data_2JGN
# 
_entry.id   2JGN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JGN         
PDBE  EBI-31452    
WWPDB D_1290031452 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JGN 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rodamilans, B.' 1 
'Montoya, G.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Ddx3 RNA Helicase Domain.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            63 
_citation.page_first                283 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17401195 
_citation.pdbx_database_id_DOI      10.1107/S1744309107006434 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rodamilans, B.' 1 
primary 'Montoya, G.'    2 
# 
_cell.entry_id           2JGN 
_cell.length_a           44.438 
_cell.length_b           61.032 
_cell.length_c           89.111 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.67 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JGN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ATP-DEPENDENT RNA HELICASE DDX3X' 21172.598 3   3.6.1.- ? 'HELICASE DOMAIN, RESIDUES 408-579' ? 
2 water   nat water                              18.015    193 ?       ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DBX, DDX3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHENLYFQGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDR
SQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKD
LLDLLVEAKQEVPSWLENMAYEHHY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHENLYFQGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDR
SQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKD
LLDLLVEAKQEVPSWLENMAYEHHY
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   GLU n 
1 9   ASN n 
1 10  LEU n 
1 11  TYR n 
1 12  PHE n 
1 13  GLN n 
1 14  GLY n 
1 15  SER n 
1 16  THR n 
1 17  SER n 
1 18  GLU n 
1 19  ASN n 
1 20  ILE n 
1 21  THR n 
1 22  GLN n 
1 23  LYS n 
1 24  VAL n 
1 25  VAL n 
1 26  TRP n 
1 27  VAL n 
1 28  GLU n 
1 29  GLU n 
1 30  SER n 
1 31  ASP n 
1 32  LYS n 
1 33  ARG n 
1 34  SER n 
1 35  PHE n 
1 36  LEU n 
1 37  LEU n 
1 38  ASP n 
1 39  LEU n 
1 40  LEU n 
1 41  ASN n 
1 42  ALA n 
1 43  THR n 
1 44  GLY n 
1 45  LYS n 
1 46  ASP n 
1 47  SER n 
1 48  LEU n 
1 49  THR n 
1 50  LEU n 
1 51  VAL n 
1 52  PHE n 
1 53  VAL n 
1 54  GLU n 
1 55  THR n 
1 56  LYS n 
1 57  LYS n 
1 58  GLY n 
1 59  ALA n 
1 60  ASP n 
1 61  SER n 
1 62  LEU n 
1 63  GLU n 
1 64  ASP n 
1 65  PHE n 
1 66  LEU n 
1 67  TYR n 
1 68  HIS n 
1 69  GLU n 
1 70  GLY n 
1 71  TYR n 
1 72  ALA n 
1 73  CYS n 
1 74  THR n 
1 75  SER n 
1 76  ILE n 
1 77  HIS n 
1 78  GLY n 
1 79  ASP n 
1 80  ARG n 
1 81  SER n 
1 82  GLN n 
1 83  ARG n 
1 84  ASP n 
1 85  ARG n 
1 86  GLU n 
1 87  GLU n 
1 88  ALA n 
1 89  LEU n 
1 90  HIS n 
1 91  GLN n 
1 92  PHE n 
1 93  ARG n 
1 94  SER n 
1 95  GLY n 
1 96  LYS n 
1 97  SER n 
1 98  PRO n 
1 99  ILE n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 THR n 
1 104 ALA n 
1 105 VAL n 
1 106 ALA n 
1 107 ALA n 
1 108 ARG n 
1 109 GLY n 
1 110 LEU n 
1 111 ASP n 
1 112 ILE n 
1 113 SER n 
1 114 ASN n 
1 115 VAL n 
1 116 LYS n 
1 117 HIS n 
1 118 VAL n 
1 119 ILE n 
1 120 ASN n 
1 121 PHE n 
1 122 ASP n 
1 123 LEU n 
1 124 PRO n 
1 125 SER n 
1 126 ASP n 
1 127 ILE n 
1 128 GLU n 
1 129 GLU n 
1 130 TYR n 
1 131 VAL n 
1 132 HIS n 
1 133 ARG n 
1 134 ILE n 
1 135 GLY n 
1 136 ARG n 
1 137 THR n 
1 138 GLY n 
1 139 ARG n 
1 140 VAL n 
1 141 GLY n 
1 142 ASN n 
1 143 LEU n 
1 144 GLY n 
1 145 LEU n 
1 146 ALA n 
1 147 THR n 
1 148 SER n 
1 149 PHE n 
1 150 PHE n 
1 151 ASN n 
1 152 GLU n 
1 153 ARG n 
1 154 ASN n 
1 155 ILE n 
1 156 ASN n 
1 157 ILE n 
1 158 THR n 
1 159 LYS n 
1 160 ASP n 
1 161 LEU n 
1 162 LEU n 
1 163 ASP n 
1 164 LEU n 
1 165 LEU n 
1 166 VAL n 
1 167 GLU n 
1 168 ALA n 
1 169 LYS n 
1 170 GLN n 
1 171 GLU n 
1 172 VAL n 
1 173 PRO n 
1 174 SER n 
1 175 TRP n 
1 176 LEU n 
1 177 GLU n 
1 178 ASN n 
1 179 MET n 
1 180 ALA n 
1 181 TYR n 
1 182 GLU n 
1 183 HIS n 
1 184 HIS n 
1 185 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PCOLD III' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2JGN        1 ? ? 2JGN   ? 
2 UNP DDX3X_HUMAN 1 ? ? O00571 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JGN A 1  ? 13  ? 2JGN   395 ? 407 ? 395 407 
2 2 2JGN A 14 ? 185 ? O00571 408 ? 579 ? 408 579 
3 1 2JGN B 1  ? 13  ? 2JGN   395 ? 407 ? 395 407 
4 2 2JGN B 14 ? 185 ? O00571 408 ? 579 ? 408 579 
5 1 2JGN C 1  ? 13  ? 2JGN   395 ? 407 ? 395 407 
6 2 2JGN C 14 ? 185 ? O00571 408 ? 579 ? 408 579 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JGN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.04 
_exptl_crystal.density_percent_sol   34.0 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'RESERVOIR: 2M (NH4)2SO4, 0.1M IMIDAZOLE PH 6.4 PLUS 5MM SPERMINE TETRA-HCL PROTEIN: 10MM HEPES, 500MM (NH4)2SO4, PH 8.0.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON (1 1 1) CHANNEL- CUT' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             0.9 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JGN 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             87.00 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   105982 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.03 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   72.2 
_reflns_shell.Rmerge_I_obs           0.33 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.53 
_reflns_shell.pdbx_redundancy        2.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JGN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     32363 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.50 
_refine.ls_d_res_high                            1.91 
_refine.ls_percent_reflns_obs                    93.0 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.255 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1704 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.B_iso_mean                               27.07 
_refine.aniso_B[1][1]                            0.16000 
_refine.aniso_B[2][2]                            -0.28000 
_refine.aniso_B[3][3]                            0.06000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.16000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2DB3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.191 
_refine.pdbx_overall_ESU_R_Free                  0.176 
_refine.overall_SU_ML                            0.126 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.522 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3727 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             193 
_refine_hist.number_atoms_total               3920 
_refine_hist.d_res_high                       1.91 
_refine_hist.d_res_low                        34.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.022  ? 3781 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.682  1.951  ? 5104 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.037  5.000  ? 459  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.625 24.541 ? 185  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.069 15.000 ? 670  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.517 15.000 ? 24   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.119  0.200  ? 592  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 2805 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.227  0.200  ? 1687 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.312  0.200  ? 2577 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.181  0.200  ? 203  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.222  0.200  ? 62   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.251  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.209  1.500  ? 2400 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.889  2.000  ? 3734 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.122  3.000  ? 1571 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.791  4.500  ? 1370 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.91 
_refine_ls_shell.d_res_low                        1.96 
_refine_ls_shell.number_reflns_R_work             1757 
_refine_ls_shell.R_factor_R_work                  0.2020 
_refine_ls_shell.percent_reflns_obs               69.20 
_refine_ls_shell.R_factor_R_free                  0.2970 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2JGN 
_struct.title                     'DDX3 helicase domain' 
_struct.pdbx_descriptor           'ATP-DEPENDENT RNA HELICASE DDX3X (E.C.3.6.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JGN 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;PHOSPHORYLATION, NUCLEOTIDE-BINDING, HELICASE, HYDROLASE, RNA-BINDING, ATP-BINDING, DNA-BINDING, NUCLEAR PROTEIN, HOST-VIRUS INTERACTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 28  ? SER A 30  ? GLU A 422 SER A 424 5 ? 3  
HELX_P HELX_P2  2  ASP A 31  ? THR A 43  ? ASP A 425 THR A 437 1 ? 13 
HELX_P HELX_P3  3  THR A 55  ? GLU A 69  ? THR A 449 GLU A 463 1 ? 15 
HELX_P HELX_P4  4  GLU A 86  ? SER A 94  ? GLU A 480 SER A 488 1 ? 9  
HELX_P HELX_P5  5  ASP A 126 ? GLY A 135 ? ASP A 520 GLY A 529 1 ? 10 
HELX_P HELX_P6  6  ASN A 151 ? ASN A 156 ? ASN A 545 ASN A 550 5 ? 6  
HELX_P HELX_P7  7  ILE A 157 ? ALA A 168 ? ILE A 551 ALA A 562 1 ? 12 
HELX_P HELX_P8  8  PRO A 173 ? TYR A 181 ? PRO A 567 TYR A 575 1 ? 9  
HELX_P HELX_P9  9  GLU B 28  ? SER B 30  ? GLU B 422 SER B 424 5 ? 3  
HELX_P HELX_P10 10 ASP B 31  ? GLY B 44  ? ASP B 425 GLY B 438 1 ? 14 
HELX_P HELX_P11 11 THR B 55  ? GLU B 69  ? THR B 449 GLU B 463 1 ? 15 
HELX_P HELX_P12 12 SER B 81  ? SER B 94  ? SER B 475 SER B 488 1 ? 14 
HELX_P HELX_P13 13 ASP B 126 ? GLY B 135 ? ASP B 520 GLY B 529 1 ? 10 
HELX_P HELX_P14 14 ASN B 151 ? ASN B 156 ? ASN B 545 ASN B 550 5 ? 6  
HELX_P HELX_P15 15 ILE B 157 ? ALA B 168 ? ILE B 551 ALA B 562 1 ? 12 
HELX_P HELX_P16 16 PRO B 173 ? TYR B 181 ? PRO B 567 TYR B 575 1 ? 9  
HELX_P HELX_P17 17 GLU C 28  ? SER C 30  ? GLU C 422 SER C 424 5 ? 3  
HELX_P HELX_P18 18 ASP C 31  ? ASN C 41  ? ASP C 425 ASN C 435 1 ? 11 
HELX_P HELX_P19 19 THR C 55  ? GLU C 69  ? THR C 449 GLU C 463 1 ? 15 
HELX_P HELX_P20 20 ARG C 85  ? SER C 94  ? ARG C 479 SER C 488 1 ? 10 
HELX_P HELX_P21 21 ASP C 126 ? GLY C 135 ? ASP C 520 GLY C 529 1 ? 10 
HELX_P HELX_P22 22 ASN C 151 ? ASN C 156 ? ASN C 545 ASN C 550 5 ? 6  
HELX_P HELX_P23 23 ILE C 157 ? ALA C 168 ? ILE C 551 ALA C 562 1 ? 12 
HELX_P HELX_P24 24 PRO C 173 ? ALA C 180 ? PRO C 567 ALA C 574 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
BA ? 6 ? 
CA ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel 
AA 2 3 ? parallel 
AA 3 4 ? parallel 
AA 4 5 ? parallel 
AA 5 6 ? parallel 
BA 1 2 ? parallel 
BA 2 3 ? parallel 
BA 3 4 ? parallel 
BA 4 5 ? parallel 
BA 5 6 ? parallel 
CA 1 2 ? parallel 
CA 2 3 ? parallel 
CA 3 4 ? parallel 
CA 4 5 ? parallel 
CA 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 20  ? TRP A 26  ? ILE A 414 TRP A 420 
AA 2 GLY A 144 ? PHE A 150 ? GLY A 538 PHE A 544 
AA 3 HIS A 117 ? ASN A 120 ? HIS A 511 ASN A 514 
AA 4 THR A 49  ? VAL A 53  ? THR A 443 VAL A 447 
AA 5 ILE A 99  ? THR A 103 ? ILE A 493 THR A 497 
AA 6 CYS A 73  ? ILE A 76  ? CYS A 467 ILE A 470 
BA 1 ILE B 20  ? TRP B 26  ? ILE B 414 TRP B 420 
BA 2 GLY B 144 ? PHE B 150 ? GLY B 538 PHE B 544 
BA 3 HIS B 117 ? ASN B 120 ? HIS B 511 ASN B 514 
BA 4 THR B 49  ? VAL B 53  ? THR B 443 VAL B 447 
BA 5 ILE B 99  ? THR B 103 ? ILE B 493 THR B 497 
BA 6 CYS B 73  ? ILE B 76  ? CYS B 467 ILE B 470 
CA 1 ILE C 20  ? TRP C 26  ? ILE C 414 TRP C 420 
CA 2 GLY C 144 ? PHE C 150 ? GLY C 538 PHE C 544 
CA 3 HIS C 117 ? ASN C 120 ? HIS C 511 ASN C 514 
CA 4 THR C 49  ? VAL C 53  ? THR C 443 VAL C 447 
CA 5 ILE C 99  ? THR C 103 ? ILE C 493 THR C 497 
CA 6 CYS C 73  ? ILE C 76  ? CYS C 467 ILE C 470 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 21  ? N THR A 415 O GLY A 144 ? O GLY A 538 
AA 2 3 N THR A 147 ? N THR A 541 O VAL A 118 ? O VAL A 512 
AA 3 4 N ILE A 119 ? N ILE A 513 O LEU A 50  ? O LEU A 444 
AA 4 5 N VAL A 51  ? N VAL A 445 O LEU A 100 ? O LEU A 494 
AA 5 6 N VAL A 101 ? N VAL A 495 O THR A 74  ? O THR A 468 
BA 1 2 N THR B 21  ? N THR B 415 O GLY B 144 ? O GLY B 538 
BA 2 3 N THR B 147 ? N THR B 541 O VAL B 118 ? O VAL B 512 
BA 3 4 N ILE B 119 ? N ILE B 513 O LEU B 50  ? O LEU B 444 
BA 4 5 N VAL B 51  ? N VAL B 445 O LEU B 100 ? O LEU B 494 
BA 5 6 N VAL B 101 ? N VAL B 495 O THR B 74  ? O THR B 468 
CA 1 2 N THR C 21  ? N THR C 415 O GLY C 144 ? O GLY C 538 
CA 2 3 N THR C 147 ? N THR C 541 O VAL C 118 ? O VAL C 512 
CA 3 4 N ILE C 119 ? N ILE C 513 O LEU C 50  ? O LEU C 444 
CA 4 5 N VAL C 51  ? N VAL C 445 O LEU C 100 ? O LEU C 494 
CA 5 6 N VAL C 101 ? N VAL C 495 O THR C 74  ? O THR C 468 
# 
_database_PDB_matrix.entry_id          2JGN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JGN 
_atom_sites.fract_transf_matrix[1][1]   0.022503 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004648 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016385 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011459 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 16  ? 5.569   13.882 78.212  1.00 37.39 ? 410  THR A N   1 
ATOM   2    C CA  . THR A 1 16  ? 4.705   14.879 77.489  1.00 36.82 ? 410  THR A CA  1 
ATOM   3    C C   . THR A 1 16  ? 5.601   15.664 76.547  1.00 35.56 ? 410  THR A C   1 
ATOM   4    O O   . THR A 1 16  ? 6.796   15.796 76.788  1.00 37.13 ? 410  THR A O   1 
ATOM   5    C CB  . THR A 1 16  ? 3.922   15.834 78.454  1.00 37.22 ? 410  THR A CB  1 
ATOM   6    O OG1 . THR A 1 16  ? 2.962   15.076 79.218  1.00 39.84 ? 410  THR A OG1 1 
ATOM   7    C CG2 . THR A 1 16  ? 3.138   16.881 77.670  1.00 38.60 ? 410  THR A CG2 1 
ATOM   8    N N   . SER A 1 17  ? 5.019   16.207 75.486  1.00 33.52 ? 411  SER A N   1 
ATOM   9    C CA  . SER A 1 17  ? 5.804   16.572 74.300  1.00 30.18 ? 411  SER A CA  1 
ATOM   10   C C   . SER A 1 17  ? 5.770   18.071 73.990  1.00 27.41 ? 411  SER A C   1 
ATOM   11   O O   . SER A 1 17  ? 5.772   18.444 72.834  1.00 27.13 ? 411  SER A O   1 
ATOM   12   C CB  . SER A 1 17  ? 5.241   15.776 73.128  1.00 30.70 ? 411  SER A CB  1 
ATOM   13   O OG  . SER A 1 17  ? 3.874   16.145 72.878  1.00 32.54 ? 411  SER A OG  1 
ATOM   14   N N   . GLU A 1 18  ? 5.732   18.934 75.004  1.00 25.10 ? 412  GLU A N   1 
ATOM   15   C CA  . GLU A 1 18  ? 5.677   20.388 74.770  1.00 24.22 ? 412  GLU A CA  1 
ATOM   16   C C   . GLU A 1 18  ? 6.864   20.849 73.931  1.00 23.14 ? 412  GLU A C   1 
ATOM   17   O O   . GLU A 1 18  ? 6.714   21.781 73.153  1.00 24.53 ? 412  GLU A O   1 
ATOM   18   C CB  . GLU A 1 18  ? 5.763   21.181 76.077  1.00 24.45 ? 412  GLU A CB  1 
ATOM   19   C CG  . GLU A 1 18  ? 4.491   21.100 76.888  1.00 27.16 ? 412  GLU A CG  1 
ATOM   20   C CD  . GLU A 1 18  ? 4.510   19.945 77.869  1.00 30.19 ? 412  GLU A CD  1 
ATOM   21   O OE1 . GLU A 1 18  ? 5.408   19.088 77.743  1.00 29.00 ? 412  GLU A OE1 1 
ATOM   22   O OE2 . GLU A 1 18  ? 3.634   19.909 78.787  1.00 30.53 ? 412  GLU A OE2 1 
ATOM   23   N N   . ASN A 1 19  ? 7.996   20.164 74.062  1.00 21.94 ? 413  ASN A N   1 
ATOM   24   C CA  . ASN A 1 19  ? 9.260   20.569 73.349  1.00 22.06 ? 413  ASN A CA  1 
ATOM   25   C C   . ASN A 1 19  ? 9.426   19.983 71.941  1.00 22.20 ? 413  ASN A C   1 
ATOM   26   O O   . ASN A 1 19  ? 10.515  20.001 71.334  1.00 23.23 ? 413  ASN A O   1 
ATOM   27   C CB  . ASN A 1 19  ? 10.484  20.349 74.244  1.00 21.91 ? 413  ASN A CB  1 
ATOM   28   C CG  . ASN A 1 19  ? 10.399  21.157 75.488  1.00 21.20 ? 413  ASN A CG  1 
ATOM   29   O OD1 . ASN A 1 19  ? 10.057  22.323 75.411  1.00 18.24 ? 413  ASN A OD1 1 
ATOM   30   N ND2 . ASN A 1 19  ? 10.608  20.529 76.665  1.00 18.56 ? 413  ASN A ND2 1 
ATOM   31   N N   . ILE A 1 20  ? 8.319   19.487 71.407  1.00 21.91 ? 414  ILE A N   1 
ATOM   32   C CA  . ILE A 1 20  ? 8.200   19.110 70.007  1.00 22.81 ? 414  ILE A CA  1 
ATOM   33   C C   . ILE A 1 20  ? 7.095   19.876 69.395  1.00 22.49 ? 414  ILE A C   1 
ATOM   34   O O   . ILE A 1 20  ? 5.929   19.665 69.727  1.00 23.18 ? 414  ILE A O   1 
ATOM   35   C CB  . ILE A 1 20  ? 7.910   17.611 69.833  1.00 23.37 ? 414  ILE A CB  1 
ATOM   36   C CG1 . ILE A 1 20  ? 9.004   16.785 70.541  1.00 23.40 ? 414  ILE A CG1 1 
ATOM   37   C CG2 . ILE A 1 20  ? 7.822   17.217 68.326  1.00 25.74 ? 414  ILE A CG2 1 
ATOM   38   C CD1 . ILE A 1 20  ? 8.594   15.330 70.790  1.00 27.30 ? 414  ILE A CD1 1 
ATOM   39   N N   . THR A 1 21  ? 7.430   20.755 68.461  1.00 22.67 ? 415  THR A N   1 
ATOM   40   C CA  . THR A 1 21  ? 6.378   21.538 67.763  1.00 23.72 ? 415  THR A CA  1 
ATOM   41   C C   . THR A 1 21  ? 5.623   20.581 66.844  1.00 23.36 ? 415  THR A C   1 
ATOM   42   O O   . THR A 1 21  ? 6.234   19.889 66.044  1.00 22.14 ? 415  THR A O   1 
ATOM   43   C CB  . THR A 1 21  ? 7.055   22.712 66.992  1.00 26.31 ? 415  THR A CB  1 
ATOM   44   O OG1 . THR A 1 21  ? 7.676   23.534 67.995  1.00 28.02 ? 415  THR A OG1 1 
ATOM   45   C CG2 . THR A 1 21  ? 6.060   23.556 66.078  1.00 24.63 ? 415  THR A CG2 1 
ATOM   46   N N   . GLN A 1 22  ? 4.303   20.527 66.969  1.00 22.31 ? 416  GLN A N   1 
ATOM   47   C CA  . GLN A 1 22  ? 3.528   19.581 66.197  1.00 21.92 ? 416  GLN A CA  1 
ATOM   48   C C   . GLN A 1 22  ? 2.505   20.281 65.345  1.00 23.99 ? 416  GLN A C   1 
ATOM   49   O O   . GLN A 1 22  ? 1.693   21.107 65.870  1.00 23.71 ? 416  GLN A O   1 
ATOM   50   C CB  . GLN A 1 22  ? 2.818   18.613 67.150  1.00 22.05 ? 416  GLN A CB  1 
ATOM   51   C CG  . GLN A 1 22  ? 3.816   17.846 68.016  1.00 24.46 ? 416  GLN A CG  1 
ATOM   52   C CD  . GLN A 1 22  ? 3.186   17.243 69.284  1.00 25.21 ? 416  GLN A CD  1 
ATOM   53   O OE1 . GLN A 1 22  ? 2.229   16.468 69.225  1.00 25.49 ? 416  GLN A OE1 1 
ATOM   54   N NE2 . GLN A 1 22  ? 3.764   17.548 70.408  1.00 24.89 ? 416  GLN A NE2 1 
ATOM   55   N N   . LYS A 1 23  ? 2.549   19.983 64.046  1.00 25.14 ? 417  LYS A N   1 
ATOM   56   C CA  . LYS A 1 23  ? 1.701   20.639 63.090  1.00 26.66 ? 417  LYS A CA  1 
ATOM   57   C C   . LYS A 1 23  ? 0.842   19.521 62.486  1.00 26.66 ? 417  LYS A C   1 
ATOM   58   O O   . LYS A 1 23  ? 1.343   18.620 61.866  1.00 26.56 ? 417  LYS A O   1 
ATOM   59   C CB  . LYS A 1 23  ? 2.558   21.284 62.006  1.00 28.71 ? 417  LYS A CB  1 
ATOM   60   C CG  . LYS A 1 23  ? 3.539   22.400 62.475  1.00 29.71 ? 417  LYS A CG  1 
ATOM   61   C CD  . LYS A 1 23  ? 2.727   23.527 63.137  1.00 36.91 ? 417  LYS A CD  1 
ATOM   62   C CE  . LYS A 1 23  ? 3.324   24.891 62.804  1.00 45.02 ? 417  LYS A CE  1 
ATOM   63   N NZ  . LYS A 1 23  ? 4.796   24.901 62.954  1.00 48.38 ? 417  LYS A NZ  1 
ATOM   64   N N   . VAL A 1 24  ? -0.442  19.556 62.699  1.00 24.53 ? 418  VAL A N   1 
ATOM   65   C CA  . VAL A 1 24  ? -1.306  18.472 62.233  1.00 23.70 ? 418  VAL A CA  1 
ATOM   66   C C   . VAL A 1 24  ? -2.077  19.121 61.116  1.00 23.94 ? 418  VAL A C   1 
ATOM   67   O O   . VAL A 1 24  ? -2.833  20.110 61.326  1.00 23.77 ? 418  VAL A O   1 
ATOM   68   C CB  . VAL A 1 24  ? -2.301  18.009 63.338  1.00 25.74 ? 418  VAL A CB  1 
ATOM   69   C CG1 . VAL A 1 24  ? -3.335  17.044 62.749  1.00 26.20 ? 418  VAL A CG1 1 
ATOM   70   C CG2 . VAL A 1 24  ? -1.562  17.348 64.546  1.00 23.91 ? 418  VAL A CG2 1 
ATOM   71   N N   . VAL A 1 25  ? -1.934  18.597 59.917  1.00 21.80 ? 419  VAL A N   1 
ATOM   72   C CA  . VAL A 1 25  ? -2.592  19.221 58.786  1.00 22.63 ? 419  VAL A CA  1 
ATOM   73   C C   . VAL A 1 25  ? -3.512  18.254 58.021  1.00 22.56 ? 419  VAL A C   1 
ATOM   74   O O   . VAL A 1 25  ? -3.265  17.033 57.996  1.00 23.72 ? 419  VAL A O   1 
ATOM   75   C CB  . VAL A 1 25  ? -1.503  19.835 57.830  1.00 22.28 ? 419  VAL A CB  1 
ATOM   76   C CG1 . VAL A 1 25  ? -0.961  21.140 58.422  1.00 25.96 ? 419  VAL A CG1 1 
ATOM   77   C CG2 . VAL A 1 25  ? -0.386  18.833 57.565  1.00 22.68 ? 419  VAL A CG2 1 
ATOM   78   N N   . TRP A 1 26  ? -4.579  18.756 57.409  1.00 21.93 ? 420  TRP A N   1 
ATOM   79   C CA  . TRP A 1 26  ? -5.502  17.886 56.665  1.00 21.88 ? 420  TRP A CA  1 
ATOM   80   C C   . TRP A 1 26  ? -4.955  17.616 55.263  1.00 21.89 ? 420  TRP A C   1 
ATOM   81   O O   . TRP A 1 26  ? -4.621  18.562 54.558  1.00 23.15 ? 420  TRP A O   1 
ATOM   82   C CB  . TRP A 1 26  ? -6.881  18.532 56.539  1.00 21.56 ? 420  TRP A CB  1 
ATOM   83   C CG  . TRP A 1 26  ? -7.907  17.629 55.936  1.00 23.42 ? 420  TRP A CG  1 
ATOM   84   C CD1 . TRP A 1 26  ? -8.204  17.454 54.602  1.00 20.36 ? 420  TRP A CD1 1 
ATOM   85   C CD2 . TRP A 1 26  ? -8.809  16.770 56.667  1.00 21.17 ? 420  TRP A CD2 1 
ATOM   86   N NE1 . TRP A 1 26  ? -9.202  16.505 54.482  1.00 19.17 ? 420  TRP A NE1 1 
ATOM   87   C CE2 . TRP A 1 26  ? -9.579  16.075 55.724  1.00 23.72 ? 420  TRP A CE2 1 
ATOM   88   C CE3 . TRP A 1 26  ? -8.997  16.499 58.026  1.00 23.31 ? 420  TRP A CE3 1 
ATOM   89   C CZ2 . TRP A 1 26  ? -10.563 15.146 56.100  1.00 21.30 ? 420  TRP A CZ2 1 
ATOM   90   C CZ3 . TRP A 1 26  ? -9.946  15.523 58.408  1.00 19.95 ? 420  TRP A CZ3 1 
ATOM   91   C CH2 . TRP A 1 26  ? -10.737 14.899 57.448  1.00 23.66 ? 420  TRP A CH2 1 
ATOM   92   N N   . VAL A 1 27  ? -4.791  16.335 54.902  1.00 22.50 ? 421  VAL A N   1 
ATOM   93   C CA  . VAL A 1 27  ? -4.294  15.971 53.577  1.00 22.81 ? 421  VAL A CA  1 
ATOM   94   C C   . VAL A 1 27  ? -5.065  14.749 53.098  1.00 23.13 ? 421  VAL A C   1 
ATOM   95   O O   . VAL A 1 27  ? -4.962  13.659 53.710  1.00 24.14 ? 421  VAL A O   1 
ATOM   96   C CB  . VAL A 1 27  ? -2.771  15.626 53.595  1.00 21.78 ? 421  VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 27  ? -2.207  15.627 52.160  1.00 24.06 ? 421  VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 27  ? -1.973  16.675 54.400  1.00 22.56 ? 421  VAL A CG2 1 
ATOM   99   N N   . GLU A 1 28  ? -5.789  14.894 51.986  1.00 23.78 ? 422  GLU A N   1 
ATOM   100  C CA  . GLU A 1 28  ? -6.479  13.750 51.370  1.00 25.00 ? 422  GLU A CA  1 
ATOM   101  C C   . GLU A 1 28  ? -5.467  12.738 50.829  1.00 25.80 ? 422  GLU A C   1 
ATOM   102  O O   . GLU A 1 28  ? -4.394  13.136 50.335  1.00 26.22 ? 422  GLU A O   1 
ATOM   103  C CB  . GLU A 1 28  ? -7.323  14.252 50.212  1.00 25.10 ? 422  GLU A CB  1 
ATOM   104  C CG  . GLU A 1 28  ? -8.432  15.242 50.625  1.00 27.11 ? 422  GLU A CG  1 
ATOM   105  C CD  . GLU A 1 28  ? -9.501  14.626 51.504  1.00 32.26 ? 422  GLU A CD  1 
ATOM   106  O OE1 . GLU A 1 28  ? -9.673  13.392 51.477  1.00 33.94 ? 422  GLU A OE1 1 
ATOM   107  O OE2 . GLU A 1 28  ? -10.173 15.386 52.250  1.00 31.92 ? 422  GLU A OE2 1 
ATOM   108  N N   . GLU A 1 29  ? -5.814  11.443 50.852  1.00 27.12 ? 423  GLU A N   1 
ATOM   109  C CA  . GLU A 1 29  ? -4.837  10.419 50.421  1.00 27.71 ? 423  GLU A CA  1 
ATOM   110  C C   . GLU A 1 29  ? -4.188  10.778 49.102  1.00 27.89 ? 423  GLU A C   1 
ATOM   111  O O   . GLU A 1 29  ? -2.970  10.651 48.974  1.00 28.20 ? 423  GLU A O   1 
ATOM   112  C CB  . GLU A 1 29  ? -5.487  9.048  50.269  1.00 28.42 ? 423  GLU A CB  1 
ATOM   113  C CG  . GLU A 1 29  ? -5.781  8.362  51.558  1.00 30.85 ? 423  GLU A CG  1 
ATOM   114  C CD  . GLU A 1 29  ? -4.504  8.060  52.306  1.00 33.14 ? 423  GLU A CD  1 
ATOM   115  O OE1 . GLU A 1 29  ? -3.690  7.221  51.815  1.00 35.70 ? 423  GLU A OE1 1 
ATOM   116  O OE2 . GLU A 1 29  ? -4.314  8.671  53.373  1.00 29.17 ? 423  GLU A OE2 1 
ATOM   117  N N   . SER A 1 30  ? -4.990  11.213 48.127  1.00 26.36 ? 424  SER A N   1 
ATOM   118  C CA  . SER A 1 30  ? -4.495  11.448 46.775  1.00 27.56 ? 424  SER A CA  1 
ATOM   119  C C   . SER A 1 30  ? -3.583  12.681 46.708  1.00 26.90 ? 424  SER A C   1 
ATOM   120  O O   . SER A 1 30  ? -2.880  12.871 45.722  1.00 25.54 ? 424  SER A O   1 
ATOM   121  C CB  . SER A 1 30  ? -5.673  11.616 45.791  1.00 27.74 ? 424  SER A CB  1 
ATOM   122  O OG  . SER A 1 30  ? -6.337  12.842 46.043  1.00 30.14 ? 424  SER A OG  1 
ATOM   123  N N   . ASP A 1 31  ? -3.615  13.507 47.763  1.00 27.46 ? 425  ASP A N   1 
ATOM   124  C CA  . ASP A 1 31  ? -2.805  14.735 47.874  1.00 26.93 ? 425  ASP A CA  1 
ATOM   125  C C   . ASP A 1 31  ? -1.527  14.548 48.649  1.00 26.51 ? 425  ASP A C   1 
ATOM   126  O O   . ASP A 1 31  ? -0.672  15.398 48.542  1.00 26.88 ? 425  ASP A O   1 
ATOM   127  C CB  . ASP A 1 31  ? -3.542  15.897 48.576  1.00 27.50 ? 425  ASP A CB  1 
ATOM   128  C CG  . ASP A 1 31  ? -4.492  16.674 47.653  1.00 30.24 ? 425  ASP A CG  1 
ATOM   129  O OD1 . ASP A 1 31  ? -4.235  16.720 46.421  1.00 31.96 ? 425  ASP A OD1 1 
ATOM   130  O OD2 . ASP A 1 31  ? -5.512  17.235 48.178  1.00 31.55 ? 425  ASP A OD2 1 
ATOM   131  N N   . LYS A 1 32  ? -1.364  13.426 49.358  1.00 25.62 ? 426  LYS A N   1 
ATOM   132  C CA  . LYS A 1 32  ? -0.226  13.266 50.297  1.00 24.56 ? 426  LYS A CA  1 
ATOM   133  C C   . LYS A 1 32  ? 1.118   13.374 49.588  1.00 23.39 ? 426  LYS A C   1 
ATOM   134  O O   . LYS A 1 32  ? 2.014   13.960 50.092  1.00 23.26 ? 426  LYS A O   1 
ATOM   135  C CB  . LYS A 1 32  ? -0.315  11.952 51.064  1.00 24.14 ? 426  LYS A CB  1 
ATOM   136  C CG  . LYS A 1 32  ? -1.442  11.958 52.131  1.00 24.02 ? 426  LYS A CG  1 
ATOM   137  C CD  . LYS A 1 32  ? -1.487  10.671 52.898  1.00 19.33 ? 426  LYS A CD  1 
ATOM   138  C CE  . LYS A 1 32  ? -2.266  10.878 54.225  1.00 25.04 ? 426  LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 32  ? -2.362  9.517  54.930  1.00 23.36 ? 426  LYS A NZ  1 
ATOM   140  N N   . ARG A 1 33  ? 1.249   12.796 48.402  1.00 23.73 ? 427  ARG A N   1 
ATOM   141  C CA  . ARG A 1 33  ? 2.547   12.828 47.770  1.00 22.85 ? 427  ARG A CA  1 
ATOM   142  C C   . ARG A 1 33  ? 2.963   14.238 47.330  1.00 23.26 ? 427  ARG A C   1 
ATOM   143  O O   . ARG A 1 33  ? 4.091   14.589 47.574  1.00 23.95 ? 427  ARG A O   1 
ATOM   144  C CB  . ARG A 1 33  ? 2.645   11.801 46.608  1.00 22.46 ? 427  ARG A CB  1 
ATOM   145  C CG  . ARG A 1 33  ? 2.597   10.374 47.025  1.00 21.03 ? 427  ARG A CG  1 
ATOM   146  C CD  . ARG A 1 33  ? 2.692   9.505  45.831  1.00 20.70 ? 427  ARG A CD  1 
ATOM   147  N NE  . ARG A 1 33  ? 2.987   8.134  46.184  1.00 19.54 ? 427  ARG A NE  1 
ATOM   148  C CZ  . ARG A 1 33  ? 3.341   7.218  45.300  1.00 18.10 ? 427  ARG A CZ  1 
ATOM   149  N NH1 . ARG A 1 33  ? 3.397   7.531  44.023  1.00 16.15 ? 427  ARG A NH1 1 
ATOM   150  N NH2 . ARG A 1 33  ? 3.572   5.981  45.682  1.00 22.09 ? 427  ARG A NH2 1 
ATOM   151  N N   . SER A 1 34  ? 2.088   15.030 46.681  1.00 25.18 ? 428  SER A N   1 
ATOM   152  C CA  . SER A 1 34  ? 2.494   16.412 46.285  1.00 27.00 ? 428  SER A CA  1 
ATOM   153  C C   . SER A 1 34  ? 2.589   17.349 47.476  1.00 27.20 ? 428  SER A C   1 
ATOM   154  O O   . SER A 1 34  ? 3.486   18.196 47.501  1.00 26.65 ? 428  SER A O   1 
ATOM   155  C CB  . SER A 1 34  ? 1.650   17.055 45.154  1.00 27.79 ? 428  SER A CB  1 
ATOM   156  O OG  . SER A 1 34  ? 0.277   17.064 45.474  1.00 32.00 ? 428  SER A OG  1 
ATOM   157  N N   . PHE A 1 35  ? 1.766   17.115 48.499  1.00 25.00 ? 429  PHE A N   1 
ATOM   158  C CA  . PHE A 1 35  ? 1.868   17.877 49.750  1.00 26.59 ? 429  PHE A CA  1 
ATOM   159  C C   . PHE A 1 35  ? 3.237   17.599 50.429  1.00 26.63 ? 429  PHE A C   1 
ATOM   160  O O   . PHE A 1 35  ? 3.875   18.501 50.976  1.00 25.43 ? 429  PHE A O   1 
ATOM   161  C CB  . PHE A 1 35  ? 0.701   17.471 50.688  1.00 28.04 ? 429  PHE A CB  1 
ATOM   162  C CG  . PHE A 1 35  ? 0.491   18.413 51.832  1.00 28.56 ? 429  PHE A CG  1 
ATOM   163  C CD1 . PHE A 1 35  ? -0.535  19.343 51.783  1.00 31.19 ? 429  PHE A CD1 1 
ATOM   164  C CD2 . PHE A 1 35  ? 1.343   18.388 52.947  1.00 32.64 ? 429  PHE A CD2 1 
ATOM   165  C CE1 . PHE A 1 35  ? -0.763  20.241 52.882  1.00 31.19 ? 429  PHE A CE1 1 
ATOM   166  C CE2 . PHE A 1 35  ? 1.143   19.237 54.023  1.00 30.36 ? 429  PHE A CE2 1 
ATOM   167  C CZ  . PHE A 1 35  ? 0.086   20.155 54.000  1.00 33.09 ? 429  PHE A CZ  1 
ATOM   168  N N   . LEU A 1 36  ? 3.715   16.357 50.328  1.00 26.75 ? 430  LEU A N   1 
ATOM   169  C CA  . LEU A 1 36  ? 5.026   15.997 50.894  1.00 25.56 ? 430  LEU A CA  1 
ATOM   170  C C   . LEU A 1 36  ? 6.136   16.730 50.172  1.00 25.98 ? 430  LEU A C   1 
ATOM   171  O O   . LEU A 1 36  ? 7.026   17.254 50.819  1.00 27.22 ? 430  LEU A O   1 
ATOM   172  C CB  . LEU A 1 36  ? 5.268   14.478 50.869  1.00 23.45 ? 430  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 36  ? 6.701   14.047 51.307  1.00 25.79 ? 430  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 36  ? 6.914   14.331 52.796  1.00 23.79 ? 430  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 36  ? 6.914   12.565 50.965  1.00 24.66 ? 430  LEU A CD2 1 
ATOM   176  N N   . LEU A 1 37  ? 6.067   16.806 48.842  1.00 26.22 ? 431  LEU A N   1 
ATOM   177  C CA  . LEU A 1 37  ? 7.052   17.575 48.094  1.00 26.20 ? 431  LEU A CA  1 
ATOM   178  C C   . LEU A 1 37  ? 7.032   19.077 48.465  1.00 26.51 ? 431  LEU A C   1 
ATOM   179  O O   . LEU A 1 37  ? 8.070   19.640 48.720  1.00 26.06 ? 431  LEU A O   1 
ATOM   180  C CB  . LEU A 1 37  ? 6.825   17.414 46.608  1.00 26.28 ? 431  LEU A CB  1 
ATOM   181  C CG  . LEU A 1 37  ? 6.980   15.992 46.093  1.00 23.44 ? 431  LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 37  ? 6.623   16.055 44.585  1.00 27.17 ? 431  LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 37  ? 8.421   15.533 46.350  1.00 28.34 ? 431  LEU A CD2 1 
ATOM   184  N N   . ASP A 1 38  ? 5.864   19.714 48.501  1.00 27.03 ? 432  ASP A N   1 
ATOM   185  C CA  . ASP A 1 38  ? 5.765   21.108 48.997  1.00 27.67 ? 432  ASP A CA  1 
ATOM   186  C C   . ASP A 1 38  ? 6.270   21.264 50.415  1.00 28.29 ? 432  ASP A C   1 
ATOM   187  O O   . ASP A 1 38  ? 6.921   22.256 50.717  1.00 28.83 ? 432  ASP A O   1 
ATOM   188  C CB  . ASP A 1 38  ? 4.332   21.680 48.937  1.00 28.98 ? 432  ASP A CB  1 
ATOM   189  C CG  . ASP A 1 38  ? 3.753   21.690 47.525  1.00 34.04 ? 432  ASP A CG  1 
ATOM   190  O OD1 . ASP A 1 38  ? 4.552   21.680 46.571  1.00 33.42 ? 432  ASP A OD1 1 
ATOM   191  O OD2 . ASP A 1 38  ? 2.504   21.693 47.370  1.00 36.57 ? 432  ASP A OD2 1 
ATOM   192  N N   . LEU A 1 39  ? 5.983   20.295 51.291  1.00 27.14 ? 433  LEU A N   1 
ATOM   193  C CA  . LEU A 1 39  ? 6.422   20.393 52.664  1.00 26.81 ? 433  LEU A CA  1 
ATOM   194  C C   . LEU A 1 39  ? 7.945   20.301 52.762  1.00 28.03 ? 433  LEU A C   1 
ATOM   195  O O   . LEU A 1 39  ? 8.588   21.017 53.534  1.00 28.19 ? 433  LEU A O   1 
ATOM   196  C CB  . LEU A 1 39  ? 5.758   19.276 53.512  1.00 27.82 ? 433  LEU A CB  1 
ATOM   197  C CG  . LEU A 1 39  ? 6.128   19.175 54.995  1.00 27.59 ? 433  LEU A CG  1 
ATOM   198  C CD1 . LEU A 1 39  ? 5.591   20.393 55.736  1.00 25.30 ? 433  LEU A CD1 1 
ATOM   199  C CD2 . LEU A 1 39  ? 5.465   17.941 55.545  1.00 25.89 ? 433  LEU A CD2 1 
ATOM   200  N N   . LEU A 1 40  ? 8.527   19.448 51.944  1.00 28.66 ? 434  LEU A N   1 
ATOM   201  C CA  . LEU A 1 40  ? 9.930   19.162 52.080  1.00 29.38 ? 434  LEU A CA  1 
ATOM   202  C C   . LEU A 1 40  ? 10.701  20.433 51.657  1.00 30.09 ? 434  LEU A C   1 
ATOM   203  O O   . LEU A 1 40  ? 11.715  20.815 52.295  1.00 29.55 ? 434  LEU A O   1 
ATOM   204  C CB  . LEU A 1 40  ? 10.321  17.957 51.179  1.00 29.93 ? 434  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 40  ? 10.097  16.508 51.692  1.00 31.03 ? 434  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 40  ? 10.330  15.483 50.535  1.00 27.46 ? 434  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 40  ? 11.055  16.175 52.837  1.00 29.03 ? 434  LEU A CD2 1 
ATOM   208  N N   . ASN A 1 41  ? 10.225  21.022 50.554  1.00 29.67 ? 435  ASN A N   1 
ATOM   209  C CA  . ASN A 1 41  ? 10.738  22.268 50.000  1.00 32.11 ? 435  ASN A CA  1 
ATOM   210  C C   . ASN A 1 41  ? 10.557  23.428 50.967  1.00 32.64 ? 435  ASN A C   1 
ATOM   211  O O   . ASN A 1 41  ? 11.448  24.260 51.121  1.00 33.47 ? 435  ASN A O   1 
ATOM   212  C CB  . ASN A 1 41  ? 10.001  22.589 48.704  1.00 32.22 ? 435  ASN A CB  1 
ATOM   213  C CG  . ASN A 1 41  ? 10.445  21.723 47.574  1.00 35.47 ? 435  ASN A CG  1 
ATOM   214  O OD1 . ASN A 1 41  ? 9.839   21.735 46.505  1.00 40.51 ? 435  ASN A OD1 1 
ATOM   215  N ND2 . ASN A 1 41  ? 11.537  20.974 47.781  1.00 35.57 ? 435  ASN A ND2 1 
ATOM   216  N N   . ALA A 1 42  ? 9.382   23.469 51.580  1.00 32.12 ? 436  ALA A N   1 
ATOM   217  C CA  . ALA A 1 42  ? 8.998   24.473 52.593  1.00 32.64 ? 436  ALA A CA  1 
ATOM   218  C C   . ALA A 1 42  ? 9.843   24.373 53.823  1.00 32.50 ? 436  ALA A C   1 
ATOM   219  O O   . ALA A 1 42  ? 10.289  25.369 54.355  1.00 32.91 ? 436  ALA A O   1 
ATOM   220  C CB  . ALA A 1 42  ? 7.517   24.280 53.023  1.00 31.63 ? 436  ALA A CB  1 
ATOM   221  N N   . THR A 1 43  ? 10.014  23.165 54.318  1.00 32.82 ? 437  THR A N   1 
ATOM   222  C CA  . THR A 1 43  ? 10.746  23.001 55.567  1.00 33.56 ? 437  THR A CA  1 
ATOM   223  C C   . THR A 1 43  ? 12.255  23.195 55.263  1.00 34.37 ? 437  THR A C   1 
ATOM   224  O O   . THR A 1 43  ? 12.972  23.806 56.071  1.00 35.68 ? 437  THR A O   1 
ATOM   225  C CB  . THR A 1 43  ? 10.412  21.644 56.173  1.00 33.23 ? 437  THR A CB  1 
ATOM   226  O OG1 . THR A 1 43  ? 8.969   21.480 56.150  1.00 32.79 ? 437  THR A OG1 1 
ATOM   227  C CG2 . THR A 1 43  ? 10.884  21.549 57.605  1.00 32.31 ? 437  THR A CG2 1 
ATOM   228  N N   . LYS A 1 45  ? 14.855  21.190 55.370  1.00 38.17 ? 439  LYS A N   1 
ATOM   229  C CA  . LYS A 1 45  ? 15.923  20.581 56.151  1.00 37.97 ? 439  LYS A CA  1 
ATOM   230  C C   . LYS A 1 45  ? 16.877  19.892 55.191  1.00 38.89 ? 439  LYS A C   1 
ATOM   231  O O   . LYS A 1 45  ? 16.438  19.263 54.234  1.00 39.36 ? 439  LYS A O   1 
ATOM   232  C CB  . LYS A 1 45  ? 15.394  19.536 57.135  1.00 38.53 ? 439  LYS A CB  1 
ATOM   233  C CG  . LYS A 1 45  ? 14.420  20.026 58.220  1.00 37.28 ? 439  LYS A CG  1 
ATOM   234  C CD  . LYS A 1 45  ? 14.908  21.278 58.905  1.00 40.12 ? 439  LYS A CD  1 
ATOM   235  C CE  . LYS A 1 45  ? 13.860  21.739 59.969  1.00 40.16 ? 439  LYS A CE  1 
ATOM   236  N NZ  . LYS A 1 45  ? 14.422  22.730 60.897  1.00 38.29 ? 439  LYS A NZ  1 
ATOM   237  N N   . ASP A 1 46  ? 18.176  19.986 55.469  1.00 38.26 ? 440  ASP A N   1 
ATOM   238  C CA  . ASP A 1 46  ? 19.181  19.423 54.608  1.00 38.60 ? 440  ASP A CA  1 
ATOM   239  C C   . ASP A 1 46  ? 19.339  17.949 54.897  1.00 37.50 ? 440  ASP A C   1 
ATOM   240  O O   . ASP A 1 46  ? 19.973  17.232 54.119  1.00 37.51 ? 440  ASP A O   1 
ATOM   241  C CB  . ASP A 1 46  ? 20.524  20.096 54.870  1.00 39.46 ? 440  ASP A CB  1 
ATOM   242  C CG  . ASP A 1 46  ? 21.270  19.470 56.039  1.00 41.83 ? 440  ASP A CG  1 
ATOM   243  O OD1 . ASP A 1 46  ? 20.694  19.427 57.158  1.00 44.53 ? 440  ASP A OD1 1 
ATOM   244  O OD2 . ASP A 1 46  ? 22.442  19.050 55.835  1.00 45.60 ? 440  ASP A OD2 1 
ATOM   245  N N   . SER A 1 47  ? 18.847  17.514 56.062  1.00 35.93 ? 441  SER A N   1 
ATOM   246  C CA  . SER A 1 47  ? 18.970  16.100 56.440  1.00 34.01 ? 441  SER A CA  1 
ATOM   247  C C   . SER A 1 47  ? 18.109  15.759 57.628  1.00 32.55 ? 441  SER A C   1 
ATOM   248  O O   . SER A 1 47  ? 17.532  16.627 58.245  1.00 32.57 ? 441  SER A O   1 
ATOM   249  C CB  . SER A 1 47  ? 20.417  15.707 56.765  1.00 34.56 ? 441  SER A CB  1 
ATOM   250  O OG  . SER A 1 47  ? 20.834  16.210 58.021  1.00 33.05 ? 441  SER A OG  1 
ATOM   251  N N   . LEU A 1 48  ? 18.084  14.465 57.930  1.00 31.00 ? 442  LEU A N   1 
ATOM   252  C CA  . LEU A 1 48  ? 17.398  13.909 59.080  1.00 28.30 ? 442  LEU A CA  1 
ATOM   253  C C   . LEU A 1 48  ? 15.929  14.281 59.042  1.00 26.55 ? 442  LEU A C   1 
ATOM   254  O O   . LEU A 1 48  ? 15.348  14.806 60.042  1.00 25.22 ? 442  LEU A O   1 
ATOM   255  C CB  . LEU A 1 48  ? 18.100  14.331 60.372  1.00 28.34 ? 442  LEU A CB  1 
ATOM   256  C CG  . LEU A 1 48  ? 19.572  13.881 60.496  1.00 29.32 ? 442  LEU A CG  1 
ATOM   257  C CD1 . LEU A 1 48  ? 20.242  14.522 61.707  1.00 30.82 ? 442  LEU A CD1 1 
ATOM   258  C CD2 . LEU A 1 48  ? 19.718  12.348 60.555  1.00 30.16 ? 442  LEU A CD2 1 
ATOM   259  N N   . THR A 1 49  ? 15.327  14.047 57.868  1.00 25.25 ? 443  THR A N   1 
ATOM   260  C CA  . THR A 1 49  ? 13.868  14.082 57.761  1.00 23.76 ? 443  THR A CA  1 
ATOM   261  C C   . THR A 1 49  ? 13.406  12.605 57.791  1.00 24.35 ? 443  THR A C   1 
ATOM   262  O O   . THR A 1 49  ? 13.753  11.804 56.915  1.00 23.35 ? 443  THR A O   1 
ATOM   263  C CB  . THR A 1 49  ? 13.400  14.801 56.478  1.00 24.25 ? 443  THR A CB  1 
ATOM   264  O OG1 . THR A 1 49  ? 13.773  16.185 56.548  1.00 26.94 ? 443  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 49  ? 11.814  14.708 56.291  1.00 24.51 ? 443  THR A CG2 1 
ATOM   266  N N   . LEU A 1 50  ? 12.637  12.236 58.810  1.00 22.14 ? 444  LEU A N   1 
ATOM   267  C CA  . LEU A 1 50  ? 12.141  10.872 58.930  1.00 22.62 ? 444  LEU A CA  1 
ATOM   268  C C   . LEU A 1 50  ? 10.643  10.821 58.582  1.00 23.80 ? 444  LEU A C   1 
ATOM   269  O O   . LEU A 1 50  ? 9.816   11.528 59.238  1.00 24.75 ? 444  LEU A O   1 
ATOM   270  C CB  . LEU A 1 50  ? 12.386  10.403 60.360  1.00 23.15 ? 444  LEU A CB  1 
ATOM   271  C CG  . LEU A 1 50  ? 11.889  9.012  60.750  1.00 25.09 ? 444  LEU A CG  1 
ATOM   272  C CD1 . LEU A 1 50  ? 12.537  8.012  59.825  1.00 21.81 ? 444  LEU A CD1 1 
ATOM   273  C CD2 . LEU A 1 50  ? 12.216  8.692  62.248  1.00 23.93 ? 444  LEU A CD2 1 
ATOM   274  N N   . VAL A 1 51  ? 10.278  10.032 57.559  1.00 23.38 ? 445  VAL A N   1 
ATOM   275  C CA  . VAL A 1 51  ? 8.896   10.032 57.062  1.00 23.21 ? 445  VAL A CA  1 
ATOM   276  C C   . VAL A 1 51  ? 8.311   8.657  57.392  1.00 23.90 ? 445  VAL A C   1 
ATOM   277  O O   . VAL A 1 51  ? 8.805   7.625  56.876  1.00 26.85 ? 445  VAL A O   1 
ATOM   278  C CB  . VAL A 1 51  ? 8.851   10.257 55.500  1.00 23.32 ? 445  VAL A CB  1 
ATOM   279  C CG1 . VAL A 1 51  ? 7.383   10.202 54.960  1.00 24.72 ? 445  VAL A CG1 1 
ATOM   280  C CG2 . VAL A 1 51  ? 9.576   11.556 55.088  1.00 22.82 ? 445  VAL A CG2 1 
ATOM   281  N N   . PHE A 1 52  ? 7.289   8.620  58.236  1.00 23.54 ? 446  PHE A N   1 
ATOM   282  C CA  . PHE A 1 52  ? 6.635   7.367  58.626  1.00 23.49 ? 446  PHE A CA  1 
ATOM   283  C C   . PHE A 1 52  ? 5.454   7.068  57.726  1.00 23.62 ? 446  PHE A C   1 
ATOM   284  O O   . PHE A 1 52  ? 4.606   7.932  57.493  1.00 23.10 ? 446  PHE A O   1 
ATOM   285  C CB  . PHE A 1 52  ? 6.152   7.445  60.077  1.00 23.78 ? 446  PHE A CB  1 
ATOM   286  C CG  . PHE A 1 52  ? 7.252   7.233  61.086  1.00 25.90 ? 446  PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 52  ? 7.856   5.980  61.211  1.00 25.42 ? 446  PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 52  ? 7.669   8.270  61.922  1.00 26.81 ? 446  PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 52  ? 8.877   5.747  62.130  1.00 28.29 ? 446  PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 52  ? 8.685   8.040  62.845  1.00 28.07 ? 446  PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 52  ? 9.284   6.772  62.953  1.00 27.26 ? 446  PHE A CZ  1 
ATOM   292  N N   . VAL A 1 53  ? 5.406   5.851  57.189  1.00 24.31 ? 447  VAL A N   1 
ATOM   293  C CA  . VAL A 1 53  ? 4.239   5.420  56.437  1.00 25.68 ? 447  VAL A CA  1 
ATOM   294  C C   . VAL A 1 53  ? 3.632   4.170  57.076  1.00 27.02 ? 447  VAL A C   1 
ATOM   295  O O   . VAL A 1 53  ? 4.304   3.492  57.848  1.00 25.75 ? 447  VAL A O   1 
ATOM   296  C CB  . VAL A 1 53  ? 4.610   5.110  55.009  1.00 25.74 ? 447  VAL A CB  1 
ATOM   297  C CG1 . VAL A 1 53  ? 5.197   6.348  54.344  1.00 26.79 ? 447  VAL A CG1 1 
ATOM   298  C CG2 . VAL A 1 53  ? 5.616   3.980  54.980  1.00 25.94 ? 447  VAL A CG2 1 
ATOM   299  N N   . GLU A 1 54  ? 2.374   3.886  56.730  1.00 28.25 ? 448  GLU A N   1 
ATOM   300  C CA  . GLU A 1 54  ? 1.618   2.736  57.273  1.00 30.47 ? 448  GLU A CA  1 
ATOM   301  C C   . GLU A 1 54  ? 2.118   1.369  56.824  1.00 30.07 ? 448  GLU A C   1 
ATOM   302  O O   . GLU A 1 54  ? 2.170   0.448  57.634  1.00 30.61 ? 448  GLU A O   1 
ATOM   303  C CB  . GLU A 1 54  ? 0.131   2.869  56.914  1.00 31.23 ? 448  GLU A CB  1 
ATOM   304  C CG  . GLU A 1 54  ? -0.823  1.937  57.689  1.00 38.35 ? 448  GLU A CG  1 
ATOM   305  C CD  . GLU A 1 54  ? -1.183  2.501  59.056  1.00 46.06 ? 448  GLU A CD  1 
ATOM   306  O OE1 . GLU A 1 54  ? -1.478  3.719  59.134  1.00 47.76 ? 448  GLU A OE1 1 
ATOM   307  O OE2 . GLU A 1 54  ? -1.172  1.732  60.053  1.00 49.62 ? 448  GLU A OE2 1 
ATOM   308  N N   . THR A 1 55  ? 2.461   1.192  55.550  1.00 30.22 ? 449  THR A N   1 
ATOM   309  C CA  . THR A 1 55  ? 2.792   -0.182 55.073  1.00 30.09 ? 449  THR A CA  1 
ATOM   310  C C   . THR A 1 55  ? 4.149   -0.317 54.379  1.00 30.08 ? 449  THR A C   1 
ATOM   311  O O   . THR A 1 55  ? 4.700   0.645  53.871  1.00 30.12 ? 449  THR A O   1 
ATOM   312  C CB  . THR A 1 55  ? 1.702   -0.787 54.137  1.00 30.11 ? 449  THR A CB  1 
ATOM   313  O OG1 . THR A 1 55  ? 1.842   -0.265 52.818  1.00 30.15 ? 449  THR A OG1 1 
ATOM   314  C CG2 . THR A 1 55  ? 0.269   -0.521 54.621  1.00 31.42 ? 449  THR A CG2 1 
ATOM   315  N N   . LYS A 1 56  ? 4.669   -1.533 54.350  1.00 30.19 ? 450  LYS A N   1 
ATOM   316  C CA  . LYS A 1 56  ? 5.920   -1.854 53.670  1.00 30.41 ? 450  LYS A CA  1 
ATOM   317  C C   . LYS A 1 56  ? 5.877   -1.486 52.182  1.00 29.79 ? 450  LYS A C   1 
ATOM   318  O O   . LYS A 1 56  ? 6.848   -0.956 51.632  1.00 29.02 ? 450  LYS A O   1 
ATOM   319  C CB  . LYS A 1 56  ? 6.205   -3.350 53.804  1.00 30.80 ? 450  LYS A CB  1 
ATOM   320  C CG  . LYS A 1 56  ? 6.147   -3.893 55.229  1.00 33.92 ? 450  LYS A CG  1 
ATOM   321  C CD  . LYS A 1 56  ? 7.070   -3.135 56.202  1.00 36.62 ? 450  LYS A CD  1 
ATOM   322  C CE  . LYS A 1 56  ? 7.600   -4.059 57.305  1.00 38.61 ? 450  LYS A CE  1 
ATOM   323  N NZ  . LYS A 1 56  ? 8.216   -3.343 58.445  1.00 36.80 ? 450  LYS A NZ  1 
ATOM   324  N N   . LYS A 1 57  ? 4.755   -1.790 51.538  1.00 29.39 ? 451  LYS A N   1 
ATOM   325  C CA  . LYS A 1 57  ? 4.580   -1.475 50.134  1.00 30.30 ? 451  LYS A CA  1 
ATOM   326  C C   . LYS A 1 57  ? 4.588   0.045  49.940  1.00 29.27 ? 451  LYS A C   1 
ATOM   327  O O   . LYS A 1 57  ? 5.116   0.552  48.951  1.00 29.00 ? 451  LYS A O   1 
ATOM   328  C CB  . LYS A 1 57  ? 3.295   -2.117 49.600  1.00 30.23 ? 451  LYS A CB  1 
ATOM   329  C CG  . LYS A 1 57  ? 2.899   -1.699 48.179  1.00 34.10 ? 451  LYS A CG  1 
ATOM   330  C CD  . LYS A 1 57  ? 1.453   -2.090 47.911  1.00 40.26 ? 451  LYS A CD  1 
ATOM   331  C CE  . LYS A 1 57  ? 0.528   -1.483 48.978  1.00 43.31 ? 451  LYS A CE  1 
ATOM   332  N NZ  . LYS A 1 57  ? -0.351  -2.549 49.584  1.00 44.88 ? 451  LYS A NZ  1 
ATOM   333  N N   . GLY A 1 58  ? 3.995   0.751  50.903  1.00 28.93 ? 452  GLY A N   1 
ATOM   334  C CA  . GLY A 1 58  ? 3.950   2.202  50.914  1.00 27.27 ? 452  GLY A CA  1 
ATOM   335  C C   . GLY A 1 58  ? 5.323   2.808  51.047  1.00 26.93 ? 452  GLY A C   1 
ATOM   336  O O   . GLY A 1 58  ? 5.639   3.785  50.371  1.00 27.63 ? 452  GLY A O   1 
ATOM   337  N N   . ALA A 1 59  ? 6.143   2.224  51.914  1.00 25.95 ? 453  ALA A N   1 
ATOM   338  C CA  . ALA A 1 59  ? 7.510   2.676  52.128  1.00 26.04 ? 453  ALA A CA  1 
ATOM   339  C C   . ALA A 1 59  ? 8.238   2.575  50.810  1.00 25.97 ? 453  ALA A C   1 
ATOM   340  O O   . ALA A 1 59  ? 8.828   3.532  50.313  1.00 25.20 ? 453  ALA A O   1 
ATOM   341  C CB  . ALA A 1 59  ? 8.225   1.782  53.201  1.00 26.11 ? 453  ALA A CB  1 
ATOM   342  N N   . ASP A 1 60  ? 8.180   1.379  50.254  1.00 24.52 ? 454  ASP A N   1 
ATOM   343  C CA  . ASP A 1 60  ? 8.783   1.095  48.995  1.00 25.83 ? 454  ASP A CA  1 
ATOM   344  C C   . ASP A 1 60  ? 8.358   2.050  47.848  1.00 24.94 ? 454  ASP A C   1 
ATOM   345  O O   . ASP A 1 60  ? 9.183   2.682  47.177  1.00 24.49 ? 454  ASP A O   1 
ATOM   346  C CB  . ASP A 1 60  ? 8.440   -0.336 48.639  1.00 25.86 ? 454  ASP A CB  1 
ATOM   347  C CG  . ASP A 1 60  ? 9.436   -0.931 47.750  1.00 30.84 ? 454  ASP A CG  1 
ATOM   348  O OD1 . ASP A 1 60  ? 10.308  -1.676 48.264  1.00 36.08 ? 454  ASP A OD1 1 
ATOM   349  O OD2 . ASP A 1 60  ? 9.376   -0.649 46.535  1.00 36.78 ? 454  ASP A OD2 1 
ATOM   350  N N   . SER A 1 61  ? 7.064   2.132  47.612  1.00 24.58 ? 455  SER A N   1 
ATOM   351  C CA  . SER A 1 61  ? 6.596   2.967  46.540  1.00 25.10 ? 455  SER A CA  1 
ATOM   352  C C   . SER A 1 61  ? 6.916   4.473  46.789  1.00 24.09 ? 455  SER A C   1 
ATOM   353  O O   . SER A 1 61  ? 7.257   5.194  45.855  1.00 22.17 ? 455  SER A O   1 
ATOM   354  C CB  . SER A 1 61  ? 5.135   2.648  46.256  1.00 25.10 ? 455  SER A CB  1 
ATOM   355  O OG  . SER A 1 61  ? 4.318   3.789  46.426  1.00 32.30 ? 455  SER A OG  1 
ATOM   356  N N   . LEU A 1 62  ? 6.859   4.939  48.039  1.00 24.13 ? 456  LEU A N   1 
ATOM   357  C CA  . LEU A 1 62  ? 7.175   6.329  48.299  1.00 24.52 ? 456  LEU A CA  1 
ATOM   358  C C   . LEU A 1 62  ? 8.665   6.648  48.027  1.00 25.40 ? 456  LEU A C   1 
ATOM   359  O O   . LEU A 1 62  ? 8.991   7.716  47.520  1.00 24.62 ? 456  LEU A O   1 
ATOM   360  C CB  . LEU A 1 62  ? 6.732   6.779  49.705  1.00 24.98 ? 456  LEU A CB  1 
ATOM   361  C CG  . LEU A 1 62  ? 6.860   8.251  50.044  1.00 24.07 ? 456  LEU A CG  1 
ATOM   362  C CD1 . LEU A 1 62  ? 6.147   9.205  49.002  1.00 21.54 ? 456  LEU A CD1 1 
ATOM   363  C CD2 . LEU A 1 62  ? 6.433   8.549  51.547  1.00 25.15 ? 456  LEU A CD2 1 
ATOM   364  N N   . GLU A 1 63  ? 9.554   5.701  48.311  1.00 25.49 ? 457  GLU A N   1 
ATOM   365  C CA  . GLU A 1 63  ? 10.963  5.897  48.053  1.00 26.17 ? 457  GLU A CA  1 
ATOM   366  C C   . GLU A 1 63  ? 11.207  6.075  46.552  1.00 26.02 ? 457  GLU A C   1 
ATOM   367  O O   . GLU A 1 63  ? 12.020  6.888  46.113  1.00 25.62 ? 457  GLU A O   1 
ATOM   368  C CB  . GLU A 1 63  ? 11.727  4.664  48.529  1.00 27.11 ? 457  GLU A CB  1 
ATOM   369  C CG  . GLU A 1 63  ? 13.194  4.798  48.297  1.00 29.84 ? 457  GLU A CG  1 
ATOM   370  C CD  . GLU A 1 63  ? 13.945  3.576  48.687  1.00 32.93 ? 457  GLU A CD  1 
ATOM   371  O OE1 . GLU A 1 63  ? 13.295  2.578  49.052  1.00 36.13 ? 457  GLU A OE1 1 
ATOM   372  O OE2 . GLU A 1 63  ? 15.188  3.613  48.635  1.00 36.81 ? 457  GLU A OE2 1 
ATOM   373  N N   . ASP A 1 64  ? 10.495  5.280  45.770  1.00 25.20 ? 458  ASP A N   1 
ATOM   374  C CA  . ASP A 1 64  ? 10.619  5.325  44.339  1.00 25.73 ? 458  ASP A CA  1 
ATOM   375  C C   . ASP A 1 64  ? 10.071  6.622  43.774  1.00 24.24 ? 458  ASP A C   1 
ATOM   376  O O   . ASP A 1 64  ? 10.664  7.199  42.876  1.00 24.05 ? 458  ASP A O   1 
ATOM   377  C CB  . ASP A 1 64  ? 9.841   4.170  43.750  1.00 26.43 ? 458  ASP A CB  1 
