7280 N N   . ALA B 1 412 ? 12.678  12.307  -28.160 1.00 45.57  ? 412  ALA B N   1 
ATOM   7281 C CA  . ALA B 1 412 ? 12.826  13.438  -27.268 1.00 45.75  ? 412  ALA B CA  1 
ATOM   7282 C C   . ALA B 1 412 ? 13.984  14.297  -27.748 1.00 46.03  ? 412  ALA B C   1 
ATOM   7283 O O   . ALA B 1 412 ? 13.916  15.530  -27.737 1.00 45.87  ? 412  ALA B O   1 
ATOM   7284 C CB  . ALA B 1 412 ? 13.079  12.957  -25.858 1.00 45.74  ? 412  ALA B CB  1 
ATOM   7285 N N   . GLN B 1 413 ? 15.041  13.633  -28.194 1.00 46.25  ? 413  GLN B N   1 
ATOM   7286 C CA  . GLN B 1 413 ? 16.238  14.338  -28.555 1.00 46.87  ? 413  GLN B CA  1 
ATOM   7287 C C   . GLN B 1 413 ? 16.053  15.162  -29.802 1.00 46.55  ? 413  GLN B C   1 
ATOM   7288 O O   . GLN B 1 413 ? 16.469  16.321  -29.846 1.00 46.96  ? 413  GLN B O   1 
ATOM   7289 C CB  . GLN B 1 413 ? 17.386  13.382  -28.751 1.00 47.28  ? 413  GLN B CB  1 
ATOM   7290 C CG  . GLN B 1 413 ? 18.673  14.014  -28.332 1.00 50.99  ? 413  GLN B CG  1 
ATOM   7291 C CD  . GLN B 1 413 ? 19.785  13.650  -29.253 1.00 56.14  ? 413  GLN B CD  1 
ATOM   7292 O OE1 . GLN B 1 413 ? 20.073  12.461  -29.462 1.00 58.40  ? 413  GLN B OE1 1 
ATOM   7293 N NE2 . GLN B 1 413 ? 20.424  14.671  -29.841 1.00 58.27  ? 413  GLN B NE2 1 
ATOM   7294 N N   . LEU B 1 414 ? 15.431  14.566  -30.813 1.00 46.06  ? 414  LEU B N   1 
ATOM   7295 C CA  . LEU B 1 414 ? 15.197  15.266  -32.058 1.00 45.64  ? 414  LEU B CA  1 
ATOM   7296 C C   . LEU B 1 414 ? 14.239  16.427  -31.826 1.00 45.77  ? 414  LEU B C   1 
ATOM   7297 O O   . LEU B 1 414 ? 14.459  17.518  -32.339 1.00 45.87  ? 414  LEU B O   1 
ATOM   7298 C CB  . LEU B 1 414 ? 14.659  14.315  -33.130 1.00 45.58  ? 414  LEU B CB  1 
ATOM   7299 C CG  . LEU B 1 414 ? 14.181  14.945  -34.448 1.00 45.05  ? 414  LEU B CG  1 
ATOM   7300 C CD1 . LEU B 1 414 ? 15.305  15.030  -35.453 1.00 43.74  ? 414  LEU B CD1 1 
ATOM   7301 C CD2 . LEU B 1 414 ? 12.994  14.181  -35.031 1.00 42.97  ? 414  LEU B CD2 1 
ATOM   7302 N N   . ALA B 1 415 ? 13.187  16.198  -31.041 1.00 45.87  ? 415  ALA B N   1 
ATOM   7303 C CA  . ALA B 1 415 ? 12.186  17.232  -30.790 1.00 46.06  ? 415  ALA B CA  1 
ATOM   7304 C C   . ALA B 1 415 ? 12.854  18.435  -30.146 1.00 46.37  ? 415  ALA B C   1 
ATOM   7305 O O   . ALA B 1 415 ? 12.599  19.579  -30.513 1.00 46.37  ? 415  ALA B O   1 
ATOM   7306 C CB  . ALA B 1 415 ? 11.087  16.703  -29.920 1.00 45.82  ? 415  ALA B CB  1 
ATOM   7307 N N   . GLY B 1 416 ? 13.741  18.159  -29.197 1.00 46.94  ? 416  GLY B N   1 
ATOM   7308 C CA  . GLY B 1 416 ? 14.575  19.196  -28.586 1.00 47.15  ? 416  GLY B CA  1 
ATOM   7309 C C   . GLY B 1 416 ? 15.462  19.928  -29.584 1.00 47.01  ? 416  GLY B C   1 
ATOM   7310 O O   . GLY B 1 416 ? 15.516  21.153  -29.567 1.00 46.94  ? 416  GLY B O   1 
ATOM   7311 N N   . ARG B 1 417 ? 16.148  19.194  -30.458 1.00 46.76  ? 417  ARG B N   1 
ATOM   7312 C CA  . ARG B 1 417 ? 17.087  19.841  -31.366 1.00 46.97  ? 417  ARG B CA  1 
ATOM   7313 C C   . ARG B 1 417 ? 16.388  20.687  -32.423 1.00 46.25  ? 417  ARG B C   1 
ATOM   7314 O O   . ARG B 1 417 ? 16.836  21.779  -32.732 1.00 46.23  ? 417  ARG B O   1 
ATOM   7315 C CB  . ARG B 1 417 ? 18.066  18.847  -32.004 1.00 47.43  ? 417  ARG B CB  1 
ATOM   7316 C CG  . ARG B 1 417 ? 18.993  18.126  -31.034 1.00 50.70  ? 417  ARG B CG  1 
ATOM   7317 C CD  . ARG B 1 417 ? 19.551  19.043  -29.938 1.00 57.04  ? 417  ARG B CD  1 
ATOM   7318 N NE  . ARG B 1 417 ? 20.438  20.081  -30.472 1.00 62.59  ? 417  ARG B NE  1 
ATOM   7319 C CZ  . ARG B 1 417 ? 21.733  20.214  -30.165 1.00 64.70  ? 417  ARG B CZ  1 
ATOM   7320 N NH1 . ARG B 1 417 ? 22.319  19.376  -29.309 1.00 64.26  ? 417  ARG B NH1 1 
ATOM   7321 N NH2 . ARG B 1 417 ? 22.446  21.191  -30.720 1.00 65.47  ? 417  ARG B NH2 1 
ATOM   7322 N N   . LEU B 1 418 ? 15.285  20.188  -32.964 1.00 45.93  ? 418  LEU B N   1 
ATOM   7323 C CA  . LEU B 1 418 ? 14.541  20.918  -33.991 1.00 45.48  ? 418  LEU B CA  1 
ATOM   7324 C C   . LEU B 1 418 ? 13.990  22.209  -33.405 1.00 45.42  ? 418  LEU B C   1 
ATOM   7325 O O   . LEU B 1 418 ? 14.059  23.256  -34.034 1.00 45.03  ? 418  LEU B O   1 
ATOM   7326 C CB  . LEU B 1 418 ? 13.400  20.066  -34.569 1.00 45.27  ? 418  LEU B CB  1 
ATOM   7327 C CG  . LEU B 1 418 ? 13.665  18.757  -35.315 1.00 44.39  ? 418  LEU B CG  1 
ATOM   7328 C CD1 . LEU B 1 418 ? 12.354  18.095  -35.618 1.00 43.73  ? 418  LEU B CD1 1 
ATOM   7329 C CD2 . LEU B 1 418 ? 14.430  18.968  -36.590 1.00 43.34  ? 418  LEU B CD2 1 
ATOM   7330 N N   . ALA B 1 419 ? 13.457  22.118  -32.187 1.00 45.71  ? 419  ALA B N   1 
ATOM   7331 C CA  . ALA B 1 419 ? 12.928  23.279  -31.465 1.00 46.09  ? 419  ALA B CA  1 
ATOM   7332 C C   . ALA B 1 419 ? 14.025  24.306  -31.174 1.00 46.23  ? 419  ALA B C   1 
ATOM   7333 O O   . ALA B 1 419 ? 13.864  25.497  -31.441 1.00 45.89  ? 419  ALA B O   1 
ATOM   7334 C CB  . ALA B 1 419 ? 12.251  22.838  -30.181 1.00 45.75  ? 419  ALA B CB  1 
ATOM   7335 N N   . ALA B 1 420 ? 15.142  23.816  -30.646 1.00 46.75  ? 420  ALA B N   1 
ATOM   7336 C CA  . ALA B 1 420 ? 16.311  24.631  -30.372 1.00 47.38  ? 420  ALA B CA  1 
ATOM   7337 C C   . ALA B 1 420 ? 16.806  25.358  -31.620 1.00 47.82  ? 420  ALA B C   1 
ATOM   7338 O O   . ALA B 1 420 ? 17.183  26.521  -31.523 1.00 48.48  ? 420  ALA B O   1 
ATOM   7339 C CB  . ALA B 1 420 ? 17.436  23.782  -29.765 1.00 47.43  ? 420  ALA B CB  1 
ATOM   7340 N N   . GLN B 1 421 ? 16.797  24.691  -32.777 1.00 47.64  ? 421  GLN B N   1 
ATOM   7341 C CA  . GLN B 1 421 ? 17.285  25.302  -34.012 1.00 47.51  ? 421  GLN B CA  1 
ATOM   7342 C C   . GLN B 1 421 ? 16.176  25.817  -34.927 1.00 47.49  ? 421  GLN B C   1 
ATOM   7343 O O   . GLN B 1 421 ? 16.300  25.783  -36.158 1.00 47.41  ? 421  GLN B O   1 
ATOM   7344 C CB  . GLN B 1 421 ? 18.220  24.360  -34.775 1.00 47.84  ? 421  GLN B CB  1 
ATOM   7345 C CG  . GLN B 1 421 ? 19.639  24.315  -34.221 1.00 49.04  ? 421  GLN B CG  1 
ATOM   7346 C CD  . GLN B 1 421 ? 19.955  23.004  -33.521 1.00 50.70  ? 421  GLN B CD  1 
ATOM   7347 O OE1 . GLN B 1 421 ? 20.139  22.952  -32.296 1.00 51.57  ? 421  GLN B OE1 1 
ATOM   7348 N NE2 . GLN B 1 421 ? 20.018  21.933  -34.297 1.00 50.67  ? 421  GLN B NE2 1 
ATOM   7349 N N   . GLY B 1 422 ? 15.078  26.263  -34.326 1.00 47.56  ? 422  GLY B N   1 
ATOM   7350 C CA  . GLY B 1 422 ? 14.112  27.093  -35.038 1.00 47.41  ? 422  GLY B CA  1 
ATOM   7351 C C   . GLY B 1 422 ? 12.960  26.435  -35.763 1.00 47.27  ? 422  GLY B C   1 
ATOM   7352 O O   . GLY B 1 422 ? 12.153  27.125  -36.386 1.00 47.62  ? 422  GLY B O   1 
ATOM   7353 N N   . ALA B 1 423 ? 12.850  25.117  -35.695 1.00 47.02  ? 423  ALA B N   1 
ATOM   7354 C CA  . ALA B 1 423 ? 11.665  24.468  -36.255 1.00 46.78  ? 423  ALA B CA  1 
ATOM   7355 C C   . ALA B 1 423 ? 10.491  24.712  -35.340 1.00 46.43  ? 423  ALA B C   1 
ATOM   7356 O O   . ALA B 1 423 ? 10.672  25.101  -34.192 1.00 46.59  ? 423  ALA B O   1 
ATOM   7357 C CB  . ALA B 1 423 ? 11.893  22.992  -36.431 1.00 47.00  ? 423  ALA B CB  1 
ATOM   7358 N N   . ARG B 1 424 ? 9.290   24.485  -35.850 1.00 46.15  ? 424  ARG B N   1 
ATOM   7359 C CA  . ARG B 1 424 ? 8.080   24.538  -35.027 1.00 45.82  ? 424  ARG B CA  1 
ATOM   7360 C C   . ARG B 1 424 ? 7.617   23.108  -34.746 1.00 44.81  ? 424  ARG B C   1 
ATOM   7361 O O   . ARG B 1 424 ? 7.221   22.396  -35.662 1.00 44.82  ? 424  ARG B O   1 
ATOM   7362 C CB  . ARG B 1 424 ? 7.013   25.318  -35.774 1.00 46.22  ? 424  ARG B CB  1 
ATOM   7363 C CG  . ARG B 1 424 ? 5.769   25.619  -35.004 1.00 48.29  ? 424  ARG B CG  1 
ATOM   7364 C CD  . ARG B 1 424 ? 4.743   26.249  -35.961 1.00 52.41  ? 424  ARG B CD  1 
ATOM   7365 N NE  . ARG B 1 424 ? 3.865   27.243  -35.339 1.00 53.48  ? 424  ARG B NE  1 
ATOM   7366 C CZ  . ARG B 1 424 ? 4.097   27.868  -34.188 1.00 53.62  ? 424  ARG B CZ  1 
ATOM   7367 N NH1 . ARG B 1 424 ? 5.197   27.642  -33.477 1.00 54.37  ? 424  ARG B NH1 1 
ATOM   7368 N NH2 . ARG B 1 424 ? 3.213   28.733  -33.747 1.00 54.22  ? 424  ARG B NH2 1 
ATOM   7369 N N   . VAL B 1 425 ? 7.682   22.695  -33.484 1.00 43.72  ? 425  VAL B N   1 
ATOM   7370 C CA  . VAL B 1 425 ? 7.512   21.281  -33.111 1.00 42.75  ? 425  VAL B CA  1 
ATOM   7371 C C   . VAL B 1 425 ? 6.255   21.030  -32.276 1.00 42.25  ? 425  VAL B C   1 
ATOM   7372 O O   . VAL B 1 425 ? 6.038   21.682  -31.272 1.00 42.04  ? 425  VAL B O   1 
ATOM   7373 C CB  . VAL B 1 425 ? 8.764   20.764  -32.324 1.00 42.64  ? 425  VAL B CB  1 
ATOM   7374 C CG1 . VAL B 1 425 ? 8.628   19.305  -31.954 1.00 41.90  ? 425  VAL B CG1 1 
ATOM   7375 C CG2 . VAL B 1 425 ? 10.025  20.978  -33.132 1.00 42.34  ? 425  VAL B CG2 1 
ATOM   7376 N N   . TYR B 1 426 ? 5.435   20.081  -32.692 1.00 41.98  ? 426  TYR B N   1 
ATOM   7377 C CA  . TYR B 1 426 ? 4.323   19.615  -31.867 1.00 41.89  ? 426  TYR B CA  1 
ATOM   7378 C C   . TYR B 1 426 ? 4.579   18.167  -31.474 1.00 42.24  ? 426  TYR B C   1 
ATOM   7379 O O   . TYR B 1 426 ? 4.950   17.348  -32.324 1.00 42.80  ? 426  TYR B O   1 
ATOM   7380 C CB  . TYR B 1 426 ? 3.024   19.711  -32.639 1.00 41.48  ? 426  TYR B CB  1 
ATOM   7381 C CG  . TYR B 1 426 ? 2.614   21.123  -32.921 1.00 41.39  ? 426  TYR B CG  1 
ATOM   7382 C CD1 . TYR B 1 426 ? 2.993   21.763  -34.093 1.00 41.04  ? 426  TYR B CD1 1 
ATOM   7383 C CD2 . TYR B 1 426 ? 1.843   21.828  -32.009 1.00 41.25  ? 426  TYR B CD2 1 
ATOM   7384 C CE1 . TYR B 1 426 ? 2.606   23.070  -34.345 1.00 40.96  ? 426  TYR B CE1 1 
ATOM   7385 C CE2 . TYR B 1 426 ? 1.452   23.121  -32.251 1.00 40.24  ? 426  TYR B CE2 1 
ATOM   7386 C CZ  . TYR B 1 426 ? 1.835   23.738  -33.416 1.00 40.85  ? 426  TYR B CZ  1 
ATOM   7387 O OH  . TYR B 1 426 ? 1.449   25.040  -33.626 1.00 42.06  ? 426  TYR B OH  1 
ATOM   7388 N N   . ALA B 1 427 ? 4.401   17.831  -30.204 1.00 41.94  ? 427  ALA B N   1 
ATOM   7389 C CA  . ALA B 1 427 ? 4.728   16.482  -29.788 1.00 41.98  ? 427  ALA B CA  1 
ATOM   7390 C C   . ALA B 1 427 ? 3.617   15.821  -28.995 1.00 42.27  ? 427  ALA B C   1 
ATOM   7391 O O   . ALA B 1 427 ? 2.855   16.502  -28.300 1.00 42.45  ? 427  ALA B O   1 
ATOM   7392 C CB  . ALA B 1 427 ? 6.043   16.461  -29.027 1.00 41.76  ? 427  ALA B CB  1 
ATOM   7393 N N   . TYR B 1 428 ? 3.525   14.495  -29.106 1.00 42.41  ? 428  TYR B N   1 
ATOM   7394 C CA  . TYR B 1 428 ? 2.462   13.747  -28.434 1.00 42.72  ? 428  TYR B CA  1 
ATOM   7395 C C   . TYR B 1 428 ? 2.945   12.458  -27.812 1.00 43.08  ? 428  TYR B C   1 
ATOM   7396 O O   . TYR B 1 428 ? 4.005   11.961  -28.128 1.00 43.13  ? 428  TYR B O   1 
ATOM   7397 C CB  . TYR B 1 428 ? 1.310   13.435  -29.395 1.00 42.28  ? 428  TYR B CB  1 
ATOM   7398 C CG  . TYR B 1 428 ? 1.682   12.454  -30.482 1.00 42.60  ? 428  TYR B CG  1 
ATOM   7399 C CD1 . TYR B 1 428 ? 1.813   11.089  -30.205 1.00 43.18  ? 428  TYR B CD1 1 
ATOM   7400 C CD2 . TYR B 1 428 ? 1.907   12.880  -31.791 1.00 42.09  ? 428  TYR B CD2 1 
ATOM   7401 C CE1 . TYR B 1 428 ? 2.163   10.184  -31.190 1.00 41.83  ? 428  TYR B CE1 1 
ATOM   7402 C CE2 . TYR B 1 428 ? 2.255   11.974  -32.787 1.00 41.42  ? 428  TYR B CE2 1 
ATOM   7403 C CZ  . TYR B 1 428 ? 2.378   10.633  -32.473 1.00 41.80  ? 428  TYR B CZ  1 
ATOM   7404 O OH  . TYR B 1 428 ? 2.725   9.725   -33.440 1.00 43.28  ? 428  TYR B OH  1 
ATOM   7405 N N   . ILE B 1 429 ? 2.138   11.928  -26.912 1.00 44.11  ? 429  ILE B N   1 
ATOM   7406 C CA  . ILE B 1 429 ? 2.229   10.539  -26.499 1.00 45.27  ? 429  ILE B CA  1 
ATOM   7407 C C   . ILE B 1 429 ? 0.827   9.923   -26.712 1.00 45.59  ? 429  ILE B C   1 
ATOM   7408 O O   . ILE B 1 429 ? -0.189  10.534  -26.374 1.00 45.30  ? 429  ILE B O   1 
ATOM   7409 C CB  . ILE B 1 429 ? 2.750   10.410  -25.050 1.00 45.21  ? 429  ILE B CB  1 
ATOM   7410 C CG1 . ILE B 1 429 ? 2.758   8.948   -24.588 1.00 45.93  ? 429  ILE B CG1 1 
ATOM   7411 C CG2 . ILE B 1 429 ? 1.914   11.239  -24.107 1.00 45.79  ? 429  ILE B CG2 1 
ATOM   7412 C CD1 . ILE B 1 429 ? 3.737   8.651   -23.410 1.00 45.85  ? 429  ILE B CD1 1 
ATOM   7413 N N   . PHE B 1 430 ? 0.790   8.746   -27.331 1.00 46.32  ? 430  PHE B N   1 
ATOM   7414 C CA  . PHE B 1 430 ? -0.453  8.057   -27.685 1.00 46.94  ? 430  PHE B CA  1 
ATOM   7415 C C   . PHE B 1 430 ? -0.706  6.964   -26.657 1.00 47.65  ? 430  PHE B C   1 
ATOM   7416 O O   . PHE B 1 430 ? 0.096   6.035   -26.499 1.00 47.82  ? 430  PHE B O   1 
ATOM   7417 C CB  . PHE B 1 430 ? -0.312  7.460   -29.087 1.00 46.90  ? 430  PHE B CB  1 
ATOM   7418 C CG  . PHE B 1 430 ? -1.549  6.799   -29.604 1.00 46.39  ? 430  PHE B CG  1 
ATOM   7419 C CD1 . PHE B 1 430 ? -1.739  5.429   -29.441 1.00 46.01  ? 430  PHE B CD1 1 
ATOM   7420 C CD2 . PHE B 1 430 ? -2.514  7.539   -30.281 1.00 46.23  ? 430  PHE B CD2 1 
ATOM   7421 C CE1 . PHE B 1 430 ? -2.885  4.811   -29.920 1.00 46.27  ? 430  PHE B CE1 1 
ATOM   7422 C CE2 . PHE B 1 430 ? -3.670  6.934   -30.770 1.00 46.35  ? 430  PHE B CE2 1 
ATOM   7423 C CZ  . PHE B 1 430 ? -3.860  5.567   -30.589 1.00 46.60  ? 430  PHE B CZ  1 
ATOM   7424 N N   . GLU B 1 431 ? -1.820  7.070   -25.948 1.00 48.52  ? 431  GLU B N   1 
ATOM   7425 C CA  . GLU B 1 431 ? -2.041  6.197   -24.791 1.00 49.41  ? 431  GLU B CA  1 
ATOM   7426 C C   . GLU B 1 431 ? -3.278  5.305   -24.873 1.00 49.76  ? 431  GLU B C   1 
ATOM   7427 O O   . GLU B 1 431 ? -3.618  4.638   -23.898 1.00 50.12  ? 431  GLU B O   1 
ATOM   7428 C CB  . GLU B 1 431 ? -2.088  7.029   -23.505 1.00 49.38  ? 431  GLU B CB  1 
ATOM   7429 C CG  . GLU B 1 431 ? -0.781  7.701   -23.170 1.00 49.81  ? 431  GLU B CG  1 
ATOM   7430 C CD  . GLU B 1 431 ? -0.839  8.479   -21.878 1.00 50.22  ? 431  GLU B CD  1 
ATOM   7431 O OE1 . GLU B 1 431 ? -1.869  9.161   -21.645 1.00 50.04  ? 431  GLU B OE1 1 
ATOM   7432 O OE2 . GLU B 1 431 ? 0.151   8.398   -21.105 1.00 49.75  ? 431  GLU B OE2 1 