ATOM   378  C CG  . ASP A 1 64  ? 10.514  3.594  42.599  1.00 31.26 ? 458  ASP A CG  1 
ATOM   379  O OD1 . ASP A 1 64  ? 10.126  3.926  41.456  1.00 36.06 ? 458  ASP A OD1 1 
ATOM   380  O OD2 . ASP A 1 64  ? 11.467  2.830  42.838  1.00 37.95 ? 458  ASP A OD2 1 
ATOM   381  N N   . PHE A 1 65  ? 8.915   7.039  44.283  1.00 22.27 ? 459  PHE A N   1 
ATOM   382  C CA  . PHE A 1 65  ? 8.326   8.346  43.939  1.00 21.12 ? 459  PHE A CA  1 
ATOM   383  C C   . PHE A 1 65  ? 9.333   9.484  44.191  1.00 20.78 ? 459  PHE A C   1 
ATOM   384  O O   . PHE A 1 65  ? 9.578   10.329 43.319  1.00 19.78 ? 459  PHE A O   1 
ATOM   385  C CB  . PHE A 1 65  ? 7.055   8.596  44.743  1.00 20.75 ? 459  PHE A CB  1 
ATOM   386  C CG  . PHE A 1 65  ? 6.468   9.980  44.533  1.00 19.22 ? 459  PHE A CG  1 
ATOM   387  C CD1 . PHE A 1 65  ? 5.840   10.313 43.329  1.00 19.51 ? 459  PHE A CD1 1 
ATOM   388  C CD2 . PHE A 1 65  ? 6.572   10.937 45.528  1.00 18.93 ? 459  PHE A CD2 1 
ATOM   389  C CE1 . PHE A 1 65  ? 5.295   11.615 43.155  1.00 21.60 ? 459  PHE A CE1 1 
ATOM   390  C CE2 . PHE A 1 65  ? 6.073   12.258 45.347  1.00 21.63 ? 459  PHE A CE2 1 
ATOM   391  C CZ  . PHE A 1 65  ? 5.420   12.579 44.164  1.00 21.00 ? 459  PHE A CZ  1 
ATOM   392  N N   . LEU A 1 66  ? 9.906   9.496  45.396  1.00 21.13 ? 460  LEU A N   1 
ATOM   393  C CA  . LEU A 1 66  ? 10.892  10.520 45.751  1.00 22.58 ? 460  LEU A CA  1 
ATOM   394  C C   . LEU A 1 66  ? 12.125  10.464 44.892  1.00 23.64 ? 460  LEU A C   1 
ATOM   395  O O   . LEU A 1 66  ? 12.684  11.523 44.581  1.00 26.09 ? 460  LEU A O   1 
ATOM   396  C CB  . LEU A 1 66  ? 11.263  10.442 47.215  1.00 22.57 ? 460  LEU A CB  1 
ATOM   397  C CG  . LEU A 1 66  ? 10.093  10.841 48.120  1.00 22.78 ? 460  LEU A CG  1 
ATOM   398  C CD1 . LEU A 1 66  ? 10.456  10.488 49.546  1.00 27.14 ? 460  LEU A CD1 1 
ATOM   399  C CD2 . LEU A 1 66  ? 9.832   12.335 48.024  1.00 25.75 ? 460  LEU A CD2 1 
ATOM   400  N N   . TYR A 1 67  ? 12.519  9.251  44.471  1.00 22.99 ? 461  TYR A N   1 
ATOM   401  C CA  . TYR A 1 67  ? 13.663  9.040  43.653  1.00 22.50 ? 461  TYR A CA  1 
ATOM   402  C C   . TYR A 1 67  ? 13.432  9.706  42.272  1.00 23.19 ? 461  TYR A C   1 
ATOM   403  O O   . TYR A 1 67  ? 14.278  10.435 41.780  1.00 22.37 ? 461  TYR A O   1 
ATOM   404  C CB  . TYR A 1 67  ? 13.907  7.531  43.532  1.00 22.56 ? 461  TYR A CB  1 
ATOM   405  C CG  . TYR A 1 67  ? 14.931  7.161  42.489  1.00 23.44 ? 461  TYR A CG  1 
ATOM   406  C CD1 . TYR A 1 67  ? 16.262  7.305  42.753  1.00 25.01 ? 461  TYR A CD1 1 
ATOM   407  C CD2 . TYR A 1 67  ? 14.559  6.690  41.239  1.00 20.47 ? 461  TYR A CD2 1 
ATOM   408  C CE1 . TYR A 1 67  ? 17.195  7.000  41.828  1.00 21.27 ? 461  TYR A CE1 1 
ATOM   409  C CE2 . TYR A 1 67  ? 15.513  6.371  40.264  1.00 25.44 ? 461  TYR A CE2 1 
ATOM   410  C CZ  . TYR A 1 67  ? 16.827  6.540  40.588  1.00 24.32 ? 461  TYR A CZ  1 
ATOM   411  O OH  . TYR A 1 67  ? 17.798  6.240  39.695  1.00 23.06 ? 461  TYR A OH  1 
ATOM   412  N N   . HIS A 1 68  ? 12.242  9.466  41.696  1.00 23.03 ? 462  HIS A N   1 
ATOM   413  C CA  . HIS A 1 68  ? 11.849  9.987  40.381  1.00 23.69 ? 462  HIS A CA  1 
ATOM   414  C C   . HIS A 1 68  ? 11.509  11.464 40.391  1.00 24.37 ? 462  HIS A C   1 
ATOM   415  O O   . HIS A 1 68  ? 11.461  12.112 39.308  1.00 23.47 ? 462  HIS A O   1 
ATOM   416  C CB  . HIS A 1 68  ? 10.707  9.149  39.805  1.00 22.26 ? 462  HIS A CB  1 
ATOM   417  C CG  . HIS A 1 68  ? 11.186  7.836  39.274  1.00 23.08 ? 462  HIS A CG  1 
ATOM   418  N ND1 . HIS A 1 68  ? 10.792  6.622  39.797  1.00 22.60 ? 462  HIS A ND1 1 
ATOM   419  C CD2 . HIS A 1 68  ? 12.100  7.555  38.323  1.00 19.44 ? 462  HIS A CD2 1 
ATOM   420  C CE1 . HIS A 1 68  ? 11.415  5.650  39.153  1.00 19.49 ? 462  HIS A CE1 1 
ATOM   421  N NE2 . HIS A 1 68  ? 12.211  6.191  38.252  1.00 20.63 ? 462  HIS A NE2 1 
ATOM   422  N N   . GLU A 1 69  ? 11.315  11.977 41.606  1.00 24.09 ? 463  GLU A N   1 
ATOM   423  C CA  . GLU A 1 69  ? 11.281  13.404 41.848  1.00 27.07 ? 463  GLU A CA  1 
ATOM   424  C C   . GLU A 1 69  ? 12.641  14.060 41.954  1.00 27.79 ? 463  GLU A C   1 
ATOM   425  O O   . GLU A 1 69  ? 12.712  15.285 41.859  1.00 29.11 ? 463  GLU A O   1 
ATOM   426  C CB  . GLU A 1 69  ? 10.472  13.753 43.109  1.00 25.11 ? 463  GLU A CB  1 
ATOM   427  C CG  . GLU A 1 69  ? 9.018   13.605 42.851  1.00 27.40 ? 463  GLU A CG  1 
ATOM   428  C CD  . GLU A 1 69  ? 8.561   14.505 41.727  1.00 31.57 ? 463  GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 69  ? 9.195   15.575 41.526  1.00 35.22 ? 463  GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 69  ? 7.584   14.144 41.044  1.00 32.16 ? 463  GLU A OE2 1 
ATOM   431  N N   . GLY A 1 70  ? 13.703  13.275 42.156  1.00 28.69 ? 464  GLY A N   1 
ATOM   432  C CA  . GLY A 1 70  ? 15.032  13.853 42.320  1.00 29.36 ? 464  GLY A CA  1 
ATOM   433  C C   . GLY A 1 70  ? 15.528  14.035 43.750  1.00 30.98 ? 464  GLY A C   1 
ATOM   434  O O   . GLY A 1 70  ? 16.608  14.585 43.957  1.00 31.69 ? 464  GLY A O   1 
ATOM   435  N N   . TYR A 1 71  ? 14.789  13.518 44.725  1.00 31.42 ? 465  TYR A N   1 
ATOM   436  C CA  . TYR A 1 71  ? 15.203  13.579 46.138  1.00 33.34 ? 465  TYR A CA  1 
ATOM   437  C C   . TYR A 1 71  ? 16.021  12.357 46.451  1.00 32.90 ? 465  TYR A C   1 
ATOM   438  O O   . TYR A 1 71  ? 15.574  11.262 46.174  1.00 35.51 ? 465  TYR A O   1 
ATOM   439  C CB  . TYR A 1 71  ? 13.991  13.587 47.048  1.00 34.62 ? 465  TYR A CB  1 
ATOM   440  C CG  . TYR A 1 71  ? 13.280  14.892 47.046  1.00 36.38 ? 465  TYR A CG  1 
ATOM   441  C CD1 . TYR A 1 71  ? 13.660  15.919 47.920  1.00 39.74 ? 465  TYR A CD1 1 
ATOM   442  C CD2 . TYR A 1 71  ? 12.259  15.132 46.147  1.00 39.81 ? 465  TYR A CD2 1 
ATOM   443  C CE1 . TYR A 1 71  ? 12.990  17.155 47.925  1.00 40.39 ? 465  TYR A CE1 1 
ATOM   444  C CE2 . TYR A 1 71  ? 11.597  16.369 46.122  1.00 44.55 ? 465  TYR A CE2 1 
ATOM   445  C CZ  . TYR A 1 71  ? 11.964  17.365 47.030  1.00 41.71 ? 465  TYR A CZ  1 
ATOM   446  O OH  . TYR A 1 71  ? 11.296  18.566 46.988  1.00 43.08 ? 465  TYR A OH  1 
ATOM   447  N N   . ALA A 1 72  ? 17.227  12.521 46.983  1.00 31.92 ? 466  ALA A N   1 
ATOM   448  C CA  . ALA A 1 72  ? 17.980  11.375 47.519  1.00 30.42 ? 466  ALA A CA  1 
ATOM   449  C C   . ALA A 1 72  ? 17.238  10.912 48.770  1.00 30.53 ? 466  ALA A C   1 
ATOM   450  O O   . ALA A 1 72  ? 16.854  11.742 49.619  1.00 29.12 ? 466  ALA A O   1 
ATOM   451  C CB  . ALA A 1 72  ? 19.393  11.772 47.868  1.00 30.47 ? 466  ALA A CB  1 
ATOM   452  N N   . CYS A 1 73  ? 17.001  9.602  48.864  1.00 29.65 ? 467  CYS A N   1 
ATOM   453  C CA  . CYS A 1 73  ? 16.308  9.036  50.013  1.00 29.34 ? 467  CYS A CA  1 
ATOM   454  C C   . CYS A 1 73  ? 16.629  7.557  50.118  1.00 29.83 ? 467  CYS A C   1 
ATOM   455  O O   . CYS A 1 73  ? 17.141  6.952  49.175  1.00 28.07 ? 467  CYS A O   1 
ATOM   456  C CB  . CYS A 1 73  ? 14.782  9.279  49.917  1.00 29.46 ? 467  CYS A CB  1 
ATOM   457  S SG  . CYS A 1 73  ? 14.080  8.631  48.424  1.00 34.38 ? 467  CYS A SG  1 
ATOM   458  N N   . THR A 1 74  ? 16.382  6.994  51.295  1.00 29.99 ? 468  THR A N   1 
ATOM   459  C CA  . THR A 1 74  ? 16.389  5.557  51.504  1.00 30.57 ? 468  THR A CA  1 
ATOM   460  C C   . THR A 1 74  ? 15.100  5.172  52.223  1.00 30.13 ? 468  THR A C   1 
ATOM   461  O O   . THR A 1 74  ? 14.301  6.064  52.645  1.00 29.17 ? 468  THR A O   1 
ATOM   462  C CB  . THR A 1 74  ? 17.584  5.095  52.379  1.00 31.35 ? 468  THR A CB  1 
ATOM   463  O OG1 . THR A 1 74  ? 17.604  5.880  53.577  1.00 34.50 ? 468  THR A OG1 1 
ATOM   464  C CG2 . THR A 1 74  ? 18.834  5.294  51.694  1.00 30.38 ? 468  THR A CG2 1 
ATOM   465  N N   . SER A 1 75  ? 14.896  3.860  52.363  1.00 29.77 ? 469  SER A N   1 
ATOM   466  C CA  . SER A 1 75  ? 13.795  3.313  53.144  1.00 30.80 ? 469  SER A CA  1 
ATOM   467  C C   . SER A 1 75  ? 14.226  2.146  53.994  1.00 31.30 ? 469  SER A C   1 
ATOM   468  O O   . SER A 1 75  ? 15.146  1.386  53.621  1.00 30.19 ? 469  SER A O   1 
ATOM   469  C CB  . SER A 1 75  ? 12.615  2.903  52.244  1.00 30.48 ? 469  SER A CB  1 
ATOM   470  O OG  . SER A 1 75  ? 12.962  1.800  51.414  1.00 34.07 ? 469  SER A OG  1 
ATOM   471  N N   . ILE A 1 76  ? 13.555  1.991  55.134  1.00 32.19 ? 470  ILE A N   1 
ATOM   472  C CA  . ILE A 1 76  ? 13.696  0.775  55.961  1.00 33.73 ? 470  ILE A CA  1 
ATOM   473  C C   . ILE A 1 76  ? 12.322  0.138  56.162  1.00 34.02 ? 470  ILE A C   1 
ATOM   474  O O   . ILE A 1 76  ? 11.428  0.762  56.717  1.00 34.35 ? 470  ILE A O   1 
ATOM   475  C CB  . ILE A 1 76  ? 14.339  1.044  57.376  1.00 34.24 ? 470  ILE A CB  1 
ATOM   476  C CG1 . ILE A 1 76  ? 15.794  1.516  57.255  1.00 34.24 ? 470  ILE A CG1 1 
ATOM   477  C CG2 . ILE A 1 76  ? 14.305  -0.256 58.260  1.00 33.16 ? 470  ILE A CG2 1 
ATOM   478  C CD1 . ILE A 1 76  ? 16.266  2.337  58.429  1.00 33.57 ? 470  ILE A CD1 1 
ATOM   479  N N   . HIS A 1 77  ? 12.178  -1.116 55.753  1.00 34.44 ? 471  HIS A N   1 
ATOM   480  C CA  . HIS A 1 77  ? 10.951  -1.877 56.003  1.00 34.62 ? 471  HIS A CA  1 
ATOM   481  C C   . HIS A 1 77  ? 11.225  -3.351 55.790  1.00 34.39 ? 471  HIS A C   1 
ATOM   482  O O   . HIS A 1 77  ? 11.694  -4.028 56.693  1.00 34.33 ? 471  HIS A O   1 
ATOM   483  C CB  . HIS A 1 77  ? 9.790   -1.399 55.111  1.00 34.58 ? 471  HIS A CB  1 
ATOM   484  C CG  . HIS A 1 77  ? 9.821   -1.952 53.722  1.00 36.15 ? 471  HIS A CG  1 
ATOM   485  N ND1 . HIS A 1 77  ? 10.126  -1.180 52.622  1.00 36.42 ? 471  HIS A ND1 1 
ATOM   486  C CD2 . HIS A 1 77  ? 9.613   -3.207 53.256  1.00 36.11 ? 471  HIS A CD2 1 
ATOM   487  C CE1 . HIS A 1 77  ? 10.099  -1.935 51.538  1.00 36.30 ? 471  HIS A CE1 1 
ATOM   488  N NE2 . HIS A 1 77  ? 9.782   -3.167 51.895  1.00 36.95 ? 471  HIS A NE2 1 
ATOM   489  N N   . GLU A 1 86  ? 21.138  -1.610 57.568  1.00 20.00 ? 480  GLU A N   1 
ATOM   490  C CA  . GLU A 1 86  ? 22.315  -0.936 58.103  1.00 20.00 ? 480  GLU A CA  1 
ATOM   491  C C   . GLU A 1 86  ? 22.815  0.141  57.146  1.00 20.00 ? 480  GLU A C   1 
ATOM   492  O O   . GLU A 1 86  ? 22.958  1.304  57.525  1.00 40.54 ? 480  GLU A O   1 
ATOM   493  C CB  . GLU A 1 86  ? 23.428  -1.946 58.387  1.00 20.00 ? 480  GLU A CB  1 
ATOM   494  C CG  . GLU A 1 86  ? 24.008  -2.597 57.141  1.00 20.00 ? 480  GLU A CG  1 
ATOM   495  C CD  . GLU A 1 86  ? 25.081  -3.618 57.463  1.00 20.00 ? 480  GLU A CD  1 
ATOM   496  O OE1 . GLU A 1 86  ? 25.356  -3.836 58.662  1.00 20.00 ? 480  GLU A OE1 1 
ATOM   497  O OE2 . GLU A 1 86  ? 25.649  -4.203 56.518  1.00 20.00 ? 480  GLU A OE2 1 
ATOM   498  N N   . GLU A 1 87  ? 23.081  -0.253 55.905  1.00 40.33 ? 481  GLU A N   1 
ATOM   499  C CA  . GLU A 1 87  ? 23.311  0.704  54.830  1.00 40.29 ? 481  GLU A CA  1 
ATOM   500  C C   . GLU A 1 87  ? 22.371  1.899  54.945  1.00 39.80 ? 481  GLU A C   1 
ATOM   501  O O   . GLU A 1 87  ? 22.813  3.034  55.122  1.00 39.89 ? 481  GLU A O   1 
ATOM   502  C CB  . GLU A 1 87  ? 23.140  0.030  53.467  1.00 40.19 ? 481  GLU A CB  1 
ATOM   503  C CG  . GLU A 1 87  ? 24.070  0.563  52.390  1.00 40.50 ? 481  GLU A CG  1 
ATOM   504  C CD  . GLU A 1 87  ? 23.700  0.071  51.005  1.00 41.46 ? 481  GLU A CD  1 
ATOM   505  O OE1 . GLU A 1 87  ? 22.569  0.350  50.555  1.00 42.92 ? 481  GLU A OE1 1 
ATOM   506  O OE2 . GLU A 1 87  ? 24.541  -0.595 50.365  1.00 40.96 ? 481  GLU A OE2 1 
ATOM   507  N N   . ALA A 1 88  ? 21.072  1.636  54.842  1.00 39.38 ? 482  ALA A N   1 
ATOM   508  C CA  . ALA A 1 88  ? 20.064  2.703  54.872  1.00 38.62 ? 482  ALA A CA  1 
ATOM   509  C C   . ALA A 1 88  ? 20.261  3.626  56.071  1.00 38.74 ? 482  ALA A C   1 
ATOM   510  O O   . ALA A 1 88  ? 20.284  4.853  55.927  1.00 39.39 ? 482  ALA A O   1 
ATOM   511  C CB  . ALA A 1 88  ? 18.649  2.114  54.857  1.00 38.42 ? 482  ALA A CB  1 
ATOM   512  N N   . LEU A 1 89  ? 20.419  3.029  57.249  1.00 38.16 ? 483  LEU A N   1 
ATOM   513  C CA  . LEU A 1 89  ? 20.601  3.770  58.494  1.00 37.49 ? 483  LEU A CA  1 
ATOM   514  C C   . LEU A 1 89  ? 21.925  4.547  58.495  1.00 37.17 ? 483  LEU A C   1 
ATOM   515  O O   . LEU A 1 89  ? 22.029  5.602  59.092  1.00 36.48 ? 483  LEU A O   1 
ATOM   516  C CB  . LEU A 1 89  ? 20.499  2.784  59.666  1.00 37.44 ? 483  LEU A CB  1 
ATOM   517  C CG  . LEU A 1 89  ? 20.639  3.166  61.136  1.00 37.44 ? 483  LEU A CG  1 
ATOM   518  C CD1 . LEU A 1 89  ? 19.472  4.020  61.617  1.00 38.47 ? 483  LEU A CD1 1 
ATOM   519  C CD2 . LEU A 1 89  ? 20.768  1.893  61.969  1.00 37.40 ? 483  LEU A CD2 1 
ATOM   520  N N   . HIS A 1 90  ? 22.927  4.018  57.793  1.00 37.35 ? 484  HIS A N   1 
ATOM   521  C CA  . HIS A 1 90  ? 24.274  4.602  57.769  1.00 37.44 ? 484  HIS A CA  1 
ATOM   522  C C   . HIS A 1 90  ? 24.387  5.793  56.803  1.00 37.26 ? 484  HIS A C   1 
ATOM   523  O O   . HIS A 1 90  ? 25.174  6.694  56.963  1.00 37.68 ? 484  HIS A O   1 
ATOM   524  C CB  . HIS A 1 90  ? 25.306  3.513  57.425  1.00 37.78 ? 484  HIS A CB  1 
ATOM   525  C CG  . HIS A 1 90  ? 26.726  3.974  57.552  1.00 38.31 ? 484  HIS A CG  1 
ATOM   526  N ND1 . HIS A 1 90  ? 27.762  3.443  56.772  1.00 41.12 ? 484  HIS A ND1 1 
ATOM   527  C CD2 . HIS A 1 90  ? 27.286  4.910  58.366  1.00 39.14 ? 484  HIS A CD2 1 
ATOM   528  C CE1 . HIS A 1 90  ? 28.898  4.032  57.101  1.00 40.48 ? 484  HIS A CE1 1 
ATOM   529  N NE2 . HIS A 1 90  ? 28.635  4.931  58.061  1.00 41.20 ? 484  HIS A NE2 1 
ATOM   530  N N   . GLN A 1 91  ? 23.360  5.809  55.829  1.00 36.98 ? 485  GLN A N   1 
ATOM   531  C CA  . GLN A 1 91  ? 23.249  6.924  54.888  1.00 36.60 ? 485  GLN A CA  1 
ATOM   532  C C   . GLN A 1 91  ? 22.524  8.093  55.543  1.00 36.55 ? 485  GLN A C   1 
ATOM   533  O O   . GLN A 1 91  ? 22.867  9.264  55.326  1.00 36.94 ? 485  GLN A O   1 
ATOM   534  C CB  . GLN A 1 91  ? 22.529  6.477  53.609  1.00 36.25 ? 485  GLN A CB  1 
ATOM   535  C CG  . GLN A 1 91  ? 23.477  5.924  52.514  1.00 36.14 ? 485  GLN A CG  1 
ATOM   536  C CD  . GLN A 1 91  ? 22.777  5.371  51.252  1.00 37.36 ? 485  GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 91  ? 23.281  4.411  50.623  1.00 38.46 ? 485  GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 91  ? 21.660  5.985  50.851  1.00 35.79 ? 485  GLN A NE2 1 
ATOM   539  N N   . PHE A 1 92  ? 21.502  7.757  56.326  1.00 35.88 ? 486  PHE A N   1 
ATOM   540  C CA  . PHE A 1 92  ? 20.708  8.744  57.075  1.00 36.13 ? 486  PHE A CA  1 
ATOM   541  C C   . PHE A 1 92  ? 21.605  9.567  58.003  1.00 36.89 ? 486  PHE A C   1 
ATOM   542  O O   . PHE A 1 92  ? 21.519  10.795 58.007  1.00 37.38 ? 486  PHE A O   1 
ATOM   543  C CB  . PHE A 1 92  ? 19.631  8.036  57.886  1.00 34.47 ? 486  PHE A CB  1 
ATOM   544  C CG  . PHE A 1 92  ? 18.489  8.945  58.333  1.00 34.45 ? 486  PHE A CG  1 
ATOM   545  C CD1 . PHE A 1 92  ? 17.949  9.908  57.462  1.00 29.63 ? 486  PHE A CD1 1 
ATOM   546  C CD2 . PHE A 1 92  ? 17.935  8.799  59.596  1.00 30.94 ? 486  PHE A CD2 1 
ATOM   547  C CE1 . PHE A 1 92  ? 16.887  10.713 57.845  1.00 29.18 ? 486  PHE A CE1 1 
ATOM   548  C CE2 . PHE A 1 92  ? 16.849  9.623  59.992  1.00 30.62 ? 486  PHE A CE2 1 
ATOM   549  C CZ  . PHE A 1 92  ? 16.342  10.578 59.104  1.00 29.15 ? 486  PHE A CZ  1 
ATOM   550  N N   . ARG A 1 93  ? 22.473  8.883  58.758  1.00 37.88 ? 487  ARG A N   1 
ATOM   551  C CA  . ARG A 1 93  ? 23.311  9.530  59.764  1.00 39.02 ? 487  ARG A CA  1 
ATOM   552  C C   . ARG A 1 93  ? 24.323  10.471 59.092  1.00 39.28 ? 487  ARG A C   1 
ATOM   553  O O   . ARG A 1 93  ? 24.437  11.642 59.465  1.00 39.93 ? 487  ARG A O   1 
ATOM   554  C CB  . ARG A 1 93  ? 24.037  8.488  60.625  1.00 39.94 ? 487  ARG A CB  1 
ATOM   555  C CG  . ARG A 1 93  ? 23.199  7.277  61.015  1.00 41.34 ? 487  ARG A CG  1 
ATOM   556  C CD  . ARG A 1 93  ? 22.160  7.582  62.096  1.00 45.61 ? 487  ARG A CD  1 
ATOM   557  N NE  . ARG A 1 93  ? 22.724  7.451  63.440  1.00 47.05 ? 487  ARG A NE  1 
ATOM   558  C CZ  . ARG A 1 93  ? 23.173  6.315  63.962  1.00 49.67 ? 487  ARG A CZ  1 
ATOM   559  N NH1 . ARG A 1 93  ? 23.155  5.186  63.253  1.00 49.44 ? 487  ARG A NH1 1 
ATOM   560  N NH2 . ARG A 1 93  ? 23.670  6.314  65.198  1.00 51.24 ? 487  ARG A NH2 1 
ATOM   561  N N   . SER A 1 94  ? 25.018  9.977  58.076  1.00 39.06 ? 488  SER A N   1 
ATOM   562  C CA  . SER A 1 94  ? 25.984  10.803 57.340  1.00 39.49 ? 488  SER A CA  1 
ATOM   563  C C   . SER A 1 94  ? 25.353  12.010 56.607  1.00 39.38 ? 488  SER A C   1 
ATOM   564  O O   . SER A 1 94  ? 26.053  12.974 56.279  1.00 39.83 ? 488  SER A O   1 
ATOM   565  C CB  . SER A 1 94  ? 26.780  9.945  56.347  1.00 38.85 ? 488  SER A CB  1 
ATOM   566  O OG  . SER A 1 94  ? 25.909  9.243  55.464  1.00 39.60 ? 488  SER A OG  1 
ATOM   567  N N   . GLY A 1 95  ? 24.043  11.958 56.361  1.00 39.21 ? 489  GLY A N   1 
ATOM   568  C CA  . GLY A 1 95  ? 23.366  12.984 55.561  1.00 37.97 ? 489  GLY A CA  1 
ATOM   569  C C   . GLY A 1 95  ? 23.608  12.809 54.064  1.00 37.87 ? 489  GLY A C   1 
ATOM   570  O O   . GLY A 1 95  ? 23.351  13.725 53.276  1.00 38.54 ? 489  GLY A O   1 
ATOM   571  N N   . LYS A 1 96  ? 24.128  11.646 53.669  1.00 35.91 ? 490  LYS A N   1 
ATOM   572  C CA  . LYS A 1 96  ? 24.112  11.271 52.273  1.00 34.87 ? 490  LYS A CA  1 
ATOM   573  C C   . LYS A 1 96  ? 22.699  11.039 51.715  1.00 34.09 ? 490  LYS A C   1 
ATOM   574  O O   . LYS A 1 96  ? 22.434  11.424 50.571  1.00 34.38 ? 490  LYS A O   1 
ATOM   575  C CB  . LYS A 1 96  ? 25.075  10.114 51.994  1.00 35.10 ? 490  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 96  ? 26.468  10.632 51.798  1.00 36.76 ? 490  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 96  ? 27.509  9.619  52.186  1.00 39.13 ? 490  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 96  ? 28.895  10.142 51.860  1.00 39.66 ? 490  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 96  ? 29.756  9.040  51.327  1.00 40.87 ? 490  LYS A NZ  1 
ATOM   580  N N   . SER A 1 97  ? 21.825  10.427 52.507  1.00 32.96 ? 491  SER A N   1 
ATOM   581  C CA  . SER A 1 97  ? 20.397  10.424 52.216  1.00 31.74 ? 491  SER A CA  1 
ATOM   582  C C   . SER A 1 97  ? 19.620  11.223 53.257  1.00 31.30 ? 491  SER A C   1 
ATOM   583  O O   . SER A 1 97  ? 19.410  10.760 54.378  1.00 29.79 ? 491  SER A O   1 
ATOM   584  C CB  . SER A 1 97  ? 19.866  8.991  52.149  1.00 32.15 ? 491  SER A CB  1 
ATOM   585  O OG  . SER A 1 97  ? 20.477  8.269  51.094  1.00 33.77 ? 491  SER A OG  1 
ATOM   586  N N   . PRO A 1 98  ? 19.196  12.425 52.879  1.00 20.00 ? 492  PRO A N   1 
ATOM   587  C CA  . PRO A 1 98  ? 18.564  13.351 53.823  1.00 20.00 ? 492  PRO A CA  1 
ATOM   588  C C   . PRO A 1 98  ? 17.200  12.848 54.284  1.00 20.00 ? 492  PRO A C   1 
ATOM   589  O O   . PRO A 1 98  ? 16.710  13.267 55.332  1.00 32.25 ? 492  PRO A O   1 
ATOM   590  C CB  . PRO A 1 98  ? 18.402  14.628 52.997  1.00 20.00 ? 492  PRO A CB  1 
ATOM   591  C CG  . PRO A 1 98  ? 19.498  14.562 51.995  1.00 20.00 ? 492  PRO A CG  1 
ATOM   592  C CD  . PRO A 1 98  ? 19.660  13.107 51.658  1.00 20.00 ? 492  PRO A CD  1 
ATOM   593  N N   . ILE A 1 99  ? 16.598  11.957 53.502  1.00 29.13 ? 493  ILE A N   1 
ATOM   594  C CA  . ILE A 1 99  ? 15.258  11.436 53.813  1.00 26.90 ? 493  ILE A CA  1 
ATOM   595  C C   . ILE A 1 99  ? 15.259  9.921  54.030  1.00 27.47 ? 493  ILE A C   1 
ATOM   596  O O   . ILE A 1 99  ? 15.767  9.155  53.183  1.00 27.05 ? 493  ILE A O   1 
ATOM   597  C CB  . ILE A 1 99  ? 14.223  11.789 52.693  1.00 27.13 ? 493  ILE A CB  1 
ATOM   598  C CG1 . ILE A 1 99  ? 14.165  13.307 52.469  1.00 26.42 ? 493  ILE A CG1 1 
ATOM   599  C CG2 . ILE A 1 99  ? 12.804  11.251 53.068  1.00 25.71 ? 493  ILE A CG2 1 
ATOM   600  C CD1 . ILE A 1 99  ? 13.552  13.754 51.148  1.00 27.66 ? 493  ILE A CD1 1 
ATOM   601  N N   . LEU A 1 100 ? 14.696  9.491  55.159  1.00 26.80 ? 494  LEU A N   1 
ATOM   602  C CA  . LEU A 1 100 ? 14.561  8.058  55.470  1.00 26.41 ? 494  LEU A CA  1 
ATOM   603  C C   . LEU A 1 100 ? 13.094  7.786  55.541  1.00 26.01 ? 494  LEU A C   1 
ATOM   604  O O   . LEU A 1 100 ? 12.389  8.384  56.370  1.00 26.10 ? 494  LEU A O   1 
ATOM   605  C CB  . LEU A 1 100 ? 15.143  7.720  56.867  1.00 26.01 ? 494  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 100 ? 15.295  6.277  57.413  1.00 28.35 ? 494  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 100 ? 15.716  6.270  58.857  1.00 30.18 ? 494  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 100 ? 14.065  5.435  57.331  1.00 35.04 ? 494  LEU A CD2 1 
ATOM   609  N N   . VAL A 1 101 ? 12.605  6.900  54.676  1.00 26.58 ? 495  VAL A N   1 
ATOM   610  C CA  . VAL A 1 101 ? 11.201  6.467  54.765  1.00 26.67 ? 495  VAL A CA  1 
ATOM   611  C C   . VAL A 1 101 ? 11.121  5.157  55.559  1.00 27.09 ? 495  VAL A C   1 
ATOM   612  O O   . VAL A 1 101 ? 11.791  4.168  55.228  1.00 26.08 ? 495  VAL A O   1 
ATOM   613  C CB  . VAL A 1 101 ? 10.535  6.247  53.379  1.00 26.22 ? 495  VAL A CB  1 
ATOM   614  C CG1 . VAL A 1 101 ? 9.138   5.618  53.556  1.00 26.56 ? 495  VAL A CG1 1 
ATOM   615  C CG2 . VAL A 1 101 ? 10.443  7.569  52.627  1.00 25.91 ? 495  VAL A CG2 1 
ATOM   616  N N   . ALA A 1 102 ? 10.270  5.137  56.577  1.00 26.56 ? 496  ALA A N   1 
ATOM   617  C CA  . ALA A 1 102 ? 10.208  3.988  57.455  1.00 27.39 ? 496  ALA A CA  1 
ATOM   618  C C   . ALA A 1 102 ? 8.791   3.578  57.763  1.00 28.10 ? 496  ALA A C   1 
ATOM   619  O O   . ALA A 1 102 ? 7.888   4.409  57.850  1.00 28.47 ? 496  ALA A O   1 
ATOM   620  C CB  . ALA A 1 102 ? 10.964  4.290  58.742  1.00 27.46 ? 496  ALA A CB  1 
ATOM   621  N N   . THR A 1 103 ? 8.602   2.289  57.954  1.00 29.47 ? 497  THR A N   1 
ATOM   622  C CA  . THR A 1 103 ? 7.389   1.778  58.594  1.00 30.84 ? 497  THR A CA  1 
ATOM   623  C C   . THR A 1 103 ? 7.554   1.795  60.127  1.00 31.82 ? 497  THR A C   1 
ATOM   624  O O   . THR A 1 103 ? 8.669   1.919  60.632  1.00 31.41 ? 497  THR A O   1 
ATOM   625  C CB  . THR A 1 103 ? 7.144   0.356  58.166  1.00 30.09 ? 497  THR A CB  1 
ATOM   626  O OG1 . THR A 1 103 ? 8.334   -0.413 58.416  1.00 30.46 ? 497  THR A OG1 1 
ATOM   627  C CG2 . THR A 1 103 ? 6.831   0.306  56.679  1.00 30.06 ? 497  THR A CG2 1 
ATOM   628  N N   . ALA A 1 104 ? 6.426   1.742  60.839  1.00 33.50 ? 498  ALA A N   1 
ATOM   629  C CA  . ALA A 1 104 ? 6.338   1.146  62.185  1.00 34.66 ? 498  ALA A CA  1 
ATOM   630  C C   . ALA A 1 104 ? 7.646   0.490  62.672  1.00 35.40 ? 498  ALA A C   1 
ATOM   631  O O   . ALA A 1 104 ? 8.374   1.027  63.519  1.00 36.24 ? 498  ALA A O   1 
ATOM   632  C CB  . ALA A 1 104 ? 5.234   0.087  62.154  1.00 34.45 ? 498  ALA A CB  1 
ATOM   633  N N   . ASP A 1 111 ? 16.519  2.718  66.748  1.00 40.82 ? 505  ASP A N   1 
ATOM   634  C CA  . ASP A 1 111 ? 17.895  3.204  66.657  1.00 40.22 ? 505  ASP A CA  1 
ATOM   635  C C   . ASP A 1 111 ? 18.005  4.665  66.207  1.00 39.00 ? 505  ASP A C   1 
ATOM   636  O O   . ASP A 1 111 ? 19.071  5.119  65.776  1.00 39.45 ? 505  ASP A O   1 
ATOM   637  C CB  . ASP A 1 111 ? 18.708  2.335  65.691  1.00 40.55 ? 505  ASP A CB  1 
ATOM   638  C CG  . ASP A 1 111 ? 20.200  2.432  65.962  1.00 43.33 ? 505  ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 111 ? 20.586  3.348  66.742  1.00 44.84 ? 505  ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 111 ? 20.981  1.591  65.433  1.00 44.58 ? 505  ASP A OD2 1 
ATOM   641  N N   . ILE A 1 112 ? 16.911  5.404  66.298  1.00 36.97 ? 506  ILE A N   1 
ATOM   642  C CA  . ILE A 1 112 ? 16.851  6.664  65.621  1.00 35.14 ? 506  ILE A CA  1 
ATOM   643  C C   . ILE A 1 112 ? 16.292  7.739  66.575  1.00 34.55 ? 506  ILE A C   1 
ATOM   644  O O   . ILE A 1 112 ? 15.160  7.629  67.057  1.00 35.21 ? 506  ILE A O   1 
ATOM   645  C CB  . ILE A 1 112 ? 15.973  6.517  64.313  1.00 35.37 ? 506  ILE A CB  1 
ATOM   646  C CG1 . ILE A 1 112 ? 16.576  5.453  63.371  1.00 34.69 ? 506  ILE A CG1 1 
ATOM   647  C CG2 . ILE A 1 112 ? 15.849  7.828  63.590  1.00 33.59 ? 506  ILE A CG2 1 
ATOM   648  C CD1 . ILE A 1 112 ? 15.556  4.637  62.572  1.00 34.49 ? 506  ILE A CD1 1 
ATOM   649  N N   . SER A 1 113 ? 17.079  8.776  66.842  1.00 32.36 ? 507  SER A N   1 
ATOM   650  C CA  . SER A 1 113 ? 16.599  9.890  67.654  1.00 31.40 ? 507  SER A CA  1 
ATOM   651  C C   . SER A 1 113 ? 17.221  11.233 67.228  1.00 30.52 ? 507  SER A C   1 
ATOM   652  O O   . SER A 1 113 ? 18.151  11.262 66.408  1.00 30.61 ? 507  SER A O   1 
ATOM   653  C CB  . SER A 1 113 ? 16.881  9.609  69.118  1.00 31.86 ? 507  SER A CB  1 
ATOM   654  O OG  . SER A 1 113 ? 18.269  9.682  69.332  1.00 32.65 ? 507  SER A OG  1 
ATOM   655  N N   . ASN A 1 114 ? 16.687  12.338 67.766  1.00 29.52 ? 508  ASN A N   1 
ATOM   656  C CA  . ASN A 1 114 ? 17.171  13.688 67.451  1.00 28.43 ? 508  ASN A CA  1 
ATOM   657  C C   . ASN A 1 114 ? 17.200  14.020 65.944  1.00 27.47 ? 508  ASN A C   1 
ATOM   658  O O   . ASN A 1 114 ? 18.119  14.690 65.474  1.00 26.17 ? 508  ASN A O   1 
ATOM   659  C CB  . ASN A 1 114 ? 18.568  13.931 68.089  1.00 29.91 ? 508  ASN A CB  1 
ATOM   660  C CG  . ASN A 1 114 ? 18.966  15.418 68.131  1.00 30.52 ? 508  ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 114 ? 18.120  16.310 68.115  1.00 31.95 ? 508  ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 114 ? 20.276  15.672 68.187  1.00 33.93 ? 508  ASN A ND2 1 
ATOM   663  N N   . VAL A 1 115 ? 16.187  13.571 65.201  1.00 25.45 ? 509  VAL A N   1 
ATOM   664  C CA  . VAL A 1 115 ? 16.044  13.966 63.778  1.00 24.91 ? 509  VAL A CA  1 
ATOM   665  C C   . VAL A 1 115 ? 15.501  15.420 63.707  1.00 24.59 ? 509  VAL A C   1 
ATOM   666  O O   . VAL A 1 115 ? 14.962  15.964 64.706  1.00 22.30 ? 509  VAL A O   1 
ATOM   667  C CB  . VAL A 1 115 ? 15.145  13.014 62.944  1.00 24.94 ? 509  VAL A CB  1 
ATOM   668  C CG1 . VAL A 1 115 ? 15.580  11.563 63.058  1.00 25.76 ? 509  VAL A CG1 1 
ATOM   669  C CG2 . VAL A 1 115 ? 13.678  13.186 63.331  1.00 25.27 ? 509  VAL A CG2 1 
ATOM   670  N N   . LYS A 1 116 ? 15.706  16.044 62.544  1.00 23.46 ? 510  LYS A N   1 
ATOM   671  C CA  . LYS A 1 116 ? 15.355  17.429 62.312  1.00 24.72 ? 510  LYS A CA  1 
ATOM   672  C C   . LYS A 1 116 ? 13.877  17.543 62.068  1.00 24.28 ? 510  LYS A C   1 
ATOM   673  O O   . LYS A 1 116 ? 13.247  18.500 62.458  1.00 24.78 ? 510  LYS A O   1 
ATOM   674  C CB  . LYS A 1 116 ? 16.137  17.958 61.109  1.00 24.28 ? 510  LYS A CB  1 
ATOM   675  C CG  . LYS A 1 116 ? 17.506  18.416 61.571  1.00 26.38 ? 510  LYS A CG  1 
ATOM   676  C CD  . LYS A 1 116 ? 18.363  18.971 60.463  1.00 24.34 ? 510  LYS A CD  1 
ATOM   677  C CE  . LYS A 1 116 ? 19.768  19.212 61.020  1.00 28.79 ? 510  LYS A CE  1 
ATOM   678  N NZ  . LYS A 1 116 ? 20.778  19.627 59.991  1.00 33.11 ? 510  LYS A NZ  1 
ATOM   679  N N   . HIS A 1 117 ? 13.302  16.549 61.421  1.00 24.59 ? 511  HIS A N   1 
ATOM   680  C CA  . HIS A 1 117 ? 11.831  16.649 61.161  1.00 24.53 ? 511  HIS A CA  1 
ATOM   681  C C   . HIS A 1 117 ? 11.211  15.279 61.081  1.00 24.94 ? 511  HIS A C   1 
ATOM   682  O O   . HIS A 1 117 ? 11.664  14.439 60.300  1.00 23.95 ? 511  HIS A O   1 
ATOM   683  C CB  . HIS A 1 117 ? 11.680  17.324 59.813  1.00 24.45 ? 511  HIS A CB  1 
ATOM   684  C CG  . HIS A 1 117 ? 10.282  17.717 59.467  1.00 23.84 ? 511  HIS A CG  1 
ATOM   685  N ND1 . HIS A 1 117 ? 9.974   18.227 58.226  1.00 21.29 ? 511  HIS A ND1 1 
ATOM   686  C CD2 . HIS A 1 117 ? 9.136   17.763 60.203  1.00 23.05 ? 511  HIS A CD2 1 
ATOM   687  C CE1 . HIS A 1 117 ? 8.678   18.552 58.204  1.00 24.42 ? 511  HIS A CE1 1 
ATOM   688  N NE2 . HIS A 1 117 ? 8.148   18.245 59.372  1.00 21.91 ? 511  HIS A NE2 1 
ATOM   689  N N   . VAL A 1 118 ? 10.162  15.049 61.865  1.00 24.51 ? 512  VAL A N   1 
ATOM   690  C CA  . VAL A 1 118 ? 9.371   13.832 61.727  1.00 25.05 ? 512  VAL A CA  1 
ATOM   691  C C   . VAL A 1 118 ? 8.081   14.110 60.925  1.00 25.36 ? 512  VAL A C   1 
ATOM   692  O O   . VAL A 1 118 ? 7.298   15.047 61.244  1.00 25.52 ? 512  VAL A O   1 
ATOM   693  C CB  . VAL A 1 118 ? 9.054   13.188 63.117  1.00 25.06 ? 512  VAL A CB  1 
ATOM   694  C CG1 . VAL A 1 118 ? 8.000   12.033 62.974  1.00 26.35 ? 512  VAL A CG1 1 
ATOM   695  C CG2 . VAL A 1 118 ? 10.353  12.652 63.759  1.00 26.53 ? 512  VAL A CG2 1 
ATOM   696  N N   . ILE A 1 119 ? 7.849   13.317 59.864  1.00 24.25 ? 513  ILE A N   1 
ATOM   697  C CA  . ILE A 1 119 ? 6.669   13.503 59.047  1.00 23.74 ? 513  ILE A CA  1 
ATOM   698  C C   . ILE A 1 119 ? 5.860   12.222 59.142  1.00 24.73 ? 513  ILE A C   1 
ATOM   699  O O   . ILE A 1 119 ? 6.338   11.160 58.723  1.00 25.67 ? 513  ILE A O   1 
ATOM   700  C CB  . ILE A 1 119 ? 6.979   13.834 57.568  1.00 22.01 ? 513  ILE A CB  1 
ATOM   701  C CG1 . ILE A 1 119 ? 7.857   15.096 57.504  1.00 24.01 ? 513  ILE A CG1 1 
ATOM   702  C CG2 . ILE A 1 119 ? 5.638   13.947 56.720  1.00 21.84 ? 513  ILE A CG2 1 
ATOM   703  C CD1 . ILE A 1 119 ? 8.341   15.496 56.069  1.00 22.85 ? 513  ILE A CD1 1 
ATOM   704  N N   . ASN A 1 120 ? 4.664   12.311 59.748  1.00 24.34 ? 514  ASN A N   1 
ATOM   705  C CA  . ASN A 1 120 ? 3.753   11.201 59.741  1.00 24.32 ? 514  ASN A CA  1 
ATOM   706  C C   . ASN A 1 120 ? 2.896   11.282 58.465  1.00 24.93 ? 514  ASN A C   1 
ATOM   707  O O   . ASN A 1 120 ? 1.819   11.864 58.458  1.00 23.39 ? 514  ASN A O   1 
ATOM   708  C CB  . ASN A 1 120 ? 2.859   11.152 60.982  1.00 24.67 ? 514  ASN A CB  1 
ATOM   709  C CG  . ASN A 1 120 ? 3.647   10.926 62.254  1.00 26.98 ? 514  ASN A CG  1 
ATOM   710  O OD1 . ASN A 1 120 ? 4.397   9.967  62.359  1.00 29.07 ? 514  ASN A OD1 1 
ATOM   711  N ND2 . ASN A 1 120 ? 3.511   11.828 63.213  1.00 28.96 ? 514  ASN A ND2 1 
ATOM   712  N N   . PHE A 1 121 ? 3.430   10.734 57.389  1.00 25.17 ? 515  PHE A N   1 
ATOM   713  C CA  . PHE A 1 121 ? 2.720   10.642 56.103  1.00 25.82 ? 515  PHE A CA  1 
ATOM   714  C C   . PHE A 1 121 ? 1.449   9.830  56.307  1.00 26.75 ? 515  PHE A C   1 
ATOM   715  O O   . PHE A 1 121 ? 0.361   10.228 55.838  1.00 26.52 ? 515  PHE A O   1 
ATOM   716  C CB  . PHE A 1 121 ? 3.691   9.971  55.096  1.00 26.13 ? 515  PHE A CB  1 
ATOM   717  C CG  . PHE A 1 121 ? 3.178   9.872  53.671  1.00 25.89 ? 515  PHE A CG  1 
ATOM   718  C CD1 . PHE A 1 121 ? 3.565   10.810 52.728  1.00 22.92 ? 515  PHE A CD1 1 
ATOM   719  C CD2 . PHE A 1 121 ? 2.387   8.790  53.273  1.00 25.67 ? 515  PHE A CD2 1 
ATOM   720  C CE1 . PHE A 1 121 ? 3.179   10.700 51.408  1.00 21.22 ? 515  PHE A CE1 1 
ATOM   721  C CE2 . PHE A 1 121 ? 1.975   8.653  51.950  1.00 25.11 ? 515  PHE A CE2 1 
ATOM   722  C CZ  . PHE A 1 121 ? 2.384   9.630  51.005  1.00 24.01 ? 515  PHE A CZ  1 
ATOM   723  N N   . ASP A 1 122 ? 1.543   8.737  57.058  1.00 26.13 ? 516  ASP A N   1 
ATOM   724  C CA  . ASP A 1 122 ? 0.325   8.090  57.554  1.00 28.16 ? 516  ASP A CA  1 
ATOM   725  C C   . ASP A 1 122 ? 0.409   8.159  59.077  1.00 28.29 ? 516  ASP A C   1 
ATOM   726  O O   . ASP A 1 122 ? 1.467   7.940  59.628  1.00 28.71 ? 516  ASP A O   1 
ATOM   727  C CB  . ASP A 1 122 ? 0.230   6.624  57.113  1.00 27.35 ? 516  ASP A CB  1 
ATOM   728  C CG  . ASP A 1 122 ? 0.312   6.438  55.600  1.00 29.84 ? 516  ASP A CG  1 
ATOM   729  O OD1 . ASP A 1 122 ? -0.483  7.074  54.882  1.00 32.08 ? 516  ASP A OD1 1 
ATOM   730  O OD2 . ASP A 1 122 ? 1.136   5.637  55.138  1.00 29.52 ? 516  ASP A OD2 1 
ATOM   731  N N   . LEU A 1 123 ? -0.695  8.491  59.728  1.00 27.98 ? 517  LEU A N   1 
ATOM   732  C CA  . LEU A 1 123 ? -0.793  8.431  61.178  1.00 28.40 ? 517  LEU A CA  1 
ATOM   733  C C   . LEU A 1 123 ? -1.078  6.990  61.615  1.00 28.43 ? 517  LEU A C   1 
ATOM   734  O O   . LEU A 1 123 ? -1.636  6.216  60.830  1.00 29.10 ? 517  LEU A O   1 
ATOM   735  C CB  . LEU A 1 123 ? -1.908  9.372  61.647  1.00 27.13 ? 517  LEU A CB  1 
ATOM   736  C CG  . LEU A 1 123 ? -1.433  10.823 61.776  1.00 27.10 ? 517  LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 123 ? -2.688  11.712 61.934  1.00 23.73 ? 517  LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 123 ? -0.482  10.894 63.000  1.00 22.50 ? 517  LEU A CD2 1 
ATOM   739  N N   . PRO A 1 124 ? -0.678  6.614  62.850  1.00 28.57 ? 518  PRO A N   1 
ATOM   740  C CA  . PRO A 1 124 ? -0.968  5.272  63.404  1.00 28.10 ? 518  PRO A CA  1 
ATOM   741  C C   . PRO A 1 124 ? -2.381  5.208  63.985  1.00 27.86 ? 518  PRO A C   1 
ATOM   742  O O   . PRO A 1 124 ? -3.076  6.217  63.964  1.00 27.50 ? 518  PRO A O   1 
ATOM   743  C CB  . PRO A 1 124 ? 0.068   5.147  64.518  1.00 28.22 ? 518  PRO A CB  1 
ATOM   744  C CG  . PRO A 1 124 ? 0.181   6.527  65.053  1.00 27.06 ? 518  PRO A CG  1 
ATOM   745  C CD  . PRO A 1 124 ? 0.115   7.424  63.800  1.00 28.76 ? 518  PRO A CD  1 
ATOM   746  N N   . SER A 1 125 ? -2.829  4.043  64.492  1.00 28.84 ? 519  SER A N   1 
ATOM   747  C CA  . SER A 1 125 ? -4.202  3.953  64.971  1.00 28.62 ? 519  SER A CA  1 
ATOM   748  C C   . SER A 1 125 ? -4.375  4.243  66.470  1.00 29.72 ? 519  SER A C   1 
ATOM   749  O O   . SER A 1 125 ? -5.512  4.264  66.994  1.00 30.10 ? 519  SER A O   1 
ATOM   750  C CB  . SER A 1 125 ? -4.817  2.601  64.594  1.00 29.54 ? 519  SER A CB  1 
ATOM   751  O OG  . SER A 1 125 ? -4.032  1.523  65.079  1.00 29.72 ? 519  SER A OG  1 
ATOM   752  N N   . ASP A 1 126 ? -3.267  4.408  67.180  1.00 29.60 ? 520  ASP A N   1 
ATOM   753  C CA  . ASP A 1 126 ? -3.351  4.787  68.576  1.00 30.74 ? 520  ASP A CA  1 
ATOM   754  C C   . ASP A 1 126 ? -2.303  5.815  68.974  1.00 29.93 ? 520  ASP A C   1 
ATOM   755  O O   . ASP A 1 126 ? -1.215  5.859  68.404  1.00 30.67 ? 520  ASP A O   1 
ATOM   756  C CB  . ASP A 1 126 ? -3.394  3.574  69.540  1.00 31.44 ? 520  ASP A CB  1 
ATOM   757  C CG  . ASP A 1 126 ? -2.678  2.338  68.993  1.00 34.30 ? 520  ASP A CG  1 
ATOM   758  O OD1 . ASP A 1 126 ? -1.489  2.451  68.592  1.00 36.41 ? 520  ASP A OD1 1 
ATOM   759  O OD2 . ASP A 1 126 ? -3.312  1.242  68.969  1.00 36.90 ? 520  ASP A OD2 1 
ATOM   760  N N   . ILE A 1 127 ? -2.658  6.647  69.956  1.00 29.36 ? 521  ILE A N   1 
ATOM   761  C CA  . ILE A 1 127 ? -1.895  7.837  70.323  1.00 28.57 ? 521  ILE A CA  1 
ATOM   762  C C   . ILE A 1 127 ? -0.506  7.530  70.916  1.00 29.16 ? 521  ILE A C   1 
ATOM   763  O O   . ILE A 1 127 ? 0.443   8.319  70.772  1.00 27.03 ? 521  ILE A O   1 
ATOM   764  C CB  . ILE A 1 127 ? -2.753  8.773  71.220  1.00 28.61 ? 521  ILE A CB  1 
ATOM   765  C CG1 . ILE A 1 127 ? -2.261  10.194 71.210  1.00 28.30 ? 521  ILE A CG1 1 
ATOM   766  C CG2 . ILE A 1 127 ? -2.892  8.253  72.669  1.00 29.44 ? 521  ILE A CG2 1 
ATOM   767  C CD1 . ILE A 1 127 ? -2.356  10.918 69.850  1.00 29.88 ? 521  ILE A CD1 1 
ATOM   768  N N   . GLU A 1 128 ? -0.392  6.362  71.554  1.00 30.35 ? 522  GLU A N   1 
ATOM   769  C CA  . GLU A 1 128 ? 0.879   5.873  72.134  1.00 30.79 ? 522  GLU A CA  1 
ATOM   770  C C   . GLU A 1 128 ? 1.935   5.684  71.054  1.00 30.78 ? 522  GLU A C   1 
ATOM   771  O O   . GLU A 1 128 ? 3.103   6.043  71.228  1.00 30.80 ? 522  GLU A O   1 
ATOM   772  C CB  . GLU A 1 128 ? 0.659   4.534  72.866  1.00 31.25 ? 522  GLU A CB  1 
ATOM   773  C CG  . GLU A 1 128 ? -0.092  4.669  74.155  1.00 34.05 ? 522  GLU A CG  1 
ATOM   774  C CD  . GLU A 1 128 ? -1.599  4.520  73.988  1.00 37.43 ? 522  GLU A CD  1 
ATOM   775  O OE1 . GLU A 1 128 ? -2.117  4.581  72.838  1.00 38.51 ? 522  GLU A OE1 1 
ATOM   776  O OE2 . GLU A 1 128 ? -2.259  4.326  75.030  1.00 38.79 ? 522  GLU A OE2 1 
ATOM   777  N N   . GLU A 1 129 ? 1.509   5.132  69.920  1.00 30.69 ? 523  GLU A N   1 
ATOM   778  C CA  . GLU A 1 129 ? 2.393   4.943  68.806  1.00 29.14 ? 523  GLU A CA  1 
ATOM   779  C C   . GLU A 1 129 ? 2.746   6.297  68.164  1.00 28.18 ? 523  GLU A C   1 
ATOM   780  O O   . GLU A 1 129 ? 3.880   6.495  67.778  1.00 26.57 ? 523  GLU A O   1 
ATOM   781  C CB  . GLU A 1 129 ? 1.805   3.948  67.804  1.00 30.02 ? 523  GLU A CB  1 
ATOM   782  C CG  . GLU A 1 129 ? 2.663   3.730  66.548  1.00 32.68 ? 523  GLU A CG  1 
ATOM   783  C CD  . GLU A 1 129 ? 4.085   3.203  66.846  1.00 39.97 ? 523  GLU A CD  1 
ATOM   784  O OE1 . GLU A 1 129 ? 4.284   2.458  67.862  1.00 41.31 ? 523  GLU A OE1 1 
ATOM   785  O OE2 . GLU A 1 129 ? 4.999   3.522  66.036  1.00 41.06 ? 523  GLU A OE2 1 
ATOM   786  N N   . TYR A 1 130 ? 1.776   7.212  68.061  1.00 27.29 ? 524  TYR A N   1 
ATOM   787  C CA  . TYR A 1 130 ? 2.062   8.604  67.723  1.00 26.43 ? 524  TYR A CA  1 
ATOM   788  C C   . TYR A 1 130 ? 3.157   9.203  68.632  1.00 26.61 ? 524  TYR A C   1 
ATOM   789  O O   . TYR A 1 130 ? 4.065   9.845  68.162  1.00 24.09 ? 524  TYR A O   1 
ATOM   790  C CB  . TYR A 1 130 ? 0.793   9.478  67.780  1.00 26.66 ? 524  TYR A CB  1 
ATOM   791  C CG  . TYR A 1 130 ? 1.042   10.979 67.535  1.00 27.06 ? 524  TYR A CG  1 
ATOM   792  C CD1 . TYR A 1 130 ? 1.181   11.494 66.234  1.00 28.23 ? 524  TYR A CD1 1 
ATOM   793  C CD2 . TYR A 1 130 ? 1.149   11.863 68.589  1.00 24.62 ? 524  TYR A CD2 1 
ATOM   794  C CE1 . TYR A 1 130 ? 1.412   12.881 66.012  1.00 27.22 ? 524  TYR A CE1 1 
ATOM   795  C CE2 . TYR A 1 130 ? 1.413   13.214 68.381  1.00 23.72 ? 524  TYR A CE2 1 
ATOM   796  C CZ  . TYR A 1 130 ? 1.494   13.729 67.108  1.00 25.90 ? 524  TYR A CZ  1 
ATOM   797  O OH  . TYR A 1 130 ? 1.708   15.078 66.966  1.00 25.28 ? 524  TYR A OH  1 
ATOM   798  N N   . VAL A 1 131 ? 3.052   8.984  69.942  1.00 25.28 ? 525  VAL A N   1 
ATOM   799  C CA  . VAL A 1 131 ? 4.002   9.573  70.877  1.00 25.70 ? 525  VAL A CA  1 
ATOM   800  C C   . VAL A 1 131 ? 5.405   8.988  70.651  1.00 25.09 ? 525  VAL A C   1 
ATOM   801  O O   . VAL A 1 131 ? 6.413   9.688  70.692  1.00 24.11 ? 525  VAL A O   1 
ATOM   802  C CB  . VAL A 1 131 ? 3.590   9.238  72.313  1.00 25.51 ? 525  VAL A CB  1 
ATOM   803  C CG1 . VAL A 1 131 ? 4.732   9.510  73.251  1.00 26.05 ? 525  VAL A CG1 1 
ATOM   804  C CG2 . VAL A 1 131 ? 2.336   10.072 72.699  1.00 25.68 ? 525  VAL A CG2 1 
ATOM   805  N N   . HIS A 1 132 ? 5.455   7.688  70.428  1.00 24.84 ? 526  HIS A N   1 
ATOM   806  C CA  . HIS A 1 132 ? 6.714   7.021  70.142  1.00 25.94 ? 526  HIS A CA  1 
ATOM   807  C C   . HIS A 1 132 ? 7.401   7.609  68.893  1.00 25.73 ? 526  HIS A C   1 
ATOM   808  O O   . HIS A 1 132 ? 8.622   7.782  68.861  1.00 25.77 ? 526  HIS A O   1 
ATOM   809  C CB  . HIS A 1 132 ? 6.470   5.512  70.000  1.00 25.78 ? 526  HIS A CB  1 
ATOM   810  C CG  . HIS A 1 132 ? 7.690   4.675  70.193  1.00 29.07 ? 526  HIS A CG  1 
ATOM   811  N ND1 . HIS A 1 132 ? 8.223   4.406  71.440  1.00 31.52 ? 526  HIS A ND1 1 
ATOM   812  C CD2 . HIS A 1 132 ? 8.466   4.011  69.301  1.00 31.91 ? 526  HIS A CD2 1 
ATOM   813  C CE1 . HIS A 1 132 ? 9.280   3.622  71.304  1.00 32.96 ? 526  HIS A CE1 1 
ATOM   814  N NE2 . HIS A 1 132 ? 9.451   3.374  70.017  1.00 34.29 ? 526  HIS A NE2 1 
ATOM   815  N N   . ARG A 1 133 ? 6.631   7.887  67.855  1.00 25.05 ? 527  ARG A N   1 
ATOM   816  C CA  . ARG A 1 133 ? 7.222   8.300  66.595  1.00 24.76 ? 527  ARG A CA  1 
ATOM   817  C C   . ARG A 1 133 ? 7.688   9.749  66.666  1.00 25.27 ? 527  ARG A C   1 
ATOM   818  O O   . ARG A 1 133 ? 8.795   10.097 66.175  1.00 24.21 ? 527  ARG A O   1 
ATOM   819  C CB  . ARG A 1 133 ? 6.160   8.237  65.517  1.00 24.92 ? 527  ARG A CB  1 
ATOM   820  C CG  . ARG A 1 133 ? 5.560   6.870  65.181  1.00 28.08 ? 527  ARG A CG  1 
ATOM   821  C CD  . ARG A 1 133 ? 4.613   7.133  64.031  1.00 30.38 ? 527  ARG A CD  1 
ATOM   822  N NE  . ARG A 1 133 ? 3.963   5.951  63.465  1.00 32.73 ? 527  ARG A NE  1 
ATOM   823  C CZ  . ARG A 1 133 ? 3.227   5.999  62.354  1.00 32.98 ? 527  ARG A CZ  1 
ATOM   824  N NH1 . ARG A 1 133 ? 3.049   7.169  61.695  1.00 30.45 ? 527  ARG A NH1 1 
ATOM   825  N NH2 . ARG A 1 133 ? 2.696   4.880  61.881  1.00 33.18 ? 527  ARG A NH2 1 
ATOM   826  N N   . ILE A 1 134 ? 6.863   10.607 67.289  1.00 23.34 ? 528  ILE A N   1 
ATOM   827  C CA  . ILE A 1 134 ? 7.270   12.010 67.416  1.00 24.71 ? 528  ILE A CA  1 
ATOM   828  C C   . ILE A 1 134 ? 8.468   12.203 68.373  1.00 23.55 ? 528  ILE A C   1 
ATOM   829  O O   . ILE A 1 134 ? 9.185   13.182 68.251  1.00 24.09 ? 528  ILE A O   1 
ATOM   830  C CB  . ILE A 1 134 ? 6.082   13.035 67.689  1.00 24.75 ? 528  ILE A CB  1 
ATOM   831  C CG1 . ILE A 1 134 ? 5.421   12.771 69.049  1.00 24.35 ? 528  ILE A CG1 1 
ATOM   832  C CG2 . ILE A 1 134 ? 4.997   12.985 66.549  1.00 23.96 ? 528  ILE A CG2 1 
ATOM   833  C CD1 . ILE A 1 134 ? 4.922   13.979 69.735  1.00 23.14 ? 528  ILE A CD1 1 
ATOM   834  N N   . GLY A 1 135 ? 8.741   11.225 69.234  1.00 23.31 ? 529  GLY A N   1 
ATOM   835  C CA  . GLY A 1 135 ? 9.888   11.250 70.147  1.00 23.50 ? 529  GLY A CA  1 
ATOM   836  C C   . GLY A 1 135 ? 11.234  11.181 69.449  1.00 23.62 ? 529  GLY A C   1 
ATOM   837  O O   . GLY A 1 135 ? 12.255  11.467 70.047  1.00 21.69 ? 529  GLY A O   1 
ATOM   838  N N   . ARG A 1 136 ? 11.225  10.862 68.147  1.00 23.93 ? 530  ARG A N   1 
ATOM   839  C CA  . ARG A 1 136 ? 12.451  10.690 67.375  1.00 24.72 ? 530  ARG A CA  1 
ATOM   840  C C   . ARG A 1 136 ? 13.066  12.020 66.880  1.00 24.58 ? 530  ARG A C   1 
ATOM   841  O O   . ARG A 1 136 ? 14.239  12.052 66.409  1.00 23.40 ? 530  ARG A O   1 
ATOM   842  C CB  . ARG A 1 136 ? 12.199  9.679  66.249  1.00 25.16 ? 530  ARG A CB  1 
ATOM   843  C CG  . ARG A 1 136 ? 11.814  8.334  66.867  1.00 28.27 ? 530  ARG A CG  1 
ATOM   844  C CD  . ARG A 1 136 ? 11.882  7.264  65.808  1.00 34.21 ? 530  ARG A CD  1 
ATOM   845  N NE  . ARG A 1 136 ? 11.342  5.975  66.260  1.00 38.15 ? 530  ARG A NE  1 
ATOM   846  C CZ  . ARG A 1 136 ? 12.046  4.982  66.782  1.00 40.01 ? 530  ARG A CZ  1 
ATOM   847  N NH1 . ARG A 1 136 ? 13.366  5.080  66.971  1.00 40.98 ? 530  ARG A NH1 1 
ATOM   848  N NH2 . ARG A 1 136 ? 11.410  3.872  67.126  1.00 43.10 ? 530  ARG A NH2 1 
ATOM   849  N N   . THR A 1 137 ? 12.311  13.113 67.090  1.00 24.82 ? 531  THR A N   1 
ATOM   850  C CA  . THR A 1 137 ? 12.829  14.472 66.865  1.00 24.56 ? 531  THR A CA  1 
ATOM   851  C C   . THR A 1 137 ? 13.038  15.211 68.177  1.00 24.39 ? 531  THR A C   1 
ATOM   852  O O   . THR A 1 137 ? 12.274  15.007 69.161  1.00 22.97 ? 531  THR A O   1 
ATOM   853  C CB  . THR A 1 137 ? 11.945  15.282 65.862  1.00 24.52 ? 531  THR A CB  1 
ATOM   854  O OG1 . THR A 1 137 ? 12.534  16.565 65.607  1.00 24.29 ? 531  THR A OG1 1 
ATOM   855  C CG2 . THR A 1 137 ? 10.498  15.430 66.374  1.00 26.78 ? 531  THR A CG2 1 
ATOM   856  N N   . GLY A 1 138 ? 14.077  16.052 68.192  1.00 23.54 ? 532  GLY A N   1 
ATOM   857  C CA  . GLY A 1 138 ? 14.373  16.868 69.314  1.00 21.99 ? 532  GLY A CA  1 
ATOM   858  C C   . GLY A 1 138 ? 15.308  16.196 70.298  1.00 23.11 ? 532  GLY A C   1 
ATOM   859  O O   . GLY A 1 138 ? 15.448  14.969 70.309  1.00 23.11 ? 532  GLY A O   1 
ATOM   860  N N   . ARG A 1 139 ? 15.918  17.031 71.139  1.00 20.99 ? 533  ARG A N   1 
ATOM   861  C CA  . ARG A 1 139 ? 16.812  16.616 72.165  1.00 22.44 ? 533  ARG A CA  1 
ATOM   862  C C   . ARG A 1 139 ? 16.642  17.622 73.311  1.00 22.52 ? 533  ARG A C   1 
ATOM   863  O O   . ARG A 1 139 ? 15.954  18.645 73.168  1.00 21.71 ? 533  ARG A O   1 
ATOM   864  C CB  . ARG A 1 139 ? 18.251  16.537 71.594  1.00 23.38 ? 533  ARG A CB  1 
ATOM   865  C CG  . ARG A 1 139 ? 19.104  17.808 71.644  1.00 26.42 ? 533  ARG A CG  1 
ATOM   866  C CD  . ARG A 1 139 ? 20.524  17.540 71.073  1.00 26.01 ? 533  ARG A CD  1 
ATOM   867  N NE  . ARG A 1 139 ? 21.421  16.856 72.018  1.00 37.32 ? 533  ARG A NE  1 
ATOM   868  C CZ  . ARG A 1 139 ? 22.297  15.906 71.685  1.00 37.47 ? 533  ARG A CZ  1 
ATOM   869  N NH1 . ARG A 1 139 ? 22.397  15.477 70.429  1.00 41.49 ? 533  ARG A NH1 1 
ATOM   870  N NH2 . ARG A 1 139 ? 23.067  15.366 72.620  1.00 42.17 ? 533  ARG A NH2 1 
ATOM   871  N N   . VAL A 1 140 ? 17.193  17.307 74.481  1.00 22.03 ? 534  VAL A N   1 
ATOM   872  C CA  . VAL A 1 140 ? 17.118  18.235 75.599  1.00 22.77 ? 534  VAL A CA  1 
ATOM   873  C C   . VAL A 1 140 ? 17.734  19.581 75.183  1.00 21.73 ? 534  VAL A C   1 
ATOM   874  O O   . VAL A 1 140 ? 18.831  19.644 74.659  1.00 18.95 ? 534  VAL A O   1 
ATOM   875  C CB  . VAL A 1 140 ? 17.756  17.635 76.911  1.00 23.22 ? 534  VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 140 ? 18.332  18.692 77.822  1.00 25.24 ? 534  VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 140 ? 16.707  16.858 77.696  1.00 23.97 ? 534  VAL A CG2 1 
ATOM   878  N N   . GLY A 1 141 ? 16.984  20.649 75.411  1.00 21.59 ? 535  GLY A N   1 
ATOM   879  C CA  . GLY A 1 141 ? 17.471  22.000 75.199  1.00 21.97 ? 535  GLY A CA  1 
ATOM   880  C C   . GLY A 1 141 ? 17.167  22.459 73.793  1.00 22.46 ? 535  GLY A C   1 
ATOM   881  O O   . GLY A 1 141 ? 17.540  23.537 73.420  1.00 23.31 ? 535  GLY A O   1 
ATOM   882  N N   . ASN A 1 142 ? 16.539  21.620 72.990  1.00 24.08 ? 536  ASN A N   1 
ATOM   883  C CA  . ASN A 1 142 ? 16.172  22.039 71.645  1.00 26.89 ? 536  ASN A CA  1 
ATOM   884  C C   . ASN A 1 142 ? 14.689  21.679 71.360  1.00 27.23 ? 536  ASN A C   1 
ATOM   885  O O   . ASN A 1 142 ? 14.030  20.988 72.198  1.00 29.68 ? 536  ASN A O   1 
ATOM   886  C CB  . ASN A 1 142 ? 17.203  21.549 70.605  1.00 28.01 ? 536  ASN A CB  1 
ATOM   887  C CG  . ASN A 1 142 ? 16.721  20.384 69.821  1.00 34.29 ? 536  ASN A CG  1 
ATOM   888  O OD1 . ASN A 1 142 ? 15.650  19.817 70.143  1.00 44.32 ? 536  ASN A OD1 1 
ATOM   889  N ND2 . ASN A 1 142 ? 17.441  20.029 68.758  1.00 37.81 ? 536  ASN A ND2 1 
ATOM   890  N N   . LEU A 1 143 ? 14.097  22.217 70.297  1.00 25.81 ? 537  LEU A N   1 
ATOM   891  C CA  . LEU A 1 143 ? 12.681  21.855 69.972  1.00 25.40 ? 537  LEU A CA  1 
ATOM   892  C C   . LEU A 1 143 ? 12.722  20.896 68.814  1.00 23.92 ? 537  LEU A C   1 
ATOM   893  O O   . LEU A 1 143 ? 13.519  21.073 67.942  1.00 21.76 ? 537  LEU A O   1 
ATOM   894  C CB  . LEU A 1 143 ? 11.870  23.083 69.528  1.00 26.81 ? 537  LEU A CB  1 
ATOM   895  C CG  . LEU A 1 143 ? 10.875  23.850 70.418  1.00 31.31 ? 537  LEU A CG  1 
ATOM   896  C CD1 . LEU A 1 143 ? 11.067  23.605 71.913  1.00 31.61 ? 537  LEU A CD1 1 
ATOM   897  C CD2 . LEU A 1 143 ? 10.884  25.371 70.039  1.00 27.72 ? 537  LEU A CD2 1 
ATOM   898  N N   . GLY A 1 144 ? 11.873  19.876 68.809  1.00 22.12 ? 538  GLY A N   1 
ATOM   899  C CA  . GLY A 1 144 ? 11.745  19.028 67.633  1.00 21.93 ? 538  GLY A CA  1 
ATOM   900  C C   . GLY A 1 144 ? 10.626  19.596 66.763  1.00 20.67 ? 538  GLY A C   1 
ATOM   901  O O   . GLY A 1 144 ? 9.891   20.535 67.170  1.00 21.61 ? 538  GLY A O   1 
ATOM   902  N N   . LEU A 1 145 ? 10.484  19.008 65.592  1.00 20.77 ? 539  LEU A N   1 