ATOM   7433 N N   . HIS B 1 432 ? -3.937  5.279   -26.026 1.00 50.19  ? 432  HIS B N   1 
ATOM   7434 C CA  . HIS B 1 432 ? -5.131  4.469   -26.185 1.00 50.74  ? 432  HIS B CA  1 
ATOM   7435 C C   . HIS B 1 432 ? -4.893  3.100   -26.794 1.00 51.07  ? 432  HIS B C   1 
ATOM   7436 O O   . HIS B 1 432 ? -4.440  2.993   -27.935 1.00 51.11  ? 432  HIS B O   1 
ATOM   7437 C CB  . HIS B 1 432 ? -6.156  5.185   -27.029 1.00 50.90  ? 432  HIS B CB  1 
ATOM   7438 C CG  . HIS B 1 432 ? -7.384  4.371   -27.259 1.00 51.52  ? 432  HIS B CG  1 
ATOM   7439 N ND1 . HIS B 1 432 ? -8.314  4.142   -26.272 1.00 52.09  ? 432  HIS B ND1 1 
ATOM   7440 C CD2 . HIS B 1 432 ? -7.821  3.705   -28.353 1.00 52.87  ? 432  HIS B CD2 1 
ATOM   7441 C CE1 . HIS B 1 432 ? -9.287  3.391   -26.757 1.00 53.35  ? 432  HIS B CE1 1 
ATOM   7442 N NE2 . HIS B 1 432 ? -9.009  3.108   -28.017 1.00 53.39  ? 432  HIS B NE2 1 
ATOM   7443 N N   . ARG B 1 433 ? -5.232  2.059   -26.034 1.00 51.78  ? 433  ARG B N   1 
ATOM   7444 C CA  . ARG B 1 433 ? -5.143  0.681   -26.512 1.00 52.23  ? 433  ARG B CA  1 
ATOM   7445 C C   . ARG B 1 433 ? -6.446  0.331   -27.219 1.00 52.94  ? 433  ARG B C   1 
ATOM   7446 O O   . ARG B 1 433 ? -7.527  0.407   -26.629 1.00 52.63  ? 433  ARG B O   1 
ATOM   7447 C CB  . ARG B 1 433 ? -4.860  -0.301  -25.371 1.00 51.76  ? 433  ARG B CB  1 
ATOM   7448 C CG  . ARG B 1 433 ? -4.710  -1.759  -25.812 1.00 52.03  ? 433  ARG B CG  1 
ATOM   7449 C CD  . ARG B 1 433 ? -4.686  -2.712  -24.618 1.00 52.34  ? 433  ARG B CD  1 
ATOM   7450 N NE  . ARG B 1 433 ? -4.959  -4.116  -24.963 1.00 53.07  ? 433  ARG B NE  1 
ATOM   7451 C CZ  . ARG B 1 433 ? -4.034  -5.083  -25.025 1.00 53.57  ? 433  ARG B CZ  1 
ATOM   7452 N NH1 . ARG B 1 433 ? -2.747  -4.825  -24.795 1.00 53.22  ? 433  ARG B NH1 1 
ATOM   7453 N NH2 . ARG B 1 433 ? -4.394  -6.324  -25.319 1.00 52.69  ? 433  ARG B NH2 1 
ATOM   7454 N N   . ALA B 1 434 ? -6.312  -0.029  -28.497 1.00 54.05  ? 434  ALA B N   1 
ATOM   7455 C CA  . ALA B 1 434 ? -7.414  -0.447  -29.353 1.00 54.90  ? 434  ALA B CA  1 
ATOM   7456 C C   . ALA B 1 434 ? -8.171  -1.591  -28.709 1.00 55.53  ? 434  ALA B C   1 
ATOM   7457 O O   . ALA B 1 434 ? -7.554  -2.569  -28.261 1.00 55.67  ? 434  ALA B O   1 
ATOM   7458 C CB  . ALA B 1 434 ? -6.871  -0.888  -30.702 1.00 54.92  ? 434  ALA B CB  1 
ATOM   7459 N N   . SER B 1 435 ? -9.499  -1.460  -28.660 1.00 56.08  ? 435  SER B N   1 
ATOM   7460 C CA  . SER B 1 435 ? -10.377 -2.509  -28.133 1.00 56.55  ? 435  SER B CA  1 
ATOM   7461 C C   . SER B 1 435 ? -10.208 -3.819  -28.899 1.00 56.81  ? 435  SER B C   1 
ATOM   7462 O O   . SER B 1 435 ? -10.198 -4.888  -28.301 1.00 56.69  ? 435  SER B O   1 
ATOM   7463 C CB  . SER B 1 435 ? -11.837 -2.059  -28.172 1.00 56.59  ? 435  SER B CB  1 
ATOM   7464 O OG  . SER B 1 435 ? -12.362 -2.117  -29.486 1.00 56.76  ? 435  SER B OG  1 
ATOM   7465 N N   . THR B 1 436 ? -10.045 -3.709  -30.217 1.00 57.43  ? 436  THR B N   1 
ATOM   7466 C CA  . THR B 1 436 ? -9.788  -4.847  -31.114 1.00 58.16  ? 436  THR B CA  1 
ATOM   7467 C C   . THR B 1 436 ? -8.329  -5.386  -31.134 1.00 58.75  ? 436  THR B C   1 
ATOM   7468 O O   . THR B 1 436 ? -7.957  -6.152  -32.042 1.00 59.03  ? 436  THR B O   1 
ATOM   7469 C CB  . THR B 1 436 ? -10.160 -4.487  -32.569 1.00 57.93  ? 436  THR B CB  1 
ATOM   7470 O OG1 . THR B 1 436 ? -9.333  -3.404  -33.023 1.00 57.88  ? 436  THR B OG1 1 
ATOM   7471 C CG2 . THR B 1 436 ? -11.618 -4.092  -32.670 1.00 58.34  ? 436  THR B CG2 1 
ATOM   7472 N N   . LEU B 1 437 ? -7.502  -5.002  -30.162 1.00 58.99  ? 437  LEU B N   1 
ATOM   7473 C CA  . LEU B 1 437 ? -6.113  -5.445  -30.183 1.00 59.37  ? 437  LEU B CA  1 
ATOM   7474 C C   . LEU B 1 437 ? -6.030  -6.930  -29.863 1.00 59.73  ? 437  LEU B C   1 
ATOM   7475 O O   . LEU B 1 437 ? -6.844  -7.458  -29.100 1.00 60.12  ? 437  LEU B O   1 
ATOM   7476 C CB  . LEU B 1 437 ? -5.243  -4.649  -29.211 1.00 59.54  ? 437  LEU B CB  1 
ATOM   7477 C CG  . LEU B 1 437 ? -3.795  -4.508  -29.694 1.00 59.48  ? 437  LEU B CG  1 
ATOM   7478 C CD1 . LEU B 1 437 ? -3.520  -3.053  -29.997 1.00 59.51  ? 437  LEU B CD1 1 
ATOM   7479 C CD2 . LEU B 1 437 ? -2.808  -5.037  -28.665 1.00 59.58  ? 437  LEU B CD2 1 
ATOM   7480 N N   . THR B 1 438 ? -5.028  -7.587  -30.438 1.00 59.76  ? 438  THR B N   1 
ATOM   7481 C CA  . THR B 1 438 ? -4.906  -9.042  -30.385 1.00 59.47  ? 438  THR B CA  1 
ATOM   7482 C C   . THR B 1 438 ? -3.722  -9.563  -29.553 1.00 58.85  ? 438  THR B C   1 
ATOM   7483 O O   . THR B 1 438 ? -3.669  -10.755 -29.246 1.00 58.58  ? 438  THR B O   1 
ATOM   7484 C CB  . THR B 1 438 ? -4.883  -9.636  -31.818 1.00 59.81  ? 438  THR B CB  1 
ATOM   7485 O OG1 . THR B 1 438 ? -4.293  -8.689  -32.730 1.00 60.15  ? 438  THR B OG1 1 
ATOM   7486 C CG2 . THR B 1 438 ? -6.311  -9.946  -32.277 1.00 59.82  ? 438  THR B CG2 1 
ATOM   7487 N N   . TRP B 1 439 ? -2.789  -8.675  -29.194 1.00 58.26  ? 439  TRP B N   1 
ATOM   7488 C CA  . TRP B 1 439 ? -1.681  -9.016  -28.277 1.00 57.87  ? 439  TRP B CA  1 
ATOM   7489 C C   . TRP B 1 439 ? -2.177  -8.996  -26.833 1.00 58.17  ? 439  TRP B C   1 
ATOM   7490 O O   . TRP B 1 439 ? -3.229  -8.431  -26.553 1.00 58.35  ? 439  TRP B O   1 
ATOM   7491 C CB  . TRP B 1 439 ? -0.533  -8.026  -28.409 1.00 57.03  ? 439  TRP B CB  1 
ATOM   7492 C CG  . TRP B 1 439 ? 0.018   -7.896  -29.778 1.00 56.55  ? 439  TRP B CG  1 
ATOM   7493 C CD1 . TRP B 1 439 ? -0.407  -7.039  -30.763 1.00 55.52  ? 439  TRP B CD1 1 
ATOM   7494 C CD2 . TRP B 1 439 ? 1.117   -8.627  -30.327 1.00 55.42  ? 439  TRP B CD2 1 
ATOM   7495 N NE1 . TRP B 1 439 ? 0.360   -7.208  -31.891 1.00 54.69  ? 439  TRP B NE1 1 
ATOM   7496 C CE2 . TRP B 1 439 ? 1.300   -8.177  -31.650 1.00 55.02  ? 439  TRP B CE2 1 
ATOM   7497 C CE3 . TRP B 1 439 ? 1.955   -9.633  -29.835 1.00 55.12  ? 439  TRP B CE3 1 
ATOM   7498 C CZ2 . TRP B 1 439 ? 2.287   -8.698  -32.481 1.00 55.72  ? 439  TRP B CZ2 1 
ATOM   7499 C CZ3 . TRP B 1 439 ? 2.937   -10.144 -30.659 1.00 54.80  ? 439  TRP B CZ3 1 
ATOM   7500 C CH2 . TRP B 1 439 ? 3.098   -9.676  -31.963 1.00 55.59  ? 439  TRP B CH2 1 
ATOM   7501 N N   . PRO B 1 440 ? -1.421  -9.590  -25.901 1.00 58.46  ? 440  PRO B N   1 
ATOM   7502 C CA  . PRO B 1 440 ? -1.949  -9.641  -24.537 1.00 59.12  ? 440  PRO B CA  1 
ATOM   7503 C C   . PRO B 1 440 ? -1.831  -8.295  -23.815 1.00 59.79  ? 440  PRO B C   1 
ATOM   7504 O O   . PRO B 1 440 ? -1.082  -7.414  -24.256 1.00 59.98  ? 440  PRO B O   1 
ATOM   7505 C CB  . PRO B 1 440 ? -1.080  -10.700 -23.861 1.00 59.17  ? 440  PRO B CB  1 
ATOM   7506 C CG  . PRO B 1 440 ? 0.210   -10.660 -24.623 1.00 58.83  ? 440  PRO B CG  1 
ATOM   7507 C CD  . PRO B 1 440 ? -0.098  -10.226 -26.022 1.00 58.45  ? 440  PRO B CD  1 
ATOM   7508 N N   . LEU B 1 441 ? -2.564  -8.150  -22.714 1.00 60.15  ? 441  LEU B N   1 
ATOM   7509 C CA  . LEU B 1 441 ? -2.668  -6.873  -22.020 1.00 60.29  ? 441  LEU B CA  1 
ATOM   7510 C C   . LEU B 1 441 ? -1.332  -6.312  -21.557 1.00 60.04  ? 441  LEU B C   1 
ATOM   7511 O O   . LEU B 1 441 ? -1.165  -5.086  -21.500 1.00 60.09  ? 441  LEU B O   1 
ATOM   7512 C CB  . LEU B 1 441 ? -3.618  -6.974  -20.824 1.00 60.67  ? 441  LEU B CB  1 
ATOM   7513 C CG  . LEU B 1 441 ? -5.121  -7.199  -21.066 1.00 62.21  ? 441  LEU B CG  1 
ATOM   7514 C CD1 . LEU B 1 441 ? -5.851  -7.322  -19.717 1.00 63.19  ? 441  LEU B CD1 1 
ATOM   7515 C CD2 . LEU B 1 441 ? -5.783  -6.115  -21.943 1.00 62.55  ? 441  LEU B CD2 1 
ATOM   7516 N N   . TRP B 1 442 ? -0.383  -7.192  -21.231 1.00 59.62  ? 442  TRP B N   1 
ATOM   7517 C CA  . TRP B 1 442 ? 0.901   -6.740  -20.673 1.00 59.06  ? 442  TRP B CA  1 
ATOM   7518 C C   . TRP B 1 442 ? 1.735   -5.916  -21.666 1.00 58.29  ? 442  TRP B C   1 
ATOM   7519 O O   . TRP B 1 442 ? 2.732   -5.307  -21.295 1.00 58.22  ? 442  TRP B O   1 
ATOM   7520 C CB  . TRP B 1 442 ? 1.717   -7.909  -20.122 1.00 59.44  ? 442  TRP B CB  1 
ATOM   7521 C CG  . TRP B 1 442 ? 2.367   -8.746  -21.174 1.00 59.96  ? 442  TRP B CG  1 
ATOM   7522 C CD1 . TRP B 1 442 ? 1.893   -9.912  -21.686 1.00 60.69  ? 442  TRP B CD1 1 
ATOM   7523 C CD2 . TRP B 1 442 ? 3.613   -8.488  -21.844 1.00 60.68  ? 442  TRP B CD2 1 
ATOM   7524 N NE1 . TRP B 1 442 ? 2.760   -10.403 -22.632 1.00 61.13  ? 442  TRP B NE1 1 
ATOM   7525 C CE2 . TRP B 1 442 ? 3.823   -9.546  -22.752 1.00 61.25  ? 442  TRP B CE2 1 
ATOM   7526 C CE3 . TRP B 1 442 ? 4.568   -7.464  -21.772 1.00 60.70  ? 442  TRP B CE3 1 
ATOM   7527 C CZ2 . TRP B 1 442 ? 4.955   -9.612  -23.588 1.00 60.89  ? 442  TRP B CZ2 1 
ATOM   7528 C CZ3 . TRP B 1 442 ? 5.687   -7.528  -22.605 1.00 60.51  ? 442  TRP B CZ3 1 
ATOM   7529 C CH2 . TRP B 1 442 ? 5.870   -8.596  -23.499 1.00 60.22  ? 442  TRP B CH2 1 
ATOM   7530 N N   . MET B 1 443 ? 1.321   -5.904  -22.925 1.00 57.38  ? 443  MET B N   1 
ATOM   7531 C CA  . MET B 1 443 ? 1.998   -5.128  -23.957 1.00 56.30  ? 443  MET B CA  1 
ATOM   7532 C C   . MET B 1 443 ? 1.448   -3.694  -24.084 1.00 55.24  ? 443  MET B C   1 
ATOM   7533 O O   . MET B 1 443 ? 2.002   -2.861  -24.795 1.00 54.72  ? 443  MET B O   1 
ATOM   7534 C CB  . MET B 1 443 ? 1.934   -5.889  -25.284 1.00 56.30  ? 443  MET B CB  1 
ATOM   7535 C CG  . MET B 1 443 ? 2.722   -7.179  -25.227 1.00 56.01  ? 443  MET B CG  1 
ATOM   7536 S SD  . MET B 1 443 ? 2.886   -8.049  -26.790 1.00 56.63  ? 443  MET B SD  1 
ATOM   7537 C CE  . MET B 1 443 ? 3.815   -6.927  -27.820 1.00 55.82  ? 443  MET B CE  1 
ATOM   7538 N N   . GLY B 1 444 ? 0.357   -3.426  -23.377 1.00 54.32  ? 444  GLY B N   1 
ATOM   7539 C CA  . GLY B 1 444 ? -0.232  -2.098  -23.328 1.00 53.46  ? 444  GLY B CA  1 
ATOM   7540 C C   . GLY B 1 444 ? -0.649  -1.573  -24.682 1.00 52.74  ? 444  GLY B C   1 
ATOM   7541 O O   . GLY B 1 444 ? -1.463  -2.197  -25.362 1.00 52.72  ? 444  GLY B O   1 
ATOM   7542 N N   . VAL B 1 445 ? -0.099  -0.410  -25.046 1.00 52.02  ? 445  VAL B N   1 
ATOM   7543 C CA  . VAL B 1 445 ? -0.320  0.234   -26.342 1.00 50.78  ? 445  VAL B CA  1 
ATOM   7544 C C   . VAL B 1 445 ? 0.995   0.098   -27.061 1.00 50.40  ? 445  VAL B C   1 
ATOM   7545 O O   . VAL B 1 445 ? 1.913   0.879   -26.823 1.00 50.24  ? 445  VAL B O   1 
ATOM   7546 C CB  . VAL B 1 445 ? -0.609  1.741   -26.216 1.00 50.78  ? 445  VAL B CB  1 
ATOM   7547 C CG1 . VAL B 1 445 ? -0.927  2.344   -27.593 1.00 50.53  ? 445  VAL B CG1 1 
ATOM   7548 C CG2 . VAL B 1 445 ? -1.720  2.024   -25.209 1.00 49.75  ? 445  VAL B CG2 1 
ATOM   7549 N N   . PRO B 1 446 ? 1.113   -0.933  -27.904 1.00 50.17  ? 446  PRO B N   1 
ATOM   7550 C CA  . PRO B 1 446 ? 2.405   -1.285  -28.479 1.00 49.97  ? 446  PRO B CA  1 
ATOM   7551 C C   . PRO B 1 446 ? 2.700   -0.595  -29.794 1.00 49.74  ? 446  PRO B C   1 
ATOM   7552 O O   . PRO B 1 446 ? 1.795   -0.168  -30.509 1.00 49.70  ? 446  PRO B O   1 
ATOM   7553 C CB  . PRO B 1 446 ? 2.294   -2.805  -28.698 1.00 49.94  ? 446  PRO B CB  1 
ATOM   7554 C CG  . PRO B 1 446 ? 0.826   -3.158  -28.464 1.00 50.12  ? 446  PRO B CG  1 
ATOM   7555 C CD  . PRO B 1 446 ? 0.063   -1.867  -28.334 1.00 50.06  ? 446  PRO B CD  1 
ATOM   7556 N N   . HIS B 1 447 ? 3.985   -0.499  -30.088 1.00 49.60  ? 447  HIS B N   1 
ATOM   7557 C CA  . HIS B 1 447 ? 4.483   -0.018  -31.352 1.00 49.72  ? 447  HIS B CA  1 
ATOM   7558 C C   . HIS B 1 447 ? 3.612   -0.413  -32.543 1.00 49.44  ? 447  HIS B C   1 
ATOM   7559 O O   . HIS B 1 447 ? 3.395   -1.586  -32.802 1.00 49.37  ? 447  HIS B O   1 
ATOM   7560 C CB  . HIS B 1 447 ? 5.879   -0.587  -31.550 1.00 50.30  ? 447  HIS B CB  1 
ATOM   7561 C CG  . HIS B 1 447 ? 6.610   0.017   -32.698 1.00 51.30  ? 447  HIS B CG  1 
ATOM   7562 N ND1 . HIS B 1 447 ? 7.510   1.044   -32.542 1.00 52.49  ? 447  HIS B ND1 1 
ATOM   7563 C CD2 . HIS B 1 447 ? 6.556   -0.243  -34.023 1.00 53.02  ? 447  HIS B CD2 1 
ATOM   7564 C CE1 . HIS B 1 447 ? 7.993   1.384   -33.722 1.00 53.71  ? 447  HIS B CE1 1 
ATOM   7565 N NE2 . HIS B 1 447 ? 7.427   0.620   -34.638 1.00 54.74  ? 447  HIS B NE2 1 
ATOM   7566 N N   . GLY B 1 448 ? 3.137   0.580   -33.276 1.00 49.57  ? 448  GLY B N   1 
ATOM   7567 C CA  . GLY B 1 448 ? 2.355   0.342   -34.472 1.00 49.63  ? 448  GLY B CA  1 
ATOM   7568 C C   . GLY B 1 448 ? 0.878   0.657   -34.326 1.00 49.92  ? 448  GLY B C   1 
ATOM   7569 O O   . GLY B 1 448 ? 0.220   1.033   -35.304 1.00 50.39  ? 448  GLY B O   1 
ATOM   7570 N N   . TYR B 1 449 ? 0.344   0.533   -33.114 1.00 49.67  ? 449  TYR B N   1 
ATOM   7571 C CA  . TYR B 1 449 ? -1.112  0.501   -32.953 1.00 49.49  ? 449  TYR B CA  1 
ATOM   7572 C C   . TYR B 1 449 ? -1.820  1.846   -32.841 1.00 49.25  ? 449  TYR B C   1 
ATOM   7573 O O   . TYR B 1 449 ? -2.945  1.924   -32.360 1.00 49.60  ? 449  TYR B O   1 
ATOM   7574 C CB  . TYR B 1 449 ? -1.512  -0.530  -31.889 1.00 49.49  ? 449  TYR B CB  1 
ATOM   7575 C CG  . TYR B 1 449 ? -1.118  -1.883  -32.408 1.00 49.93  ? 449  TYR B CG  1 
ATOM   7576 C CD1 . TYR B 1 449 ? 0.162   -2.393  -32.175 1.00 49.81  ? 449  TYR B CD1 1 
ATOM   7577 C CD2 . TYR B 1 449 ? -1.983  -2.614  -33.231 1.00 50.05  ? 449  TYR B CD2 1 
ATOM   7578 C CE1 . TYR B 1 449 ? 0.554   -3.617  -32.707 1.00 50.16  ? 449  TYR B CE1 1 
ATOM   7579 C CE2 . TYR B 1 449 ? -1.603  -3.836  -33.764 1.00 49.90  ? 449  TYR B CE2 1 
ATOM   7580 C CZ  . TYR B 1 449 ? -0.333  -4.331  -33.499 1.00 50.21  ? 449  TYR B CZ  1 
ATOM   7581 O OH  . TYR B 1 449 ? 0.056   -5.540  -34.025 1.00 50.66  ? 449  TYR B OH  1 
ATOM   7582 N N   . GLU B 1 450 ? -1.161  2.887   -33.336 1.00 48.64  ? 450  GLU B N   1 
ATOM   7583 C CA  . GLU B 1 450 ? -1.755  4.193   -33.461 1.00 48.36  ? 450  GLU B CA  1 
ATOM   7584 C C   . GLU B 1 450 ? -2.211  4.416   -34.905 1.00 48.18  ? 450  GLU B C   1 
ATOM   7585 O O   . GLU B 1 450 ? -3.206  5.099   -35.163 1.00 48.36  ? 450  GLU B O   1 