ATOM   903  C CA  . LEU A 1 145 ? 9.423   19.333 64.673  1.00 21.51 ? 539  LEU A CA  1 
ATOM   904  C C   . LEU A 1 145 ? 8.782   18.056 64.149  1.00 22.78 ? 539  LEU A C   1 
ATOM   905  O O   . LEU A 1 145 ? 9.462   17.197 63.549  1.00 21.54 ? 539  LEU A O   1 
ATOM   906  C CB  . LEU A 1 145 ? 9.964   20.159 63.506  1.00 22.26 ? 539  LEU A CB  1 
ATOM   907  C CG  . LEU A 1 145 ? 8.951   20.480 62.417  1.00 24.02 ? 539  LEU A CG  1 
ATOM   908  C CD1 . LEU A 1 145 ? 7.858   21.407 63.007  1.00 26.31 ? 539  LEU A CD1 1 
ATOM   909  C CD2 . LEU A 1 145 ? 9.714   21.153 61.252  1.00 26.76 ? 539  LEU A CD2 1 
ATOM   910  N N   . ALA A 1 146 ? 7.467   17.959 64.304  1.00 21.79 ? 540  ALA A N   1 
ATOM   911  C CA  . ALA A 1 146 ? 6.752   16.838 63.763  1.00 22.41 ? 540  ALA A CA  1 
ATOM   912  C C   . ALA A 1 146 ? 5.505   17.310 63.039  1.00 22.73 ? 540  ALA A C   1 
ATOM   913  O O   . ALA A 1 146 ? 4.600   17.972 63.650  1.00 21.70 ? 540  ALA A O   1 
ATOM   914  C CB  . ALA A 1 146 ? 6.388   15.823 64.881  1.00 23.34 ? 540  ALA A CB  1 
ATOM   915  N N   . THR A 1 147 ? 5.397   16.888 61.768  1.00 23.66 ? 541  THR A N   1 
ATOM   916  C CA  . THR A 1 147 ? 4.234   17.272 60.937  1.00 24.55 ? 541  THR A CA  1 
ATOM   917  C C   . THR A 1 147 ? 3.421   15.996 60.656  1.00 25.90 ? 541  THR A C   1 
ATOM   918  O O   . THR A 1 147 ? 3.990   15.011 60.266  1.00 25.61 ? 541  THR A O   1 
ATOM   919  C CB  . THR A 1 147 ? 4.682   17.974 59.618  1.00 23.10 ? 541  THR A CB  1 
ATOM   920  O OG1 . THR A 1 147 ? 5.515   19.084 59.975  1.00 25.95 ? 541  THR A OG1 1 
ATOM   921  C CG2 . THR A 1 147 ? 3.423   18.537 58.808  1.00 23.35 ? 541  THR A CG2 1 
ATOM   922  N N   . SER A 1 148 ? 2.104   16.031 60.849  1.00 23.35 ? 542  SER A N   1 
ATOM   923  C CA  . SER A 1 148 ? 1.308   14.845 60.625  1.00 24.59 ? 542  SER A CA  1 
ATOM   924  C C   . SER A 1 148 ? 0.201   15.110 59.601  1.00 25.03 ? 542  SER A C   1 
ATOM   925  O O   . SER A 1 148 ? -0.534  16.107 59.738  1.00 26.17 ? 542  SER A O   1 
ATOM   926  C CB  . SER A 1 148 ? 0.660   14.440 61.957  1.00 25.43 ? 542  SER A CB  1 
ATOM   927  O OG  . SER A 1 148 ? 1.699   14.022 62.880  1.00 27.64 ? 542  SER A OG  1 
ATOM   928  N N   . PHE A 1 149 ? 0.040   14.197 58.648  1.00 23.83 ? 543  PHE A N   1 
ATOM   929  C CA  . PHE A 1 149 ? -1.074  14.269 57.667  1.00 23.71 ? 543  PHE A CA  1 
ATOM   930  C C   . PHE A 1 149 ? -2.259  13.501 58.196  1.00 23.63 ? 543  PHE A C   1 
ATOM   931  O O   . PHE A 1 149 ? -2.127  12.375 58.645  1.00 22.93 ? 543  PHE A O   1 
ATOM   932  C CB  . PHE A 1 149 ? -0.711  13.644 56.328  1.00 23.99 ? 543  PHE A CB  1 
ATOM   933  C CG  . PHE A 1 149 ? 0.518   14.236 55.663  1.00 23.01 ? 543  PHE A CG  1 
ATOM   934  C CD1 . PHE A 1 149 ? 1.078   15.447 56.082  1.00 26.71 ? 543  PHE A CD1 1 
ATOM   935  C CD2 . PHE A 1 149 ? 1.061   13.600 54.540  1.00 27.47 ? 543  PHE A CD2 1 
ATOM   936  C CE1 . PHE A 1 149 ? 2.264   15.992 55.405  1.00 25.69 ? 543  PHE A CE1 1 
ATOM   937  C CE2 . PHE A 1 149 ? 2.190   14.129 53.865  1.00 26.00 ? 543  PHE A CE2 1 
ATOM   938  C CZ  . PHE A 1 149 ? 2.798   15.323 54.330  1.00 29.70 ? 543  PHE A CZ  1 
ATOM   939  N N   . PHE A 1 150 ? -3.440  14.104 58.075  1.00 22.63 ? 544  PHE A N   1 
ATOM   940  C CA  . PHE A 1 150 ? -4.642  13.573 58.693  1.00 22.25 ? 544  PHE A CA  1 
ATOM   941  C C   . PHE A 1 150 ? -5.752  13.655 57.676  1.00 22.22 ? 544  PHE A C   1 
ATOM   942  O O   . PHE A 1 150 ? -5.856  14.654 56.948  1.00 22.03 ? 544  PHE A O   1 
ATOM   943  C CB  . PHE A 1 150 ? -5.018  14.453 59.914  1.00 22.15 ? 544  PHE A CB  1 
ATOM   944  C CG  . PHE A 1 150 ? -6.046  13.827 60.848  1.00 25.27 ? 544  PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 150 ? -5.679  13.370 62.133  1.00 26.95 ? 544  PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 150 ? -7.381  13.782 60.494  1.00 23.58 ? 544  PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 150 ? -6.663  12.832 62.993  1.00 29.14 ? 544  PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 150 ? -8.367  13.220 61.356  1.00 26.15 ? 544  PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 150 ? -7.996  12.764 62.605  1.00 27.65 ? 544  PHE A CZ  1 
ATOM   950  N N   . ASN A 1 151 ? -6.571  12.618 57.618  1.00 23.35 ? 545  ASN A N   1 
ATOM   951  C CA  . ASN A 1 151 ? -7.853  12.663 56.857  1.00 23.59 ? 545  ASN A CA  1 
ATOM   952  C C   . ASN A 1 151 ? -8.896  11.720 57.503  1.00 24.59 ? 545  ASN A C   1 
ATOM   953  O O   . ASN A 1 151 ? -8.656  11.259 58.608  1.00 23.95 ? 545  ASN A O   1 
ATOM   954  C CB  . ASN A 1 151 ? -7.627  12.427 55.344  1.00 23.72 ? 545  ASN A CB  1 
ATOM   955  C CG  . ASN A 1 151 ? -6.953  11.109 55.066  1.00 26.70 ? 545  ASN A CG  1 
ATOM   956  O OD1 . ASN A 1 151 ? -7.363  10.091 55.607  1.00 26.86 ? 545  ASN A OD1 1 
ATOM   957  N ND2 . ASN A 1 151 ? -5.904  11.113 54.207  1.00 25.25 ? 545  ASN A ND2 1 
ATOM   958  N N   . GLU A 1 152 ? -10.031 11.440 56.835  1.00 25.36 ? 546  GLU A N   1 
ATOM   959  C CA  . GLU A 1 152 ? -11.117 10.658 57.451  1.00 27.97 ? 546  GLU A CA  1 
ATOM   960  C C   . GLU A 1 152 ? -10.683 9.261  57.940  1.00 27.85 ? 546  GLU A C   1 
ATOM   961  O O   . GLU A 1 152 ? -11.340 8.668  58.828  1.00 28.63 ? 546  GLU A O   1 
ATOM   962  C CB  . GLU A 1 152 ? -12.300 10.494 56.491  1.00 28.30 ? 546  GLU A CB  1 
ATOM   963  C CG  . GLU A 1 152 ? -12.997 11.791 56.055  1.00 34.27 ? 546  GLU A CG  1 
ATOM   964  C CD  . GLU A 1 152 ? -13.943 12.397 57.105  1.00 43.46 ? 546  GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 152 ? -14.329 11.684 58.096  1.00 45.55 ? 546  GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 152 ? -14.325 13.596 56.900  1.00 46.09 ? 546  GLU A OE2 1 
ATOM   967  N N   . ARG A 1 153 ? -9.611  8.740  57.332  1.00 28.54 ? 547  ARG A N   1 
ATOM   968  C CA  . ARG A 1 153 ? -9.004  7.458  57.731  1.00 29.51 ? 547  ARG A CA  1 
ATOM   969  C C   . ARG A 1 153 ? -8.535  7.462  59.193  1.00 28.51 ? 547  ARG A C   1 
ATOM   970  O O   . ARG A 1 153 ? -8.467  6.404  59.843  1.00 28.72 ? 547  ARG A O   1 
ATOM   971  C CB  . ARG A 1 153 ? -7.853  7.082  56.792  1.00 30.58 ? 547  ARG A CB  1 
ATOM   972  C CG  . ARG A 1 153 ? -8.306  6.692  55.390  1.00 33.39 ? 547  ARG A CG  1 
ATOM   973  C CD  . ARG A 1 153 ? -7.067  6.505  54.519  1.00 42.18 ? 547  ARG A CD  1 
ATOM   974  N NE  . ARG A 1 153 ? -6.471  5.185  54.769  1.00 47.70 ? 547  ARG A NE  1 
ATOM   975  C CZ  . ARG A 1 153 ? -6.304  4.232  53.847  1.00 48.41 ? 547  ARG A CZ  1 
ATOM   976  N NH1 . ARG A 1 153 ? -6.631  4.458  52.574  1.00 46.43 ? 547  ARG A NH1 1 
ATOM   977  N NH2 . ARG A 1 153 ? -5.786  3.056  54.201  1.00 48.53 ? 547  ARG A NH2 1 
ATOM   978  N N   . ASN A 1 154 ? -8.288  8.665  59.701  1.00 26.02 ? 548  ASN A N   1 
ATOM   979  C CA  . ASN A 1 154 ? -7.721  8.880  61.023  1.00 25.80 ? 548  ASN A CA  1 
ATOM   980  C C   . ASN A 1 154 ? -8.797  9.264  62.077  1.00 25.49 ? 548  ASN A C   1 
ATOM   981  O O   . ASN A 1 154 ? -8.480  9.668  63.195  1.00 25.53 ? 548  ASN A O   1 
ATOM   982  C CB  . ASN A 1 154 ? -6.572  9.922  60.878  1.00 24.71 ? 548  ASN A CB  1 
ATOM   983  C CG  . ASN A 1 154 ? -5.559  9.513  59.803  1.00 26.02 ? 548  ASN A CG  1 
ATOM   984  O OD1 . ASN A 1 154 ? -5.245  10.274 58.894  1.00 26.31 ? 548  ASN A OD1 1 
ATOM   985  N ND2 . ASN A 1 154 ? -5.046  8.290  59.912  1.00 24.11 ? 548  ASN A ND2 1 
ATOM   986  N N   . ILE A 1 155 ? -10.081 9.126  61.731  1.00 24.76 ? 549  ILE A N   1 
ATOM   987  C CA  . ILE A 1 155 ? -11.149 9.562  62.685  1.00 26.40 ? 549  ILE A CA  1 
ATOM   988  C C   . ILE A 1 155 ? -11.044 8.851  64.051  1.00 25.84 ? 549  ILE A C   1 
ATOM   989  O O   . ILE A 1 155 ? -11.312 9.448  65.079  1.00 26.11 ? 549  ILE A O   1 
ATOM   990  C CB  . ILE A 1 155 ? -12.577 9.544  62.072  1.00 25.35 ? 549  ILE A CB  1 
ATOM   991  C CG1 . ILE A 1 155 ? -13.675 9.919  63.097  1.00 30.70 ? 549  ILE A CG1 1 
ATOM   992  C CG2 . ILE A 1 155 ? -12.914 8.155  61.542  1.00 28.12 ? 549  ILE A CG2 1 
ATOM   993  C CD1 . ILE A 1 155 ? -13.611 11.336 63.759  1.00 29.59 ? 549  ILE A CD1 1 
ATOM   994  N N   . ASN A 1 156 ? -10.579 7.606  64.042  1.00 26.48 ? 550  ASN A N   1 
ATOM   995  C CA  . ASN A 1 156 ? -10.321 6.814  65.253  1.00 28.79 ? 550  ASN A CA  1 
ATOM   996  C C   . ASN A 1 156 ? -9.389  7.486  66.284  1.00 28.35 ? 550  ASN A C   1 
ATOM   997  O O   . ASN A 1 156 ? -9.566  7.326  67.489  1.00 28.38 ? 550  ASN A O   1 
ATOM   998  C CB  . ASN A 1 156 ? -9.748  5.455  64.825  1.00 29.12 ? 550  ASN A CB  1 
ATOM   999  C CG  . ASN A 1 156 ? -8.878  5.571  63.560  1.00 32.70 ? 550  ASN A CG  1 
ATOM   1000 O OD1 . ASN A 1 156 ? -7.646  5.725  63.651  1.00 34.28 ? 550  ASN A OD1 1 
ATOM   1001 N ND2 . ASN A 1 156 ? -9.531  5.546  62.362  1.00 30.30 ? 550  ASN A ND2 1 
ATOM   1002 N N   . ILE A 1 157 ? -8.411  8.266  65.823  1.00 28.62 ? 551  ILE A N   1 
ATOM   1003 C CA  . ILE A 1 157 ? -7.450  8.885  66.724  1.00 28.00 ? 551  ILE A CA  1 
ATOM   1004 C C   . ILE A 1 157 ? -7.770  10.387 67.012  1.00 28.21 ? 551  ILE A C   1 
ATOM   1005 O O   . ILE A 1 157 ? -7.041  11.065 67.744  1.00 25.60 ? 551  ILE A O   1 
ATOM   1006 C CB  . ILE A 1 157 ? -6.003  8.632  66.179  1.00 28.61 ? 551  ILE A CB  1 
ATOM   1007 C CG1 . ILE A 1 157 ? -4.948  8.722  67.304  1.00 30.47 ? 551  ILE A CG1 1 
ATOM   1008 C CG2 . ILE A 1 157 ? -5.697  9.550  65.014  1.00 27.33 ? 551  ILE A CG2 1 
ATOM   1009 C CD1 . ILE A 1 157 ? -3.514  8.336  66.877  1.00 30.16 ? 551  ILE A CD1 1 
ATOM   1010 N N   . THR A 1 158 ? -8.908  10.870 66.500  1.00 28.21 ? 552  THR A N   1 
ATOM   1011 C CA  . THR A 1 158 ? -9.241  12.306 66.517  1.00 28.01 ? 552  THR A CA  1 
ATOM   1012 C C   . THR A 1 158 ? -9.169  12.918 67.937  1.00 26.98 ? 552  THR A C   1 
ATOM   1013 O O   . THR A 1 158 ? -8.449  13.868 68.188  1.00 23.45 ? 552  THR A O   1 
ATOM   1014 C CB  . THR A 1 158 ? -10.687 12.563 65.959  1.00 29.68 ? 552  THR A CB  1 
ATOM   1015 O OG1 . THR A 1 158 ? -10.784 12.136 64.582  1.00 30.67 ? 552  THR A OG1 1 
ATOM   1016 C CG2 . THR A 1 158 ? -11.023 14.046 66.015  1.00 32.83 ? 552  THR A CG2 1 
ATOM   1017 N N   . LYS A 1 159 ? -9.956  12.371 68.858  1.00 24.60 ? 553  LYS A N   1 
ATOM   1018 C CA  . LYS A 1 159 ? -10.001 12.907 70.233  1.00 26.00 ? 553  LYS A CA  1 
ATOM   1019 C C   . LYS A 1 159 ? -8.694  12.792 71.037  1.00 24.27 ? 553  LYS A C   1 
ATOM   1020 O O   . LYS A 1 159 ? -8.309  13.692 71.768  1.00 25.46 ? 553  LYS A O   1 
ATOM   1021 C CB  . LYS A 1 159 ? -11.112 12.222 71.007  1.00 24.09 ? 553  LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 159 ? -12.389 12.090 70.231  1.00 30.09 ? 553  LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 159 ? -13.523 11.583 71.138  1.00 27.49 ? 553  LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 159 ? -13.396 10.078 71.379  1.00 31.44 ? 553  LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 159 ? -14.411 9.555  72.375  1.00 29.92 ? 553  LYS A NZ  1 
ATOM   1026 N N   . ASP A 1 160 ? -8.025  11.664 70.911  1.00 23.62 ? 554  ASP A N   1 
ATOM   1027 C CA  . ASP A 1 160 ? -6.768  11.475 71.581  1.00 23.32 ? 554  ASP A CA  1 
ATOM   1028 C C   . ASP A 1 160 ? -5.709  12.468 71.063  1.00 22.79 ? 554  ASP A C   1 
ATOM   1029 O O   . ASP A 1 160 ? -4.995  13.056 71.856  1.00 20.51 ? 554  ASP A O   1 
ATOM   1030 C CB  . ASP A 1 160 ? -6.301  10.036 71.398  1.00 23.85 ? 554  ASP A CB  1 
ATOM   1031 C CG  . ASP A 1 160 ? -7.163  9.054  72.180  1.00 24.76 ? 554  ASP A CG  1 
ATOM   1032 O OD1 . ASP A 1 160 ? -7.795  9.469  73.180  1.00 30.84 ? 554  ASP A OD1 1 
ATOM   1033 O OD2 . ASP A 1 160 ? -7.230  7.885  71.764  1.00 22.91 ? 554  ASP A OD2 1 
ATOM   1034 N N   . LEU A 1 161 ? -5.648  12.661 69.744  1.00 22.19 ? 555  LEU A N   1 
ATOM   1035 C CA  . LEU A 1 161 ? -4.726  13.627 69.171  1.00 22.99 ? 555  LEU A CA  1 
ATOM   1036 C C   . LEU A 1 161 ? -5.087  15.027 69.668  1.00 23.70 ? 555  LEU A C   1 
ATOM   1037 O O   . LEU A 1 161 ? -4.215  15.761 70.074  1.00 24.52 ? 555  LEU A O   1 
ATOM   1038 C CB  . LEU A 1 161 ? -4.744  13.527 67.641  1.00 23.57 ? 555  LEU A CB  1 
ATOM   1039 C CG  . LEU A 1 161 ? -3.783  14.411 66.815  1.00 21.94 ? 555  LEU A CG  1 
ATOM   1040 C CD1 . LEU A 1 161 ? -2.345  14.414 67.409  1.00 20.57 ? 555  LEU A CD1 1 
ATOM   1041 C CD2 . LEU A 1 161 ? -3.743  14.019 65.369  1.00 22.66 ? 555  LEU A CD2 1 
ATOM   1042 N N   . LEU A 1 162 ? -6.384  15.374 69.692  1.00 22.85 ? 556  LEU A N   1 
ATOM   1043 C CA  . LEU A 1 162 ? -6.816  16.661 70.208  1.00 23.08 ? 556  LEU A CA  1 
ATOM   1044 C C   . LEU A 1 162 ? -6.341  16.864 71.645  1.00 22.41 ? 556  LEU A C   1 
ATOM   1045 O O   . LEU A 1 162 ? -5.689  17.849 71.929  1.00 23.15 ? 556  LEU A O   1 
ATOM   1046 C CB  . LEU A 1 162 ? -8.343  16.844 70.091  1.00 22.84 ? 556  LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 162 ? -8.862  18.162 70.710  1.00 23.57 ? 556  LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 162 ? -8.180  19.385 70.028  1.00 29.46 ? 556  LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 162 ? -10.365 18.295 70.655  1.00 26.13 ? 556  LEU A CD2 1 
ATOM   1050 N N   . ASP A 1 163 ? -6.605  15.911 72.523  1.00 22.30 ? 557  ASP A N   1 
ATOM   1051 C CA  . ASP A 1 163 ? -6.273  16.087 73.931  1.00 22.94 ? 557  ASP A CA  1 
ATOM   1052 C C   . ASP A 1 163 ? -4.757  16.222 74.095  1.00 22.48 ? 557  ASP A C   1 
ATOM   1053 O O   . ASP A 1 163 ? -4.282  16.995 74.940  1.00 22.69 ? 557  ASP A O   1 
ATOM   1054 C CB  . ASP A 1 163 ? -6.740  14.905 74.761  1.00 21.79 ? 557  ASP A CB  1 
ATOM   1055 C CG  . ASP A 1 163 ? -8.264  14.863 74.960  1.00 27.99 ? 557  ASP A CG  1 
ATOM   1056 O OD1 . ASP A 1 163 ? -8.993  15.817 74.590  1.00 29.63 ? 557  ASP A OD1 1 
ATOM   1057 O OD2 . ASP A 1 163 ? -8.732  13.834 75.495  1.00 29.14 ? 557  ASP A OD2 1 
ATOM   1058 N N   . LEU A 1 164 ? -4.007  15.433 73.342  1.00 22.32 ? 558  LEU A N   1 
ATOM   1059 C CA  . LEU A 1 164 ? -2.544  15.522 73.402  1.00 23.92 ? 558  LEU A CA  1 
ATOM   1060 C C   . LEU A 1 164 ? -2.057  16.910 72.971  1.00 23.59 ? 558  LEU A C   1 
ATOM   1061 O O   . LEU A 1 164 ? -1.183  17.519 73.618  1.00 22.55 ? 558  LEU A O   1 
ATOM   1062 C CB  . LEU A 1 164 ? -1.891  14.447 72.526  1.00 24.76 ? 558  LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 164 ? -0.361  14.255 72.466  1.00 24.52 ? 558  LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 164 ? -0.099  12.872 71.916  1.00 24.08 ? 558  LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 164 ? 0.377   15.276 71.638  1.00 30.44 ? 558  LEU A CD2 1 
ATOM   1066 N N   . LEU A 1 165 ? -2.599  17.408 71.866  1.00 22.37 ? 559  LEU A N   1 
ATOM   1067 C CA  . LEU A 1 165 ? -2.197  18.747 71.390  1.00 22.89 ? 559  LEU A CA  1 
ATOM   1068 C C   . LEU A 1 165 ? -2.538  19.849 72.398  1.00 22.30 ? 559  LEU A C   1 
ATOM   1069 O O   . LEU A 1 165 ? -1.734  20.793 72.610  1.00 23.02 ? 559  LEU A O   1 
ATOM   1070 C CB  . LEU A 1 165 ? -2.761  19.076 70.004  1.00 21.02 ? 559  LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 165 ? -2.288  18.238 68.818  1.00 23.12 ? 559  LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 165 ? -3.148  18.679 67.641  1.00 24.19 ? 559  LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 165 ? -0.771  18.432 68.519  1.00 18.44 ? 559  LEU A CD2 1 
ATOM   1074 N N   . VAL A 1 166 ? -3.698  19.715 73.061  1.00 22.42 ? 560  VAL A N   1 
ATOM   1075 C CA  . VAL A 1 166 ? -4.085  20.687 74.080  1.00 23.37 ? 560  VAL A CA  1 
ATOM   1076 C C   . VAL A 1 166 ? -3.163  20.641 75.277  1.00 24.05 ? 560  VAL A C   1 
ATOM   1077 O O   . VAL A 1 166 ? -2.729  21.693 75.747  1.00 24.62 ? 560  VAL A O   1 
ATOM   1078 C CB  . VAL A 1 166 ? -5.578  20.487 74.535  1.00 22.12 ? 560  VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 166 ? -6.003  21.490 75.694  1.00 25.74 ? 560  VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 166 ? -6.466  20.611 73.335  1.00 22.12 ? 560  VAL A CG2 1 
ATOM   1081 N N   . GLU A 1 167 ? -2.846  19.452 75.777  1.00 24.66 ? 561  GLU A N   1 
ATOM   1082 C CA  . GLU A 1 167 ? -1.987  19.403 76.961  1.00 27.65 ? 561  GLU A CA  1 
ATOM   1083 C C   . GLU A 1 167 ? -0.556  19.792 76.680  1.00 27.27 ? 561  GLU A C   1 
ATOM   1084 O O   . GLU A 1 167 ? 0.130   20.249 77.584  1.00 27.53 ? 561  GLU A O   1 
ATOM   1085 C CB  . GLU A 1 167 ? -2.061  18.058 77.721  1.00 28.31 ? 561  GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 167 ? -1.779  16.824 76.847  1.00 28.86 ? 561  GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 167 ? -1.557  15.513 77.654  1.00 31.84 ? 561  GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 167 ? -2.131  15.357 78.785  1.00 37.13 ? 561  GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 167 ? -0.803  14.630 77.138  1.00 37.26 ? 561  GLU A OE2 1 
ATOM   1090 N N   . ALA A 1 168 ? -0.120  19.653 75.414  1.00 26.79 ? 562  ALA A N   1 
ATOM   1091 C CA  . ALA A 1 168 ? 1.204   20.017 75.015  1.00 26.46 ? 562  ALA A CA  1 
ATOM   1092 C C   . ALA A 1 168 ? 1.233   21.477 74.565  1.00 26.60 ? 562  ALA A C   1 
ATOM   1093 O O   . ALA A 1 168 ? 2.257   21.947 74.056  1.00 26.43 ? 562  ALA A O   1 
ATOM   1094 C CB  . ALA A 1 168 ? 1.681   19.112 73.904  1.00 26.45 ? 562  ALA A CB  1 
ATOM   1095 N N   . LYS A 1 169 ? 0.119   22.173 74.774  1.00 24.98 ? 563  LYS A N   1 
ATOM   1096 C CA  . LYS A 1 169 ? -0.056  23.569 74.352  1.00 25.50 ? 563  LYS A CA  1 
ATOM   1097 C C   . LYS A 1 169 ? 0.337   23.798 72.902  1.00 26.29 ? 563  LYS A C   1 
ATOM   1098 O O   . LYS A 1 169 ? 0.970   24.796 72.571  1.00 25.69 ? 563  LYS A O   1 
ATOM   1099 C CB  . LYS A 1 169 ? 0.684   24.519 75.321  1.00 27.38 ? 563  LYS A CB  1 
ATOM   1100 C CG  . LYS A 1 169 ? 0.354   24.183 76.802  1.00 26.10 ? 563  LYS A CG  1 
ATOM   1101 C CD  . LYS A 1 169 ? 1.493   24.492 77.780  1.00 31.80 ? 563  LYS A CD  1 
ATOM   1102 C CE  . LYS A 1 169 ? 1.249   23.781 79.156  1.00 33.68 ? 563  LYS A CE  1 
ATOM   1103 N NZ  . LYS A 1 169 ? 2.082   22.534 79.174  1.00 35.07 ? 563  LYS A NZ  1 
ATOM   1104 N N   . GLN A 1 170 ? -0.072  22.879 72.011  1.00 25.87 ? 564  GLN A N   1 
ATOM   1105 C CA  . GLN A 1 170 ? 0.283   22.980 70.592  1.00 26.23 ? 564  GLN A CA  1 
ATOM   1106 C C   . GLN A 1 170 ? -0.861  23.644 69.818  1.00 27.12 ? 564  GLN A C   1 
ATOM   1107 O O   . GLN A 1 170 ? -1.986  23.813 70.352  1.00 26.97 ? 564  GLN A O   1 
ATOM   1108 C CB  . GLN A 1 170 ? 0.555   21.564 70.024  1.00 26.46 ? 564  GLN A CB  1 
ATOM   1109 C CG  . GLN A 1 170 ? 1.734   20.797 70.671  1.00 26.72 ? 564  GLN A CG  1 
ATOM   1110 C CD  . GLN A 1 170 ? 3.044   21.541 70.464  1.00 23.61 ? 564  GLN A CD  1 
ATOM   1111 O OE1 . GLN A 1 170 ? 3.788   21.840 71.435  1.00 29.82 ? 564  GLN A OE1 1 
ATOM   1112 N NE2 . GLN A 1 170 ? 3.289   21.928 69.245  1.00 17.12 ? 564  GLN A NE2 1 
ATOM   1113 N N   . GLU A 1 171 ? -0.596  24.043 68.577  1.00 27.73 ? 565  GLU A N   1 
ATOM   1114 C CA  . GLU A 1 171 ? -1.669  24.570 67.698  1.00 27.79 ? 565  GLU A CA  1 
ATOM   1115 C C   . GLU A 1 171 ? -2.742  23.536 67.457  1.00 26.04 ? 565  GLU A C   1 
ATOM   1116 O O   . GLU A 1 171 ? -2.468  22.410 67.074  1.00 26.35 ? 565  GLU A O   1 
ATOM   1117 C CB  . GLU A 1 171 ? -1.088  25.027 66.348  1.00 28.76 ? 565  GLU A CB  1 
ATOM   1118 C CG  . GLU A 1 171 ? -1.892  26.150 65.685  1.00 33.83 ? 565  GLU A CG  1 
ATOM   1119 C CD  . GLU A 1 171 ? -1.067  26.823 64.592  1.00 40.55 ? 565  GLU A CD  1 
ATOM   1120 O OE1 . GLU A 1 171 ? -0.297  26.108 63.904  1.00 45.77 ? 565  GLU A OE1 1 
ATOM   1121 O OE2 . GLU A 1 171 ? -1.143  28.064 64.455  1.00 44.16 ? 565  GLU A OE2 1 
ATOM   1122 N N   . VAL A 1 172 ? -3.992  23.911 67.682  1.00 25.81 ? 566  VAL A N   1 
ATOM   1123 C CA  . VAL A 1 172 ? -5.088  23.035 67.385  1.00 24.48 ? 566  VAL A CA  1 
ATOM   1124 C C   . VAL A 1 172 ? -5.934  23.659 66.259  1.00 23.88 ? 566  VAL A C   1 
ATOM   1125 O O   . VAL A 1 172 ? -6.558  24.734 66.440  1.00 19.07 ? 566  VAL A O   1 
ATOM   1126 C CB  . VAL A 1 172 ? -5.961  22.812 68.631  1.00 25.89 ? 566  VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 172 ? -7.260  22.042 68.292  1.00 27.42 ? 566  VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 172 ? -5.149  22.092 69.678  1.00 27.38 ? 566  VAL A CG2 1 
ATOM   1129 N N   . PRO A 1 173 ? -5.983  22.965 65.120  1.00 22.13 ? 567  PRO A N   1 
ATOM   1130 C CA  . PRO A 1 173 ? -6.752  23.313 63.938  1.00 23.00 ? 567  PRO A CA  1 
ATOM   1131 C C   . PRO A 1 173 ? -8.247  23.295 64.277  1.00 22.90 ? 567  PRO A C   1 
ATOM   1132 O O   . PRO A 1 173 ? -8.707  22.405 64.990  1.00 24.08 ? 567  PRO A O   1 
ATOM   1133 C CB  . PRO A 1 173 ? -6.409  22.151 62.980  1.00 23.11 ? 567  PRO A CB  1 
ATOM   1134 C CG  . PRO A 1 173 ? -5.123  21.639 63.489  1.00 24.24 ? 567  PRO A CG  1 
ATOM   1135 C CD  . PRO A 1 173 ? -5.306  21.663 64.942  1.00 22.32 ? 567  PRO A CD  1 
ATOM   1136 N N   . SER A 1 174 ? -8.996  24.289 63.803  1.00 21.40 ? 568  SER A N   1 
ATOM   1137 C CA  . SER A 1 174 ? -10.443 24.381 64.034  1.00 22.48 ? 568  SER A CA  1 
ATOM   1138 C C   . SER A 1 174 ? -11.135 23.072 63.628  1.00 21.47 ? 568  SER A C   1 
ATOM   1139 O O   . SER A 1 174 ? -12.050 22.608 64.306  1.00 22.46 ? 568  SER A O   1 
ATOM   1140 C CB  . SER A 1 174 ? -11.005 25.548 63.226  1.00 20.80 ? 568  SER A CB  1 
ATOM   1141 O OG  . SER A 1 174 ? -12.411 25.680 63.467  1.00 23.83 ? 568  SER A OG  1 
ATOM   1142 N N   . TRP A 1 175 ? -10.667 22.482 62.535  1.00 22.15 ? 569  TRP A N   1 
ATOM   1143 C CA  . TRP A 1 175 ? -11.285 21.264 62.013  1.00 22.48 ? 569  TRP A CA  1 
ATOM   1144 C C   . TRP A 1 175 ? -11.163 20.094 62.954  1.00 22.07 ? 569  TRP A C   1 
ATOM   1145 O O   . TRP A 1 175 ? -12.030 19.257 62.980  1.00 22.89 ? 569  TRP A O   1 
ATOM   1146 C CB  . TRP A 1 175 ? -10.770 20.899 60.603  1.00 21.51 ? 569  TRP A CB  1 
ATOM   1147 C CG  . TRP A 1 175 ? -9.330  20.600 60.494  1.00 23.15 ? 569  TRP A CG  1 
ATOM   1148 C CD1 . TRP A 1 175 ? -8.381  21.427 60.019  1.00 21.05 ? 569  TRP A CD1 1 
ATOM   1149 C CD2 . TRP A 1 175 ? -8.670  19.391 60.857  1.00 25.27 ? 569  TRP A CD2 1 
ATOM   1150 N NE1 . TRP A 1 175 ? -7.144  20.820 60.049  1.00 24.27 ? 569  TRP A NE1 1 
ATOM   1151 C CE2 . TRP A 1 175 ? -7.303  19.555 60.552  1.00 25.43 ? 569  TRP A CE2 1 
ATOM   1152 C CE3 . TRP A 1 175 ? -9.103  18.157 61.358  1.00 22.47 ? 569  TRP A CE3 1 
ATOM   1153 C CZ2 . TRP A 1 175 ? -6.356  18.539 60.769  1.00 24.01 ? 569  TRP A CZ2 1 
ATOM   1154 C CZ3 . TRP A 1 175 ? -8.152  17.140 61.558  1.00 19.77 ? 569  TRP A CZ3 1 
ATOM   1155 C CH2 . TRP A 1 175 ? -6.820  17.347 61.288  1.00 23.21 ? 569  TRP A CH2 1 
ATOM   1156 N N   . LEU A 1 176 ? -10.073 20.037 63.713  1.00 21.95 ? 570  LEU A N   1 
ATOM   1157 C CA  . LEU A 1 176 ? -9.856  18.903 64.593  1.00 22.45 ? 570  LEU A CA  1 
ATOM   1158 C C   . LEU A 1 176 ? -10.783 19.011 65.780  1.00 22.31 ? 570  LEU A C   1 
ATOM   1159 O O   . LEU A 1 176 ? -11.449 18.054 66.210  1.00 21.67 ? 570  LEU A O   1 
ATOM   1160 C CB  . LEU A 1 176 ? -8.381  18.891 65.005  1.00 21.95 ? 570  LEU A CB  1 
ATOM   1161 C CG  . LEU A 1 176 ? -7.888  17.748 65.876  1.00 22.09 ? 570  LEU A CG  1 
ATOM   1162 C CD1 . LEU A 1 176 ? -8.128  16.382 65.174  1.00 25.41 ? 570  LEU A CD1 1 
ATOM   1163 C CD2 . LEU A 1 176 ? -6.417  17.955 66.356  1.00 24.06 ? 570  LEU A CD2 1 
ATOM   1164 N N   . GLU A 1 177 ? -10.850 20.220 66.304  1.00 23.44 ? 571  GLU A N   1 
ATOM   1165 C CA  . GLU A 1 177 ? -11.689 20.487 67.431  1.00 25.97 ? 571  GLU A CA  1 
ATOM   1166 C C   . GLU A 1 177 ? -13.119 20.157 67.078  1.00 25.12 ? 571  GLU A C   1 
ATOM   1167 O O   . GLU A 1 177 ? -13.858 19.561 67.892  1.00 28.25 ? 571  GLU A O   1 
ATOM   1168 C CB  . GLU A 1 177 ? -11.477 21.927 67.941  1.00 25.60 ? 571  GLU A CB  1 
ATOM   1169 C CG  . GLU A 1 177 ? -12.482 22.330 69.065  1.00 30.98 ? 571  GLU A CG  1 
ATOM   1170 C CD  . GLU A 1 177 ? -11.887 23.322 70.053  1.00 37.35 ? 571  GLU A CD  1 
ATOM   1171 O OE1 . GLU A 1 177 ? -10.697 23.698 69.877  1.00 42.30 ? 571  GLU A OE1 1 
ATOM   1172 O OE2 . GLU A 1 177 ? -12.596 23.722 71.004  1.00 42.53 ? 571  GLU A OE2 1 
ATOM   1173 N N   . ASN A 1 178 ? -13.535 20.504 65.869  1.00 24.98 ? 572  ASN A N   1 
ATOM   1174 C CA  . ASN A 1 178 ? -14.944 20.351 65.495  1.00 27.93 ? 572  ASN A CA  1 
ATOM   1175 C C   . ASN A 1 178 ? -15.345 18.894 65.206  1.00 28.63 ? 572  ASN A C   1 
ATOM   1176 O O   . ASN A 1 178 ? -16.463 18.474 65.542  1.00 27.93 ? 572  ASN A O   1 
ATOM   1177 C CB  . ASN A 1 178 ? -15.353 21.348 64.390  1.00 27.83 ? 572  ASN A CB  1 
ATOM   1178 C CG  . ASN A 1 178 ? -15.540 22.783 64.940  1.00 30.06 ? 572  ASN A CG  1 
ATOM   1179 O OD1 . ASN A 1 178 ? -16.239 22.982 65.949  1.00 34.87 ? 572  ASN A OD1 1 
ATOM   1180 N ND2 . ASN A 1 178 ? -14.925 23.781 64.279  1.00 25.98 ? 572  ASN A ND2 1 
ATOM   1181 N N   . MET A 1 179 ? -14.399 18.135 64.656  1.00 29.38 ? 573  MET A N   1 
ATOM   1182 C CA  . MET A 1 179 ? -14.503 16.679 64.460  1.00 30.70 ? 573  MET A CA  1 
ATOM   1183 C C   . MET A 1 179 ? -14.421 15.840 65.732  1.00 30.55 ? 573  MET A C   1 
ATOM   1184 O O   . MET A 1 179 ? -15.053 14.795 65.811  1.00 30.72 ? 573  MET A O   1 
ATOM   1185 C CB  . MET A 1 179 ? -13.408 16.212 63.526  1.00 31.23 ? 573  MET A CB  1 
ATOM   1186 C CG  . MET A 1 179 ? -13.826 16.143 62.110  1.00 32.41 ? 573  MET A CG  1 
ATOM   1187 S SD  . MET A 1 179 ? -12.368 15.678 61.178  1.00 33.81 ? 573  MET A SD  1 
ATOM   1188 C CE  . MET A 1 179 ? -12.415 13.870 61.136  1.00 34.39 ? 573  MET A CE  1 
ATOM   1189 N N   . ALA A 1 180 ? -13.631 16.267 66.716  1.00 30.53 ? 574  ALA A N   1 
ATOM   1190 C CA  . ALA A 1 180 ? -13.699 15.627 68.031  1.00 32.69 ? 574  ALA A CA  1 
ATOM   1191 C C   . ALA A 1 180 ? -15.048 15.955 68.685  1.00 33.44 ? 574  ALA A C   1 
ATOM   1192 O O   . ALA A 1 180 ? -15.620 15.120 69.379  1.00 34.91 ? 574  ALA A O   1 
ATOM   1193 C CB  . ALA A 1 180 ? -12.552 16.049 68.914  1.00 30.88 ? 574  ALA A CB  1 
ATOM   1194 N N   . TYR A 1 181 ? -15.506 17.194 68.461  1.00 35.61 ? 575  TYR A N   1 
ATOM   1195 C CA  . TYR A 1 181 ? -16.846 17.790 68.792  1.00 36.49 ? 575  TYR A CA  1 
ATOM   1196 C C   . TYR A 1 181 ? -16.790 18.944 69.790  1.00 36.76 ? 575  TYR A C   1 
ATOM   1197 O O   . TYR A 1 181 ? -17.815 19.270 70.447  1.00 37.47 ? 575  TYR A O   1 
ATOM   1198 C CB  . TYR A 1 181 ? -17.929 16.792 69.221  1.00 38.66 ? 575  TYR A CB  1 
ATOM   1199 C CG  . TYR A 1 181 ? -18.334 15.801 68.182  1.00 40.68 ? 575  TYR A CG  1 
ATOM   1200 C CD1 . TYR A 1 181 ? -18.364 16.132 66.824  1.00 41.94 ? 575  TYR A CD1 1 
ATOM   1201 C CD2 . TYR A 1 181 ? -18.698 14.524 68.560  1.00 42.50 ? 575  TYR A CD2 1 
ATOM   1202 C CE1 . TYR A 1 181 ? -18.734 15.200 65.880  1.00 42.37 ? 575  TYR A CE1 1 
ATOM   1203 C CE2 . TYR A 1 181 ? -19.058 13.593 67.633  1.00 44.33 ? 575  TYR A CE2 1 
ATOM   1204 C CZ  . TYR A 1 181 ? -19.076 13.926 66.303  1.00 41.52 ? 575  TYR A CZ  1 
ATOM   1205 O OH  . TYR A 1 181 ? -19.463 12.953 65.423  1.00 42.97 ? 575  TYR A OH  1 
ATOM   1206 N N   . GLY B 1 14  ? -6.244  19.393 46.689  1.00 24.05 ? 408  GLY B N   1 
ATOM   1207 C CA  . GLY B 1 14  ? -7.334  19.621 47.697  1.00 24.37 ? 408  GLY B CA  1 
ATOM   1208 C C   . GLY B 1 14  ? -7.916  21.042 47.770  1.00 26.13 ? 408  GLY B C   1 
ATOM   1209 O O   . GLY B 1 14  ? -7.404  21.962 47.141  1.00 25.70 ? 408  GLY B O   1 
ATOM   1210 N N   . SER B 1 15  ? -8.961  21.212 48.572  1.00 26.28 ? 409  SER B N   1 
ATOM   1211 C CA  . SER B 1 15  ? -9.677  22.501 48.747  1.00 28.23 ? 409  SER B CA  1 
ATOM   1212 C C   . SER B 1 15  ? -8.736  23.654 49.089  1.00 28.95 ? 409  SER B C   1 
ATOM   1213 O O   . SER B 1 15  ? -7.805  23.467 49.878  1.00 28.40 ? 409  SER B O   1 
ATOM   1214 C CB  . SER B 1 15  ? -10.656 22.343 49.867  1.00 28.40 ? 409  SER B CB  1 
ATOM   1215 O OG  . SER B 1 15  ? -11.365 23.538 50.092  1.00 32.21 ? 409  SER B OG  1 
ATOM   1216 N N   . THR B 1 16  ? -8.967  24.840 48.526  1.00 29.92 ? 410  THR B N   1 
ATOM   1217 C CA  . THR B 1 16  ? -8.084  25.997 48.816  1.00 31.57 ? 410  THR B CA  1 
ATOM   1218 C C   . THR B 1 16  ? -8.182  26.367 50.313  1.00 31.79 ? 410  THR B C   1 
ATOM   1219 O O   . THR B 1 16  ? -7.227  26.855 50.903  1.00 32.57 ? 410  THR B O   1 
ATOM   1220 C CB  . THR B 1 16  ? -8.393  27.232 47.897  1.00 31.59 ? 410  THR B CB  1 
ATOM   1221 O OG1 . THR B 1 16  ? -7.993  26.945 46.558  1.00 34.80 ? 410  THR B OG1 1 
ATOM   1222 C CG2 . THR B 1 16  ? -7.652  28.546 48.352  1.00 31.77 ? 410  THR B CG2 1 
ATOM   1223 N N   . SER B 1 17  ? -9.321  26.090 50.920  1.00 31.58 ? 411  SER B N   1 
ATOM   1224 C CA  . SER B 1 17  ? -9.523  26.421 52.327  1.00 32.50 ? 411  SER B CA  1 
ATOM   1225 C C   . SER B 1 17  ? -8.986  25.349 53.318  1.00 31.32 ? 411  SER B C   1 
ATOM   1226 O O   . SER B 1 17  ? -9.150  25.475 54.538  1.00 31.10 ? 411  SER B O   1 
ATOM   1227 C CB  . SER B 1 17  ? -11.026 26.672 52.571  1.00 32.72 ? 411  SER B CB  1 
ATOM   1228 O OG  . SER B 1 17  ? -11.677 25.423 52.737  1.00 38.66 ? 411  SER B OG  1 
ATOM   1229 N N   . GLU B 1 18  ? -8.391  24.281 52.819  1.00 29.60 ? 412  GLU B N   1 
ATOM   1230 C CA  . GLU B 1 18  ? -7.761  23.304 53.716  1.00 29.07 ? 412  GLU B CA  1 
ATOM   1231 C C   . GLU B 1 18  ? -6.684  24.035 54.524  1.00 26.69 ? 412  GLU B C   1 
ATOM   1232 O O   . GLU B 1 18  ? -5.934  24.869 53.973  1.00 27.75 ? 412  GLU B O   1 
ATOM   1233 C CB  . GLU B 1 18  ? -7.112  22.113 52.956  1.00 30.01 ? 412  GLU B CB  1 
ATOM   1234 C CG  . GLU B 1 18  ? -8.044  21.181 52.205  1.00 34.61 ? 412  GLU B CG  1 
ATOM   1235 C CD  . GLU B 1 18  ? -9.233  20.602 53.009  1.00 41.22 ? 412  GLU B CD  1 
ATOM   1236 O OE1 . GLU B 1 18  ? -9.498  20.983 54.190  1.00 43.31 ? 412  GLU B OE1 1 
ATOM   1237 O OE2 . GLU B 1 18  ? -9.931  19.745 52.409  1.00 44.72 ? 412  GLU B OE2 1 
ATOM   1238 N N   . ASN B 1 19  ? -6.607  23.713 55.809  1.00 24.76 ? 413  ASN B N   1 
ATOM   1239 C CA  . ASN B 1 19  ? -5.505  24.134 56.693  1.00 22.10 ? 413  ASN B CA  1 
ATOM   1240 C C   . ASN B 1 19  ? -5.427  25.639 56.859  1.00 23.06 ? 413  ASN B C   1 
ATOM   1241 O O   . ASN B 1 19  ? -4.326  26.203 56.972  1.00 22.44 ? 413  ASN B O   1 
ATOM   1242 C CB  . ASN B 1 19  ? -4.213  23.574 56.187  1.00 22.21 ? 413  ASN B CB  1 
ATOM   1243 C CG  . ASN B 1 19  ? -4.234  22.081 56.178  1.00 19.41 ? 413  ASN B CG  1 
ATOM   1244 O OD1 . ASN B 1 19  ? -4.577  21.472 57.190  1.00 17.79 ? 413  ASN B OD1 1 
ATOM   1245 N ND2 . ASN B 1 19  ? -3.973  21.485 55.051  1.00 14.98 ? 413  ASN B ND2 1 
ATOM   1246 N N   . ILE B 1 20  ? -6.605  26.264 56.790  1.00 20.80 ? 414  ILE B N   1 
ATOM   1247 C CA  . ILE B 1 20  ? -6.814  27.656 57.147  1.00 22.11 ? 414  ILE B CA  1 
ATOM   1248 C C   . ILE B 1 20  ? -7.921  27.708 58.195  1.00 22.60 ? 414  ILE B C   1 
ATOM   1249 O O   . ILE B 1 20  ? -9.040  27.229 57.946  1.00 22.74 ? 414  ILE B O   1 
ATOM   1250 C CB  . ILE B 1 20  ? -7.236  28.483 55.893  1.00 21.30 ? 414  ILE B CB  1 
ATOM   1251 C CG1 . ILE B 1 20  ? -6.086  28.431 54.839  1.00 22.61 ? 414  ILE B CG1 1 
ATOM   1252 C CG2 . ILE B 1 20  ? -7.581  29.883 56.284  1.00 21.44 ? 414  ILE B CG2 1 
ATOM   1253 C CD1 . ILE B 1 20  ? -6.500  28.835 53.375  1.00 23.02 ? 414  ILE B CD1 1 
ATOM   1254 N N   . THR B 1 21  ? -7.639  28.306 59.350  1.00 22.58 ? 415  THR B N   1 
ATOM   1255 C CA  . THR B 1 21  ? -8.701  28.573 60.331  1.00 23.22 ? 415  THR B CA  1 
ATOM   1256 C C   . THR B 1 21  ? -9.464  29.831 59.889  1.00 23.04 ? 415  THR B C   1 
ATOM   1257 O O   . THR B 1 21  ? -8.842  30.866 59.665  1.00 23.80 ? 415  THR B O   1 
ATOM   1258 C CB  . THR B 1 21  ? -8.074  28.730 61.755  1.00 23.84 ? 415  THR B CB  1 
ATOM   1259 O OG1 . THR B 1 21  ? -7.617  27.450 62.186  1.00 29.00 ? 415  THR B OG1 1 
ATOM   1260 C CG2 . THR B 1 21  ? -9.135  29.207 62.772  1.00 22.66 ? 415  THR B CG2 1 
ATOM   1261 N N   . GLN B 1 22  ? -10.789 29.701 59.686  1.00 20.84 ? 416  GLN B N   1 
ATOM   1262 C CA  . GLN B 1 22  ? -11.627 30.793 59.175  1.00 21.96 ? 416  GLN B CA  1 
ATOM   1263 C C   . GLN B 1 22  ? -12.470 31.275 60.322  1.00 21.24 ? 416  GLN B C   1 
ATOM   1264 O O   . GLN B 1 22  ? -13.232 30.485 60.924  1.00 23.82 ? 416  GLN B O   1 
ATOM   1265 C CB  . GLN B 1 22  ? -12.524 30.334 58.021  1.00 21.21 ? 416  GLN B CB  1 
ATOM   1266 C CG  . GLN B 1 22  ? -11.715 29.807 56.786  1.00 22.48 ? 416  GLN B CG  1 
ATOM   1267 C CD  . GLN B 1 22  ? -12.718 29.355 55.734  1.00 26.74 ? 416  GLN B CD  1 
ATOM   1268 O OE1 . GLN B 1 22  ? -13.599 30.127 55.358  1.00 23.73 ? 416  GLN B OE1 1 
ATOM   1269 N NE2 . GLN B 1 22  ? -12.659 28.066 55.333  1.00 29.73 ? 416  GLN B NE2 1 
ATOM   1270 N N   . LYS B 1 23  ? -12.321 32.529 60.678  1.00 21.89 ? 417  LYS B N   1 
ATOM   1271 C CA  . LYS B 1 23  ? -13.097 33.117 61.821  1.00 21.92 ? 417  LYS B CA  1 
ATOM   1272 C C   . LYS B 1 23  ? -13.949 34.235 61.240  1.00 23.49 ? 417  LYS B C   1 
ATOM   1273 O O   . LYS B 1 23  ? -13.450 35.355 60.948  1.00 23.15 ? 417  LYS B O   1 
ATOM   1274 C CB  . LYS B 1 23  ? -12.138 33.719 62.848  1.00 23.31 ? 417  LYS B CB  1 
ATOM   1275 C CG  . LYS B 1 23  ? -11.122 32.733 63.444  1.00 26.78 ? 417  LYS B CG  1 
ATOM   1276 C CD  . LYS B 1 23  ? -11.841 31.780 64.371  1.00 34.35 ? 417  LYS B CD  1 
ATOM   1277 C CE  . LYS B 1 23  ? -10.923 31.239 65.512  1.00 38.47 ? 417  LYS B CE  1 
ATOM   1278 N NZ  . LYS B 1 23  ? -11.803 30.393 66.404  1.00 41.22 ? 417  LYS B NZ  1 
ATOM   1279 N N   . VAL B 1 24  ? -15.244 33.979 61.091  1.00 21.86 ? 418  VAL B N   1 
ATOM   1280 C CA  . VAL B 1 24  ? -16.164 34.990 60.554  1.00 21.08 ? 418  VAL B CA  1 
ATOM   1281 C C   . VAL B 1 24  ? -16.923 35.586 61.728  1.00 20.07 ? 418  VAL B C   1 
ATOM   1282 O O   . VAL B 1 24  ? -17.454 34.841 62.594  1.00 20.80 ? 418  VAL B O   1 
ATOM   1283 C CB  . VAL B 1 24  ? -17.183 34.337 59.614  1.00 21.78 ? 418  VAL B CB  1 
ATOM   1284 C CG1 . VAL B 1 24  ? -18.186 35.396 59.101  1.00 24.07 ? 418  VAL B CG1 1 
ATOM   1285 C CG2 . VAL B 1 24  ? -16.411 33.559 58.497  1.00 21.13 ? 418  VAL B CG2 1 
ATOM   1286 N N   . VAL B 1 25  ? -16.884 36.889 61.848  1.00 20.49 ? 419  VAL B N   1 
ATOM   1287 C CA  . VAL B 1 25  ? -17.435 37.562 63.035  1.00 20.60 ? 419  VAL B CA  1 
ATOM   1288 C C   . VAL B 1 25  ? -18.351 38.697 62.630  1.00 20.99 ? 419  VAL B C   1 
ATOM   1289 O O   . VAL B 1 25  ? -18.073 39.344 61.630  1.00 22.67 ? 419  VAL B O   1 
ATOM   1290 C CB  . VAL B 1 25  ? -16.304 38.034 63.998  1.00 21.91 ? 419  VAL B CB  1 
ATOM   1291 C CG1 . VAL B 1 25  ? -15.672 36.810 64.676  1.00 25.03 ? 419  VAL B CG1 1 
ATOM   1292 C CG2 . VAL B 1 25  ? -15.229 38.861 63.283  1.00 21.60 ? 419  VAL B CG2 1 
ATOM   1293 N N   . TRP B 1 26  ? -19.395 38.993 63.410  1.00 20.69 ? 420  TRP B N   1 
ATOM   1294 C CA  . TRP B 1 26  ? -20.344 40.027 63.037  1.00 20.76 ? 420  TRP B CA  1 
ATOM   1295 C C   . TRP B 1 26  ? -19.747 41.347 63.464  1.00 21.44 ? 420  TRP B C   1 
ATOM   1296 O O   . TRP B 1 26  ? -19.454 41.513 64.668  1.00 23.19 ? 420  TRP B O   1 
ATOM   1297 C CB  . TRP B 1 26  ? -21.659 39.888 63.823  1.00 20.58 ? 420  TRP B CB  1 
ATOM   1298 C CG  . TRP B 1 26  ? -22.681 40.875 63.368  1.00 22.14 ? 420  TRP B CG  1 
ATOM   1299 C CD1 . TRP B 1 26  ? -22.891 42.122 63.878  1.00 23.48 ? 420  TRP B CD1 1 
ATOM   1300 C CD2 . TRP B 1 26  ? -23.637 40.714 62.306  1.00 24.49 ? 420  TRP B CD2 1 
ATOM   1301 N NE1 . TRP B 1 26  ? -23.952 42.734 63.236  1.00 23.17 ? 420  TRP B NE1 1 
ATOM   1302 C CE2 . TRP B 1 26  ? -24.424 41.898 62.263  1.00 24.98 ? 420  TRP B CE2 1 
ATOM   1303 C CE3 . TRP B 1 26  ? -23.928 39.678 61.401  1.00 28.35 ? 420  TRP B CE3 1 
ATOM   1304 C CZ2 . TRP B 1 26  ? -25.472 42.085 61.328  1.00 25.63 ? 420  TRP B CZ2 1 
ATOM   1305 C CZ3 . TRP B 1 26  ? -24.971 39.870 60.459  1.00 23.04 ? 420  TRP B CZ3 1 
ATOM   1306 C CH2 . TRP B 1 26  ? -25.713 41.054 60.429  1.00 24.09 ? 420  TRP B CH2 1 
ATOM   1307 N N   . VAL B 1 27  ? -19.606 42.296 62.533  1.00 20.44 ? 421  VAL B N   1 
ATOM   1308 C CA  . VAL B 1 27  ? -19.133 43.640 62.918  1.00 21.73 ? 421  VAL B CA  1 
ATOM   1309 C C   . VAL B 1 27  ? -19.837 44.755 62.154  1.00 21.83 ? 421  VAL B C   1 
ATOM   1310 O O   . VAL B 1 27  ? -19.723 44.834 60.915  1.00 20.96 ? 421  VAL B O   1 
ATOM   1311 C CB  . VAL B 1 27  ? -17.621 43.814 62.652  1.00 21.90 ? 421  VAL B CB  1 
ATOM   1312 C CG1 . VAL B 1 27  ? -17.081 45.063 63.429  1.00 18.83 ? 421  VAL B CG1 1 
ATOM   1313 C CG2 . VAL B 1 27  ? -16.857 42.552 63.031  1.00 20.53 ? 421  VAL B CG2 1 
ATOM   1314 N N   . GLU B 1 28  ? -20.521 45.649 62.885  1.00 22.55 ? 422  GLU B N   1 
ATOM   1315 C CA  . GLU B 1 28  ? -21.173 46.792 62.269  1.00 23.62 ? 422  GLU B CA  1 
ATOM   1316 C C   . GLU B 1 28  ? -20.099 47.709 61.690  1.00 23.89 ? 422  GLU B C   1 
ATOM   1317 O O   . GLU B 1 28  ? -19.006 47.758 62.218  1.00 25.15 ? 422  GLU B O   1 
ATOM   1318 C CB  . GLU B 1 28  ? -22.028 47.529 63.313  1.00 23.59 ? 422  GLU B CB  1 
ATOM   1319 C CG  . GLU B 1 28  ? -23.107 46.627 63.905  1.00 26.48 ? 422  GLU B CG  1 
ATOM   1320 C CD  . GLU B 1 28  ? -24.155 46.082 62.900  1.00 27.63 ? 422  GLU B CD  1 
ATOM   1321 O OE1 . GLU B 1 28  ? -24.197 46.458 61.724  1.00 34.72 ? 422  GLU B OE1 1 
ATOM   1322 O OE2 . GLU B 1 28  ? -24.964 45.237 63.292  1.00 28.79 ? 422  GLU B OE2 1 
ATOM   1323 N N   . GLU B 1 29  ? -20.403 48.405 60.592  1.00 24.63 ? 423  GLU B N   1 
ATOM   1324 C CA  . GLU B 1 29  ? -19.469 49.322 59.921  1.00 24.86 ? 423  GLU B CA  1 
ATOM   1325 C C   . GLU B 1 29  ? -18.725 50.257 60.877  1.00 25.20 ? 423  GLU B C   1 
ATOM   1326 O O   . GLU B 1 29  ? -17.506 50.394 60.822  1.00 25.29 ? 423  GLU B O   1 
ATOM   1327 C CB  . GLU B 1 29  ? -20.233 50.160 58.877  1.00 24.68 ? 423  GLU B CB  1 
ATOM   1328 C CG  . GLU B 1 29  ? -20.664 49.395 57.639  1.00 23.07 ? 423  GLU B CG  1 
ATOM   1329 C CD  . GLU B 1 29  ? -19.458 48.752 56.938  1.00 26.94 ? 423  GLU B CD  1 
ATOM   1330 O OE1 . GLU B 1 29  ? -18.552 49.511 56.498  1.00 25.65 ? 423  GLU B OE1 1 
ATOM   1331 O OE2 . GLU B 1 29  ? -19.414 47.501 56.847  1.00 25.53 ? 423  GLU B OE2 1 
ATOM   1332 N N   . SER B 1 30  ? -19.489 50.907 61.747  1.00 26.05 ? 424  SER B N   1 
ATOM   1333 C CA  . SER B 1 30  ? -18.960 51.850 62.718  1.00 26.60 ? 424  SER B CA  1 
ATOM   1334 C C   . SER B 1 30  ? -18.038 51.248 63.800  1.00 27.36 ? 424  SER B C   1 
ATOM   1335 O O   . SER B 1 30  ? -17.499 52.004 64.616  1.00 27.19 ? 424  SER B O   1 
ATOM   1336 C CB  . SER B 1 30  ? -20.134 52.553 63.412  1.00 27.27 ? 424  SER B CB  1 
ATOM   1337 O OG  . SER B 1 30  ? -20.790 51.629 64.288  1.00 27.82 ? 424  SER B OG  1 
ATOM   1338 N N   . ASP B 1 31  ? -17.895 49.911 63.854  1.00 26.16 ? 425  ASP B N   1 
ATOM   1339 C CA  . ASP B 1 31  ? -17.009 49.284 64.829  1.00 26.33 ? 425  ASP B CA  1 
ATOM   1340 C C   . ASP B 1 31  ? -15.846 48.592 64.155  1.00 26.00 ? 425  ASP B C   1 
ATOM   1341 O O   . ASP B 1 31  ? -15.006 48.026 64.845  1.00 25.61 ? 425  ASP B O   1 
ATOM   1342 C CB  . ASP B 1 31  ? -17.739 48.228 65.662  1.00 27.82 ? 425  ASP B CB  1 
ATOM   1343 C CG  . ASP B 1 31  ? -18.812 48.816 66.562  1.00 31.02 ? 425  ASP B CG  1 
ATOM   1344 O OD1 . ASP B 1 31  ? -18.509 49.790 67.288  1.00 33.94 ? 425  ASP B OD1 1 
ATOM   1345 O OD2 . ASP B 1 31  ? -19.960 48.276 66.572  1.00 32.33 ? 425  ASP B OD2 1 
ATOM   1346 N N   . LYS B 1 32  ? -15.775 48.631 62.824  1.00 24.04 ? 426  LYS B N   1 
ATOM   1347 C CA  . LYS B 1 32  ? -14.738 47.878 62.136  1.00 24.27 ? 426  LYS B CA  1 
ATOM   1348 C C   . LYS B 1 32  ? -13.329 48.314 62.494  1.00 24.88 ? 426  LYS B C   1 
ATOM   1349 O O   . LYS B 1 32  ? -12.476 47.465 62.679  1.00 26.36 ? 426  LYS B O   1 
ATOM   1350 C CB  . LYS B 1 32  ? -14.943 47.857 60.640  1.00 23.17 ? 426  LYS B CB  1 
ATOM   1351 C CG  . LYS B 1 32  ? -15.929 46.749 60.224  1.00 23.53 ? 426  LYS B CG  1 
ATOM   1352 C CD  . LYS B 1 32  ? -16.199 46.796 58.759  1.00 23.43 ? 426  LYS B CD  1 
ATOM   1353 C CE  . LYS B 1 32  ? -17.178 45.713 58.338  1.00 26.94 ? 426  LYS B CE  1 
ATOM   1354 N NZ  . LYS B 1 32  ? -17.342 45.689 56.816  1.00 28.50 ? 426  LYS B NZ  1 
ATOM   1355 N N   . ARG B 1 33  ? -13.078 49.618 62.628  1.00 25.87 ? 427  ARG B N   1 
ATOM   1356 C CA  . ARG B 1 33  ? -11.729 50.088 62.927  1.00 25.74 ? 427  ARG B CA  1 
ATOM   1357 C C   . ARG B 1 33  ? -11.277 49.709 64.308  1.00 26.21 ? 427  ARG B C   1 
ATOM   1358 O O   . ARG B 1 33  ? -10.143 49.271 64.498  1.00 25.45 ? 427  ARG B O   1 
ATOM   1359 C CB  . ARG B 1 33  ? -11.630 51.587 62.735  1.00 27.38 ? 427  ARG B CB  1 
ATOM   1360 C CG  . ARG B 1 33  ? -11.694 52.000 61.270  1.00 25.44 ? 427  ARG B CG  1 
ATOM   1361 C CD  . ARG B 1 33  ? -11.243 53.468 61.151  1.00 28.48 ? 427  ARG B CD  1 
ATOM   1362 N NE  . ARG B 1 33  ? -11.282 53.844 59.749  1.00 28.28 ? 427  ARG B NE  1 
ATOM   1363 C CZ  . ARG B 1 33  ? -10.688 54.898 59.214  1.00 29.17 ? 427  ARG B CZ  1 
ATOM   1364 N NH1 . ARG B 1 33  ? -9.980  55.750 59.965  1.00 29.89 ? 427  ARG B NH1 1 
ATOM   1365 N NH2 . ARG B 1 33  ? -10.817 55.100 57.911  1.00 26.88 ? 427  ARG B NH2 1 
ATOM   1366 N N   . SER B 1 34  ? -12.175 49.872 65.269  1.00 26.54 ? 428  SER B N   1 
ATOM   1367 C CA  . SER B 1 34  ? -11.916 49.551 66.665  1.00 27.86 ? 428  SER B CA  1 
ATOM   1368 C C   . SER B 1 34  ? -11.669 48.050 66.825  1.00 26.76 ? 428  SER B C   1 
ATOM   1369 O O   . SER B 1 34  ? -10.709 47.637 67.453  1.00 25.97 ? 428  SER B O   1 
ATOM   1370 C CB  . SER B 1 34  ? -13.096 50.001 67.516  1.00 28.19 ? 428  SER B CB  1 
ATOM   1371 O OG  . SER B 1 34  ? -12.851 49.701 68.874  1.00 33.29 ? 428  SER B OG  1 
ATOM   1372 N N   . PHE B 1 35  ? -12.524 47.244 66.211  1.00 26.74 ? 429  PHE B N   1 
ATOM   1373 C CA  . PHE B 1 35  ? -12.329 45.802 66.098  1.00 25.55 ? 429  PHE B CA  1 
ATOM   1374 C C   . PHE B 1 35  ? -10.977 45.405 65.452  1.00 25.82 ? 429  PHE B C   1 
ATOM   1375 O O   . PHE B 1 35  ? -10.285 44.499 65.908  1.00 25.35 ? 429  PHE B O   1 
ATOM   1376 C CB  . PHE B 1 35  ? -13.478 45.280 65.245  1.00 27.10 ? 429  PHE B CB  1 
ATOM   1377 C CG  . PHE B 1 35  ? -13.884 43.888 65.556  1.00 26.52 ? 429  PHE B CG  1 
ATOM   1378 C CD1 . PHE B 1 35  ? -14.888 43.643 66.426  1.00 26.33 ? 429  PHE B CD1 1 
ATOM   1379 C CD2 . PHE B 1 35  ? -13.235 42.818 64.947  1.00 29.94 ? 429  PHE B CD2 1 
ATOM   1380 C CE1 . PHE B 1 35  ? -15.296 42.344 66.736  1.00 26.91 ? 429  PHE B CE1 1 
ATOM   1381 C CE2 . PHE B 1 35  ? -13.614 41.501 65.219  1.00 31.56 ? 429  PHE B CE2 1 
ATOM   1382 C CZ  . PHE B 1 35  ? -14.658 41.259 66.138  1.00 31.44 ? 429  PHE B CZ  1 
ATOM   1383 N N   . LEU B 1 36  ? -10.597 46.086 64.382  1.00 24.90 ? 430  LEU B N   1 
ATOM   1384 C CA  . LEU B 1 36  ? -9.365  45.734 63.712  1.00 24.34 ? 430  LEU B CA  1 
ATOM   1385 C C   . LEU B 1 36  ? -8.211  45.986 64.686  1.00 25.19 ? 430  LEU B C   1 
ATOM   1386 O O   . LEU B 1 36  ? -7.283  45.190 64.750  1.00 24.96 ? 430  LEU B O   1 
ATOM   1387 C CB  . LEU B 1 36  ? -9.199  46.581 62.456  1.00 23.22 ? 430  LEU B CB  1 
ATOM   1388 C CG  . LEU B 1 36  ? -7.839  46.455 61.720  1.00 23.33 ? 430  LEU B CG  1 
ATOM   1389 C CD1 . LEU B 1 36  ? -7.584  45.054 61.169  1.00 26.80 ? 430  LEU B CD1 1 
ATOM   1390 C CD2 . LEU B 1 36  ? -7.868  47.410 60.601  1.00 21.36 ? 430  LEU B CD2 1 
ATOM   1391 N N   . LEU B 1 37  ? -8.248  47.122 65.397  1.00 24.61 ? 431  LEU B N   1 
ATOM   1392 C CA  . LEU B 1 37  ? -7.158  47.469 66.317  1.00 25.80 ? 431  LEU B CA  1 
ATOM   1393 C C   . LEU B 1 37  ? -7.029  46.414 67.385  1.00 26.49 ? 431  LEU B C   1 
ATOM   1394 O O   . LEU B 1 37  ? -5.941  45.898 67.631  1.00 27.40 ? 431  LEU B O   1 
ATOM   1395 C CB  . LEU B 1 37  ? -7.419  48.814 66.998  1.00 26.41 ? 431  LEU B CB  1 
ATOM   1396 C CG  . LEU B 1 37  ? -7.251  50.012 66.084  1.00 27.38 ? 431  LEU B CG  1 
ATOM   1397 C CD1 . LEU B 1 37  ? -7.268  51.364 66.885  1.00 28.52 ? 431  LEU B CD1 1 
ATOM   1398 C CD2 . LEU B 1 37  ? -5.994  49.857 65.242  1.00 29.22 ? 431  LEU B CD2 1 
ATOM   1399 N N   . ASP B 1 38  ? -8.156  46.088 68.018  1.00 27.34 ? 432  ASP B N   1 
ATOM   1400 C CA  . ASP B 1 38  ? -8.186  45.040 69.029  1.00 28.17 ? 432  ASP B CA  1 
ATOM   1401 C C   . ASP B 1 38  ? -7.647  43.791 68.383  1.00 27.47 ? 432  ASP B C   1 
ATOM   1402 O O   . ASP B 1 38  ? -6.868  43.066 68.971  1.00 26.77 ? 432  ASP B O   1 
ATOM   1403 C CB  . ASP B 1 38  ? -9.607  44.781 69.524  1.00 29.05 ? 432  ASP B CB  1 
ATOM   1404 C CG  . ASP B 1 38  ? -10.176 45.935 70.367  1.00 34.81 ? 432  ASP B CG  1 
ATOM   1405 O OD1 . ASP B 1 38  ? -9.454  46.920 70.722  1.00 39.06 ? 432  ASP B OD1 1 
ATOM   1406 O OD2 . ASP B 1 38  ? -11.385 45.837 70.701  1.00 39.66 ? 432  ASP B OD2 1 
ATOM   1407 N N   . LEU B 1 39  ? -8.034  43.559 67.130  1.00 27.53 ? 433  LEU B N   1 
ATOM   1408 C CA  . LEU B 1 39  ? -7.643  42.342 66.475  1.00 27.27 ? 433  LEU B CA  1 
ATOM   1409 C C   . LEU B 1 39  ? -6.167  42.252 66.164  1.00 28.21 ? 433  LEU B C   1 
ATOM   1410 O O   . LEU B 1 39  ? -5.589  41.200 66.357  1.00 29.90 ? 433  LEU B O   1 
ATOM   1411 C CB  . LEU B 1 39  ? -8.573  41.991 65.271  1.00 26.93 ? 433  LEU B CB  1 
ATOM   1412 C CG  . LEU B 1 39  ? -8.304  40.672 64.533  1.00 25.71 ? 433  LEU B CG  1 
ATOM   1413 C CD1 . LEU B 1 39  ? -8.552  39.411 65.368  1.00 24.16 ? 433  LEU B CD1 1 
ATOM   1414 C CD2 . LEU B 1 39  ? -9.065  40.634 63.212  1.00 25.19 ? 433  LEU B CD2 1 
ATOM   1415 N N   . LEU B 1 40  ? -5.553  43.343 65.717  1.00 29.44 ? 434  LEU B N   1 
ATOM   1416 C CA  . LEU B 1 40  ? -4.112  43.424 65.510  1.00 31.19 ? 434  LEU B CA  1 
ATOM   1417 C C   . LEU B 1 40  ? -3.315  43.297 66.814  1.00 32.99 ? 434  LEU B C   1 
ATOM   1418 O O   . LEU B 1 40  ? -2.232  42.737 66.808  1.00 33.57 ? 434  LEU B O   1 
ATOM   1419 C CB  . LEU B 1 40  ? -3.761  44.745 64.830  1.00 29.88 ? 434  LEU B CB  1 
ATOM   1420 C CG  . LEU B 1 40  ? -4.291  44.849 63.387  1.00 30.02 ? 434  LEU B CG  1 
ATOM   1421 C CD1 . LEU B 1 40  ? -4.196  46.274 62.874  1.00 27.91 ? 434  LEU B CD1 1 
ATOM   1422 C CD2 . LEU B 1 40  ? -3.546  43.889 62.481  1.00 28.07 ? 434  LEU B CD2 1 
ATOM   1423 N N   . ASN B 1 41  ? -3.837  43.860 67.904  1.00 35.27 ? 435  ASN B N   1 
ATOM   1424 C CA  . ASN B 1 41  ? -3.265  43.676 69.256  1.00 37.20 ? 435  ASN B CA  1 
ATOM   1425 C C   . ASN B 1 41  ? -3.369  42.230 69.768  1.00 38.73 ? 435  ASN B C   1 