ATOM   7586 C CB  . GLU B 1 450 ? -0.741  5.261   -33.050 1.00 48.47  ? 450  GLU B CB  1 
ATOM   7587 C CG  . GLU B 1 450 ? 0.258   5.686   -34.141 1.00 50.04  ? 450  GLU B CG  1 
ATOM   7588 C CD  . GLU B 1 450 ? 1.561   4.875   -34.154 1.00 53.54  ? 450  GLU B CD  1 
ATOM   7589 O OE1 . GLU B 1 450 ? 1.523   3.627   -33.994 1.00 53.04  ? 450  GLU B OE1 1 
ATOM   7590 O OE2 . GLU B 1 450 ? 2.637   5.502   -34.332 1.00 55.43  ? 450  GLU B OE2 1 
ATOM   7591 N N   . ILE B 1 451 ? -1.464  3.833   -35.841 1.00 47.73  ? 451  ILE B N   1 
ATOM   7592 C CA  . ILE B 1 451 ? -1.657  4.040   -37.273 1.00 47.07  ? 451  ILE B CA  1 
ATOM   7593 C C   . ILE B 1 451 ? -3.118  3.823   -37.656 1.00 46.79  ? 451  ILE B C   1 
ATOM   7594 O O   . ILE B 1 451 ? -3.711  4.655   -38.349 1.00 46.13  ? 451  ILE B O   1 
ATOM   7595 C CB  . ILE B 1 451 ? -0.718  3.108   -38.109 1.00 47.16  ? 451  ILE B CB  1 
ATOM   7596 C CG1 . ILE B 1 451 ? 0.758   3.460   -37.886 1.00 46.61  ? 451  ILE B CG1 1 
ATOM   7597 C CG2 . ILE B 1 451 ? -1.025  3.196   -39.597 1.00 47.46  ? 451  ILE B CG2 1 
ATOM   7598 C CD1 . ILE B 1 451 ? 1.713   2.287   -38.061 1.00 44.41  ? 451  ILE B CD1 1 
ATOM   7599 N N   . GLU B 1 452 ? -3.696  2.716   -37.184 1.00 46.77  ? 452  GLU B N   1 
ATOM   7600 C CA  . GLU B 1 452 ? -5.077  2.370   -37.526 1.00 47.11  ? 452  GLU B CA  1 
ATOM   7601 C C   . GLU B 1 452 ? -6.065  3.476   -37.181 1.00 46.94  ? 452  GLU B C   1 
ATOM   7602 O O   . GLU B 1 452 ? -7.055  3.660   -37.882 1.00 47.14  ? 452  GLU B O   1 
ATOM   7603 C CB  . GLU B 1 452 ? -5.509  1.033   -36.913 1.00 47.05  ? 452  GLU B CB  1 
ATOM   7604 C CG  . GLU B 1 452 ? -5.401  0.912   -35.402 1.00 47.84  ? 452  GLU B CG  1 
ATOM   7605 C CD  . GLU B 1 452 ? -5.347  -0.545  -34.934 1.00 48.30  ? 452  GLU B CD  1 
ATOM   7606 O OE1 . GLU B 1 452 ? -6.242  -0.967  -34.165 1.00 49.43  ? 452  GLU B OE1 1 
ATOM   7607 O OE2 . GLU B 1 452 ? -4.412  -1.278  -35.338 1.00 50.06  ? 452  GLU B OE2 1 
ATOM   7608 N N   . PHE B 1 453 ? -5.784  4.222   -36.116 1.00 46.86  ? 453  PHE B N   1 
ATOM   7609 C CA  . PHE B 1 453 ? -6.616  5.354   -35.735 1.00 46.44  ? 453  PHE B CA  1 
ATOM   7610 C C   . PHE B 1 453 ? -6.364  6.585   -36.595 1.00 47.05  ? 453  PHE B C   1 
ATOM   7611 O O   . PHE B 1 453 ? -7.316  7.256   -36.989 1.00 47.67  ? 453  PHE B O   1 
ATOM   7612 C CB  . PHE B 1 453 ? -6.424  5.691   -34.273 1.00 45.82  ? 453  PHE B CB  1 
ATOM   7613 C CG  . PHE B 1 453 ? -6.952  4.658   -33.352 1.00 44.74  ? 453  PHE B CG  1 
ATOM   7614 C CD1 . PHE B 1 453 ? -8.280  4.688   -32.949 1.00 44.06  ? 453  PHE B CD1 1 
ATOM   7615 C CD2 . PHE B 1 453 ? -6.126  3.650   -32.880 1.00 44.11  ? 453  PHE B CD2 1 
ATOM   7616 C CE1 . PHE B 1 453 ? -8.785  3.717   -32.087 1.00 44.43  ? 453  PHE B CE1 1 
ATOM   7617 C CE2 . PHE B 1 453 ? -6.621  2.665   -32.014 1.00 44.46  ? 453  PHE B CE2 1 
ATOM   7618 C CZ  . PHE B 1 453 ? -7.953  2.699   -31.617 1.00 44.39  ? 453  PHE B CZ  1 
ATOM   7619 N N   . ILE B 1 454 ? -5.100  6.889   -36.892 1.00 47.25  ? 454  ILE B N   1 
ATOM   7620 C CA  . ILE B 1 454 ? -4.783  8.060   -37.717 1.00 47.48  ? 454  ILE B CA  1 
ATOM   7621 C C   . ILE B 1 454 ? -5.410  7.909   -39.090 1.00 48.09  ? 454  ILE B C   1 
ATOM   7622 O O   . ILE B 1 454 ? -5.893  8.884   -39.671 1.00 48.20  ? 454  ILE B O   1 
ATOM   7623 C CB  . ILE B 1 454 ? -3.263  8.251   -37.924 1.00 47.47  ? 454  ILE B CB  1 
ATOM   7624 C CG1 . ILE B 1 454 ? -2.507  8.364   -36.592 1.00 47.74  ? 454  ILE B CG1 1 
ATOM   7625 C CG2 . ILE B 1 454 ? -2.995  9.429   -38.834 1.00 46.63  ? 454  ILE B CG2 1 
ATOM   7626 C CD1 . ILE B 1 454 ? -3.030  9.447   -35.663 1.00 49.10  ? 454  ILE B CD1 1 
ATOM   7627 N N   . PHE B 1 455 ? -5.394  6.679   -39.602 1.00 48.70  ? 455  PHE B N   1 
ATOM   7628 C CA  . PHE B 1 455 ? -5.860  6.397   -40.955 1.00 49.29  ? 455  PHE B CA  1 
ATOM   7629 C C   . PHE B 1 455 ? -7.386  6.323   -41.065 1.00 50.02  ? 455  PHE B C   1 
ATOM   7630 O O   . PHE B 1 455 ? -7.937  6.316   -42.174 1.00 50.39  ? 455  PHE B O   1 
ATOM   7631 C CB  . PHE B 1 455 ? -5.174  5.144   -41.519 1.00 49.18  ? 455  PHE B CB  1 
ATOM   7632 C CG  . PHE B 1 455 ? -3.887  5.438   -42.238 1.00 48.81  ? 455  PHE B CG  1 
ATOM   7633 C CD1 . PHE B 1 455 ? -2.672  5.446   -41.551 1.00 49.59  ? 455  PHE B CD1 1 
ATOM   7634 C CD2 . PHE B 1 455 ? -3.887  5.727   -43.593 1.00 47.89  ? 455  PHE B CD2 1 
ATOM   7635 C CE1 . PHE B 1 455 ? -1.474  5.739   -42.208 1.00 48.69  ? 455  PHE B CE1 1 
ATOM   7636 C CE2 . PHE B 1 455 ? -2.703  6.020   -44.258 1.00 48.46  ? 455  PHE B CE2 1 
ATOM   7637 C CZ  . PHE B 1 455 ? -1.493  6.026   -43.566 1.00 48.66  ? 455  PHE B CZ  1 
ATOM   7638 N N   . GLY B 1 456 ? -8.059  6.281   -39.921 1.00 50.61  ? 456  GLY B N   1 
ATOM   7639 C CA  . GLY B 1 456 ? -9.511  6.358   -39.888 1.00 51.98  ? 456  GLY B CA  1 
ATOM   7640 C C   . GLY B 1 456 ? -10.240 5.031   -39.882 1.00 53.06  ? 456  GLY B C   1 
ATOM   7641 O O   . GLY B 1 456 ? -11.437 4.979   -40.154 1.00 53.08  ? 456  GLY B O   1 
ATOM   7642 N N   . LEU B 1 457 ? -9.536  3.958   -39.537 1.00 54.17  ? 457  LEU B N   1 
ATOM   7643 C CA  . LEU B 1 457 ? -10.097 2.616   -39.669 1.00 55.31  ? 457  LEU B CA  1 
ATOM   7644 C C   . LEU B 1 457 ? -11.361 2.362   -38.854 1.00 56.49  ? 457  LEU B C   1 
ATOM   7645 O O   . LEU B 1 457 ? -12.263 1.671   -39.324 1.00 56.72  ? 457  LEU B O   1 
ATOM   7646 C CB  . LEU B 1 457 ? -9.051  1.539   -39.397 1.00 55.05  ? 457  LEU B CB  1 
ATOM   7647 C CG  . LEU B 1 457 ? -8.535  0.835   -40.651 1.00 54.70  ? 457  LEU B CG  1 
ATOM   7648 C CD1 . LEU B 1 457 ? -7.697  1.778   -41.507 1.00 55.08  ? 457  LEU B CD1 1 
ATOM   7649 C CD2 . LEU B 1 457 ? -7.740  -0.416  -40.274 1.00 54.49  ? 457  LEU B CD2 1 
ATOM   7650 N N   . PRO B 1 458 ? -11.437 2.898   -37.629 1.00 57.49  ? 458  PRO B N   1 
ATOM   7651 C CA  . PRO B 1 458 ? -12.658 2.665   -36.860 1.00 58.31  ? 458  PRO B CA  1 
ATOM   7652 C C   . PRO B 1 458 ? -13.946 3.232   -37.471 1.00 59.21  ? 458  PRO B C   1 
ATOM   7653 O O   . PRO B 1 458 ? -15.033 2.843   -37.043 1.00 59.50  ? 458  PRO B O   1 
ATOM   7654 C CB  . PRO B 1 458 ? -12.351 3.336   -35.519 1.00 58.21  ? 458  PRO B CB  1 
ATOM   7655 C CG  . PRO B 1 458 ? -10.856 3.339   -35.444 1.00 57.70  ? 458  PRO B CG  1 
ATOM   7656 C CD  . PRO B 1 458 ? -10.449 3.655   -36.845 1.00 57.43  ? 458  PRO B CD  1 
ATOM   7657 N N   . LEU B 1 459 ? -13.842 4.118   -38.457 1.00 60.02  ? 459  LEU B N   1 
ATOM   7658 C CA  . LEU B 1 459 ? -15.046 4.665   -39.081 1.00 61.31  ? 459  LEU B CA  1 
ATOM   7659 C C   . LEU B 1 459 ? -15.772 3.605   -39.919 1.00 62.36  ? 459  LEU B C   1 
ATOM   7660 O O   . LEU B 1 459 ? -16.876 3.830   -40.430 1.00 62.54  ? 459  LEU B O   1 
ATOM   7661 C CB  . LEU B 1 459 ? -14.731 5.893   -39.941 1.00 61.24  ? 459  LEU B CB  1 
ATOM   7662 C CG  . LEU B 1 459 ? -13.915 7.104   -39.463 1.00 61.40  ? 459  LEU B CG  1 
ATOM   7663 C CD1 . LEU B 1 459 ? -14.479 8.337   -40.141 1.00 61.27  ? 459  LEU B CD1 1 
ATOM   7664 C CD2 . LEU B 1 459 ? -13.886 7.316   -37.952 1.00 60.99  ? 459  LEU B CD2 1 
ATOM   7665 N N   . ASP B 1 460 ? -15.135 2.449   -40.052 1.00 63.59  ? 460  ASP B N   1 
ATOM   7666 C CA  . ASP B 1 460 ? -15.659 1.350   -40.836 1.00 64.66  ? 460  ASP B CA  1 
ATOM   7667 C C   . ASP B 1 460 ? -16.359 0.394   -39.880 1.00 65.18  ? 460  ASP B C   1 
ATOM   7668 O O   . ASP B 1 460 ? -15.692 -0.294  -39.085 1.00 64.91  ? 460  ASP B O   1 
ATOM   7669 C CB  . ASP B 1 460 ? -14.512 0.665   -41.576 1.00 64.92  ? 460  ASP B CB  1 
ATOM   7670 C CG  . ASP B 1 460 ? -14.940 -0.589  -42.311 1.00 66.53  ? 460  ASP B CG  1 
ATOM   7671 O OD1 . ASP B 1 460 ? -15.889 -1.268  -41.856 1.00 68.95  ? 460  ASP B OD1 1 
ATOM   7672 O OD2 . ASP B 1 460 ? -14.308 -0.906  -43.346 1.00 68.00  ? 460  ASP B OD2 1 
ATOM   7673 N N   . PRO B 1 461 ? -17.710 0.335   -39.965 1.00 65.80  ? 461  PRO B N   1 
ATOM   7674 C CA  . PRO B 1 461 ? -18.527 -0.367  -38.961 1.00 65.99  ? 461  PRO B CA  1 
ATOM   7675 C C   . PRO B 1 461 ? -18.253 -1.868  -38.946 1.00 66.19  ? 461  PRO B C   1 
ATOM   7676 O O   . PRO B 1 461 ? -18.299 -2.497  -37.881 1.00 66.43  ? 461  PRO B O   1 
ATOM   7677 C CB  . PRO B 1 461 ? -19.967 -0.061  -39.393 1.00 65.95  ? 461  PRO B CB  1 
ATOM   7678 C CG  . PRO B 1 461 ? -19.849 1.125   -40.346 1.00 65.98  ? 461  PRO B CG  1 
ATOM   7679 C CD  . PRO B 1 461 ? -18.543 0.916   -41.036 1.00 65.70  ? 461  PRO B CD  1 
ATOM   7680 N N   . SER B 1 462 ? -17.925 -2.422  -40.109 1.00 66.24  ? 462  SER B N   1 
ATOM   7681 C CA  . SER B 1 462 ? -17.627 -3.845  -40.221 1.00 66.65  ? 462  SER B CA  1 
ATOM   7682 C C   . SER B 1 462 ? -16.439 -4.310  -39.359 1.00 67.00  ? 462  SER B C   1 
ATOM   7683 O O   . SER B 1 462 ? -16.144 -5.506  -39.291 1.00 67.00  ? 462  SER B O   1 
ATOM   7684 C CB  . SER B 1 462 ? -17.415 -4.234  -41.694 1.00 66.71  ? 462  SER B CB  1 
ATOM   7685 O OG  . SER B 1 462 ? -16.235 -3.665  -42.239 1.00 66.30  ? 462  SER B OG  1 
ATOM   7686 N N   . LEU B 1 463 ? -15.766 -3.372  -38.697 1.00 67.37  ? 463  LEU B N   1 
ATOM   7687 C CA  . LEU B 1 463 ? -14.534 -3.700  -37.983 1.00 67.68  ? 463  LEU B CA  1 
ATOM   7688 C C   . LEU B 1 463 ? -14.702 -3.780  -36.465 1.00 68.09  ? 463  LEU B C   1 
ATOM   7689 O O   . LEU B 1 463 ? -13.780 -4.190  -35.747 1.00 68.07  ? 463  LEU B O   1 
ATOM   7690 C CB  . LEU B 1 463 ? -13.415 -2.736  -38.386 1.00 67.55  ? 463  LEU B CB  1 
ATOM   7691 C CG  . LEU B 1 463 ? -12.741 -3.034  -39.730 1.00 67.26  ? 463  LEU B CG  1 
ATOM   7692 C CD1 . LEU B 1 463 ? -12.171 -1.775  -40.349 1.00 66.26  ? 463  LEU B CD1 1 
ATOM   7693 C CD2 . LEU B 1 463 ? -11.655 -4.106  -39.575 1.00 67.31  ? 463  LEU B CD2 1 
ATOM   7694 N N   . ASN B 1 464 ? -15.891 -3.408  -35.993 1.00 68.62  ? 464  ASN B N   1 
ATOM   7695 C CA  . ASN B 1 464 ? -16.277 -3.540  -34.576 1.00 69.22  ? 464  ASN B CA  1 
ATOM   7696 C C   . ASN B 1 464 ? -15.398 -2.767  -33.583 1.00 68.96  ? 464  ASN B C   1 
ATOM   7697 O O   . ASN B 1 464 ? -15.055 -3.259  -32.501 1.00 68.90  ? 464  ASN B O   1 
ATOM   7698 C CB  . ASN B 1 464 ? -16.448 -5.023  -34.169 1.00 69.54  ? 464  ASN B CB  1 
ATOM   7699 C CG  . ASN B 1 464 ? -17.567 -5.727  -34.953 1.00 70.90  ? 464  ASN B CG  1 
ATOM   7700 O OD1 . ASN B 1 464 ? -17.429 -6.893  -35.353 1.00 71.74  ? 464  ASN B OD1 1 
ATOM   7701 N ND2 . ASN B 1 464 ? -18.674 -5.014  -35.183 1.00 71.92  ? 464  ASN B ND2 1 
ATOM   7702 N N   . TYR B 1 465 ? -15.046 -1.546  -33.973 1.00 68.68  ? 465  TYR B N   1 
ATOM   7703 C CA  . TYR B 1 465 ? -14.450 -0.584  -33.056 1.00 68.30  ? 465  TYR B CA  1 
ATOM   7704 C C   . TYR B 1 465 ? -15.569 0.116   -32.279 1.00 68.26  ? 465  TYR B C   1 
ATOM   7705 O O   . TYR B 1 465 ? -16.593 0.496   -32.867 1.00 68.04  ? 465  TYR B O   1 
ATOM   7706 C CB  . TYR B 1 465 ? -13.647 0.460   -33.831 1.00 67.86  ? 465  TYR B CB  1 
ATOM   7707 C CG  . TYR B 1 465 ? -12.265 0.048   -34.285 1.00 67.20  ? 465  TYR B CG  1 
ATOM   7708 C CD1 . TYR B 1 465 ? -11.196 0.006   -33.399 1.00 66.75  ? 465  TYR B CD1 1 
ATOM   7709 C CD2 . TYR B 1 465 ? -12.016 -0.250  -35.616 1.00 67.35  ? 465  TYR B CD2 1 
ATOM   7710 C CE1 . TYR B 1 465 ? -9.924  -0.354  -33.828 1.00 66.66  ? 465  TYR B CE1 1 
ATOM   7711 C CE2 . TYR B 1 465 ? -10.746 -0.601  -36.053 1.00 67.06  ? 465  TYR B CE2 1 
ATOM   7712 C CZ  . TYR B 1 465 ? -9.710  -0.655  -35.157 1.00 66.64  ? 465  TYR B CZ  1 
ATOM   7713 O OH  . TYR B 1 465 ? -8.464  -1.002  -35.606 1.00 66.49  ? 465  TYR B OH  1 
ATOM   7714 N N   . THR B 1 466 ? -15.363 0.301   -30.974 1.00 68.22  ? 466  THR B N   1 
ATOM   7715 C CA  . THR B 1 466 ? -16.333 0.992   -30.111 1.00 68.36  ? 466  THR B CA  1 
ATOM   7716 C C   . THR B 1 466 ? -16.706 2.369   -30.645 1.00 68.38  ? 466  THR B C   1 
ATOM   7717 O O   . THR B 1 466 ? -15.913 3.027   -31.310 1.00 68.29  ? 466  THR B O   1 
ATOM   7718 C CB  . THR B 1 466 ? -15.811 1.191   -28.669 1.00 68.48  ? 466  THR B CB  1 
ATOM   7719 O OG1 . THR B 1 466 ? -15.003 2.379   -28.599 1.00 68.62  ? 466  THR B OG1 1 
ATOM   7720 C CG2 . THR B 1 466 ? -15.012 -0.017  -28.195 1.00 68.51  ? 466  THR B CG2 1 
ATOM   7721 N N   . THR B 1 467 ? -17.914 2.810   -30.323 1.00 68.63  ? 467  THR B N   1 
ATOM   7722 C CA  . THR B 1 467 ? -18.400 4.106   -30.782 1.00 68.88  ? 467  THR B CA  1 
ATOM   7723 C C   . THR B 1 467 ? -17.536 5.268   -30.261 1.00 68.84  ? 467  THR B C   1 
ATOM   7724 O O   . THR B 1 467 ? -17.433 6.314   -30.917 1.00 68.77  ? 467  THR B O   1 
ATOM   7725 C CB  . THR B 1 467 ? -19.927 4.302   -30.473 1.00 69.14  ? 467  THR B CB  1 
ATOM   7726 O OG1 . THR B 1 467 ? -20.339 5.631   -30.832 1.00 68.99  ? 467  THR B OG1 1 
ATOM   7727 C CG2 . THR B 1 467 ? -20.261 4.016   -28.982 1.00 69.42  ? 467  THR B CG2 1 
ATOM   7728 N N   . GLU B 1 468 ? -16.909 5.075   -29.100 1.00 68.66  ? 468  GLU B N   1 
ATOM   7729 C CA  . GLU B 1 468 ? -15.940 6.044   -28.579 1.00 68.69  ? 468  GLU B CA  1 
ATOM   7730 C C   . GLU B 1 468 ? -14.703 6.120   -29.489 1.00 67.84  ? 468  GLU B C   1 
ATOM   7731 O O   . GLU B 1 468 ? -14.295 7.221   -29.902 1.00 67.93  ? 468  GLU B O   1 
ATOM   7732 C CB  . GLU B 1 468 ? -15.526 5.710   -27.137 1.00 69.16  ? 468  GLU B CB  1 
ATOM   7733 C CG  . GLU B 1 468 ? -16.500 6.190   -26.055 1.00 71.75  ? 468  GLU B CG  1 
ATOM   7734 C CD  . GLU B 1 468 ? -17.642 5.199   -25.799 1.00 75.38  ? 468  GLU B CD  1 
ATOM   7735 O OE1 . GLU B 1 468 ? -18.801 5.502   -26.195 1.00 76.02  ? 468  GLU B OE1 1 
ATOM   7736 O OE2 . GLU B 1 468 ? -17.373 4.117   -25.211 1.00 76.03  ? 468  GLU B OE2 1 
ATOM   7737 N N   . GLU B 1 469 ? -14.137 4.948   -29.807 1.00 66.46  ? 469  GLU B N   1 
ATOM   7738 C CA  . GLU B 1 469 ? -12.954 4.830   -30.662 1.00 65.02  ? 469  GLU B CA  1 
ATOM   7739 C C   . GLU B 1 469 ? -13.169 5.472   -32.018 1.00 64.38  ? 469  GLU B C   1 