ATOM   1426 O O   . ASN B 1 41  ? -2.481  41.718 70.433  1.00 38.87 ? 435  ASN B O   1 
ATOM   1427 C CB  . ASN B 1 41  ? -3.997  44.568 70.258  1.00 36.86 ? 435  ASN B CB  1 
ATOM   1428 C CG  . ASN B 1 41  ? -3.792  46.034 70.006  1.00 36.69 ? 435  ASN B CG  1 
ATOM   1429 O OD1 . ASN B 1 41  ? -4.378  46.882 70.700  1.00 39.17 ? 435  ASN B OD1 1 
ATOM   1430 N ND2 . ASN B 1 41  ? -2.956  46.359 69.037  1.00 35.39 ? 435  ASN B ND2 1 
ATOM   1431 N N   . ALA B 1 42  ? -4.485  41.591 69.482  1.00 41.46 ? 436  ALA B N   1 
ATOM   1432 C CA  . ALA B 1 42  ? -4.791  40.296 70.083  1.00 43.67 ? 436  ALA B CA  1 
ATOM   1433 C C   . ALA B 1 42  ? -4.179  39.117 69.319  1.00 45.77 ? 436  ALA B C   1 
ATOM   1434 O O   . ALA B 1 42  ? -3.963  38.031 69.889  1.00 46.09 ? 436  ALA B O   1 
ATOM   1435 C CB  . ALA B 1 42  ? -6.294  40.131 70.228  1.00 43.52 ? 436  ALA B CB  1 
ATOM   1436 N N   . THR B 1 43  ? -3.919  39.320 68.026  1.00 47.82 ? 437  THR B N   1 
ATOM   1437 C CA  . THR B 1 43  ? -3.219  38.313 67.217  1.00 49.16 ? 437  THR B CA  1 
ATOM   1438 C C   . THR B 1 43  ? -1.718  38.531 67.342  1.00 50.04 ? 437  THR B C   1 
ATOM   1439 O O   . THR B 1 43  ? -0.937  37.607 67.099  1.00 51.42 ? 437  THR B O   1 
ATOM   1440 C CB  . THR B 1 43  ? -3.666  38.302 65.708  1.00 49.50 ? 437  THR B CB  1 
ATOM   1441 O OG1 . THR B 1 43  ? -5.088  38.522 65.598  1.00 48.95 ? 437  THR B OG1 1 
ATOM   1442 C CG2 . THR B 1 43  ? -3.292  36.958 65.025  1.00 48.42 ? 437  THR B CG2 1 
ATOM   1443 N N   . GLY B 1 44  ? -1.317  39.750 67.719  1.00 50.31 ? 438  GLY B N   1 
ATOM   1444 C CA  . GLY B 1 44  ? 0.106   40.117 67.815  1.00 50.32 ? 438  GLY B CA  1 
ATOM   1445 C C   . GLY B 1 44  ? 0.912   39.715 66.591  1.00 50.13 ? 438  GLY B C   1 
ATOM   1446 O O   . GLY B 1 44  ? 2.109   39.447 66.687  1.00 49.27 ? 438  GLY B O   1 
ATOM   1447 N N   . SER B 1 47  ? 4.867   40.500 61.903  1.00 38.52 ? 441  SER B N   1 
ATOM   1448 C CA  . SER B 1 47  ? 4.056   39.377 61.410  1.00 37.31 ? 441  SER B CA  1 
ATOM   1449 C C   . SER B 1 47  ? 3.020   39.739 60.279  1.00 35.51 ? 441  SER B C   1 
ATOM   1450 O O   . SER B 1 47  ? 2.080   40.557 60.504  1.00 36.04 ? 441  SER B O   1 
ATOM   1451 C CB  . SER B 1 47  ? 3.370   38.693 62.597  1.00 38.48 ? 441  SER B CB  1 
ATOM   1452 O OG  . SER B 1 47  ? 2.004   39.071 62.693  1.00 39.93 ? 441  SER B OG  1 
ATOM   1453 N N   . LEU B 1 48  ? 3.150   39.062 59.124  1.00 31.62 ? 442  LEU B N   1 
ATOM   1454 C CA  . LEU B 1 48  ? 2.525   39.455 57.840  1.00 29.20 ? 442  LEU B CA  1 
ATOM   1455 C C   . LEU B 1 48  ? 1.009   39.411 57.865  1.00 27.55 ? 442  LEU B C   1 
ATOM   1456 O O   . LEU B 1 48  ? 0.454   38.314 57.923  1.00 26.74 ? 442  LEU B O   1 
ATOM   1457 C CB  . LEU B 1 48  ? 2.912   38.458 56.745  1.00 29.74 ? 442  LEU B CB  1 
ATOM   1458 C CG  . LEU B 1 48  ? 4.365   38.424 56.292  1.00 31.07 ? 442  LEU B CG  1 
ATOM   1459 C CD1 . LEU B 1 48  ? 4.704   37.015 55.802  1.00 35.20 ? 442  LEU B CD1 1 
ATOM   1460 C CD2 . LEU B 1 48  ? 4.570   39.430 55.218  1.00 31.94 ? 442  LEU B CD2 1 
ATOM   1461 N N   . THR B 1 49  ? 0.348   40.568 57.811  1.00 23.83 ? 443  THR B N   1 
ATOM   1462 C CA  . THR B 1 49  ? -1.133  40.584 57.873  1.00 23.94 ? 443  THR B CA  1 
ATOM   1463 C C   . THR B 1 49  ? -1.616  41.299 56.604  1.00 23.20 ? 443  THR B C   1 
ATOM   1464 O O   . THR B 1 49  ? -1.161  42.393 56.332  1.00 19.86 ? 443  THR B O   1 
ATOM   1465 C CB  . THR B 1 49  ? -1.594  41.363 59.100  1.00 22.54 ? 443  THR B CB  1 
ATOM   1466 O OG1 . THR B 1 49  ? -1.064  40.698 60.259  1.00 23.77 ? 443  THR B OG1 1 
ATOM   1467 C CG2 . THR B 1 49  ? -3.105  41.379 59.167  1.00 24.90 ? 443  THR B CG2 1 
ATOM   1468 N N   . LEU B 1 50  ? -2.507  40.671 55.834  1.00 22.29 ? 444  LEU B N   1 
ATOM   1469 C CA  . LEU B 1 50  ? -3.001  41.317 54.616  1.00 23.05 ? 444  LEU B CA  1 
ATOM   1470 C C   . LEU B 1 50  ? -4.445  41.684 54.912  1.00 22.79 ? 444  LEU B C   1 
ATOM   1471 O O   . LEU B 1 50  ? -5.175  40.833 55.293  1.00 22.56 ? 444  LEU B O   1 
ATOM   1472 C CB  . LEU B 1 50  ? -2.965  40.300 53.525  1.00 23.59 ? 444  LEU B CB  1 
ATOM   1473 C CG  . LEU B 1 50  ? -3.629  40.654 52.205  1.00 27.44 ? 444  LEU B CG  1 
ATOM   1474 C CD1 . LEU B 1 50  ? -3.023  41.950 51.573  1.00 25.13 ? 444  LEU B CD1 1 
ATOM   1475 C CD2 . LEU B 1 50  ? -3.383  39.456 51.294  1.00 29.61 ? 444  LEU B CD2 1 
ATOM   1476 N N   . VAL B 1 51  ? -4.829  42.946 54.739  1.00 22.29 ? 445  VAL B N   1 
ATOM   1477 C CA  . VAL B 1 51  ? -6.172  43.414 55.140  1.00 19.87 ? 445  VAL B CA  1 
ATOM   1478 C C   . VAL B 1 51  ? -6.908  43.807 53.833  1.00 20.87 ? 445  VAL B C   1 
ATOM   1479 O O   . VAL B 1 51  ? -6.421  44.645 53.066  1.00 21.14 ? 445  VAL B O   1 
ATOM   1480 C CB  . VAL B 1 51  ? -6.112  44.619 56.105  1.00 19.69 ? 445  VAL B CB  1 
ATOM   1481 C CG1 . VAL B 1 51  ? -7.568  45.119 56.476  1.00 20.86 ? 445  VAL B CG1 1 
ATOM   1482 C CG2 . VAL B 1 51  ? -5.303  44.305 57.422  1.00 18.37 ? 445  VAL B CG2 1 
ATOM   1483 N N   . PHE B 1 52  ? -8.064  43.222 53.555  1.00 20.77 ? 446  PHE B N   1 
ATOM   1484 C CA  . PHE B 1 52  ? -8.693  43.542 52.274  1.00 20.79 ? 446  PHE B CA  1 
ATOM   1485 C C   . PHE B 1 52  ? -9.819  44.522 52.543  1.00 20.51 ? 446  PHE B C   1 
ATOM   1486 O O   . PHE B 1 52  ? -10.633 44.290 53.487  1.00 20.15 ? 446  PHE B O   1 
ATOM   1487 C CB  . PHE B 1 52  ? -9.247  42.281 51.598  1.00 21.48 ? 446  PHE B CB  1 
ATOM   1488 C CG  . PHE B 1 52  ? -8.228  41.452 50.864  1.00 23.75 ? 446  PHE B CG  1 
ATOM   1489 C CD1 . PHE B 1 52  ? -7.735  41.871 49.590  1.00 24.68 ? 446  PHE B CD1 1 
ATOM   1490 C CD2 . PHE B 1 52  ? -7.764  40.221 51.409  1.00 19.80 ? 446  PHE B CD2 1 
ATOM   1491 C CE1 . PHE B 1 52  ? -6.780  41.064 48.841  1.00 29.52 ? 446  PHE B CE1 1 
ATOM   1492 C CE2 . PHE B 1 52  ? -6.837  39.403 50.663  1.00 21.17 ? 446  PHE B CE2 1 
ATOM   1493 C CZ  . PHE B 1 52  ? -6.340  39.827 49.399  1.00 25.98 ? 446  PHE B CZ  1 
ATOM   1494 N N   . VAL B 1 53  ? -9.893  45.598 51.757  1.00 20.10 ? 447  VAL B N   1 
ATOM   1495 C CA  . VAL B 1 53  ? -10.992 46.577 51.895  1.00 21.19 ? 447  VAL B CA  1 
ATOM   1496 C C   . VAL B 1 53  ? -11.763 46.713 50.580  1.00 23.85 ? 447  VAL B C   1 
ATOM   1497 O O   . VAL B 1 53  ? -11.288 46.229 49.577  1.00 23.45 ? 447  VAL B O   1 
ATOM   1498 C CB  . VAL B 1 53  ? -10.552 47.976 52.366  1.00 21.61 ? 447  VAL B CB  1 
ATOM   1499 C CG1 . VAL B 1 53  ? -10.094 47.941 53.821  1.00 20.58 ? 447  VAL B CG1 1 
ATOM   1500 C CG2 . VAL B 1 53  ? -9.484  48.546 51.507  1.00 19.87 ? 447  VAL B CG2 1 
ATOM   1501 N N   . GLU B 1 54  ? -12.943 47.358 50.599  1.00 24.97 ? 448  GLU B N   1 
ATOM   1502 C CA  . GLU B 1 54  ? -13.794 47.462 49.377  1.00 26.80 ? 448  GLU B CA  1 
ATOM   1503 C C   . GLU B 1 54  ? -13.326 48.477 48.336  1.00 26.62 ? 448  GLU B C   1 
ATOM   1504 O O   . GLU B 1 54  ? -13.376 48.200 47.147  1.00 26.71 ? 448  GLU B O   1 
ATOM   1505 C CB  . GLU B 1 54  ? -15.229 47.804 49.759  1.00 26.21 ? 448  GLU B CB  1 
ATOM   1506 C CG  . GLU B 1 54  ? -16.297 47.884 48.626  1.00 27.35 ? 448  GLU B CG  1 
ATOM   1507 C CD  . GLU B 1 54  ? -17.752 48.008 49.217  1.00 32.78 ? 448  GLU B CD  1 
ATOM   1508 O OE1 . GLU B 1 54  ? -18.305 46.983 49.712  1.00 39.34 ? 448  GLU B OE1 1 
ATOM   1509 O OE2 . GLU B 1 54  ? -18.335 49.132 49.189  1.00 41.99 ? 448  GLU B OE2 1 
ATOM   1510 N N   . THR B 1 55  ? -12.907 49.655 48.775  1.00 26.36 ? 449  THR B N   1 
ATOM   1511 C CA  . THR B 1 55  ? -12.698 50.785 47.835  1.00 24.91 ? 449  THR B CA  1 
ATOM   1512 C C   . THR B 1 55  ? -11.317 51.411 48.034  1.00 24.31 ? 449  THR B C   1 
ATOM   1513 O O   . THR B 1 55  ? -10.691 51.260 49.109  1.00 23.63 ? 449  THR B O   1 
ATOM   1514 C CB  . THR B 1 55  ? -13.743 51.913 48.063  1.00 25.98 ? 449  THR B CB  1 
ATOM   1515 O OG1 . THR B 1 55  ? -13.492 52.540 49.343  1.00 28.31 ? 449  THR B OG1 1 
ATOM   1516 C CG2 . THR B 1 55  ? -15.229 51.396 48.011  1.00 24.03 ? 449  THR B CG2 1 
ATOM   1517 N N   . LYS B 1 56  ? -10.833 52.091 46.988  1.00 23.91 ? 450  LYS B N   1 
ATOM   1518 C CA  . LYS B 1 56  ? -9.643  52.944 47.065  1.00 24.04 ? 450  LYS B CA  1 
ATOM   1519 C C   . LYS B 1 56  ? -9.667  53.951 48.214  1.00 24.39 ? 450  LYS B C   1 
ATOM   1520 O O   . LYS B 1 56  ? -8.687  54.080 48.951  1.00 24.80 ? 450  LYS B O   1 
ATOM   1521 C CB  . LYS B 1 56  ? -9.463  53.723 45.756  1.00 24.75 ? 450  LYS B CB  1 
ATOM   1522 C CG  . LYS B 1 56  ? -9.083  52.882 44.548  1.00 26.57 ? 450  LYS B CG  1 
ATOM   1523 C CD  . LYS B 1 56  ? -9.193  53.703 43.261  1.00 21.72 ? 450  LYS B CD  1 
ATOM   1524 C CE  . LYS B 1 56  ? -10.615 53.595 42.693  1.00 16.58 ? 450  LYS B CE  1 
ATOM   1525 N NZ  . LYS B 1 56  ? -10.962 54.905 42.208  1.00 32.07 ? 450  LYS B NZ  1 
ATOM   1526 N N   . LYS B 1 57  ? -10.769 54.694 48.352  1.00 24.73 ? 451  LYS B N   1 
ATOM   1527 C CA  . LYS B 1 57  ? -10.893 55.640 49.472  1.00 24.82 ? 451  LYS B CA  1 
ATOM   1528 C C   . LYS B 1 57  ? -10.810 54.947 50.837  1.00 24.08 ? 451  LYS B C   1 
ATOM   1529 O O   . LYS B 1 57  ? -10.237 55.504 51.785  1.00 23.76 ? 451  LYS B O   1 
ATOM   1530 C CB  . LYS B 1 57  ? -12.179 56.431 49.384  1.00 26.00 ? 451  LYS B CB  1 
ATOM   1531 C CG  . LYS B 1 57  ? -12.011 57.868 49.897  1.00 28.69 ? 451  LYS B CG  1 
ATOM   1532 C CD  . LYS B 1 57  ? -13.354 58.572 50.107  1.00 33.77 ? 451  LYS B CD  1 
ATOM   1533 C CE  . LYS B 1 57  ? -13.866 58.453 51.552  1.00 35.44 ? 451  LYS B CE  1 
ATOM   1534 N NZ  . LYS B 1 57  ? -15.370 58.625 51.591  1.00 36.55 ? 451  LYS B NZ  1 
ATOM   1535 N N   . GLY B 1 58  ? -11.392 53.750 50.939  1.00 22.90 ? 452  GLY B N   1 
ATOM   1536 C CA  . GLY B 1 58  ? -11.275 52.914 52.135  1.00 23.19 ? 452  GLY B CA  1 
ATOM   1537 C C   . GLY B 1 58  ? -9.855  52.465 52.430  1.00 23.13 ? 452  GLY B C   1 
ATOM   1538 O O   . GLY B 1 58  ? -9.416  52.514 53.592  1.00 24.21 ? 452  GLY B O   1 
ATOM   1539 N N   . ALA B 1 59  ? -9.143  51.991 51.406  1.00 22.90 ? 453  ALA B N   1 
ATOM   1540 C CA  . ALA B 1 59  ? -7.756  51.547 51.587  1.00 23.18 ? 453  ALA B CA  1 
ATOM   1541 C C   . ALA B 1 59  ? -6.885  52.691 52.103  1.00 23.68 ? 453  ALA B C   1 
ATOM   1542 O O   . ALA B 1 59  ? -6.179  52.501 53.071  1.00 23.59 ? 453  ALA B O   1 
ATOM   1543 C CB  . ALA B 1 59  ? -7.165  50.967 50.287  1.00 23.88 ? 453  ALA B CB  1 
ATOM   1544 N N   . ASP B 1 60  ? -6.962  53.869 51.460  1.00 23.86 ? 454  ASP B N   1 
ATOM   1545 C CA  . ASP B 1 60  ? -6.238  55.094 51.871  1.00 24.72 ? 454  ASP B CA  1 
ATOM   1546 C C   . ASP B 1 60  ? -6.493  55.536 53.304  1.00 25.45 ? 454  ASP B C   1 
ATOM   1547 O O   . ASP B 1 60  ? -5.566  55.842 54.059  1.00 25.64 ? 454  ASP B O   1 
ATOM   1548 C CB  . ASP B 1 60  ? -6.673  56.264 50.961  1.00 26.00 ? 454  ASP B CB  1 
ATOM   1549 C CG  . ASP B 1 60  ? -5.854  56.361 49.723  1.00 27.62 ? 454  ASP B CG  1 
ATOM   1550 O OD1 . ASP B 1 60  ? -4.725  55.839 49.763  1.00 29.27 ? 454  ASP B OD1 1 
ATOM   1551 O OD2 . ASP B 1 60  ? -6.320  56.978 48.717  1.00 30.30 ? 454  ASP B OD2 1 
ATOM   1552 N N   . SER B 1 61  ? -7.769  55.623 53.648  1.00 25.65 ? 455  SER B N   1 
ATOM   1553 C CA  . SER B 1 61  ? -8.208  56.096 54.939  1.00 27.36 ? 455  SER B CA  1 
ATOM   1554 C C   . SER B 1 61  ? -7.848  55.138 56.086  1.00 27.03 ? 455  SER B C   1 
ATOM   1555 O O   . SER B 1 61  ? -7.491  55.576 57.191  1.00 27.32 ? 455  SER B O   1 
ATOM   1556 C CB  . SER B 1 61  ? -9.719  56.313 54.902  1.00 27.00 ? 455  SER B CB  1 
ATOM   1557 O OG  . SER B 1 61  ? -10.199 56.609 56.202  1.00 31.90 ? 455  SER B OG  1 
ATOM   1558 N N   . LEU B 1 62  ? -7.999  53.836 55.839  1.00 27.65 ? 456  LEU B N   1 
ATOM   1559 C CA  . LEU B 1 62  ? -7.578  52.822 56.800  1.00 26.38 ? 456  LEU B CA  1 
ATOM   1560 C C   . LEU B 1 62  ? -6.045  52.853 57.014  1.00 26.85 ? 456  LEU B C   1 
ATOM   1561 O O   . LEU B 1 62  ? -5.564  52.733 58.162  1.00 25.62 ? 456  LEU B O   1 
ATOM   1562 C CB  . LEU B 1 62  ? -8.033  51.450 56.333  1.00 26.80 ? 456  LEU B CB  1 
ATOM   1563 C CG  . LEU B 1 62  ? -7.941  50.336 57.378  1.00 25.68 ? 456  LEU B CG  1 
ATOM   1564 C CD1 . LEU B 1 62  ? -8.766  50.701 58.658  1.00 25.88 ? 456  LEU B CD1 1 
ATOM   1565 C CD2 . LEU B 1 62  ? -8.389  48.975 56.790  1.00 26.12 ? 456  LEU B CD2 1 
ATOM   1566 N N   . GLU B 1 63  ? -5.277  53.029 55.935  1.00 26.22 ? 457  GLU B N   1 
ATOM   1567 C CA  . GLU B 1 63  ? -3.809  53.056 56.084  1.00 27.81 ? 457  GLU B CA  1 
ATOM   1568 C C   . GLU B 1 63  ? -3.424  54.235 56.957  1.00 27.17 ? 457  GLU B C   1 
ATOM   1569 O O   . GLU B 1 63  ? -2.545  54.123 57.816  1.00 26.92 ? 457  GLU B O   1 
ATOM   1570 C CB  . GLU B 1 63  ? -3.071  53.120 54.736  1.00 27.90 ? 457  GLU B CB  1 
ATOM   1571 C CG  . GLU B 1 63  ? -1.556  53.377 54.872  1.00 30.63 ? 457  GLU B CG  1 
ATOM   1572 C CD  . GLU B 1 63  ? -0.912  53.717 53.547  1.00 31.06 ? 457  GLU B CD  1 
ATOM   1573 O OE1 . GLU B 1 63  ? -1.655  54.110 52.613  1.00 36.38 ? 457  GLU B OE1 1 
ATOM   1574 O OE2 . GLU B 1 63  ? 0.332   53.605 53.439  1.00 35.91 ? 457  GLU B OE2 1 
ATOM   1575 N N   . ASP B 1 64  ? -4.093  55.368 56.754  1.00 27.69 ? 458  ASP B N   1 
ATOM   1576 C CA  . ASP B 1 64  ? -3.796  56.547 57.541  1.00 27.97 ? 458  ASP B CA  1 
ATOM   1577 C C   . ASP B 1 64  ? -4.200  56.283 58.984  1.00 27.91 ? 458  ASP B C   1 
ATOM   1578 O O   . ASP B 1 64  ? -3.426  56.538 59.901  1.00 27.68 ? 458  ASP B O   1 
ATOM   1579 C CB  . ASP B 1 64  ? -4.462  57.792 56.948  1.00 28.56 ? 458  ASP B CB  1 
ATOM   1580 C CG  . ASP B 1 64  ? -3.815  58.236 55.595  1.00 31.03 ? 458  ASP B CG  1 
ATOM   1581 O OD1 . ASP B 1 64  ? -2.628  57.862 55.311  1.00 29.73 ? 458  ASP B OD1 1 
ATOM   1582 O OD2 . ASP B 1 64  ? -4.503  58.980 54.828  1.00 33.10 ? 458  ASP B OD2 1 
ATOM   1583 N N   . PHE B 1 65  ? -5.377  55.692 59.175  1.00 27.30 ? 459  PHE B N   1 
ATOM   1584 C CA  . PHE B 1 65  ? -5.815  55.244 60.508  1.00 27.78 ? 459  PHE B CA  1 
ATOM   1585 C C   . PHE B 1 65  ? -4.778  54.394 61.251  1.00 27.65 ? 459  PHE B C   1 
ATOM   1586 O O   . PHE B 1 65  ? -4.442  54.687 62.402  1.00 27.42 ? 459  PHE B O   1 
ATOM   1587 C CB  . PHE B 1 65  ? -7.107  54.447 60.385  1.00 27.69 ? 459  PHE B CB  1 
ATOM   1588 C CG  . PHE B 1 65  ? -7.634  53.945 61.693  1.00 29.43 ? 459  PHE B CG  1 
ATOM   1589 C CD1 . PHE B 1 65  ? -8.221  54.818 62.608  1.00 31.19 ? 459  PHE B CD1 1 
ATOM   1590 C CD2 . PHE B 1 65  ? -7.544  52.604 62.013  1.00 30.23 ? 459  PHE B CD2 1 
ATOM   1591 C CE1 . PHE B 1 65  ? -8.717  54.338 63.797  1.00 30.66 ? 459  PHE B CE1 1 
ATOM   1592 C CE2 . PHE B 1 65  ? -8.026  52.130 63.198  1.00 30.75 ? 459  PHE B CE2 1 
ATOM   1593 C CZ  . PHE B 1 65  ? -8.608  52.990 64.090  1.00 30.00 ? 459  PHE B CZ  1 
ATOM   1594 N N   . LEU B 1 66  ? -4.291  53.341 60.584  1.00 27.90 ? 460  LEU B N   1 
ATOM   1595 C CA  . LEU B 1 66  ? -3.302  52.422 61.155  1.00 27.95 ? 460  LEU B CA  1 
ATOM   1596 C C   . LEU B 1 66  ? -1.937  53.081 61.393  1.00 29.45 ? 460  LEU B C   1 
ATOM   1597 O O   . LEU B 1 66  ? -1.265  52.756 62.381  1.00 29.43 ? 460  LEU B O   1 
ATOM   1598 C CB  . LEU B 1 66  ? -3.160  51.155 60.292  1.00 27.65 ? 460  LEU B CB  1 
ATOM   1599 C CG  . LEU B 1 66  ? -4.354  50.174 60.279  1.00 24.70 ? 460  LEU B CG  1 
ATOM   1600 C CD1 . LEU B 1 66  ? -4.159  49.007 59.308  1.00 23.84 ? 460  LEU B CD1 1 
ATOM   1601 C CD2 . LEU B 1 66  ? -4.677  49.647 61.709  1.00 22.88 ? 460  LEU B CD2 1 
ATOM   1602 N N   . TYR B 1 67  ? -1.544  53.975 60.479  1.00 30.38 ? 461  TYR B N   1 
ATOM   1603 C CA  . TYR B 1 67  ? -0.303  54.752 60.558  1.00 31.50 ? 461  TYR B CA  1 
ATOM   1604 C C   . TYR B 1 67  ? -0.363  55.653 61.793  1.00 31.92 ? 461  TYR B C   1 
ATOM   1605 O O   . TYR B 1 67  ? 0.599   55.732 62.565  1.00 32.37 ? 461  TYR B O   1 
ATOM   1606 C CB  . TYR B 1 67  ? -0.079  55.546 59.241  1.00 31.39 ? 461  TYR B CB  1 
ATOM   1607 C CG  . TYR B 1 67  ? 1.261   56.296 59.059  1.00 31.91 ? 461  TYR B CG  1 
ATOM   1608 C CD1 . TYR B 1 67  ? 2.449   55.838 59.653  1.00 33.26 ? 461  TYR B CD1 1 
ATOM   1609 C CD2 . TYR B 1 67  ? 1.339   57.445 58.249  1.00 33.30 ? 461  TYR B CD2 1 
ATOM   1610 C CE1 . TYR B 1 67  ? 3.672   56.520 59.478  1.00 31.27 ? 461  TYR B CE1 1 
ATOM   1611 C CE2 . TYR B 1 67  ? 2.554   58.125 58.063  1.00 33.69 ? 461  TYR B CE2 1 
ATOM   1612 C CZ  . TYR B 1 67  ? 3.718   57.654 58.689  1.00 33.13 ? 461  TYR B CZ  1 
ATOM   1613 O OH  . TYR B 1 67  ? 4.927   58.307 58.526  1.00 31.01 ? 461  TYR B OH  1 
ATOM   1614 N N   . HIS B 1 68  ? -1.512  56.287 62.001  1.00 32.37 ? 462  HIS B N   1 
ATOM   1615 C CA  . HIS B 1 68  ? -1.736  57.108 63.174  1.00 33.33 ? 462  HIS B CA  1 
ATOM   1616 C C   . HIS B 1 68  ? -1.638  56.323 64.475  1.00 33.15 ? 462  HIS B C   1 
ATOM   1617 O O   . HIS B 1 68  ? -0.993  56.771 65.418  1.00 33.22 ? 462  HIS B O   1 
ATOM   1618 C CB  . HIS B 1 68  ? -3.075  57.839 63.092  1.00 33.58 ? 462  HIS B CB  1 
ATOM   1619 C CG  . HIS B 1 68  ? -2.943  59.264 62.652  1.00 35.80 ? 462  HIS B CG  1 
ATOM   1620 N ND1 . HIS B 1 68  ? -3.194  59.669 61.358  1.00 37.34 ? 462  HIS B ND1 1 
ATOM   1621 C CD2 . HIS B 1 68  ? -2.559  60.376 63.327  1.00 37.84 ? 462  HIS B CD2 1 
ATOM   1622 C CE1 . HIS B 1 68  ? -2.982  60.971 61.255  1.00 38.04 ? 462  HIS B CE1 1 
ATOM   1623 N NE2 . HIS B 1 68  ? -2.600  61.425 62.437  1.00 38.79 ? 462  HIS B NE2 1 
ATOM   1624 N N   . GLU B 1 69  ? -2.254  55.146 64.501  1.00 33.01 ? 463  GLU B N   1 
ATOM   1625 C CA  . GLU B 1 69  ? -2.316  54.279 65.696  1.00 32.76 ? 463  GLU B CA  1 
ATOM   1626 C C   . GLU B 1 69  ? -1.006  53.533 66.029  1.00 32.71 ? 463  GLU B C   1 
ATOM   1627 O O   . GLU B 1 69  ? -0.975  52.715 66.957  1.00 32.66 ? 463  GLU B O   1 
ATOM   1628 C CB  . GLU B 1 69  ? -3.479  53.283 65.564  1.00 32.60 ? 463  GLU B CB  1 
ATOM   1629 C CG  . GLU B 1 69  ? -4.866  53.911 65.492  1.00 32.68 ? 463  GLU B CG  1 
ATOM   1630 C CD  . GLU B 1 69  ? -5.296  54.625 66.768  1.00 35.18 ? 463  GLU B CD  1 
ATOM   1631 O OE1 . GLU B 1 69  ? -5.068  54.100 67.888  1.00 34.52 ? 463  GLU B OE1 1 
ATOM   1632 O OE2 . GLU B 1 69  ? -5.881  55.723 66.643  1.00 36.30 ? 463  GLU B OE2 1 
ATOM   1633 N N   . GLY B 1 70  ? 0.060   53.819 65.279  1.00 32.69 ? 464  GLY B N   1 
ATOM   1634 C CA  . GLY B 1 70  ? 1.398   53.265 65.549  1.00 32.06 ? 464  GLY B CA  1 
ATOM   1635 C C   . GLY B 1 70  ? 1.914   52.160 64.629  1.00 32.11 ? 464  GLY B C   1 
ATOM   1636 O O   . GLY B 1 70  ? 3.059   51.703 64.777  1.00 31.00 ? 464  GLY B O   1 
ATOM   1637 N N   . TYR B 1 71  ? 1.083   51.722 63.680  1.00 31.02 ? 465  TYR B N   1 
ATOM   1638 C CA  . TYR B 1 71  ? 1.433   50.575 62.857  1.00 31.52 ? 465  TYR B CA  1 
ATOM   1639 C C   . TYR B 1 71  ? 2.226   50.962 61.602  1.00 31.51 ? 465  TYR B C   1 
ATOM   1640 O O   . TYR B 1 71  ? 1.954   52.001 60.978  1.00 32.34 ? 465  TYR B O   1 
ATOM   1641 C CB  . TYR B 1 71  ? 0.185   49.753 62.507  1.00 31.61 ? 465  TYR B CB  1 
ATOM   1642 C CG  . TYR B 1 71  ? -0.430  49.053 63.700  1.00 31.28 ? 465  TYR B CG  1 
ATOM   1643 C CD1 . TYR B 1 71  ? -0.018  47.776 64.065  1.00 33.02 ? 465  TYR B CD1 1 
ATOM   1644 C CD2 . TYR B 1 71  ? -1.408  49.670 64.459  1.00 30.91 ? 465  TYR B CD2 1 
ATOM   1645 C CE1 . TYR B 1 71  ? -0.555  47.130 65.177  1.00 33.63 ? 465  TYR B CE1 1 
ATOM   1646 C CE2 . TYR B 1 71  ? -1.949  49.058 65.557  1.00 33.94 ? 465  TYR B CE2 1 
ATOM   1647 C CZ  . TYR B 1 71  ? -1.534  47.778 65.909  1.00 33.03 ? 465  TYR B CZ  1 
ATOM   1648 O OH  . TYR B 1 71  ? -2.098  47.167 66.989  1.00 32.42 ? 465  TYR B OH  1 
ATOM   1649 N N   . ALA B 1 72  ? 3.240   50.151 61.284  1.00 30.49 ? 466  ALA B N   1 
ATOM   1650 C CA  . ALA B 1 72  ? 4.009   50.290 60.051  1.00 29.86 ? 466  ALA B CA  1 
ATOM   1651 C C   . ALA B 1 72  ? 3.240   49.471 59.005  1.00 29.51 ? 466  ALA B C   1 
ATOM   1652 O O   . ALA B 1 72  ? 3.046   48.252 59.141  1.00 28.74 ? 466  ALA B O   1 
ATOM   1653 C CB  . ALA B 1 72  ? 5.438   49.765 60.227  1.00 30.36 ? 466  ALA B CB  1 
ATOM   1654 N N   . CYS B 1 73  ? 2.741   50.167 58.004  1.00 27.33 ? 467  CYS B N   1 
ATOM   1655 C CA  . CYS B 1 73  ? 1.815   49.530 57.073  1.00 27.44 ? 467  CYS B CA  1 
ATOM   1656 C C   . CYS B 1 73  ? 1.935   50.208 55.754  1.00 25.83 ? 467  CYS B C   1 
ATOM   1657 O O   . CYS B 1 73  ? 2.566   51.291 55.659  1.00 25.22 ? 467  CYS B O   1 
ATOM   1658 C CB  . CYS B 1 73  ? 0.365   49.566 57.575  1.00 28.30 ? 467  CYS B CB  1 
ATOM   1659 S SG  . CYS B 1 73  ? -0.307  51.221 57.788  1.00 32.62 ? 467  CYS B SG  1 
ATOM   1660 N N   . THR B 1 74  ? 1.411   49.547 54.738  1.00 23.62 ? 468  THR B N   1 
ATOM   1661 C CA  . THR B 1 74  ? 1.418   50.077 53.384  1.00 23.69 ? 468  THR B CA  1 
ATOM   1662 C C   . THR B 1 74  ? 0.080   49.748 52.733  1.00 23.74 ? 468  THR B C   1 
ATOM   1663 O O   . THR B 1 74  ? -0.788  49.098 53.362  1.00 23.34 ? 468  THR B O   1 
ATOM   1664 C CB  . THR B 1 74  ? 2.679   49.594 52.588  1.00 23.83 ? 468  THR B CB  1 
ATOM   1665 O OG1 . THR B 1 74  ? 2.767   50.288 51.336  1.00 25.76 ? 468  THR B OG1 1 
ATOM   1666 C CG2 . THR B 1 74  ? 2.646   48.108 52.347  1.00 23.68 ? 468  THR B CG2 1 
ATOM   1667 N N   . SER B 1 75  ? -0.129  50.209 51.509  1.00 23.09 ? 469  SER B N   1 
ATOM   1668 C CA  . SER B 1 75  ? -1.399  49.964 50.858  1.00 24.06 ? 469  SER B CA  1 
ATOM   1669 C C   . SER B 1 75  ? -1.227  49.799 49.355  1.00 24.79 ? 469  SER B C   1 
ATOM   1670 O O   . SER B 1 75  ? -0.293  50.372 48.742  1.00 24.54 ? 469  SER B O   1 
ATOM   1671 C CB  . SER B 1 75  ? -2.407  51.086 51.158  1.00 23.60 ? 469  SER B CB  1 
ATOM   1672 O OG  . SER B 1 75  ? -1.961  52.312 50.622  1.00 25.36 ? 469  SER B OG  1 
ATOM   1673 N N   . ILE B 1 76  ? -2.095  48.982 48.763  1.00 24.30 ? 470  ILE B N   1 
ATOM   1674 C CA  . ILE B 1 76  ? -2.171  48.914 47.313  1.00 24.85 ? 470  ILE B CA  1 
ATOM   1675 C C   . ILE B 1 76  ? -3.604  49.071 46.891  1.00 23.87 ? 470  ILE B C   1 
ATOM   1676 O O   . ILE B 1 76  ? -4.462  48.438 47.442  1.00 22.90 ? 470  ILE B O   1 
ATOM   1677 C CB  . ILE B 1 76  ? -1.562  47.622 46.716  1.00 24.40 ? 470  ILE B CB  1 
ATOM   1678 C CG1 . ILE B 1 76  ? -2.299  46.387 47.196  1.00 26.78 ? 470  ILE B CG1 1 
ATOM   1679 C CG2 . ILE B 1 76  ? -0.048  47.501 47.105  1.00 27.98 ? 470  ILE B CG2 1 
ATOM   1680 C CD1 . ILE B 1 76  ? -1.792  45.062 46.540  1.00 27.51 ? 470  ILE B CD1 1 
ATOM   1681 N N   . HIS B 1 77  ? -3.865  49.931 45.894  1.00 23.34 ? 471  HIS B N   1 
ATOM   1682 C CA  . HIS B 1 77  ? -5.219  50.014 45.317  1.00 22.40 ? 471  HIS B CA  1 
ATOM   1683 C C   . HIS B 1 77  ? -5.125  50.473 43.892  1.00 22.85 ? 471  HIS B C   1 
ATOM   1684 O O   . HIS B 1 77  ? -4.030  50.729 43.414  1.00 20.58 ? 471  HIS B O   1 
ATOM   1685 C CB  . HIS B 1 77  ? -6.150  50.926 46.124  1.00 21.90 ? 471  HIS B CB  1 
ATOM   1686 C CG  . HIS B 1 77  ? -5.695  52.349 46.243  1.00 22.19 ? 471  HIS B CG  1 
ATOM   1687 N ND1 . HIS B 1 77  ? -5.317  52.910 47.444  1.00 24.81 ? 471  HIS B ND1 1 
ATOM   1688 C CD2 . HIS B 1 77  ? -5.591  53.334 45.320  1.00 20.75 ? 471  HIS B CD2 1 
ATOM   1689 C CE1 . HIS B 1 77  ? -5.004  54.180 47.252  1.00 21.01 ? 471  HIS B CE1 1 
ATOM   1690 N NE2 . HIS B 1 77  ? -5.150  54.457 45.972  1.00 22.50 ? 471  HIS B NE2 1 
ATOM   1691 N N   . GLY B 1 78  ? -6.279  50.605 43.237  1.00 23.46 ? 472  GLY B N   1 
ATOM   1692 C CA  . GLY B 1 78  ? -6.355  51.028 41.819  1.00 23.55 ? 472  GLY B CA  1 
ATOM   1693 C C   . GLY B 1 78  ? -5.668  52.309 41.411  1.00 23.92 ? 472  GLY B C   1 
ATOM   1694 O O   . GLY B 1 78  ? -5.182  52.431 40.266  1.00 25.19 ? 472  GLY B O   1 
ATOM   1695 N N   . ASP B 1 79  ? -5.599  53.278 42.315  1.00 23.43 ? 473  ASP B N   1 
ATOM   1696 C CA  . ASP B 1 79  ? -4.925  54.540 42.001  1.00 23.73 ? 473  ASP B CA  1 
ATOM   1697 C C   . ASP B 1 79  ? -3.441  54.614 42.412  1.00 24.68 ? 473  ASP B C   1 
ATOM   1698 O O   . ASP B 1 79  ? -2.829  55.664 42.274  1.00 23.27 ? 473  ASP B O   1 
ATOM   1699 C CB  . ASP B 1 79  ? -5.733  55.745 42.511  1.00 22.84 ? 473  ASP B CB  1 
ATOM   1700 C CG  . ASP B 1 79  ? -6.914  56.085 41.596  1.00 23.86 ? 473  ASP B CG  1 
ATOM   1701 O OD1 . ASP B 1 79  ? -6.910  55.651 40.422  1.00 19.91 ? 473  ASP B OD1 1 
ATOM   1702 O OD2 . ASP B 1 79  ? -7.841  56.804 42.043  1.00 25.07 ? 473  ASP B OD2 1 
ATOM   1703 N N   . ARG B 1 80  ? -2.855  53.510 42.875  1.00 25.30 ? 474  ARG B N   1 
ATOM   1704 C CA  . ARG B 1 80  ? -1.383  53.483 43.103  1.00 26.74 ? 474  ARG B CA  1 
ATOM   1705 C C   . ARG B 1 80  ? -0.578  53.189 41.828  1.00 26.60 ? 474  ARG B C   1 
ATOM   1706 O O   . ARG B 1 80  ? -0.856  52.208 41.135  1.00 26.72 ? 474  ARG B O   1 
ATOM   1707 C CB  . ARG B 1 80  ? -1.007  52.432 44.144  1.00 27.55 ? 474  ARG B CB  1 
ATOM   1708 C CG  . ARG B 1 80  ? -1.584  52.661 45.501  1.00 31.20 ? 474  ARG B CG  1 
ATOM   1709 C CD  . ARG B 1 80  ? -0.764  53.718 46.230  1.00 37.02 ? 474  ARG B CD  1 
ATOM   1710 N NE  . ARG B 1 80  ? -1.268  53.820 47.593  1.00 41.93 ? 474  ARG B NE  1 
ATOM   1711 C CZ  . ARG B 1 80  ? -1.981  54.846 48.048  1.00 44.85 ? 474  ARG B CZ  1 
ATOM   1712 N NH1 . ARG B 1 80  ? -2.239  55.892 47.254  1.00 45.50 ? 474  ARG B NH1 1 
ATOM   1713 N NH2 . ARG B 1 80  ? -2.415  54.843 49.304  1.00 44.11 ? 474  ARG B NH2 1 
ATOM   1714 N N   . SER B 1 81  ? 0.450   53.995 41.565  1.00 27.27 ? 475  SER B N   1 
ATOM   1715 C CA  . SER B 1 81  ? 1.383   53.759 40.437  1.00 28.46 ? 475  SER B CA  1 
ATOM   1716 C C   . SER B 1 81  ? 1.999   52.355 40.503  1.00 29.38 ? 475  SER B C   1 
ATOM   1717 O O   . SER B 1 81  ? 2.035   51.726 41.568  1.00 27.42 ? 475  SER B O   1 
ATOM   1718 C CB  . SER B 1 81  ? 2.487   54.799 40.420  1.00 28.25 ? 475  SER B CB  1 
ATOM   1719 O OG  . SER B 1 81  ? 3.538   54.447 41.308  1.00 29.03 ? 475  SER B OG  1 
ATOM   1720 N N   . GLN B 1 82  ? 2.477   51.853 39.371  1.00 30.14 ? 476  GLN B N   1 
ATOM   1721 C CA  . GLN B 1 82  ? 2.991   50.490 39.362  1.00 31.80 ? 476  GLN B CA  1 
ATOM   1722 C C   . GLN B 1 82  ? 4.260   50.379 40.223  1.00 30.93 ? 476  GLN B C   1 
ATOM   1723 O O   . GLN B 1 82  ? 4.460   49.372 40.900  1.00 30.92 ? 476  GLN B O   1 
ATOM   1724 C CB  . GLN B 1 82  ? 3.247   50.002 37.931  1.00 33.28 ? 476  GLN B CB  1 
ATOM   1725 C CG  . GLN B 1 82  ? 3.608   48.508 37.883  1.00 38.03 ? 476  GLN B CG  1 
ATOM   1726 C CD  . GLN B 1 82  ? 2.483   47.623 38.363  1.00 41.04 ? 476  GLN B CD  1 
ATOM   1727 O OE1 . GLN B 1 82  ? 1.500   47.433 37.653  1.00 45.17 ? 476  GLN B OE1 1 
ATOM   1728 N NE2 . GLN B 1 82  ? 2.620   47.066 39.573  1.00 44.71 ? 476  GLN B NE2 1 
ATOM   1729 N N   . ARG B 1 83  ? 5.078   51.429 40.216  1.00 30.19 ? 477  ARG B N   1 
ATOM   1730 C CA  . ARG B 1 83  ? 6.212   51.571 41.141  1.00 30.27 ? 477  ARG B CA  1 
ATOM   1731 C C   . ARG B 1 83  ? 5.746   51.469 42.588  1.00 29.65 ? 477  ARG B C   1 
ATOM   1732 O O   . ARG B 1 83  ? 6.221   50.617 43.348  1.00 29.60 ? 477  ARG B O   1 
ATOM   1733 C CB  . ARG B 1 83  ? 6.931   52.911 40.912  1.00 30.15 ? 477  ARG B CB  1 
ATOM   1734 C CG  . ARG B 1 83  ? 7.834   52.914 39.731  1.00 33.66 ? 477  ARG B CG  1 
ATOM   1735 C CD  . ARG B 1 83  ? 8.223   54.355 39.312  1.00 35.25 ? 477  ARG B CD  1 
ATOM   1736 N NE  . ARG B 1 83  ? 9.410   54.411 38.458  1.00 41.52 ? 477  ARG B NE  1 
ATOM   1737 C CZ  . ARG B 1 83  ? 10.669  54.444 38.909  1.00 42.77 ? 477  ARG B CZ  1 
ATOM   1738 N NH1 . ARG B 1 83  ? 10.918  54.400 40.218  1.00 44.19 ? 477  ARG B NH1 1 
ATOM   1739 N NH2 . ARG B 1 83  ? 11.689  54.504 38.056  1.00 43.20 ? 477  ARG B NH2 1 
ATOM   1740 N N   . ASP B 1 84  ? 4.767   52.302 42.952  1.00 28.56 ? 478  ASP B N   1 
ATOM   1741 C CA  . ASP B 1 84  ? 4.277   52.345 44.329  1.00 27.24 ? 478  ASP B CA  1 
ATOM   1742 C C   . ASP B 1 84  ? 3.710   50.997 44.733  1.00 26.62 ? 478  ASP B C   1 
ATOM   1743 O O   . ASP B 1 84  ? 3.886   50.594 45.878  1.00 25.23 ? 478  ASP B O   1 
ATOM   1744 C CB  . ASP B 1 84  ? 3.202   53.419 44.538  1.00 27.35 ? 478  ASP B CB  1 
ATOM   1745 C CG  . ASP B 1 84  ? 3.756   54.839 44.555  1.00 29.31 ? 478  ASP B CG  1 
ATOM   1746 O OD1 . ASP B 1 84  ? 4.988   55.068 44.387  1.00 29.77 ? 478  ASP B OD1 1 
ATOM   1747 O OD2 . ASP B 1 84  ? 2.918   55.751 44.726  1.00 31.61 ? 478  ASP B OD2 1 
ATOM   1748 N N   . ARG B 1 85  ? 3.037   50.305 43.809  1.00 25.62 ? 479  ARG B N   1 
ATOM   1749 C CA  . ARG B 1 85  ? 2.520   48.959 44.112  1.00 27.62 ? 479  ARG B CA  1 
ATOM   1750 C C   . ARG B 1 85  ? 3.646   47.939 44.375  1.00 26.46 ? 479  ARG B C   1 
ATOM   1751 O O   . ARG B 1 85  ? 3.536   47.165 45.312  1.00 24.84 ? 479  ARG B O   1 
ATOM   1752 C CB  . ARG B 1 85  ? 1.598   48.445 43.019  1.00 27.76 ? 479  ARG B CB  1 
ATOM   1753 C CG  . ARG B 1 85  ? 0.251   49.113 42.968  1.00 31.23 ? 479  ARG B CG  1 
ATOM   1754 C CD  . ARG B 1 85  ? -0.646  48.304 42.057  1.00 38.42 ? 479  ARG B CD  1 
ATOM   1755 N NE  . ARG B 1 85  ? -1.949  48.916 41.831  1.00 42.00 ? 479  ARG B NE  1 
ATOM   1756 C CZ  . ARG B 1 85  ? -2.745  48.628 40.799  1.00 43.35 ? 479  ARG B CZ  1 
ATOM   1757 N NH1 . ARG B 1 85  ? -2.364  47.745 39.887  1.00 44.09 ? 479  ARG B NH1 1 
ATOM   1758 N NH2 . ARG B 1 85  ? -3.926  49.221 40.679  1.00 44.29 ? 479  ARG B NH2 1 
ATOM   1759 N N   . GLU B 1 86  ? 4.691   47.940 43.531  1.00 26.21 ? 480  GLU B N   1 
ATOM   1760 C CA  . GLU B 1 86  ? 5.842   47.019 43.658  1.00 26.45 ? 480  GLU B CA  1 
ATOM   1761 C C   . GLU B 1 86  ? 6.624   47.279 44.933  1.00 26.27 ? 480  GLU B C   1 
ATOM   1762 O O   . GLU B 1 86  ? 7.150   46.322 45.528  1.00 26.78 ? 480  GLU B O   1 
ATOM   1763 C CB  . GLU B 1 86  ? 6.798   47.094 42.444  1.00 26.30 ? 480  GLU B CB  1 
ATOM   1764 C CG  . GLU B 1 86  ? 6.320   46.300 41.236  1.00 26.74 ? 480  GLU B CG  1 
ATOM   1765 C CD  . GLU B 1 86  ? 7.299   46.305 40.070  1.00 27.85 ? 480  GLU B CD  1 
ATOM   1766 O OE1 . GLU B 1 86  ? 8.519   46.278 40.299  1.00 31.06 ? 480  GLU B OE1 1 
ATOM   1767 O OE2 . GLU B 1 86  ? 6.841   46.321 38.913  1.00 31.05 ? 480  GLU B OE2 1 
ATOM   1768 N N   . GLU B 1 87  ? 6.740   48.568 45.308  1.00 26.23 ? 481  GLU B N   1 
ATOM   1769 C CA  . GLU B 1 87  ? 7.424   48.970 46.532  1.00 26.03 ? 481  GLU B CA  1 
ATOM   1770 C C   . GLU B 1 87  ? 6.701   48.540 47.781  1.00 25.96 ? 481  GLU B C   1 
ATOM   1771 O O   . GLU B 1 87  ? 7.334   48.073 48.713  1.00 25.71 ? 481  GLU B O   1 
ATOM   1772 C CB  . GLU B 1 87  ? 7.636   50.487 46.558  1.00 27.34 ? 481  GLU B CB  1 
ATOM   1773 C CG  . GLU B 1 87  ? 8.276   51.047 47.843  1.00 28.94 ? 481  GLU B CG  1 
ATOM   1774 C CD  . GLU B 1 87  ? 9.811   50.924 47.890  1.00 33.04 ? 481  GLU B CD  1 
ATOM   1775 O OE1 . GLU B 1 87  ? 10.454  50.830 46.823  1.00 36.26 ? 481  GLU B OE1 1 
ATOM   1776 O OE2 . GLU B 1 87  ? 10.388  50.944 49.000  1.00 32.53 ? 481  GLU B OE2 1 
ATOM   1777 N N   . ALA B 1 88  ? 5.372   48.701 47.793  1.00 25.36 ? 482  ALA B N   1 
ATOM   1778 C CA  . ALA B 1 88  ? 4.516   48.341 48.916  1.00 25.47 ? 482  ALA B CA  1 
ATOM   1779 C C   . ALA B 1 88  ? 4.606   46.835 49.203  1.00 26.07 ? 482  ALA B C   1 
ATOM   1780 O O   . ALA B 1 88  ? 4.915   46.395 50.325  1.00 24.67 ? 482  ALA B O   1 
ATOM   1781 C CB  . ALA B 1 88  ? 3.093   48.728 48.591  1.00 24.25 ? 482  ALA B CB  1 
ATOM   1782 N N   . LEU B 1 89  ? 4.348   46.056 48.156  1.00 26.94 ? 483  LEU B N   1 
ATOM   1783 C CA  . LEU B 1 89  ? 4.541   44.605 48.139  1.00 26.99 ? 483  LEU B CA  1 
ATOM   1784 C C   . LEU B 1 89  ? 5.921   44.186 48.688  1.00 27.23 ? 483  LEU B C   1 
ATOM   1785 O O   . LEU B 1 89  ? 6.035   43.236 49.484  1.00 25.56 ? 483  LEU B O   1 
ATOM   1786 C CB  . LEU B 1 89  ? 4.422   44.169 46.678  1.00 28.07 ? 483  LEU B CB  1 
ATOM   1787 C CG  . LEU B 1 89  ? 3.417   43.141 46.266  1.00 27.47 ? 483  LEU B CG  1 
ATOM   1788 C CD1 . LEU B 1 89  ? 2.005   43.716 46.508  1.00 33.10 ? 483  LEU B CD1 1 
ATOM   1789 C CD2 . LEU B 1 89  ? 3.617   42.882 44.790  1.00 31.74 ? 483  LEU B CD2 1 
ATOM   1790 N N   . HIS B 1 90  ? 6.967   44.902 48.244  1.00 27.14 ? 484  HIS B N   1 
ATOM   1791 C CA  . HIS B 1 90  ? 8.315   44.665 48.684  1.00 28.47 ? 484  HIS B CA  1 
ATOM   1792 C C   . HIS B 1 90  ? 8.535   44.962 50.168  1.00 29.12 ? 484  HIS B C   1 
ATOM   1793 O O   . HIS B 1 90  ? 9.268   44.247 50.848  1.00 29.43 ? 484  HIS B O   1 
ATOM   1794 C CB  . HIS B 1 90  ? 9.277   45.531 47.864  1.00 27.52 ? 484  HIS B CB  1 
ATOM   1795 C CG  . HIS B 1 90  ? 10.695  45.478 48.323  1.00 28.35 ? 484  HIS B CG  1 
ATOM   1796 N ND1 . HIS B 1 90  ? 11.391  44.297 48.461  1.00 28.46 ? 484  HIS B ND1 1 
ATOM   1797 C CD2 . HIS B 1 90  ? 11.571  46.469 48.621  1.00 25.40 ? 484  HIS B CD2 1 
ATOM   1798 C CE1 . HIS B 1 90  ? 12.620  44.561 48.857  1.00 27.40 ? 484  HIS B CE1 1 
ATOM   1799 N NE2 . HIS B 1 90  ? 12.759  45.871 48.955  1.00 27.43 ? 484  HIS B NE2 1 
ATOM   1800 N N   . GLN B 1 91  ? 7.954   46.059 50.643  1.00 29.26 ? 485  GLN B N   1 
ATOM   1801 C CA  . GLN B 1 91  ? 8.067   46.421 52.045  1.00 29.38 ? 485  GLN B CA  1 
ATOM   1802 C C   . GLN B 1 91  ? 7.298   45.431 52.882  1.00 28.97 ? 485  GLN B C   1 
ATOM   1803 O O   . GLN B 1 91  ? 7.714   45.098 53.976  1.00 28.25 ? 485  GLN B O   1 
ATOM   1804 C CB  . GLN B 1 91  ? 7.501   47.793 52.279  1.00 29.33 ? 485  GLN B CB  1 
ATOM   1805 C CG  . GLN B 1 91  ? 8.289   48.865 51.663  1.00 31.86 ? 485  GLN B CG  1 
ATOM   1806 C CD  . GLN B 1 91  ? 8.090   50.130 52.417  1.00 36.93 ? 485  GLN B CD  1 
ATOM   1807 O OE1 . GLN B 1 91  ? 9.026   50.921 52.555  1.00 40.08 ? 485  GLN B OE1 1 
ATOM   1808 N NE2 . GLN B 1 91  ? 6.868   50.324 52.971  1.00 37.05 ? 485  GLN B NE2 1 
ATOM   1809 N N   . PHE B 1 92  ? 6.187   44.958 52.334  1.00 28.55 ? 486  PHE B N   1 
ATOM   1810 C CA  . PHE B 1 92  ? 5.374   43.959 52.968  1.00 29.73 ? 486  PHE B CA  1 
ATOM   1811 C C   . PHE B 1 92  ? 6.182   42.674 53.171  1.00 30.36 ? 486  PHE B C   1 
ATOM   1812 O O   . PHE B 1 92  ? 6.337   42.223 54.298  1.00 30.20 ? 486  PHE B O   1 
ATOM   1813 C CB  . PHE B 1 92  ? 4.124   43.713 52.128  1.00 28.82 ? 486  PHE B CB  1 
ATOM   1814 C CG  . PHE B 1 92  ? 3.157   42.751 52.734  1.00 28.37 ? 486  PHE B CG  1 
ATOM   1815 C CD1 . PHE B 1 92  ? 2.624   42.967 54.027  1.00 24.56 ? 486  PHE B CD1 1 
ATOM   1816 C CD2 . PHE B 1 92  ? 2.745   41.641 52.008  1.00 26.19 ? 486  PHE B CD2 1 
ATOM   1817 C CE1 . PHE B 1 92  ? 1.679   42.077 54.560  1.00 27.32 ? 486  PHE B CE1 1 
ATOM   1818 C CE2 . PHE B 1 92  ? 1.835   40.754 52.532  1.00 25.88 ? 486  PHE B CE2 1 
ATOM   1819 C CZ  . PHE B 1 92  ? 1.290   40.967 53.796  1.00 28.50 ? 486  PHE B CZ  1 
ATOM   1820 N N   . ARG B 1 93  ? 6.707   42.114 52.085  1.00 31.26 ? 487  ARG B N   1 
ATOM   1821 C CA  . ARG B 1 93  ? 7.328   40.792 52.110  1.00 33.09 ? 487  ARG B CA  1 
ATOM   1822 C C   . ARG B 1 93  ? 8.613   40.774 52.875  1.00 33.10 ? 487  ARG B C   1 
ATOM   1823 O O   . ARG B 1 93  ? 8.836   39.845 53.653  1.00 34.64 ? 487  ARG B O   1 
ATOM   1824 C CB  . ARG B 1 93  ? 7.550   40.231 50.708  1.00 34.43 ? 487  ARG B CB  1 
ATOM   1825 C CG  . ARG B 1 93  ? 6.253   39.721 50.054  1.00 37.84 ? 487  ARG B CG  1 
ATOM   1826 C CD  . ARG B 1 93  ? 6.508   39.388 48.562  1.00 40.90 ? 487  ARG B CD  1 
ATOM   1827 N NE  . ARG B 1 93  ? 7.663   40.116 48.022  1.00 41.15 ? 487  ARG B NE  1 
ATOM   1828 C CZ  . ARG B 1 93  ? 7.729   40.575 46.775  1.00 41.18 ? 487  ARG B CZ  1 
ATOM   1829 N NH1 . ARG B 1 93  ? 6.706   40.411 45.943  1.00 42.40 ? 487  ARG B NH1 1 
ATOM   1830 N NH2 . ARG B 1 93  ? 8.798   41.226 46.362  1.00 42.66 ? 487  ARG B NH2 1 
ATOM   1831 N N   . SER B 1 94  ? 9.448   41.800 52.684  1.00 32.18 ? 488  SER B N   1 
ATOM   1832 C CA  . SER B 1 94  ? 10.677  41.959 53.466  1.00 31.58 ? 488  SER B CA  1 
ATOM   1833 C C   . SER B 1 94  ? 10.414  42.106 54.995  1.00 30.52 ? 488  SER B C   1 
ATOM   1834 O O   . SER B 1 94  ? 11.320  42.004 55.802  1.00 30.14 ? 488  SER B O   1 
ATOM   1835 C CB  . SER B 1 94  ? 11.502  43.129 52.916  1.00 31.92 ? 488  SER B CB  1 
ATOM   1836 O OG  . SER B 1 94  ? 11.103  44.377 53.461  1.00 31.78 ? 488  SER B OG  1 
ATOM   1837 N N   . GLY B 1 95  ? 9.159   42.323 55.369  1.00 30.00 ? 489  GLY B N   1 
ATOM   1838 C CA  . GLY B 1 95  ? 8.762   42.518 56.767  1.00 29.37 ? 489  GLY B CA  1 
ATOM   1839 C C   . GLY B 1 95  ? 8.904   43.950 57.261  1.00 29.41 ? 489  GLY B C   1 
ATOM   1840 O O   . GLY B 1 95  ? 8.566   44.256 58.403  1.00 29.58 ? 489  GLY B O   1 
ATOM   1841 N N   . LYS B 1 96  ? 9.372   44.850 56.403  1.00 27.34 ? 490  LYS B N   1 
ATOM   1842 C CA  . LYS B 1 96  ? 9.518   46.232 56.811  1.00 26.88 ? 490  LYS B CA  1 
ATOM   1843 C C   . LYS B 1 96  ? 8.218   46.945 57.157  1.00 26.02 ? 490  LYS B C   1 
ATOM   1844 O O   . LYS B 1 96  ? 8.205   47.770 58.052  1.00 24.81 ? 490  LYS B O   1 
ATOM   1845 C CB  . LYS B 1 96  ? 10.388  47.022 55.796  1.00 26.62 ? 490  LYS B CB  1 
ATOM   1846 C CG  . LYS B 1 96  ? 11.788  46.520 55.844  1.00 28.04 ? 490  LYS B CG  1 
ATOM   1847 C CD  . LYS B 1 96  ? 12.645  46.902 54.655  1.00 31.48 ? 490  LYS B CD  1 
ATOM   1848 C CE  . LYS B 1 96  ? 13.995  46.218 54.810  1.00 33.93 ? 490  LYS B CE  1 
ATOM   1849 N NZ  . LYS B 1 96  ? 14.489  45.754 53.478  1.00 37.18 ? 490  LYS B NZ  1 
ATOM   1850 N N   . SER B 1 97  ? 7.152   46.655 56.406  1.00 26.44 ? 491  SER B N   1 
ATOM   1851 C CA  . SER B 1 97  ? 5.803   47.148 56.659  1.00 26.92 ? 491  SER B CA  1 
ATOM   1852 C C   . SER B 1 97  ? 4.934   45.919 56.754  1.00 27.33 ? 491  SER B C   1 
ATOM   1853 O O   . SER B 1 97  ? 4.401   45.464 55.743  1.00 28.66 ? 491  SER B O   1 
ATOM   1854 C CB  . SER B 1 97  ? 5.313   48.051 55.510  1.00 27.35 ? 491  SER B CB  1 
ATOM   1855 O OG  . SER B 1 97  ? 5.975   49.315 55.556  1.00 25.03 ? 491  SER B OG  1 
ATOM   1856 N N   . PRO B 1 98  ? 4.799   45.356 57.973  1.00 27.97 ? 492  PRO B N   1 
ATOM   1857 C CA  . PRO B 1 98  ? 4.055   44.110 58.228  1.00 26.73 ? 492  PRO B CA  1 
ATOM   1858 C C   . PRO B 1 98  ? 2.565   44.091 57.970  1.00 26.33 ? 492  PRO B C   1 
ATOM   1859 O O   . PRO B 1 98  ? 1.999   43.001 57.935  1.00 27.41 ? 492  PRO B O   1 
ATOM   1860 C CB  . PRO B 1 98  ? 4.307   43.841 59.725  1.00 27.37 ? 492  PRO B CB  1 
ATOM   1861 C CG  . PRO B 1 98  ? 4.603   45.204 60.297  1.00 28.69 ? 492  PRO B CG  1 
ATOM   1862 C CD  . PRO B 1 98  ? 5.407   45.888 59.213  1.00 27.37 ? 492  PRO B CD  1 
ATOM   1863 N N   . ILE B 1 99  ? 1.911   45.238 57.853  1.00 23.50 ? 493  ILE B N   1 
ATOM   1864 C CA  . ILE B 1 99  ? 0.498   45.262 57.454  1.00 22.01 ? 493  ILE B CA  1 
ATOM   1865 C C   . ILE B 1 99  ? 0.370   45.816 56.045  1.00 21.20 ? 493  ILE B C   1 
ATOM   1866 O O   . ILE B 1 99  ? 0.980   46.855 55.735  1.00 20.03 ? 493  ILE B O   1 
ATOM   1867 C CB  . ILE B 1 99  ? -0.381  46.097 58.404  1.00 22.37 ? 493  ILE B CB  1 
ATOM   1868 C CG1 . ILE B 1 99  ? -0.276  45.539 59.828  1.00 23.85 ? 493  ILE B CG1 1 
ATOM   1869 C CG2 . ILE B 1 99  ? -1.901  46.089 57.933  1.00 22.36 ? 493  ILE B CG2 1 
ATOM   1870 C CD1 . ILE B 1 99  ? -0.982  46.419 60.840  1.00 26.40 ? 493  ILE B CD1 1 
ATOM   1871 N N   . LEU B 1 100 ? -0.327  45.088 55.173  1.00 20.83 ? 494  LEU B N   1 
ATOM   1872 C CA  . LEU B 1 100 ? -0.626  45.637 53.841  1.00 20.98 ? 494  LEU B CA  1 
ATOM   1873 C C   . LEU B 1 100 ? -2.106  45.757 53.688  1.00 21.91 ? 494  LEU B C   1 
ATOM   1874 O O   . LEU B 1 100 ? -2.801  44.748 53.739  1.00 21.47 ? 494  LEU B O   1 
ATOM   1875 C CB  . LEU B 1 100 ? -0.136  44.690 52.753  1.00 21.14 ? 494  LEU B CB  1 
ATOM   1876 C CG  . LEU B 1 100 ? -0.542  45.025 51.289  1.00 21.86 ? 494  LEU B CG  1 
ATOM   1877 C CD1 . LEU B 1 100 ? 0.126   46.367 50.844  1.00 16.50 ? 494  LEU B CD1 1 
ATOM   1878 C CD2 . LEU B 1 100 ? 0.013   43.941 50.370  1.00 22.89 ? 494  LEU B CD2 1 
ATOM   1879 N N   . VAL B 1 101 ? -2.596  46.958 53.424  1.00 21.18 ? 495  VAL B N   1 
ATOM   1880 C CA  . VAL B 1 101 ? -4.010  47.131 53.175  1.00 20.93 ? 495  VAL B CA  1 
ATOM   1881 C C   . VAL B 1 101 ? -4.212  47.083 51.659  1.00 21.67 ? 495  VAL B C   1 
ATOM   1882 O O   . VAL B 1 101 ? -3.538  47.804 50.918  1.00 20.04 ? 495  VAL B O   1 
ATOM   1883 C CB  . VAL B 1 101 ? -4.499  48.498 53.690  1.00 19.33 ? 495  VAL B CB  1 
ATOM   1884 C CG1 . VAL B 1 101 ? -5.898  48.729 53.223  1.00 19.04 ? 495  VAL B CG1 1 
ATOM   1885 C CG2 . VAL B 1 101 ? -4.395  48.558 55.231  1.00 21.87 ? 495  VAL B CG2 1 
ATOM   1886 N N   . ALA B 1 102 ? -5.135  46.247 51.200  1.00 21.33 ? 496  ALA B N   1 
ATOM   1887 C CA  . ALA B 1 102 ? -5.335  46.111 49.787  1.00 22.34 ? 496  ALA B CA  1 
ATOM   1888 C C   . ALA B 1 102 ? -6.818  46.050 49.368  1.00 22.46 ? 496  ALA B C   1 
ATOM   1889 O O   . ALA B 1 102 ? -7.688  45.526 50.090  1.00 21.61 ? 496  ALA B O   1 
ATOM   1890 C CB  . ALA B 1 102 ? -4.574  44.907 49.294  1.00 22.41 ? 496  ALA B CB  1 
ATOM   1891 N N   . THR B 1 103 ? -7.099  46.595 48.190  1.00 24.59 ? 497  THR B N   1 
ATOM   1892 C CA  . THR B 1 103 ? -8.345  46.278 47.508  1.00 25.96 ? 497  THR B CA  1 
ATOM   1893 C C   . THR B 1 103 ? -8.150  45.053 46.601  1.00 29.01 ? 497  THR B C   1 
ATOM   1894 O O   . THR B 1 103 ? -7.006  44.689 46.256  1.00 29.40 ? 497  THR B O   1 
ATOM   1895 C CB  . THR B 1 103 ? -8.848  47.433 46.650  1.00 25.98 ? 497  THR B CB  1 
ATOM   1896 O OG1 . THR B 1 103 ? -7.948  47.632 45.561  1.00 23.35 ? 497  THR B OG1 1 
ATOM   1897 C CG2 . THR B 1 103 ? -9.018  48.722 47.471  1.00 22.87 ? 497  THR B CG2 1 
ATOM   1898 N N   . ALA B 1 104 ? -9.267  44.449 46.175  1.00 31.37 ? 498  ALA B N   1 
ATOM   1899 C CA  . ALA B 1 104 ? -9.248  43.232 45.359  1.00 34.58 ? 498  ALA B CA  1 
ATOM   1900 C C   . ALA B 1 104 ? -8.383  43.358 44.131  1.00 36.98 ? 498  ALA B C   1 
ATOM   1901 O O   . ALA B 1 104 ? -7.614  42.453 43.821  1.00 37.50 ? 498  ALA B O   1 
ATOM   1902 C CB  . ALA B 1 104 ? -10.674 42.847 44.932  1.00 35.13 ? 498  ALA B CB  1 
ATOM   1903 N N   . VAL B 1 105 ? -8.550  44.467 43.404  1.00 40.72 ? 499  VAL B N   1 
ATOM   1904 C CA  . VAL B 1 105 ? -7.746  44.744 42.195  1.00 43.49 ? 499  VAL B CA  1 
ATOM   1905 C C   . VAL B 1 105 ? -6.378  45.306 42.630  1.00 44.62 ? 499  VAL B C   1 
ATOM   1906 O O   . VAL B 1 105 ? -6.280  46.389 43.219  1.00 44.89 ? 499  VAL B O   1 
ATOM   1907 C CB  . VAL B 1 105 ? -8.537  45.607 41.149  1.00 43.78 ? 499  VAL B CB  1 
ATOM   1908 C CG1 . VAL B 1 105 ? -9.222  46.827 41.803  1.00 45.32 ? 499  VAL B CG1 1 
ATOM   1909 C CG2 . VAL B 1 105 ? -7.673  45.996 39.924  1.00 45.19 ? 499  VAL B CG2 1 
ATOM   1910 N N   . ALA B 1 106 ? -5.327  44.523 42.377  1.00 46.52 ? 500  ALA B N   1 
ATOM   1911 C CA  . ALA B 1 106 ? -3.999  44.738 42.974  1.00 46.54 ? 500  ALA B CA  1 
ATOM   1912 C C   . ALA B 1 106 ? -3.626  43.541 43.849  1.00 47.19 ? 500  ALA B C   1 
ATOM   1913 O O   . ALA B 1 106 ? -4.480  42.884 44.437  1.00 46.27 ? 500  ALA B O   1 
ATOM   1914 C CB  . ALA B 1 106 ? -3.979  46.029 43.797  1.00 46.75 ? 500  ALA B CB  1 
ATOM   1915 N N   . ILE B 1 112 ? 1.364   37.456 46.024  1.00 39.62 ? 506  ILE B N   1 
ATOM   1916 C CA  . ILE B 1 112 ? 1.214   37.621 47.469  1.00 39.57 ? 506  ILE B CA  1 
ATOM   1917 C C   . ILE B 1 112 ? 0.692   36.319 48.087  1.00 38.69 ? 506  ILE B C   1 
ATOM   1918 O O   . ILE B 1 112 ? -0.458  35.933 47.846  1.00 38.82 ? 506  ILE B O   1 
ATOM   1919 C CB  . ILE B 1 112 ? 0.221   38.765 47.846  1.00 39.79 ? 506  ILE B CB  1 
ATOM   1920 C CG1 . ILE B 1 112 ? 0.610   40.086 47.190  1.00 40.98 ? 506  ILE B CG1 1 
ATOM   1921 C CG2 . ILE B 1 112 ? 0.149   38.930 49.365  1.00 38.31 ? 506  ILE B CG2 1 
ATOM   1922 C CD1 . ILE B 1 112 ? -0.476  41.132 47.316  1.00 41.57 ? 506  ILE B CD1 1 
ATOM   1923 N N   . SER B 1 113 ? 1.512   35.644 48.883  1.00 37.39 ? 507  SER B N   1 
ATOM   1924 C CA  . SER B 1 113 ? 1.019   34.432 49.554  1.00 37.40 ? 507  SER B CA  1 
ATOM   1925 C C   . SER B 1 113 ? 1.837   34.140 50.781  1.00 35.83 ? 507  SER B C   1 
ATOM   1926 O O   . SER B 1 113 ? 2.867   34.797 51.039  1.00 34.57 ? 507  SER B O   1 
ATOM   1927 C CB  . SER B 1 113 ? 1.108   33.219 48.623  1.00 38.29 ? 507  SER B CB  1 
ATOM   1928 O OG  . SER B 1 113 ? 2.464   33.023 48.259  1.00 39.09 ? 507  SER B OG  1 
ATOM   1929 N N   . ASN B 1 114 ? 1.393   33.106 51.493  1.00 33.24 ? 508  ASN B N   1 
ATOM   1930 C CA  . ASN B 1 114 ? 2.035   32.646 52.700  1.00 31.68 ? 508  ASN B CA  1 
ATOM   1931 C C   . ASN B 1 114 ? 1.993   33.707 53.795  1.00 29.70 ? 508  ASN B C   1 
ATOM   1932 O O   . ASN B 1 114 ? 2.893   33.818 54.596  1.00 30.19 ? 508  ASN B O   1 
ATOM   1933 C CB  . ASN B 1 114 ? 3.483   32.198 52.397  1.00 32.34 ? 508  ASN B CB  1 
ATOM   1934 C CG  . ASN B 1 114 ? 3.541   31.167 51.281  1.00 33.91 ? 508  ASN B CG  1 
ATOM   1935 O OD1 . ASN B 1 114 ? 4.477   31.146 50.501  1.00 35.25 ? 508  ASN B OD1 1 
ATOM   1936 N ND2 . ASN B 1 114 ? 2.498   30.320 51.188  1.00 37.98 ? 508  ASN B ND2 1 
ATOM   1937 N N   . VAL B 1 115 ? 0.943   34.498 53.830  1.00 27.32 ? 509  VAL B N   1 
ATOM   1938 C CA  . VAL B 1 115 ? 0.820   35.458 54.908  1.00 25.44 ? 509  VAL B CA  1 
ATOM   1939 C C   . VAL B 1 115 ? 0.321   34.768 56.182  1.00 24.90 ? 509  VAL B C   1 
ATOM   1940 O O   . VAL B 1 115 ? -0.316  33.705 56.119  1.00 22.74 ? 509  VAL B O   1 
ATOM   1941 C CB  . VAL B 1 115 ? -0.038  36.705 54.506  1.00 25.29 ? 509  VAL B CB  1 
ATOM   1942 C CG1 . VAL B 1 115 ? 0.443   37.301 53.179  1.00 24.21 ? 509  VAL B CG1 1 
ATOM   1943 C CG2 . VAL B 1 115 ? -1.483  36.374 54.410  1.00 27.25 ? 509  VAL B CG2 1 
ATOM   1944 N N   . LYS B 1 116 ? 0.650   35.351 57.320  1.00 22.41 ? 510  LYS B N   1 
ATOM   1945 C CA  . LYS B 1 116 ? 0.232   34.820 58.619  1.00 24.42 ? 510  LYS B CA  1 
ATOM   1946 C C   . LYS B 1 116 ? -1.255  35.032 58.893  1.00 24.11 ? 510  LYS B C   1 
ATOM   1947 O O   . LYS B 1 116 ? -1.902  34.127 59.428  1.00 23.31 ? 510  LYS B O   1 
ATOM   1948 C CB  . LYS B 1 116 ? 1.078   35.472 59.730  1.00 26.68 ? 510  LYS B CB  1 
ATOM   1949 C CG  . LYS B 1 116 ? 0.872   34.896 61.165  1.00 29.89 ? 510  LYS B CG  1 
ATOM   1950 C CD  . LYS B 1 116 ? 2.230   35.120 61.913  1.00 40.17 ? 510  LYS B CD  1 
ATOM   1951 C CE  . LYS B 1 116 ? 2.232   34.668 63.363  1.00 43.74 ? 510  LYS B CE  1 
ATOM   1952 N NZ  . LYS B 1 116 ? 2.000   33.192 63.449  1.00 50.05 ? 510  LYS B NZ  1 
ATOM   1953 N N   . HIS B 1 117 ? -1.796  36.161 58.439  1.00 22.64 ? 511  HIS B N   1 