ATOM   7740 O O   . GLU B 1 469 ? -12.254 6.038   -32.601 1.00 64.30  ? 469  GLU B O   1 
ATOM   7741 C CB  . GLU B 1 469 ? -12.560 3.369   -30.841 1.00 64.74  ? 469  GLU B CB  1 
ATOM   7742 C CG  . GLU B 1 469 ? -11.908 2.765   -29.621 1.00 64.40  ? 469  GLU B CG  1 
ATOM   7743 C CD  . GLU B 1 469 ? -11.675 1.272   -29.748 1.00 64.77  ? 469  GLU B CD  1 
ATOM   7744 O OE1 . GLU B 1 469 ? -12.477 0.596   -30.434 1.00 64.49  ? 469  GLU B OE1 1 
ATOM   7745 O OE2 . GLU B 1 469 ? -10.691 0.774   -29.147 1.00 64.71  ? 469  GLU B OE2 1 
ATOM   7746 N N   . ARG B 1 470 ? -14.393 5.395   -32.509 1.00 63.78  ? 470  ARG B N   1 
ATOM   7747 C CA  . ARG B 1 470 ? -14.743 6.002   -33.782 1.00 63.47  ? 470  ARG B CA  1 
ATOM   7748 C C   . ARG B 1 470 ? -14.647 7.541   -33.737 1.00 62.51  ? 470  ARG B C   1 
ATOM   7749 O O   . ARG B 1 470 ? -14.302 8.172   -34.729 1.00 62.09  ? 470  ARG B O   1 
ATOM   7750 C CB  . ARG B 1 470 ? -16.127 5.506   -34.218 1.00 63.72  ? 470  ARG B CB  1 
ATOM   7751 C CG  . ARG B 1 470 ? -16.480 5.744   -35.672 1.00 65.93  ? 470  ARG B CG  1 
ATOM   7752 C CD  . ARG B 1 470 ? -17.431 6.929   -35.809 1.00 70.60  ? 470  ARG B CD  1 
ATOM   7753 N NE  . ARG B 1 470 ? -18.610 6.733   -34.962 1.00 74.34  ? 470  ARG B NE  1 
ATOM   7754 C CZ  . ARG B 1 470 ? -19.548 7.647   -34.720 1.00 75.55  ? 470  ARG B CZ  1 
ATOM   7755 N NH1 . ARG B 1 470 ? -19.483 8.862   -35.262 1.00 75.61  ? 470  ARG B NH1 1 
ATOM   7756 N NH2 . ARG B 1 470 ? -20.562 7.331   -33.925 1.00 76.32  ? 470  ARG B NH2 1 
ATOM   7757 N N   . ILE B 1 471 ? -14.924 8.135   -32.579 1.00 61.67  ? 471  ILE B N   1 
ATOM   7758 C CA  . ILE B 1 471 ? -14.821 9.592   -32.429 1.00 61.00  ? 471  ILE B CA  1 
ATOM   7759 C C   . ILE B 1 471 ? -13.362 10.013  -32.272 1.00 59.91  ? 471  ILE B C   1 
ATOM   7760 O O   . ILE B 1 471 ? -12.919 10.990  -32.885 1.00 59.90  ? 471  ILE B O   1 
ATOM   7761 C CB  . ILE B 1 471 ? -15.659 10.121  -31.236 1.00 61.27  ? 471  ILE B CB  1 
ATOM   7762 C CG1 . ILE B 1 471 ? -17.143 9.819   -31.464 1.00 62.22  ? 471  ILE B CG1 1 
ATOM   7763 C CG2 . ILE B 1 471 ? -15.458 11.634  -31.055 1.00 60.98  ? 471  ILE B CG2 1 
ATOM   7764 C CD1 . ILE B 1 471 ? -17.941 9.644   -30.175 1.00 64.31  ? 471  ILE B CD1 1 
ATOM   7765 N N   . PHE B 1 472 ? -12.639 9.262   -31.442 1.00 58.39  ? 472  PHE B N   1 
ATOM   7766 C CA  . PHE B 1 472 ? -11.204 9.415   -31.243 1.00 56.99  ? 472  PHE B CA  1 
ATOM   7767 C C   . PHE B 1 472 ? -10.466 9.434   -32.588 1.00 56.72  ? 472  PHE B C   1 
ATOM   7768 O O   . PHE B 1 472 ? -9.570  10.259  -32.809 1.00 56.72  ? 472  PHE B O   1 
ATOM   7769 C CB  . PHE B 1 472 ? -10.713 8.283   -30.335 1.00 56.54  ? 472  PHE B CB  1 
ATOM   7770 C CG  . PHE B 1 472 ? -9.245  8.318   -30.028 1.00 55.51  ? 472  PHE B CG  1 
ATOM   7771 C CD1 . PHE B 1 472 ? -8.641  9.472   -29.548 1.00 55.02  ? 472  PHE B CD1 1 
ATOM   7772 C CD2 . PHE B 1 472 ? -8.470  7.172   -30.187 1.00 55.08  ? 472  PHE B CD2 1 
ATOM   7773 C CE1 . PHE B 1 472 ? -7.280  9.497   -29.254 1.00 55.50  ? 472  PHE B CE1 1 
ATOM   7774 C CE2 . PHE B 1 472 ? -7.109  7.175   -29.894 1.00 55.50  ? 472  PHE B CE2 1 
ATOM   7775 C CZ  . PHE B 1 472 ? -6.509  8.339   -29.422 1.00 56.19  ? 472  PHE B CZ  1 
ATOM   7776 N N   . ALA B 1 473 ? -10.864 8.545   -33.496 1.00 56.09  ? 473  ALA B N   1 
ATOM   7777 C CA  . ALA B 1 473 ? -10.306 8.535   -34.837 1.00 55.52  ? 473  ALA B CA  1 
ATOM   7778 C C   . ALA B 1 473 ? -10.552 9.867   -35.519 1.00 55.28  ? 473  ALA B C   1 
ATOM   7779 O O   . ALA B 1 473 ? -9.614  10.483  -36.009 1.00 55.87  ? 473  ALA B O   1 
ATOM   7780 C CB  . ALA B 1 473 ? -10.875 7.408   -35.654 1.00 55.36  ? 473  ALA B CB  1 
ATOM   7781 N N   . GLN B 1 474 ? -11.795 10.334  -35.538 1.00 54.65  ? 474  GLN B N   1 
ATOM   7782 C CA  . GLN B 1 474 ? -12.098 11.560  -36.268 1.00 54.35  ? 474  GLN B CA  1 
ATOM   7783 C C   . GLN B 1 474 ? -11.235 12.675  -35.731 1.00 53.83  ? 474  GLN B C   1 
ATOM   7784 O O   . GLN B 1 474 ? -10.742 13.512  -36.491 1.00 53.99  ? 474  GLN B O   1 
ATOM   7785 C CB  . GLN B 1 474 ? -13.562 11.938  -36.147 1.00 54.56  ? 474  GLN B CB  1 
ATOM   7786 C CG  . GLN B 1 474 ? -14.466 10.754  -35.951 1.00 56.40  ? 474  GLN B CG  1 
ATOM   7787 C CD  . GLN B 1 474 ? -15.786 10.880  -36.676 1.00 58.60  ? 474  GLN B CD  1 
ATOM   7788 O OE1 . GLN B 1 474 ? -16.780 10.276  -36.263 1.00 60.53  ? 474  GLN B OE1 1 
ATOM   7789 N NE2 . GLN B 1 474 ? -15.808 11.655  -37.768 1.00 58.55  ? 474  GLN B NE2 1 
ATOM   7790 N N   . ARG B 1 475 ? -11.040 12.664  -34.418 1.00 53.10  ? 475  ARG B N   1 
ATOM   7791 C CA  . ARG B 1 475 ? -10.196 13.642  -33.765 1.00 52.66  ? 475  ARG B CA  1 
ATOM   7792 C C   . ARG B 1 475 ? -8.766  13.613  -34.271 1.00 52.13  ? 475  ARG B C   1 
ATOM   7793 O O   . ARG B 1 475 ? -8.246  14.642  -34.694 1.00 52.17  ? 475  ARG B O   1 
ATOM   7794 C CB  . ARG B 1 475 ? -10.226 13.461  -32.253 1.00 52.78  ? 475  ARG B CB  1 
ATOM   7795 C CG  . ARG B 1 475 ? -10.988 14.564  -31.525 1.00 53.19  ? 475  ARG B CG  1 
ATOM   7796 C CD  . ARG B 1 475 ? -11.016 14.311  -30.032 1.00 52.06  ? 475  ARG B CD  1 
ATOM   7797 N NE  . ARG B 1 475 ? -9.733  14.620  -29.411 1.00 50.33  ? 475  ARG B NE  1 
ATOM   7798 C CZ  . ARG B 1 475 ? -9.154  13.847  -28.505 1.00 48.54  ? 475  ARG B CZ  1 
ATOM   7799 N NH1 . ARG B 1 475 ? -9.731  12.709  -28.142 1.00 46.94  ? 475  ARG B NH1 1 
ATOM   7800 N NH2 . ARG B 1 475 ? -7.997  14.205  -27.981 1.00 48.31  ? 475  ARG B NH2 1 
ATOM   7801 N N   . LEU B 1 476 ? -8.138  12.443  -34.233 1.00 51.45  ? 476  LEU B N   1 
ATOM   7802 C CA  . LEU B 1 476 ? -6.770  12.304  -34.723 1.00 51.06  ? 476  LEU B CA  1 
ATOM   7803 C C   . LEU B 1 476 ? -6.659  12.674  -36.197 1.00 50.84  ? 476  LEU B C   1 
ATOM   7804 O O   . LEU B 1 476 ? -5.695  13.312  -36.608 1.00 50.90  ? 476  LEU B O   1 
ATOM   7805 C CB  . LEU B 1 476 ? -6.251  10.890  -34.490 1.00 51.02  ? 476  LEU B CB  1 
ATOM   7806 C CG  . LEU B 1 476 ? -6.183  10.451  -33.024 1.00 51.58  ? 476  LEU B CG  1 
ATOM   7807 C CD1 . LEU B 1 476 ? -5.831  8.979   -32.908 1.00 51.11  ? 476  LEU B CD1 1 
ATOM   7808 C CD2 . LEU B 1 476 ? -5.195  11.297  -32.246 1.00 51.59  ? 476  LEU B CD2 1 
ATOM   7809 N N   . MET B 1 477 ? -7.659  12.291  -36.986 1.00 50.46  ? 477  MET B N   1 
ATOM   7810 C CA  . MET B 1 477 ? -7.669  12.600  -38.400 1.00 50.29  ? 477  MET B CA  1 
ATOM   7811 C C   . MET B 1 477 ? -7.721  14.110  -38.595 1.00 49.97  ? 477  MET B C   1 
ATOM   7812 O O   . MET B 1 477 ? -7.129  14.642  -39.539 1.00 50.05  ? 477  MET B O   1 
ATOM   7813 C CB  . MET B 1 477 ? -8.858  11.938  -39.087 1.00 50.42  ? 477  MET B CB  1 
ATOM   7814 C CG  . MET B 1 477 ? -8.742  10.430  -39.291 1.00 50.74  ? 477  MET B CG  1 
ATOM   7815 S SD  . MET B 1 477 ? -10.258 9.709   -39.985 1.00 51.59  ? 477  MET B SD  1 
ATOM   7816 C CE  . MET B 1 477 ? -10.080 10.049  -41.718 1.00 49.56  ? 477  MET B CE  1 
ATOM   7817 N N   . LYS B 1 478 ? -8.423  14.802  -37.699 1.00 49.31  ? 478  LYS B N   1 
ATOM   7818 C CA  . LYS B 1 478 ? -8.449  16.256  -37.744 1.00 48.59  ? 478  LYS B CA  1 
ATOM   7819 C C   . LYS B 1 478 ? -7.108  16.832  -37.350 1.00 47.29  ? 478  LYS B C   1 
ATOM   7820 O O   . LYS B 1 478 ? -6.660  17.791  -37.967 1.00 47.20  ? 478  LYS B O   1 
ATOM   7821 C CB  . LYS B 1 478 ? -9.545  16.849  -36.853 1.00 49.86  ? 478  LYS B CB  1 
ATOM   7822 C CG  . LYS B 1 478 ? -10.884 17.003  -37.524 1.00 51.08  ? 478  LYS B CG  1 
ATOM   7823 C CD  . LYS B 1 478 ? -11.450 18.415  -37.330 1.00 54.77  ? 478  LYS B CD  1 
ATOM   7824 C CE  . LYS B 1 478 ? -12.892 18.549  -37.922 1.00 55.74  ? 478  LYS B CE  1 
ATOM   7825 N NZ  . LYS B 1 478 ? -13.015 18.183  -39.399 1.00 56.95  ? 478  LYS B NZ  1 
ATOM   7826 N N   . TYR B 1 479 ? -6.473  16.256  -36.325 1.00 45.70  ? 479  TYR B N   1 
ATOM   7827 C CA  . TYR B 1 479 ? -5.183  16.761  -35.862 1.00 44.30  ? 479  TYR B CA  1 
ATOM   7828 C C   . TYR B 1 479 ? -4.165  16.685  -36.996 1.00 43.44  ? 479  TYR B C   1 
ATOM   7829 O O   . TYR B 1 479 ? -3.517  17.686  -37.329 1.00 43.40  ? 479  TYR B O   1 
ATOM   7830 C CB  . TYR B 1 479 ? -4.668  16.011  -34.630 1.00 44.46  ? 479  TYR B CB  1 
ATOM   7831 C CG  . TYR B 1 479 ? -5.427  16.250  -33.327 1.00 44.55  ? 479  TYR B CG  1 
ATOM   7832 C CD1 . TYR B 1 479 ? -6.012  17.488  -33.022 1.00 44.14  ? 479  TYR B CD1 1 
ATOM   7833 C CD2 . TYR B 1 479 ? -5.528  15.235  -32.385 1.00 45.38  ? 479  TYR B CD2 1 
ATOM   7834 C CE1 . TYR B 1 479 ? -6.706  17.688  -31.817 1.00 44.54  ? 479  TYR B CE1 1 
ATOM   7835 C CE2 . TYR B 1 479 ? -6.211  15.422  -31.177 1.00 46.54  ? 479  TYR B CE2 1 
ATOM   7836 C CZ  . TYR B 1 479 ? -6.803  16.644  -30.894 1.00 45.94  ? 479  TYR B CZ  1 
ATOM   7837 O OH  . TYR B 1 479 ? -7.484  16.775  -29.689 1.00 44.97  ? 479  TYR B OH  1 
ATOM   7838 N N   . TRP B 1 480 ? -4.062  15.507  -37.608 1.00 41.96  ? 480  TRP B N   1 
ATOM   7839 C CA  . TRP B 1 480 ? -3.117  15.272  -38.692 1.00 40.83  ? 480  TRP B CA  1 
ATOM   7840 C C   . TRP B 1 480 ? -3.362  16.149  -39.920 1.00 41.17  ? 480  TRP B C   1 
ATOM   7841 O O   . TRP B 1 480 ? -2.453  16.854  -40.381 1.00 41.41  ? 480  TRP B O   1 
ATOM   7842 C CB  . TRP B 1 480 ? -3.090  13.794  -39.072 1.00 39.34  ? 480  TRP B CB  1 
ATOM   7843 C CG  . TRP B 1 480 ? -2.020  13.016  -38.380 1.00 37.33  ? 480  TRP B CG  1 
ATOM   7844 C CD1 . TRP B 1 480 ? -1.006  12.334  -38.975 1.00 36.33  ? 480  TRP B CD1 1 
ATOM   7845 C CD2 . TRP B 1 480 ? -1.844  12.846  -36.967 1.00 35.65  ? 480  TRP B CD2 1 
ATOM   7846 N NE1 . TRP B 1 480 ? -0.207  11.732  -38.029 1.00 35.36  ? 480  TRP B NE1 1 
ATOM   7847 C CE2 . TRP B 1 480 ? -0.699  12.024  -36.786 1.00 35.44  ? 480  TRP B CE2 1 
ATOM   7848 C CE3 . TRP B 1 480 ? -2.538  13.300  -35.837 1.00 35.50  ? 480  TRP B CE3 1 
ATOM   7849 C CZ2 . TRP B 1 480 ? -0.232  11.642  -35.515 1.00 35.65  ? 480  TRP B CZ2 1 
ATOM   7850 C CZ3 . TRP B 1 480 ? -2.078  12.921  -34.569 1.00 36.60  ? 480  TRP B CZ3 1 
ATOM   7851 C CH2 . TRP B 1 480 ? -0.924  12.100  -34.423 1.00 36.66  ? 480  TRP B CH2 1 
ATOM   7852 N N   . THR B 1 481 ? -4.581  16.114  -40.447 1.00 41.38  ? 481  THR B N   1 
ATOM   7853 C CA  . THR B 1 481 ? -4.925  16.931  -41.615 1.00 41.43  ? 481  THR B CA  1 
ATOM   7854 C C   . THR B 1 481 ? -4.844  18.423  -41.321 1.00 41.54  ? 481  THR B C   1 
ATOM   7855 O O   . THR B 1 481 ? -4.490  19.210  -42.191 1.00 41.16  ? 481  THR B O   1 
ATOM   7856 C CB  . THR B 1 481 ? -6.321  16.605  -42.118 1.00 41.43  ? 481  THR B CB  1 
ATOM   7857 O OG1 . THR B 1 481 ? -7.217  16.576  -41.000 1.00 41.25  ? 481  THR B OG1 1 
ATOM   7858 C CG2 . THR B 1 481 ? -6.322  15.250  -42.803 1.00 41.48  ? 481  THR B CG2 1 
ATOM   7859 N N   . ASN B 1 482 ? -5.168  18.812  -40.091 1.00 42.20  ? 482  ASN B N   1 
ATOM   7860 C CA  . ASN B 1 482 ? -5.060  20.211  -39.709 1.00 43.00  ? 482  ASN B CA  1 
ATOM   7861 C C   . ASN B 1 482 ? -3.633  20.665  -39.708 1.00 43.09  ? 482  ASN B C   1 
ATOM   7862 O O   . ASN B 1 482 ? -3.313  21.738  -40.205 1.00 42.96  ? 482  ASN B O   1 
ATOM   7863 C CB  . ASN B 1 482 ? -5.714  20.476  -38.366 1.00 43.29  ? 482  ASN B CB  1 
ATOM   7864 C CG  . ASN B 1 482 ? -7.176  20.819  -38.511 1.00 44.37  ? 482  ASN B CG  1 
ATOM   7865 O OD1 . ASN B 1 482 ? -7.588  21.393  -39.530 1.00 44.45  ? 482  ASN B OD1 1 
ATOM   7866 N ND2 . ASN B 1 482 ? -7.977  20.461  -37.506 1.00 45.08  ? 482  ASN B ND2 1 
ATOM   7867 N N   . PHE B 1 483 ? -2.770  19.815  -39.175 1.00 43.52  ? 483  PHE B N   1 
ATOM   7868 C CA  . PHE B 1 483 ? -1.349  20.040  -39.287 1.00 43.86  ? 483  PHE B CA  1 
ATOM   7869 C C   . PHE B 1 483 ? -0.899  20.005  -40.753 1.00 44.49  ? 483  PHE B C   1 
ATOM   7870 O O   . PHE B 1 483 ? -0.041  20.782  -41.167 1.00 44.82  ? 483  PHE B O   1 
ATOM   7871 C CB  . PHE B 1 483 ? -0.589  19.028  -38.453 1.00 43.58  ? 483  PHE B CB  1 
ATOM   7872 C CG  . PHE B 1 483 ? 0.872   19.076  -38.659 1.00 42.87  ? 483  PHE B CG  1 
ATOM   7873 C CD1 . PHE B 1 483 ? 1.637   20.032  -38.013 1.00 44.13  ? 483  PHE B CD1 1 
ATOM   7874 C CD2 . PHE B 1 483 ? 1.488   18.178  -39.509 1.00 42.06  ? 483  PHE B CD2 1 
ATOM   7875 C CE1 . PHE B 1 483 ? 3.007   20.095  -38.205 1.00 44.60  ? 483  PHE B CE1 1 
ATOM   7876 C CE2 . PHE B 1 483 ? 2.843   18.222  -39.712 1.00 43.28  ? 483  PHE B CE2 1 
ATOM   7877 C CZ  . PHE B 1 483 ? 3.614   19.180  -39.055 1.00 44.64  ? 483  PHE B CZ  1 
ATOM   7878 N N   . ALA B 1 484 ? -1.478  19.124  -41.552 1.00 45.23  ? 484  ALA B N   1 
ATOM   7879 C CA  . ALA B 1 484 ? -1.078  19.064  -42.948 1.00 46.18  ? 484  ALA B CA  1 
ATOM   7880 C C   . ALA B 1 484 ? -1.412  20.371  -43.645 1.00 47.12  ? 484  ALA B C   1 
ATOM   7881 O O   . ALA B 1 484 ? -0.580  20.905  -44.382 1.00 47.28  ? 484  ALA B O   1 
ATOM   7882 C CB  . ALA B 1 484 ? -1.734  17.892  -43.650 1.00 46.27  ? 484  ALA B CB  1 
ATOM   7883 N N   . ARG B 1 485 ? -2.619  20.885  -43.382 1.00 48.27  ? 485  ARG B N   1 
ATOM   7884 C CA  . ARG B 1 485 ? -3.129  22.110  -44.011 1.00 49.51  ? 485  ARG B CA  1 
ATOM   7885 C C   . ARG B 1 485 ? -2.352  23.353  -43.604 1.00 49.71  ? 485  ARG B C   1 
ATOM   7886 O O   . ARG B 1 485 ? -2.117  24.221  -44.435 1.00 49.70  ? 485  ARG B O   1 
ATOM   7887 C CB  . ARG B 1 485 ? -4.605  22.348  -43.643 1.00 49.63  ? 485  ARG B CB  1 
ATOM   7888 C CG  . ARG B 1 485 ? -5.650  21.679  -44.526 1.00 50.73  ? 485  ARG B CG  1 
ATOM   7889 C CD  . ARG B 1 485 ? -7.074  21.927  -44.009 1.00 50.71  ? 485  ARG B CD  1 
ATOM   7890 N NE  . ARG B 1 485 ? -7.367  21.134  -42.815 1.00 53.41  ? 485  ARG B NE  1 
ATOM   7891 C CZ  . ARG B 1 485 ? -7.840  19.884  -42.829 1.00 54.66  ? 485  ARG B CZ  1 
ATOM   7892 N NH1 . ARG B 1 485 ? -8.086  19.269  -43.986 1.00 55.40  ? 485  ARG B NH1 1 