ATOM   1954 C CA  . HIS B 1 117 ? -3.209  36.515 58.761  1.00 22.91 ? 511  HIS B CA  1 
ATOM   1955 C C   . HIS B 1 117 ? -3.830  37.229 57.570  1.00 22.68 ? 511  HIS B C   1 
ATOM   1956 O O   . HIS B 1 117 ? -3.248  38.201 57.083  1.00 22.43 ? 511  HIS B O   1 
ATOM   1957 C CB  . HIS B 1 117 ? -3.227  37.436 59.994  1.00 22.33 ? 511  HIS B CB  1 
ATOM   1958 C CG  . HIS B 1 117 ? -4.574  37.541 60.643  1.00 22.79 ? 511  HIS B CG  1 
ATOM   1959 N ND1 . HIS B 1 117 ? -4.769  38.226 61.818  1.00 23.75 ? 511  HIS B ND1 1 
ATOM   1960 C CD2 . HIS B 1 117 ? -5.778  37.013 60.310  1.00 20.66 ? 511  HIS B CD2 1 
ATOM   1961 C CE1 . HIS B 1 117 ? -6.049  38.137 62.174  1.00 22.32 ? 511  HIS B CE1 1 
ATOM   1962 N NE2 . HIS B 1 117 ? -6.684  37.416 61.274  1.00 20.74 ? 511  HIS B NE2 1 
ATOM   1963 N N   . VAL B 1 118 ? -4.958  36.753 57.062  1.00 21.51 ? 512  VAL B N   1 
ATOM   1964 C CA  . VAL B 1 118 ? -5.761  37.544 56.078  1.00 22.18 ? 512  VAL B CA  1 
ATOM   1965 C C   . VAL B 1 118 ? -6.960  38.079 56.849  1.00 21.82 ? 512  VAL B C   1 
ATOM   1966 O O   . VAL B 1 118 ? -7.635  37.310 57.544  1.00 21.89 ? 512  VAL B O   1 
ATOM   1967 C CB  . VAL B 1 118 ? -6.255  36.727 54.879  1.00 22.26 ? 512  VAL B CB  1 
ATOM   1968 C CG1 . VAL B 1 118 ? -7.392  37.487 54.067  1.00 23.44 ? 512  VAL B CG1 1 
ATOM   1969 C CG2 . VAL B 1 118 ? -5.121  36.491 53.934  1.00 21.82 ? 512  VAL B CG2 1 
ATOM   1970 N N   . ILE B 1 119 ? -7.190  39.392 56.777  1.00 21.85 ? 513  ILE B N   1 
ATOM   1971 C CA  . ILE B 1 119 ? -8.385  40.016 57.396  1.00 20.59 ? 513  ILE B CA  1 
ATOM   1972 C C   . ILE B 1 119 ? -9.266  40.560 56.284  1.00 22.06 ? 513  ILE B C   1 
ATOM   1973 O O   . ILE B 1 119 ? -8.859  41.468 55.512  1.00 22.78 ? 513  ILE B O   1 
ATOM   1974 C CB  . ILE B 1 119 ? -8.016  41.138 58.433  1.00 21.29 ? 513  ILE B CB  1 
ATOM   1975 C CG1 . ILE B 1 119 ? -7.036  40.596 59.484  1.00 22.13 ? 513  ILE B CG1 1 
ATOM   1976 C CG2 . ILE B 1 119 ? -9.263  41.689 59.141  1.00 23.45 ? 513  ILE B CG2 1 
ATOM   1977 C CD1 . ILE B 1 119 ? -6.355  41.642 60.434  1.00 21.27 ? 513  ILE B CD1 1 
ATOM   1978 N N   . ASN B 1 120 ? -10.481 40.013 56.175  1.00 22.44 ? 514  ASN B N   1 
ATOM   1979 C CA  . ASN B 1 120 ? -11.501 40.632 55.295  1.00 23.99 ? 514  ASN B CA  1 
ATOM   1980 C C   . ASN B 1 120 ? -12.229 41.707 56.075  1.00 23.56 ? 514  ASN B C   1 
ATOM   1981 O O   . ASN B 1 120 ? -13.250 41.429 56.738  1.00 23.53 ? 514  ASN B O   1 
ATOM   1982 C CB  . ASN B 1 120 ? -12.460 39.586 54.706  1.00 22.93 ? 514  ASN B CB  1 
ATOM   1983 C CG  . ASN B 1 120 ? -11.769 38.659 53.723  1.00 27.56 ? 514  ASN B CG  1 
ATOM   1984 O OD1 . ASN B 1 120 ? -11.136 39.140 52.781  1.00 27.80 ? 514  ASN B OD1 1 
ATOM   1985 N ND2 . ASN B 1 120 ? -11.871 37.309 53.934  1.00 23.67 ? 514  ASN B ND2 1 
ATOM   1986 N N   . PHE B 1 121 ? -11.681 42.928 56.033  1.00 22.61 ? 515  PHE B N   1 
ATOM   1987 C CA  . PHE B 1 121 ? -12.274 44.072 56.733  1.00 23.25 ? 515  PHE B CA  1 
ATOM   1988 C C   . PHE B 1 121 ? -13.656 44.370 56.093  1.00 23.35 ? 515  PHE B C   1 
ATOM   1989 O O   . PHE B 1 121 ? -14.672 44.727 56.779  1.00 22.89 ? 515  PHE B O   1 
ATOM   1990 C CB  . PHE B 1 121 ? -11.314 45.264 56.603  1.00 24.04 ? 515  PHE B CB  1 
ATOM   1991 C CG  . PHE B 1 121 ? -11.719 46.514 57.375  1.00 22.15 ? 515  PHE B CG  1 
ATOM   1992 C CD1 . PHE B 1 121 ? -11.252 46.727 58.661  1.00 18.28 ? 515  PHE B CD1 1 
ATOM   1993 C CD2 . PHE B 1 121 ? -12.527 47.486 56.774  1.00 22.73 ? 515  PHE B CD2 1 
ATOM   1994 C CE1 . PHE B 1 121 ? -11.568 47.901 59.359  1.00 18.68 ? 515  PHE B CE1 1 
ATOM   1995 C CE2 . PHE B 1 121 ? -12.886 48.664 57.462  1.00 22.25 ? 515  PHE B CE2 1 
ATOM   1996 C CZ  . PHE B 1 121 ? -12.398 48.887 58.738  1.00 20.35 ? 515  PHE B CZ  1 
ATOM   1997 N N   . ASP B 1 122 ? -13.678 44.236 54.772  1.00 23.28 ? 516  ASP B N   1 
ATOM   1998 C CA  . ASP B 1 122 ? -14.893 44.208 53.955  1.00 24.41 ? 516  ASP B CA  1 
ATOM   1999 C C   . ASP B 1 122 ? -14.872 42.915 53.172  1.00 26.20 ? 516  ASP B C   1 
ATOM   2000 O O   . ASP B 1 122 ? -13.821 42.515 52.658  1.00 26.46 ? 516  ASP B O   1 
ATOM   2001 C CB  . ASP B 1 122 ? -14.942 45.365 52.925  1.00 25.13 ? 516  ASP B CB  1 
ATOM   2002 C CG  . ASP B 1 122 ? -14.980 46.751 53.584  1.00 26.53 ? 516  ASP B CG  1 
ATOM   2003 O OD1 . ASP B 1 122 ? -15.731 46.931 54.583  1.00 25.96 ? 516  ASP B OD1 1 
ATOM   2004 O OD2 . ASP B 1 122 ? -14.240 47.653 53.118  1.00 24.00 ? 516  ASP B OD2 1 
ATOM   2005 N N   . LEU B 1 123 ? -16.016 42.243 53.109  1.00 25.96 ? 517  LEU B N   1 
ATOM   2006 C CA  . LEU B 1 123 ? -16.125 40.995 52.372  1.00 25.72 ? 517  LEU B CA  1 
ATOM   2007 C C   . LEU B 1 123 ? -16.470 41.247 50.915  1.00 25.90 ? 517  LEU B C   1 
ATOM   2008 O O   . LEU B 1 123 ? -17.065 42.265 50.612  1.00 26.16 ? 517  LEU B O   1 
ATOM   2009 C CB  . LEU B 1 123 ? -17.165 40.094 53.054  1.00 26.11 ? 517  LEU B CB  1 
ATOM   2010 C CG  . LEU B 1 123 ? -16.690 39.236 54.245  1.00 22.62 ? 517  LEU B CG  1 
ATOM   2011 C CD1 . LEU B 1 123 ? -17.865 38.610 54.979  1.00 25.83 ? 517  LEU B CD1 1 
ATOM   2012 C CD2 . LEU B 1 123 ? -15.803 38.089 53.680  1.00 25.01 ? 517  LEU B CD2 1 
ATOM   2013 N N   . PRO B 1 124 ? -16.102 40.323 50.004  1.00 24.99 ? 518  PRO B N   1 
ATOM   2014 C CA  . PRO B 1 124 ? -16.554 40.452 48.604  1.00 24.07 ? 518  PRO B CA  1 
ATOM   2015 C C   . PRO B 1 124 ? -18.000 39.973 48.446  1.00 23.85 ? 518  PRO B C   1 
ATOM   2016 O O   . PRO B 1 124 ? -18.575 39.432 49.390  1.00 22.08 ? 518  PRO B O   1 
ATOM   2017 C CB  . PRO B 1 124 ? -15.625 39.481 47.872  1.00 24.96 ? 518  PRO B CB  1 
ATOM   2018 C CG  . PRO B 1 124 ? -15.354 38.404 48.852  1.00 23.82 ? 518  PRO B CG  1 
ATOM   2019 C CD  . PRO B 1 124 ? -15.302 39.101 50.204  1.00 25.29 ? 518  PRO B CD  1 
ATOM   2020 N N   . SER B 1 125 ? -18.596 40.178 47.285  1.00 23.55 ? 519  SER B N   1 
ATOM   2021 C CA  . SER B 1 125 ? -19.958 39.662 47.056  1.00 25.17 ? 519  SER B CA  1 
ATOM   2022 C C   . SER B 1 125 ? -19.995 38.231 46.521  1.00 25.99 ? 519  SER B C   1 
ATOM   2023 O O   . SER B 1 125 ? -21.070 37.600 46.523  1.00 28.11 ? 519  SER B O   1 
ATOM   2024 C CB  . SER B 1 125 ? -20.681 40.526 46.020  1.00 26.26 ? 519  SER B CB  1 
ATOM   2025 O OG  . SER B 1 125 ? -20.017 40.427 44.769  1.00 27.01 ? 519  SER B OG  1 
ATOM   2026 N N   . ASP B 1 126 ? -18.846 37.755 46.034  1.00 24.28 ? 520  ASP B N   1 
ATOM   2027 C CA  . ASP B 1 126 ? -18.691 36.448 45.412  1.00 25.45 ? 520  ASP B CA  1 
ATOM   2028 C C   . ASP B 1 126 ? -17.845 35.543 46.307  1.00 24.53 ? 520  ASP B C   1 
ATOM   2029 O O   . ASP B 1 126 ? -16.716 35.879 46.675  1.00 23.35 ? 520  ASP B O   1 
ATOM   2030 C CB  . ASP B 1 126 ? -17.897 36.589 44.086  1.00 26.31 ? 520  ASP B CB  1 
ATOM   2031 C CG  . ASP B 1 126 ? -18.016 35.354 43.186  1.00 30.28 ? 520  ASP B CG  1 
ATOM   2032 O OD1 . ASP B 1 126 ? -18.422 34.270 43.670  1.00 33.33 ? 520  ASP B OD1 1 
ATOM   2033 O OD2 . ASP B 1 126 ? -17.766 35.470 41.954  1.00 34.99 ? 520  ASP B OD2 1 
ATOM   2034 N N   . ILE B 1 127 ? -18.351 34.358 46.565  1.00 23.38 ? 521  ILE B N   1 
ATOM   2035 C CA  . ILE B 1 127 ? -17.630 33.377 47.385  1.00 23.34 ? 521  ILE B CA  1 
ATOM   2036 C C   . ILE B 1 127 ? -16.320 32.946 46.717  1.00 24.59 ? 521  ILE B C   1 
ATOM   2037 O O   . ILE B 1 127 ? -15.356 32.636 47.428  1.00 25.66 ? 521  ILE B O   1 
ATOM   2038 C CB  . ILE B 1 127 ? -18.490 32.101 47.672  1.00 22.03 ? 521  ILE B CB  1 
ATOM   2039 C CG1 . ILE B 1 127 ? -17.849 31.319 48.818  1.00 22.39 ? 521  ILE B CG1 1 
ATOM   2040 C CG2 . ILE B 1 127 ? -18.604 31.203 46.483  1.00 20.70 ? 521  ILE B CG2 1 
ATOM   2041 C CD1 . ILE B 1 127 ? -17.815 32.134 50.190  1.00 22.85 ? 521  ILE B CD1 1 
ATOM   2042 N N   . GLU B 1 128 ? -16.268 32.928 45.380  1.00 25.73 ? 522  GLU B N   1 
ATOM   2043 C CA  . GLU B 1 128 ? -14.991 32.586 44.666  1.00 26.98 ? 522  GLU B CA  1 
ATOM   2044 C C   . GLU B 1 128 ? -13.835 33.593 44.939  1.00 27.39 ? 522  GLU B C   1 
ATOM   2045 O O   . GLU B 1 128 ? -12.634 33.202 45.015  1.00 27.16 ? 522  GLU B O   1 
ATOM   2046 C CB  . GLU B 1 128 ? -15.239 32.462 43.171  1.00 28.21 ? 522  GLU B CB  1 
ATOM   2047 C CG  . GLU B 1 128 ? -15.928 31.154 42.780  1.00 29.90 ? 522  GLU B CG  1 
ATOM   2048 C CD  . GLU B 1 128 ? -16.226 31.025 41.287  1.00 31.07 ? 522  GLU B CD  1 
ATOM   2049 O OE1 . GLU B 1 128 ? -15.605 31.728 40.435  1.00 34.97 ? 522  GLU B OE1 1 
ATOM   2050 O OE2 . GLU B 1 128 ? -17.092 30.185 40.945  1.00 38.67 ? 522  GLU B OE2 1 
ATOM   2051 N N   . GLU B 1 129 ? -14.193 34.879 45.054  1.00 26.36 ? 523  GLU B N   1 
ATOM   2052 C CA  . GLU B 1 129 ? -13.269 35.936 45.506  1.00 27.46 ? 523  GLU B CA  1 
ATOM   2053 C C   . GLU B 1 129 ? -12.878 35.727 46.954  1.00 25.11 ? 523  GLU B C   1 
ATOM   2054 O O   . GLU B 1 129 ? -11.714 35.824 47.307  1.00 21.30 ? 523  GLU B O   1 
ATOM   2055 C CB  . GLU B 1 129 ? -13.895 37.337 45.357  1.00 27.00 ? 523  GLU B CB  1 
ATOM   2056 C CG  . GLU B 1 129 ? -12.962 38.436 45.926  1.00 33.44 ? 523  GLU B CG  1 
ATOM   2057 C CD  . GLU B 1 129 ? -13.309 39.880 45.521  1.00 35.60 ? 523  GLU B CD  1 
ATOM   2058 O OE1 . GLU B 1 129 ? -14.202 40.069 44.615  1.00 42.42 ? 523  GLU B OE1 1 
ATOM   2059 O OE2 . GLU B 1 129 ? -12.676 40.805 46.130  1.00 42.30 ? 523  GLU B OE2 1 
ATOM   2060 N N   . TYR B 1 130 ? -13.865 35.423 47.814  1.00 21.20 ? 524  TYR B N   1 
ATOM   2061 C CA  . TYR B 1 130 ? -13.523 35.056 49.202  1.00 21.14 ? 524  TYR B CA  1 
ATOM   2062 C C   . TYR B 1 130 ? -12.518 33.935 49.253  1.00 21.97 ? 524  TYR B C   1 
ATOM   2063 O O   . TYR B 1 130 ? -11.457 34.091 49.903  1.00 23.98 ? 524  TYR B O   1 
ATOM   2064 C CB  . TYR B 1 130 ? -14.758 34.581 49.962  1.00 20.13 ? 524  TYR B CB  1 
ATOM   2065 C CG  . TYR B 1 130 ? -14.424 34.091 51.338  1.00 22.29 ? 524  TYR B CG  1 
ATOM   2066 C CD1 . TYR B 1 130 ? -14.289 34.988 52.404  1.00 25.82 ? 524  TYR B CD1 1 
ATOM   2067 C CD2 . TYR B 1 130 ? -14.301 32.716 51.604  1.00 22.86 ? 524  TYR B CD2 1 
ATOM   2068 C CE1 . TYR B 1 130 ? -14.011 34.509 53.733  1.00 25.26 ? 524  TYR B CE1 1 
ATOM   2069 C CE2 . TYR B 1 130 ? -14.041 32.230 52.923  1.00 22.12 ? 524  TYR B CE2 1 
ATOM   2070 C CZ  . TYR B 1 130 ? -13.878 33.121 53.959  1.00 21.76 ? 524  TYR B CZ  1 
ATOM   2071 O OH  . TYR B 1 130 ? -13.624 32.650 55.261  1.00 25.56 ? 524  TYR B OH  1 
ATOM   2072 N N   . VAL B 1 131 ? -12.751 32.858 48.492  1.00 21.68 ? 525  VAL B N   1 
ATOM   2073 C CA  . VAL B 1 131 ? -11.778 31.721 48.457  1.00 23.49 ? 525  VAL B CA  1 
ATOM   2074 C C   . VAL B 1 131 ? -10.361 32.173 48.061  1.00 24.25 ? 525  VAL B C   1 
ATOM   2075 O O   . VAL B 1 131 ? -9.368  31.808 48.707  1.00 24.59 ? 525  VAL B O   1 
ATOM   2076 C CB  . VAL B 1 131 ? -12.303 30.562 47.610  1.00 24.57 ? 525  VAL B CB  1 
ATOM   2077 C CG1 . VAL B 1 131 ? -11.232 29.490 47.313  1.00 25.84 ? 525  VAL B CG1 1 
ATOM   2078 C CG2 . VAL B 1 131 ? -13.533 29.950 48.352  1.00 20.68 ? 525  VAL B CG2 1 
ATOM   2079 N N   . HIS B 1 132 ? -10.284 32.951 46.987  1.00 24.94 ? 526  HIS B N   1 
ATOM   2080 C CA  . HIS B 1 132 ? -9.014  33.449 46.483  1.00 25.28 ? 526  HIS B CA  1 
ATOM   2081 C C   . HIS B 1 132 ? -8.262  34.332 47.469  1.00 24.60 ? 526  HIS B C   1 
ATOM   2082 O O   . HIS B 1 132 ? -7.009  34.358 47.516  1.00 23.81 ? 526  HIS B O   1 
ATOM   2083 C CB  . HIS B 1 132 ? -9.230  34.204 45.179  1.00 27.41 ? 526  HIS B CB  1 
ATOM   2084 C CG  . HIS B 1 132 ? -7.973  34.363 44.398  1.00 33.00 ? 526  HIS B CG  1 
ATOM   2085 N ND1 . HIS B 1 132 ? -7.116  35.429 44.576  1.00 41.43 ? 526  HIS B ND1 1 
ATOM   2086 C CD2 . HIS B 1 132 ? -7.361  33.533 43.516  1.00 36.11 ? 526  HIS B CD2 1 
ATOM   2087 C CE1 . HIS B 1 132 ? -6.056  35.276 43.794  1.00 39.87 ? 526  HIS B CE1 1 
ATOM   2088 N NE2 . HIS B 1 132 ? -6.172  34.127 43.152  1.00 39.66 ? 526  HIS B NE2 1 
ATOM   2089 N N   . ARG B 1 133 ? -9.005  35.123 48.205  1.00 21.40 ? 527  ARG B N   1 
ATOM   2090 C CA  . ARG B 1 133 ? -8.410  35.954 49.263  1.00 24.20 ? 527  ARG B CA  1 
ATOM   2091 C C   . ARG B 1 133 ? -7.835  35.156 50.402  1.00 23.81 ? 527  ARG B C   1 
ATOM   2092 O O   . ARG B 1 133 ? -6.637  35.314 50.756  1.00 24.20 ? 527  ARG B O   1 
ATOM   2093 C CB  . ARG B 1 133 ? -9.432  36.946 49.777  1.00 23.66 ? 527  ARG B CB  1 
ATOM   2094 C CG  . ARG B 1 133 ? -9.748  38.125 48.767  1.00 26.16 ? 527  ARG B CG  1 
ATOM   2095 C CD  . ARG B 1 133 ? -10.835 38.915 49.491  1.00 28.41 ? 527  ARG B CD  1 
ATOM   2096 N NE  . ARG B 1 133 ? -11.399 40.059 48.800  1.00 31.24 ? 527  ARG B NE  1 
ATOM   2097 C CZ  . ARG B 1 133 ? -12.130 40.993 49.417  1.00 28.51 ? 527  ARG B CZ  1 
ATOM   2098 N NH1 . ARG B 1 133 ? -12.425 40.899 50.724  1.00 29.84 ? 527  ARG B NH1 1 
ATOM   2099 N NH2 . ARG B 1 133 ? -12.615 41.982 48.694  1.00 29.52 ? 527  ARG B NH2 1 
ATOM   2100 N N   . ILE B 1 134 ? -8.627  34.240 50.932  1.00 25.07 ? 528  ILE B N   1 
ATOM   2101 C CA  . ILE B 1 134 ? -8.125  33.480 52.094  1.00 26.58 ? 528  ILE B CA  1 
ATOM   2102 C C   . ILE B 1 134 ? -7.018  32.486 51.718  1.00 26.36 ? 528  ILE B C   1 
ATOM   2103 O O   . ILE B 1 134 ? -6.177  32.167 52.581  1.00 27.25 ? 528  ILE B O   1 
ATOM   2104 C CB  . ILE B 1 134 ? -9.253  32.816 52.930  1.00 25.66 ? 528  ILE B CB  1 
ATOM   2105 C CG1 . ILE B 1 134 ? -9.839  31.617 52.200  1.00 26.24 ? 528  ILE B CG1 1 
ATOM   2106 C CG2 . ILE B 1 134 ? -10.302 33.877 53.369  1.00 26.27 ? 528  ILE B CG2 1 
ATOM   2107 C CD1 . ILE B 1 134 ? -10.713 30.653 53.061  1.00 26.07 ? 528  ILE B CD1 1 
ATOM   2108 N N   . GLY B 1 135 ? -7.006  32.018 50.461  1.00 27.00 ? 529  GLY B N   1 
ATOM   2109 C CA  . GLY B 1 135 ? -5.918  31.164 49.957  1.00 26.58 ? 529  GLY B CA  1 
ATOM   2110 C C   . GLY B 1 135 ? -4.531  31.801 50.060  1.00 27.86 ? 529  GLY B C   1 
ATOM   2111 O O   . GLY B 1 135 ? -3.482  31.155 49.824  1.00 27.01 ? 529  GLY B O   1 
ATOM   2112 N N   . ARG B 1 136 ? -4.505  33.081 50.406  1.00 27.37 ? 530  ARG B N   1 
ATOM   2113 C CA  . ARG B 1 136 ? -3.221  33.814 50.509  1.00 27.18 ? 530  ARG B CA  1 
ATOM   2114 C C   . ARG B 1 136 ? -2.549  33.665 51.864  1.00 27.02 ? 530  ARG B C   1 
ATOM   2115 O O   . ARG B 1 136 ? -1.397  34.054 52.018  1.00 27.45 ? 530  ARG B O   1 
ATOM   2116 C CB  . ARG B 1 136 ? -3.459  35.290 50.228  1.00 26.74 ? 530  ARG B CB  1 
ATOM   2117 C CG  . ARG B 1 136 ? -3.931  35.520 48.768  1.00 28.78 ? 530  ARG B CG  1 
ATOM   2118 C CD  . ARG B 1 136 ? -3.663  36.926 48.411  1.00 38.28 ? 530  ARG B CD  1 
ATOM   2119 N NE  . ARG B 1 136 ? -4.143  37.249 47.070  1.00 40.68 ? 530  ARG B NE  1 
ATOM   2120 C CZ  . ARG B 1 136 ? -3.414  37.217 45.965  1.00 41.82 ? 530  ARG B CZ  1 
ATOM   2121 N NH1 . ARG B 1 136 ? -2.128  36.895 46.013  1.00 45.22 ? 530  ARG B NH1 1 
ATOM   2122 N NH2 . ARG B 1 136 ? -3.984  37.536 44.809  1.00 40.08 ? 530  ARG B NH2 1 
ATOM   2123 N N   . THR B 1 137 ? -3.268  33.142 52.857  1.00 25.76 ? 531  THR B N   1 
ATOM   2124 C CA  . THR B 1 137 ? -2.643  32.857 54.142  1.00 25.62 ? 531  THR B CA  1 
ATOM   2125 C C   . THR B 1 137 ? -2.267  31.394 54.279  1.00 27.28 ? 531  THR B C   1 
ATOM   2126 O O   . THR B 1 137 ? -2.991  30.496 53.844  1.00 28.21 ? 531  THR B O   1 
ATOM   2127 C CB  . THR B 1 137 ? -3.476  33.258 55.377  1.00 24.55 ? 531  THR B CB  1 
ATOM   2128 O OG1 . THR B 1 137 ? -2.774  32.822 56.575  1.00 24.21 ? 531  THR B OG1 1 
ATOM   2129 C CG2 . THR B 1 137 ? -4.854  32.595 55.321  1.00 17.99 ? 531  THR B CG2 1 
ATOM   2130 N N   . GLY B 1 138 ? -1.096  31.182 54.860  1.00 27.41 ? 532  GLY B N   1 
ATOM   2131 C CA  . GLY B 1 138 ? -0.720  29.867 55.305  1.00 28.00 ? 532  GLY B CA  1 
ATOM   2132 C C   . GLY B 1 138 ? 0.239   29.297 54.302  1.00 26.83 ? 532  GLY B C   1 
ATOM   2133 O O   . GLY B 1 138 ? 0.211   29.644 53.110  1.00 28.13 ? 532  GLY B O   1 
ATOM   2134 N N   . ARG B 1 139 ? 1.082   28.413 54.806  1.00 26.79 ? 533  ARG B N   1 
ATOM   2135 C CA  . ARG B 1 139 ? 2.105   27.772 54.018  1.00 27.55 ? 533  ARG B CA  1 
ATOM   2136 C C   . ARG B 1 139 ? 1.803   26.297 54.141  1.00 25.96 ? 533  ARG B C   1 
ATOM   2137 O O   . ARG B 1 139 ? 1.255   25.875 55.139  1.00 26.15 ? 533  ARG B O   1 
ATOM   2138 C CB  . ARG B 1 139 ? 3.471   28.105 54.645  1.00 25.99 ? 533  ARG B CB  1 
ATOM   2139 C CG  . ARG B 1 139 ? 4.678   27.556 53.885  1.00 31.14 ? 533  ARG B CG  1 
ATOM   2140 C CD  . ARG B 1 139 ? 5.978   27.671 54.725  1.00 32.14 ? 533  ARG B CD  1 
ATOM   2141 N NE  . ARG B 1 139 ? 5.733   27.233 56.120  1.00 39.49 ? 533  ARG B NE  1 
ATOM   2142 C CZ  . ARG B 1 139 ? 6.678   26.996 57.045  1.00 38.52 ? 533  ARG B CZ  1 
ATOM   2143 N NH1 . ARG B 1 139 ? 7.973   27.150 56.770  1.00 37.42 ? 533  ARG B NH1 1 
ATOM   2144 N NH2 . ARG B 1 139 ? 6.313   26.591 58.259  1.00 35.80 ? 533  ARG B NH2 1 
ATOM   2145 N N   . VAL B 1 140 ? 2.189   25.494 53.156  1.00 26.37 ? 534  VAL B N   1 
ATOM   2146 C CA  . VAL B 1 140 ? 2.157   24.043 53.331  1.00 25.09 ? 534  VAL B CA  1 
ATOM   2147 C C   . VAL B 1 140 ? 2.849   23.646 54.647  1.00 23.91 ? 534  VAL B C   1 
ATOM   2148 O O   . VAL B 1 140 ? 4.001   24.003 54.886  1.00 22.31 ? 534  VAL B O   1 
ATOM   2149 C CB  . VAL B 1 140 ? 2.907   23.304 52.210  1.00 25.44 ? 534  VAL B CB  1 
ATOM   2150 C CG1 . VAL B 1 140 ? 2.521   21.833 52.245  1.00 26.40 ? 534  VAL B CG1 1 
ATOM   2151 C CG2 . VAL B 1 140 ? 2.608   23.917 50.844  1.00 26.43 ? 534  VAL B CG2 1 
ATOM   2152 N N   . GLY B 1 141 ? 2.166   22.881 55.487  1.00 20.71 ? 535  GLY B N   1 
ATOM   2153 C CA  . GLY B 1 141 ? 2.845   22.379 56.658  1.00 20.58 ? 535  GLY B CA  1 
ATOM   2154 C C   . GLY B 1 141 ? 2.455   23.219 57.864  1.00 20.08 ? 535  GLY B C   1 
ATOM   2155 O O   . GLY B 1 141 ? 2.738   22.843 58.993  1.00 20.35 ? 535  GLY B O   1 
ATOM   2156 N N   . ASN B 1 142 ? 1.882   24.385 57.631  1.00 20.33 ? 536  ASN B N   1 
ATOM   2157 C CA  . ASN B 1 142 ? 1.281   25.114 58.750  1.00 24.03 ? 536  ASN B CA  1 
ATOM   2158 C C   . ASN B 1 142 ? -0.171  25.478 58.542  1.00 23.26 ? 536  ASN B C   1 
ATOM   2159 O O   . ASN B 1 142 ? -0.768  25.166 57.512  1.00 22.87 ? 536  ASN B O   1 
ATOM   2160 C CB  . ASN B 1 142 ? 2.072   26.363 59.102  1.00 24.91 ? 536  ASN B CB  1 
ATOM   2161 C CG  . ASN B 1 142 ? 1.806   27.492 58.160  1.00 30.23 ? 536  ASN B CG  1 
ATOM   2162 O OD1 . ASN B 1 142 ? 0.713   27.602 57.568  1.00 35.68 ? 536  ASN B OD1 1 
ATOM   2163 N ND2 . ASN B 1 142 ? 2.793   28.365 58.011  1.00 37.38 ? 536  ASN B ND2 1 
ATOM   2164 N N   . LEU B 1 143 ? -0.718  26.216 59.499  1.00 22.64 ? 537  LEU B N   1 
ATOM   2165 C CA  . LEU B 1 143 ? -2.117  26.569 59.469  1.00 24.39 ? 537  LEU B CA  1 
ATOM   2166 C C   . LEU B 1 143 ? -2.267  28.098 59.265  1.00 25.15 ? 537  LEU B C   1 
ATOM   2167 O O   . LEU B 1 143 ? -1.619  28.890 59.954  1.00 25.86 ? 537  LEU B O   1 
ATOM   2168 C CB  . LEU B 1 143 ? -2.726  26.141 60.782  1.00 25.84 ? 537  LEU B CB  1 
ATOM   2169 C CG  . LEU B 1 143 ? -4.197  26.446 61.012  1.00 30.92 ? 537  LEU B CG  1 
ATOM   2170 C CD1 . LEU B 1 143 ? -5.124  25.387 60.360  1.00 33.50 ? 537  LEU B CD1 1 
ATOM   2171 C CD2 . LEU B 1 143 ? -4.376  26.546 62.574  1.00 33.14 ? 537  LEU B CD2 1 
ATOM   2172 N N   . GLY B 1 144 ? -3.045  28.500 58.273  1.00 23.06 ? 538  GLY B N   1 
ATOM   2173 C CA  . GLY B 1 144 ? -3.283  29.911 58.059  1.00 21.79 ? 538  GLY B CA  1 
ATOM   2174 C C   . GLY B 1 144 ? -4.457  30.354 58.924  1.00 21.60 ? 538  GLY B C   1 
ATOM   2175 O O   . GLY B 1 144 ? -5.136  29.525 59.604  1.00 19.53 ? 538  GLY B O   1 
ATOM   2176 N N   . LEU B 1 145 ? -4.704  31.661 58.901  1.00 21.30 ? 539  LEU B N   1 
ATOM   2177 C CA  . LEU B 1 145 ? -5.748  32.294 59.717  1.00 21.35 ? 539  LEU B CA  1 
ATOM   2178 C C   . LEU B 1 145 ? -6.368  33.326 58.846  1.00 20.99 ? 539  LEU B C   1 
ATOM   2179 O O   . LEU B 1 145 ? -5.662  34.190 58.291  1.00 21.66 ? 539  LEU B O   1 
ATOM   2180 C CB  . LEU B 1 145 ? -5.160  33.010 60.964  1.00 19.34 ? 539  LEU B CB  1 
ATOM   2181 C CG  . LEU B 1 145 ? -6.276  33.749 61.772  1.00 22.69 ? 539  LEU B CG  1 
ATOM   2182 C CD1 . LEU B 1 145 ? -7.317  32.772 62.373  1.00 23.55 ? 539  LEU B CD1 1 
ATOM   2183 C CD2 . LEU B 1 145 ? -5.581  34.561 62.875  1.00 25.24 ? 539  LEU B CD2 1 
ATOM   2184 N N   . ALA B 1 146 ? -7.688  33.231 58.668  1.00 21.80 ? 540  ALA B N   1 
ATOM   2185 C CA  . ALA B 1 146 ? -8.392  34.192 57.884  1.00 20.66 ? 540  ALA B CA  1 
ATOM   2186 C C   . ALA B 1 146 ? -9.557  34.733 58.712  1.00 22.87 ? 540  ALA B C   1 
ATOM   2187 O O   . ALA B 1 146 ? -10.497 33.979 59.018  1.00 24.42 ? 540  ALA B O   1 
ATOM   2188 C CB  . ALA B 1 146 ? -8.927  33.506 56.641  1.00 23.28 ? 540  ALA B CB  1 
ATOM   2189 N N   . THR B 1 147 ? -9.541  36.010 59.049  1.00 21.70 ? 541  THR B N   1 
ATOM   2190 C CA  . THR B 1 147 ? -10.677 36.582 59.903  1.00 22.94 ? 541  THR B CA  1 
ATOM   2191 C C   . THR B 1 147 ? -11.537 37.493 59.037  1.00 22.80 ? 541  THR B C   1 
ATOM   2192 O O   . THR B 1 147 ? -10.976 38.328 58.308  1.00 23.22 ? 541  THR B O   1 
ATOM   2193 C CB  . THR B 1 147 ? -10.126 37.359 61.121  1.00 22.65 ? 541  THR B CB  1 
ATOM   2194 O OG1 . THR B 1 147 ? -9.204  36.528 61.858  1.00 22.75 ? 541  THR B OG1 1 
ATOM   2195 C CG2 . THR B 1 147 ? -11.278 37.802 62.080  1.00 23.39 ? 541  THR B CG2 1 
ATOM   2196 N N   . SER B 1 148 ? -12.887 37.402 59.116  1.00 21.14 ? 542  SER B N   1 
ATOM   2197 C CA  . SER B 1 148 ? -13.719 38.168 58.165  1.00 21.19 ? 542  SER B CA  1 
ATOM   2198 C C   . SER B 1 148 ? -14.770 38.927 58.959  1.00 20.99 ? 542  SER B C   1 
ATOM   2199 O O   . SER B 1 148 ? -15.338 38.375 59.900  1.00 21.99 ? 542  SER B O   1 
ATOM   2200 C CB  . SER B 1 148 ? -14.389 37.264 57.133  1.00 20.61 ? 542  SER B CB  1 
ATOM   2201 O OG  . SER B 1 148 ? -13.426 36.601 56.353  1.00 24.11 ? 542  SER B OG  1 
ATOM   2202 N N   . PHE B 1 149 ? -14.939 40.215 58.655  1.00 22.62 ? 543  PHE B N   1 
ATOM   2203 C CA  . PHE B 1 149 ? -15.953 41.038 59.351  1.00 22.02 ? 543  PHE B CA  1 
ATOM   2204 C C   . PHE B 1 149 ? -17.202 40.989 58.521  1.00 21.59 ? 543  PHE B C   1 
ATOM   2205 O O   . PHE B 1 149 ? -17.092 41.199 57.306  1.00 22.48 ? 543  PHE B O   1 
ATOM   2206 C CB  . PHE B 1 149 ? -15.481 42.509 59.494  1.00 23.09 ? 543  PHE B CB  1 
ATOM   2207 C CG  . PHE B 1 149 ? -14.201 42.701 60.296  1.00 22.34 ? 543  PHE B CG  1 
ATOM   2208 C CD1 . PHE B 1 149 ? -13.639 41.676 61.058  1.00 24.47 ? 543  PHE B CD1 1 
ATOM   2209 C CD2 . PHE B 1 149 ? -13.601 43.956 60.321  1.00 23.71 ? 543  PHE B CD2 1 
ATOM   2210 C CE1 . PHE B 1 149 ? -12.463 41.880 61.776  1.00 23.88 ? 543  PHE B CE1 1 
ATOM   2211 C CE2 . PHE B 1 149 ? -12.431 44.174 61.032  1.00 24.56 ? 543  PHE B CE2 1 
ATOM   2212 C CZ  . PHE B 1 149 ? -11.867 43.121 61.775  1.00 24.99 ? 543  PHE B CZ  1 
ATOM   2213 N N   . PHE B 1 150 ? -18.380 40.778 59.143  1.00 21.63 ? 544  PHE B N   1 
ATOM   2214 C CA  . PHE B 1 150 ? -19.624 40.525 58.414  1.00 20.30 ? 544  PHE B CA  1 
ATOM   2215 C C   . PHE B 1 150 ? -20.724 41.405 59.006  1.00 20.09 ? 544  PHE B C   1 
ATOM   2216 O O   . PHE B 1 150 ? -20.761 41.614 60.213  1.00 18.56 ? 544  PHE B O   1 
ATOM   2217 C CB  . PHE B 1 150 ? -19.921 38.997 58.471  1.00 22.44 ? 544  PHE B CB  1 
ATOM   2218 C CG  . PHE B 1 150 ? -21.080 38.524 57.597  1.00 22.34 ? 544  PHE B CG  1 
ATOM   2219 C CD1 . PHE B 1 150 ? -20.876 37.649 56.519  1.00 22.35 ? 544  PHE B CD1 1 
ATOM   2220 C CD2 . PHE B 1 150 ? -22.392 38.876 57.931  1.00 22.87 ? 544  PHE B CD2 1 
ATOM   2221 C CE1 . PHE B 1 150 ? -22.050 37.166 55.750  1.00 22.10 ? 544  PHE B CE1 1 
ATOM   2222 C CE2 . PHE B 1 150 ? -23.520 38.438 57.132  1.00 23.95 ? 544  PHE B CE2 1 
ATOM   2223 C CZ  . PHE B 1 150 ? -23.318 37.627 56.069  1.00 24.78 ? 544  PHE B CZ  1 
ATOM   2224 N N   . ASN B 1 151 ? -21.587 41.976 58.160  1.00 19.07 ? 545  ASN B N   1 
ATOM   2225 C CA  . ASN B 1 151 ? -22.801 42.639 58.690  1.00 21.23 ? 545  ASN B CA  1 
ATOM   2226 C C   . ASN B 1 151 ? -23.885 42.597 57.592  1.00 20.92 ? 545  ASN B C   1 
ATOM   2227 O O   . ASN B 1 151 ? -23.709 41.875 56.596  1.00 18.75 ? 545  ASN B O   1 
ATOM   2228 C CB  . ASN B 1 151 ? -22.469 44.049 59.197  1.00 20.76 ? 545  ASN B CB  1 
ATOM   2229 C CG  . ASN B 1 151 ? -21.935 44.970 58.088  1.00 23.51 ? 545  ASN B CG  1 
ATOM   2230 O OD1 . ASN B 1 151 ? -22.496 45.011 57.004  1.00 24.54 ? 545  ASN B OD1 1 
ATOM   2231 N ND2 . ASN B 1 151 ? -20.909 45.757 58.386  1.00 24.19 ? 545  ASN B ND2 1 
ATOM   2232 N N   . GLU B 1 152 ? -24.976 43.342 57.754  1.00 22.37 ? 546  GLU B N   1 
ATOM   2233 C CA  . GLU B 1 152 ? -26.121 43.201 56.830  1.00 23.59 ? 546  GLU B CA  1 
ATOM   2234 C C   . GLU B 1 152 ? -25.821 43.488 55.363  1.00 24.33 ? 546  GLU B C   1 
ATOM   2235 O O   . GLU B 1 152 ? -26.536 43.021 54.475  1.00 24.48 ? 546  GLU B O   1 
ATOM   2236 C CB  . GLU B 1 152 ? -27.308 44.036 57.313  1.00 24.87 ? 546  GLU B CB  1 
ATOM   2237 C CG  . GLU B 1 152 ? -27.592 43.799 58.830  1.00 29.94 ? 546  GLU B CG  1 
ATOM   2238 C CD  . GLU B 1 152 ? -28.741 42.840 59.087  1.00 40.24 ? 546  GLU B CD  1 
ATOM   2239 O OE1 . GLU B 1 152 ? -28.974 41.965 58.218  1.00 43.72 ? 546  GLU B OE1 1 
ATOM   2240 O OE2 . GLU B 1 152 ? -29.417 42.966 60.155  1.00 42.21 ? 546  GLU B OE2 1 
ATOM   2241 N N   . ARG B 1 153 ? -24.772 44.267 55.112  1.00 23.26 ? 547  ARG B N   1 
ATOM   2242 C CA  . ARG B 1 153 ? -24.254 44.506 53.797  1.00 24.60 ? 547  ARG B CA  1 
ATOM   2243 C C   . ARG B 1 153 ? -23.826 43.227 53.056  1.00 23.55 ? 547  ARG B C   1 
ATOM   2244 O O   . ARG B 1 153 ? -23.675 43.266 51.828  1.00 21.57 ? 547  ARG B O   1 
ATOM   2245 C CB  . ARG B 1 153 ? -23.032 45.446 53.883  1.00 25.06 ? 547  ARG B CB  1 
ATOM   2246 C CG  . ARG B 1 153 ? -23.411 46.867 54.415  1.00 30.47 ? 547  ARG B CG  1 
ATOM   2247 C CD  . ARG B 1 153 ? -22.290 47.842 54.173  1.00 38.11 ? 547  ARG B CD  1 
ATOM   2248 N NE  . ARG B 1 153 ? -21.923 47.772 52.757  1.00 45.41 ? 547  ARG B NE  1 
ATOM   2249 C CZ  . ARG B 1 153 ? -20.755 48.148 52.236  1.00 49.63 ? 547  ARG B CZ  1 
ATOM   2250 N NH1 . ARG B 1 153 ? -19.793 48.673 53.000  1.00 51.32 ? 547  ARG B NH1 1 
ATOM   2251 N NH2 . ARG B 1 153 ? -20.550 47.999 50.928  1.00 51.64 ? 547  ARG B NH2 1 
ATOM   2252 N N   . ASN B 1 154 ? -23.649 42.118 53.787  1.00 21.67 ? 548  ASN B N   1 
ATOM   2253 C CA  . ASN B 1 154 ? -23.088 40.885 53.217  1.00 21.79 ? 548  ASN B CA  1 
ATOM   2254 C C   . ASN B 1 154 ? -24.083 39.725 53.125  1.00 22.00 ? 548  ASN B C   1 
ATOM   2255 O O   . ASN B 1 154 ? -23.688 38.573 52.893  1.00 20.77 ? 548  ASN B O   1 
ATOM   2256 C CB  . ASN B 1 154 ? -21.829 40.426 53.972  1.00 22.56 ? 548  ASN B CB  1 
ATOM   2257 C CG  . ASN B 1 154 ? -20.824 41.515 54.135  1.00 23.41 ? 548  ASN B CG  1 
ATOM   2258 O OD1 . ASN B 1 154 ? -20.519 41.880 55.240  1.00 21.89 ? 548  ASN B OD1 1 
ATOM   2259 N ND2 . ASN B 1 154 ? -20.292 42.061 53.021  1.00 22.05 ? 548  ASN B ND2 1 
ATOM   2260 N N   . ILE B 1 155 ? -25.375 40.022 53.293  1.00 21.87 ? 549  ILE B N   1 
ATOM   2261 C CA  . ILE B 1 155 ? -26.452 39.011 53.079  1.00 22.43 ? 549  ILE B CA  1 
ATOM   2262 C C   . ILE B 1 155 ? -26.277 38.218 51.773  1.00 22.99 ? 549  ILE B C   1 
ATOM   2263 O O   . ILE B 1 155 ? -26.541 36.994 51.717  1.00 23.05 ? 549  ILE B O   1 
ATOM   2264 C CB  . ILE B 1 155 ? -27.749 39.694 53.059  1.00 22.97 ? 549  ILE B CB  1 
ATOM   2265 C CG1 . ILE B 1 155 ? -28.072 40.065 54.518  1.00 26.28 ? 549  ILE B CG1 1 
ATOM   2266 C CG2 . ILE B 1 155 ? -28.870 38.801 52.375  1.00 25.87 ? 549  ILE B CG2 1 
ATOM   2267 C CD1 . ILE B 1 155 ? -28.757 38.961 55.373  1.00 33.14 ? 549  ILE B CD1 1 
ATOM   2268 N N   . ASN B 1 156 ? -25.783 38.903 50.743  1.00 20.51 ? 550  ASN B N   1 
ATOM   2269 C CA  . ASN B 1 156 ? -25.609 38.252 49.468  1.00 22.10 ? 550  ASN B CA  1 
ATOM   2270 C C   . ASN B 1 156 ? -24.665 37.052 49.431  1.00 23.78 ? 550  ASN B C   1 
ATOM   2271 O O   . ASN B 1 156 ? -24.781 36.204 48.543  1.00 24.90 ? 550  ASN B O   1 
ATOM   2272 C CB  . ASN B 1 156 ? -25.229 39.254 48.363  1.00 23.90 ? 550  ASN B CB  1 
ATOM   2273 C CG  . ASN B 1 156 ? -23.944 39.999 48.638  1.00 21.10 ? 550  ASN B CG  1 
ATOM   2274 O OD1 . ASN B 1 156 ? -23.147 39.674 49.529  1.00 22.10 ? 550  ASN B OD1 1 
ATOM   2275 N ND2 . ASN B 1 156 ? -23.732 41.019 47.857  1.00 24.39 ? 550  ASN B ND2 1 
ATOM   2276 N N   . ILE B 1 157 ? -23.724 36.974 50.367  1.00 21.80 ? 551  ILE B N   1 
ATOM   2277 C CA  . ILE B 1 157 ? -22.804 35.854 50.390  1.00 23.11 ? 551  ILE B CA  1 
ATOM   2278 C C   . ILE B 1 157 ? -23.141 34.816 51.500  1.00 23.91 ? 551  ILE B C   1 
ATOM   2279 O O   . ILE B 1 157 ? -22.407 33.846 51.686  1.00 23.94 ? 551  ILE B O   1 
ATOM   2280 C CB  . ILE B 1 157 ? -21.327 36.398 50.504  1.00 22.94 ? 551  ILE B CB  1 
ATOM   2281 C CG1 . ILE B 1 157 ? -20.271 35.420 49.919  1.00 25.63 ? 551  ILE B CG1 1 
ATOM   2282 C CG2 . ILE B 1 157 ? -21.019 36.835 51.924  1.00 21.64 ? 551  ILE B CG2 1 
ATOM   2283 C CD1 . ILE B 1 157 ? -18.785 36.001 49.985  1.00 24.84 ? 551  ILE B CD1 1 
ATOM   2284 N N   . THR B 1 158 ? -24.238 35.026 52.239  1.00 23.37 ? 552  THR B N   1 
ATOM   2285 C CA  . THR B 1 158 ? -24.498 34.249 53.425  1.00 23.71 ? 552  THR B CA  1 
ATOM   2286 C C   . THR B 1 158 ? -24.507 32.751 53.194  1.00 22.92 ? 552  THR B C   1 
ATOM   2287 O O   . THR B 1 158 ? -23.787 32.027 53.889  1.00 22.70 ? 552  THR B O   1 
ATOM   2288 C CB  . THR B 1 158 ? -25.837 34.641 54.021  1.00 25.31 ? 552  THR B CB  1 
ATOM   2289 O OG1 . THR B 1 158 ? -25.795 36.031 54.401  1.00 26.77 ? 552  THR B OG1 1 
ATOM   2290 C CG2 . THR B 1 158 ? -26.151 33.762 55.191  1.00 24.21 ? 552  THR B CG2 1 
ATOM   2291 N N   . LYS B 1 159 ? -25.301 32.293 52.227  1.00 20.49 ? 553  LYS B N   1 
ATOM   2292 C CA  . LYS B 1 159 ? -25.481 30.886 51.971  1.00 23.24 ? 553  LYS B CA  1 
ATOM   2293 C C   . LYS B 1 159 ? -24.191 30.225 51.502  1.00 22.38 ? 553  LYS B C   1 
ATOM   2294 O O   . LYS B 1 159 ? -23.832 29.163 52.003  1.00 21.69 ? 553  LYS B O   1 
ATOM   2295 C CB  . LYS B 1 159 ? -26.610 30.601 50.944  1.00 23.58 ? 553  LYS B CB  1 
ATOM   2296 C CG  . LYS B 1 159 ? -27.941 31.384 51.189  1.00 28.95 ? 553  LYS B CG  1 
ATOM   2297 C CD  . LYS B 1 159 ? -29.272 30.565 50.775  1.00 28.38 ? 553  LYS B CD  1 
ATOM   2298 C CE  . LYS B 1 159 ? -30.596 31.288 51.114  1.00 30.96 ? 553  LYS B CE  1 
ATOM   2299 N NZ  . LYS B 1 159 ? -31.880 30.602 50.685  1.00 35.35 ? 553  LYS B NZ  1 
ATOM   2300 N N   . ASP B 1 160 ? -23.492 30.835 50.554  1.00 21.28 ? 554  ASP B N   1 
ATOM   2301 C CA  . ASP B 1 160 ? -22.275 30.191 50.060  1.00 22.31 ? 554  ASP B CA  1 
ATOM   2302 C C   . ASP B 1 160 ? -21.147 30.218 51.123  1.00 21.63 ? 554  ASP B C   1 
ATOM   2303 O O   . ASP B 1 160 ? -20.312 29.286 51.131  1.00 20.47 ? 554  ASP B O   1 
ATOM   2304 C CB  . ASP B 1 160 ? -21.725 30.871 48.814  1.00 23.23 ? 554  ASP B CB  1 
ATOM   2305 C CG  . ASP B 1 160 ? -22.578 30.644 47.588  1.00 28.09 ? 554  ASP B CG  1 
ATOM   2306 O OD1 . ASP B 1 160 ? -23.217 29.556 47.491  1.00 28.58 ? 554  ASP B OD1 1 
ATOM   2307 O OD2 . ASP B 1 160 ? -22.577 31.565 46.726  1.00 29.58 ? 554  ASP B OD2 1 
ATOM   2308 N N   . LEU B 1 161 ? -21.078 31.294 51.926  1.00 19.77 ? 555  LEU B N   1 
ATOM   2309 C CA  . LEU B 1 161 ? -20.133 31.368 53.065  1.00 20.85 ? 555  LEU B CA  1 
ATOM   2310 C C   . LEU B 1 161 ? -20.470 30.312 54.105  1.00 21.47 ? 555  LEU B C   1 
ATOM   2311 O O   . LEU B 1 161 ? -19.598 29.541 54.534  1.00 20.84 ? 555  LEU B O   1 
ATOM   2312 C CB  . LEU B 1 161 ? -20.112 32.745 53.761  1.00 20.41 ? 555  LEU B CB  1 
ATOM   2313 C CG  . LEU B 1 161 ? -19.072 32.959 54.854  1.00 21.39 ? 555  LEU B CG  1 
ATOM   2314 C CD1 . LEU B 1 161 ? -17.647 32.686 54.359  1.00 20.66 ? 555  LEU B CD1 1 
ATOM   2315 C CD2 . LEU B 1 161 ? -19.145 34.390 55.393  1.00 21.08 ? 555  LEU B CD2 1 
ATOM   2316 N N   . LEU B 1 162 ? -21.712 30.260 54.519  1.00 20.99 ? 556  LEU B N   1 
ATOM   2317 C CA  . LEU B 1 162 ? -22.143 29.135 55.392  1.00 22.81 ? 556  LEU B CA  1 
ATOM   2318 C C   . LEU B 1 162 ? -21.732 27.751 54.856  1.00 23.70 ? 556  LEU B C   1 
ATOM   2319 O O   . LEU B 1 162 ? -21.147 26.964 55.587  1.00 24.37 ? 556  LEU B O   1 
ATOM   2320 C CB  . LEU B 1 162 ? -23.624 29.175 55.696  1.00 21.96 ? 556  LEU B CB  1 
ATOM   2321 C CG  . LEU B 1 162 ? -24.189 27.989 56.494  1.00 25.19 ? 556  LEU B CG  1 
ATOM   2322 C CD1 . LEU B 1 162 ? -23.657 27.883 57.957  1.00 25.91 ? 556  LEU B CD1 1 
ATOM   2323 C CD2 . LEU B 1 162 ? -25.730 27.953 56.458  1.00 24.30 ? 556  LEU B CD2 1 
ATOM   2324 N N   . ASP B 1 163 ? -22.065 27.427 53.607  1.00 23.42 ? 557  ASP B N   1 
ATOM   2325 C CA  . ASP B 1 163 ? -21.781 26.082 53.074  1.00 23.99 ? 557  ASP B CA  1 
ATOM   2326 C C   . ASP B 1 163 ? -20.241 25.784 53.121  1.00 24.42 ? 557  ASP B C   1 
ATOM   2327 O O   . ASP B 1 163 ? -19.790 24.646 53.420  1.00 23.43 ? 557  ASP B O   1 
ATOM   2328 C CB  . ASP B 1 163 ? -22.339 25.926 51.641  1.00 23.86 ? 557  ASP B CB  1 
ATOM   2329 C CG  . ASP B 1 163 ? -23.900 25.952 51.589  1.00 28.79 ? 557  ASP B CG  1 
ATOM   2330 O OD1 . ASP B 1 163 ? -24.540 25.769 52.647  1.00 29.27 ? 557  ASP B OD1 1 
ATOM   2331 O OD2 . ASP B 1 163 ? -24.495 26.124 50.480  1.00 30.98 ? 557  ASP B OD2 1 
ATOM   2332 N N   . LEU B 1 164 ? -19.460 26.817 52.848  1.00 22.66 ? 558  LEU B N   1 
ATOM   2333 C CA  . LEU B 1 164 ? -18.019 26.680 52.818  1.00 24.00 ? 558  LEU B CA  1 
ATOM   2334 C C   . LEU B 1 164 ? -17.464 26.370 54.214  1.00 23.34 ? 558  LEU B C   1 
ATOM   2335 O O   . LEU B 1 164 ? -16.606 25.485 54.352  1.00 21.66 ? 558  LEU B O   1 
ATOM   2336 C CB  . LEU B 1 164 ? -17.366 27.917 52.186  1.00 23.59 ? 558  LEU B CB  1 
ATOM   2337 C CG  . LEU B 1 164 ? -15.836 27.861 51.923  1.00 28.38 ? 558  LEU B CG  1 
ATOM   2338 C CD1 . LEU B 1 164 ? -15.453 28.940 50.956  1.00 30.54 ? 558  LEU B CD1 1 
ATOM   2339 C CD2 . LEU B 1 164 ? -15.050 28.001 53.202  1.00 30.34 ? 558  LEU B CD2 1 
ATOM   2340 N N   . LEU B 1 165 ? -17.913 27.111 55.225  1.00 20.99 ? 559  LEU B N   1 
ATOM   2341 C CA  . LEU B 1 165 ? -17.494 26.860 56.613  1.00 20.19 ? 559  LEU B CA  1 
ATOM   2342 C C   . LEU B 1 165 ? -17.855 25.462 57.084  1.00 20.83 ? 559  LEU B C   1 
ATOM   2343 O O   . LEU B 1 165 ? -17.079 24.748 57.714  1.00 21.13 ? 559  LEU B O   1 
ATOM   2344 C CB  . LEU B 1 165 ? -18.165 27.931 57.527  1.00 20.45 ? 559  LEU B CB  1 
ATOM   2345 C CG  . LEU B 1 165 ? -17.619 29.370 57.307  1.00 19.10 ? 559  LEU B CG  1 
ATOM   2346 C CD1 . LEU B 1 165 ? -18.453 30.386 58.184  1.00 24.13 ? 559  LEU B CD1 1 
ATOM   2347 C CD2 . LEU B 1 165 ? -16.144 29.508 57.619  1.00 24.71 ? 559  LEU B CD2 1 
ATOM   2348 N N   . VAL B 1 166 ? -19.055 25.029 56.730  1.00 21.26 ? 560  VAL B N   1 
ATOM   2349 C CA  . VAL B 1 166 ? -19.548 23.739 57.193  1.00 21.49 ? 560  VAL B CA  1 
ATOM   2350 C C   . VAL B 1 166 ? -18.733 22.655 56.543  1.00 22.14 ? 560  VAL B C   1 
ATOM   2351 O O   . VAL B 1 166 ? -18.313 21.693 57.222  1.00 23.46 ? 560  VAL B O   1 
ATOM   2352 C CB  . VAL B 1 166 ? -21.032 23.589 56.859  1.00 20.62 ? 560  VAL B CB  1 
ATOM   2353 C CG1 . VAL B 1 166 ? -21.504 22.126 57.004  1.00 21.70 ? 560  VAL B CG1 1 
ATOM   2354 C CG2 . VAL B 1 166 ? -21.855 24.477 57.802  1.00 23.77 ? 560  VAL B CG2 1 
ATOM   2355 N N   . GLU B 1 167 ? -18.451 22.808 55.250  1.00 21.82 ? 561  GLU B N   1 
ATOM   2356 C CA  . GLU B 1 167 ? -17.700 21.742 54.579  1.00 23.81 ? 561  GLU B CA  1 
ATOM   2357 C C   . GLU B 1 167 ? -16.264 21.687 55.073  1.00 23.02 ? 561  GLU B C   1 
ATOM   2358 O O   . GLU B 1 167 ? -15.682 20.603 55.113  1.00 22.95 ? 561  GLU B O   1 
ATOM   2359 C CB  . GLU B 1 167 ? -17.732 21.865 53.053  1.00 24.91 ? 561  GLU B CB  1 
ATOM   2360 C CG  . GLU B 1 167 ? -19.067 21.581 52.410  1.00 30.75 ? 561  GLU B CG  1 
ATOM   2361 C CD  . GLU B 1 167 ? -19.576 20.157 52.648  1.00 38.07 ? 561  GLU B CD  1 
ATOM   2362 O OE1 . GLU B 1 167 ? -18.923 19.188 52.170  1.00 41.93 ? 561  GLU B OE1 1 
ATOM   2363 O OE2 . GLU B 1 167 ? -20.638 20.011 53.308  1.00 37.94 ? 561  GLU B OE2 1 
ATOM   2364 N N   . ALA B 1 168 ? -15.703 22.853 55.439  1.00 21.89 ? 562  ALA B N   1 
ATOM   2365 C CA  . ALA B 1 168 ? -14.328 22.964 55.935  1.00 19.74 ? 562  ALA B CA  1 
ATOM   2366 C C   . ALA B 1 168 ? -14.214 22.713 57.424  1.00 20.72 ? 562  ALA B C   1 
ATOM   2367 O O   . ALA B 1 168 ? -13.121 22.858 57.980  1.00 21.05 ? 562  ALA B O   1 
ATOM   2368 C CB  . ALA B 1 168 ? -13.741 24.356 55.582  1.00 18.81 ? 562  ALA B CB  1 
ATOM   2369 N N   . LYS B 1 169 ? -15.307 22.269 58.042  1.00 21.24 ? 563  LYS B N   1 
ATOM   2370 C CA  . LYS B 1 169 ? -15.385 21.979 59.489  1.00 22.36 ? 563  LYS B CA  1 
ATOM   2371 C C   . LYS B 1 169 ? -14.888 23.123 60.381  1.00 21.29 ? 563  LYS B C   1 
ATOM   2372 O O   . LYS B 1 169 ? -14.210 22.874 61.389  1.00 20.40 ? 563  LYS B O   1 
ATOM   2373 C CB  . LYS B 1 169 ? -14.713 20.629 59.841  1.00 22.20 ? 563  LYS B CB  1 
ATOM   2374 C CG  . LYS B 1 169 ? -15.345 19.441 59.162  1.00 26.91 ? 563  LYS B CG  1 
ATOM   2375 C CD  . LYS B 1 169 ? -14.735 18.163 59.681  1.00 33.49 ? 563  LYS B CD  1 
ATOM   2376 C CE  . LYS B 1 169 ? -15.158 16.905 58.892  1.00 39.10 ? 563  LYS B CE  1 
ATOM   2377 N NZ  . LYS B 1 169 ? -16.591 16.589 59.000  1.00 39.29 ? 563  LYS B NZ  1 
ATOM   2378 N N   . GLN B 1 170 ? -15.252 24.366 59.994  1.00 20.86 ? 564  GLN B N   1 
ATOM   2379 C CA  . GLN B 1 170 ? -14.903 25.585 60.696  1.00 19.13 ? 564  GLN B CA  1 
ATOM   2380 C C   . GLN B 1 170 ? -16.038 25.979 61.614  1.00 21.73 ? 564  GLN B C   1 
ATOM   2381 O O   . GLN B 1 170 ? -17.131 25.423 61.488  1.00 20.42 ? 564  GLN B O   1 
ATOM   2382 C CB  . GLN B 1 170 ? -14.649 26.713 59.690  1.00 19.85 ? 564  GLN B CB  1 
ATOM   2383 C CG  . GLN B 1 170 ? -13.503 26.366 58.755  1.00 20.85 ? 564  GLN B CG  1 
ATOM   2384 C CD  . GLN B 1 170 ? -12.193 26.136 59.541  1.00 27.55 ? 564  GLN B CD  1 
ATOM   2385 O OE1 . GLN B 1 170 ? -11.559 25.059 59.466  1.00 31.86 ? 564  GLN B OE1 1 
ATOM   2386 N NE2 . GLN B 1 170 ? -11.787 27.146 60.289  1.00 23.06 ? 564  GLN B NE2 1 
ATOM   2387 N N   . GLU B 1 171 ? -15.771 26.911 62.535  1.00 20.19 ? 565  GLU B N   1 
ATOM   2388 C CA  . GLU B 1 171 ? -16.799 27.325 63.456  1.00 24.18 ? 565  GLU B CA  1 
ATOM   2389 C C   . GLU B 1 171 ? -17.890 28.037 62.685  1.00 23.08 ? 565  GLU B C   1 
ATOM   2390 O O   . GLU B 1 171 ? -17.620 28.801 61.778  1.00 23.24 ? 565  GLU B O   1 
ATOM   2391 C CB  . GLU B 1 171 ? -16.236 28.230 64.535  1.00 24.35 ? 565  GLU B CB  1 
ATOM   2392 C CG  . GLU B 1 171 ? -17.228 28.452 65.646  1.00 33.48 ? 565  GLU B CG  1 
ATOM   2393 C CD  . GLU B 1 171 ? -16.559 28.606 67.010  1.00 40.53 ? 565  GLU B CD  1 
ATOM   2394 O OE1 . GLU B 1 171 ? -15.380 29.052 67.037  1.00 41.69 ? 565  GLU B OE1 1 
ATOM   2395 O OE2 . GLU B 1 171 ? -17.227 28.239 68.032  1.00 45.43 ? 565  GLU B OE2 1 
ATOM   2396 N N   . VAL B 1 172 ? -19.124 27.762 63.019  1.00 21.65 ? 566  VAL B N   1 
ATOM   2397 C CA  . VAL B 1 172 ? -20.240 28.413 62.306  1.00 22.38 ? 566  VAL B CA  1 
ATOM   2398 C C   . VAL B 1 172 ? -21.017 29.318 63.310  1.00 22.56 ? 566  VAL B C   1 
ATOM   2399 O O   . VAL B 1 172 ? -21.538 28.810 64.297  1.00 21.43 ? 566  VAL B O   1 
ATOM   2400 C CB  . VAL B 1 172 ? -21.177 27.352 61.688  1.00 24.29 ? 566  VAL B CB  1 
ATOM   2401 C CG1 . VAL B 1 172 ? -22.421 28.013 61.018  1.00 24.88 ? 566  VAL B CG1 1 
ATOM   2402 C CG2 . VAL B 1 172 ? -20.386 26.538 60.644  1.00 25.60 ? 566  VAL B CG2 1 
ATOM   2403 N N   . PRO B 1 173 ? -21.002 30.647 63.102  1.00 22.20 ? 567  PRO B N   1 
ATOM   2404 C CA  . PRO B 1 173 ? -21.770 31.556 63.926  1.00 22.61 ? 567  PRO B CA  1 
ATOM   2405 C C   . PRO B 1 173 ? -23.226 31.200 63.822  1.00 22.29 ? 567  PRO B C   1 
ATOM   2406 O O   . PRO B 1 173 ? -23.722 30.907 62.738  1.00 20.57 ? 567  PRO B O   1 
ATOM   2407 C CB  . PRO B 1 173 ? -21.510 32.914 63.267  1.00 22.57 ? 567  PRO B CB  1 
ATOM   2408 C CG  . PRO B 1 173 ? -20.150 32.739 62.627  1.00 23.45 ? 567  PRO B CG  1 
ATOM   2409 C CD  . PRO B 1 173 ? -20.266 31.379 62.038  1.00 22.09 ? 567  PRO B CD  1 
ATOM   2410 N N   . SER B 1 174 ? -23.920 31.254 64.959  1.00 22.43 ? 568  SER B N   1 
ATOM   2411 C CA  . SER B 1 174 ? -25.360 31.029 65.025  1.00 21.80 ? 568  SER B CA  1 
ATOM   2412 C C   . SER B 1 174 ? -26.111 31.982 64.114  1.00 21.29 ? 568  SER B C   1 
ATOM   2413 O O   . SER B 1 174 ? -27.139 31.640 63.495  1.00 21.81 ? 568  SER B O   1 
ATOM   2414 C CB  . SER B 1 174 ? -25.796 31.263 66.465  1.00 21.85 ? 568  SER B CB  1 
ATOM   2415 O OG  . SER B 1 174 ? -27.179 31.107 66.494  1.00 28.22 ? 568  SER B OG  1 
ATOM   2416 N N   . TRP B 1 175 ? -25.646 33.219 64.105  1.00 21.73 ? 569  TRP B N   1 
ATOM   2417 C CA  . TRP B 1 175 ? -26.251 34.288 63.316  1.00 21.54 ? 569  TRP B CA  1 
ATOM   2418 C C   . TRP B 1 175 ? -26.123 33.967 61.827  1.00 22.24 ? 569  TRP B C   1 
ATOM   2419 O O   . TRP B 1 175 ? -27.001 34.301 61.062  1.00 24.81 ? 569  TRP B O   1 
ATOM   2420 C CB  . TRP B 1 175 ? -25.625 35.673 63.671  1.00 22.36 ? 569  TRP B CB  1 
ATOM   2421 C CG  . TRP B 1 175 ? -24.104 35.848 63.515  1.00 24.04 ? 569  TRP B CG  1 
ATOM   2422 C CD1 . TRP B 1 175 ? -23.165 35.853 64.509  1.00 24.90 ? 569  TRP B CD1 1 
ATOM   2423 C CD2 . TRP B 1 175 ? -23.373 36.012 62.293  1.00 23.59 ? 569  TRP B CD2 1 
ATOM   2424 N NE1 . TRP B 1 175 ? -21.906 35.977 63.981  1.00 24.25 ? 569  TRP B NE1 1 
ATOM   2425 C CE2 . TRP B 1 175 ? -22.003 36.084 62.626  1.00 25.98 ? 569  TRP B CE2 1 
ATOM   2426 C CE3 . TRP B 1 175 ? -23.745 36.119 60.944  1.00 23.41 ? 569  TRP B CE3 1 
ATOM   2427 C CZ2 . TRP B 1 175 ? -21.019 36.294 61.675  1.00 23.58 ? 569  TRP B CZ2 1 
ATOM   2428 C CZ3 . TRP B 1 175 ? -22.755 36.267 59.997  1.00 24.11 ? 569  TRP B CZ3 1 
ATOM   2429 C CH2 . TRP B 1 175 ? -21.415 36.341 60.359  1.00 26.15 ? 569  TRP B CH2 1 
ATOM   2430 N N   . LEU B 1 176 ? -25.030 33.313 61.422  1.00 21.53 ? 570  LEU B N   1 
ATOM   2431 C CA  . LEU B 1 176 ? -24.837 32.924 60.028  1.00 20.71 ? 570  LEU B CA  1 
ATOM   2432 C C   . LEU B 1 176 ? -25.909 31.901 59.591  1.00 22.97 ? 570  LEU B C   1 
ATOM   2433 O O   . LEU B 1 176 ? -26.528 32.077 58.546  1.00 20.34 ? 570  LEU B O   1 
ATOM   2434 C CB  . LEU B 1 176 ? -23.382 32.449 59.763  1.00 20.97 ? 570  LEU B CB  1 
ATOM   2435 C CG  . LEU B 1 176 ? -23.016 32.351 58.279  1.00 22.48 ? 570  LEU B CG  1 
ATOM   2436 C CD1 . LEU B 1 176 ? -23.111 33.708 57.565  1.00 17.19 ? 570  LEU B CD1 1 
ATOM   2437 C CD2 . LEU B 1 176 ? -21.592 31.754 58.045  1.00 18.49 ? 570  LEU B CD2 1 
ATOM   2438 N N   . GLU B 1 177 ? -26.136 30.855 60.403  1.00 24.09 ? 571  GLU B N   1 
ATOM   2439 C CA  . GLU B 1 177 ? -27.132 29.860 60.106  1.00 27.58 ? 571  GLU B CA  1 
ATOM   2440 C C   . GLU B 1 177 ? -28.525 30.465 60.087  1.00 27.55 ? 571  GLU B C   1 
ATOM   2441 O O   . GLU B 1 177 ? -29.331 30.030 59.248  1.00 27.49 ? 571  GLU B O   1 
ATOM   2442 C CB  . GLU B 1 177 ? -27.165 28.713 61.124  1.00 28.02 ? 571  GLU B CB  1 
ATOM   2443 C CG  . GLU B 1 177 ? -25.836 28.131 61.448  1.00 33.37 ? 571  GLU B CG  1 
ATOM   2444 C CD  . GLU B 1 177 ? -25.910 27.210 62.664  1.00 42.58 ? 571  GLU B CD  1 
ATOM   2445 O OE1 . GLU B 1 177 ? -26.307 27.695 63.757  1.00 45.52 ? 571  GLU B OE1 1 
ATOM   2446 O OE2 . GLU B 1 177 ? -25.550 26.014 62.538  1.00 44.45 ? 571  GLU B OE2 1 
ATOM   2447 N N   . ASN B 1 178 ? -28.812 31.414 60.997  1.00 29.32 ? 572  ASN B N   1 
ATOM   2448 C CA  . ASN B 1 178 ? -30.127 32.109 61.022  1.00 30.67 ? 572  ASN B CA  1 
ATOM   2449 C C   . ASN B 1 178 ? -30.387 32.853 59.725  1.00 31.42 ? 572  ASN B C   1 
ATOM   2450 O O   . ASN B 1 178 ? -31.474 32.820 59.153  1.00 32.46 ? 572  ASN B O   1 
ATOM   2451 C CB  . ASN B 1 178 ? -30.179 33.175 62.141  1.00 30.48 ? 572  ASN B CB  1 
ATOM   2452 C CG  . ASN B 1 178 ? -31.401 34.164 61.993  1.00 34.13 ? 572  ASN B CG  1 
ATOM   2453 O OD1 . ASN B 1 178 ? -31.269 35.314 61.505  1.00 39.32 ? 572  ASN B OD1 1 
ATOM   2454 N ND2 . ASN B 1 178 ? -32.582 33.709 62.428  1.00 37.84 ? 572  ASN B ND2 1 
ATOM   2455 N N   . MET B 1 179 ? -29.405 33.640 59.323  1.00 32.90 ? 573  MET B N   1 
ATOM   2456 C CA  . MET B 1 179 ? -29.534 34.459 58.129  1.00 34.79 ? 573  MET B CA  1 
ATOM   2457 C C   . MET B 1 179 ? -29.617 33.625 56.867  1.00 33.93 ? 573  MET B C   1 
ATOM   2458 O O   . MET B 1 179 ? -30.345 33.978 55.944  1.00 33.74 ? 573  MET B O   1 
ATOM   2459 C CB  . MET B 1 179 ? -28.361 35.396 58.069  1.00 34.50 ? 573  MET B CB  1 
ATOM   2460 C CG  . MET B 1 179 ? -28.294 36.157 59.334  1.00 36.79 ? 573  MET B CG  1 
ATOM   2461 S SD  . MET B 1 179 ? -27.224 37.518 59.034  1.00 40.04 ? 573  MET B SD  1 
ATOM   2462 C CE  . MET B 1 179 ? -28.503 38.738 58.880  1.00 35.91 ? 573  MET B CE  1 
ATOM   2463 N N   . ALA B 1 180 ? -28.860 32.528 56.827  1.00 34.41 ? 574  ALA B N   1 
ATOM   2464 C CA  . ALA B 1 180 ? -28.978 31.598 55.701  1.00 35.18 ? 574  ALA B CA  1 
ATOM   2465 C C   . ALA B 1 180 ? -30.386 31.024 55.667  1.00 36.28 ? 574  ALA B C   1 
ATOM   2466 O O   . ALA B 1 180 ? -30.949 30.829 54.583  1.00 35.98 ? 574  ALA B O   1 
ATOM   2467 C CB  . ALA B 1 180 ? -27.967 30.525 55.804  1.00 35.36 ? 574  ALA B CB  1 
ATOM   2468 N N   . TYR B 1 181 ? -30.933 30.767 56.867  1.00 36.81 ? 575  TYR B N   1 
ATOM   2469 C CA  . TYR B 1 181 ? -32.358 30.420 57.113  1.00 38.47 ? 575  TYR B CA  1 
ATOM   2470 C C   . TYR B 1 181 ? -32.653 29.038 57.696  1.00 38.39 ? 575  TYR B C   1 
ATOM   2471 O O   . TYR B 1 181 ? -33.783 28.518 57.551  1.00 38.98 ? 575  TYR B O   1 
ATOM   2472 C CB  . TYR B 1 181 ? -33.231 30.680 55.888  1.00 39.55 ? 575  TYR B CB  1 
ATOM   2473 C CG  . TYR B 1 181 ? -33.665 32.103 55.741  1.00 40.29 ? 575  TYR B CG  1 
ATOM   2474 C CD1 . TYR B 1 181 ? -33.716 32.957 56.837  1.00 39.33 ? 575  TYR B CD1 1 
ATOM   2475 C CD2 . TYR B 1 181 ? -34.053 32.590 54.501  1.00 44.18 ? 575  TYR B CD2 1 
ATOM   2476 C CE1 . TYR B 1 181 ? -34.127 34.261 56.704  1.00 40.88 ? 575  TYR B CE1 1 
ATOM   2477 C CE2 . TYR B 1 181 ? -34.486 33.895 54.345  1.00 44.14 ? 575  TYR B CE2 1 
ATOM   2478 C CZ  . TYR B 1 181 ? -34.515 34.725 55.444  1.00 42.62 ? 575  TYR B CZ  1 
ATOM   2479 O OH  . TYR B 1 181 ? -34.934 36.020 55.258  1.00 43.02 ? 575  TYR B OH  1 
ATOM   2480 N N   . SER C 1 17  ? 19.680  41.158 71.142  1.00 23.17 ? 411  SER C N   1 
ATOM   2481 C CA  . SER C 1 17  ? 20.414  39.869 71.495  1.00 21.95 ? 411  SER C CA  1 
ATOM   2482 C C   . SER C 1 17  ? 20.408  38.800 70.362  1.00 20.58 ? 411  SER C C   1 
ATOM   2483 O O   . SER C 1 17  ? 20.348  37.604 70.620  1.00 18.85 ? 411  SER C O   1 
ATOM   2484 C CB  . SER C 1 17  ? 19.834  39.280 72.786  1.00 23.06 ? 411  SER C CB  1 
ATOM   2485 O OG  . SER C 1 17  ? 18.453  38.941 72.580  1.00 26.57 ? 411  SER C OG  1 
ATOM   2486 N N   . GLU C 1 18  ? 20.403  39.264 69.115  1.00 19.32 ? 412  GLU C N   1 
ATOM   2487 C CA  . GLU C 1 18  ? 20.446  38.431 67.914  1.00 20.35 ? 412  GLU C CA  1 
ATOM   2488 C C   . GLU C 1 18  ? 21.537  37.402 67.977  1.00 19.38 ? 412  GLU C C   1 
ATOM   2489 O O   . GLU C 1 18  ? 21.319  36.235 67.624  1.00 20.22 ? 412  GLU C O   1 
ATOM   2490 C CB  . GLU C 1 18  ? 20.721  39.322 66.683  1.00 19.69 ? 412  GLU C CB  1 
ATOM   2491 C CG  . GLU C 1 18  ? 19.494  40.013 66.163  1.00 24.70 ? 412  GLU C CG  1 
ATOM   2492 C CD  . GLU C 1 18  ? 19.204  41.377 66.786  1.00 25.93 ? 412  GLU C CD  1 
ATOM   2493 O OE1 . GLU C 1 18  ? 19.701  41.687 67.873  1.00 25.04 ? 412  GLU C OE1 1 
ATOM   2494 O OE2 . GLU C 1 18  ? 18.442  42.125 66.158  1.00 27.13 ? 412  GLU C OE2 1 
ATOM   2495 N N   . ASN C 1 19  ? 22.710  37.822 68.468  1.00 18.45 ? 413  ASN C N   1 
ATOM   2496 C CA  . ASN C 1 19  ? 23.895  36.930 68.457  1.00 16.51 ? 413  ASN C CA  1 
ATOM   2497 C C   . ASN C 1 19  ? 24.040  36.078 69.712  1.00 17.19 ? 413  ASN C C   1 
ATOM   2498 O O   . ASN C 1 19  ? 25.110  35.611 70.021  1.00 17.45 ? 413  ASN C O   1 
ATOM   2499 C CB  . ASN C 1 19  ? 25.141  37.774 68.275  1.00 16.50 ? 413  ASN C CB  1 
ATOM   2500 C CG  . ASN C 1 19  ? 25.161  38.437 66.945  1.00 13.58 ? 413  ASN C CG  1 
ATOM   2501 O OD1 . ASN C 1 19  ? 24.816  37.813 65.904  1.00 13.80 ? 413  ASN C OD1 1 
ATOM   2502 N ND2 . ASN C 1 19  ? 25.543  39.708 66.938  1.00 14.51 ? 413  ASN C ND2 1 
ATOM   2503 N N   . ILE C 1 20  ? 22.965  35.966 70.476  1.00 17.17 ? 414  ILE C N   1 
ATOM   2504 C CA  . ILE C 1 20  ? 22.893  34.946 71.518  1.00 16.94 ? 414  ILE C CA  1 
ATOM   2505 C C   . ILE C 1 20  ? 21.818  34.021 71.104  1.00 17.87 ? 414  ILE C C   1 
ATOM   2506 O O   . ILE C 1 20  ? 20.645  34.431 71.021  1.00 18.81 ? 414  ILE C O   1 
ATOM   2507 C CB  . ILE C 1 20  ? 22.550  35.559 72.867  1.00 17.08 ? 414  ILE C CB  1 
ATOM   2508 C CG1 . ILE C 1 20  ? 23.654  36.557 73.256  1.00 18.35 ? 414  ILE C CG1 1 
ATOM   2509 C CG2 . ILE C 1 20  ? 22.370  34.468 73.952  1.00 16.39 ? 414  ILE C CG2 1 
ATOM   2510 C CD1 . ILE C 1 20  ? 23.112  37.658 74.149  1.00 23.31 ? 414  ILE C CD1 1 
ATOM   2511 N N   . THR C 1 21  ? 22.181  32.787 70.776  1.00 17.75 ? 415  THR C N   1 
ATOM   2512 C CA  . THR C 1 21  ? 21.151  31.797 70.456  1.00 17.90 ? 415  THR C CA  1 
ATOM   2513 C C   . THR C 1 21  ? 20.354  31.452 71.743  1.00 17.41 ? 415  THR C C   1 
ATOM   2514 O O   . THR C 1 21  ? 20.962  31.058 72.759  1.00 15.10 ? 415  THR C O   1 
ATOM   2515 C CB  . THR C 1 21  ? 21.803  30.556 69.820  1.00 19.22 ? 415  THR C CB  1 
ATOM   2516 O OG1 . THR C 1 21  ? 22.351  30.963 68.580  1.00 19.82 ? 415  THR C OG1 1 
ATOM   2517 C CG2 . THR C 1 21  ? 20.772  29.446 69.590  1.00 19.39 ? 415  THR C CG2 1 
ATOM   2518 N N   . GLN C 1 22  ? 19.018  31.640 71.719  1.00 16.55 ? 416  GLN C N   1 
ATOM   2519 C CA  . GLN C 1 22  ? 18.170  31.462 72.895  1.00 17.49 ? 416  GLN C CA  1 
ATOM   2520 C C   . GLN C 1 22  ? 17.232  30.288 72.746  1.00 18.56 ? 416  GLN C C   1 
ATOM   2521 O O   . GLN C 1 22  ? 16.420  30.229 71.788  1.00 19.05 ? 416  GLN C O   1 
ATOM   2522 C CB  . GLN C 1 22  ? 17.392  32.768 73.199  1.00 16.89 ? 416  GLN C CB  1 
ATOM   2523 C CG  . GLN C 1 22  ? 18.365  33.921 73.497  1.00 19.51 ? 416  GLN C CG  1 
ATOM   2524 C CD  . GLN C 1 22  ? 17.732  35.264 73.413  1.00 19.54 ? 416  GLN C CD  1 
ATOM   2525 O OE1 . GLN C 1 22  ? 16.724  35.548 74.110  1.00 18.46 ? 416  GLN C OE1 1 
ATOM   2526 N NE2 . GLN C 1 22  ? 18.308  36.125 72.552  1.00 22.03 ? 416  GLN C NE2 1 
ATOM   2527 N N   . LYS C 1 23  ? 17.355  29.321 73.652  1.00 18.12 ? 417  LYS C N   1 
ATOM   2528 C CA  . LYS C 1 23  ? 16.538  28.124 73.552  1.00 18.66 ? 417  LYS C CA  1 
ATOM   2529 C C   . LYS C 1 23  ? 15.675  28.038 74.802  1.00 18.63 ? 417  LYS C C   1 
ATOM   2530 O O   . LYS C 1 23  ? 16.180  27.724 75.876  1.00 18.97 ? 417  LYS C O   1 
ATOM   2531 C CB  . LYS C 1 23  ? 17.396  26.869 73.474  1.00 18.78 ? 417  LYS C CB  1 
ATOM   2532 C CG  . LYS C 1 23  ? 18.335  26.764 72.236  1.00 23.03 ? 417  LYS C CG  1 
ATOM   2533 C CD  . LYS C 1 23  ? 17.501  26.553 71.012  1.00 27.40 ? 417  LYS C CD  1 
ATOM   2534 C CE  . LYS C 1 23  ? 18.297  25.669 69.997  1.00 36.83 ? 417  LYS C CE  1 
ATOM   2535 N NZ  . LYS C 1 23  ? 19.170  26.593 69.306  1.00 38.70 ? 417  LYS C NZ  1 
ATOM   2536 N N   . VAL C 1 24  ? 14.397  28.350 74.672  1.00 18.35 ? 418  VAL C N   1 
ATOM   2537 C CA  . VAL C 1 24  ? 13.513  28.272 75.807  1.00 18.51 ? 418  VAL C CA  1 
ATOM   2538 C C   . VAL C 1 24  ? 12.747  26.985 75.682  1.00 17.51 ? 418  VAL C C   1 
ATOM   2539 O O   . VAL C 1 24  ? 12.110  26.702 74.638  1.00 15.76 ? 418  VAL C O   1 
ATOM   2540 C CB  . VAL C 1 24  ? 12.527  29.410 75.845  1.00 19.08 ? 418  VAL C CB  1 
ATOM   2541 C CG1 . VAL C 1 24  ? 11.714  29.374 77.170  1.00 19.89 ? 418  VAL C CG1 1 
ATOM   2542 C CG2 . VAL C 1 24  ? 13.283  30.733 75.665  1.00 18.42 ? 418  VAL C CG2 1 
ATOM   2543 N N   . VAL C 1 25  ? 12.827  26.201 76.740  1.00 16.85 ? 419  VAL C N   1 
ATOM   2544 C CA  . VAL C 1 25  ? 12.166  24.930 76.793  1.00 18.52 ? 419  VAL C CA  1 
ATOM   2545 C C   . VAL C 1 25  ? 11.313  24.709 78.032  1.00 18.20 ? 419  VAL C C   1 
ATOM   2546 O O   . VAL C 1 25  ? 11.545  25.253 79.130  1.00 17.84 ? 419  VAL C O   1 
ATOM   2547 C CB  . VAL C 1 25  ? 13.176  23.761 76.615  1.00 19.50 ? 419  VAL C CB  1 
ATOM   2548 C CG1 . VAL C 1 25  ? 13.767  23.750 75.172  1.00 22.81 ? 419  VAL C CG1 1 
ATOM   2549 C CG2 . VAL C 1 25  ? 14.298  23.863 77.649  1.00 20.77 ? 419  VAL C CG2 1 
ATOM   2550 N N   . TRP C 1 26  ? 10.265  23.946 77.820  1.00 17.72 ? 420  TRP C N   1 
ATOM   2551 C CA  . TRP C 1 26  ? 9.310   23.667 78.883  1.00 17.54 ? 420  TRP C CA  1 
ATOM   2552 C C   . TRP C 1 26  ? 9.895   22.610 79.809  1.00 18.05 ? 420  TRP C C   1 
ATOM   2553 O O   . TRP C 1 26  ? 10.238  21.496 79.367  1.00 17.51 ? 420  TRP C O   1 
ATOM   2554 C CB  . TRP C 1 26  ? 7.978   23.197 78.294  1.00 17.73 ? 420  TRP C CB  1 
ATOM   2555 C CG  . TRP C 1 26  ? 6.942   23.065 79.383  1.00 16.90 ? 420  TRP C CG  1 
ATOM   2556 C CD1 . TRP C 1 26  ? 6.737   21.978 80.153  1.00 18.12 ? 420  TRP C CD1 1 
ATOM   2557 C CD2 . TRP C 1 26  ? 6.019   24.070 79.837  1.00 17.25 ? 420  TRP C CD2 1 
ATOM   2558 N NE1 . TRP C 1 26  ? 5.715   22.205 81.052  1.00 15.34 ? 420  TRP C NE1 1 
ATOM   2559 C CE2 . TRP C 1 26  ? 5.277   23.497 80.900  1.00 16.37 ? 420  TRP C CE2 1 
ATOM   2560 C CE3 . TRP C 1 26  ? 5.772   25.415 79.471  1.00 15.51 ? 420  TRP C CE3 1 
ATOM   2561 C CZ2 . TRP C 1 26  ? 4.255   24.199 81.596  1.00 20.20 ? 420  TRP C CZ2 1 
ATOM   2562 C CZ3 . TRP C 1 26  ? 4.719   26.124 80.163  1.00 18.05 ? 420  TRP C CZ3 1 
ATOM   2563 C CH2 . TRP C 1 26  ? 3.996   25.496 81.226  1.00 18.64 ? 420  TRP C CH2 1 
ATOM   2564 N N   . VAL C 1 27  ? 10.003  22.925 81.103  1.00 17.79 ? 421  VAL C N   1 
ATOM   2565 C CA  . VAL C 1 27  ? 10.561  21.934 81.994  1.00 17.75 ? 421  VAL C CA  1 
ATOM   2566 C C   . VAL C 1 27  ? 9.830   22.003 83.325  1.00 17.14 ? 421  VAL C C   1 
ATOM   2567 O O   . VAL C 1 27  ? 9.941   23.006 84.005  1.00 17.89 ? 421  VAL C O   1 
ATOM   2568 C CB  . VAL C 1 27  ? 12.129  22.137 82.222  1.00 16.09 ? 421  VAL C CB  1 
ATOM   2569 C CG1 . VAL C 1 27  ? 12.726  20.971 83.098  1.00 18.39 ? 421  VAL C CG1 1 
ATOM   2570 C CG2 . VAL C 1 27  ? 12.947  22.329 80.886  1.00 16.62 ? 421  VAL C CG2 1 
ATOM   2571 N N   . GLU C 1 28  ? 9.092   20.953 83.705  1.00 16.05 ? 422  GLU C N   1 
ATOM   2572 C CA  . GLU C 1 28  ? 8.508   20.864 85.061  1.00 16.79 ? 422  GLU C CA  1 
ATOM   2573 C C   . GLU C 1 28  ? 9.557   20.908 86.155  1.00 17.28 ? 422  GLU C C   1 
ATOM   2574 O O   . GLU C 1 28  ? 10.659  20.513 85.952  1.00 17.46 ? 422  GLU C O   1 
ATOM   2575 C CB  . GLU C 1 28  ? 7.690   19.567 85.214  1.00 15.48 ? 422  GLU C CB  1 
ATOM   2576 C CG  . GLU C 1 28  ? 6.624   19.395 84.136  1.00 16.53 ? 422  GLU C CG  1 
ATOM   2577 C CD  . GLU C 1 28  ? 5.531   20.452 84.140  1.00 21.75 ? 422  GLU C CD  1 
ATOM   2578 O OE1 . GLU C 1 28  ? 5.464   21.309 85.054  1.00 24.21 ? 422  GLU C OE1 1 
ATOM   2579 O OE2 . GLU C 1 28  ? 4.687   20.396 83.211  1.00 22.39 ? 422  GLU C OE2 1 
ATOM   2580 N N   . GLU C 1 29  ? 9.205   21.446 87.314  1.00 18.44 ? 423  GLU C N   1 
ATOM   2581 C CA  . GLU C 1 29  ? 10.166  21.573 88.421  1.00 19.22 ? 423  GLU C CA  1 
ATOM   2582 C C   . GLU C 1 29  ? 10.884  20.255 88.759  1.00 20.67 ? 423  GLU C C   1 
ATOM   2583 O O   . GLU C 1 29  ? 12.078  20.230 89.009  1.00 18.78 ? 423  GLU C O   1 
ATOM   2584 C CB  . GLU C 1 29  ? 9.426   22.082 89.682  1.00 19.13 ? 423  GLU C CB  1 
ATOM   2585 C CG  . GLU C 1 29  ? 9.108   23.518 89.679  1.00 19.63 ? 423  GLU C CG  1 
ATOM   2586 C CD  . GLU C 1 29  ? 10.366  24.360 89.543  1.00 26.12 ? 423  GLU C CD  1 
ATOM   2587 O OE1 . GLU C 1 29  ? 11.348  24.139 90.297  1.00 28.47 ? 423  GLU C OE1 1 
ATOM   2588 O OE2 . GLU C 1 29  ? 10.391  25.230 88.654  1.00 24.03 ? 423  GLU C OE2 1 
ATOM   2589 N N   . SER C 1 30  ? 10.120  19.163 88.776  1.00 21.97 ? 424  SER C N   1 
ATOM   2590 C CA  . SER C 1 30  ? 10.657  17.839 89.070  1.00 23.94 ? 424  SER C CA  1 
ATOM   2591 C C   . SER C 1 30  ? 11.603  17.247 88.015  1.00 24.45 ? 424  SER C C   1 
ATOM   2592 O O   . SER C 1 30  ? 12.208  16.217 88.285  1.00 26.27 ? 424  SER C O   1 
ATOM   2593 C CB  . SER C 1 30  ? 9.522   16.843 89.412  1.00 24.71 ? 424  SER C CB  1 
ATOM   2594 O OG  . SER C 1 30  ? 8.794   16.494 88.239  1.00 28.39 ? 424  SER C OG  1 
ATOM   2595 N N   . ASP C 1 31  ? 11.702  17.841 86.817  1.00 22.37 ? 425  ASP C N   1 
ATOM   2596 C CA  . ASP C 1 31  ? 12.611  17.340 85.790  1.00 22.47 ? 425  ASP C CA  1 
ATOM   2597 C C   . ASP C 1 31  ? 13.830  18.276 85.560  1.00 20.97 ? 425  ASP C C   1 
ATOM   2598 O O   . ASP C 1 31  ? 14.766  17.922 84.808  1.00 22.64 ? 425  ASP C O   1 
ATOM   2599 C CB  . ASP C 1 31  ? 11.913  17.182 84.437  1.00 21.74 ? 425  ASP C CB  1 
ATOM   2600 C CG  . ASP C 1 31  ? 10.807  16.138 84.445  1.00 26.72 ? 425  ASP C CG  1 
ATOM   2601 O OD1 . ASP C 1 31  ? 11.077  14.945 84.718  1.00 31.69 ? 425  ASP C OD1 1 
ATOM   2602 O OD2 . ASP C 1 31  ? 9.666   16.504 84.116  1.00 26.66 ? 425  ASP C OD2 1 
ATOM   2603 N N   . LYS C 1 32  ? 13.853  19.446 86.209  1.00 20.27 ? 426  LYS C N   1 
ATOM   2604 C CA  . LYS C 1 32  ? 14.925  20.425 85.927  1.00 18.82 ? 426  LYS C CA  1 
ATOM   2605 C C   . LYS C 1 32  ? 16.311  19.825 86.185  1.00 19.34 ? 426  LYS C C   1 
ATOM   2606 O O   . LYS C 1 32  ? 17.252  20.085 85.482  1.00 19.73 ? 426  LYS C O   1 
ATOM   2607 C CB  . LYS C 1 32  ? 14.747  21.717 86.744  1.00 19.75 ? 426  LYS C CB  1 
ATOM   2608 C CG  . LYS C 1 32  ? 13.523  22.530 86.315  1.00 19.54 ? 426  LYS C CG  1 
ATOM   2609 C CD  . LYS C 1 32  ? 13.519  23.924 86.889  1.00 20.31 ? 426  LYS C CD  1 
ATOM   2610 C CE  . LYS C 1 32  ? 12.426  24.767 86.269  1.00 21.75 ? 426  LYS C CE  1 
ATOM   2611 N NZ  . LYS C 1 32  ? 12.444  26.180 86.865  1.00 24.23 ? 426  LYS C NZ  1 
ATOM   2612 N N   . ARG C 1 33  ? 16.449  19.047 87.245  1.00 20.59 ? 427  ARG C N   1 
ATOM   2613 C CA  . ARG C 1 33  ? 17.772  18.614 87.623  1.00 20.47 ? 427  ARG C CA  1 
ATOM   2614 C C   . ARG C 1 33  ? 18.307  17.599 86.626  1.00 21.79 ? 427  ARG C C   1 
ATOM   2615 O O   . ARG C 1 33  ? 19.450  17.714 86.238  1.00 20.77 ? 427  ARG C O   1 
ATOM   2616 C CB  . ARG C 1 33  ? 17.749  18.029 89.044  1.00 21.06 ? 427  ARG C CB  1 
ATOM   2617 C CG  . ARG C 1 33  ? 17.839  19.090 90.101  1.00 20.16 ? 427  ARG C CG  1 
ATOM   2618 C CD  . ARG C 1 33  ? 18.004  18.464 91.488  1.00 22.52 ? 427  ARG C CD  1 
ATOM   2619 N NE  . ARG C 1 33  ? 18.220  19.516 92.476  1.00 23.51 ? 427  ARG C NE  1 
ATOM   2620 C CZ  . ARG C 1 33  ? 18.510  19.307 93.750  1.00 22.27 ? 427  ARG C CZ  1 
ATOM   2621 N NH1 . ARG C 1 33  ? 18.630  18.076 94.243  1.00 18.37 ? 427  ARG C NH1 1 
ATOM   2622 N NH2 . ARG C 1 33  ? 18.690  20.344 94.527  1.00 26.80 ? 427  ARG C NH2 1 
ATOM   2623 N N   . SER C 1 34  ? 17.475  16.608 86.245  1.00 22.03 ? 428  SER C N   1 
ATOM   2624 C CA  . SER C 1 34  ? 17.796  15.618 85.194  1.00 22.00 ? 428  SER C CA  1 
ATOM   2625 C C   . SER C 1 34  ? 18.020  16.285 83.853  1.00 23.28 ? 428  SER C C   1 
ATOM   2626 O O   . SER C 1 34  ? 18.968  15.968 83.103  1.00 22.16 ? 428  SER C O   1 
ATOM   2627 C CB  . SER C 1 34  ? 16.696  14.546 85.108  1.00 22.90 ? 428  SER C CB  1 
ATOM   2628 O OG  . SER C 1 34  ? 16.722  13.672 86.265  1.00 21.13 ? 428  SER C OG  1 
ATOM   2629 N N   . PHE C 1 35  ? 17.158  17.231 83.530  1.00 23.92 ? 429  PHE C N   1 
ATOM   2630 C CA  . PHE C 1 35  ? 17.361  18.057 82.349  1.00 23.98 ? 429  PHE C CA  1 
ATOM   2631 C C   . PHE C 1 35  ? 18.700  18.747 82.289  1.00 23.87 ? 429  PHE C C   1 
ATOM   2632 O O   . PHE C 1 35  ? 19.392  18.740 81.265  1.00 22.66 ? 429  PHE C O   1 
ATOM   2633 C CB  . PHE C 1 35  ? 16.306  19.157 82.331  1.00 25.35 ? 429  PHE C CB  1 
ATOM   2634 C CG  . PHE C 1 35  ? 15.804  19.481 80.994  1.00 28.23 ? 429  PHE C CG  1 
ATOM   2635 C CD1 . PHE C 1 35  ? 14.711  18.798 80.470  1.00 27.37 ? 429  PHE C CD1 1 
ATOM   2636 C CD2 . PHE C 1 35  ? 16.430  20.490 80.232  1.00 35.09 ? 429  PHE C CD2 1 
ATOM   2637 C CE1 . PHE C 1 35  ? 14.216  19.122 79.209  1.00 30.86 ? 429  PHE C CE1 1 
ATOM   2638 C CE2 . PHE C 1 35  ? 15.948  20.832 78.965  1.00 34.94 ? 429  PHE C CE2 1 
ATOM   2639 C CZ  . PHE C 1 35  ? 14.829  20.140 78.449  1.00 30.36 ? 429  PHE C CZ  1 
ATOM   2640 N N   . LEU C 1 36  ? 19.045  19.402 83.388  1.00 23.01 ? 430  LEU C N   1 
ATOM   2641 C CA  . LEU C 1 36  ? 20.336  20.076 83.509  1.00 20.56 ? 430  LEU C CA  1 
ATOM   2642 C C   . LEU C 1 36  ? 21.501  19.152 83.226  1.00 20.82 ? 430  LEU C C   1 
ATOM   2643 O O   . LEU C 1 36  ? 22.441  19.540 82.514  1.00 18.80 ? 430  LEU C O   1 
ATOM   2644 C CB  . LEU C 1 36  ? 20.478  20.703 84.895  1.00 20.39 ? 430  LEU C CB  1 
ATOM   2645 C CG  . LEU C 1 36  ? 21.809  21.351 85.183  1.00 22.64 ? 430  LEU C CG  1 
ATOM   2646 C CD1 . LEU C 1 36  ? 22.105  22.552 84.237  1.00 23.77 ? 430  LEU C CD1 1 
ATOM   2647 C CD2 . LEU C 1 36  ? 21.757  21.855 86.644  1.00 21.95 ? 430  LEU C CD2 1 
ATOM   2648 N N   . LEU C 1 37  ? 21.446  17.954 83.805  1.00 20.50 ? 431  LEU C N   1 
ATOM   2649 C CA  . LEU C 1 37  ? 22.511  16.944 83.619  1.00 20.26 ? 431  LEU C CA  1 
ATOM   2650 C C   . LEU C 1 37  ? 22.615  16.575 82.152  1.00 21.69 ? 431  LEU C C   1 
ATOM   2651 O O   . LEU C 1 37  ? 23.707  16.405 81.610  1.00 19.19 ? 431  LEU C O   1 
ATOM   2652 C CB  . LEU C 1 37  ? 22.206  15.680 84.445  1.00 20.31 ? 431  LEU C CB  1 
ATOM   2653 C CG  . LEU C 1 37  ? 22.323  15.781 85.984  1.00 16.32 ? 431  LEU C CG  1 
ATOM   2654 C CD1 . LEU C 1 37  ? 21.969  14.485 86.651  1.00 21.06 ? 431  LEU C CD1 1 
ATOM   2655 C CD2 . LEU C 1 37  ? 23.709  16.250 86.433  1.00 20.53 ? 431  LEU C CD2 1 
ATOM   2656 N N   . ASP C 1 38  ? 21.468  16.449 81.488  1.00 23.71 ? 432  ASP C N   1 
ATOM   2657 C CA  . ASP C 1 38  ? 21.560  15.978 80.096  1.00 25.97 ? 432  ASP C CA  1 
ATOM   2658 C C   . ASP C 1 38  ? 22.186  17.119 79.274  1.00 26.66 ? 432  ASP C C   1 
ATOM   2659 O O   . ASP C 1 38  ? 23.054  16.920 78.417  1.00 24.82 ? 432  ASP C O   1 
ATOM   2660 C CB  . ASP C 1 38  ? 20.188  15.459 79.623  1.00 28.47 ? 432  ASP C CB  1 
ATOM   2661 C CG  . ASP C 1 38  ? 19.750  14.175 80.398  1.00 34.46 ? 432  ASP C CG  1 
ATOM   2662 O OD1 . ASP C 1 38  ? 20.633  13.443 80.948  1.00 38.89 ? 432  ASP C OD1 1 
ATOM   2663 O OD2 . ASP C 1 38  ? 18.529  13.870 80.461  1.00 39.10 ? 432  ASP C OD2 1 
ATOM   2664 N N   . LEU C 1 39  ? 21.815  18.337 79.630  1.00 25.75 ? 433  LEU C N   1 
ATOM   2665 C CA  . LEU C 1 39  ? 22.391  19.549 79.049  1.00 27.21 ? 433  LEU C CA  1 
ATOM   2666 C C   . LEU C 1 39  ? 23.883  19.762 79.283  1.00 28.45 ? 433  LEU C C   1 
ATOM   2667 O O   . LEU C 1 39  ? 24.621  20.027 78.316  1.00 31.79 ? 433  LEU C O   1 
ATOM   2668 C CB  . LEU C 1 39  ? 21.531  20.715 79.524  1.00 29.00 ? 433  LEU C CB  1 
ATOM   2669 C CG  . LEU C 1 39  ? 21.298  21.998 78.766  1.00 28.75 ? 433  LEU C CG  1 
ATOM   2670 C CD1 . LEU C 1 39  ? 20.752  21.784 77.342  1.00 28.34 ? 433  LEU C CD1 1 
ATOM   2671 C CD2 . LEU C 1 39  ? 20.367  22.829 79.603  1.00 23.06 ? 433  LEU C CD2 1 
ATOM   2672 N N   . LEU C 1 40  ? 24.381  19.549 80.509  1.00 27.77 ? 434  LEU C N   1 
ATOM   2673 C CA  . LEU C 1 40  ? 25.794  19.600 80.806  1.00 27.74 ? 434  LEU C CA  1 
ATOM   2674 C C   . LEU C 1 40  ? 26.524  18.433 80.140  1.00 29.49 ? 434  LEU C C   1 
ATOM   2675 O O   . LEU C 1 40  ? 27.709  18.565 79.804  1.00 30.48 ? 434  LEU C O   1 
ATOM   2676 C CB  . LEU C 1 40  ? 26.049  19.488 82.309  1.00 27.81 ? 434  LEU C CB  1 
ATOM   2677 C CG  . LEU C 1 40  ? 25.460  20.635 83.159  1.00 22.67 ? 434  LEU C CG  1 
ATOM   2678 C CD1 . LEU C 1 40  ? 25.457  20.302 84.636  1.00 24.48 ? 434  LEU C CD1 1 
ATOM   2679 C CD2 . LEU C 1 40  ? 26.187  21.914 82.927  1.00 24.90 ? 434  LEU C CD2 1 
ATOM   2680 N N   . ASN C 1 41  ? 25.854  17.288 80.018  1.00 29.27 ? 435  ASN C N   1 
ATOM   2681 C CA  . ASN C 1 41  ? 26.499  16.107 79.420  1.00 31.82 ? 435  ASN C CA  1 
ATOM   2682 C C   . ASN C 1 41  ? 26.629  16.325 77.927  1.00 31.82 ? 435  ASN C C   1 
ATOM   2683 O O   . ASN C 1 41  ? 27.523  15.740 77.287  1.00 35.20 ? 435  ASN C O   1 
ATOM   2684 C CB  . ASN C 1 41  ? 25.719  14.815 79.747  1.00 32.28 ? 435  ASN C CB  1 
ATOM   2685 C CG  . ASN C 1 41  ? 25.979  14.292 81.202  1.00 36.96 ? 435  ASN C CG  1 
ATOM   2686 O OD1 . ASN C 1 41  ? 26.998  14.609 81.817  1.00 40.21 ? 435  ASN C OD1 1 
ATOM   2687 N ND2 . ASN C 1 41  ? 25.040  13.482 81.738  1.00 39.99 ? 435  ASN C ND2 1 
ATOM   2688 N N   . THR C 1 43  ? 25.443  19.135 75.737  1.00 48.66 ? 437  THR C N   1 
ATOM   2689 C CA  . THR C 1 43  ? 26.130  20.373 75.353  1.00 48.42 ? 437  THR C CA  1 
ATOM   2690 C C   . THR C 1 43  ? 27.609  20.080 75.319  1.00 49.27 ? 437  THR C C   1 
ATOM   2691 O O   . THR C 1 43  ? 28.275  20.521 74.395  1.00 49.97 ? 437  THR C O   1 
ATOM   2692 C CB  . THR C 1 43  ? 25.869  21.646 76.285  1.00 48.89 ? 437  THR C CB  1 
ATOM   2693 O OG1 . THR C 1 43  ? 24.476  21.938 76.388  1.00 42.99 ? 437  THR C OG1 1 
ATOM   2694 C CG2 . THR C 1 43  ? 26.568  22.923 75.738  1.00 48.45 ? 437  THR C CG2 1 
ATOM   2695 N N   . GLY C 1 44  ? 28.111  19.345 76.316  1.00 49.16 ? 438  GLY C N   1 
ATOM   2696 C CA  . GLY C 1 44  ? 29.545  19.053 76.421  1.00 49.25 ? 438  GLY C CA  1 
ATOM   2697 C C   . GLY C 1 44  ? 30.344  20.252 76.894  1.00 48.81 ? 438  GLY C C   1 
ATOM   2698 O O   . GLY C 1 44  ? 31.275  20.708 76.216  1.00 48.70 ? 438  GLY C O   1 
ATOM   2699 N N   . SER C 1 47  ? 34.807  24.335 79.240  1.00 32.55 ? 441  SER C N   1 
ATOM   2700 C CA  . SER C 1 47  ? 33.890  25.403 78.804  1.00 33.11 ? 441  SER C CA  1 
ATOM   2701 C C   . SER C 1 47  ? 32.907  25.909 79.906  1.00 31.57 ? 441  SER C C   1 
ATOM   2702 O O   . SER C 1 47  ? 32.134  25.137 80.531  1.00 33.26 ? 441  SER C O   1 
ATOM   2703 C CB  . SER C 1 47  ? 33.162  25.020 77.513  1.00 33.90 ? 441  SER C CB  1 
ATOM   2704 O OG  . SER C 1 47  ? 31.822  24.658 77.790  1.00 38.18 ? 441  SER C OG  1 
ATOM   2705 N N   . LEU C 1 48  ? 32.912  27.223 80.096  1.00 28.42 ? 442  LEU C N   1 
ATOM   2706 C CA  . LEU C 1 48  ? 32.253  27.906 81.237  1.00 24.46 ? 442  LEU C CA  1 
ATOM   2707 C C   . LEU C 1 48  ? 30.716  27.986 81.143  1.00 22.17 ? 442  LEU C C   1 
ATOM   2708 O O   . LEU C 1 48  ? 30.198  28.531 80.152  1.00 20.54 ? 442  LEU C O   1 
ATOM   2709 C CB  . LEU C 1 48  ? 32.832  29.316 81.287  1.00 24.14 ? 442  LEU C CB  1 
ATOM   2710 C CG  . LEU C 1 48  ? 34.042  29.576 82.229  1.00 29.58 ? 442  LEU C CG  1 
ATOM   2711 C CD1 . LEU C 1 48  ? 34.886  28.329 82.561  1.00 26.85 ? 442  LEU C CD1 1 
ATOM   2712 C CD2 . LEU C 1 48  ? 34.893  30.738 81.781  1.00 24.68 ? 442  LEU C CD2 1 
ATOM   2713 N N   . THR C 1 49  ? 29.988  27.433 82.134  1.00 18.85 ? 443  THR C N   1 
ATOM   2714 C CA  . THR C 1 49  ? 28.548  27.472 82.141  1.00 18.40 ? 443  THR C CA  1 
ATOM   2715 C C   . THR C 1 49  ? 28.131  28.292 83.399  1.00 18.38 ? 443  THR C C   1 
ATOM   2716 O O   . THR C 1 49  ? 28.644  28.046 84.488  1.00 17.93 ? 443  THR C O   1 
ATOM   2717 C CB  . THR C 1 49  ? 27.980  26.022 82.210  1.00 20.31 ? 443  THR C CB  1 
ATOM   2718 O OG1 . THR C 1 49  ? 28.487  25.261 81.094  1.00 20.26 ? 443  THR C OG1 1 
ATOM   2719 C CG2 . THR C 1 49  ? 26.432  25.991 82.163  1.00 19.64 ? 443  THR C CG2 1 
ATOM   2720 N N   . LEU C 1 50  ? 27.273  29.271 83.217  1.00 16.90 ? 444  LEU C N   1 
ATOM   2721 C CA  . LEU C 1 50  ? 26.710  30.056 84.308  1.00 18.52 ? 444  LEU C CA  1 
ATOM   2722 C C   . LEU C 1 50  ? 25.268  29.603 84.464  1.00 18.56 ? 444  LEU C C   1 
ATOM   2723 O O   . LEU C 1 50  ? 24.488  29.630 83.475  1.00 19.40 ? 444  LEU C O   1 
ATOM   2724 C CB  . LEU C 1 50  ? 26.778  31.525 83.826  1.00 18.74 ? 444  LEU C CB  1 
ATOM   2725 C CG  . LEU C 1 50  ? 26.290  32.650 84.737  1.00 22.51 ? 444  LEU C CG  1 
ATOM   2726 C CD1 . LEU C 1 50  ? 26.763  32.525 86.248  1.00 25.37 ? 444  LEU C CD1 1 
ATOM   2727 C CD2 . LEU C 1 50  ? 26.734  33.991 84.035  1.00 20.88 ? 444  LEU C CD2 1 
ATOM   2728 N N   . VAL C 1 51  ? 24.888  29.202 85.662  1.00 18.17 ? 445  VAL C N   1 
ATOM   2729 C CA  . VAL C 1 51  ? 23.534  28.666 85.849  1.00 16.90 ? 445  VAL C CA  1 
ATOM   2730 C C   . VAL C 1 51  ? 22.892  29.618 86.812  1.00 17.12 ? 445  VAL C C   1 
ATOM   2731 O O   . VAL C 1 51  ? 23.418  29.839 87.911  1.00 19.53 ? 445  VAL C O   1 
ATOM   2732 C CB  . VAL C 1 51  ? 23.562  27.196 86.420  1.00 16.79 ? 445  VAL C CB  1 
ATOM   2733 C CG1 . VAL C 1 51  ? 22.088  26.638 86.757  1.00 17.03 ? 445  VAL C CG1 1 
ATOM   2734 C CG2 . VAL C 1 51  ? 24.333  26.246 85.510  1.00 16.16 ? 445  VAL C CG2 1 
ATOM   2735 N N   . PHE C 1 52  ? 21.720  30.156 86.458  1.00 15.85 ? 446  PHE C N   1 
ATOM   2736 C CA  . PHE C 1 52  ? 21.013  31.067 87.354  1.00 16.43 ? 446  PHE C CA  1 
ATOM   2737 C C   . PHE C 1 52  ? 19.833  30.380 88.013  1.00 16.46 ? 446  PHE C C   1 
ATOM   2738 O O   . PHE C 1 52  ? 19.101  29.657 87.317  1.00 16.43 ? 446  PHE C O   1 
ATOM   2739 C CB  . PHE C 1 52  ? 20.483  32.261 86.562  1.00 17.88 ? 446  PHE C CB  1 
ATOM   2740 C CG  . PHE C 1 52  ? 21.566  33.234 86.183  1.00 15.94 ? 446  PHE C CG  1 
ATOM   2741 C CD1 . PHE C 1 52  ? 22.140  34.031 87.147  1.00 17.47 ? 446  PHE C CD1 1 
ATOM   2742 C CD2 . PHE C 1 52  ? 22.013  33.330 84.880  1.00 16.03 ? 446  PHE C CD2 1 
ATOM   2743 C CE1 . PHE C 1 52  ? 23.138  34.948 86.838  1.00 19.63 ? 446  PHE C CE1 1 
ATOM   2744 C CE2 . PHE C 1 52  ? 23.032  34.254 84.552  1.00 20.73 ? 446  PHE C CE2 1 
ATOM   2745 C CZ  . PHE C 1 52  ? 23.590  35.036 85.541  1.00 21.24 ? 446  PHE C CZ  1 
ATOM   2746 N N   . VAL C 1 53  ? 19.700  30.565 89.327  1.00 17.53 ? 447  VAL C N   1 
ATOM   2747 C CA  . VAL C 1 53  ? 18.587  30.004 90.144  1.00 18.89 ? 447  VAL C CA  1 
ATOM   2748 C C   . VAL C 1 53  ? 17.946  31.107 90.952  1.00 19.64 ? 447  VAL C C   1 
ATOM   2749 O O   . VAL C 1 53  ? 18.540  32.176 91.122  1.00 19.84 ? 447  VAL C O   1 
ATOM   2750 C CB  . VAL C 1 53  ? 19.050  28.877 91.138  1.00 18.38 ? 447  VAL C CB  1 
ATOM   2751 C CG1 . VAL C 1 53  ? 19.606  27.677 90.341  1.00 20.50 ? 447  VAL C CG1 1 
ATOM   2752 C CG2 . VAL C 1 53  ? 20.095  29.388 92.060  1.00 18.46 ? 447  VAL C CG2 1 
ATOM   2753 N N   . GLU C 1 54  ? 16.762  30.842 91.492  1.00 18.79 ? 448  GLU C N   1 
ATOM   2754 C CA  . GLU C 1 54  ? 16.017  31.904 92.132  1.00 21.28 ? 448  GLU C CA  1 
ATOM   2755 C C   . GLU C 1 54  ? 16.562  32.276 93.511  1.00 20.52 ? 448  GLU C C   1 
ATOM   2756 O O   . GLU C 1 54  ? 16.697  33.461 93.828  1.00 21.52 ? 448  GLU C O   1 
ATOM   2757 C CB  . GLU C 1 54  ? 14.519  31.580 92.198  1.00 20.83 ? 448  GLU C CB  1 
ATOM   2758 C CG  . GLU C 1 54  ? 13.703  32.684 92.927  1.00 24.44 ? 448  GLU C CG  1 
ATOM   2759 C CD  . GLU C 1 54  ? 12.210  32.328 93.096  1.00 27.04 ? 448  GLU C CD  1 
ATOM   2760 O OE1 . GLU C 1 54  ? 11.717  31.459 92.329  1.00 33.60 ? 448  GLU C OE1 1 
ATOM   2761 O OE2 . GLU C 1 54  ? 11.524  32.930 94.002  1.00 35.64 ? 448  GLU C OE2 1 
ATOM   2762 N N   . THR C 1 55  ? 16.906  31.291 94.328  1.00 19.47 ? 449  THR C N   1 
ATOM   2763 C CA  . THR C 1 55  ? 17.145  31.609 95.753  1.00 19.01 ? 449  THR C CA  1 
ATOM   2764 C C   . THR C 1 55  ? 18.424  31.023 96.263  1.00 18.41 ? 449  THR C C   1 
ATOM   2765 O O   . THR C 1 55  ? 18.989  30.125 95.645  1.00 16.62 ? 449  THR C O   1 
ATOM   2766 C CB  . THR C 1 55  ? 16.045  31.044 96.665  1.00 20.69 ? 449  THR C CB  1 
ATOM   2767 O OG1 . THR C 1 55  ? 16.225  29.631 96.732  1.00 18.94 ? 449  THR C OG1 1 
ATOM   2768 C CG2 . THR C 1 55  ? 14.599  31.398 96.147  1.00 22.30 ? 449  THR C CG2 1 
ATOM   2769 N N   . LYS C 1 56  ? 18.869  31.498 97.437  1.00 18.49 ? 450  LYS C N   1 
ATOM   2770 C CA  . LYS C 1 56  ? 20.127  31.041 98.003  1.00 19.38 ? 450  LYS C CA  1 
ATOM   2771 C C   . LYS C 1 56  ? 20.020  29.566 98.344  1.00 19.63 ? 450  LYS C C   1 
ATOM   2772 O O   . LYS C 1 56  ? 20.962  28.788 98.120  1.00 19.03 ? 450  LYS C O   1 
ATOM   2773 C CB  . LYS C 1 56  ? 20.512  31.884 99.259  1.00 20.45 ? 450  LYS C CB  1 
ATOM   2774 C CG  . LYS C 1 56  ? 20.337  33.403 99.085  1.00 23.21 ? 450  LYS C CG  1 
ATOM   2775 C CD  . LYS C 1 56  ? 21.081  34.051 97.861  1.00 27.22 ? 450  LYS C CD  1 
ATOM   2776 C CE  . LYS C 1 56  ? 20.506  35.476 97.410  1.00 26.93 ? 450  LYS C CE  1 
ATOM   2777 N NZ  . LYS C 1 56  ? 18.968  35.611 97.436  1.00 26.13 ? 450  LYS C NZ  1 
ATOM   2778 N N   . LYS C 1 57  ? 18.866  29.174 98.881  1.00 19.45 ? 451  LYS C N   1 
ATOM   2779 C CA  . LYS C 1 57  ? 18.615  27.781 99.223  1.00 21.14 ? 451  LYS C CA  1 
ATOM   2780 C C   . LYS C 1 57  ? 18.697  26.836 97.980  1.00 19.81 ? 451  LYS C C   1 
ATOM   2781 O O   . LYS C 1 57  ? 19.287  25.746 98.041  1.00 17.09 ? 451  LYS C O   1 
ATOM   2782 C CB  . LYS C 1 57  ? 17.236  27.681 99.904  1.00 21.05 ? 451  LYS C CB  1 
ATOM   2783 C CG  . LYS C 1 57  ? 16.786  26.278 100.222 1.00 26.93 ? 451  LYS C CG  1 
ATOM   2784 C CD  . LYS C 1 57  ? 15.253  26.181 100.494 1.00 26.35 ? 451  LYS C CD  1 
ATOM   2785 C CE  . LYS C 1 57  ? 14.518  25.616 99.223  1.00 30.79 ? 451  LYS C CE  1 
ATOM   2786 N NZ  . LYS C 1 57  ? 13.137  25.007 99.564  1.00 32.10 ? 451  LYS C NZ  1 
ATOM   2787 N N   . GLY C 1 58  ? 18.103  27.255 96.864  1.00 19.86 ? 452  GLY C N   1 
ATOM   2788 C CA  . GLY C 1 58  ? 18.209  26.498 95.615  1.00 19.36 ? 452  GLY C CA  1 
ATOM   2789 C C   . GLY C 1 58  ? 19.628  26.447 95.078  1.00 19.81 ? 452  GLY C C   1 
ATOM   2790 O O   . GLY C 1 58  ? 20.050  25.443 94.498  1.00 20.14 ? 452  GLY C O   1 
ATOM   2791 N N   . ALA C 1 59  ? 20.369  27.545 95.193  1.00 20.31 ? 453  ALA C N   1 
ATOM   2792 C CA  . ALA C 1 59  ? 21.767  27.545 94.713  1.00 19.09 ? 453  ALA C CA  1 
ATOM   2793 C C   . ALA C 1 59  ? 22.611  26.557 95.530  1.00 18.95 ? 453  ALA C C   1 
ATOM   2794 O O   . ALA C 1 59  ? 23.369  25.756 94.959  1.00 18.35 ? 453  ALA C O   1 
ATOM   2795 C CB  . ALA C 1 59  ? 22.400  28.954 94.800  1.00 18.08 ? 453  ALA C CB  1 
ATOM   2796 N N   . ASP C 1 60  ? 22.487  26.614 96.862  1.00 19.20 ? 454  ASP C N   1 
ATOM   2797 C CA  . ASP C 1 60  ? 23.262  25.734 97.719  1.00 19.19 ? 454  ASP C CA  1 
ATOM   2798 C C   . ASP C 1 60  ? 22.985  24.265 97.371  1.00 18.31 ? 454  ASP C C   1 
ATOM   2799 O O   . ASP C 1 60  ? 23.893  23.435 97.210  1.00 18.52 ? 454  ASP C O   1 
ATOM   2800 C CB  . ASP C 1 60  ? 22.961  26.037 99.179  1.00 20.68 ? 454  ASP C CB  1 
ATOM   2801 C CG  . ASP C 1 60  ? 23.656  27.299 99.656  1.00 23.74 ? 454  ASP C CG  1 
ATOM   2802 O OD1 . ASP C 1 60  ? 24.597  27.778 98.973  1.00 26.36 ? 454  ASP C OD1 1 
ATOM   2803 O OD2 . ASP C 1 60  ? 23.242  27.810 100.713 1.00 26.86 ? 454  ASP C OD2 1 
ATOM   2804 N N   . SER C 1 61  ? 21.718  23.972 97.191  1.00 17.57 ? 455  SER C N   1 
ATOM   2805 C CA  . SER C 1 61  ? 21.260  22.615 96.959  1.00 18.35 ? 455  SER C CA  1 
ATOM   2806 C C   . SER C 1 61  ? 21.658  22.116 95.558  1.00 16.95 ? 455  SER C C   1 
ATOM   2807 O O   . SER C 1 61  ? 22.104  20.980 95.411  1.00 15.31 ? 455  SER C O   1 
ATOM   2808 C CB  . SER C 1 61  ? 19.744  22.583 97.195  1.00 19.15 ? 455  SER C CB  1 
ATOM   2809 O OG  . SER C 1 61  ? 19.197  21.340 96.820  1.00 22.12 ? 455  SER C OG  1 
ATOM   2810 N N   . LEU C 1 62  ? 21.604  22.997 94.549  1.00 18.10 ? 456  LEU C N   1 
ATOM   2811 C CA  . LEU C 1 62  ? 21.966  22.594 93.217  1.00 16.98 ? 456  LEU C CA  1 
ATOM   2812 C C   . LEU C 1 62  ? 23.481  22.428 93.158  1.00 17.90 ? 456  LEU C C   1 
ATOM   2813 O O   . LEU C 1 62  ? 23.984  21.528 92.500  1.00 17.53 ? 456  LEU C O   1 
ATOM   2814 C CB  . LEU C 1 62  ? 21.490  23.628 92.191  1.00 18.33 ? 456  LEU C CB  1 
ATOM   2815 C CG  . LEU C 1 62  ? 21.720  23.230 90.725  1.00 17.89 ? 456  LEU C CG  1 
ATOM   2816 C CD1 . LEU C 1 62  ? 20.962  21.969 90.358  1.00 18.99 ? 456  LEU C CD1 1 
ATOM   2817 C CD2 . LEU C 1 62  ? 21.407  24.412 89.786  1.00 17.20 ? 456  LEU C CD2 1 
ATOM   2818 N N   . GLU C 1 63  ? 24.228  23.297 93.854  1.00 17.88 ? 457  GLU C N   1 
ATOM   2819 C CA  . GLU C 1 63  ? 25.665  23.117 93.937  1.00 18.26 ? 457  GLU C CA  1 
ATOM   2820 C C   . GLU C 1 63  ? 26.028  21.750 94.497  1.00 17.13 ? 457  GLU C C   1 
ATOM   2821 O O   . GLU C 1 63  ? 26.904  21.088 93.975  1.00 15.40 ? 457  GLU C O   1 
ATOM   2822 C CB  . GLU C 1 63  ? 26.309  24.195 94.795  1.00 19.66 ? 457  GLU C CB  1 
ATOM   2823 C CG  . GLU C 1 63  ? 27.769  24.316 94.518  1.00 24.59 ? 457  GLU C CG  1 
ATOM   2824 C CD  . GLU C 1 63  ? 28.456  25.208 95.504  1.00 29.87 ? 457  GLU C CD  1 
ATOM   2825 O OE1 . GLU C 1 63  ? 27.799  26.131 96.001  1.00 32.68 ? 457  GLU C OE1 1 
ATOM   2826 O OE2 . GLU C 1 63  ? 29.654  24.971 95.768  1.00 34.03 ? 457  GLU C OE2 1 
ATOM   2827 N N   . ASP C 1 64  ? 25.392  21.373 95.604  1.00 16.40 ? 458  ASP C N   1 
ATOM   2828 C CA  . ASP C 1 64  ? 25.611  20.038 96.204  1.00 17.05 ? 458  ASP C CA  1 
ATOM   2829 C C   . ASP C 1 64  ? 25.254  18.913 95.239  1.00 14.98 ? 458  ASP C C   1 
ATOM   2830 O O   . ASP C 1 64  ? 25.976  17.915 95.158  1.00 15.56 ? 458  ASP C O   1 
ATOM   2831 C CB  . ASP C 1 64  ? 24.813  19.877 97.485  1.00 16.12 ? 458  ASP C CB  1 
ATOM   2832 C CG  . ASP C 1 64  ? 25.617  20.190 98.693  1.00 24.77 ? 458  ASP C CG  1 
ATOM   2833 O OD1 . ASP C 1 64  ? 26.217  21.297 98.733  1.00 26.93 ? 458  ASP C OD1 1 
ATOM   2834 O OD2 . ASP C 1 64  ? 25.629  19.329 99.620  1.00 29.61 ? 458  ASP C OD2 1 
ATOM   2835 N N   . PHE C 1 65  ? 24.156  19.093 94.510  1.00 13.68 ? 459  PHE C N   1 
ATOM   2836 C CA  . PHE C 1 65  ? 23.690  18.091 93.569  1.00 13.61 ? 459  PHE C CA  1 
ATOM   2837 C C   . PHE C 1 65  ? 24.734  17.887 92.495  1.00 13.51 ? 459  PHE C C   1 
ATOM   2838 O O   . PHE C 1 65  ? 25.163  16.747 92.194  1.00 12.63 ? 459  PHE C O   1 
ATOM   2839 C CB  . PHE C 1 65  ? 22.328  18.494 92.978  1.00 15.11 ? 459  PHE C CB  1 
ATOM   2840 C CG  . PHE C 1 65  ? 21.875  17.623 91.822  1.00 16.85 ? 459  PHE C CG  1 
ATOM   2841 C CD1 . PHE C 1 65  ? 21.394  16.338 92.059  1.00 19.34 ? 459  PHE C CD1 1 
ATOM   2842 C CD2 . PHE C 1 65  ? 21.964  18.075 90.511  1.00 16.74 ? 459  PHE C CD2 1 
ATOM   2843 C CE1 . PHE C 1 65  ? 21.001  15.542 90.990  1.00 18.12 ? 459  PHE C CE1 1 
ATOM   2844 C CE2 . PHE C 1 65  ? 21.548  17.288 89.447  1.00 16.99 ? 459  PHE C CE2 1 
ATOM   2845 C CZ  . PHE C 1 65  ? 21.075  16.016 89.715  1.00 17.17 ? 459  PHE C CZ  1 
ATOM   2846 N N   . LEU C 1 66  ? 25.197  18.996 91.923  1.00 13.17 ? 460  LEU C N   1 
ATOM   2847 C CA  . LEU C 1 66  ? 26.204  18.871 90.828  1.00 13.73 ? 460  LEU C CA  1 
ATOM   2848 C C   . LEU C 1 66  ? 27.490  18.264 91.298  1.00 13.13 ? 460  LEU C C   1 
ATOM   2849 O O   . LEU C 1 66  ? 28.084  17.417 90.647  1.00 13.85 ? 460  LEU C O   1 
ATOM   2850 C CB  . LEU C 1 66  ? 26.419  20.253 90.195  1.00 14.59 ? 460  LEU C CB  1 
ATOM   2851 C CG  . LEU C 1 66  ? 25.155  20.692 89.438  1.00 14.46 ? 460  LEU C CG  1 
ATOM   2852 C CD1 . LEU C 1 66  ? 25.371  22.104 88.805  1.00 18.61 ? 460  LEU C CD1 1 
ATOM   2853 C CD2 . LEU C 1 66  ? 24.761  19.752 88.269  1.00 15.94 ? 460  LEU C CD2 1 
ATOM   2854 N N   . TYR C 1 67  ? 27.922  18.649 92.475  1.00 14.37 ? 461  TYR C N   1 
ATOM   2855 C CA  . TYR C 1 67  ? 29.139  18.102 93.032  1.00 13.90 ? 461  TYR C CA  1 
ATOM   2856 C C   . TYR C 1 67  ? 28.974  16.600 93.259  1.00 13.67 ? 461  TYR C C   1 
ATOM   2857 O O   . TYR C 1 67  ? 29.861  15.800 92.935  1.00 13.51 ? 461  TYR C O   1 
ATOM   2858 C CB  . TYR C 1 67  ? 29.487  18.815 94.352  1.00 14.80 ? 461  TYR C CB  1 
ATOM   2859 C CG  . TYR C 1 67  ? 30.506  18.071 95.188  1.00 15.91 ? 461  TYR C CG  1 
ATOM   2860 C CD1 . TYR C 1 67  ? 31.862  18.127 94.877  1.00 18.24 ? 461  TYR C CD1 1 
ATOM   2861 C CD2 . TYR C 1 67  ? 30.110  17.322 96.302  1.00 18.45 ? 461  TYR C CD2 1 
ATOM   2862 C CE1 . TYR C 1 67  ? 32.813  17.446 95.658  1.00 18.69 ? 461  TYR C CE1 1 
ATOM   2863 C CE2 . TYR C 1 67  ? 31.039  16.634 97.082  1.00 20.95 ? 461  TYR C CE2 1 
ATOM   2864 C CZ  . TYR C 1 67  ? 32.390  16.704 96.753  1.00 19.10 ? 461  TYR C CZ  1 
ATOM   2865 O OH  . TYR C 1 67  ? 33.284  16.030 97.521  1.00 18.29 ? 461  TYR C OH  1 
ATOM   2866 N N   . HIS C 1 68  ? 27.837  16.181 93.802  1.00 12.78 ? 462  HIS C N   1 
ATOM   2867 C CA  . HIS C 1 68  ? 27.629  14.741 93.957  1.00 12.17 ? 462  HIS C CA  1 
ATOM   2868 C C   . HIS C 1 68  ? 27.508  13.980 92.615  1.00 11.56 ? 462  HIS C C   1 
ATOM   2869 O O   . HIS C 1 68  ? 27.797  12.767 92.577  1.00 11.97 ? 462  HIS C O   1 
ATOM   2870 C CB  . HIS C 1 68  ? 26.417  14.456 94.851  1.00 12.70 ? 462  HIS C CB  1 
ATOM   2871 C CG  . HIS C 1 68  ? 26.683  14.749 96.285  1.00 17.05 ? 462  HIS C CG  1 
ATOM   2872 N ND1 . HIS C 1 68  ? 25.952  15.668 97.003  1.00 23.26 ? 462  HIS C ND1 1 
ATOM   2873 C CD2 . HIS C 1 68  ? 27.644  14.288 97.120  1.00 16.94 ? 462  HIS C CD2 1 
ATOM   2874 C CE1 . HIS C 1 68  ? 26.429  15.735 98.235  1.00 23.81 ? 462  HIS C CE1 1 
ATOM   2875 N NE2 . HIS C 1 68  ? 27.468  14.923 98.327  1.00 22.08 ? 462  HIS C NE2 1 
ATOM   2876 N N   . GLU C 1 69  ? 27.060  14.658 91.569  1.00 11.34 ? 463  GLU C N   1 
ATOM   2877 C CA  . GLU C 1 69  ? 26.931  14.003 90.247  1.00 13.21 ? 463  GLU C CA  1 
ATOM   2878 C C   . GLU C 1 69  ? 28.261  13.963 89.493  1.00 14.63 ? 463  GLU C C   1 
ATOM   2879 O O   . GLU C 1 69  ? 28.322  13.441 88.373  1.00 15.08 ? 463  GLU C O   1 
ATOM   2880 C CB  . GLU C 1 69  ? 25.861  14.661 89.388  1.00 12.68 ? 463  GLU C CB  1 
ATOM   2881 C CG  . GLU C 1 69  ? 24.418  14.214 89.709  1.00 14.46 ? 463  GLU C CG  1 
ATOM   2882 C CD  . GLU C 1 69  ? 24.184  12.750 89.492  1.00 17.12 ? 463  GLU C CD  1 
ATOM   2883 O OE1 . GLU C 1 69  ? 24.666  12.276 88.461  1.00 18.25 ? 463  GLU C OE1 1 
ATOM   2884 O OE2 . GLU C 1 69  ? 23.597  12.042 90.370  1.00 17.20 ? 463  GLU C OE2 1 
ATOM   2885 N N   . GLY C 1 70  ? 29.304  14.542 90.090  1.00 16.02 ? 464  GLY C N   1 
ATOM   2886 C CA  . GLY C 1 70  ? 30.654  14.481 89.506  1.00 18.54 ? 464  GLY C CA  1 
ATOM   2887 C C   . GLY C 1 70  ? 31.097  15.738 88.747  1.00 20.31 ? 464  GLY C C   1 
ATOM   2888 O O   . GLY C 1 70  ? 32.088  15.695 88.043  1.00 21.79 ? 464  GLY C O   1 
ATOM   2889 N N   . TYR C 1 71  ? 30.395  16.856 88.923  1.00 20.16 ? 465  TYR C N   1 
ATOM   2890 C CA  . TYR C 1 71  ? 30.750  18.126 88.280  1.00 22.21 ? 465  TYR C CA  1 
ATOM   2891 C C   . TYR C 1 71  ? 31.428  19.097 89.229  1.00 22.96 ? 465  TYR C C   1 
ATOM   2892 O O   . TYR C 1 71  ? 30.881  19.424 90.277  1.00 22.83 ? 465  TYR C O   1 
ATOM   2893 C CB  . TYR C 1 71  ? 29.504  18.800 87.731  1.00 23.00 ? 465  TYR C CB  1 
ATOM   2894 C CG  . TYR C 1 71  ? 28.992  18.154 86.481  1.00 25.08 ? 465  TYR C CG  1 
ATOM   2895 C CD1 . TYR C 1 71  ? 29.613  18.413 85.263  1.00 25.68 ? 465  TYR C CD1 1 
ATOM   2896 C CD2 . TYR C 1 71  ? 27.891  17.267 86.501  1.00 24.68 ? 465  TYR C CD2 1 
ATOM   2897 C CE1 . TYR C 1 71  ? 29.177  17.826 84.106  1.00 27.37 ? 465  TYR C CE1 1 
ATOM   2898 C CE2 . TYR C 1 71  ? 27.436  16.667 85.304  1.00 25.14 ? 465  TYR C CE2 1 
ATOM   2899 C CZ  . TYR C 1 71  ? 28.097  16.960 84.125  1.00 28.43 ? 465  TYR C CZ  1 
ATOM   2900 O OH  . TYR C 1 71  ? 27.732  16.385 82.909  1.00 30.27 ? 465  TYR C OH  1 
ATOM   2901 N N   . ALA C 1 72  ? 32.597  19.605 88.851  1.00 23.32 ? 466  ALA C N   1 
ATOM   2902 C CA  . ALA C 1 72  ? 33.215  20.686 89.630  1.00 23.47 ? 466  ALA C CA  1 
ATOM   2903 C C   . ALA C 1 72  ? 32.360  21.954 89.442  1.00 23.55 ? 466  ALA C C   1 
ATOM   2904 O O   . ALA C 1 72  ? 32.109  22.387 88.323  1.00 23.84 ? 466  ALA C O   1 
ATOM   2905 C CB  . ALA C 1 72  ? 34.649  20.900 89.196  1.00 23.42 ? 466  ALA C CB  1 
ATOM   2906 N N   . CYS C 1 73  ? 31.886  22.539 90.532  1.00 22.70 ? 467  CYS C N   1 
ATOM   2907 C CA  . CYS C 1 73  ? 31.108  23.761 90.414  1.00 23.85 ? 467  CYS C CA  1 
ATOM   2908 C C   . CYS C 1 73  ? 31.352  24.668 91.603  1.00 23.52 ? 467  CYS C C   1 
ATOM   2909 O O   . CYS C 1 73  ? 31.799  24.192 92.659  1.00 22.26 ? 467  CYS C O   1 
ATOM   2910 C CB  . CYS C 1 73  ? 29.631  23.451 90.268  1.00 24.98 ? 467  CYS C CB  1 
ATOM   2911 S SG  . CYS C 1 73  ? 29.053  22.429 91.586  1.00 33.58 ? 467  CYS C SG  1 
ATOM   2912 N N   . THR C 1 74  ? 31.099  25.965 91.441  1.00 21.58 ? 468  THR C N   1 
ATOM   2913 C CA  . THR C 1 74  ? 31.102  26.901 92.548  1.00 22.18 ? 468  THR C CA  1 
ATOM   2914 C C   . THR C 1 74  ? 29.813  27.682 92.484  1.00 22.13 ? 468  THR C C   1 
ATOM   2915 O O   . THR C 1 74  ? 28.899  27.397 91.648  1.00 20.61 ? 468  THR C O   1 
ATOM   2916 C CB  . THR C 1 74  ? 32.302  27.941 92.570  1.00 22.44 ? 468  THR C CB  1 
ATOM   2917 O OG1 . THR C 1 74  ? 32.423  28.556 91.293  1.00 25.39 ? 468  THR C OG1 1 
ATOM   2918 C CG2 . THR C 1 74  ? 33.567  27.301 92.834  1.00 25.79 ? 468  THR C CG2 1 
ATOM   2919 N N   . SER C 1 75  ? 29.719  28.657 93.377  1.00 22.19 ? 469  SER C N   1 
ATOM   2920 C CA  . SER C 1 75  ? 28.555  29.507 93.430  1.00 23.66 ? 469  SER C CA  1 
ATOM   2921 C C   . SER C 1 75  ? 28.845  30.911 93.963  1.00 24.41 ? 469  SER C C   1 
ATOM   2922 O O   . SER C 1 75  ? 29.870  31.161 94.630  1.00 23.23 ? 469  SER C O   1 
ATOM   2923 C CB  . SER C 1 75  ? 27.461  28.833 94.259  1.00 23.24 ? 469  SER C CB  1 
ATOM   2924 O OG  . SER C 1 75  ? 27.872  28.732 95.598  1.00 26.30 ? 469  SER C OG  1 
ATOM   2925 N N   . ILE C 1 76  ? 27.942  31.844 93.658  1.00 24.83 ? 470  ILE C N   1 
ATOM   2926 C CA  . ILE C 1 76  ? 28.049  33.170 94.217  1.00 25.55 ? 470  ILE C CA  1 
ATOM   2927 C C   . ILE C 1 76  ? 26.676  33.539 94.636  1.00 26.63 ? 470  ILE C C   1 
ATOM   2928 O O   . ILE C 1 76  ? 25.755  33.422 93.848  1.00 24.77 ? 470  ILE C O   1 
ATOM   2929 C CB  . ILE C 1 76  ? 28.513  34.211 93.171  1.00 25.98 ? 470  ILE C CB  1 
ATOM   2930 C CG1 . ILE C 1 76  ? 30.013  34.063 92.897  1.00 27.10 ? 470  ILE C CG1 1 
ATOM   2931 C CG2 . ILE C 1 76  ? 28.249  35.694 93.683  1.00 26.97 ? 470  ILE C CG2 1 
ATOM   2932 C CD1 . ILE C 1 76  ? 30.542  35.035 91.883  1.00 25.28 ? 470  ILE C CD1 1 
ATOM   2933 N N   . HIS C 1 77  ? 26.524  34.030 95.858  1.00 28.58 ? 471  HIS C N   1 
ATOM   2934 C CA  . HIS C 1 77  ? 25.303  34.746 96.176  1.00 31.92 ? 471  HIS C CA  1 
ATOM   2935 C C   . HIS C 1 77  ? 25.448  35.689 97.336  1.00 34.36 ? 471  HIS C C   1 
ATOM   2936 O O   . HIS C 1 77  ? 26.560  35.874 97.851  1.00 34.85 ? 471  HIS C O   1 
ATOM   2937 C CB  . HIS C 1 77  ? 24.181  33.766 96.443  1.00 31.92 ? 471  HIS C CB  1 
ATOM   2938 C CG  . HIS C 1 77  ? 24.405  32.872 97.615  1.00 33.19 ? 471  HIS C CG  1 
ATOM   2939 N ND1 . HIS C 1 77  ? 24.629  31.516 97.483  1.00 34.91 ? 471  HIS C ND1 1 
ATOM   2940 C CD2 . HIS C 1 77  ? 24.388  33.129 98.946  1.00 33.34 ? 471  HIS C CD2 1 
ATOM   2941 C CE1 . HIS C 1 77  ? 24.743  30.979 98.686  1.00 35.77 ? 471  HIS C CE1 1 
ATOM   2942 N NE2 . HIS C 1 77  ? 24.606  31.936 99.590  1.00 36.34 ? 471  HIS C NE2 1 
ATOM   2943 N N   . GLY C 1 78  ? 24.313  36.250 97.772  1.00 37.14 ? 472  GLY C N   1 
ATOM   2944 C CA  . GLY C 1 78  ? 24.267  37.272 98.859  1.00 39.19 ? 472  GLY C CA  1 
ATOM   2945 C C   . GLY C 1 78  ? 24.760  36.912 100.262 1.00 41.31 ? 472  GLY C C   1 
ATOM   2946 O O   . GLY C 1 78  ? 25.254  37.790 100.988 1.00 40.94 ? 472  GLY C O   1 
ATOM   2947 N N   . ASP C 1 79  ? 24.623  35.638 100.649 1.00 42.83 ? 473  ASP C N   1 
ATOM   2948 C CA  . ASP C 1 79  ? 25.135  35.139 101.942 1.00 44.95 ? 473  ASP C CA  1 
ATOM   2949 C C   . ASP C 1 79  ? 26.627  34.739 101.937 1.00 45.73 ? 473  ASP C C   1 
ATOM   2950 O O   . ASP C 1 79  ? 27.164  34.303 102.960 1.00 45.23 ? 473  ASP C O   1 
ATOM   2951 C CB  . ASP C 1 79  ? 24.265  33.983 102.463 1.00 45.08 ? 473  ASP C CB  1 
ATOM   2952 C CG  . ASP C 1 79  ? 22.905  34.451 102.947 1.00 46.85 ? 473  ASP C CG  1 
ATOM   2953 O OD1 . ASP C 1 79  ? 22.661  35.683 102.971 1.00 47.75 ? 473  ASP C OD1 1 
ATOM   2954 O OD2 . ASP C 1 79  ? 22.072  33.584 103.299 1.00 48.52 ? 473  ASP C OD2 1 
ATOM   2955 N N   . ARG C 1 80  ? 27.275  34.888 100.782 1.00 46.50 ? 474  ARG C N   1 
ATOM   2956 C CA  . ARG C 1 80  ? 28.732  34.748 100.650 1.00 47.29 ? 474  ARG C CA  1 
ATOM   2957 C C   . ARG C 1 80  ? 29.439  36.119 100.644 1.00 47.48 ? 474  ARG C C   1 
ATOM   2958 O O   . ARG C 1 80  ? 28.783  37.151 100.488 1.00 47.78 ? 474  ARG C O   1 
ATOM   2959 C CB  . ARG C 1 80  ? 29.056  34.008 99.348  1.00 47.51 ? 474  ARG C CB  1 
ATOM   2960 C CG  . ARG C 1 80  ? 28.363  32.667 99.187  1.00 48.27 ? 474  ARG C CG  1 
ATOM   2961 C CD  . ARG C 1 80  ? 29.085  31.824 98.141  1.00 51.20 ? 474  ARG C CD  1 
ATOM   2962 N NE  . ARG C 1 80  ? 28.587  30.454 98.113  1.00 53.75 ? 474  ARG C NE  1 
ATOM   2963 C CZ  . ARG C 1 80  ? 28.864  29.531 99.030  1.00 56.63 ? 474  ARG C CZ  1 
ATOM   2964 N NH1 . ARG C 1 80  ? 29.645  29.815 100.072 1.00 58.13 ? 474  ARG C NH1 1 
ATOM   2965 N NH2 . ARG C 1 80  ? 28.356  28.314 98.906  1.00 57.79 ? 474  ARG C NH2 1 
ATOM   2966 N N   . SER C 1 81  ? 30.767  36.127 100.794 1.00 47.70 ? 475  SER C N   1 
ATOM   2967 C CA  . SER C 1 81  ? 31.568  37.351 100.630 1.00 47.79 ? 475  SER C CA  1 
ATOM   2968 C C   . SER C 1 81  ? 32.596  37.179 99.508  1.00 48.01 ? 475  SER C C   1 
ATOM   2969 O O   . SER C 1 81  ? 33.449  38.045 99.276  1.00 48.07 ? 475  SER C O   1 
ATOM   2970 C CB  . SER C 1 81  ? 32.286  37.711 101.927 1.00 47.79 ? 475  SER C CB  1 
ATOM   2971 O OG  . SER C 1 81  ? 33.259  36.727 102.243 1.00 47.70 ? 475  SER C OG  1 
ATOM   2972 N N   . ARG C 1 85  ? 33.624  34.381 97.401  1.00 31.50 ? 479  ARG C N   1 
ATOM   2973 C CA  . ARG C 1 85  ? 33.172  35.137 96.248  1.00 32.81 ? 479  ARG C CA  1 
ATOM   2974 C C   . ARG C 1 85  ? 34.293  35.397 95.256  1.00 32.20 ? 479  ARG C C   1 
ATOM   2975 O O   . ARG C 1 85  ? 34.172  35.011 94.117  1.00 30.85 ? 479  ARG C O   1 
ATOM   2976 C CB  . ARG C 1 85  ? 32.528  36.465 96.633  1.00 32.66 ? 479  ARG C CB  1 
ATOM   2977 C CG  . ARG C 1 85  ? 31.803  37.084 95.452  1.00 36.08 ? 479  ARG C CG  1 
ATOM   2978 C CD  . ARG C 1 85  ? 31.772  38.614 95.451  1.00 38.26 ? 479  ARG C CD  1 
ATOM   2979 N NE  . ARG C 1 85  ? 31.287  39.091 94.157  1.00 40.01 ? 479  ARG C NE  1 
ATOM   2980 C CZ  . ARG C 1 85  ? 30.004  39.262 93.824  1.00 42.75 ? 479  ARG C CZ  1 
ATOM   2981 N NH1 . ARG C 1 85  ? 29.028  39.001 94.694  1.00 42.20 ? 479  ARG C NH1 1 
ATOM   2982 N NH2 . ARG C 1 85  ? 29.693  39.691 92.595  1.00 41.28 ? 479  ARG C NH2 1 
ATOM   2983 N N   . GLU C 1 86  ? 35.370  36.060 95.693  1.00 32.09 ? 480  GLU C N   1 
ATOM   2984 C CA  . GLU C 1 86  ? 36.560  36.250 94.849  1.00 33.02 ? 480  GLU C CA  1 
ATOM   2985 C C   . GLU C 1 86  ? 37.223  34.914 94.477  1.00 32.20 ? 480  GLU C C   1 
ATOM   2986 O O   . GLU C 1 86  ? 37.783  34.780 93.386  1.00 32.25 ? 480  GLU C O   1 
ATOM   2987 C CB  . GLU C 1 86  ? 37.591  37.176 95.523  1.00 33.23 ? 480  GLU C CB  1 
ATOM   2988 C CG  . GLU C 1 86  ? 37.317  38.694 95.385  1.00 34.54 ? 480  GLU C CG  1 
ATOM   2989 C CD  . GLU C 1 86  ? 38.521  39.559 95.793  1.00 35.49 ? 480  GLU C CD  1 
ATOM   2990 O OE1 . GLU C 1 86  ? 39.300  39.138 96.684  1.00 37.82 ? 480  GLU C OE1 1 
ATOM   2991 O OE2 . GLU C 1 86  ? 38.702  40.665 95.214  1.00 40.04 ? 480  GLU C OE2 1 
ATOM   2992 N N   . GLU C 1 87  ? 37.184  33.954 95.402  1.00 31.93 ? 481  GLU C N   1 
ATOM   2993 C CA  . GLU C 1 87  ? 37.646  32.583 95.152  1.00 31.24 ? 481  GLU C CA  1 
ATOM   2994 C C   . GLU C 1 87  ? 36.739  31.846 94.139  1.00 30.15 ? 481  GLU C C   1 
ATOM   2995 O O   . GLU C 1 87  ? 37.226  31.122 93.268  1.00 29.55 ? 481  GLU C O   1 
ATOM   2996 C CB  . GLU C 1 87  ? 37.753  31.793 96.467  1.00 31.84 ? 481  GLU C CB  1 
ATOM   2997 C CG  . GLU C 1 87  ? 38.024  30.255 96.329  1.00 33.96 ? 481  GLU C CG  1 
ATOM   2998 C CD  . GLU C 1 87  ? 39.455  29.859 95.867  1.00 38.23 ? 481  GLU C CD  1 
ATOM   2999 O OE1 . GLU C 1 87  ? 40.419  30.648 96.033  1.00 41.41 ? 481  GLU C OE1 1 
ATOM   3000 O OE2 . GLU C 1 87  ? 39.620  28.726 95.349  1.00 38.97 ? 481  GLU C OE2 1 
ATOM   3001 N N   . ALA C 1 88  ? 35.428  32.031 94.269  1.00 28.66 ? 482  ALA C N   1 
ATOM   3002 C CA  . ALA C 1 88  ? 34.478  31.473 93.313  1.00 28.55 ? 482  ALA C CA  1 
ATOM   3003 C C   . ALA C 1 88  ? 34.741  32.026 91.901  1.00 27.70 ? 482  ALA C C   1 
ATOM   3004 O O   . ALA C 1 88  ? 34.831  31.259 90.929  1.00 27.76 ? 482  ALA C O   1 
ATOM   3005 C CB  . ALA C 1 88  ? 33.034  31.770 93.776  1.00 28.21 ? 482  ALA C CB  1 
ATOM   3006 N N   . LEU C 1 89  ? 34.877  33.348 91.792  1.00 27.60 ? 483  LEU C N   1 
ATOM   3007 C CA  . LEU C 1 89  ? 35.173  33.990 90.504  1.00 27.26 ? 483  LEU C CA  1 
ATOM   3008 C C   . LEU C 1 89  ? 36.466  33.466 89.919  1.00 26.12 ? 483  LEU C C   1 