ATOM   7893 N NH2 . ARG B 1 485 ? -8.067  19.242  -41.681 1.00 53.66  ? 485  ARG B NH2 1 
ATOM   7894 N N   . THR B 1 486 ? -1.969  23.429  -42.326 1.00 50.21  ? 486  THR B N   1 
ATOM   7895 C CA  . THR B 1 486 ? -1.567  24.697  -41.703 1.00 50.89  ? 486  THR B CA  1 
ATOM   7896 C C   . THR B 1 486 ? -0.214  24.706  -40.969 1.00 51.69  ? 486  THR B C   1 
ATOM   7897 O O   . THR B 1 486 ? 0.318   25.778  -40.649 1.00 51.99  ? 486  THR B O   1 
ATOM   7898 C CB  . THR B 1 486 ? -2.628  25.188  -40.673 1.00 50.64  ? 486  THR B CB  1 
ATOM   7899 O OG1 . THR B 1 486 ? -2.664  24.298  -39.547 1.00 50.57  ? 486  THR B OG1 1 
ATOM   7900 C CG2 . THR B 1 486 ? -4.011  25.294  -41.295 1.00 49.92  ? 486  THR B CG2 1 
ATOM   7901 N N   . GLY B 1 487 ? 0.333   23.532  -40.682 1.00 52.15  ? 487  GLY B N   1 
ATOM   7902 C CA  . GLY B 1 487 ? 1.489   23.447  -39.803 1.00 52.98  ? 487  GLY B CA  1 
ATOM   7903 C C   . GLY B 1 487 ? 1.100   23.473  -38.336 1.00 53.75  ? 487  GLY B C   1 
ATOM   7904 O O   . GLY B 1 487 ? 1.972   23.506  -37.472 1.00 54.00  ? 487  GLY B O   1 
ATOM   7905 N N   . ASP B 1 488 ? -0.206  23.437  -38.057 1.00 54.44  ? 488  ASP B N   1 
ATOM   7906 C CA  . ASP B 1 488 ? -0.741  23.575  -36.701 1.00 55.22  ? 488  ASP B CA  1 
ATOM   7907 C C   . ASP B 1 488 ? -1.914  22.618  -36.524 1.00 56.43  ? 488  ASP B C   1 
ATOM   7908 O O   . ASP B 1 488 ? -2.977  22.823  -37.126 1.00 56.48  ? 488  ASP B O   1 
ATOM   7909 C CB  . ASP B 1 488 ? -1.197  25.020  -36.472 1.00 54.96  ? 488  ASP B CB  1 
ATOM   7910 C CG  . ASP B 1 488 ? -1.647  25.296  -35.046 1.00 53.97  ? 488  ASP B CG  1 
ATOM   7911 O OD1 . ASP B 1 488 ? -1.746  24.368  -34.226 1.00 53.24  ? 488  ASP B OD1 1 
ATOM   7912 O OD2 . ASP B 1 488 ? -1.918  26.470  -34.745 1.00 52.86  ? 488  ASP B OD2 1 
ATOM   7913 N N   . PRO B 1 489 ? -1.733  21.579  -35.682 1.00 57.58  ? 489  PRO B N   1 
ATOM   7914 C CA  . PRO B 1 489 ? -2.726  20.512  -35.501 1.00 58.79  ? 489  PRO B CA  1 
ATOM   7915 C C   . PRO B 1 489 ? -4.035  20.984  -34.889 1.00 60.32  ? 489  PRO B C   1 
ATOM   7916 O O   . PRO B 1 489 ? -4.999  20.224  -34.861 1.00 60.48  ? 489  PRO B O   1 
ATOM   7917 C CB  . PRO B 1 489 ? -2.035  19.546  -34.541 1.00 58.36  ? 489  PRO B CB  1 
ATOM   7918 C CG  . PRO B 1 489 ? -1.017  20.355  -33.852 1.00 57.62  ? 489  PRO B CG  1 
ATOM   7919 C CD  . PRO B 1 489 ? -0.547  21.364  -34.837 1.00 57.47  ? 489  PRO B CD  1 
ATOM   7920 N N   . ASN B 1 490 ? -4.061  22.228  -34.421 1.00 62.37  ? 490  ASN B N   1 
ATOM   7921 C CA  . ASN B 1 490 ? -5.200  22.770  -33.693 1.00 64.55  ? 490  ASN B CA  1 
ATOM   7922 C C   . ASN B 1 490 ? -6.316  23.197  -34.621 1.00 66.78  ? 490  ASN B C   1 
ATOM   7923 O O   . ASN B 1 490 ? -6.062  23.787  -35.675 1.00 66.76  ? 490  ASN B O   1 
ATOM   7924 C CB  . ASN B 1 490 ? -4.771  23.953  -32.827 1.00 63.97  ? 490  ASN B CB  1 
ATOM   7925 C CG  . ASN B 1 490 ? -3.949  23.531  -31.641 1.00 62.44  ? 490  ASN B CG  1 
ATOM   7926 O OD1 . ASN B 1 490 ? -4.484  23.121  -30.626 1.00 61.87  ? 490  ASN B OD1 1 
ATOM   7927 N ND2 . ASN B 1 490 ? -2.641  23.639  -31.760 1.00 60.51  ? 490  ASN B ND2 1 
ATOM   7928 N N   . ASP B 1 491 ? -7.547  22.896  -34.205 1.00 69.66  ? 491  ASP B N   1 
ATOM   7929 C CA  . ASP B 1 491 ? -8.746  23.236  -34.961 1.00 72.70  ? 491  ASP B CA  1 
ATOM   7930 C C   . ASP B 1 491 ? -8.923  24.764  -34.985 1.00 74.62  ? 491  ASP B C   1 
ATOM   7931 O O   . ASP B 1 491 ? -9.166  25.378  -33.942 1.00 74.82  ? 491  ASP B O   1 
ATOM   7932 C CB  . ASP B 1 491 ? -9.972  22.541  -34.341 1.00 72.85  ? 491  ASP B CB  1 
ATOM   7933 C CG  . ASP B 1 491 ? -10.987 22.045  -35.392 1.00 74.06  ? 491  ASP B CG  1 
ATOM   7934 O OD1 . ASP B 1 491 ? -11.143 22.673  -36.471 1.00 74.84  ? 491  ASP B OD1 1 
ATOM   7935 O OD2 . ASP B 1 491 ? -11.643 21.010  -35.124 1.00 75.06  ? 491  ASP B OD2 1 
ATOM   7936 N N   . PRO B 1 492 ? -8.808  25.383  -36.178 1.00 76.68  ? 492  PRO B N   1 
ATOM   7937 C CA  . PRO B 1 492 ? -8.842  26.843  -36.247 1.00 78.42  ? 492  PRO B CA  1 
ATOM   7938 C C   . PRO B 1 492 ? -10.235 27.374  -35.957 1.00 80.04  ? 492  PRO B C   1 
ATOM   7939 O O   . PRO B 1 492 ? -10.420 28.589  -35.862 1.00 80.49  ? 492  PRO B O   1 
ATOM   7940 C CB  . PRO B 1 492 ? -8.445  27.147  -37.702 1.00 78.44  ? 492  PRO B CB  1 
ATOM   7941 C CG  . PRO B 1 492 ? -8.861  25.934  -38.464 1.00 77.74  ? 492  PRO B CG  1 
ATOM   7942 C CD  . PRO B 1 492 ? -8.682  24.770  -37.515 1.00 77.00  ? 492  PRO B CD  1 
ATOM   7943 N N   . ARG B 1 493 ? -11.202 26.464  -35.846 1.00 81.70  ? 493  ARG B N   1 
ATOM   7944 C CA  . ARG B 1 493 ? -12.549 26.800  -35.390 1.00 83.48  ? 493  ARG B CA  1 
ATOM   7945 C C   . ARG B 1 493 ? -12.906 25.898  -34.202 1.00 84.22  ? 493  ARG B C   1 
ATOM   7946 O O   . ARG B 1 493 ? -13.928 25.191  -34.188 1.00 84.39  ? 493  ARG B O   1 
ATOM   7947 C CB  . ARG B 1 493 ? -13.582 26.703  -36.529 1.00 83.83  ? 493  ARG B CB  1 
ATOM   7948 C CG  . ARG B 1 493 ? -13.314 27.601  -37.765 1.00 85.12  ? 493  ARG B CG  1 
ATOM   7949 C CD  . ARG B 1 493 ? -13.001 29.051  -37.386 1.00 86.95  ? 493  ARG B CD  1 
ATOM   7950 N NE  . ARG B 1 493 ? -13.621 30.017  -38.291 1.00 88.25  ? 493  ARG B NE  1 
ATOM   7951 C CZ  . ARG B 1 493 ? -13.578 31.338  -38.131 1.00 88.47  ? 493  ARG B CZ  1 
ATOM   7952 N NH1 . ARG B 1 493 ? -12.928 31.880  -37.106 1.00 88.17  ? 493  ARG B NH1 1 
ATOM   7953 N NH2 . ARG B 1 493 ? -14.190 32.122  -39.005 1.00 88.71  ? 493  ARG B NH2 1 
ATOM   7954 N N   . ASP B 1 494 ? -12.015 25.905  -33.219 1.00 84.93  ? 494  ASP B N   1 
ATOM   7955 C CA  . ASP B 1 494 ? -12.309 25.327  -31.926 1.00 85.64  ? 494  ASP B CA  1 
ATOM   7956 C C   . ASP B 1 494 ? -11.617 26.122  -30.826 1.00 85.69  ? 494  ASP B C   1 
ATOM   7957 O O   . ASP B 1 494 ? -10.455 25.864  -30.462 1.00 85.86  ? 494  ASP B O   1 
ATOM   7958 C CB  . ASP B 1 494 ? -11.945 23.835  -31.849 1.00 86.02  ? 494  ASP B CB  1 
ATOM   7959 C CG  . ASP B 1 494 ? -12.416 23.180  -30.541 1.00 87.33  ? 494  ASP B CG  1 
ATOM   7960 O OD1 . ASP B 1 494 ? -13.633 23.239  -30.244 1.00 88.62  ? 494  ASP B OD1 1 
ATOM   7961 O OD2 . ASP B 1 494 ? -11.574 22.607  -29.811 1.00 88.04  ? 494  ASP B OD2 1 
ATOM   7962 N N   . SER B 1 495 ? -12.346 27.124  -30.338 1.00 85.39  ? 495  SER B N   1 
ATOM   7963 C CA  . SER B 1 495 ? -12.165 27.644  -28.993 1.00 84.87  ? 495  SER B CA  1 
ATOM   7964 C C   . SER B 1 495 ? -12.497 26.492  -28.015 1.00 84.50  ? 495  SER B C   1 
ATOM   7965 O O   . SER B 1 495 ? -12.950 25.415  -28.440 1.00 84.31  ? 495  SER B O   1 
ATOM   7966 C CB  . SER B 1 495 ? -13.117 28.822  -28.784 1.00 84.75  ? 495  SER B CB  1 
ATOM   7967 O OG  . SER B 1 495 ? -13.185 29.198  -27.420 1.00 84.82  ? 495  SER B OG  1 
ATOM   7968 N N   . LYS B 1 496 ? -12.279 26.716  -26.719 1.00 83.89  ? 496  LYS B N   1 
ATOM   7969 C CA  . LYS B 1 496 ? -12.655 25.733  -25.696 1.00 83.38  ? 496  LYS B CA  1 
ATOM   7970 C C   . LYS B 1 496 ? -12.112 24.353  -26.079 1.00 82.38  ? 496  LYS B C   1 
ATOM   7971 O O   . LYS B 1 496 ? -12.881 23.392  -26.310 1.00 82.51  ? 496  LYS B O   1 
ATOM   7972 C CB  . LYS B 1 496 ? -14.189 25.687  -25.507 1.00 83.77  ? 496  LYS B CB  1 
ATOM   7973 C CG  . LYS B 1 496 ? -14.700 24.694  -24.424 1.00 85.11  ? 496  LYS B CG  1 
ATOM   7974 C CD  . LYS B 1 496 ? -14.064 24.932  -23.024 1.00 85.64  ? 496  LYS B CD  1 
ATOM   7975 C CE  . LYS B 1 496 ? -14.233 26.378  -22.539 1.00 85.10  ? 496  LYS B CE  1 
ATOM   7976 N NZ  . LYS B 1 496 ? -15.661 26.806  -22.396 1.00 84.18  ? 496  LYS B NZ  1 
ATOM   7977 N N   . SER B 1 497 ? -10.780 24.275  -26.149 1.00 80.67  ? 497  SER B N   1 
ATOM   7978 C CA  . SER B 1 497 ? -10.099 23.094  -26.703 1.00 78.50  ? 497  SER B CA  1 
ATOM   7979 C C   . SER B 1 497 ? -9.840  21.963  -25.663 1.00 76.28  ? 497  SER B C   1 
ATOM   7980 O O   . SER B 1 497 ? -10.604 20.991  -25.651 1.00 76.39  ? 497  SER B O   1 
ATOM   7981 C CB  . SER B 1 497 ? -8.857  23.506  -27.521 1.00 78.78  ? 497  SER B CB  1 
ATOM   7982 O OG  . SER B 1 497 ? -8.995  24.823  -28.053 1.00 79.51  ? 497  SER B OG  1 
ATOM   7983 N N   . PRO B 1 498 ? -8.795  22.074  -24.793 1.00 73.79  ? 498  PRO B N   1 
ATOM   7984 C CA  . PRO B 1 498 ? -7.763  23.116  -24.659 1.00 71.43  ? 498  PRO B CA  1 
ATOM   7985 C C   . PRO B 1 498 ? -6.682  22.912  -25.718 1.00 68.76  ? 498  PRO B C   1 
ATOM   7986 O O   . PRO B 1 498 ? -6.601  21.830  -26.315 1.00 68.48  ? 498  PRO B O   1 
ATOM   7987 C CB  . PRO B 1 498 ? -7.203  22.874  -23.258 1.00 71.79  ? 498  PRO B CB  1 
ATOM   7988 C CG  . PRO B 1 498 ? -7.351  21.394  -23.064 1.00 72.70  ? 498  PRO B CG  1 
ATOM   7989 C CD  . PRO B 1 498 ? -8.596  20.990  -23.806 1.00 73.54  ? 498  PRO B CD  1 
ATOM   7990 N N   . GLN B 1 499 ? -5.873  23.944  -25.951 1.00 65.50  ? 499  GLN B N   1 
ATOM   7991 C CA  . GLN B 1 499 ? -4.987  23.988  -27.120 1.00 61.82  ? 499  GLN B CA  1 
ATOM   7992 C C   . GLN B 1 499 ? -3.758  23.075  -27.007 1.00 59.30  ? 499  GLN B C   1 
ATOM   7993 O O   . GLN B 1 499 ? -3.280  22.798  -25.910 1.00 59.01  ? 499  GLN B O   1 
ATOM   7994 C CB  . GLN B 1 499 ? -4.601  25.437  -27.410 1.00 62.01  ? 499  GLN B CB  1 
ATOM   7995 C CG  . GLN B 1 499 ? -5.804  26.312  -27.809 1.00 61.68  ? 499  GLN B CG  1 
ATOM   7996 C CD  . GLN B 1 499 ? -6.006  26.428  -29.326 1.00 62.26  ? 499  GLN B CD  1 
ATOM   7997 O OE1 . GLN B 1 499 ? -7.090  26.142  -29.855 1.00 61.02  ? 499  GLN B OE1 1 
ATOM   7998 N NE2 . GLN B 1 499 ? -4.958  26.872  -30.030 1.00 63.19  ? 499  GLN B NE2 1 
ATOM   7999 N N   . TRP B 1 500 ? -3.290  22.581  -28.151 1.00 56.20  ? 500  TRP B N   1 
ATOM   8000 C CA  . TRP B 1 500 ? -2.049  21.810  -28.262 1.00 53.31  ? 500  TRP B CA  1 
ATOM   8001 C C   . TRP B 1 500 ? -0.856  22.785  -28.411 1.00 52.01  ? 500  TRP B C   1 
ATOM   8002 O O   . TRP B 1 500 ? -0.678  23.392  -29.469 1.00 51.95  ? 500  TRP B O   1 
ATOM   8003 C CB  . TRP B 1 500 ? -2.140  20.889  -29.487 1.00 52.31  ? 500  TRP B CB  1 
ATOM   8004 C CG  . TRP B 1 500 ? -1.036  19.856  -29.604 1.00 51.39  ? 500  TRP B CG  1 
ATOM   8005 C CD1 . TRP B 1 500 ? 0.189   19.895  -29.017 1.00 50.20  ? 500  TRP B CD1 1 
ATOM   8006 C CD2 . TRP B 1 500 ? -1.061  18.652  -30.387 1.00 50.55  ? 500  TRP B CD2 1 
ATOM   8007 N NE1 . TRP B 1 500 ? 0.922   18.791  -29.366 1.00 49.93  ? 500  TRP B NE1 1 
ATOM   8008 C CE2 . TRP B 1 500 ? 0.181   18.012  -30.207 1.00 49.79  ? 500  TRP B CE2 1 
ATOM   8009 C CE3 . TRP B 1 500 ? -2.020  18.047  -31.215 1.00 50.47  ? 500  TRP B CE3 1 
ATOM   8010 C CZ2 . TRP B 1 500 ? 0.492   16.798  -30.814 1.00 50.64  ? 500  TRP B CZ2 1 
ATOM   8011 C CZ3 . TRP B 1 500 ? -1.708  16.838  -31.825 1.00 50.12  ? 500  TRP B CZ3 1 
ATOM   8012 C CH2 . TRP B 1 500 ? -0.464  16.227  -31.617 1.00 50.74  ? 500  TRP B CH2 1 
ATOM   8013 N N   . PRO B 1 501 ? -0.051  22.966  -27.349 1.00 50.34  ? 501  PRO B N   1 
ATOM   8014 C CA  . PRO B 1 501 ? 1.082   23.882  -27.385 1.00 49.29  ? 501  PRO B CA  1 
ATOM   8015 C C   . PRO B 1 501 ? 2.272   23.339  -28.171 1.00 48.19  ? 501  PRO B C   1 
ATOM   8016 O O   . PRO B 1 501 ? 2.526   22.136  -28.154 1.00 48.25  ? 501  PRO B O   1 
ATOM   8017 C CB  . PRO B 1 501 ? 1.479   23.994  -25.908 1.00 49.30  ? 501  PRO B CB  1 
ATOM   8018 C CG  . PRO B 1 501 ? 0.331   23.437  -25.145 1.00 49.56  ? 501  PRO B CG  1 
ATOM   8019 C CD  . PRO B 1 501 ? -0.167  22.353  -26.026 1.00 50.24  ? 501  PRO B CD  1 
ATOM   8020 N N   . PRO B 1 502 ? 3.018   24.222  -28.845 1.00 47.07  ? 502  PRO B N   1 
ATOM   8021 C CA  . PRO B 1 502 ? 4.231   23.781  -29.506 1.00 46.25  ? 502  PRO B CA  1 
ATOM   8022 C C   . PRO B 1 502 ? 5.255   23.271  -28.494 1.00 45.52  ? 502  PRO B C   1 
ATOM   8023 O O   . PRO B 1 502 ? 5.345   23.799  -27.394 1.00 45.60  ? 502  PRO B O   1 
ATOM   8024 C CB  . PRO B 1 502 ? 4.741   25.055  -30.178 1.00 46.18  ? 502  PRO B CB  1 
ATOM   8025 C CG  . PRO B 1 502 ? 3.571   25.949  -30.267 1.00 46.29  ? 502  PRO B CG  1 
ATOM   8026 C CD  . PRO B 1 502 ? 2.788   25.660  -29.041 1.00 47.16  ? 502  PRO B CD  1 
ATOM   8027 N N   . TYR B 1 503 ? 5.995   22.234  -28.857 1.00 44.84  ? 503  TYR B N   1 
ATOM   8028 C CA  . TYR B 1 503 ? 7.070   21.732  -28.017 1.00 44.40  ? 503  TYR B CA  1 
ATOM   8029 C C   . TYR B 1 503 ? 8.274   22.666  -28.127 1.00 45.03  ? 503  TYR B C   1 
ATOM   8030 O O   . TYR B 1 503 ? 8.775   22.909  -29.230 1.00 45.30  ? 503  TYR B O   1 
ATOM   8031 C CB  . TYR B 1 503 ? 7.451   20.315  -28.426 1.00 43.42  ? 503  TYR B CB  1 
ATOM   8032 C CG  . TYR B 1 503 ? 8.564   19.720  -27.616 1.00 41.59  ? 503  TYR B CG  1 
ATOM   8033 C CD1 . TYR B 1 503 ? 9.877   19.790  -28.065 1.00 41.75  ? 503  TYR B CD1 1 
ATOM   8034 C CD2 . TYR B 1 503 ? 8.310   19.074  -26.413 1.00 39.90  ? 503  TYR B CD2 1 
ATOM   8035 C CE1 . TYR B 1 503 ? 10.920  19.245  -27.337 1.00 41.22  ? 503  TYR B CE1 1 
ATOM   8036 C CE2 . TYR B 1 503 ? 9.338   18.530  -25.670 1.00 40.77  ? 503  TYR B CE2 1 
ATOM   8037 C CZ  . TYR B 1 503 ? 10.646  18.621  -26.141 1.00 41.68  ? 503  TYR B CZ  1 
ATOM   8038 O OH  . TYR B 1 503 ? 11.690  18.095  -25.426 1.00 41.98  ? 503  TYR B OH  1 
ATOM   8039 N N   . THR B 1 504 ? 8.706   23.203  -26.985 1.00 45.30  ? 504  THR B N   1 
ATOM   8040 C CA  . THR B 1 504 ? 9.855   24.104  -26.912 1.00 45.53  ? 504  THR B CA  1 
ATOM   8041 C C   . THR B 1 504 ? 10.837  23.510  -25.917 1.00 45.64  ? 504  THR B C   1 
ATOM   8042 O O   . THR B 1 504 ? 10.443  22.669  -25.113 1.00 45.50  ? 504  THR B O   1 
ATOM   8043 C CB  . THR B 1 504 ? 9.447   25.520  -26.445 1.00 45.76  ? 504  THR B CB  1 
ATOM   8044 O OG1 . THR B 1 504 ? 9.013   25.482  -25.071 1.00 46.68  ? 504  THR B OG1 1 
ATOM   8045 C CG2 . THR B 1 504 ? 8.354   26.113  -27.338 1.00 44.49  ? 504  THR B CG2 1 