ATOM   3009 O O   . LEU C 1 89  ? 36.527  33.186 88.746  1.00 25.91 ? 483  LEU C O   1 
ATOM   3010 C CB  . LEU C 1 89  ? 35.295  35.505 90.631  1.00 27.49 ? 483  LEU C CB  1 
ATOM   3011 C CG  . LEU C 1 89  ? 34.204  36.607 90.678  1.00 29.40 ? 483  LEU C CG  1 
ATOM   3012 C CD1 . LEU C 1 89  ? 32.931  36.260 89.901  1.00 32.16 ? 483  LEU C CD1 1 
ATOM   3013 C CD2 . LEU C 1 89  ? 33.882  37.077 92.103  1.00 33.98 ? 483  LEU C CD2 1 
ATOM   3014 N N   . HIS C 1 90  ? 37.501  33.354 90.745  1.00 26.24 ? 484  HIS C N   1 
ATOM   3015 C CA  . HIS C 1 90  ? 38.799  32.870 90.287  1.00 26.60 ? 484  HIS C CA  1 
ATOM   3016 C C   . HIS C 1 90  ? 38.698  31.400 89.852  1.00 26.06 ? 484  HIS C C   1 
ATOM   3017 O O   . HIS C 1 90  ? 39.195  31.042 88.793  1.00 26.12 ? 484  HIS C O   1 
ATOM   3018 C CB  . HIS C 1 90  ? 39.878  33.059 91.365  1.00 27.01 ? 484  HIS C CB  1 
ATOM   3019 C CG  . HIS C 1 90  ? 41.131  32.292 91.092  1.00 29.36 ? 484  HIS C CG  1 
ATOM   3020 N ND1 . HIS C 1 90  ? 41.445  31.120 91.753  1.00 32.42 ? 484  HIS C ND1 1 
ATOM   3021 C CD2 . HIS C 1 90  ? 42.136  32.510 90.210  1.00 31.04 ? 484  HIS C CD2 1 
ATOM   3022 C CE1 . HIS C 1 90  ? 42.596  30.656 91.296  1.00 32.95 ? 484  HIS C CE1 1 
ATOM   3023 N NE2 . HIS C 1 90  ? 43.034  31.479 90.356  1.00 32.39 ? 484  HIS C NE2 1 
ATOM   3024 N N   . GLN C 1 91  ? 38.022  30.564 90.647  1.00 25.18 ? 485  GLN C N   1 
ATOM   3025 C CA  . GLN C 1 91  ? 37.883  29.159 90.313  1.00 24.45 ? 485  GLN C CA  1 
ATOM   3026 C C   . GLN C 1 91  ? 37.099  28.984 89.015  1.00 24.65 ? 485  GLN C C   1 
ATOM   3027 O O   . GLN C 1 91  ? 37.326  28.031 88.255  1.00 23.57 ? 485  GLN C O   1 
ATOM   3028 C CB  . GLN C 1 91  ? 37.082  28.483 91.392  1.00 24.89 ? 485  GLN C CB  1 
ATOM   3029 C CG  . GLN C 1 91  ? 37.863  28.078 92.595  1.00 28.72 ? 485  GLN C CG  1 
ATOM   3030 C CD  . GLN C 1 91  ? 37.380  26.746 93.071  1.00 35.53 ? 485  GLN C CD  1 
ATOM   3031 O OE1 . GLN C 1 91  ? 36.786  26.631 94.148  1.00 38.12 ? 485  GLN C OE1 1 
ATOM   3032 N NE2 . GLN C 1 91  ? 37.581  25.720 92.239  1.00 37.03 ? 485  GLN C NE2 1 
ATOM   3033 N N   . PHE C 1 92  ? 36.128  29.866 88.799  1.00 22.93 ? 486  PHE C N   1 
ATOM   3034 C CA  . PHE C 1 92  ? 35.324  29.783 87.589  1.00 24.44 ? 486  PHE C CA  1 
ATOM   3035 C C   . PHE C 1 92  ? 36.090  30.326 86.435  1.00 26.45 ? 486  PHE C C   1 
ATOM   3036 O O   . PHE C 1 92  ? 36.219  29.643 85.435  1.00 27.45 ? 486  PHE C O   1 
ATOM   3037 C CB  . PHE C 1 92  ? 34.006  30.535 87.751  1.00 23.12 ? 486  PHE C CB  1 
ATOM   3038 C CG  . PHE C 1 92  ? 33.113  30.533 86.537  1.00 21.95 ? 486  PHE C CG  1 
ATOM   3039 C CD1 . PHE C 1 92  ? 32.396  29.397 86.186  1.00 16.85 ? 486  PHE C CD1 1 
ATOM   3040 C CD2 . PHE C 1 92  ? 32.960  31.679 85.776  1.00 23.35 ? 486  PHE C CD2 1 
ATOM   3041 C CE1 . PHE C 1 92  ? 31.524  29.377 85.119  1.00 18.51 ? 486  PHE C CE1 1 
ATOM   3042 C CE2 . PHE C 1 92  ? 32.080  31.683 84.680  1.00 25.65 ? 486  PHE C CE2 1 
ATOM   3043 C CZ  . PHE C 1 92  ? 31.341  30.522 84.378  1.00 23.73 ? 486  PHE C CZ  1 
ATOM   3044 N N   . ARG C 1 93  ? 36.609  31.541 86.544  1.00 27.98 ? 487  ARG C N   1 
ATOM   3045 C CA  . ARG C 1 93  ? 37.167  32.145 85.340  1.00 31.02 ? 487  ARG C CA  1 
ATOM   3046 C C   . ARG C 1 93  ? 38.432  31.420 84.934  1.00 31.52 ? 487  ARG C C   1 
ATOM   3047 O O   . ARG C 1 93  ? 38.782  31.435 83.765  1.00 33.50 ? 487  ARG C O   1 
ATOM   3048 C CB  . ARG C 1 93  ? 37.254  33.692 85.349  1.00 30.66 ? 487  ARG C CB  1 
ATOM   3049 C CG  . ARG C 1 93  ? 38.111  34.344 86.403  1.00 36.17 ? 487  ARG C CG  1 
ATOM   3050 C CD  . ARG C 1 93  ? 37.494  35.669 86.913  1.00 39.80 ? 487  ARG C CD  1 
ATOM   3051 N NE  . ARG C 1 93  ? 36.640  36.330 85.927  1.00 43.08 ? 487  ARG C NE  1 
ATOM   3052 C CZ  . ARG C 1 93  ? 35.857  37.387 86.171  1.00 45.28 ? 487  ARG C CZ  1 
ATOM   3053 N NH1 . ARG C 1 93  ? 35.787  37.940 87.380  1.00 44.34 ? 487  ARG C NH1 1 
ATOM   3054 N NH2 . ARG C 1 93  ? 35.125  37.898 85.182  1.00 47.85 ? 487  ARG C NH2 1 
ATOM   3055 N N   . SER C 1 94  ? 39.052  30.722 85.883  1.00 31.89 ? 488  SER C N   1 
ATOM   3056 C CA  . SER C 1 94  ? 40.265  29.966 85.629  1.00 31.32 ? 488  SER C CA  1 
ATOM   3057 C C   . SER C 1 94  ? 40.013  28.547 85.146  1.00 31.67 ? 488  SER C C   1 
ATOM   3058 O O   . SER C 1 94  ? 40.977  27.771 85.022  1.00 32.40 ? 488  SER C O   1 
ATOM   3059 C CB  . SER C 1 94  ? 41.100  29.885 86.902  1.00 31.91 ? 488  SER C CB  1 
ATOM   3060 O OG  . SER C 1 94  ? 40.630  28.820 87.704  1.00 32.45 ? 488  SER C OG  1 
ATOM   3061 N N   . GLY C 1 95  ? 38.746  28.181 84.937  1.00 30.35 ? 489  GLY C N   1 
ATOM   3062 C CA  . GLY C 1 95  ? 38.401  26.879 84.391  1.00 30.18 ? 489  GLY C CA  1 
ATOM   3063 C C   . GLY C 1 95  ? 38.489  25.749 85.395  1.00 29.91 ? 489  GLY C C   1 
ATOM   3064 O O   . GLY C 1 95  ? 38.244  24.563 85.084  1.00 30.23 ? 489  GLY C O   1 
ATOM   3065 N N   . LYS C 1 96  ? 38.801  26.122 86.622  1.00 28.58 ? 490  LYS C N   1 
ATOM   3066 C CA  . LYS C 1 96  ? 38.962  25.168 87.682  1.00 28.02 ? 490  LYS C CA  1 
ATOM   3067 C C   . LYS C 1 96  ? 37.615  24.550 88.095  1.00 26.28 ? 490  LYS C C   1 
ATOM   3068 O O   . LYS C 1 96  ? 37.508  23.347 88.262  1.00 26.33 ? 490  LYS C O   1 
ATOM   3069 C CB  . LYS C 1 96  ? 39.617  25.885 88.850  1.00 28.74 ? 490  LYS C CB  1 
ATOM   3070 C CG  . LYS C 1 96  ? 40.841  25.212 89.357  1.00 31.87 ? 490  LYS C CG  1 
ATOM   3071 C CD  . LYS C 1 96  ? 41.558  26.105 90.353  1.00 35.39 ? 490  LYS C CD  1 
ATOM   3072 C CE  . LYS C 1 96  ? 42.003  25.274 91.548  1.00 40.32 ? 490  LYS C CE  1 
ATOM   3073 N NZ  . LYS C 1 96  ? 42.465  23.883 91.138  1.00 42.35 ? 490  LYS C NZ  1 
ATOM   3074 N N   . SER C 1 97  ? 36.604  25.379 88.302  1.00 24.42 ? 491  SER C N   1 
ATOM   3075 C CA  . SER C 1 97  ? 35.242  24.889 88.509  1.00 23.72 ? 491  SER C CA  1 
ATOM   3076 C C   . SER C 1 97  ? 34.454  25.519 87.400  1.00 22.94 ? 491  SER C C   1 
ATOM   3077 O O   . SER C 1 97  ? 34.044  26.656 87.559  1.00 23.56 ? 491  SER C O   1 
ATOM   3078 C CB  . SER C 1 97  ? 34.700  25.360 89.840  1.00 24.22 ? 491  SER C CB  1 
ATOM   3079 O OG  . SER C 1 97  ? 35.575  24.939 90.869  1.00 29.06 ? 491  SER C OG  1 
ATOM   3080 N N   . PRO C 1 98  ? 34.317  24.829 86.248  1.00 21.78 ? 492  PRO C N   1 
ATOM   3081 C CA  . PRO C 1 98  ? 33.733  25.469 85.051  1.00 21.97 ? 492  PRO C CA  1 
ATOM   3082 C C   . PRO C 1 98  ? 32.221  25.711 85.089  1.00 21.09 ? 492  PRO C C   1 
ATOM   3083 O O   . PRO C 1 98  ? 31.689  26.264 84.137  1.00 21.13 ? 492  PRO C O   1 
ATOM   3084 C CB  . PRO C 1 98  ? 34.070  24.487 83.931  1.00 23.35 ? 492  PRO C CB  1 
ATOM   3085 C CG  . PRO C 1 98  ? 33.984  23.157 84.627  1.00 23.66 ? 492  PRO C CG  1 
ATOM   3086 C CD  . PRO C 1 98  ? 34.661  23.416 85.984  1.00 21.54 ? 492  PRO C CD  1 
ATOM   3087 N N   . ILE C 1 99  ? 31.542  25.295 86.148  1.00 19.93 ? 493  ILE C N   1 
ATOM   3088 C CA  . ILE C 1 99  ? 30.105  25.664 86.349  1.00 17.47 ? 493  ILE C CA  1 
ATOM   3089 C C   . ILE C 1 99  ? 30.006  26.586 87.544  1.00 17.76 ? 493  ILE C C   1 
ATOM   3090 O O   . ILE C 1 99  ? 30.584  26.307 88.620  1.00 17.19 ? 493  ILE C O   1 
ATOM   3091 C CB  . ILE C 1 99  ? 29.185  24.421 86.566  1.00 18.36 ? 493  ILE C CB  1 
ATOM   3092 C CG1 . ILE C 1 99  ? 29.221  23.508 85.355  1.00 17.44 ? 493  ILE C CG1 1 
ATOM   3093 C CG2 . ILE C 1 99  ? 27.731  24.828 86.764  1.00 18.51 ? 493  ILE C CG2 1 
ATOM   3094 C CD1 . ILE C 1 99  ? 28.893  22.092 85.659  1.00 23.33 ? 493  ILE C CD1 1 
ATOM   3095 N N   . LEU C 1 100 ? 29.282  27.687 87.395  1.00 18.12 ? 494  LEU C N   1 
ATOM   3096 C CA  . LEU C 1 100 ? 29.059  28.625 88.481  1.00 17.95 ? 494  LEU C CA  1 
ATOM   3097 C C   . LEU C 1 100 ? 27.564  28.829 88.627  1.00 19.35 ? 494  LEU C C   1 
ATOM   3098 O O   . LEU C 1 100 ? 26.882  29.192 87.661  1.00 19.80 ? 494  LEU C O   1 
ATOM   3099 C CB  . LEU C 1 100 ? 29.716  29.973 88.210  1.00 20.34 ? 494  LEU C CB  1 
ATOM   3100 C CG  . LEU C 1 100 ? 29.627  30.940 89.417  1.00 19.94 ? 494  LEU C CG  1 
ATOM   3101 C CD1 . LEU C 1 100 ? 30.943  31.679 89.698  1.00 25.07 ? 494  LEU C CD1 1 
ATOM   3102 C CD2 . LEU C 1 100 ? 28.484  31.896 89.329  1.00 22.42 ? 494  LEU C CD2 1 
ATOM   3103 N N   . VAL C 1 101 ? 27.061  28.588 89.828  1.00 17.16 ? 495  VAL C N   1 
ATOM   3104 C CA  . VAL C 1 101 ? 25.643  28.764 90.092  1.00 17.14 ? 495  VAL C CA  1 
ATOM   3105 C C   . VAL C 1 101 ? 25.459  30.130 90.739  1.00 17.01 ? 495  VAL C C   1 
ATOM   3106 O O   . VAL C 1 101 ? 26.077  30.432 91.746  1.00 17.35 ? 495  VAL C O   1 
ATOM   3107 C CB  . VAL C 1 101 ? 25.121  27.669 91.009  1.00 17.31 ? 495  VAL C CB  1 
ATOM   3108 C CG1 . VAL C 1 101 ? 23.562  27.868 91.298  1.00 14.20 ? 495  VAL C CG1 1 
ATOM   3109 C CG2 . VAL C 1 101 ? 25.410  26.239 90.358  1.00 18.05 ? 495  VAL C CG2 1 
ATOM   3110 N N   . ALA C 1 102 ? 24.596  30.967 90.187  1.00 17.35 ? 496  ALA C N   1 
ATOM   3111 C CA  . ALA C 1 102 ? 24.414  32.276 90.808  1.00 17.23 ? 496  ALA C CA  1 
ATOM   3112 C C   . ALA C 1 102 ? 22.931  32.483 91.131  1.00 17.52 ? 496  ALA C C   1 
ATOM   3113 O O   . ALA C 1 102 ? 22.076  31.977 90.398  1.00 17.74 ? 496  ALA C O   1 
ATOM   3114 C CB  . ALA C 1 102 ? 24.945  33.378 89.869  1.00 14.97 ? 496  ALA C CB  1 
ATOM   3115 N N   . THR C 1 103 ? 22.630  33.246 92.189  1.00 17.78 ? 497  THR C N   1 
ATOM   3116 C CA  . THR C 1 103 ? 21.243  33.597 92.439  1.00 18.02 ? 497  THR C CA  1 
ATOM   3117 C C   . THR C 1 103 ? 20.733  34.732 91.585  1.00 18.91 ? 497  THR C C   1 
ATOM   3118 O O   . THR C 1 103 ? 21.490  35.469 91.003  1.00 18.77 ? 497  THR C O   1 
ATOM   3119 C CB  . THR C 1 103 ? 20.987  33.993 93.879  1.00 17.68 ? 497  THR C CB  1 
ATOM   3120 O OG1 . THR C 1 103 ? 21.827  35.128 94.186  1.00 17.35 ? 497  THR C OG1 1 
ATOM   3121 C CG2 . THR C 1 103 ? 21.238  32.797 94.821  1.00 17.53 ? 497  THR C CG2 1 
ATOM   3122 N N   . ALA C 1 104 ? 19.415  34.950 91.663  1.00 19.86 ? 498  ALA C N   1 
ATOM   3123 C CA  . ALA C 1 104 ? 18.759  35.958 90.884  1.00 20.77 ? 498  ALA C CA  1 
ATOM   3124 C C   . ALA C 1 104 ? 19.298  37.313 91.325  1.00 21.27 ? 498  ALA C C   1 
ATOM   3125 O O   . ALA C 1 104 ? 19.524  38.171 90.505  1.00 20.16 ? 498  ALA C O   1 
ATOM   3126 C CB  . ALA C 1 104 ? 17.253  35.888 91.080  1.00 20.09 ? 498  ALA C CB  1 
ATOM   3127 N N   . VAL C 1 105 ? 19.577  37.453 92.612  1.00 21.35 ? 499  VAL C N   1 
ATOM   3128 C CA  . VAL C 1 105 ? 20.093  38.703 93.149  1.00 23.15 ? 499  VAL C CA  1 
ATOM   3129 C C   . VAL C 1 105 ? 21.597  38.915 92.800  1.00 23.39 ? 499  VAL C C   1 
ATOM   3130 O O   . VAL C 1 105 ? 22.006  40.036 92.412  1.00 24.71 ? 499  VAL C O   1 
ATOM   3131 C CB  . VAL C 1 105 ? 19.735  38.810 94.614  1.00 22.72 ? 499  VAL C CB  1 
ATOM   3132 C CG1 . VAL C 1 105 ? 20.617  39.789 95.353  1.00 25.83 ? 499  VAL C CG1 1 
ATOM   3133 C CG2 . VAL C 1 105 ? 18.257  39.224 94.715  1.00 24.80 ? 499  VAL C CG2 1 
ATOM   3134 N N   . ALA C 1 106 ? 22.392  37.842 92.831  1.00 22.04 ? 500  ALA C N   1 
ATOM   3135 C CA  . ALA C 1 106 ? 23.810  37.968 92.539  1.00 21.17 ? 500  ALA C CA  1 
ATOM   3136 C C   . ALA C 1 106 ? 24.023  38.328 91.035  1.00 20.81 ? 500  ALA C C   1 
ATOM   3137 O O   . ALA C 1 106 ? 25.119  38.755 90.631  1.00 21.38 ? 500  ALA C O   1 
ATOM   3138 C CB  . ALA C 1 106 ? 24.548  36.714 92.926  1.00 20.97 ? 500  ALA C CB  1 
ATOM   3139 N N   . ALA C 1 107 ? 22.966  38.176 90.236  1.00 19.94 ? 501  ALA C N   1 
ATOM   3140 C CA  . ALA C 1 107 ? 23.033  38.417 88.807  1.00 20.86 ? 501  ALA C CA  1 
ATOM   3141 C C   . ALA C 1 107 ? 23.476  39.856 88.449  1.00 20.05 ? 501  ALA C C   1 
ATOM   3142 O O   . ALA C 1 107 ? 24.249  40.076 87.521  1.00 20.41 ? 501  ALA C O   1 
ATOM   3143 C CB  . ALA C 1 107 ? 21.719  38.043 88.100  1.00 20.65 ? 501  ALA C CB  1 
ATOM   3144 N N   . ARG C 1 108 ? 22.956  40.846 89.150  1.00 19.56 ? 502  ARG C N   1 
ATOM   3145 C CA  . ARG C 1 108 ? 23.297  42.216 88.818  1.00 18.72 ? 502  ARG C CA  1 
ATOM   3146 C C   . ARG C 1 108 ? 24.691  42.551 89.360  1.00 17.85 ? 502  ARG C C   1 
ATOM   3147 O O   . ARG C 1 108 ? 24.931  42.403 90.550  1.00 18.62 ? 502  ARG C O   1 
ATOM   3148 C CB  . ARG C 1 108 ? 22.211  43.098 89.412  1.00 18.37 ? 502  ARG C CB  1 
ATOM   3149 C CG  . ARG C 1 108 ? 22.464  44.573 89.450  1.00 22.47 ? 502  ARG C CG  1 
ATOM   3150 C CD  . ARG C 1 108 ? 21.116  45.244 89.712  1.00 27.70 ? 502  ARG C CD  1 
ATOM   3151 N NE  . ARG C 1 108 ? 21.226  46.367 90.613  1.00 33.78 ? 502  ARG C NE  1 
ATOM   3152 C CZ  . ARG C 1 108 ? 20.186  47.021 91.123  1.00 34.80 ? 502  ARG C CZ  1 
ATOM   3153 N NH1 . ARG C 1 108 ? 18.937  46.649 90.827  1.00 34.69 ? 502  ARG C NH1 1 
ATOM   3154 N NH2 . ARG C 1 108 ? 20.401  48.044 91.916  1.00 33.64 ? 502  ARG C NH2 1 
ATOM   3155 N N   . GLY C 1 109 ? 25.590  43.049 88.494  1.00 15.95 ? 503  GLY C N   1 
ATOM   3156 C CA  . GLY C 1 109 ? 26.958  43.361 88.877  1.00 14.42 ? 503  GLY C CA  1 
ATOM   3157 C C   . GLY C 1 109 ? 27.782  42.108 89.125  1.00 13.53 ? 503  GLY C C   1 
ATOM   3158 O O   . GLY C 1 109 ? 28.777  42.155 89.828  1.00 12.49 ? 503  GLY C O   1 
ATOM   3159 N N   . LEU C 1 110 ? 27.308  40.974 88.618  1.00 14.30 ? 504  LEU C N   1 
ATOM   3160 C CA  . LEU C 1 110 ? 28.082  39.699 88.624  1.00 16.04 ? 504  LEU C CA  1 
ATOM   3161 C C   . LEU C 1 110 ? 29.520  39.807 88.049  1.00 16.50 ? 504  LEU C C   1 
ATOM   3162 O O   . LEU C 1 110 ? 30.421  39.106 88.526  1.00 15.49 ? 504  LEU C O   1 
ATOM   3163 C CB  . LEU C 1 110 ? 27.322  38.600 87.894  1.00 16.65 ? 504  LEU C CB  1 
ATOM   3164 C CG  . LEU C 1 110 ? 27.722  37.158 88.110  1.00 17.80 ? 504  LEU C CG  1 
ATOM   3165 C CD1 . LEU C 1 110 ? 27.716  36.743 89.598  1.00 17.80 ? 504  LEU C CD1 1 
ATOM   3166 C CD2 . LEU C 1 110 ? 26.848  36.274 87.287  1.00 20.90 ? 504  LEU C CD2 1 
ATOM   3167 N N   . ASP C 1 111 ? 29.740  40.703 87.070  1.00 16.11 ? 505  ASP C N   1 
ATOM   3168 C CA  . ASP C 1 111 ? 31.104  40.960 86.550  1.00 16.52 ? 505  ASP C CA  1 
ATOM   3169 C C   . ASP C 1 111 ? 31.754  39.757 85.802  1.00 16.89 ? 505  ASP C C   1 
ATOM   3170 O O   . ASP C 1 111 ? 32.959  39.566 85.858  1.00 16.94 ? 505  ASP C O   1 
ATOM   3171 C CB  . ASP C 1 111 ? 32.013  41.425 87.706  1.00 15.89 ? 505  ASP C CB  1 
ATOM   3172 C CG  . ASP C 1 111 ? 33.134  42.280 87.242  1.00 17.76 ? 505  ASP C CG  1 
ATOM   3173 O OD1 . ASP C 1 111 ? 33.176  42.622 86.053  1.00 15.30 ? 505  ASP C OD1 1 
ATOM   3174 O OD2 . ASP C 1 111 ? 33.994  42.653 88.079  1.00 22.17 ? 505  ASP C OD2 1 
ATOM   3175 N N   . ILE C 1 112 ? 30.930  38.984 85.099  1.00 18.19 ? 506  ILE C N   1 
ATOM   3176 C CA  . ILE C 1 112 ? 31.338  37.764 84.410  1.00 18.92 ? 506  ILE C CA  1 
ATOM   3177 C C   . ILE C 1 112 ? 30.697  37.831 83.017  1.00 19.15 ? 506  ILE C C   1 
ATOM   3178 O O   . ILE C 1 112 ? 29.477  38.044 82.905  1.00 18.45 ? 506  ILE C O   1 
ATOM   3179 C CB  . ILE C 1 112 ? 30.698  36.526 85.109  1.00 19.40 ? 506  ILE C CB  1 
ATOM   3180 C CG1 . ILE C 1 112 ? 31.430  36.183 86.404  1.00 20.17 ? 506  ILE C CG1 1 
ATOM   3181 C CG2 . ILE C 1 112 ? 30.627  35.323 84.166  1.00 21.70 ? 506  ILE C CG2 1 
ATOM   3182 C CD1 . ILE C 1 112 ? 30.793  34.932 87.085  1.00 19.61 ? 506  ILE C CD1 1 
ATOM   3183 N N   . SER C 1 113 ? 31.493  37.720 81.963  1.00 18.39 ? 507  SER C N   1 
ATOM   3184 C CA  . SER C 1 113 ? 30.906  37.668 80.646  1.00 18.20 ? 507  SER C CA  1 
ATOM   3185 C C   . SER C 1 113 ? 31.770  36.786 79.739  1.00 18.51 ? 507  SER C C   1 
ATOM   3186 O O   . SER C 1 113 ? 32.747  36.182 80.179  1.00 16.03 ? 507  SER C O   1 
ATOM   3187 C CB  . SER C 1 113 ? 30.850  39.062 80.129  1.00 18.97 ? 507  SER C CB  1 
ATOM   3188 O OG  . SER C 1 113 ? 32.203  39.419 79.870  1.00 18.51 ? 507  SER C OG  1 
ATOM   3189 N N   . ASN C 1 114 ? 31.361  36.701 78.483  1.00 19.44 ? 508  ASN C N   1 
ATOM   3190 C CA  . ASN C 1 114 ? 31.920  35.774 77.493  1.00 18.48 ? 508  ASN C CA  1 
ATOM   3191 C C   . ASN C 1 114 ? 31.890  34.349 77.957  1.00 18.29 ? 508  ASN C C   1 
ATOM   3192 O O   . ASN C 1 114 ? 32.878  33.677 77.746  1.00 19.86 ? 508  ASN C O   1 
ATOM   3193 C CB  . ASN C 1 114 ? 33.383  36.135 77.145  1.00 20.91 ? 508  ASN C CB  1 
ATOM   3194 C CG  . ASN C 1 114 ? 33.956  35.260 75.988  1.00 25.32 ? 508  ASN C CG  1 
ATOM   3195 O OD1 . ASN C 1 114 ? 35.164  34.979 75.930  1.00 36.67 ? 508  ASN C OD1 1 
ATOM   3196 N ND2 . ASN C 1 114 ? 33.081  34.824 75.080  1.00 29.92 ? 508  ASN C ND2 1 
ATOM   3197 N N   . VAL C 1 115 ? 30.842  33.852 78.651  1.00 16.38 ? 509  VAL C N   1 
ATOM   3198 C CA  . VAL C 1 115 ? 30.871  32.413 78.945  1.00 17.38 ? 509  VAL C CA  1 
ATOM   3199 C C   . VAL C 1 115 ? 30.285  31.607 77.770  1.00 17.74 ? 509  VAL C C   1 
ATOM   3200 O O   . VAL C 1 115 ? 29.651  32.196 76.866  1.00 17.63 ? 509  VAL C O   1 
ATOM   3201 C CB  . VAL C 1 115 ? 30.108  32.100 80.254  1.00 18.04 ? 509  VAL C CB  1 
ATOM   3202 C CG1 . VAL C 1 115 ? 30.582  33.069 81.342  1.00 17.02 ? 509  VAL C CG1 1 
ATOM   3203 C CG2 . VAL C 1 115 ? 28.613  32.237 79.984  1.00 16.39 ? 509  VAL C CG2 1 
ATOM   3204 N N   . LYS C 1 116 ? 30.517  30.305 77.745  1.00 17.14 ? 510  LYS C N   1 
ATOM   3205 C CA  . LYS C 1 116 ? 30.012  29.482 76.629  1.00 18.39 ? 510  LYS C CA  1 
ATOM   3206 C C   . LYS C 1 116 ? 28.478  29.235 76.708  1.00 17.50 ? 510  LYS C C   1 
ATOM   3207 O O   . LYS C 1 116 ? 27.797  29.109 75.689  1.00 16.25 ? 510  LYS C O   1 
ATOM   3208 C CB  . LYS C 1 116 ? 30.797  28.176 76.544  1.00 18.44 ? 510  LYS C CB  1 
ATOM   3209 C CG  . LYS C 1 116 ? 31.930  28.301 75.390  1.00 26.11 ? 510  LYS C CG  1 
ATOM   3210 C CD  . LYS C 1 116 ? 32.985  27.169 75.387  1.00 24.08 ? 510  LYS C CD  1 
ATOM   3211 C CE  . LYS C 1 116 ? 34.372  27.601 74.838  1.00 29.92 ? 510  LYS C CE  1 
ATOM   3212 N NZ  . LYS C 1 116 ? 34.497  27.091 73.405  1.00 33.02 ? 510  LYS C NZ  1 
ATOM   3213 N N   . HIS C 1 117 ? 27.943  29.192 77.895  1.00 17.31 ? 511  HIS C N   1 
ATOM   3214 C CA  . HIS C 1 117 ? 26.533  28.812 78.009  1.00 16.61 ? 511  HIS C CA  1 
ATOM   3215 C C   . HIS C 1 117 ? 25.954  29.433 79.238  1.00 16.58 ? 511  HIS C C   1 
ATOM   3216 O O   . HIS C 1 117 ? 26.480  29.281 80.337  1.00 17.73 ? 511  HIS C O   1 
ATOM   3217 C CB  . HIS C 1 117 ? 26.439  27.267 78.145  1.00 18.76 ? 511  HIS C CB  1 
ATOM   3218 C CG  . HIS C 1 117 ? 25.047  26.716 77.983  1.00 15.58 ? 511  HIS C CG  1 
ATOM   3219 N ND1 . HIS C 1 117 ? 24.766  25.369 78.096  1.00 20.94 ? 511  HIS C ND1 1 
ATOM   3220 C CD2 . HIS C 1 117 ? 23.900  27.305 77.538  1.00 19.09 ? 511  HIS C CD2 1 
ATOM   3221 C CE1 . HIS C 1 117 ? 23.493  25.167 77.818  1.00 17.80 ? 511  HIS C CE1 1 
ATOM   3222 N NE2 . HIS C 1 117 ? 22.939  26.330 77.482  1.00 16.58 ? 511  HIS C NE2 1 
ATOM   3223 N N   . VAL C 1 118 ? 24.822  30.104 79.078  1.00 15.60 ? 512  VAL C N   1 
ATOM   3224 C CA  . VAL C 1 118 ? 24.077  30.607 80.232  1.00 15.75 ? 512  VAL C CA  1 
ATOM   3225 C C   . VAL C 1 118 ? 22.857  29.709 80.303  1.00 16.44 ? 512  VAL C C   1 
ATOM   3226 O O   . VAL C 1 118 ? 22.166  29.500 79.284  1.00 15.57 ? 512  VAL C O   1 
ATOM   3227 C CB  . VAL C 1 118 ? 23.605  32.069 80.047  1.00 15.83 ? 512  VAL C CB  1 
ATOM   3228 C CG1 . VAL C 1 118 ? 22.472  32.400 81.078  1.00 14.75 ? 512  VAL C CG1 1 
ATOM   3229 C CG2 . VAL C 1 118 ? 24.740  33.038 80.289  1.00 14.41 ? 512  VAL C CG2 1 
ATOM   3230 N N   . ILE C 1 119 ? 22.542  29.264 81.505  1.00 15.76 ? 513  ILE C N   1 
ATOM   3231 C CA  . ILE C 1 119 ? 21.355  28.419 81.724  1.00 16.58 ? 513  ILE C CA  1 
ATOM   3232 C C   . ILE C 1 119 ? 20.471  29.053 82.756  1.00 16.11 ? 513  ILE C C   1 
ATOM   3233 O O   . ILE C 1 119 ? 20.825  29.211 83.921  1.00 17.82 ? 513  ILE C O   1 
ATOM   3234 C CB  . ILE C 1 119 ? 21.676  26.992 82.188  1.00 16.49 ? 513  ILE C CB  1 
ATOM   3235 C CG1 . ILE C 1 119 ? 22.585  26.290 81.186  1.00 15.93 ? 513  ILE C CG1 1 
ATOM   3236 C CG2 . ILE C 1 119 ? 20.378  26.195 82.536  1.00 16.51 ? 513  ILE C CG2 1 
ATOM   3237 C CD1 . ILE C 1 119 ? 23.183  24.900 81.619  1.00 15.64 ? 513  ILE C CD1 1 
ATOM   3238 N N   . ASN C 1 120 ? 19.289  29.442 82.345  1.00 14.30 ? 514  ASN C N   1 
ATOM   3239 C CA  . ASN C 1 120 ? 18.346  29.954 83.357  1.00 15.93 ? 514  ASN C CA  1 
ATOM   3240 C C   . ASN C 1 120 ? 17.596  28.739 83.919  1.00 17.73 ? 514  ASN C C   1 
ATOM   3241 O O   . ASN C 1 120 ? 16.604  28.300 83.323  1.00 19.24 ? 514  ASN C O   1 
ATOM   3242 C CB  . ASN C 1 120 ? 17.358  30.938 82.728  1.00 16.67 ? 514  ASN C CB  1 
ATOM   3243 C CG  . ASN C 1 120 ? 18.005  32.231 82.368  1.00 19.72 ? 514  ASN C CG  1 
ATOM   3244 O OD1 . ASN C 1 120 ? 18.664  32.845 83.201  1.00 20.51 ? 514  ASN C OD1 1 
ATOM   3245 N ND2 . ASN C 1 120 ? 17.910  32.622 81.101  1.00 17.50 ? 514  ASN C ND2 1 
ATOM   3246 N N   . PHE C 1 121 ? 18.117  28.134 84.992  1.00 16.02 ? 515  PHE C N   1 
ATOM   3247 C CA  . PHE C 1 121 ? 17.465  26.999 85.652  1.00 15.92 ? 515  PHE C CA  1 
ATOM   3248 C C   . PHE C 1 121 ? 16.152  27.461 86.200  1.00 17.65 ? 515  PHE C C   1 
ATOM   3249 O O   . PHE C 1 121 ? 15.128  26.769 86.030  1.00 16.70 ? 515  PHE C O   1 
ATOM   3250 C CB  . PHE C 1 121 ? 18.418  26.498 86.760  1.00 17.61 ? 515  PHE C CB  1 
ATOM   3251 C CG  . PHE C 1 121 ? 18.032  25.208 87.408  1.00 17.17 ? 515  PHE C CG  1 
ATOM   3252 C CD1 . PHE C 1 121 ? 18.491  23.983 86.920  1.00 15.22 ? 515  PHE C CD1 1 
ATOM   3253 C CD2 . PHE C 1 121 ? 17.271  25.214 88.530  1.00 18.15 ? 515  PHE C CD2 1 
ATOM   3254 C CE1 . PHE C 1 121 ? 18.139  22.749 87.591  1.00 14.81 ? 515  PHE C CE1 1 
ATOM   3255 C CE2 . PHE C 1 121 ? 16.925  24.009 89.207  1.00 18.42 ? 515  PHE C CE2 1 
ATOM   3256 C CZ  . PHE C 1 121 ? 17.386  22.778 88.716  1.00 16.30 ? 515  PHE C CZ  1 
ATOM   3257 N N   . ASP C 1 122 ? 16.147  28.653 86.815  1.00 18.65 ? 516  ASP C N   1 
ATOM   3258 C CA  . ASP C 1 122 ? 14.911  29.353 87.098  1.00 19.22 ? 516  ASP C CA  1 
ATOM   3259 C C   . ASP C 1 122 ? 14.945  30.654 86.291  1.00 19.95 ? 516  ASP C C   1 
ATOM   3260 O O   . ASP C 1 122 ? 15.964  31.355 86.267  1.00 21.29 ? 516  ASP C O   1 
ATOM   3261 C CB  . ASP C 1 122 ? 14.792  29.679 88.593  1.00 18.34 ? 516  ASP C CB  1 
ATOM   3262 C CG  . ASP C 1 122 ? 14.825  28.465 89.462  1.00 18.55 ? 516  ASP C CG  1 
ATOM   3263 O OD1 . ASP C 1 122 ? 14.143  27.449 89.159  1.00 24.11 ? 516  ASP C OD1 1 
ATOM   3264 O OD2 . ASP C 1 122 ? 15.527  28.512 90.477  1.00 17.44 ? 516  ASP C OD2 1 
ATOM   3265 N N   . LEU C 1 123 ? 13.844  30.950 85.579  1.00 20.93 ? 517  LEU C N   1 
ATOM   3266 C CA  . LEU C 1 123 ? 13.678  32.244 84.923  1.00 20.89 ? 517  LEU C CA  1 
ATOM   3267 C C   . LEU C 1 123 ? 13.438  33.320 85.985  1.00 20.87 ? 517  LEU C C   1 
ATOM   3268 O O   . LEU C 1 123 ? 12.939  32.977 87.061  1.00 22.98 ? 517  LEU C O   1 
ATOM   3269 C CB  . LEU C 1 123 ? 12.543  32.178 83.903  1.00 20.00 ? 517  LEU C CB  1 
ATOM   3270 C CG  . LEU C 1 123 ? 12.952  31.609 82.524  1.00 19.02 ? 517  LEU C CG  1 
ATOM   3271 C CD1 . LEU C 1 123 ? 11.754  31.173 81.670  1.00 16.32 ? 517  LEU C CD1 1 
ATOM   3272 C CD2 . LEU C 1 123 ? 13.818  32.632 81.764  1.00 18.43 ? 517  LEU C CD2 1 
ATOM   3273 N N   . PRO C 1 124 ? 13.813  34.604 85.717  1.00 21.71 ? 518  PRO C N   1 
ATOM   3274 C CA  . PRO C 1 124 ? 13.505  35.719 86.646  1.00 21.66 ? 518  PRO C CA  1 
ATOM   3275 C C   . PRO C 1 124 ? 12.112  36.237 86.460  1.00 21.63 ? 518  PRO C C   1 
ATOM   3276 O O   . PRO C 1 124 ? 11.452  35.896 85.456  1.00 19.62 ? 518  PRO C O   1 
ATOM   3277 C CB  . PRO C 1 124 ? 14.452  36.814 86.215  1.00 20.11 ? 518  PRO C CB  1 
ATOM   3278 C CG  . PRO C 1 124 ? 14.591  36.580 84.702  1.00 21.50 ? 518  PRO C CG  1 
ATOM   3279 C CD  . PRO C 1 124 ? 14.549  35.080 84.526  1.00 22.19 ? 518  PRO C CD  1 
ATOM   3280 N N   . SER C 1 125 ? 11.636  37.057 87.404  1.00 23.52 ? 519  SER C N   1 
ATOM   3281 C CA  . SER C 1 125 ? 10.280  37.591 87.267  1.00 26.31 ? 519  SER C CA  1 
ATOM   3282 C C   . SER C 1 125 ? 10.198  38.758 86.302  1.00 26.45 ? 519  SER C C   1 
ATOM   3283 O O   . SER C 1 125 ? 9.118   39.081 85.828  1.00 27.63 ? 519  SER C O   1 
ATOM   3284 C CB  . SER C 1 125 ? 9.598   37.914 88.604  1.00 27.67 ? 519  SER C CB  1 
ATOM   3285 O OG  . SER C 1 125 ? 10.272  38.939 89.309  1.00 31.40 ? 519  SER C OG  1 
ATOM   3286 N N   . ASP C 1 126 ? 11.322  39.391 86.012  1.00 25.55 ? 520  ASP C N   1 
ATOM   3287 C CA  . ASP C 1 126 ? 11.313  40.557 85.147  1.00 26.80 ? 520  ASP C CA  1 
ATOM   3288 C C   . ASP C 1 126 ? 12.181  40.341 83.911  1.00 24.77 ? 520  ASP C C   1 
ATOM   3289 O O   . ASP C 1 126 ? 13.291  39.877 83.995  1.00 24.64 ? 520  ASP C O   1 
ATOM   3290 C CB  . ASP C 1 126 ? 11.780  41.809 85.891  1.00 27.38 ? 520  ASP C CB  1 
ATOM   3291 C CG  . ASP C 1 126 ? 11.402  43.106 85.155  1.00 33.32 ? 520  ASP C CG  1 
ATOM   3292 O OD1 . ASP C 1 126 ? 10.210  43.522 85.239  1.00 38.16 ? 520  ASP C OD1 1 
ATOM   3293 O OD2 . ASP C 1 126 ? 12.289  43.727 84.506  1.00 36.36 ? 520  ASP C OD2 1 
ATOM   3294 N N   . ILE C 1 127 ? 11.685  40.746 82.761  1.00 23.80 ? 521  ILE C N   1 
ATOM   3295 C CA  . ILE C 1 127 ? 12.428  40.526 81.520  1.00 23.45 ? 521  ILE C CA  1 
ATOM   3296 C C   . ILE C 1 127 ? 13.787  41.246 81.399  1.00 23.44 ? 521  ILE C C   1 
ATOM   3297 O O   . ILE C 1 127 ? 14.706  40.768 80.693  1.00 23.79 ? 521  ILE C O   1 
ATOM   3298 C CB  . ILE C 1 127 ? 11.512  40.855 80.313  1.00 23.25 ? 521  ILE C CB  1 
ATOM   3299 C CG1 . ILE C 1 127 ? 12.128  40.340 78.998  1.00 24.48 ? 521  ILE C CG1 1 
ATOM   3300 C CG2 . ILE C 1 127 ? 11.199  42.325 80.245  1.00 22.58 ? 521  ILE C CG2 1 
ATOM   3301 C CD1 . ILE C 1 127 ? 12.053  38.834 78.827  1.00 21.39 ? 521  ILE C CD1 1 
ATOM   3302 N N   . GLU C 1 128 ? 13.923  42.398 82.058  1.00 24.28 ? 522  GLU C N   1 
ATOM   3303 C CA  . GLU C 1 128 ? 15.188  43.141 82.019  1.00 24.16 ? 522  GLU C CA  1 
ATOM   3304 C C   . GLU C 1 128 ? 16.245  42.313 82.732  1.00 23.59 ? 522  GLU C C   1 
ATOM   3305 O O   . GLU C 1 128 ? 17.418  42.353 82.354  1.00 23.05 ? 522  GLU C O   1 
ATOM   3306 C CB  . GLU C 1 128 ? 15.058  44.552 82.653  1.00 26.23 ? 522  GLU C CB  1 
ATOM   3307 C CG  . GLU C 1 128 ? 14.605  45.668 81.655  1.00 30.32 ? 522  GLU C CG  1 
ATOM   3308 C CD  . GLU C 1 128 ? 15.174  45.484 80.243  1.00 38.37 ? 522  GLU C CD  1 
ATOM   3309 O OE1 . GLU C 1 128 ? 16.428  45.653 80.044  1.00 39.66 ? 522  GLU C OE1 1 
ATOM   3310 O OE2 . GLU C 1 128 ? 14.364  45.142 79.332  1.00 40.11 ? 522  GLU C OE2 1 
ATOM   3311 N N   . GLU C 1 129 ? 15.840  41.498 83.714  1.00 21.84 ? 523  GLU C N   1 
ATOM   3312 C CA  . GLU C 1 129 ? 16.813  40.602 84.368  1.00 21.77 ? 523  GLU C CA  1 
ATOM   3313 C C   . GLU C 1 129 ? 17.239  39.472 83.415  1.00 21.52 ? 523  GLU C C   1 
ATOM   3314 O O   . GLU C 1 129 ? 18.394  39.098 83.382  1.00 20.26 ? 523  GLU C O   1 
ATOM   3315 C CB  . GLU C 1 129 ? 16.236  39.930 85.612  1.00 21.39 ? 523  GLU C CB  1 
ATOM   3316 C CG  . GLU C 1 129 ? 15.989  40.804 86.847  1.00 25.08 ? 523  GLU C CG  1 
ATOM   3317 C CD  . GLU C 1 129 ? 15.438  39.951 87.983  1.00 25.16 ? 523  GLU C CD  1 
ATOM   3318 O OE1 . GLU C 1 129 ? 16.167  39.033 88.463  1.00 26.29 ? 523  GLU C OE1 1 
ATOM   3319 O OE2 . GLU C 1 129 ? 14.235  40.122 88.339  1.00 33.59 ? 523  GLU C OE2 1 
ATOM   3320 N N   . TYR C 1 130 ? 16.284  38.890 82.686  1.00 19.85 ? 524  TYR C N   1 
ATOM   3321 C CA  . TYR C 1 130 ? 16.623  37.983 81.599  1.00 19.30 ? 524  TYR C CA  1 
ATOM   3322 C C   . TYR C 1 130 ? 17.687  38.539 80.623  1.00 19.34 ? 524  TYR C C   1 
ATOM   3323 O O   . TYR C 1 130 ? 18.692  37.849 80.263  1.00 19.57 ? 524  TYR C O   1 
ATOM   3324 C CB  . TYR C 1 130 ? 15.325  37.564 80.874  1.00 20.01 ? 524  TYR C CB  1 
ATOM   3325 C CG  . TYR C 1 130 ? 15.574  36.632 79.681  1.00 19.59 ? 524  TYR C CG  1 
ATOM   3326 C CD1 . TYR C 1 130 ? 15.541  35.262 79.833  1.00 21.06 ? 524  TYR C CD1 1 
ATOM   3327 C CD2 . TYR C 1 130 ? 15.788  37.151 78.418  1.00 21.43 ? 524  TYR C CD2 1 
ATOM   3328 C CE1 . TYR C 1 130 ? 15.766  34.402 78.725  1.00 18.36 ? 524  TYR C CE1 1 
ATOM   3329 C CE2 . TYR C 1 130 ? 15.994  36.333 77.318  1.00 18.92 ? 524  TYR C CE2 1 
ATOM   3330 C CZ  . TYR C 1 130 ? 15.962  34.966 77.474  1.00 19.55 ? 524  TYR C CZ  1 
ATOM   3331 O OH  . TYR C 1 130 ? 16.177  34.171 76.352  1.00 20.89 ? 524  TYR C OH  1 
ATOM   3332 N N   . VAL C 1 131 ? 17.480  39.778 80.181  1.00 19.08 ? 525  VAL C N   1 
ATOM   3333 C CA  . VAL C 1 131 ? 18.360  40.434 79.208  1.00 18.95 ? 525  VAL C CA  1 
ATOM   3334 C C   . VAL C 1 131 ? 19.791  40.425 79.700  1.00 19.03 ? 525  VAL C C   1 
ATOM   3335 O O   . VAL C 1 131 ? 20.678  40.045 78.965  1.00 18.33 ? 525  VAL C O   1 
ATOM   3336 C CB  . VAL C 1 131 ? 17.868  41.877 78.864  1.00 19.25 ? 525  VAL C CB  1 
ATOM   3337 C CG1 . VAL C 1 131 ? 18.879  42.676 77.928  1.00 21.16 ? 525  VAL C CG1 1 
ATOM   3338 C CG2 . VAL C 1 131 ? 16.489  41.800 78.252  1.00 20.74 ? 525  VAL C CG2 1 
ATOM   3339 N N   . HIS C 1 132 ? 20.019  40.911 80.915  1.00 18.62 ? 526  HIS C N   1 
ATOM   3340 C CA  . HIS C 1 132 ? 21.400  40.988 81.423  1.00 19.64 ? 526  HIS C CA  1 
ATOM   3341 C C   . HIS C 1 132 ? 21.967  39.636 81.773  1.00 20.08 ? 526  HIS C C   1 
ATOM   3342 O O   . HIS C 1 132 ? 23.164  39.472 81.633  1.00 19.93 ? 526  HIS C O   1 
ATOM   3343 C CB  . HIS C 1 132 ? 21.615  42.046 82.544  1.00 20.40 ? 526  HIS C CB  1 
ATOM   3344 C CG  . HIS C 1 132 ? 20.938  41.764 83.868  1.00 25.10 ? 526  HIS C CG  1 
ATOM   3345 N ND1 . HIS C 1 132 ? 21.222  40.665 84.656  1.00 27.84 ? 526  HIS C ND1 1 
ATOM   3346 C CD2 . HIS C 1 132 ? 20.077  42.526 84.593  1.00 29.80 ? 526  HIS C CD2 1 
ATOM   3347 C CE1 . HIS C 1 132 ? 20.530  40.735 85.779  1.00 33.14 ? 526  HIS C CE1 1 
ATOM   3348 N NE2 . HIS C 1 132 ? 19.827  41.857 85.772  1.00 33.08 ? 526  HIS C NE2 1 
ATOM   3349 N N   . ARG C 1 133 ? 21.129  38.655 82.177  1.00 17.35 ? 527  ARG C N   1 
ATOM   3350 C CA  . ARG C 1 133 ? 21.683  37.288 82.348  1.00 18.06 ? 527  ARG C CA  1 
ATOM   3351 C C   . ARG C 1 133 ? 22.238  36.700 81.056  1.00 16.30 ? 527  ARG C C   1 
ATOM   3352 O O   . ARG C 1 133 ? 23.377  36.251 81.006  1.00 14.82 ? 527  ARG C O   1 
ATOM   3353 C CB  . ARG C 1 133 ? 20.634  36.320 82.905  1.00 18.05 ? 527  ARG C CB  1 
ATOM   3354 C CG  . ARG C 1 133 ? 20.278  36.576 84.375  1.00 17.07 ? 527  ARG C CG  1 
ATOM   3355 C CD  . ARG C 1 133 ? 19.026  35.678 84.713  1.00 19.06 ? 527  ARG C CD  1 
ATOM   3356 N NE  . ARG C 1 133 ? 18.538  35.756 86.077  1.00 18.61 ? 527  ARG C NE  1 
ATOM   3357 C CZ  . ARG C 1 133 ? 17.760  34.803 86.612  1.00 19.08 ? 527  ARG C CZ  1 
ATOM   3358 N NH1 . ARG C 1 133 ? 17.428  33.751 85.883  1.00 16.97 ? 527  ARG C NH1 1 
ATOM   3359 N NH2 . ARG C 1 133 ? 17.301  34.895 87.836  1.00 22.18 ? 527  ARG C NH2 1 
ATOM   3360 N N   . ILE C 1 134 ? 21.446  36.759 79.983  1.00 16.92 ? 528  ILE C N   1 
ATOM   3361 C CA  . ILE C 1 134 ? 21.839  36.091 78.784  1.00 17.33 ? 528  ILE C CA  1 
ATOM   3362 C C   . ILE C 1 134 ? 22.902  36.885 78.083  1.00 18.68 ? 528  ILE C C   1 
ATOM   3363 O O   . ILE C 1 134 ? 23.609  36.329 77.271  1.00 18.35 ? 528  ILE C O   1 
ATOM   3364 C CB  . ILE C 1 134 ? 20.619  35.771 77.788  1.00 17.14 ? 528  ILE C CB  1 
ATOM   3365 C CG1 . ILE C 1 134 ? 20.076  37.067 77.175  1.00 17.29 ? 528  ILE C CG1 1 
ATOM   3366 C CG2 . ILE C 1 134 ? 19.485  34.945 78.519  1.00 16.17 ? 528  ILE C CG2 1 
ATOM   3367 C CD1 . ILE C 1 134 ? 19.363  36.894 75.837  1.00 16.49 ? 528  ILE C CD1 1 
ATOM   3368 N N   . GLY C 1 135 ? 23.069  38.167 78.419  1.00 17.59 ? 529  GLY C N   1 
ATOM   3369 C CA  . GLY C 1 135 ? 24.151  38.974 77.764  1.00 17.73 ? 529  GLY C CA  1 
ATOM   3370 C C   . GLY C 1 135 ? 25.548  38.565 78.196  1.00 17.50 ? 529  GLY C C   1 
ATOM   3371 O O   . GLY C 1 135 ? 26.534  38.904 77.536  1.00 18.62 ? 529  GLY C O   1 
ATOM   3372 N N   . ARG C 1 136 ? 25.630  37.740 79.239  1.00 17.28 ? 530  ARG C N   1 
ATOM   3373 C CA  . ARG C 1 136 ? 26.903  37.221 79.756  1.00 15.43 ? 530  ARG C CA  1 
ATOM   3374 C C   . ARG C 1 136 ? 27.483  36.065 78.936  1.00 15.42 ? 530  ARG C C   1 
ATOM   3375 O O   . ARG C 1 136 ? 28.577  35.581 79.270  1.00 16.13 ? 530  ARG C O   1 
ATOM   3376 C CB  . ARG C 1 136 ? 26.689  36.779 81.208  1.00 15.10 ? 530  ARG C CB  1 
ATOM   3377 C CG  . ARG C 1 136 ? 26.176  37.982 82.014  1.00 15.07 ? 530  ARG C CG  1 
ATOM   3378 C CD  . ARG C 1 136 ? 26.150  37.792 83.568  1.00 16.40 ? 530  ARG C CD  1 
ATOM   3379 N NE  . ARG C 1 136 ? 25.736  39.042 84.268  1.00 17.11 ? 530  ARG C NE  1 
ATOM   3380 C CZ  . ARG C 1 136 ? 26.578  40.034 84.571  1.00 16.51 ? 530  ARG C CZ  1 
ATOM   3381 N NH1 . ARG C 1 136 ? 27.859  39.955 84.221  1.00 13.17 ? 530  ARG C NH1 1 
ATOM   3382 N NH2 . ARG C 1 136 ? 26.158  41.140 85.185  1.00 14.47 ? 530  ARG C NH2 1 
ATOM   3383 N N   . THR C 1 137 ? 26.780  35.589 77.890  1.00 14.33 ? 531  THR C N   1 
ATOM   3384 C CA  . THR C 1 137 ? 27.379  34.549 76.983  1.00 15.28 ? 531  THR C CA  1 
ATOM   3385 C C   . THR C 1 137 ? 27.665  35.196 75.657  1.00 16.11 ? 531  THR C C   1 
ATOM   3386 O O   . THR C 1 137 ? 26.894  36.090 75.246  1.00 17.73 ? 531  THR C O   1 
ATOM   3387 C CB  . THR C 1 137 ? 26.515  33.261 76.772  1.00 15.10 ? 531  THR C CB  1 
ATOM   3388 O OG1 . THR C 1 137 ? 27.110  32.425 75.767  1.00 16.40 ? 531  THR C OG1 1 
ATOM   3389 C CG2 . THR C 1 137 ? 25.072  33.642 76.332  1.00 14.21 ? 531  THR C CG2 1 
ATOM   3390 N N   . GLY C 1 138 ? 28.731  34.745 74.993  1.00 17.45 ? 532  GLY C N   1 
ATOM   3391 C CA  . GLY C 1 138 ? 29.108  35.263 73.654  1.00 17.29 ? 532  GLY C CA  1 
ATOM   3392 C C   . GLY C 1 138 ? 30.050  36.462 73.730  1.00 19.00 ? 532  GLY C C   1 
ATOM   3393 O O   . GLY C 1 138 ? 30.241  37.103 74.791  1.00 18.28 ? 532  GLY C O   1 
ATOM   3394 N N   . ARG C 1 139 ? 30.669  36.735 72.589  1.00 19.09 ? 533  ARG C N   1 
ATOM   3395 C CA  . ARG C 1 139 ? 31.788  37.681 72.425  1.00 20.99 ? 533  ARG C CA  1 
ATOM   3396 C C   . ARG C 1 139 ? 31.643  38.219 71.000  1.00 19.65 ? 533  ARG C C   1 
ATOM   3397 O O   . ARG C 1 139 ? 30.842  37.715 70.207  1.00 18.37 ? 533  ARG C O   1 
ATOM   3398 C CB  . ARG C 1 139 ? 33.082  36.894 72.675  1.00 21.18 ? 533  ARG C CB  1 
ATOM   3399 C CG  . ARG C 1 139 ? 34.288  37.112 71.919  1.00 27.50 ? 533  ARG C CG  1 
ATOM   3400 C CD  . ARG C 1 139 ? 35.329  36.199 72.607  1.00 34.21 ? 533  ARG C CD  1 
ATOM   3401 N NE  . ARG C 1 139 ? 36.724  36.589 72.398  1.00 41.47 ? 533  ARG C NE  1 
ATOM   3402 C CZ  . ARG C 1 139 ? 37.376  37.513 73.105  1.00 42.46 ? 533  ARG C CZ  1 
ATOM   3403 N NH1 . ARG C 1 139 ? 36.747  38.208 74.060  1.00 42.01 ? 533  ARG C NH1 1 
ATOM   3404 N NH2 . ARG C 1 139 ? 38.659  37.761 72.815  1.00 44.97 ? 533  ARG C NH2 1 
ATOM   3405 N N   . VAL C 1 140 ? 32.356  39.289 70.683  1.00 19.02 ? 534  VAL C N   1 
ATOM   3406 C CA  . VAL C 1 140 ? 32.159  39.874 69.378  1.00 17.98 ? 534  VAL C CA  1 
ATOM   3407 C C   . VAL C 1 140 ? 32.619  38.842 68.357  1.00 16.26 ? 534  VAL C C   1 
ATOM   3408 O O   . VAL C 1 140 ? 33.698  38.286 68.455  1.00 15.99 ? 534  VAL C O   1 
ATOM   3409 C CB  . VAL C 1 140 ? 32.913  41.233 69.208  1.00 16.97 ? 534  VAL C CB  1 
ATOM   3410 C CG1 . VAL C 1 140 ? 32.954  41.612 67.791  1.00 18.57 ? 534  VAL C CG1 1 
ATOM   3411 C CG2 . VAL C 1 140 ? 32.194  42.347 69.954  1.00 21.48 ? 534  VAL C CG2 1 
ATOM   3412 N N   . GLY C 1 141 ? 31.817  38.609 67.337  1.00 16.31 ? 535  GLY C N   1 
ATOM   3413 C CA  . GLY C 1 141 ? 32.277  37.710 66.284  1.00 16.05 ? 535  GLY C CA  1 
ATOM   3414 C C   . GLY C 1 141 ? 31.953  36.247 66.575  1.00 16.39 ? 535  GLY C C   1 
ATOM   3415 O O   . GLY C 1 141 ? 32.296  35.375 65.764  1.00 14.98 ? 535  GLY C O   1 
ATOM   3416 N N   . ASN C 1 142 ? 31.312  35.967 67.711  1.00 17.44 ? 536  ASN C N   1 
ATOM   3417 C CA  . ASN C 1 142 ? 30.954  34.581 68.122  1.00 19.07 ? 536  ASN C CA  1 
ATOM   3418 C C   . ASN C 1 142 ? 29.425  34.593 68.412  1.00 19.40 ? 536  ASN C C   1 
ATOM   3419 O O   . ASN C 1 142 ? 28.793  35.674 68.440  1.00 18.59 ? 536  ASN C O   1 
ATOM   3420 C CB  . ASN C 1 142 ? 31.666  34.139 69.438  1.00 21.79 ? 536  ASN C CB  1 
ATOM   3421 C CG  . ASN C 1 142 ? 33.197  33.856 69.305  1.00 27.75 ? 536  ASN C CG  1 
ATOM   3422 O OD1 . ASN C 1 142 ? 33.876  33.569 70.335  1.00 31.94 ? 536  ASN C OD1 1 
ATOM   3423 N ND2 . ASN C 1 142 ? 33.738  33.906 68.098  1.00 28.22 ? 536  ASN C ND2 1 
ATOM   3424 N N   . LEU C 1 143 ? 28.797  33.418 68.540  1.00 18.02 ? 537  LEU C N   1 
ATOM   3425 C CA  . LEU C 1 143 ? 27.408  33.348 69.072  1.00 19.25 ? 537  LEU C CA  1 
ATOM   3426 C C   . LEU C 1 143 ? 27.471  32.887 70.490  1.00 17.83 ? 537  LEU C C   1 
ATOM   3427 O O   . LEU C 1 143 ? 28.253  32.002 70.789  1.00 16.27 ? 537  LEU C O   1 
ATOM   3428 C CB  . LEU C 1 143 ? 26.512  32.383 68.290  1.00 19.08 ? 537  LEU C CB  1 
ATOM   3429 C CG  . LEU C 1 143 ? 26.316  32.820 66.835  1.00 25.04 ? 537  LEU C CG  1 
ATOM   3430 C CD1 . LEU C 1 143 ? 25.961  31.635 65.951  1.00 24.76 ? 537  LEU C CD1 1 
ATOM   3431 C CD2 . LEU C 1 143 ? 25.195  33.871 66.835  1.00 23.63 ? 537  LEU C CD2 1 
ATOM   3432 N N   . GLY C 1 144 ? 26.644  33.490 71.329  1.00 17.28 ? 538  GLY C N   1 
ATOM   3433 C CA  . GLY C 1 144 ? 26.402  33.004 72.687  1.00 17.34 ? 538  GLY C CA  1 
ATOM   3434 C C   . GLY C 1 144 ? 25.318  31.931 72.670  1.00 16.68 ? 538  GLY C C   1 
ATOM   3435 O O   . GLY C 1 144 ? 24.685  31.690 71.630  1.00 15.73 ? 538  GLY C O   1 
ATOM   3436 N N   . LEU C 1 145 ? 25.125  31.276 73.808  1.00 17.58 ? 539  LEU C N   1 
ATOM   3437 C CA  . LEU C 1 145 ? 24.093  30.252 73.960  1.00 15.08 ? 539  LEU C CA  1 
ATOM   3438 C C   . LEU C 1 145 ? 23.454  30.445 75.316  1.00 18.51 ? 539  LEU C C   1 
ATOM   3439 O O   . LEU C 1 145 ? 24.119  30.386 76.365  1.00 17.53 ? 539  LEU C O   1 
ATOM   3440 C CB  . LEU C 1 145 ? 24.681  28.817 73.788  1.00 15.59 ? 539  LEU C CB  1 
ATOM   3441 C CG  . LEU C 1 145 ? 23.647  27.708 74.094  1.00 15.17 ? 539  LEU C CG  1 
ATOM   3442 C CD1 . LEU C 1 145 ? 22.492  27.790 73.081  1.00 21.38 ? 539  LEU C CD1 1 
ATOM   3443 C CD2 . LEU C 1 145 ? 24.285  26.273 74.060  1.00 19.67 ? 539  LEU C CD2 1 
ATOM   3444 N N   . ALA C 1 146 ? 22.130  30.686 75.292  1.00 16.45 ? 540  ALA C N   1 
ATOM   3445 C CA  . ALA C 1 146 ? 21.381  30.760 76.509  1.00 17.08 ? 540  ALA C CA  1 
ATOM   3446 C C   . ALA C 1 146 ? 20.184  29.834 76.467  1.00 18.01 ? 540  ALA C C   1 
ATOM   3447 O O   . ALA C 1 146 ? 19.213  30.012 75.675  1.00 19.55 ? 540  ALA C O   1 
ATOM   3448 C CB  . ALA C 1 146 ? 20.886  32.168 76.710  1.00 16.65 ? 540  ALA C CB  1 
ATOM   3449 N N   . THR C 1 147 ? 20.183  28.887 77.385  1.00 18.29 ? 541  THR C N   1 
ATOM   3450 C CA  . THR C 1 147 ? 19.059  27.956 77.471  1.00 17.02 ? 541  THR C CA  1 
ATOM   3451 C C   . THR C 1 147 ? 18.272  28.280 78.729  1.00 16.14 ? 541  THR C C   1 
ATOM   3452 O O   . THR C 1 147 ? 18.851  28.492 79.818  1.00 17.36 ? 541  THR C O   1 
ATOM   3453 C CB  . THR C 1 147 ? 19.565  26.534 77.614  1.00 16.55 ? 541  THR C CB  1 
ATOM   3454 O OG1 . THR C 1 147 ? 20.388  26.235 76.496  1.00 19.94 ? 541  THR C OG1 1 
ATOM   3455 C CG2 . THR C 1 147 ? 18.365  25.485 77.613  1.00 15.48 ? 541  THR C CG2 1 
ATOM   3456 N N   . SER C 1 148 ? 16.950  28.262 78.618  1.00 16.90 ? 542  SER C N   1 
ATOM   3457 C CA  . SER C 1 148 ? 16.114  28.655 79.758  1.00 17.21 ? 542  SER C CA  1 
ATOM   3458 C C   . SER C 1 148 ? 15.006  27.626 79.937  1.00 17.86 ? 542  SER C C   1 
ATOM   3459 O O   . SER C 1 148 ? 14.417  27.170 78.964  1.00 18.76 ? 542  SER C O   1 
ATOM   3460 C CB  . SER C 1 148 ? 15.425  30.012 79.515  1.00 18.20 ? 542  SER C CB  1 
ATOM   3461 O OG  . SER C 1 148 ? 16.363  31.060 79.396  1.00 19.31 ? 542  SER C OG  1 
ATOM   3462 N N   . PHE C 1 149 ? 14.695  27.321 81.187  1.00 18.61 ? 543  PHE C N   1 
ATOM   3463 C CA  . PHE C 1 149 ? 13.700  26.298 81.545  1.00 18.81 ? 543  PHE C CA  1 
ATOM   3464 C C   . PHE C 1 149 ? 12.496  27.072 81.986  1.00 17.64 ? 543  PHE C C   1 
ATOM   3465 O O   . PHE C 1 149 ? 12.583  27.944 82.879  1.00 19.43 ? 543  PHE C O   1 
ATOM   3466 C CB  . PHE C 1 149 ? 14.148  25.495 82.760  1.00 17.84 ? 543  PHE C CB  1 
ATOM   3467 C CG  . PHE C 1 149 ? 15.431  24.704 82.566  1.00 19.76 ? 543  PHE C CG  1 
ATOM   3468 C CD1 . PHE C 1 149 ? 16.002  24.504 81.292  1.00 19.64 ? 543  PHE C CD1 1 
ATOM   3469 C CD2 . PHE C 1 149 ? 15.989  24.072 83.675  1.00 20.59 ? 543  PHE C CD2 1 
ATOM   3470 C CE1 . PHE C 1 149 ? 17.170  23.751 81.152  1.00 23.29 ? 543  PHE C CE1 1 
ATOM   3471 C CE2 . PHE C 1 149 ? 17.130  23.310 83.560  1.00 18.68 ? 543  PHE C CE2 1 
ATOM   3472 C CZ  . PHE C 1 149 ? 17.728  23.148 82.304  1.00 20.72 ? 543  PHE C CZ  1 
ATOM   3473 N N   . PHE C 1 150 ? 11.365  26.743 81.383  1.00 17.88 ? 544  PHE C N   1 
ATOM   3474 C CA  . PHE C 1 150 ? 10.139  27.492 81.634  1.00 19.04 ? 544  PHE C CA  1 
ATOM   3475 C C   . PHE C 1 150 ? 9.027   26.584 82.123  1.00 17.14 ? 544  PHE C C   1 
ATOM   3476 O O   . PHE C 1 150 ? 8.835   25.516 81.598  1.00 17.38 ? 544  PHE C O   1 
ATOM   3477 C CB  . PHE C 1 150 ? 9.780   28.209 80.310  1.00 17.13 ? 544  PHE C CB  1 
ATOM   3478 C CG  . PHE C 1 150 ? 8.626   29.182 80.406  1.00 19.18 ? 544  PHE C CG  1 
ATOM   3479 C CD1 . PHE C 1 150 ? 8.796   30.530 80.074  1.00 20.61 ? 544  PHE C CD1 1 
ATOM   3480 C CD2 . PHE C 1 150 ? 7.351   28.734 80.694  1.00 16.39 ? 544  PHE C CD2 1 
ATOM   3481 C CE1 . PHE C 1 150 ? 7.683   31.418 80.119  1.00 16.02 ? 544  PHE C CE1 1 
ATOM   3482 C CE2 . PHE C 1 150 ? 6.234   29.618 80.781  1.00 19.62 ? 544  PHE C CE2 1 
ATOM   3483 C CZ  . PHE C 1 150 ? 6.408   30.948 80.473  1.00 20.45 ? 544  PHE C CZ  1 
ATOM   3484 N N   . ASN C 1 151 ? 8.220   27.017 83.101  1.00 18.26 ? 545  ASN C N   1 
ATOM   3485 C CA  . ASN C 1 151 ? 7.005   26.312 83.366  1.00 17.41 ? 545  ASN C CA  1 
ATOM   3486 C C   . ASN C 1 151 ? 5.900   27.285 83.885  1.00 18.13 ? 545  ASN C C   1 
ATOM   3487 O O   . ASN C 1 151 ? 5.987   28.475 83.636  1.00 15.86 ? 545  ASN C O   1 
ATOM   3488 C CB  . ASN C 1 151 ? 7.206   25.087 84.286  1.00 17.83 ? 545  ASN C CB  1 
ATOM   3489 C CG  . ASN C 1 151 ? 7.780   25.451 85.613  1.00 20.99 ? 545  ASN C CG  1 
ATOM   3490 O OD1 . ASN C 1 151 ? 7.274   26.364 86.276  1.00 20.02 ? 545  ASN C OD1 1 
ATOM   3491 N ND2 . ASN C 1 151 ? 8.859   24.757 86.019  1.00 17.04 ? 545  ASN C ND2 1 
ATOM   3492 N N   . GLU C 1 152 ? 4.852   26.760 84.494  1.00 18.35 ? 546  GLU C N   1 
ATOM   3493 C CA  . GLU C 1 152 ? 3.702   27.616 84.856  1.00 20.42 ? 546  GLU C CA  1 
ATOM   3494 C C   . GLU C 1 152 ? 4.114   28.694 85.875  1.00 19.85 ? 546  GLU C C   1 
ATOM   3495 O O   . GLU C 1 152 ? 3.451   29.742 86.002  1.00 17.70 ? 546  GLU C O   1 
ATOM   3496 C CB  . GLU C 1 152 ? 2.490   26.805 85.410  1.00 22.47 ? 546  GLU C CB  1 
ATOM   3497 C CG  . GLU C 1 152 ? 1.971   25.623 84.485  1.00 28.41 ? 546  GLU C CG  1 
ATOM   3498 C CD  . GLU C 1 152 ? 0.978   25.995 83.336  1.00 34.01 ? 546  GLU C CD  1 
ATOM   3499 O OE1 . GLU C 1 152 ? 0.924   27.179 82.916  1.00 36.54 ? 546  GLU C OE1 1 
ATOM   3500 O OE2 . GLU C 1 152 ? 0.249   25.069 82.843  1.00 33.73 ? 546  GLU C OE2 1 
ATOM   3501 N N   . ARG C 1 153 ? 5.185   28.422 86.617  1.00 18.79 ? 547  ARG C N   1 
ATOM   3502 C CA  . ARG C 1 153 ? 5.709   29.384 87.577  1.00 22.65 ? 547  ARG C CA  1 
ATOM   3503 C C   . ARG C 1 153 ? 6.039   30.698 86.866  1.00 21.11 ? 547  ARG C C   1 
ATOM   3504 O O   . ARG C 1 153 ? 6.119   31.748 87.503  1.00 21.32 ? 547  ARG C O   1 
ATOM   3505 C CB  . ARG C 1 153 ? 6.981   28.807 88.273  1.00 23.59 ? 547  ARG C CB  1 
ATOM   3506 C CG  . ARG C 1 153 ? 6.625   27.681 89.339  1.00 28.33 ? 547  ARG C CG  1 
ATOM   3507 C CD  . ARG C 1 153 ? 7.724   27.451 90.423  1.00 27.47 ? 547  ARG C CD  1 
ATOM   3508 N NE  . ARG C 1 153 ? 7.471   26.223 91.189  1.00 33.15 ? 547  ARG C NE  1 
ATOM   3509 C CZ  . ARG C 1 153 ? 6.663   26.094 92.250  1.00 41.63 ? 547  ARG C CZ  1 
ATOM   3510 N NH1 . ARG C 1 153 ? 5.984   27.137 92.763  1.00 39.95 ? 547  ARG C NH1 1 
ATOM   3511 N NH2 . ARG C 1 153 ? 6.523   24.884 92.813  1.00 42.72 ? 547  ARG C NH2 1 
ATOM   3512 N N   . ASN C 1 154 ? 6.234   30.616 85.547  1.00 19.04 ? 548  ASN C N   1 
ATOM   3513 C CA  . ASN C 1 154 ? 6.828   31.709 84.743  1.00 18.43 ? 548  ASN C CA  1 
ATOM   3514 C C   . ASN C 1 154 ? 5.774   32.417 83.908  1.00 18.74 ? 548  ASN C C   1 
ATOM   3515 O O   . ASN C 1 154 ? 6.116   33.167 83.033  1.00 17.51 ? 548  ASN C O   1 
ATOM   3516 C CB  . ASN C 1 154 ? 7.991   31.173 83.867  1.00 19.13 ? 548  ASN C CB  1 
ATOM   3517 C CG  . ASN C 1 154 ? 9.054   30.494 84.696  1.00 18.29 ? 548  ASN C CG  1 
ATOM   3518 O OD1 . ASN C 1 154 ? 9.263   29.279 84.595  1.00 15.82 ? 548  ASN C OD1 1 
ATOM   3519 N ND2 . ASN C 1 154 ? 9.598   31.230 85.643  1.00 17.50 ? 548  ASN C ND2 1 
ATOM   3520 N N   . ILE C 1 155 ? 4.477   32.190 84.210  1.00 18.22 ? 549  ILE C N   1 
ATOM   3521 C CA  . ILE C 1 155 ? 3.396   32.738 83.395  1.00 20.57 ? 549  ILE C CA  1 
ATOM   3522 C C   . ILE C 1 155 ? 3.493   34.266 83.274  1.00 20.86 ? 549  ILE C C   1 
ATOM   3523 O O   . ILE C 1 155 ? 3.184   34.848 82.202  1.00 19.38 ? 549  ILE C O   1 
ATOM   3524 C CB  . ILE C 1 155 ? 1.986   32.421 83.981  1.00 21.46 ? 549  ILE C CB  1 
ATOM   3525 C CG1 . ILE C 1 155 ? 1.696   30.910 83.867  1.00 22.89 ? 549  ILE C CG1 1 
ATOM   3526 C CG2 . ILE C 1 155 ? 0.939   33.259 83.263  1.00 21.78 ? 549  ILE C CG2 1 
ATOM   3527 C CD1 . ILE C 1 155 ? 0.406   30.398 84.701  1.00 23.45 ? 549  ILE C CD1 1 
ATOM   3528 N N   . ASN C 1 156 ? 3.967   34.878 84.363  1.00 20.87 ? 550  ASN C N   1 
ATOM   3529 C CA  . ASN C 1 156 ? 4.120   36.343 84.473  1.00 23.65 ? 550  ASN C CA  1 
ATOM   3530 C C   . ASN C 1 156 ? 5.061   36.951 83.387  1.00 22.54 ? 550  ASN C C   1 
ATOM   3531 O O   . ASN C 1 156 ? 4.871   38.085 82.933  1.00 23.23 ? 550  ASN C O   1 
ATOM   3532 C CB  . ASN C 1 156 ? 4.561   36.744 85.914  1.00 23.13 ? 550  ASN C CB  1 
ATOM   3533 C CG  . ASN C 1 156 ? 5.933   36.074 86.376  1.00 29.74 ? 550  ASN C CG  1 
ATOM   3534 O OD1 . ASN C 1 156 ? 6.633   35.363 85.613  1.00 29.78 ? 550  ASN C OD1 1 
ATOM   3535 N ND2 . ASN C 1 156 ? 6.303   36.314 87.654  1.00 32.07 ? 550  ASN C ND2 1 
ATOM   3536 N N   . ILE C 1 157 ? 6.035   36.185 82.941  1.00 22.30 ? 551  ILE C N   1 