ATOM   8046 N N   . THR B 1 505 ? 12.101  23.930  -25.959 1.00 45.98  ? 505  THR B N   1 
ATOM   8047 C CA  . THR B 1 505 ? 13.118  23.319  -25.076 1.00 46.70  ? 505  THR B CA  1 
ATOM   8048 C C   . THR B 1 505 ? 12.950  23.796  -23.635 1.00 47.15  ? 505  THR B C   1 
ATOM   8049 O O   . THR B 1 505 ? 13.261  23.059  -22.676 1.00 47.33  ? 505  THR B O   1 
ATOM   8050 C CB  . THR B 1 505 ? 14.576  23.579  -25.521 1.00 46.51  ? 505  THR B CB  1 
ATOM   8051 O OG1 . THR B 1 505 ? 14.901  24.954  -25.308 1.00 47.18  ? 505  THR B OG1 1 
ATOM   8052 C CG2 . THR B 1 505 ? 14.778  23.236  -26.984 1.00 46.55  ? 505  THR B CG2 1 
ATOM   8053 N N   . ALA B 1 506 ? 12.450  25.026  -23.497 1.00 47.33  ? 506  ALA B N   1 
ATOM   8054 C CA  . ALA B 1 506 ? 12.144  25.596  -22.192 1.00 47.37  ? 506  ALA B CA  1 
ATOM   8055 C C   . ALA B 1 506 ? 10.964  24.858  -21.541 1.00 47.49  ? 506  ALA B C   1 
ATOM   8056 O O   . ALA B 1 506 ? 11.173  24.088  -20.602 1.00 47.71  ? 506  ALA B O   1 
ATOM   8057 C CB  . ALA B 1 506 ? 11.869  27.074  -22.312 1.00 47.35  ? 506  ALA B CB  1 
ATOM   8058 N N   . ALA B 1 507 ? 9.748   25.052  -22.064 1.00 47.00  ? 507  ALA B N   1 
ATOM   8059 C CA  . ALA B 1 507 ? 8.546   24.455  -21.463 1.00 46.54  ? 507  ALA B CA  1 
ATOM   8060 C C   . ALA B 1 507 ? 8.426   22.932  -21.603 1.00 46.12  ? 507  ALA B C   1 
ATOM   8061 O O   . ALA B 1 507 ? 8.004   22.269  -20.667 1.00 46.10  ? 507  ALA B O   1 
ATOM   8062 C CB  . ALA B 1 507 ? 7.291   25.136  -21.985 1.00 46.83  ? 507  ALA B CB  1 
ATOM   8063 N N   . GLN B 1 508 ? 8.772   22.389  -22.769 1.00 45.66  ? 508  GLN B N   1 
ATOM   8064 C CA  . GLN B 1 508 ? 8.785   20.934  -22.987 1.00 45.22  ? 508  GLN B CA  1 
ATOM   8065 C C   . GLN B 1 508 ? 7.406   20.259  -23.023 1.00 44.44  ? 508  GLN B C   1 
ATOM   8066 O O   . GLN B 1 508 ? 7.259   19.099  -22.634 1.00 44.09  ? 508  GLN B O   1 
ATOM   8067 C CB  . GLN B 1 508 ? 9.692   20.246  -21.962 1.00 45.55  ? 508  GLN B CB  1 
ATOM   8068 C CG  . GLN B 1 508 ? 10.982  19.736  -22.531 1.00 46.68  ? 508  GLN B CG  1 
ATOM   8069 C CD  . GLN B 1 508 ? 12.097  19.756  -21.518 1.00 48.06  ? 508  GLN B CD  1 
ATOM   8070 O OE1 . GLN B 1 508 ? 12.383  20.801  -20.934 1.00 50.43  ? 508  GLN B OE1 1 
ATOM   8071 N NE2 . GLN B 1 508 ? 12.752  18.618  -21.317 1.00 46.75  ? 508  GLN B NE2 1 
ATOM   8072 N N   . GLN B 1 509 ? 6.416   20.975  -23.535 1.00 43.77  ? 509  GLN B N   1 
ATOM   8073 C CA  . GLN B 1 509 ? 5.039   20.486  -23.575 1.00 43.23  ? 509  GLN B CA  1 
ATOM   8074 C C   . GLN B 1 509 ? 4.693   19.524  -24.714 1.00 43.21  ? 509  GLN B C   1 
ATOM   8075 O O   . GLN B 1 509 ? 4.941   19.788  -25.891 1.00 43.28  ? 509  GLN B O   1 
ATOM   8076 C CB  . GLN B 1 509 ? 4.083   21.670  -23.597 1.00 43.16  ? 509  GLN B CB  1 
ATOM   8077 C CG  . GLN B 1 509 ? 4.612   22.837  -22.790 1.00 42.45  ? 509  GLN B CG  1 
ATOM   8078 C CD  . GLN B 1 509 ? 3.547   23.813  -22.396 1.00 39.51  ? 509  GLN B CD  1 
ATOM   8079 O OE1 . GLN B 1 509 ? 3.292   24.769  -23.111 1.00 37.64  ? 509  GLN B OE1 1 
ATOM   8080 N NE2 . GLN B 1 509 ? 2.926   23.587  -21.237 1.00 38.90  ? 509  GLN B NE2 1 
ATOM   8081 N N   . TYR B 1 510 ? 4.101   18.400  -24.344 1.00 43.49  ? 510  TYR B N   1 
ATOM   8082 C CA  . TYR B 1 510 ? 3.443   17.520  -25.300 1.00 43.83  ? 510  TYR B CA  1 
ATOM   8083 C C   . TYR B 1 510 ? 1.986   17.280  -24.877 1.00 43.96  ? 510  TYR B C   1 
ATOM   8084 O O   . TYR B 1 510 ? 1.556   17.744  -23.826 1.00 44.15  ? 510  TYR B O   1 
ATOM   8085 C CB  . TYR B 1 510 ? 4.209   16.215  -25.411 1.00 43.50  ? 510  TYR B CB  1 
ATOM   8086 C CG  . TYR B 1 510 ? 4.305   15.450  -24.123 1.00 43.67  ? 510  TYR B CG  1 
ATOM   8087 C CD1 . TYR B 1 510 ? 5.342   15.681  -23.221 1.00 43.59  ? 510  TYR B CD1 1 
ATOM   8088 C CD2 . TYR B 1 510 ? 3.371   14.467  -23.814 1.00 43.86  ? 510  TYR B CD2 1 
ATOM   8089 C CE1 . TYR B 1 510 ? 5.436   14.949  -22.038 1.00 43.74  ? 510  TYR B CE1 1 
ATOM   8090 C CE2 . TYR B 1 510 ? 3.457   13.736  -22.643 1.00 43.40  ? 510  TYR B CE2 1 
ATOM   8091 C CZ  . TYR B 1 510 ? 4.484   13.976  -21.765 1.00 43.54  ? 510  TYR B CZ  1 
ATOM   8092 O OH  . TYR B 1 510 ? 4.536   13.240  -20.611 1.00 43.89  ? 510  TYR B OH  1 
ATOM   8093 N N   . VAL B 1 511 ? 1.212   16.577  -25.687 1.00 44.12  ? 511  VAL B N   1 
ATOM   8094 C CA  . VAL B 1 511 ? -0.145  16.238  -25.262 1.00 44.36  ? 511  VAL B CA  1 
ATOM   8095 C C   . VAL B 1 511 ? -0.335  14.735  -25.167 1.00 44.92  ? 511  VAL B C   1 
ATOM   8096 O O   . VAL B 1 511 ? 0.389   13.971  -25.801 1.00 44.83  ? 511  VAL B O   1 
ATOM   8097 C CB  . VAL B 1 511 ? -1.199  16.802  -26.201 1.00 44.08  ? 511  VAL B CB  1 
ATOM   8098 C CG1 . VAL B 1 511 ? -1.218  18.314  -26.136 1.00 43.19  ? 511  VAL B CG1 1 
ATOM   8099 C CG2 . VAL B 1 511 ? -0.951  16.304  -27.618 1.00 44.56  ? 511  VAL B CG2 1 
ATOM   8100 N N   . SER B 1 512 ? -1.304  14.307  -24.365 1.00 45.68  ? 512  SER B N   1 
ATOM   8101 C CA  . SER B 1 512 ? -1.649  12.900  -24.330 1.00 46.44  ? 512  SER B CA  1 
ATOM   8102 C C   . SER B 1 512 ? -2.794  12.673  -25.298 1.00 46.85  ? 512  SER B C   1 
ATOM   8103 O O   . SER B 1 512 ? -3.862  13.281  -25.182 1.00 47.01  ? 512  SER B O   1 
ATOM   8104 C CB  . SER B 1 512 ? -2.032  12.456  -22.931 1.00 46.37  ? 512  SER B CB  1 
ATOM   8105 O OG  . SER B 1 512 ? -3.382  12.773  -22.665 1.00 47.79  ? 512  SER B OG  1 
ATOM   8106 N N   . LEU B 1 513 ? -2.543  11.827  -26.286 1.00 47.50  ? 513  LEU B N   1 
ATOM   8107 C CA  . LEU B 1 513 ? -3.569  11.434  -27.219 1.00 48.04  ? 513  LEU B CA  1 
ATOM   8108 C C   . LEU B 1 513 ? -4.208  10.161  -26.676 1.00 49.12  ? 513  LEU B C   1 
ATOM   8109 O O   . LEU B 1 513 ? -3.574  9.090   -26.645 1.00 49.09  ? 513  LEU B O   1 
ATOM   8110 C CB  . LEU B 1 513 ? -2.982  11.232  -28.618 1.00 47.48  ? 513  LEU B CB  1 
ATOM   8111 C CG  . LEU B 1 513 ? -2.549  12.479  -29.391 1.00 46.34  ? 513  LEU B CG  1 
ATOM   8112 C CD1 . LEU B 1 513 ? -1.900  12.128  -30.710 1.00 45.37  ? 513  LEU B CD1 1 
ATOM   8113 C CD2 . LEU B 1 513 ? -3.716  13.396  -29.629 1.00 45.63  ? 513  LEU B CD2 1 
ATOM   8114 N N   . ASN B 1 514 ? -5.444  10.315  -26.194 1.00 50.22  ? 514  ASN B N   1 
ATOM   8115 C CA  . ASN B 1 514 ? -6.280  9.207   -25.730 1.00 51.43  ? 514  ASN B CA  1 
ATOM   8116 C C   . ASN B 1 514 ? -7.735  9.634   -25.668 1.00 52.36  ? 514  ASN B C   1 
ATOM   8117 O O   . ASN B 1 514 ? -8.108  10.661  -26.230 1.00 52.75  ? 514  ASN B O   1 
ATOM   8118 C CB  . ASN B 1 514 ? -5.822  8.669   -24.375 1.00 51.37  ? 514  ASN B CB  1 
ATOM   8119 C CG  . ASN B 1 514 ? -5.832  9.728   -23.294 1.00 51.80  ? 514  ASN B CG  1 
ATOM   8120 O OD1 . ASN B 1 514 ? -6.723  10.579  -23.249 1.00 51.94  ? 514  ASN B OD1 1 
ATOM   8121 N ND2 . ASN B 1 514 ? -4.833  9.680   -22.407 1.00 51.65  ? 514  ASN B ND2 1 
ATOM   8122 N N   . LEU B 1 515 ? -8.553  8.856   -24.969 1.00 53.58  ? 515  LEU B N   1 
ATOM   8123 C CA  . LEU B 1 515 ? -10.003 9.044   -25.031 1.00 54.64  ? 515  LEU B CA  1 
ATOM   8124 C C   . LEU B 1 515 ? -10.516 10.278  -24.284 1.00 55.21  ? 515  LEU B C   1 
ATOM   8125 O O   . LEU B 1 515 ? -11.476 10.916  -24.730 1.00 55.07  ? 515  LEU B O   1 
ATOM   8126 C CB  . LEU B 1 515 ? -10.723 7.777   -24.565 1.00 54.73  ? 515  LEU B CB  1 
ATOM   8127 C CG  . LEU B 1 515 ? -10.706 6.616   -25.556 1.00 54.21  ? 515  LEU B CG  1 
ATOM   8128 C CD1 . LEU B 1 515 ? -11.389 5.435   -24.927 1.00 54.71  ? 515  LEU B CD1 1 
ATOM   8129 C CD2 . LEU B 1 515 ? -11.400 7.003   -26.839 1.00 54.38  ? 515  LEU B CD2 1 
ATOM   8130 N N   . LYS B 1 516 ? -9.887  10.590  -23.147 1.00 55.89  ? 516  LYS B N   1 
ATOM   8131 C CA  . LYS B 1 516 ? -10.131 11.847  -22.443 1.00 56.79  ? 516  LYS B CA  1 
ATOM   8132 C C   . LYS B 1 516 ? -9.586  12.960  -23.338 1.00 56.62  ? 516  LYS B C   1 
ATOM   8133 O O   . LYS B 1 516 ? -8.536  12.788  -23.969 1.00 56.93  ? 516  LYS B O   1 
ATOM   8134 C CB  . LYS B 1 516 ? -9.437  11.869  -21.072 1.00 56.61  ? 516  LYS B CB  1 
ATOM   8135 C CG  . LYS B 1 516 ? -9.729  10.656  -20.159 1.00 58.08  ? 516  LYS B CG  1 
ATOM   8136 C CD  . LYS B 1 516 ? -9.053  10.752  -18.747 1.00 58.52  ? 516  LYS B CD  1 
ATOM   8137 C CE  . LYS B 1 516 ? -7.602  10.163  -18.716 1.00 61.11  ? 516  LYS B CE  1 
ATOM   8138 N NZ  . LYS B 1 516 ? -6.980  10.103  -17.342 1.00 59.71  ? 516  LYS B NZ  1 
ATOM   8139 N N   . PRO B 1 517 ? -10.313 14.086  -23.440 1.00 56.52  ? 517  PRO B N   1 
ATOM   8140 C CA  . PRO B 1 517 ? -9.835  15.286  -24.151 1.00 56.24  ? 517  PRO B CA  1 
ATOM   8141 C C   . PRO B 1 517 ? -8.406  15.658  -23.750 1.00 55.52  ? 517  PRO B C   1 
ATOM   8142 O O   . PRO B 1 517 ? -7.983  15.303  -22.646 1.00 55.71  ? 517  PRO B O   1 
ATOM   8143 C CB  . PRO B 1 517 ? -10.810 16.384  -23.691 1.00 56.44  ? 517  PRO B CB  1 
ATOM   8144 C CG  . PRO B 1 517 ? -11.649 15.746  -22.588 1.00 56.75  ? 517  PRO B CG  1 
ATOM   8145 C CD  . PRO B 1 517 ? -11.662 14.286  -22.899 1.00 56.57  ? 517  PRO B CD  1 
ATOM   8146 N N   . LEU B 1 518 ? -7.693  16.370  -24.631 1.00 54.50  ? 518  LEU B N   1 
ATOM   8147 C CA  . LEU B 1 518 ? -6.251  16.624  -24.487 1.00 53.66  ? 518  LEU B CA  1 
ATOM   8148 C C   . LEU B 1 518 ? -5.827  17.046  -23.098 1.00 53.62  ? 518  LEU B C   1 
ATOM   8149 O O   . LEU B 1 518 ? -6.469  17.876  -22.458 1.00 53.71  ? 518  LEU B O   1 
ATOM   8150 C CB  . LEU B 1 518 ? -5.761  17.706  -25.454 1.00 53.35  ? 518  LEU B CB  1 
ATOM   8151 C CG  . LEU B 1 518 ? -5.507  17.498  -26.943 1.00 52.42  ? 518  LEU B CG  1 
ATOM   8152 C CD1 . LEU B 1 518 ? -5.003  18.789  -27.547 1.00 51.12  ? 518  LEU B CD1 1 
ATOM   8153 C CD2 . LEU B 1 518 ? -4.531  16.386  -27.211 1.00 51.72  ? 518  LEU B CD2 1 
ATOM   8154 N N   . GLU B 1 519 ? -4.723  16.475  -22.648 1.00 53.41  ? 519  GLU B N   1 
ATOM   8155 C CA  . GLU B 1 519 ? -4.086  16.910  -21.429 1.00 53.57  ? 519  GLU B CA  1 
ATOM   8156 C C   . GLU B 1 519 ? -2.690  17.361  -21.822 1.00 52.71  ? 519  GLU B C   1 
ATOM   8157 O O   . GLU B 1 519 ? -1.989  16.638  -22.527 1.00 53.05  ? 519  GLU B O   1 
ATOM   8158 C CB  . GLU B 1 519 ? -4.032  15.753  -20.432 1.00 53.38  ? 519  GLU B CB  1 
ATOM   8159 C CG  . GLU B 1 519 ? -3.085  15.973  -19.256 1.00 55.18  ? 519  GLU B CG  1 
ATOM   8160 C CD  . GLU B 1 519 ? -3.063  14.801  -18.279 1.00 55.61  ? 519  GLU B CD  1 
ATOM   8161 O OE1 . GLU B 1 519 ? -4.169  14.361  -17.854 1.00 59.00  ? 519  GLU B OE1 1 
ATOM   8162 O OE2 . GLU B 1 519 ? -1.944  14.338  -17.933 1.00 56.09  ? 519  GLU B OE2 1 
ATOM   8163 N N   . VAL B 1 520 ? -2.285  18.550  -21.393 1.00 51.86  ? 520  VAL B N   1 
ATOM   8164 C CA  . VAL B 1 520 ? -0.918  18.993  -21.645 1.00 50.95  ? 520  VAL B CA  1 
ATOM   8165 C C   . VAL B 1 520 ? -0.005  18.521  -20.511 1.00 50.62  ? 520  VAL B C   1 
ATOM   8166 O O   . VAL B 1 520 ? -0.271  18.802  -19.355 1.00 50.75  ? 520  VAL B O   1 
ATOM   8167 C CB  . VAL B 1 520 ? -0.837  20.526  -21.829 1.00 50.75  ? 520  VAL B CB  1 
ATOM   8168 C CG1 . VAL B 1 520 ? 0.598   20.979  -21.989 1.00 50.65  ? 520  VAL B CG1 1 
ATOM   8169 C CG2 . VAL B 1 520 ? -1.649  20.960  -23.022 1.00 49.89  ? 520  VAL B CG2 1 
ATOM   8170 N N   . ARG B 1 521 ? 1.044   17.778  -20.851 1.00 50.26  ? 521  ARG B N   1 
ATOM   8171 C CA  . ARG B 1 521 ? 2.069   17.360  -19.885 1.00 50.07  ? 521  ARG B CA  1 
ATOM   8172 C C   . ARG B 1 521 ? 3.384   17.992  -20.259 1.00 49.79  ? 521  ARG B C   1 
ATOM   8173 O O   . ARG B 1 521 ? 3.537   18.436  -21.382 1.00 49.89  ? 521  ARG B O   1 
ATOM   8174 C CB  . ARG B 1 521 ? 2.230   15.853  -19.901 1.00 50.04  ? 521  ARG B CB  1 
ATOM   8175 C CG  . ARG B 1 521 ? 0.969   15.129  -19.557 1.00 50.48  ? 521  ARG B CG  1 
ATOM   8176 C CD  . ARG B 1 521 ? 1.161   13.635  -19.527 1.00 51.21  ? 521  ARG B CD  1 
ATOM   8177 N NE  . ARG B 1 521 ? -0.152  12.999  -19.522 1.00 52.95  ? 521  ARG B NE  1 
ATOM   8178 C CZ  . ARG B 1 521 ? -0.374  11.731  -19.839 1.00 53.74  ? 521  ARG B CZ  1 
ATOM   8179 N NH1 . ARG B 1 521 ? 0.637   10.942  -20.182 1.00 54.00  ? 521  ARG B NH1 1 
ATOM   8180 N NH2 . ARG B 1 521 ? -1.610  11.258  -19.818 1.00 53.47  ? 521  ARG B NH2 1 
ATOM   8181 N N   . ARG B 1 522 ? 4.340   18.030  -19.338 1.00 49.76  ? 522  ARG B N   1 
ATOM   8182 C CA  . ARG B 1 522 ? 5.634   18.673  -19.621 1.00 49.94  ? 522  ARG B CA  1 
ATOM   8183 C C   . ARG B 1 522 ? 6.798   17.711  -19.475 1.00 50.34  ? 522  ARG B C   1 
ATOM   8184 O O   . ARG B 1 522 ? 6.879   16.965  -18.511 1.00 50.40  ? 522  ARG B O   1 
ATOM   8185 C CB  . ARG B 1 522 ? 5.845   19.915  -18.748 1.00 49.52  ? 522  ARG B CB  1 
ATOM   8186 C CG  . ARG B 1 522 ? 4.958   21.099  -19.154 1.00 50.02  ? 522  ARG B CG  1 
ATOM   8187 C CD  . ARG B 1 522 ? 5.043   22.297  -18.213 1.00 49.68  ? 522  ARG B CD  1 
ATOM   8188 N NE  . ARG B 1 522 ? 6.424   22.741  -18.078 1.00 49.37  ? 522  ARG B NE  1 
ATOM   8189 C CZ  . ARG B 1 522 ? 6.815   23.949  -17.681 1.00 49.83  ? 522  ARG B CZ  1 
ATOM   8190 N NH1 . ARG B 1 522 ? 5.931   24.889  -17.367 1.00 48.74  ? 522  ARG B NH1 1 
ATOM   8191 N NH2 . ARG B 1 522 ? 8.117   24.215  -17.613 1.00 51.01  ? 522  ARG B NH2 1 
ATOM   8192 N N   . GLY B 1 523 ? 7.694   17.722  -20.449 1.00 51.13  ? 523  GLY B N   1 
ATOM   8193 C CA  . GLY B 1 523 ? 8.897   16.898  -20.388 1.00 51.94  ? 523  GLY B CA  1 
ATOM   8194 C C   . GLY B 1 523 ? 8.602   15.452  -20.734 1.00 52.40  ? 523  GLY B C   1 
ATOM   8195 O O   . GLY B 1 523 ? 7.932   14.744  -19.983 1.00 52.99  ? 523  GLY B O   1 
ATOM   8196 N N   . LEU B 1 524 ? 9.115   15.030  -21.880 1.00 52.47  ? 524  LEU B N   1 
ATOM   8197 C CA  . LEU B 1 524 ? 8.885   13.724  -22.430 1.00 52.71  ? 524  LEU B CA  1 
ATOM   8198 C C   . LEU B 1 524 ? 9.949   12.795  -21.875 1.00 53.13  ? 524  LEU B C   1 
ATOM   8199 O O   . LEU B 1 524 ? 11.029  12.676  -22.458 1.00 53.60  ? 524  LEU B O   1 
ATOM   8200 C CB  . LEU B 1 524 ? 9.046   13.834  -23.938 1.00 52.76  ? 524  LEU B CB  1 
ATOM   8201 C CG  . LEU B 1 524 ? 8.275   12.947  -24.908 1.00 54.02  ? 524  LEU B CG  1 
ATOM   8202 C CD1 . LEU B 1 524 ? 7.058   13.670  -25.462 1.00 53.35  ? 524  LEU B CD1 1 
ATOM   8203 C CD2 . LEU B 1 524 ? 9.195   12.573  -26.052 1.00 55.77  ? 524  LEU B CD2 1 
ATOM   8204 N N   . ARG B 1 525 ? 9.667   12.149  -20.743 1.00 53.44  ? 525  ARG B N   1 
ATOM   8205 C CA  . ARG B 1 525 ? 10.644  11.261  -20.102 1.00 53.78  ? 525  ARG B CA  1 
ATOM   8206 C C   . ARG B 1 525 ? 11.948  11.998  -19.793 1.00 53.56  ? 525  ARG B C   1 
ATOM   8207 O O   . ARG B 1 525 ? 13.043  11.536  -20.136 1.00 53.07  ? 525  ARG B O   1 
ATOM   8208 C CB  . ARG B 1 525 ? 10.934  10.055  -20.993 1.00 54.01  ? 525  ARG B CB  1 
ATOM   8209 C CG  . ARG B 1 525 ? 9.845   9.030   -21.016 1.00 55.96  ? 525  ARG B CG  1 
ATOM   8210 C CD  . ARG B 1 525 ? 10.077  7.961   -19.952 1.00 60.83  ? 525  ARG B CD  1 
ATOM   8211 N NE  . ARG B 1 525 ? 9.684   6.627   -20.418 1.00 64.01  ? 525  ARG B NE  1 
ATOM   8212 C CZ  . ARG B 1 525 ? 8.447   6.279   -20.775 1.00 65.46  ? 525  ARG B CZ  1 
ATOM   8213 N NH1 . ARG B 1 525 ? 7.448   7.161   -20.736 1.00 65.40  ? 525  ARG B NH1 1 
ATOM   8214 N NH2 . ARG B 1 525 ? 8.210   5.039   -21.181 1.00 66.34  ? 525  ARG B NH2 1 
ATOM   8215 N N   . ALA B 1 526 ? 11.818  13.141  -19.127 1.00 53.78  ? 526  ALA B N   1 
ATOM   8216 C CA  . ALA B 1 526 ? 12.928  14.083  -18.995 1.00 53.84  ? 526  ALA B CA  1 
ATOM   8217 C C   . ALA B 1 526 ? 14.155  13.494  -18.314 1.00 53.99  ? 526  ALA B C   1 
ATOM   8218 O O   . ALA B 1 526 ? 15.251  13.581  -18.863 1.00 54.03  ? 526  ALA B O   1 
ATOM   8219 C CB  . ALA B 1 526 ? 12.482  15.346  -18.304 1.00 53.62  ? 526  ALA B CB  1 
ATOM   8220 N N   . GLN B 1 527 ? 13.968  12.886  -17.140 1.00 54.28  ? 527  GLN B N   1 
ATOM   8221 C CA  . GLN B 1 527 ? 15.090  12.356  -16.359 1.00 54.44  ? 527  GLN B CA  1 
ATOM   8222 C C   . GLN B 1 527 ? 15.712  11.151  -17.042 1.00 54.09  ? 527  GLN B C   1 
ATOM   8223 O O   . GLN B 1 527 ? 16.927  11.085  -17.224 1.00 54.05  ? 527  GLN B O   1 
ATOM   8224 C CB  . GLN B 1 527 ? 14.666  11.987  -14.934 1.00 54.86  ? 527  GLN B CB  1 
ATOM   8225 C CG  . GLN B 1 527 ? 14.212  13.157  -14.049 1.00 57.47  ? 527  GLN B CG  1 
ATOM   8226 C CD  . GLN B 1 527 ? 15.273  14.267  -13.905 1.00 61.87  ? 527  GLN B CD  1 
ATOM   8227 O OE1 . GLN B 1 527 ? 15.005  15.445  -14.224 1.00 63.45  ? 527  GLN B OE1 1 
ATOM   8228 N NE2 . GLN B 1 527 ? 16.478  13.898  -13.423 1.00 61.84  ? 527  GLN B NE2 1 
ATOM   8229 N N   . THR B 1 528 ? 14.877  10.201  -17.441 1.00 53.88  ? 528  THR B N   1 
ATOM   8230 C CA  . THR B 1 528 ? 15.379  8.972   -18.055 1.00 53.36  ? 528  THR B CA  1 
ATOM   8231 C C   . THR B 1 528 ? 16.125  9.231   -19.371 1.00 53.21  ? 528  THR B C   1 
ATOM   8232 O O   . THR B 1 528 ? 17.186  8.636   -19.614 1.00 53.22  ? 528  THR B O   1 
ATOM   8233 C CB  . THR B 1 528 ? 14.255  7.950   -18.232 1.00 53.18  ? 528  THR B CB  1 
ATOM   8234 O OG1 . THR B 1 528 ? 13.866  7.479   -16.940 1.00 53.01  ? 528  THR B OG1 1 
ATOM   8235 C CG2 . THR B 1 528 ? 14.721  6.778   -19.049 1.00 52.71  ? 528  THR B CG2 1 
ATOM   8236 N N   . CYS B 1 529 ? 15.585  10.127  -20.198 1.00 52.66  ? 529  CYS B N   1 
ATOM   8237 C CA  . CYS B 1 529 ? 16.224  10.442  -21.472 1.00 52.37  ? 529  CYS B CA  1 
ATOM   8238 C C   . CYS B 1 529 ? 17.490  11.253  -21.302 1.00 52.16  ? 529  CYS B C   1 
ATOM   8239 O O   . CYS B 1 529 ? 18.394  11.196  -22.135 1.00 52.10  ? 529  CYS B O   1 
ATOM   8240 C CB  . CYS B 1 529 ? 15.250  11.088  -22.454 1.00 52.29  ? 529  CYS B CB  1 
ATOM   8241 S SG  . CYS B 1 529 ? 14.078  9.861   -23.127 1.00 52.54  ? 529  CYS B SG  1 
ATOM   8242 N N   . ALA B 1 530 ? 17.572  11.988  -20.206 1.00 52.04  ? 530  ALA B N   1 
ATOM   8243 C CA  . ALA B 1 530 ? 18.818  12.638  -19.867 1.00 52.27  ? 530  ALA B CA  1 
ATOM   8244 C C   . ALA B 1 530 ? 19.893  11.567  -19.668 1.00 52.41  ? 530  ALA B C   1 
ATOM   8245 O O   . ALA B 1 530 ? 21.026  11.715  -20.134 1.00 52.54  ? 530  ALA B O   1 
ATOM   8246 C CB  . ALA B 1 530 ? 18.651  13.480  -18.629 1.00 52.31  ? 530  ALA B CB  1 
ATOM   8247 N N   . PHE B 1 531 ? 19.517  10.482  -18.995 1.00 52.42  ? 531  PHE B N   1 
ATOM   8248 C CA  . PHE B 1 531 ? 20.400  9.349   -18.815 1.00 52.32  ? 531  PHE B CA  1 
ATOM   8249 C C   . PHE B 1 531 ? 20.857  8.771   -20.154 1.00 52.45  ? 531  PHE B C   1 
ATOM   8250 O O   . PHE B 1 531 ? 22.049  8.527   -20.342 1.00 52.56  ? 531  PHE B O   1 
ATOM   8251 C CB  . PHE B 1 531 ? 19.733  8.280   -17.948 1.00 52.27  ? 531  PHE B CB  1 
ATOM   8252 C CG  . PHE B 1 531 ? 20.469  6.974   -17.931 1.00 52.82  ? 531  PHE B CG  1 
ATOM   8253 C CD1 . PHE B 1 531 ? 21.695  6.857   -17.292 1.00 52.60  ? 531  PHE B CD1 1 
ATOM   8254 C CD2 . PHE B 1 531 ? 19.942  5.857   -18.572 1.00 54.00  ? 531  PHE B CD2 1 
ATOM   8255 C CE1 . PHE B 1 531 ? 22.385  5.647   -17.281 1.00 52.68  ? 531  PHE B CE1 1 
ATOM   8256 C CE2 . PHE B 1 531 ? 20.630  4.637   -18.570 1.00 54.01  ? 531  PHE B CE2 1 
ATOM   8257 C CZ  . PHE B 1 531 ? 21.852  4.536   -17.920 1.00 53.15  ? 531  PHE B CZ  1 
ATOM   8258 N N   . TRP B 1 532 ? 19.912  8.562   -21.075 1.00 52.75  ? 532  TRP B N   1 
ATOM   8259 C CA  . TRP B 1 532 ? 20.206  7.959   -22.392 1.00 52.90  ? 532  TRP B CA  1 
ATOM   8260 C C   . TRP B 1 532 ? 20.955  8.894   -23.317 1.00 53.25  ? 532  TRP B C   1 
ATOM   8261 O O   . TRP B 1 532 ? 21.850  8.459   -24.035 1.00 53.29  ? 532  TRP B O   1 
ATOM   8262 C CB  . TRP B 1 532 ? 18.929  7.498   -23.112 1.00 52.45  ? 532  TRP B CB  1 
ATOM   8263 C CG  . TRP B 1 532 ? 18.365  6.242   -22.585 1.00 51.96  ? 532  TRP B CG  1 
ATOM   8264 C CD1 . TRP B 1 532 ? 17.224  6.108   -21.867 1.00 52.18  ? 532  TRP B CD1 1 
ATOM   8265 C CD2 . TRP B 1 532 ? 18.916  4.928   -22.715 1.00 51.62  ? 532  TRP B CD2 1 
ATOM   8266 N NE1 . TRP B 1 532 ? 17.019  4.789   -21.538 1.00 52.02  ? 532  TRP B NE1 1 
ATOM   8267 C CE2 . TRP B 1 532 ? 18.046  4.043   -22.047 1.00 51.65  ? 532  TRP B CE2 1 
ATOM   8268 C CE3 . TRP B 1 532 ? 20.058  4.408   -23.338 1.00 52.03  ? 532  TRP B CE3 1 
ATOM   8269 C CZ2 . TRP B 1 532 ? 18.277  2.668   -21.983 1.00 52.12  ? 532  TRP B CZ2 1 
ATOM   8270 C CZ3 . TRP B 1 532 ? 20.288  3.037   -23.272 1.00 51.70  ? 532  TRP B CZ3 1 
ATOM   8271 C CH2 . TRP B 1 532 ? 19.403  2.187   -22.600 1.00 51.92  ? 532  TRP B CH2 1 
ATOM   8272 N N   . ASN B 1 533 ? 20.576  10.169  -23.308 1.00 53.80  ? 533  ASN B N   1 
ATOM   8273 C CA  . ASN B 1 533 ? 21.103  11.132  -24.268 1.00 54.63  ? 533  ASN B CA  1 
ATOM   8274 C C   . ASN B 1 533 ? 22.357  11.872  -23.813 1.00 55.18  ? 533  ASN B C   1 
ATOM   8275 O O   . ASN B 1 533 ? 23.117  12.369  -24.643 1.00 55.05  ? 533  ASN B O   1 
ATOM   8276 C CB  . ASN B 1 533 ? 20.028  12.142  -24.653 1.00 54.70  ? 533  ASN B CB  1 
ATOM   8277 C CG  . ASN B 1 533 ? 18.859  11.508  -25.372 1.00 55.23  ? 533  ASN B CG  1 
ATOM   8278 O OD1 . ASN B 1 533 ? 18.938  10.382  -25.860 1.00 55.84  ? 533  ASN B OD1 1 
ATOM   8279 N ND2 . ASN B 1 533 ? 17.754  12.239  -25.442 1.00 56.67  ? 533  ASN B ND2 1 
ATOM   8280 N N   . ARG B 1 534 ? 22.569  11.959  -22.502 1.00 56.03  ? 534  ARG B N   1 
ATOM   8281 C CA  . ARG B 1 534 ? 23.732  12.668  -21.974 1.00 56.67  ? 534  ARG B CA  1 
ATOM   8282 C C   . ARG B 1 534 ? 24.730  11.767  -21.261 1.00 56.96  ? 534  ARG B C   1 
ATOM   8283 O O   . ARG B 1 534 ? 25.939  11.955  -21.424 1.00 57.26  ? 534  ARG B O   1 
ATOM   8284 C CB  . ARG B 1 534 ? 23.317  13.813  -21.054 1.00 56.79  ? 534  ARG B CB  1 
ATOM   8285 C CG  . ARG B 1 534 ? 22.589  14.949  -21.741 1.00 57.61  ? 534  ARG B CG  1 
ATOM   8286 C CD  . ARG B 1 534 ? 21.636  15.600  -20.758 1.00 59.47  ? 534  ARG B CD  1 
ATOM   8287 N NE  . ARG B 1 534 ? 20.462  16.204  -21.394 1.00 60.54  ? 534  ARG B NE  1 
ATOM   8288 C CZ  . ARG B 1 534 ? 20.400  17.475  -21.777 1.00 60.21  ? 534  ARG B CZ  1 
ATOM   8289 N NH1 . ARG B 1 534 ? 21.447  18.269  -21.593 1.00 60.55  ? 534  ARG B NH1 1 
ATOM   8290 N NH2 . ARG B 1 534 ? 19.297  17.952  -22.335 1.00 59.13  ? 534  ARG B NH2 1 
ATOM   8291 N N   . PHE B 1 535 ? 24.257  10.796  -20.480 1.00 57.08  ? 535  PHE B N   1 
ATOM   8292 C CA  . PHE B 1 535 ? 25.197  10.015  -19.695 1.00 57.46  ? 535  PHE B CA  1 
ATOM   8293 C C   . PHE B 1 535 ? 25.883  8.908   -20.446 1.00 58.63  ? 535  PHE B C   1 
ATOM   8294 O O   . PHE B 1 535 ? 27.110  8.896   -20.532 1.00 58.85  ? 535  PHE B O   1 
ATOM   8295 C CB  . PHE B 1 535 ? 24.592  9.444   -18.435 1.00 56.79  ? 535  PHE B CB  1 
ATOM   8296 C CG  . PHE B 1 535 ? 25.617  8.878   -17.504 1.00 55.81  ? 535  PHE B CG  1 
ATOM   8297 C CD1 . PHE B 1 535 ? 26.629  9.688   -16.999 1.00 53.52  ? 535  PHE B CD1 1 
ATOM   8298 C CD2 . PHE B 1 535 ? 25.588  7.535   -17.143 1.00 54.92  ? 535  PHE B CD2 1 
ATOM   8299 C CE1 . PHE B 1 535 ? 27.580  9.177   -16.148 1.00 52.51  ? 535  PHE B CE1 1 
ATOM   8300 C CE2 . PHE B 1 535 ? 26.540  7.017   -16.284 1.00 53.92  ? 535  PHE B CE2 1 
ATOM   8301 C CZ  . PHE B 1 535 ? 27.538  7.845   -15.787 1.00 54.08  ? 535  PHE B CZ  1 
ATOM   8302 N N   . LEU B 1 536 ? 25.104  7.967   -20.968 1.00 60.00  ? 536  LEU B N   1 
ATOM   8303 C CA  . LEU B 1 536 ? 25.680  6.833   -21.674 1.00 61.65  ? 536  LEU B CA  1 
ATOM   8304 C C   . LEU B 1 536 ? 26.750  7.200   -22.717 1.00 63.24  ? 536  LEU B C   1 
ATOM   8305 O O   . LEU B 1 536 ? 27.840  6.628   -22.683 1.00 63.52  ? 536  LEU B O   1 
ATOM   8306 C CB  . LEU B 1 536 ? 24.603  5.954   -22.287 1.00 61.44  ? 536  LEU B CB  1 
ATOM   8307 C CG  . LEU B 1 536 ? 23.903  4.957   -21.379 1.00 61.39  ? 536  LEU B CG  1 
ATOM   8308 C CD1 . LEU B 1 536 ? 23.478  3.837   -22.276 1.00 62.19  ? 536  LEU B CD1 1 
ATOM   8309 C CD2 . LEU B 1 536 ? 24.806  4.413   -20.284 1.00 61.09  ? 536  LEU B CD2 1 
ATOM   8310 N N   . PRO B 1 537 ? 26.451  8.135   -23.651 1.00 64.74  ? 537  PRO B N   1 
ATOM   8311 C CA  . PRO B 1 537 ? 27.507  8.614   -24.551 1.00 66.06  ? 537  PRO B CA  1 
ATOM   8312 C C   . PRO B 1 537 ? 28.879  8.795   -23.875 1.00 67.55  ? 537  PRO B C   1 
ATOM   8313 O O   . PRO B 1 537 ? 29.862  8.179   -24.318 1.00 67.59  ? 537  PRO B O   1 
ATOM   8314 C CB  . PRO B 1 537 ? 26.957  9.953   -25.040 1.00 65.87  ? 537  PRO B CB  1 
ATOM   8315 C CG  . PRO B 1 537 ? 25.490  9.732   -25.075 1.00 65.28  ? 537  PRO B CG  1 
ATOM   8316 C CD  . PRO B 1 537 ? 25.153  8.764   -23.973 1.00 64.71  ? 537  PRO B CD  1 
ATOM   8317 N N   . LYS B 1 538 ? 28.928  9.613   -22.815 1.00 69.30  ? 538  LYS B N   1 
ATOM   8318 C CA  . LYS B 1 538 ? 30.166  9.885   -22.066 1.00 70.94  ? 538  LYS B CA  1 
ATOM   8319 C C   . LYS B 1 538 ? 30.801  8.580   -21.625 1.00 71.67  ? 538  LYS B C   1 
ATOM   8320 O O   . LYS B 1 538 ? 32.001  8.384   -21.786 1.00 72.08  ? 538  LYS B O   1 
ATOM   8321 C CB  . LYS B 1 538 ? 29.908  10.742  -20.820 1.00 71.09  ? 538  LYS B CB  1 
ATOM   8322 C CG  . LYS B 1 538 ? 29.151  12.041  -21.044 1.00 73.08  ? 538  LYS B CG  1 
ATOM   8323 C CD  . LYS B 1 538 ? 30.062  13.253  -21.270 1.00 75.83  ? 538  LYS B CD  1 
ATOM   8324 C CE  . LYS B 1 538 ? 29.208  14.528  -21.324 1.00 77.32  ? 538  LYS B CE  1 
ATOM   8325 N NZ  . LYS B 1 538 ? 29.871  15.666  -22.027 1.00 79.03  ? 538  LYS B NZ  1 
ATOM   8326 N N   . LEU B 1 539 ? 29.975  7.691   -21.082 1.00 72.52  ? 539  LEU B N   1 
ATOM   8327 C CA  . LEU B 1 539 ? 30.406  6.393   -20.578 1.00 73.46  ? 539  LEU B CA  1 
ATOM   8328 C C   . LEU B 1 539 ? 31.054  5.500   -21.649 1.00 74.25  ? 539  LEU B C   1 
ATOM   8329 O O   . LEU B 1 539 ? 31.695  4.493   -21.335 1.00 74.59  ? 539  LEU B O   1 
ATOM   8330 C CB  . LEU B 1 539 ? 29.194  5.696   -19.971 1.00 73.25  ? 539  LEU B CB  1 
ATOM   8331 C CG  . LEU B 1 539 ? 29.360  4.416   -19.175 1.00 73.46  ? 539  LEU B CG  1 
ATOM   8332 C CD1 . LEU B 1 539 ? 30.565  4.507   -18.263 1.00 74.26  ? 539  LEU B CD1 1 
ATOM   8333 C CD2 . LEU B 1 539 ? 28.100  4.185   -18.376 1.00 74.01  ? 539  LEU B CD2 1 
ATOM   8334 N N   . LEU B 1 540 ? 30.890  5.880   -22.912 1.00 75.21  ? 540  LEU B N   1 
ATOM   8335 C CA  . LEU B 1 540 ? 31.349  5.064   -24.036 1.00 75.98  ? 540  LEU B CA  1 
ATOM   8336 C C   . LEU B 1 540 ? 32.133  5.900   -25.055 1.00 76.12  ? 540  LEU B C   1 
ATOM   8337 O O   . LEU B 1 540 ? 33.038  6.659   -24.690 1.00 76.16  ? 540  LEU B O   1 
ATOM   8338 C CB  . LEU B 1 540 ? 30.147  4.375   -24.705 1.00 76.19  ? 540  LEU B CB  1 
ATOM   8339 C CG  . LEU B 1 540 ? 29.124  3.688   -23.774 1.00 76.89  ? 540  LEU B CG  1 
ATOM   8340 C CD1 . LEU B 1 540 ? 27.785  3.408   -24.486 1.00 76.93  ? 540  LEU B CD1 1 
ATOM   8341 C CD2 . LEU B 1 540 ? 29.702  2.412   -23.133 1.00 77.52  ? 540  LEU B CD2 1 
HETATM 8342 C C1  . NAG C 2 .   ? 24.781  35.529  -0.912  1.00 82.18  ? 1544 NAG A C1  1 
HETATM 8343 C C2  . NAG C 2 .   ? 24.955  35.888  -2.407  1.00 86.00  ? 1544 NAG A C2  1 
HETATM 8344 C C3  . NAG C 2 .   ? 26.271  35.342  -2.997  1.00 85.87  ? 1544 NAG A C3  1 
HETATM 8345 C C4  . NAG C 2 .   ? 27.465  35.678  -2.116  1.00 85.70  ? 1544 NAG A C4  1 
HETATM 8346 C C5  . NAG C 2 .   ? 27.182  35.074  -0.737  1.00 85.61  ? 1544 NAG A C5  1 
HETATM 8347 C C6  . NAG C 2 .   ? 28.385  35.146  0.223   1.00 85.88  ? 1544 NAG A C6  1 
HETATM 8348 C C7  . NAG C 2 .   ? 23.066  36.140  -4.006  1.00 90.48  ? 1544 NAG A C7  1 
HETATM 8349 C C8  . NAG C 2 .   ? 23.314  36.017  -5.494  1.00 90.40  ? 1544 NAG A C8  1 
HETATM 8350 N N2  . NAG C 2 .   ? 23.820  35.389  -3.186  1.00 88.54  ? 1544 NAG A N2  1 
HETATM 8351 O O3  . NAG C 2 .   ? 26.526  35.834  -4.293  1.00 86.24  ? 1544 NAG A O3  1 
HETATM 8352 O O4  . NAG C 2 .   ? 28.641  35.169  -2.709  1.00 85.97  ? 1544 NAG A O4  1 
HETATM 8353 O O5  . NAG C 2 .   ? 26.007  35.688  -0.189  1.00 84.10  ? 1544 NAG A O5  1 
HETATM 8354 O O6  . NAG C 2 .   ? 28.682  36.477  0.614   1.00 85.81  ? 1544 NAG A O6  1 
HETATM 8355 O O7  . NAG C 2 .   ? 22.188  36.903  -3.586  1.00 91.57  ? 1544 NAG A O7  1 
HETATM 8356 O O1  . P6G D 3 .   ? 17.562  10.630  -12.318 1.00 76.97  ? 1542 P6G B O1  1 
HETATM 8357 C C2  . P6G D 3 .   ? 18.517  10.091  -13.076 1.00 77.92  ? 1542 P6G B C2  1 
HETATM 8358 C C3  . P6G D 3 .   ? 19.028  10.766  -14.110 1.00 78.30  ? 1542 P6G B C3  1 
HETATM 8359 O O4  . P6G D 3 .   ? 20.077  10.171  -14.935 1.00 78.90  ? 1542 P6G B O4  1 
HETATM 8360 C C5  . P6G D 3 .   ? 21.424  10.727  -14.948 1.00 79.11  ? 1542 P6G B C5  1 
HETATM 8361 C C6  . P6G D 3 .   ? 22.489  10.018  -14.551 1.00 79.57  ? 1542 P6G B C6  1 
HETATM 8362 O O7  . P6G D 3 .   ? 22.432  8.631   -14.072 1.00 79.45  ? 1542 P6G B O7  1 
HETATM 8363 C C8  . P6G D 3 .   ? 23.667  7.847   -14.130 1.00 78.50  ? 1542 P6G B C8  1 
HETATM 8364 C C9  . P6G D 3 .   ? 23.801  6.619   -13.627 1.00 78.15  ? 1542 P6G B C9  1 
HETATM 8365 O O10 . P6G D 3 .   ? 22.716  5.924   -12.956 1.00 78.81  ? 1542 P6G B O10 1 
HETATM 8366 C C11 . P6G D 3 .   ? 22.921  4.589   -12.489 1.00 80.06  ? 1542 P6G B C11 1 
HETATM 8367 C C12 . P6G D 3 .   ? 22.092  4.286   -11.233 1.00 82.04  ? 1542 P6G B C12 1 
HETATM 8368 O O13 . P6G D 3 .   ? 20.872  5.044   -11.145 1.00 83.66  ? 1542 P6G B O13 1 
HETATM 8369 C C14 . P6G D 3 .   ? 19.950  4.799   -10.034 1.00 83.85  ? 1542 P6G B C14 1 
HETATM 8370 C C15 . P6G D 3 .   ? 18.756  5.395   -9.920  1.00 83.86  ? 1542 P6G B C15 1 
HETATM 8371 O O16 . P6G D 3 .   ? 18.251  6.358   -10.893 1.00 83.93  ? 1542 P6G B O16 1 
HETATM 8372 C C17 . P6G D 3 .   ? 16.836  6.392   -11.278 1.00 83.87  ? 1542 P6G B C17 1 
HETATM 8373 C C18 . P6G D 3 .   ? 16.278  7.513   -11.758 1.00 83.71  ? 1542 P6G B C18 1 
HETATM 8374 O O19 . P6G D 3 .   ? 14.996  7.570   -12.125 1.00 82.63  ? 1542 P6G B O19 1 
HETATM 8375 O O   . HOH E 4 .   ? 20.031  24.291  38.799  1.00 39.03  ? 2001 HOH A O   1 
HETATM 8376 O O   . HOH E 4 .   ? 11.212  18.149  33.906  1.00 49.75  ? 2002 HOH A O   1 
HETATM 8377 O O   . HOH E 4 .   ? 49.963  6.216   28.405  1.00 47.79  ? 2003 HOH A O   1 
HETATM 8378 O O   . HOH E 4 .   ? 42.957  14.598  40.321  1.00 33.36  ? 2004 HOH A O   1 
HETATM 8379 O O   . HOH E 4 .   ? 40.337  15.350  45.228  1.00 42.97  ? 2005 HOH A O   1 
HETATM 8380 O O   . HOH E 4 .   ? 39.857  23.442  35.255  1.00 47.66  ? 2006 HOH A O   1 
HETATM 8381 O O   . HOH E 4 .   ? 24.186  24.055  23.062  1.00 35.51  ? 2007 HOH A O   1 
HETATM 8382 O O   . HOH E 4 .   ? 42.114  14.166  31.582  1.00 39.04  ? 2008 HOH A O   1 
HETATM 8383 O O   . HOH E 4 .   ? 31.086  21.098  16.414  1.00 30.73  ? 2009 HOH A O   1 
HETATM 8384 O O   . HOH E 4 .   ? 35.780  17.914  24.609  1.00 24.64  ? 2010 HOH A O   1 
HETATM 8385 O O   . HOH E 4 .   ? 25.626  19.449  28.517  1.00 28.15  ? 2011 HOH A O   1 
HETATM 8386 O O   . HOH E 4 .   ? 17.842  15.513  29.323  1.00 37.99  ? 2012 HOH A O   1 
HETATM 8387 O O   . HOH E 4 .   ? 53.298  -1.259  20.284  1.00 43.38  ? 2013 HOH A O   1 
HETATM 8388 O O   . HOH E 4 .   ? 47.329  7.620   18.002  1.00 33.33  ? 2014 HOH A O   1 
HETATM 8389 O O   . HOH E 4 .   ? 29.346  0.328   29.839  1.00 28.55  ? 2015 HOH A O   1 
HETATM 8390 O O   . HOH E 4 .   ? 36.596  2.075   36.951  1.00 46.62  ? 2016 HOH A O   1 
HETATM 8391 O O   . HOH E 4 .   ? 32.482  -7.027  14.456  1.00 40.52  ? 2017 HOH A O   1 
HETATM 8392 O O   . HOH E 4 .   ? 36.720  5.138   2.790   1.00 26.65  ? 2018 HOH A O   1 
HETATM 8393 O O   . HOH E 4 .   ? 41.906  7.098   2.895   1.00 39.86  ? 2019 HOH A O   1 
HETATM 8394 O O   . HOH E 4 .   ? 59.018  4.737   9.246   1.00 46.01  ? 2020 HOH A O   1 
HETATM 8395 O O   . HOH E 4 .   ? 58.465  14.613  8.347   1.00 37.37  ? 2021 HOH A O   1 
HETATM 8396 O O   . HOH E 4 .   ? 65.071  5.857   17.172  1.00 38.46  ? 2022 HOH A O   1 
HETATM 8397 O O   . HOH E 4 .   ? 54.677  21.144  25.419  1.00 32.93  ? 2023 HOH A O   1 
HETATM 8398 O O   . HOH E 4 .   ? 32.737  21.356  7.749   1.00 37.07  ? 2024 HOH A O   1 
HETATM 8399 O O   . HOH E 4 .   ? 40.561  17.420  11.889  1.00 59.44  ? 2025 HOH A O   1 
HETATM 8400 O O   . HOH E 4 .   ? 45.083  -3.139  8.073   1.00 27.67  ? 2026 HOH A O   1 
HETATM 8401 O O   . HOH E 4 .   ? 13.464  23.976  2.149   1.00 45.19  ? 2027 HOH A O   1 
HETATM 8402 O O   . HOH E 4 .   ? 17.601  25.795  17.833  1.00 34.90  ? 2028 HOH A O   1 
HETATM 8403 O O   . HOH E 4 .   ? 17.206  23.367  32.452  1.00 43.26  ? 2029 HOH A O   1 
HETATM 8404 O O   . HOH E 4 .   ? 13.100  34.892  25.292  1.00 51.60  ? 2030 HOH A O   1 
HETATM 8405 O O   . HOH E 4 .   ? 10.139  -2.767  7.076   1.00 39.30  ? 2031 HOH A O   1 
HETATM 8406 O O   . HOH E 4 .   ? 5.786   19.202  12.138  1.00 51.15  ? 2032 HOH A O   1 
HETATM 8407 O O   . HOH E 4 .   ? 15.248  2.398   1.683   1.00 33.08  ? 2033 HOH A O   1 
HETATM 8408 O O   . HOH E 4 .   ? 15.276  8.324   -4.013  1.00 50.43  ? 2034 HOH A O   1 
HETATM 8409 O O   . HOH F 4 .   ? -1.107  6.742   -72.424 1.00 35.17  ? 2001 HOH B O   1 
HETATM 8410 O O   . HOH F 4 .   ? 6.064   -1.390  -38.192 1.00 44.25  ? 2002 HOH B O   1 
HETATM 8411 O O   . HOH F 4 .   ? -3.513  0.160   -48.124 1.00 45.68  ? 2003 HOH B O   1 
HETATM 8412 O O   . HOH F 4 .   ? -3.045  -4.233  -42.116 1.00 42.71  ? 2004 HOH B O   1 
HETATM 8413 O O   . HOH F 4 .   ? 0.563   -2.499  -19.106 1.00 29.10  ? 2005 HOH B O   1 
HETATM 8414 O O   . HOH F 4 .   ? 4.866   4.111   -48.115 1.00 47.40  ? 2006 HOH B O   1 
HETATM 8415 O O   . HOH F 4 .   ? 17.508  -3.028  -55.767 1.00 43.74  ? 2007 HOH B O   1 
HETATM 8416 O O   . HOH F 4 .   ? 10.227  23.826  -49.473 1.00 36.15  ? 2008 HOH B O   1 
HETATM 8417 O O   . HOH F 4 .   ? 6.203   16.105  -53.485 1.00 29.92  ? 2009 HOH B O   1 
HETATM 8418 O O   . HOH F 4 .   ? 25.083  4.980   -34.996 1.00 35.34  ? 2010 HOH B O   1 
HETATM 8419 O O   . HOH F 4 .   ? 16.969  -8.098  -48.528 1.00 52.11  ? 2011 HOH B O   1 
HETATM 8420 O O   . HOH F 4 .   ? 17.600  -5.269  -42.763 1.00 41.88  ? 2012 HOH B O   1 
HETATM 8421 O O   . HOH F 4 .   ? 30.085  10.180  -52.204 1.00 41.23  ? 2013 HOH B O   1 
HETATM 8422 O O   . HOH F 4 .   ? 31.869  9.570   -46.184 1.00 29.39  ? 2014 HOH B O   1 
HETATM 8423 O O   . HOH F 4 .   ? 31.093  11.020  -44.091 1.00 43.22  ? 2015 HOH B O   1 
HETATM 8424 O O   . HOH F 4 .   ? 7.409   -18.276 -21.310 1.00 52.27  ? 2016 HOH B O   1 
HETATM 8425 O O   . HOH F 4 .   ? 10.489  -7.217  -4.722  1.00 40.79  ? 2017 HOH B O   1 
HETATM 8426 O O   . HOH F 4 .   ? 9.972   -12.825 -6.797  1.00 35.97  ? 2018 HOH B O   1 
HETATM 8427 O O   . HOH F 4 .   ? 2.710   -1.612  -18.495 1.00 35.98  ? 2019 HOH B O   1 
HETATM 8428 O O   . HOH F 4 .   ? 8.999   3.014   -24.217 1.00 50.97  ? 2020 HOH B O   1 
HETATM 8429 O O   . HOH F 4 .   ? 13.630  6.019   -33.376 1.00 44.05  ? 2021 HOH B O   1 
HETATM 8430 O O   . HOH F 4 .   ? -6.017  -4.314  -33.590 1.00 44.75  ? 2022 HOH B O   1 
HETATM 8431 O O   . HOH F 4 .   ? -18.778 -8.927  -36.346 1.00 53.37  ? 2023 HOH B O   1 
HETATM 8432 O O   . HOH F 4 .   ? -7.003  18.640  -46.840 1.00 51.29  ? 2024 HOH B O   1 
HETATM 8433 O O   . HOH F 4 .   ? -16.192 30.055  -36.001 1.00 41.09  ? 2025 HOH B O   1 
HETATM 8434 O O   . HOH F 4 .   ? 10.948  16.921  -23.069 1.00 37.28  ? 2026 HOH B O   1 
HETATM 8435 O O   . HOH F 4 .   ? 8.788   28.508  -23.677 1.00 36.78  ? 2027 HOH B O   1 
HETATM 8436 O O   . HOH F 4 .   ? 12.159  27.056  -25.322 1.00 47.72  ? 2028 HOH B O   1 
HETATM 8437 O O   . HOH F 4 .   ? 3.791   16.909  -16.403 1.00 46.31  ? 2029 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SVZ 203 203 203 SVZ SVZ A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SVZ 203 203 203 SVZ SVZ B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 ?   ?   ?   B . n 
B 1 542 ALA 542 542 ?   ?   ?   B . n 
B 1 543 THR 543 543 ?   ?   ?   B . n 
B 1 544 ALA 544 544 ?   ?   ?   B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLU 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1  1544 1544 NAG NAG A . 
D 3 P6G 1  1542 1542 P6G P6G B . 
E 4 HOH 1  2001 2001 HOH HOH A . 
E 4 HOH 2  2002 2002 HOH HOH A . 
E 4 HOH 3  2003 2003 HOH HOH A . 
E 4 HOH 4  2004 2004 HOH HOH A . 
E 4 HOH 5  2005 2005 HOH HOH A . 
E 4 HOH 6  2006 2006 HOH HOH A . 
E 4 HOH 7  2007 2007 HOH HOH A . 
E 4 HOH 8  2008 2008 HOH HOH A . 
E 4 HOH 9  2009 2009 HOH HOH A . 
E 4 HOH 10 2010 2010 HOH HOH A . 
E 4 HOH 11 2011 2011 HOH HOH A . 
E 4 HOH 12 2012 2012 HOH HOH A . 
E 4 HOH 13 2013 2013 HOH HOH A . 
E 4 HOH 14 2014 2014 HOH HOH A . 
E 4 HOH 15 2015 2015 HOH HOH A . 
E 4 HOH 16 2016 2016 HOH HOH A . 
E 4 HOH 17 2017 2017 HOH HOH A . 
E 4 HOH 18 2018 2018 HOH HOH A . 
E 4 HOH 19 2019 2019 HOH HOH A . 
E 4 HOH 20 2020 2020 HOH HOH A . 
E 4 HOH 21 2021 2021 HOH HOH A . 
E 4 HOH 22 2022 2022 HOH HOH A . 
E 4 HOH 23 2023 2023 HOH HOH A . 
E 4 HOH 24 2024 2024 HOH HOH A . 
E 4 HOH 25 2025 2025 HOH HOH A . 
E 4 HOH 26 2026 2026 HOH HOH A . 
E 4 HOH 27 2027 2027 HOH HOH A . 
E 4 HOH 28 2028 2028 HOH HOH A . 
E 4 HOH 29 2029 2029 HOH HOH A . 
E 4 HOH 30 2030 2030 HOH HOH A . 
E 4 HOH 31 2031 2031 HOH HOH A . 
E 4 HOH 32 2032 2032 HOH HOH A . 
E 4 HOH 33 2033 2033 HOH HOH A . 
E 4 HOH 34 2034 2034 HOH HOH A . 
F 4 HOH 1  2001 2001 HOH HOH B . 
F 4 HOH 2  2002 2002 HOH HOH B . 
F 4 HOH 3  2003 2003 HOH HOH B . 
F 4 HOH 4  2004 2004 HOH HOH B . 
F 4 HOH 5  2005 2005 HOH HOH B . 
F 4 HOH 6  2006 2006 HOH HOH B . 
F 4 HOH 7  2007 2007 HOH HOH B . 
F 4 HOH 8  2008 2008 HOH HOH B . 
F 4 HOH 9  2009 2009 HOH HOH B . 
F 4 HOH 10 2010 2010 HOH HOH B . 
F 4 HOH 11 2011 2011 HOH HOH B . 
F 4 HOH 12 2012 2012 HOH HOH B . 
F 4 HOH 13 2013 2013 HOH HOH B . 
F 4 HOH 14 2014 2014 HOH HOH B . 
F 4 HOH 15 2015 2015 HOH HOH B . 
F 4 HOH 16 2016 2016 HOH HOH B . 
F 4 HOH 17 2017 2017 HOH HOH B . 
F 4 HOH 18 2018 2018 HOH HOH B . 
F 4 HOH 19 2019 2019 HOH HOH B . 
F 4 HOH 20 2020 2020 HOH HOH B . 
F 4 HOH 21 2021 2021 HOH HOH B . 
F 4 HOH 22 2022 2022 HOH HOH B . 
F 4 HOH 23 2023 2023 HOH HOH B . 
F 4 HOH 24 2024 2024 HOH HOH B . 
F 4 HOH 25 2025 2025 HOH HOH B . 
F 4 HOH 26 2026 2026 HOH HOH B . 
F 4 HOH 27 2027 2027 HOH HOH B . 
F 4 HOH 28 2028 2028 HOH HOH B . 
F 4 HOH 29 2029 2029 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A SVZ 203 A SVZ 203 ? SER ?                    
3 B SVZ 203 B SVZ 203 ? SER ?                    
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-17 
2 'Structure model' 1 1 2014-01-29 
3 'Structure model' 1 2 2018-01-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'      
2 2 'Structure model' 'Non-polymer description'   
3 2 'Structure model' Other                       
4 2 'Structure model' 'Source and taxonomy'       
5 2 'Structure model' 'Structure summary'         
6 2 'Structure model' 'Version format compliance' 
7 3 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.pdbx_synchrotron_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
CCP4   phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2JGK 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;GAP BETWEEN RESIDUES 257 AND 265 (MONOMER A AND B).
MONOMER B STARTS AT RESIDUE 4.
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              107 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              108 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              108 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.60 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            11.30 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 77.67   -5.14   
2  1 ASN A 67  ? ? -48.11  152.42  
3  1 PRO A 78  ? ? -37.89  134.05  
4  1 PRO A 104 ? ? -41.32  163.38  
5  1 ALA A 109 ? ? -65.58  -71.74  
6  1 ASN A 170 ? ? 55.20   14.68   
7  1 PRO A 194 ? ? -65.86  2.25    
8  1 SVZ A 203 ? ? 50.52   -119.14 
9  1 GLN A 291 ? ? -18.02  108.83  
10 1 SER A 293 ? ? -170.49 129.80  
11 1 ASP A 306 ? ? -122.27 -80.72  
12 1 VAL A 407 ? ? -122.38 -64.75  
13 1 HIS A 447 ? ? -37.55  119.99  
14 1 ARG A 493 ? ? -78.03  -86.78  
15 1 ASP A 494 ? ? -56.16  107.91  
16 1 ARG A 525 ? ? 31.34   61.93   
17 1 LEU A 539 ? ? -78.46  22.51   
18 1 PRO B 25  ? ? -18.86  -62.20  
19 1 CYS B 96  ? ? -144.35 -2.74   
20 1 PRO B 108 ? ? -24.59  127.05  
21 1 LEU B 161 ? ? -119.94 78.26   
22 1 ALA B 167 ? ? -160.58 76.10   
23 1 SER B 196 ? ? -141.43 54.94   
24 1 SVZ B 203 ? ? 48.65   -118.87 
25 1 ASN B 233 ? ? -69.27  -179.54 
26 1 GLN B 291 ? ? -0.13   92.69   
27 1 GLU B 292 ? ? -52.39  83.11   
28 1 ASP B 306 ? ? -120.35 -84.84  
29 1 ASP B 323 ? ? -100.56 71.93   
30 1 VAL B 407 ? ? -122.60 -60.41  
31 1 HIS B 447 ? ? -35.27  121.99  
32 1 SER B 497 ? ? -86.87  -78.92  
33 1 ALA B 506 ? ? -67.84  -71.30  
34 1 ASN B 514 ? ? -161.98 -164.20 
35 1 PRO B 517 ? ? -47.65  155.72  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 A ALA 544 ? A ALA 544 
10 1 Y 1 A THR 545 ? A THR 545 
11 1 Y 1 A GLU 546 ? A GLU 546 
12 1 Y 1 A ALA 547 ? A ALA 547 
13 1 Y 1 A PRO 548 ? A PRO 548 
14 1 Y 1 B GLU 1   ? B GLU 1   
15 1 Y 1 B GLY 2   ? B GLY 2   
16 1 Y 1 B ARG 3   ? B ARG 3   
17 1 Y 1 B PRO 258 ? B PRO 258 
18 1 Y 1 B PRO 259 ? B PRO 259 
19 1 Y 1 B GLY 260 ? B GLY 260 
20 1 Y 1 B GLY 261 ? B GLY 261 
21 1 Y 1 B ALA 262 ? B ALA 262 
22 1 Y 1 B GLY 263 ? B GLY 263 
23 1 Y 1 B GLY 264 ? B GLY 264 
24 1 Y 1 B SER 541 ? B SER 541 
25 1 Y 1 B ALA 542 ? B ALA 542 
26 1 Y 1 B THR 543 ? B THR 543 
27 1 Y 1 B ALA 544 ? B ALA 544 
28 1 Y 1 B THR 545 ? B THR 545 
29 1 Y 1 B GLU 546 ? B GLU 546 
30 1 Y 1 B ALA 547 ? B ALA 547 
31 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE NAG 
3 'HEXAETHYLENE GLYCOL'  P6G 
4 water                  HOH 
#