ATOM   3537 C CA  . ILE C 1 157 ? 7.003   36.686 81.942  1.00 21.36 ? 551  ILE C CA  1 
ATOM   3538 C C   . ILE C 1 157 ? 6.652   36.244 80.477  1.00 20.72 ? 551  ILE C C   1 
ATOM   3539 O O   . ILE C 1 157 ? 7.347   36.606 79.547  1.00 19.00 ? 551  ILE C O   1 
ATOM   3540 C CB  . ILE C 1 157 ? 8.462   36.270 82.331  1.00 22.75 ? 551  ILE C CB  1 
ATOM   3541 C CG1 . ILE C 1 157 ? 9.514   37.320 81.935  1.00 23.14 ? 551  ILE C CG1 1 
ATOM   3542 C CG2 . ILE C 1 157 ? 8.898   34.892 81.751  1.00 19.32 ? 551  ILE C CG2 1 
ATOM   3543 C CD1 . ILE C 1 157 ? 11.005  36.780 82.026  1.00 23.71 ? 551  ILE C CD1 1 
ATOM   3544 N N   . THR C 1 158 ? 5.566   35.488 80.298  1.00 20.22 ? 552  THR C N   1 
ATOM   3545 C CA  . THR C 1 158 ? 5.198   34.939 78.997  1.00 20.21 ? 552  THR C CA  1 
ATOM   3546 C C   . THR C 1 158 ? 5.278   35.991 77.857  1.00 20.83 ? 552  THR C C   1 
ATOM   3547 O O   . THR C 1 158 ? 6.035   35.830 76.894  1.00 18.69 ? 552  THR C O   1 
ATOM   3548 C CB  . THR C 1 158 ? 3.771   34.351 79.061  1.00 21.62 ? 552  THR C CB  1 
ATOM   3549 O OG1 . THR C 1 158 ? 3.713   33.352 80.091  1.00 20.57 ? 552  THR C OG1 1 
ATOM   3550 C CG2 . THR C 1 158 ? 3.357   33.743 77.734  1.00 21.91 ? 552  THR C CG2 1 
ATOM   3551 N N   . LYS C 1 159 ? 4.497   37.061 77.957  1.00 20.09 ? 553  LYS C N   1 
ATOM   3552 C CA  . LYS C 1 159 ? 4.396   38.004 76.838  1.00 21.21 ? 553  LYS C CA  1 
ATOM   3553 C C   . LYS C 1 159 ? 5.703   38.756 76.543  1.00 20.63 ? 553  LYS C C   1 
ATOM   3554 O O   . LYS C 1 159 ? 6.094   38.916 75.375  1.00 18.68 ? 553  LYS C O   1 
ATOM   3555 C CB  . LYS C 1 159 ? 3.187   38.955 76.985  1.00 22.23 ? 553  LYS C CB  1 
ATOM   3556 C CG  . LYS C 1 159 ? 3.076   40.037 75.862  1.00 24.76 ? 553  LYS C CG  1 
ATOM   3557 C CD  . LYS C 1 159 ? 3.209   39.510 74.377  1.00 28.53 ? 553  LYS C CD  1 
ATOM   3558 C CE  . LYS C 1 159 ? 2.455   40.471 73.412  1.00 30.41 ? 553  LYS C CE  1 
ATOM   3559 N NZ  . LYS C 1 159 ? 2.225   39.913 72.018  1.00 31.72 ? 553  LYS C NZ  1 
ATOM   3560 N N   . ASP C 1 160 ? 6.369   39.215 77.609  1.00 19.77 ? 554  ASP C N   1 
ATOM   3561 C CA  . ASP C 1 160 ? 7.624   39.931 77.485  1.00 19.33 ? 554  ASP C CA  1 
ATOM   3562 C C   . ASP C 1 160 ? 8.684   39.048 76.872  1.00 18.33 ? 554  ASP C C   1 
ATOM   3563 O O   . ASP C 1 160 ? 9.429   39.523 76.014  1.00 18.87 ? 554  ASP C O   1 
ATOM   3564 C CB  . ASP C 1 160 ? 8.093   40.461 78.841  1.00 18.23 ? 554  ASP C CB  1 
ATOM   3565 C CG  . ASP C 1 160 ? 7.255   41.668 79.314  1.00 23.32 ? 554  ASP C CG  1 
ATOM   3566 O OD1 . ASP C 1 160 ? 6.423   42.201 78.538  1.00 21.81 ? 554  ASP C OD1 1 
ATOM   3567 O OD2 . ASP C 1 160 ? 7.443   42.061 80.471  1.00 21.50 ? 554  ASP C OD2 1 
ATOM   3568 N N   . LEU C 1 161 ? 8.742   37.778 77.264  1.00 17.47 ? 555  LEU C N   1 
ATOM   3569 C CA  . LEU C 1 161 ? 9.748   36.839 76.705  1.00 17.83 ? 555  LEU C CA  1 
ATOM   3570 C C   . LEU C 1 161 ? 9.484   36.588 75.232  1.00 18.92 ? 555  LEU C C   1 
ATOM   3571 O O   . LEU C 1 161 ? 10.384  36.600 74.452  1.00 17.69 ? 555  LEU C O   1 
ATOM   3572 C CB  . LEU C 1 161 ? 9.798   35.501 77.429  1.00 16.77 ? 555  LEU C CB  1 
ATOM   3573 C CG  . LEU C 1 161 ? 10.837  34.409 77.000  1.00 18.19 ? 555  LEU C CG  1 
ATOM   3574 C CD1 . LEU C 1 161 ? 12.246  34.931 77.102  1.00 14.62 ? 555  LEU C CD1 1 
ATOM   3575 C CD2 . LEU C 1 161 ? 10.649  33.142 77.930  1.00 18.10 ? 555  LEU C CD2 1 
ATOM   3576 N N   . LEU C 1 162 ? 8.224   36.340 74.889  1.00 18.55 ? 556  LEU C N   1 
ATOM   3577 C CA  . LEU C 1 162 ? 7.835   36.157 73.478  1.00 17.09 ? 556  LEU C CA  1 
ATOM   3578 C C   . LEU C 1 162 ? 8.241   37.358 72.637  1.00 16.88 ? 556  LEU C C   1 
ATOM   3579 O O   . LEU C 1 162 ? 8.800   37.190 71.579  1.00 15.87 ? 556  LEU C O   1 
ATOM   3580 C CB  . LEU C 1 162 ? 6.313   35.941 73.374  1.00 15.96 ? 556  LEU C CB  1 
ATOM   3581 C CG  . LEU C 1 162 ? 5.745   35.763 71.936  1.00 13.08 ? 556  LEU C CG  1 
ATOM   3582 C CD1 . LEU C 1 162 ? 6.434   34.613 71.277  1.00 17.36 ? 556  LEU C CD1 1 
ATOM   3583 C CD2 . LEU C 1 162 ? 4.245   35.507 72.037  1.00 16.82 ? 556  LEU C CD2 1 
ATOM   3584 N N   . ASP C 1 163 ? 7.884   38.563 73.080  1.00 18.11 ? 557  ASP C N   1 
ATOM   3585 C CA  . ASP C 1 163 ? 8.201   39.791 72.349  1.00 18.18 ? 557  ASP C CA  1 
ATOM   3586 C C   . ASP C 1 163 ? 9.709   39.869 72.131  1.00 18.20 ? 557  ASP C C   1 
ATOM   3587 O O   . ASP C 1 163 ? 10.147  40.266 71.057  1.00 16.69 ? 557  ASP C O   1 
ATOM   3588 C CB  . ASP C 1 163 ? 7.706   41.057 73.090  1.00 18.56 ? 557  ASP C CB  1 
ATOM   3589 C CG  . ASP C 1 163 ? 6.163   41.286 72.945  1.00 23.83 ? 557  ASP C CG  1 
ATOM   3590 O OD1 . ASP C 1 163 ? 5.476   40.514 72.222  1.00 27.31 ? 557  ASP C OD1 1 
ATOM   3591 O OD2 . ASP C 1 163 ? 5.648   42.277 73.523  1.00 24.05 ? 557  ASP C OD2 1 
ATOM   3592 N N   . LEU C 1 164 ? 10.494  39.477 73.130  1.00 18.23 ? 558  LEU C N   1 
ATOM   3593 C CA  . LEU C 1 164 ? 11.959  39.504 72.995  1.00 20.51 ? 558  LEU C CA  1 
ATOM   3594 C C   . LEU C 1 164 ? 12.479  38.489 71.953  1.00 20.65 ? 558  LEU C C   1 
ATOM   3595 O O   . LEU C 1 164 ? 13.347  38.826 71.128  1.00 22.13 ? 558  LEU C O   1 
ATOM   3596 C CB  . LEU C 1 164 ? 12.624  39.243 74.367  1.00 20.44 ? 558  LEU C CB  1 
ATOM   3597 C CG  . LEU C 1 164 ? 14.145  39.380 74.411  1.00 23.42 ? 558  LEU C CG  1 
ATOM   3598 C CD1 . LEU C 1 164 ? 14.632  39.722 75.789  1.00 25.55 ? 558  LEU C CD1 1 
ATOM   3599 C CD2 . LEU C 1 164 ? 14.785  38.068 73.994  1.00 20.91 ? 558  LEU C CD2 1 
ATOM   3600 N N   . LEU C 1 165 ? 11.979  37.253 72.024  1.00 19.46 ? 559  LEU C N   1 
ATOM   3601 C CA  . LEU C 1 165 ? 12.414  36.192 71.099  1.00 19.20 ? 559  LEU C CA  1 
ATOM   3602 C C   . LEU C 1 165 ? 12.065  36.617 69.671  1.00 20.15 ? 559  LEU C C   1 
ATOM   3603 O O   . LEU C 1 165 ? 12.837  36.452 68.737  1.00 19.79 ? 559  LEU C O   1 
ATOM   3604 C CB  . LEU C 1 165 ? 11.711  34.855 71.424  1.00 17.38 ? 559  LEU C CB  1 
ATOM   3605 C CG  . LEU C 1 165 ? 12.190  34.182 72.742  1.00 17.79 ? 559  LEU C CG  1 
ATOM   3606 C CD1 . LEU C 1 165 ? 11.357  32.890 73.052  1.00 14.49 ? 559  LEU C CD1 1 
ATOM   3607 C CD2 . LEU C 1 165 ? 13.744  33.902 72.763  1.00 15.31 ? 559  LEU C CD2 1 
ATOM   3608 N N   . VAL C 1 166 ? 10.866  37.155 69.501  1.00 18.30 ? 560  VAL C N   1 
ATOM   3609 C CA  . VAL C 1 166 ? 10.442  37.636 68.178  1.00 19.31 ? 560  VAL C CA  1 
ATOM   3610 C C   . VAL C 1 166 ? 11.378  38.753 67.699  1.00 19.73 ? 560  VAL C C   1 
ATOM   3611 O O   . VAL C 1 166 ? 11.856  38.726 66.525  1.00 18.89 ? 560  VAL C O   1 
ATOM   3612 C CB  . VAL C 1 166 ? 8.937   38.053 68.150  1.00 18.06 ? 560  VAL C CB  1 
ATOM   3613 C CG1 . VAL C 1 166 ? 8.542   38.713 66.806  1.00 18.74 ? 560  VAL C CG1 1 
ATOM   3614 C CG2 . VAL C 1 166 ? 8.056   36.820 68.373  1.00 19.19 ? 560  VAL C CG2 1 
ATOM   3615 N N   . GLU C 1 167 ? 11.665  39.707 68.577  1.00 19.96 ? 561  GLU C N   1 
ATOM   3616 C CA  . GLU C 1 167 ? 12.459  40.862 68.160  1.00 23.65 ? 561  GLU C CA  1 
ATOM   3617 C C   . GLU C 1 167 ? 13.903  40.456 67.825  1.00 23.35 ? 561  GLU C C   1 
ATOM   3618 O O   . GLU C 1 167 ? 14.508  41.083 66.945  1.00 23.26 ? 561  GLU C O   1 
ATOM   3619 C CB  . GLU C 1 167 ? 12.473  41.972 69.221  1.00 25.30 ? 561  GLU C CB  1 
ATOM   3620 C CG  . GLU C 1 167 ? 13.588  43.015 68.987  1.00 31.82 ? 561  GLU C CG  1 
ATOM   3621 C CD  . GLU C 1 167 ? 13.183  44.471 69.278  1.00 38.97 ? 561  GLU C CD  1 
ATOM   3622 O OE1 . GLU C 1 167 ? 12.779  44.781 70.434  1.00 39.74 ? 561  GLU C OE1 1 
ATOM   3623 O OE2 . GLU C 1 167 ? 13.322  45.317 68.345  1.00 42.12 ? 561  GLU C OE2 1 
ATOM   3624 N N   . ALA C 1 168 ? 14.427  39.423 68.502  1.00 23.24 ? 562  ALA C N   1 
ATOM   3625 C CA  . ALA C 1 168 ? 15.793  38.897 68.241  1.00 22.55 ? 562  ALA C CA  1 
ATOM   3626 C C   . ALA C 1 168 ? 15.859  37.793 67.157  1.00 23.10 ? 562  ALA C C   1 
ATOM   3627 O O   . ALA C 1 168 ? 16.921  37.182 66.934  1.00 21.98 ? 562  ALA C O   1 
ATOM   3628 C CB  . ALA C 1 168 ? 16.431  38.422 69.553  1.00 24.26 ? 562  ALA C CB  1 
ATOM   3629 N N   . LYS C 1 169 ? 14.731  37.562 66.476  1.00 21.43 ? 563  LYS C N   1 
ATOM   3630 C CA  . LYS C 1 169 ? 14.565  36.499 65.461  1.00 21.76 ? 563  LYS C CA  1 
ATOM   3631 C C   . LYS C 1 169 ? 14.905  35.069 65.957  1.00 20.21 ? 563  LYS C C   1 
ATOM   3632 O O   . LYS C 1 169 ? 15.507  34.268 65.234  1.00 20.13 ? 563  LYS C O   1 
ATOM   3633 C CB  . LYS C 1 169 ? 15.342  36.864 64.163  1.00 21.42 ? 563  LYS C CB  1 
ATOM   3634 C CG  . LYS C 1 169 ? 15.067  38.314 63.737  1.00 22.44 ? 563  LYS C CG  1 
ATOM   3635 C CD  . LYS C 1 169 ? 16.034  38.878 62.697  1.00 24.11 ? 563  LYS C CD  1 
ATOM   3636 C CE  . LYS C 1 169 ? 15.893  40.439 62.677  1.00 27.40 ? 563  LYS C CE  1 
ATOM   3637 N NZ  . LYS C 1 169 ? 16.387  41.042 64.033  1.00 29.77 ? 563  LYS C NZ  1 
ATOM   3638 N N   . GLN C 1 170 ? 14.488  34.770 67.188  1.00 18.08 ? 564  GLN C N   1 
ATOM   3639 C CA  . GLN C 1 170 ? 14.854  33.541 67.834  1.00 17.67 ? 564  GLN C CA  1 
ATOM   3640 C C   . GLN C 1 170 ? 13.741  32.529 67.630  1.00 19.13 ? 564  GLN C C   1 
ATOM   3641 O O   . GLN C 1 170 ? 12.683  32.884 67.126  1.00 19.22 ? 564  GLN C O   1 
ATOM   3642 C CB  . GLN C 1 170 ? 15.171  33.762 69.346  1.00 17.47 ? 564  GLN C CB  1 
ATOM   3643 C CG  . GLN C 1 170 ? 16.368  34.678 69.685  1.00 16.62 ? 564  GLN C CG  1 
ATOM   3644 C CD  . GLN C 1 170 ? 17.642  34.183 69.041  1.00 18.18 ? 564  GLN C CD  1 
ATOM   3645 O OE1 . GLN C 1 170 ? 18.251  34.877 68.203  1.00 23.96 ? 564  GLN C OE1 1 
ATOM   3646 N NE2 . GLN C 1 170 ? 18.033  32.973 69.385  1.00 12.13 ? 564  GLN C NE2 1 
ATOM   3647 N N   . GLU C 1 171 ? 13.989  31.268 67.955  1.00 21.14 ? 565  GLU C N   1 
ATOM   3648 C CA  . GLU C 1 171 ? 12.978  30.230 67.856  1.00 22.50 ? 565  GLU C CA  1 
ATOM   3649 C C   . GLU C 1 171 ? 11.912  30.495 68.910  1.00 22.84 ? 565  GLU C C   1 
ATOM   3650 O O   . GLU C 1 171 ? 12.228  30.827 70.082  1.00 21.83 ? 565  GLU C O   1 
ATOM   3651 C CB  . GLU C 1 171 ? 13.627  28.883 68.076  1.00 24.14 ? 565  GLU C CB  1 
ATOM   3652 C CG  . GLU C 1 171 ? 12.858  27.667 67.541  1.00 31.59 ? 565  GLU C CG  1 
ATOM   3653 C CD  . GLU C 1 171 ? 13.770  26.441 67.414  1.00 38.44 ? 565  GLU C CD  1 
ATOM   3654 O OE1 . GLU C 1 171 ? 14.890  26.476 68.000  1.00 41.16 ? 565  GLU C OE1 1 
ATOM   3655 O OE2 . GLU C 1 171 ? 13.380  25.457 66.721  1.00 42.42 ? 565  GLU C OE2 1 
ATOM   3656 N N   . VAL C 1 172 ? 10.651  30.367 68.494  1.00 21.57 ? 566  VAL C N   1 
ATOM   3657 C CA  . VAL C 1 172 ? 9.544   30.626 69.369  1.00 21.76 ? 566  VAL C CA  1 
ATOM   3658 C C   . VAL C 1 172 ? 8.785   29.322 69.477  1.00 20.80 ? 566  VAL C C   1 
ATOM   3659 O O   . VAL C 1 172 ? 8.120   28.897 68.509  1.00 20.98 ? 566  VAL C O   1 
ATOM   3660 C CB  . VAL C 1 172 ? 8.617   31.714 68.814  1.00 21.46 ? 566  VAL C CB  1 
ATOM   3661 C CG1 . VAL C 1 172 ? 7.304   31.760 69.594  1.00 22.24 ? 566  VAL C CG1 1 
ATOM   3662 C CG2 . VAL C 1 172 ? 9.299   33.021 68.848  1.00 24.89 ? 566  VAL C CG2 1 
ATOM   3663 N N   . PRO C 1 173 ? 8.856   28.693 70.653  1.00 20.05 ? 567  PRO C N   1 
ATOM   3664 C CA  . PRO C 1 173 ? 8.148   27.452 70.915  1.00 20.30 ? 567  PRO C CA  1 
ATOM   3665 C C   . PRO C 1 173 ? 6.636   27.685 70.722  1.00 19.67 ? 567  PRO C C   1 
ATOM   3666 O O   . PRO C 1 173 ? 6.137   28.759 71.010  1.00 18.24 ? 567  PRO C O   1 
ATOM   3667 C CB  . PRO C 1 173 ? 8.459   27.219 72.387  1.00 22.21 ? 567  PRO C CB  1 
ATOM   3668 C CG  . PRO C 1 173 ? 9.831   27.877 72.525  1.00 22.39 ? 567  PRO C CG  1 
ATOM   3669 C CD  . PRO C 1 173 ? 9.544   29.170 71.873  1.00 19.44 ? 567  PRO C CD  1 
ATOM   3670 N N   . SER C 1 174 ? 5.933   26.690 70.208  1.00 18.88 ? 568  SER C N   1 
ATOM   3671 C CA  . SER C 1 174 ? 4.509   26.790 70.018  1.00 18.35 ? 568  SER C CA  1 
ATOM   3672 C C   . SER C 1 174 ? 3.753   27.025 71.348  1.00 18.32 ? 568  SER C C   1 
ATOM   3673 O O   . SER C 1 174 ? 2.813   27.811 71.401  1.00 13.54 ? 568  SER C O   1 
ATOM   3674 C CB  . SER C 1 174 ? 4.001   25.549 69.285  1.00 17.77 ? 568  SER C CB  1 
ATOM   3675 O OG  . SER C 1 174 ? 2.564   25.510 69.222  1.00 23.44 ? 568  SER C OG  1 
ATOM   3676 N N   . TRP C 1 175 ? 4.208   26.388 72.421  1.00 18.82 ? 569  TRP C N   1 
ATOM   3677 C CA  . TRP C 1 175 ? 3.520   26.511 73.708  1.00 18.84 ? 569  TRP C CA  1 
ATOM   3678 C C   . TRP C 1 175 ? 3.650   27.979 74.190  1.00 17.84 ? 569  TRP C C   1 
ATOM   3679 O O   . TRP C 1 175 ? 2.811   28.460 74.925  1.00 17.42 ? 569  TRP C O   1 
ATOM   3680 C CB  . TRP C 1 175 ? 4.148   25.491 74.720  1.00 18.71 ? 569  TRP C CB  1 
ATOM   3681 C CG  . TRP C 1 175 ? 5.633   25.591 74.944  1.00 20.94 ? 569  TRP C CG  1 
ATOM   3682 C CD1 . TRP C 1 175 ? 6.620   24.796 74.384  1.00 15.22 ? 569  TRP C CD1 1 
ATOM   3683 C CD2 . TRP C 1 175 ? 6.302   26.518 75.791  1.00 17.26 ? 569  TRP C CD2 1 
ATOM   3684 N NE1 . TRP C 1 175 ? 7.852   25.206 74.823  1.00 20.63 ? 569  TRP C NE1 1 
ATOM   3685 C CE2 . TRP C 1 175 ? 7.688   26.246 75.699  1.00 20.85 ? 569  TRP C CE2 1 
ATOM   3686 C CE3 . TRP C 1 175 ? 5.860   27.550 76.634  1.00 18.90 ? 569  TRP C CE3 1 
ATOM   3687 C CZ2 . TRP C 1 175 ? 8.642   26.970 76.406  1.00 21.20 ? 569  TRP C CZ2 1 
ATOM   3688 C CZ3 . TRP C 1 175 ? 6.792   28.263 77.330  1.00 19.59 ? 569  TRP C CZ3 1 
ATOM   3689 C CH2 . TRP C 1 175 ? 8.174   27.982 77.217  1.00 19.81 ? 569  TRP C CH2 1 
ATOM   3690 N N   . LEU C 1 176 ? 4.729   28.682 73.800  1.00 17.63 ? 570  LEU C N   1 
ATOM   3691 C CA  . LEU C 1 176 ? 4.942   30.081 74.276  1.00 16.67 ? 570  LEU C CA  1 
ATOM   3692 C C   . LEU C 1 176 ? 3.980   31.000 73.606  1.00 17.44 ? 570  LEU C C   1 
ATOM   3693 O O   . LEU C 1 176 ? 3.355   31.890 74.241  1.00 16.84 ? 570  LEU C O   1 
ATOM   3694 C CB  . LEU C 1 176 ? 6.370   30.594 73.969  1.00 17.70 ? 570  LEU C CB  1 
ATOM   3695 C CG  . LEU C 1 176 ? 6.781   31.947 74.605  1.00 15.09 ? 570  LEU C CG  1 
ATOM   3696 C CD1 . LEU C 1 176 ? 6.585   31.895 76.115  1.00 21.54 ? 570  LEU C CD1 1 
ATOM   3697 C CD2 . LEU C 1 176 ? 8.275   32.221 74.282  1.00 16.57 ? 570  LEU C CD2 1 
ATOM   3698 N N   . GLU C 1 177 ? 3.855   30.785 72.301  1.00 18.42 ? 571  GLU C N   1 
ATOM   3699 C CA  . GLU C 1 177 ? 2.893   31.524 71.507  1.00 21.58 ? 571  GLU C CA  1 
ATOM   3700 C C   . GLU C 1 177 ? 1.501   31.295 72.047  1.00 21.88 ? 571  GLU C C   1 
ATOM   3701 O O   . GLU C 1 177 ? 0.707   32.229 72.185  1.00 21.23 ? 571  GLU C O   1 
ATOM   3702 C CB  . GLU C 1 177 ? 2.953   31.018 70.083  1.00 21.90 ? 571  GLU C CB  1 
ATOM   3703 C CG  . GLU C 1 177 ? 2.672   32.056 69.069  1.00 29.19 ? 571  GLU C CG  1 
ATOM   3704 C CD  . GLU C 1 177 ? 3.480   31.803 67.801  1.00 38.12 ? 571  GLU C CD  1 
ATOM   3705 O OE1 . GLU C 1 177 ? 4.034   30.675 67.637  1.00 39.33 ? 571  GLU C OE1 1 
ATOM   3706 O OE2 . GLU C 1 177 ? 3.557   32.739 66.975  1.00 41.76 ? 571  GLU C OE2 1 
ATOM   3707 N N   . ASN C 1 178 ? 1.168   30.042 72.328  1.00 23.34 ? 572  ASN C N   1 
ATOM   3708 C CA  . ASN C 1 178 ? -0.231  29.766 72.714  1.00 24.90 ? 572  ASN C CA  1 
ATOM   3709 C C   . ASN C 1 178 ? -0.539  30.255 74.146  1.00 25.35 ? 572  ASN C C   1 
ATOM   3710 O O   . ASN C 1 178 ? -1.665  30.653 74.483  1.00 25.23 ? 572  ASN C O   1 
ATOM   3711 C CB  . ASN C 1 178 ? -0.577  28.291 72.444  1.00 25.94 ? 572  ASN C CB  1 
ATOM   3712 C CG  . ASN C 1 178 ? -0.556  27.938 70.913  1.00 27.20 ? 572  ASN C CG  1 
ATOM   3713 O OD1 . ASN C 1 178 ? 0.134   27.014 70.471  1.00 23.72 ? 572  ASN C OD1 1 
ATOM   3714 N ND2 . ASN C 1 178 ? -1.329  28.683 70.125  1.00 27.98 ? 572  ASN C ND2 1 
ATOM   3715 N N   . MET C 1 179 ? 0.483   30.256 74.985  1.00 25.36 ? 573  MET C N   1 
ATOM   3716 C CA  . MET C 1 179 ? 0.337   30.828 76.304  1.00 26.10 ? 573  MET C CA  1 
ATOM   3717 C C   . MET C 1 179 ? 0.250   32.346 76.333  1.00 25.09 ? 573  MET C C   1 
ATOM   3718 O O   . MET C 1 179 ? -0.548  32.917 77.102  1.00 24.28 ? 573  MET C O   1 
ATOM   3719 C CB  . MET C 1 179 ? 1.439   30.335 77.208  1.00 26.58 ? 573  MET C CB  1 
ATOM   3720 C CG  . MET C 1 179 ? 1.024   29.084 77.899  1.00 27.70 ? 573  MET C CG  1 
ATOM   3721 S SD  . MET C 1 179 ? 2.522   28.558 78.617  1.00 29.52 ? 573  MET C SD  1 
ATOM   3722 C CE  . MET C 1 179 ? 2.304   29.145 80.305  1.00 27.03 ? 573  MET C CE  1 
ATOM   3723 N N   . ALA C 1 180 ? 1.070   32.993 75.511  1.00 23.09 ? 574  ALA C N   1 
ATOM   3724 C CA  . ALA C 1 180 ? 0.912   34.416 75.263  1.00 23.67 ? 574  ALA C CA  1 
ATOM   3725 C C   . ALA C 1 180 ? -0.458  34.712 74.658  1.00 23.15 ? 574  ALA C C   1 
ATOM   3726 O O   . ALA C 1 180 ? -1.176  35.539 75.200  1.00 25.43 ? 574  ALA C O   1 
ATOM   3727 C CB  . ALA C 1 180 ? 1.988   34.926 74.367  1.00 22.01 ? 574  ALA C CB  1 
HETATM 3728 O O   . HOH D 2 .   ? 8.673   17.370 75.046  1.00 41.38 ? 2001 HOH A O   1 
HETATM 3729 O O   . HOH D 2 .   ? 6.602   23.674 70.811  1.00 30.19 ? 2002 HOH A O   1 
HETATM 3730 O O   . HOH D 2 .   ? 11.516  17.554 76.811  1.00 45.70 ? 2003 HOH A O   1 
HETATM 3731 O O   . HOH D 2 .   ? -8.573  10.875 51.447  1.00 35.82 ? 2004 HOH A O   1 
HETATM 3732 O O   . HOH D 2 .   ? -1.342  6.686  52.490  1.00 51.47 ? 2005 HOH A O   1 
HETATM 3733 O O   . HOH D 2 .   ? -0.813  11.091 47.151  1.00 30.87 ? 2006 HOH A O   1 
HETATM 3734 O O   . HOH D 2 .   ? -7.850  11.028 48.257  1.00 37.78 ? 2007 HOH A O   1 
HETATM 3735 O O   . HOH D 2 .   ? -0.249  13.711 45.237  1.00 25.15 ? 2008 HOH A O   1 
HETATM 3736 O O   . HOH D 2 .   ? -5.873  17.318 50.563  1.00 26.50 ? 2009 HOH A O   1 
HETATM 3737 O O   . HOH D 2 .   ? 2.401   7.072  48.619  1.00 38.55 ? 2010 HOH A O   1 
HETATM 3738 O O   . HOH D 2 .   ? 12.830  19.602 54.138  1.00 26.78 ? 2011 HOH A O   1 
HETATM 3739 O O   . HOH D 2 .   ? 7.240   22.690 58.039  1.00 30.46 ? 2012 HOH A O   1 
HETATM 3740 O O   . HOH D 2 .   ? 16.513  21.337 62.813  1.00 48.19 ? 2013 HOH A O   1 
HETATM 3741 O O   . HOH D 2 .   ? 15.792  16.433 54.949  1.00 40.01 ? 2014 HOH A O   1 
HETATM 3742 O O   . HOH D 2 .   ? 11.838  18.066 56.167  1.00 29.04 ? 2015 HOH A O   1 
HETATM 3743 O O   . HOH D 2 .   ? 0.805   4.409  60.108  1.00 45.61 ? 2016 HOH A O   1 
HETATM 3744 O O   . HOH D 2 .   ? 0.576   2.911  53.060  1.00 44.34 ? 2017 HOH A O   1 
HETATM 3745 O O   . HOH D 2 .   ? 6.614   -3.251 60.422  1.00 92.01 ? 2018 HOH A O   1 
HETATM 3746 O O   . HOH D 2 .   ? 6.816   -4.055 48.522  1.00 49.65 ? 2019 HOH A O   1 
HETATM 3747 O O   . HOH D 2 .   ? 6.029   4.689  43.387  1.00 43.42 ? 2020 HOH A O   1 
HETATM 3748 O O   . HOH D 2 .   ? 13.998  3.589  44.509  1.00 46.00 ? 2021 HOH A O   1 
HETATM 3749 O O   . HOH D 2 .   ? 8.169   11.065 41.018  1.00 36.14 ? 2022 HOH A O   1 
HETATM 3750 O O   . HOH D 2 .   ? 13.926  9.677  37.127  1.00 34.75 ? 2023 HOH A O   1 
HETATM 3751 O O   . HOH D 2 .   ? 19.906  12.459 56.575  1.00 44.85 ? 2024 HOH A O   1 
HETATM 3752 O O   . HOH D 2 .   ? 20.598  11.709 64.427  1.00 48.25 ? 2025 HOH A O   1 
HETATM 3753 O O   . HOH D 2 .   ? 22.848  20.143 60.466  1.00 49.35 ? 2026 HOH A O   1 
HETATM 3754 O O   . HOH D 2 .   ? 22.315  22.628 61.316  1.00 40.57 ? 2027 HOH A O   1 
HETATM 3755 O O   . HOH D 2 .   ? 13.913  20.342 64.112  1.00 33.36 ? 2028 HOH A O   1 
HETATM 3756 O O   . HOH D 2 .   ? 13.366  8.123  70.262  1.00 51.77 ? 2029 HOH A O   1 
HETATM 3757 O O   . HOH D 2 .   ? 12.432  15.236 71.847  1.00 42.31 ? 2030 HOH A O   1 
HETATM 3758 O O   . HOH D 2 .   ? 14.765  12.456 69.714  1.00 26.60 ? 2031 HOH A O   1 
HETATM 3759 O O   . HOH D 2 .   ? 17.732  14.673 75.082  1.00 43.71 ? 2032 HOH A O   1 
HETATM 3760 O O   . HOH D 2 .   ? 20.330  20.694 72.437  1.00 50.89 ? 2033 HOH A O   1 
HETATM 3761 O O   . HOH D 2 .   ? 14.271  20.327 75.041  1.00 36.81 ? 2034 HOH A O   1 
HETATM 3762 O O   . HOH D 2 .   ? 12.860  18.589 72.283  1.00 26.39 ? 2035 HOH A O   1 
HETATM 3763 O O   . HOH D 2 .   ? 2.417   16.060 64.416  1.00 21.24 ? 2036 HOH A O   1 
HETATM 3764 O O   . HOH D 2 .   ? -10.784 12.087 54.055  1.00 35.33 ? 2037 HOH A O   1 
HETATM 3765 O O   . HOH D 2 .   ? -3.046  9.956  57.696  1.00 36.38 ? 2038 HOH A O   1 
HETATM 3766 O O   . HOH D 2 .   ? -5.349  6.641  62.573  1.00 29.25 ? 2039 HOH A O   1 
HETATM 3767 O O   . HOH D 2 .   ? -5.450  6.066  70.733  1.00 44.76 ? 2040 HOH A O   1 
HETATM 3768 O O   . HOH D 2 .   ? -2.942  22.862 78.699  1.00 54.45 ? 2041 HOH A O   1 
HETATM 3769 O O   . HOH D 2 .   ? 0.543   16.161 75.508  1.00 45.80 ? 2042 HOH A O   1 
HETATM 3770 O O   . HOH D 2 .   ? 1.287   27.030 61.701  1.00 42.69 ? 2043 HOH A O   1 
HETATM 3771 O O   . HOH D 2 .   ? -0.964  21.284 65.087  1.00 22.53 ? 2044 HOH A O   1 
HETATM 3772 O O   . HOH D 2 .   ? -5.021  27.709 66.222  1.00 45.36 ? 2045 HOH A O   1 
HETATM 3773 O O   . HOH D 2 .   ? -4.299  26.287 68.933  1.00 52.28 ? 2046 HOH A O   1 
HETATM 3774 O O   . HOH D 2 .   ? -13.130 28.101 62.692  1.00 23.73 ? 2047 HOH A O   1 
HETATM 3775 O O   . HOH D 2 .   ? -13.880 19.622 70.540  1.00 45.20 ? 2048 HOH A O   1 
HETATM 3776 O O   . HOH D 2 .   ? -9.017  23.263 71.513  1.00 45.31 ? 2049 HOH A O   1 
HETATM 3777 O O   . HOH D 2 .   ? -15.313 24.102 68.340  1.00 45.72 ? 2050 HOH A O   1 
HETATM 3778 O O   . HOH E 2 .   ? -7.326  19.510 43.672  1.00 33.33 ? 2001 HOH B O   1 
HETATM 3779 O O   . HOH E 2 .   ? -10.720 26.174 56.334  1.00 28.56 ? 2002 HOH B O   1 
HETATM 3780 O O   . HOH E 2 .   ? -11.683 22.226 53.953  1.00 51.72 ? 2003 HOH B O   1 
HETATM 3781 O O   . HOH E 2 .   ? -8.166  19.120 50.834  1.00 55.19 ? 2004 HOH B O   1 
HETATM 3782 O O   . HOH E 2 .   ? -3.496  22.678 52.353  1.00 37.21 ? 2005 HOH B O   1 
HETATM 3783 O O   . HOH E 2 .   ? -8.474  23.939 57.962  1.00 43.71 ? 2006 HOH B O   1 
HETATM 3784 O O   . HOH E 2 .   ? -8.281  21.875 56.693  1.00 37.31 ? 2007 HOH B O   1 
HETATM 3785 O O   . HOH E 2 .   ? -4.677  22.169 59.891  1.00 23.02 ? 2008 HOH B O   1 
HETATM 3786 O O   . HOH E 2 .   ? -15.843 31.058 61.592  1.00 19.66 ? 2009 HOH B O   1 
HETATM 3787 O O   . HOH E 2 .   ? 1.435   44.770 62.985  1.00 42.95 ? 2010 HOH B O   1 
HETATM 3788 O O   . HOH E 2 .   ? -27.559 45.392 61.878  1.00 52.26 ? 2011 HOH B O   1 
HETATM 3789 O O   . HOH E 2 .   ? -15.057 51.581 61.702  1.00 43.94 ? 2012 HOH B O   1 
HETATM 3790 O O   . HOH E 2 .   ? -22.610 51.182 61.441  1.00 35.81 ? 2013 HOH B O   1 
HETATM 3791 O O   . HOH E 2 .   ? -20.196 45.565 65.733  1.00 31.13 ? 2014 HOH B O   1 
HETATM 3792 O O   . HOH E 2 .   ? -14.521 51.666 65.120  1.00 38.87 ? 2015 HOH B O   1 
HETATM 3793 O O   . HOH E 2 .   ? -1.880  40.852 64.958  1.00 46.32 ? 2016 HOH B O   1 
HETATM 3794 O O   . HOH E 2 .   ? -2.624  40.059 62.492  1.00 26.12 ? 2017 HOH B O   1 
HETATM 3795 O O   . HOH E 2 .   ? -7.731  35.711 66.158  1.00 40.66 ? 2018 HOH B O   1 
HETATM 3796 O O   . HOH E 2 .   ? -18.038 48.883 45.973  1.00 60.78 ? 2019 HOH B O   1 
HETATM 3797 O O   . HOH E 2 .   ? -29.299 33.591 51.084  1.00 49.20 ? 2020 HOH B O   1 
HETATM 3798 O O   . HOH E 2 .   ? -14.057 50.814 51.293  1.00 51.38 ? 2021 HOH B O   1 
HETATM 3799 O O   . HOH E 2 .   ? -13.113 54.912 46.132  1.00 36.99 ? 2022 HOH B O   1 
HETATM 3800 O O   . HOH E 2 .   ? 2.959   53.601 51.918  1.00 55.31 ? 2023 HOH B O   1 
HETATM 3801 O O   . HOH E 2 .   ? -1.548  59.474 57.639  1.00 48.60 ? 2024 HOH B O   1 
HETATM 3802 O O   . HOH E 2 .   ? 2.304   47.255 61.691  1.00 45.10 ? 2025 HOH B O   1 
HETATM 3803 O O   . HOH E 2 .   ? -8.875  49.269 43.030  1.00 47.92 ? 2026 HOH B O   1 
HETATM 3804 O O   . HOH E 2 .   ? 4.959   53.483 38.050  1.00 42.22 ? 2027 HOH B O   1 
HETATM 3805 O O   . HOH E 2 .   ? 4.589   52.393 47.802  1.00 46.69 ? 2028 HOH B O   1 
HETATM 3806 O O   . HOH E 2 .   ? 6.817   36.655 52.357  1.00 52.76 ? 2029 HOH B O   1 
HETATM 3807 O O   . HOH E 2 .   ? -14.839 43.708 49.467  1.00 38.68 ? 2030 HOH B O   1 
HETATM 3808 O O   . HOH E 2 .   ? -20.745 40.570 50.482  1.00 22.87 ? 2031 HOH B O   1 
HETATM 3809 O O   . HOH E 2 .   ? -17.233 42.512 45.783  1.00 36.28 ? 2032 HOH B O   1 
HETATM 3810 O O   . HOH E 2 .   ? -19.284 42.777 44.212  1.00 34.56 ? 2033 HOH B O   1 
HETATM 3811 O O   . HOH E 2 .   ? -12.807 34.129 57.367  1.00 22.84 ? 2034 HOH B O   1 
HETATM 3812 O O   . HOH E 2 .   ? -5.149  32.644 46.586  1.00 41.37 ? 2035 HOH B O   1 
HETATM 3813 O O   . HOH E 2 .   ? -6.955  37.627 46.136  1.00 46.69 ? 2036 HOH B O   1 
HETATM 3814 O O   . HOH E 2 .   ? -0.817  31.185 51.073  1.00 43.42 ? 2037 HOH B O   1 
HETATM 3815 O O   . HOH E 2 .   ? 6.222   24.510 56.259  1.00 36.22 ? 2038 HOH B O   1 
HETATM 3816 O O   . HOH E 2 .   ? 5.128   21.764 59.262  1.00 25.34 ? 2039 HOH B O   1 
HETATM 3817 O O   . HOH E 2 .   ? -0.586  23.197 55.685  1.00 27.76 ? 2040 HOH B O   1 
HETATM 3818 O O   . HOH E 2 .   ? 1.855   31.170 57.252  1.00 49.40 ? 2041 HOH B O   1 
HETATM 3819 O O   . HOH E 2 .   ? -1.816  26.483 55.425  1.00 40.10 ? 2042 HOH B O   1 
HETATM 3820 O O   . HOH E 2 .   ? -9.628  35.879 64.421  1.00 27.98 ? 2043 HOH B O   1 
HETATM 3821 O O   . HOH E 2 .   ? -18.410 46.506 53.678  1.00 41.73 ? 2044 HOH B O   1 
HETATM 3822 O O   . HOH E 2 .   ? -18.366 44.220 52.768  1.00 33.04 ? 2045 HOH B O   1 
HETATM 3823 O O   . HOH E 2 .   ? -18.197 43.230 55.627  1.00 30.79 ? 2046 HOH B O   1 
HETATM 3824 O O   . HOH E 2 .   ? -27.172 34.454 50.673  1.00 31.86 ? 2047 HOH B O   1 
HETATM 3825 O O   . HOH E 2 .   ? -25.686 41.710 50.482  1.00 28.76 ? 2048 HOH B O   1 
HETATM 3826 O O   . HOH E 2 .   ? -32.210 33.823 52.019  1.00 48.93 ? 2049 HOH B O   1 
HETATM 3827 O O   . HOH E 2 .   ? -19.896 27.471 49.273  1.00 27.35 ? 2050 HOH B O   1 
HETATM 3828 O O   . HOH E 2 .   ? -24.678 33.000 49.036  1.00 35.10 ? 2051 HOH B O   1 
HETATM 3829 O O   . HOH E 2 .   ? -21.307 33.863 46.328  1.00 30.56 ? 2052 HOH B O   1 
HETATM 3830 O O   . HOH E 2 .   ? -27.238 27.853 51.613  1.00 55.98 ? 2053 HOH B O   1 
HETATM 3831 O O   . HOH E 2 .   ? -18.946 24.884 50.055  1.00 40.87 ? 2054 HOH B O   1 
HETATM 3832 O O   . HOH E 2 .   ? -15.094 24.505 52.215  1.00 34.45 ? 2055 HOH B O   1 
HETATM 3833 O O   . HOH E 2 .   ? -19.115 20.729 59.648  1.00 39.21 ? 2056 HOH B O   1 
HETATM 3834 O O   . HOH E 2 .   ? -9.169  24.734 60.770  1.00 32.81 ? 2057 HOH B O   1 
HETATM 3835 O O   . HOH E 2 .   ? -14.772 31.645 66.340  1.00 35.35 ? 2058 HOH B O   1 
HETATM 3836 O O   . HOH E 2 .   ? -19.417 25.697 65.007  1.00 40.48 ? 2059 HOH B O   1 
HETATM 3837 O O   . HOH E 2 .   ? -29.611 31.382 64.805  1.00 40.25 ? 2060 HOH B O   1 
HETATM 3838 O O   . HOH E 2 .   ? -27.894 30.231 68.968  1.00 22.44 ? 2061 HOH B O   1 
HETATM 3839 O O   . HOH E 2 .   ? -14.309 51.977 58.217  1.00 52.63 ? 2062 HOH B O   1 
HETATM 3840 O O   . HOH E 2 .   ? -23.757 26.401 64.523  1.00 42.66 ? 2063 HOH B O   1 
HETATM 3841 O O   . HOH F 2 .   ? 21.113  33.489 67.109  1.00 32.92 ? 2001 HOH C O   1 
HETATM 3842 O O   . HOH F 2 .   ? 29.777  12.384 96.085  1.00 30.10 ? 2002 HOH C O   1 
HETATM 3843 O O   . HOH F 2 .   ? 19.446  27.146 66.454  1.00 42.42 ? 2003 HOH C O   1 
HETATM 3844 O O   . HOH F 2 .   ? 13.433  27.012 71.590  1.00 29.33 ? 2004 HOH C O   1 
HETATM 3845 O O   . HOH F 2 .   ? 6.346   22.048 87.502  1.00 26.10 ? 2005 HOH C O   1 
HETATM 3846 O O   . HOH F 2 .   ? 4.376   23.893 84.998  1.00 43.52 ? 2006 HOH C O   1 
HETATM 3847 O O   . HOH F 2 .   ? 14.391  18.606 89.419  1.00 35.01 ? 2007 HOH C O   1 
HETATM 3848 O O   . HOH F 2 .   ? 13.700  21.962 90.541  1.00 40.90 ? 2008 HOH C O   1 
HETATM 3849 O O   . HOH F 2 .   ? 6.998   19.198 88.978  1.00 32.54 ? 2009 HOH C O   1 
HETATM 3850 O O   . HOH F 2 .   ? 13.574  13.499 84.898  1.00 49.76 ? 2010 HOH C O   1 
HETATM 3851 O O   . HOH F 2 .   ? 9.204   18.453 82.219  1.00 28.23 ? 2011 HOH C O   1 
HETATM 3852 O O   . HOH F 2 .   ? 18.313  15.660 93.413  1.00 38.78 ? 2012 HOH C O   1 
HETATM 3853 O O   . HOH F 2 .   ? 15.240  15.829 87.923  1.00 36.77 ? 2013 HOH C O   1 
HETATM 3854 O O   . HOH F 2 .   ? 23.463  14.510 77.025  1.00 42.11 ? 2014 HOH C O   1 
HETATM 3855 O O   . HOH F 2 .   ? 21.534  12.045 83.032  1.00 51.20 ? 2015 HOH C O   1 
HETATM 3856 O O   . HOH F 2 .   ? 22.710  12.456 79.814  1.00 57.71 ? 2016 HOH C O   1 
HETATM 3857 O O   . HOH F 2 .   ? 28.242  21.329 78.892  1.00 39.92 ? 2017 HOH C O   1 
HETATM 3858 O O   . HOH F 2 .   ? 13.820  35.085 90.714  1.00 47.56 ? 2018 HOH C O   1 
HETATM 3859 O O   . HOH F 2 .   ? 24.083  41.512 74.963  1.00 48.11 ? 2019 HOH C O   1 
HETATM 3860 O O   . HOH F 2 .   ? 30.675  23.828 81.897  1.00 37.24 ? 2020 HOH C O   1 
HETATM 3861 O O   . HOH F 2 .   ? 27.023  23.881 79.289  1.00 28.27 ? 2021 HOH C O   1 
HETATM 3862 O O   . HOH F 2 .   ? 17.964  35.662 94.626  1.00 29.22 ? 2022 HOH C O   1 
HETATM 3863 O O   . HOH F 2 .   ? 13.911  28.508 98.570  1.00 51.70 ? 2023 HOH C O   1 
HETATM 3864 O O   . HOH F 2 .   ? 15.781  28.572 93.854  1.00 31.07 ? 2024 HOH C O   1 
HETATM 3865 O O   . HOH F 2 .   ? 17.106  34.006 98.322  1.00 32.31 ? 2025 HOH C O   1 
HETATM 3866 O O   . HOH F 2 .   ? 16.908  31.229 100.275 1.00 32.26 ? 2026 HOH C O   1 
HETATM 3867 O O   . HOH F 2 .   ? 21.373  25.935 102.451 1.00 43.70 ? 2027 HOH C O   1 
HETATM 3868 O O   . HOH F 2 .   ? 21.302  18.677 96.678  1.00 33.93 ? 2028 HOH C O   1 
HETATM 3869 O O   . HOH F 2 .   ? 26.536  23.851 98.558  1.00 41.76 ? 2029 HOH C O   1 
HETATM 3870 O O   . HOH F 2 .   ? 24.722  22.788 101.469 1.00 49.66 ? 2030 HOH C O   1 
HETATM 3871 O O   . HOH F 2 .   ? 31.377  13.742 94.476  1.00 30.33 ? 2031 HOH C O   1 
HETATM 3872 O O   . HOH F 2 .   ? 27.934  10.679 94.227  1.00 24.97 ? 2032 HOH C O   1 
HETATM 3873 O O   . HOH F 2 .   ? 23.761  12.302 93.074  1.00 36.10 ? 2033 HOH C O   1 
HETATM 3874 O O   . HOH F 2 .   ? 32.240  20.739 85.747  1.00 40.56 ? 2034 HOH C O   1 
HETATM 3875 O O   . HOH F 2 .   ? 23.274  38.644 96.562  1.00 62.68 ? 2035 HOH C O   1 
HETATM 3876 O O   . HOH F 2 .   ? 35.711  35.294 99.208  1.00 48.90 ? 2036 HOH C O   1 
HETATM 3877 O O   . HOH F 2 .   ? 27.123  39.810 92.053  1.00 43.47 ? 2037 HOH C O   1 
HETATM 3878 O O   . HOH F 2 .   ? 43.895  22.651 92.861  1.00 50.47 ? 2038 HOH C O   1 
HETATM 3879 O O   . HOH F 2 .   ? 19.935  43.084 92.619  1.00 45.39 ? 2039 HOH C O   1 
HETATM 3880 O O   . HOH F 2 .   ? 23.828  42.055 93.018  1.00 43.49 ? 2040 HOH C O   1 
HETATM 3881 O O   . HOH F 2 .   ? 34.210  34.574 82.296  1.00 49.81 ? 2041 HOH C O   1 
HETATM 3882 O O   . HOH F 2 .   ? 31.603  33.421 74.240  1.00 42.26 ? 2042 HOH C O   1 
HETATM 3883 O O   . HOH F 2 .   ? 36.955  34.758 75.166  1.00 50.83 ? 2043 HOH C O   1 
HETATM 3884 O O   . HOH F 2 .   ? 33.087  38.509 76.238  1.00 44.22 ? 2044 HOH C O   1 
HETATM 3885 O O   . HOH F 2 .   ? 16.062  26.613 92.316  1.00 29.50 ? 2045 HOH C O   1 
HETATM 3886 O O   . HOH F 2 .   ? 11.279  28.949 88.581  1.00 41.84 ? 2046 HOH C O   1 
HETATM 3887 O O   . HOH F 2 .   ? 13.470  25.807 90.836  1.00 34.68 ? 2047 HOH C O   1 
HETATM 3888 O O   . HOH F 2 .   ? 11.365  30.861 87.822  1.00 30.91 ? 2048 HOH C O   1 
HETATM 3889 O O   . HOH F 2 .   ? 9.343   34.303 85.766  1.00 27.30 ? 2049 HOH C O   1 
HETATM 3890 O O   . HOH F 2 .   ? 18.183  37.968 88.065  1.00 28.79 ? 2050 HOH C O   1 
HETATM 3891 O O   . HOH F 2 .   ? 23.246  39.097 85.059  1.00 24.70 ? 2051 HOH C O   1 
HETATM 3892 O O   . HOH F 2 .   ? 15.254  33.388 89.038  1.00 23.58 ? 2052 HOH C O   1 
HETATM 3893 O O   . HOH F 2 .   ? 27.842  40.936 79.919  1.00 27.28 ? 2053 HOH C O   1 
HETATM 3894 O O   . HOH F 2 .   ? 26.280  40.983 75.583  1.00 40.39 ? 2054 HOH C O   1 
HETATM 3895 O O   . HOH F 2 .   ? 26.809  38.436 73.649  1.00 37.06 ? 2055 HOH C O   1 
HETATM 3896 O O   . HOH F 2 .   ? 29.181  38.076 77.029  1.00 22.60 ? 2056 HOH C O   1 
HETATM 3897 O O   . HOH F 2 .   ? 33.438  40.773 73.107  1.00 48.18 ? 2057 HOH C O   1 
HETATM 3898 O O   . HOH F 2 .   ? 27.946  37.178 70.720  1.00 35.43 ? 2058 HOH C O   1 
HETATM 3899 O O   . HOH F 2 .   ? 25.335  29.347 70.145  1.00 37.99 ? 2059 HOH C O   1 
HETATM 3900 O O   . HOH F 2 .   ? 20.076  24.360 74.445  1.00 22.75 ? 2060 HOH C O   1 
HETATM 3901 O O   . HOH F 2 .   ? 17.037  31.566 76.839  1.00 20.00 ? 2061 HOH C O   1 
HETATM 3902 O O   . HOH F 2 .   ? 4.484   33.865 87.041  1.00 33.30 ? 2062 HOH C O   1 
HETATM 3903 O O   . HOH F 2 .   ? 11.708  28.466 85.413  1.00 24.15 ? 2063 HOH C O   1 
HETATM 3904 O O   . HOH F 2 .   ? 2.664   38.004 79.991  1.00 39.36 ? 2064 HOH C O   1 
HETATM 3905 O O   . HOH F 2 .   ? 8.755   41.359 82.444  1.00 36.98 ? 2065 HOH C O   1 
HETATM 3906 O O   . HOH F 2 .   ? 10.203  42.180 75.868  1.00 37.12 ? 2066 HOH C O   1 
HETATM 3907 O O   . HOH F 2 .   ? 11.671  40.085 63.897  1.00 43.33 ? 2067 HOH C O   1 
HETATM 3908 O O   . HOH F 2 .   ? 18.588  40.175 64.131  1.00 82.47 ? 2068 HOH C O   1 
HETATM 3909 O O   . HOH F 2 .   ? 16.840  27.744 68.244  1.00 44.96 ? 2069 HOH C O   1 
HETATM 3910 O O   . HOH F 2 .   ? 13.740  29.582 71.811  1.00 23.35 ? 2070 HOH C O   1 
HETATM 3911 O O   . HOH F 2 .   ? 15.069  25.081 70.111  1.00 44.19 ? 2071 HOH C O   1 
HETATM 3912 O O   . HOH F 2 .   ? 10.053  30.574 65.584  1.00 36.33 ? 2072 HOH C O   1 
HETATM 3913 O O   . HOH F 2 .   ? 30.619  11.843 98.452  1.00 39.51 ? 2073 HOH C O   1 
HETATM 3914 O O   . HOH F 2 .   ? 1.792   27.948 67.803  1.00 33.69 ? 2074 HOH C O   1 
HETATM 3915 O O   . HOH F 2 .   ? 1.983   23.741 67.226  1.00 25.53 ? 2075 HOH C O   1 
HETATM 3916 O O   . HOH F 2 .   ? 4.297   36.123 67.647  1.00 38.76 ? 2076 HOH C O   1 
HETATM 3917 O O   . HOH F 2 .   ? 5.885   34.012 67.202  1.00 46.27 ? 2077 HOH C O   1 
HETATM 3918 O O   . HOH F 2 .   ? 7.009   17.703 80.998  1.00 44.40 ? 2078 HOH C O   1 
HETATM 3919 O O   . HOH F 2 .   ? 16.925  14.920 91.080  1.00 42.73 ? 2079 HOH C O   1 
HETATM 3920 O O   . HOH F 2 .   ? -1.342  32.495 80.190  1.00 48.99 ? 2080 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   395 ?   ?   ?   A . n 
A 1 2   HIS 2   396 ?   ?   ?   A . n 
A 1 3   HIS 3   397 ?   ?   ?   A . n 
A 1 4   HIS 4   398 ?   ?   ?   A . n 
A 1 5   HIS 5   399 ?   ?   ?   A . n 
A 1 6   HIS 6   400 ?   ?   ?   A . n 
A 1 7   HIS 7   401 ?   ?   ?   A . n 
A 1 8   GLU 8   402 ?   ?   ?   A . n 
A 1 9   ASN 9   403 ?   ?   ?   A . n 
A 1 10  LEU 10  404 ?   ?   ?   A . n 
A 1 11  TYR 11  405 ?   ?   ?   A . n 
A 1 12  PHE 12  406 ?   ?   ?   A . n 
A 1 13  GLN 13  407 ?   ?   ?   A . n 
A 1 14  GLY 14  408 ?   ?   ?   A . n 
A 1 15  SER 15  409 ?   ?   ?   A . n 
A 1 16  THR 16  410 410 THR THR A . n 
A 1 17  SER 17  411 411 SER SER A . n 
A 1 18  GLU 18  412 412 GLU GLU A . n 
A 1 19  ASN 19  413 413 ASN ASN A . n 
A 1 20  ILE 20  414 414 ILE ILE A . n 
A 1 21  THR 21  415 415 THR THR A . n 
A 1 22  GLN 22  416 416 GLN GLN A . n 
A 1 23  LYS 23  417 417 LYS LYS A . n 
A 1 24  VAL 24  418 418 VAL VAL A . n 
A 1 25  VAL 25  419 419 VAL VAL A . n 
A 1 26  TRP 26  420 420 TRP TRP A . n 
A 1 27  VAL 27  421 421 VAL VAL A . n 
A 1 28  GLU 28  422 422 GLU GLU A . n 
A 1 29  GLU 29  423 423 GLU GLU A . n 
A 1 30  SER 30  424 424 SER SER A . n 
A 1 31  ASP 31  425 425 ASP ASP A . n 
A 1 32  LYS 32  426 426 LYS LYS A . n 
A 1 33  ARG 33  427 427 ARG ARG A . n 
A 1 34  SER 34  428 428 SER SER A . n 
A 1 35  PHE 35  429 429 PHE PHE A . n 
A 1 36  LEU 36  430 430 LEU LEU A . n 
A 1 37  LEU 37  431 431 LEU LEU A . n 
A 1 38  ASP 38  432 432 ASP ASP A . n 
A 1 39  LEU 39  433 433 LEU LEU A . n 
A 1 40  LEU 40  434 434 LEU LEU A . n 
A 1 41  ASN 41  435 435 ASN ASN A . n 
A 1 42  ALA 42  436 436 ALA ALA A . n 
A 1 43  THR 43  437 437 THR THR A . n 
A 1 44  GLY 44  438 ?   ?   ?   A . n 
A 1 45  LYS 45  439 439 LYS LYS A . n 
A 1 46  ASP 46  440 440 ASP ASP A . n 
A 1 47  SER 47  441 441 SER SER A . n 
A 1 48  LEU 48  442 442 LEU LEU A . n 
A 1 49  THR 49  443 443 THR THR A . n 
A 1 50  LEU 50  444 444 LEU LEU A . n 
A 1 51  VAL 51  445 445 VAL VAL A . n 
A 1 52  PHE 52  446 446 PHE PHE A . n 
A 1 53  VAL 53  447 447 VAL VAL A . n 
A 1 54  GLU 54  448 448 GLU GLU A . n 
A 1 55  THR 55  449 449 THR THR A . n 
A 1 56  LYS 56  450 450 LYS LYS A . n 
A 1 57  LYS 57  451 451 LYS LYS A . n 
A 1 58  GLY 58  452 452 GLY GLY A . n 
A 1 59  ALA 59  453 453 ALA ALA A . n 
A 1 60  ASP 60  454 454 ASP ASP A . n 
A 1 61  SER 61  455 455 SER SER A . n 
A 1 62  LEU 62  456 456 LEU LEU A . n 
A 1 63  GLU 63  457 457 GLU GLU A . n 
A 1 64  ASP 64  458 458 ASP ASP A . n 
A 1 65  PHE 65  459 459 PHE PHE A . n 
A 1 66  LEU 66  460 460 LEU LEU A . n 
A 1 67  TYR 67  461 461 TYR TYR A . n 
A 1 68  HIS 68  462 462 HIS HIS A . n 
A 1 69  GLU 69  463 463 GLU GLU A . n 
A 1 70  GLY 70  464 464 GLY GLY A . n 
A 1 71  TYR 71  465 465 TYR TYR A . n 
A 1 72  ALA 72  466 466 ALA ALA A . n 
A 1 73  CYS 73  467 467 CYS CYS A . n 
A 1 74  THR 74  468 468 THR THR A . n 
A 1 75  SER 75  469 469 SER SER A . n 
A 1 76  ILE 76  470 470 ILE ILE A . n 
A 1 77  HIS 77  471 471 HIS HIS A . n 
A 1 78  GLY 78  472 ?   ?   ?   A . n 
A 1 79  ASP 79  473 ?   ?   ?   A . n 
A 1 80  ARG 80  474 ?   ?   ?   A . n 
A 1 81  SER 81  475 ?   ?   ?   A . n 
A 1 82  GLN 82  476 ?   ?   ?   A . n 
A 1 83  ARG 83  477 ?   ?   ?   A . n 
A 1 84  ASP 84  478 ?   ?   ?   A . n 
A 1 85  ARG 85  479 ?   ?   ?   A . n 
A 1 86  GLU 86  480 480 GLU GLU A . n 
A 1 87  GLU 87  481 481 GLU GLU A . n 
A 1 88  ALA 88  482 482 ALA ALA A . n 
A 1 89  LEU 89  483 483 LEU LEU A . n 
A 1 90  HIS 90  484 484 HIS HIS A . n 
A 1 91  GLN 91  485 485 GLN GLN A . n 
A 1 92  PHE 92  486 486 PHE PHE A . n 
A 1 93  ARG 93  487 487 ARG ARG A . n 
A 1 94  SER 94  488 488 SER SER A . n 
A 1 95  GLY 95  489 489 GLY GLY A . n 
A 1 96  LYS 96  490 490 LYS LYS A . n 
A 1 97  SER 97  491 491 SER SER A . n 
A 1 98  PRO 98  492 492 PRO PRO A . n 
A 1 99  ILE 99  493 493 ILE ILE A . n 
A 1 100 LEU 100 494 494 LEU LEU A . n 
A 1 101 VAL 101 495 495 VAL VAL A . n 
A 1 102 ALA 102 496 496 ALA ALA A . n 
A 1 103 THR 103 497 497 THR THR A . n 
A 1 104 ALA 104 498 498 ALA ALA A . n 
A 1 105 VAL 105 499 ?   ?   ?   A . n 
A 1 106 ALA 106 500 ?   ?   ?   A . n 
A 1 107 ALA 107 501 ?   ?   ?   A . n 
A 1 108 ARG 108 502 ?   ?   ?   A . n 
A 1 109 GLY 109 503 ?   ?   ?   A . n 
A 1 110 LEU 110 504 ?   ?   ?   A . n 
A 1 111 ASP 111 505 505 ASP ASP A . n 
A 1 112 ILE 112 506 506 ILE ILE A . n 
A 1 113 SER 113 507 507 SER SER A . n 
A 1 114 ASN 114 508 508 ASN ASN A . n 
A 1 115 VAL 115 509 509 VAL VAL A . n 
A 1 116 LYS 116 510 510 LYS LYS A . n 
A 1 117 HIS 117 511 511 HIS HIS A . n 
A 1 118 VAL 118 512 512 VAL VAL A . n 
A 1 119 ILE 119 513 513 ILE ILE A . n 
A 1 120 ASN 120 514 514 ASN ASN A . n 
A 1 121 PHE 121 515 515 PHE PHE A . n 
A 1 122 ASP 122 516 516 ASP ASP A . n 
A 1 123 LEU 123 517 517 LEU LEU A . n 
A 1 124 PRO 124 518 518 PRO PRO A . n 
A 1 125 SER 125 519 519 SER SER A . n 
A 1 126 ASP 126 520 520 ASP ASP A . n 
A 1 127 ILE 127 521 521 ILE ILE A . n 
A 1 128 GLU 128 522 522 GLU GLU A . n 
A 1 129 GLU 129 523 523 GLU GLU A . n 
A 1 130 TYR 130 524 524 TYR TYR A . n 
A 1 131 VAL 131 525 525 VAL VAL A . n 
A 1 132 HIS 132 526 526 HIS HIS A . n 
A 1 133 ARG 133 527 527 ARG ARG A . n 
A 1 134 ILE 134 528 528 ILE ILE A . n 
A 1 135 GLY 135 529 529 GLY GLY A . n 
A 1 136 ARG 136 530 530 ARG ARG A . n 
A 1 137 THR 137 531 531 THR THR A . n 
A 1 138 GLY 138 532 532 GLY GLY A . n 
A 1 139 ARG 139 533 533 ARG ARG A . n 
A 1 140 VAL 140 534 534 VAL VAL A . n 
A 1 141 GLY 141 535 535 GLY GLY A . n 
A 1 142 ASN 142 536 536 ASN ASN A . n 
A 1 143 LEU 143 537 537 LEU LEU A . n 
A 1 144 GLY 144 538 538 GLY GLY A . n 
A 1 145 LEU 145 539 539 LEU LEU A . n 
A 1 146 ALA 146 540 540 ALA ALA A . n 
A 1 147 THR 147 541 541 THR THR A . n 
A 1 148 SER 148 542 542 SER SER A . n 
A 1 149 PHE 149 543 543 PHE PHE A . n 
A 1 150 PHE 150 544 544 PHE PHE A . n 
A 1 151 ASN 151 545 545 ASN ASN A . n 
A 1 152 GLU 152 546 546 GLU GLU A . n 
A 1 153 ARG 153 547 547 ARG ARG A . n 
A 1 154 ASN 154 548 548 ASN ASN A . n 
A 1 155 ILE 155 549 549 ILE ILE A . n 
A 1 156 ASN 156 550 550 ASN ASN A . n 
A 1 157 ILE 157 551 551 ILE ILE A . n 
A 1 158 THR 158 552 552 THR THR A . n 
A 1 159 LYS 159 553 553 LYS LYS A . n 
A 1 160 ASP 160 554 554 ASP ASP A . n 
A 1 161 LEU 161 555 555 LEU LEU A . n 
A 1 162 LEU 162 556 556 LEU LEU A . n 
A 1 163 ASP 163 557 557 ASP ASP A . n 
A 1 164 LEU 164 558 558 LEU LEU A . n 
A 1 165 LEU 165 559 559 LEU LEU A . n 
A 1 166 VAL 166 560 560 VAL VAL A . n 
A 1 167 GLU 167 561 561 GLU GLU A . n 
A 1 168 ALA 168 562 562 ALA ALA A . n 
A 1 169 LYS 169 563 563 LYS LYS A . n 
A 1 170 GLN 170 564 564 GLN GLN A . n 
A 1 171 GLU 171 565 565 GLU GLU A . n 
A 1 172 VAL 172 566 566 VAL VAL A . n 
A 1 173 PRO 173 567 567 PRO PRO A . n 
A 1 174 SER 174 568 568 SER SER A . n 
A 1 175 TRP 175 569 569 TRP TRP A . n 
A 1 176 LEU 176 570 570 LEU LEU A . n 
A 1 177 GLU 177 571 571 GLU GLU A . n 
A 1 178 ASN 178 572 572 ASN ASN A . n 
A 1 179 MET 179 573 573 MET MET A . n 
A 1 180 ALA 180 574 574 ALA ALA A . n 
A 1 181 TYR 181 575 575 TYR TYR A . n 
A 1 182 GLU 182 576 ?   ?   ?   A . n 
A 1 183 HIS 183 577 ?   ?   ?   A . n 
A 1 184 HIS 184 578 ?   ?   ?   A . n 
A 1 185 TYR 185 579 ?   ?   ?   A . n 
B 1 1   MET 1   395 ?   ?   ?   B . n 
B 1 2   HIS 2   396 ?   ?   ?   B . n 
B 1 3   HIS 3   397 ?   ?   ?   B . n 
B 1 4   HIS 4   398 ?   ?   ?   B . n 
B 1 5   HIS 5   399 ?   ?   ?   B . n 
B 1 6   HIS 6   400 ?   ?   ?   B . n 
B 1 7   HIS 7   401 ?   ?   ?   B . n 
B 1 8   GLU 8   402 ?   ?   ?   B . n 
B 1 9   ASN 9   403 ?   ?   ?   B . n 
B 1 10  LEU 10  404 ?   ?   ?   B . n 
B 1 11  TYR 11  405 ?   ?   ?   B . n 
B 1 12  PHE 12  406 ?   ?   ?   B . n 
B 1 13  GLN 13  407 ?   ?   ?   B . n 
B 1 14  GLY 14  408 408 GLY GLY B . n 
B 1 15  SER 15  409 409 SER SER B . n 
B 1 16  THR 16  410 410 THR THR B . n 
B 1 17  SER 17  411 411 SER SER B . n 
B 1 18  GLU 18  412 412 GLU GLU B . n 
B 1 19  ASN 19  413 413 ASN ASN B . n 
B 1 20  ILE 20  414 414 ILE ILE B . n 
B 1 21  THR 21  415 415 THR THR B . n 
B 1 22  GLN 22  416 416 GLN GLN B . n 
B 1 23  LYS 23  417 417 LYS LYS B . n 
B 1 24  VAL 24  418 418 VAL VAL B . n 
B 1 25  VAL 25  419 419 VAL VAL B . n 
B 1 26  TRP 26  420 420 TRP TRP B . n 
B 1 27  VAL 27  421 421 VAL VAL B . n 
B 1 28  GLU 28  422 422 GLU GLU B . n 
B 1 29  GLU 29  423 423 GLU GLU B . n 
B 1 30  SER 30  424 424 SER SER B . n 
B 1 31  ASP 31  425 425 ASP ASP B . n 
B 1 32  LYS 32  426 426 LYS LYS B . n 
B 1 33  ARG 33  427 427 ARG ARG B . n 
B 1 34  SER 34  428 428 SER SER B . n 
B 1 35  PHE 35  429 429 PHE PHE B . n 
B 1 36  LEU 36  430 430 LEU LEU B . n 
B 1 37  LEU 37  431 431 LEU LEU B . n 
B 1 38  ASP 38  432 432 ASP ASP B . n 
B 1 39  LEU 39  433 433 LEU LEU B . n 
B 1 40  LEU 40  434 434 LEU LEU B . n 
B 1 41  ASN 41  435 435 ASN ASN B . n 
B 1 42  ALA 42  436 436 ALA ALA B . n 
B 1 43  THR 43  437 437 THR THR B . n 
B 1 44  GLY 44  438 438 GLY GLY B . n 
B 1 45  LYS 45  439 ?   ?   ?   B . n 
B 1 46  ASP 46  440 ?   ?   ?   B . n 
B 1 47  SER 47  441 441 SER SER B . n 
B 1 48  LEU 48  442 442 LEU LEU B . n 
B 1 49  THR 49  443 443 THR THR B . n 
B 1 50  LEU 50  444 444 LEU LEU B . n 
B 1 51  VAL 51  445 445 VAL VAL B . n 
B 1 52  PHE 52  446 446 PHE PHE B . n 
B 1 53  VAL 53  447 447 VAL VAL B . n 
B 1 54  GLU 54  448 448 GLU GLU B . n 
B 1 55  THR 55  449 449 THR THR B . n 
B 1 56  LYS 56  450 450 LYS LYS B . n 
B 1 57  LYS 57  451 451 LYS LYS B . n 
B 1 58  GLY 58  452 452 GLY GLY B . n 
B 1 59  ALA 59  453 453 ALA ALA B . n 
B 1 60  ASP 60  454 454 ASP ASP B . n 
B 1 61  SER 61  455 455 SER SER B . n 
B 1 62  LEU 62  456 456 LEU LEU B . n 
B 1 63  GLU 63  457 457 GLU GLU B . n 
B 1 64  ASP 64  458 458 ASP ASP B . n 
B 1 65  PHE 65  459 459 PHE PHE B . n 
B 1 66  LEU 66  460 460 LEU LEU B . n 
B 1 67  TYR 67  461 461 TYR TYR B . n 
B 1 68  HIS 68  462 462 HIS HIS B . n 
B 1 69  GLU 69  463 463 GLU GLU B . n 
B 1 70  GLY 70  464 464 GLY GLY B . n 
B 1 71  TYR 71  465 465 TYR TYR B . n 
B 1 72  ALA 72  466 466 ALA ALA B . n 
B 1 73  CYS 73  467 467 CYS CYS B . n 
B 1 74  THR 74  468 468 THR THR B . n 
B 1 75  SER 75  469 469 SER SER B . n 
B 1 76  ILE 76  470 470 ILE ILE B . n 
B 1 77  HIS 77  471 471 HIS HIS B . n 
B 1 78  GLY 78  472 472 GLY GLY B . n 
B 1 79  ASP 79  473 473 ASP ASP B . n 
B 1 80  ARG 80  474 474 ARG ARG B . n 
B 1 81  SER 81  475 475 SER SER B . n 
B 1 82  GLN 82  476 476 GLN GLN B . n 
B 1 83  ARG 83  477 477 ARG ARG B . n 
B 1 84  ASP 84  478 478 ASP ASP B . n 
B 1 85  ARG 85  479 479 ARG ARG B . n 
B 1 86  GLU 86  480 480 GLU GLU B . n 
B 1 87  GLU 87  481 481 GLU GLU B . n 
B 1 88  ALA 88  482 482 ALA ALA B . n 
B 1 89  LEU 89  483 483 LEU LEU B . n 
B 1 90  HIS 90  484 484 HIS HIS B . n 
B 1 91  GLN 91  485 485 GLN GLN B . n 
B 1 92  PHE 92  486 486 PHE PHE B . n 
B 1 93  ARG 93  487 487 ARG ARG B . n 
B 1 94  SER 94  488 488 SER SER B . n 
B 1 95  GLY 95  489 489 GLY GLY B . n 
B 1 96  LYS 96  490 490 LYS LYS B . n 
B 1 97  SER 97  491 491 SER SER B . n 
B 1 98  PRO 98  492 492 PRO PRO B . n 
B 1 99  ILE 99  493 493 ILE ILE B . n 
B 1 100 LEU 100 494 494 LEU LEU B . n 
B 1 101 VAL 101 495 495 VAL VAL B . n 
B 1 102 ALA 102 496 496 ALA ALA B . n 
B 1 103 THR 103 497 497 THR THR B . n 
B 1 104 ALA 104 498 498 ALA ALA B . n 
B 1 105 VAL 105 499 499 VAL VAL B . n 
B 1 106 ALA 106 500 500 ALA ALA B . n 
B 1 107 ALA 107 501 ?   ?   ?   B . n 
B 1 108 ARG 108 502 ?   ?   ?   B . n 
B 1 109 GLY 109 503 ?   ?   ?   B . n 
B 1 110 LEU 110 504 ?   ?   ?   B . n 
B 1 111 ASP 111 505 ?   ?   ?   B . n 
B 1 112 ILE 112 506 506 ILE ILE B . n 
B 1 113 SER 113 507 507 SER SER B . n 
B 1 114 ASN 114 508 508 ASN ASN B . n 
B 1 115 VAL 115 509 509 VAL VAL B . n 
B 1 116 LYS 116 510 510 LYS LYS B . n 
B 1 117 HIS 117 511 511 HIS HIS B . n 
B 1 118 VAL 118 512 512 VAL VAL B . n 
B 1 119 ILE 119 513 513 ILE ILE B . n 
B 1 120 ASN 120 514 514 ASN ASN B . n 
B 1 121 PHE 121 515 515 PHE PHE B . n 
B 1 122 ASP 122 516 516 ASP ASP B . n 
B 1 123 LEU 123 517 517 LEU LEU B . n 
B 1 124 PRO 124 518 518 PRO PRO B . n 
B 1 125 SER 125 519 519 SER SER B . n 
B 1 126 ASP 126 520 520 ASP ASP B . n 
B 1 127 ILE 127 521 521 ILE ILE B . n 
B 1 128 GLU 128 522 522 GLU GLU B . n 
B 1 129 GLU 129 523 523 GLU GLU B . n 
B 1 130 TYR 130 524 524 TYR TYR B . n 
B 1 131 VAL 131 525 525 VAL VAL B . n 
B 1 132 HIS 132 526 526 HIS HIS B . n 
B 1 133 ARG 133 527 527 ARG ARG B . n 
B 1 134 ILE 134 528 528 ILE ILE B . n 
B 1 135 GLY 135 529 529 GLY GLY B . n 
B 1 136 ARG 136 530 530 ARG ARG B . n 
B 1 137 THR 137 531 531 THR THR B . n 
B 1 138 GLY 138 532 532 GLY GLY B . n 
B 1 139 ARG 139 533 533 ARG ARG B . n 
B 1 140 VAL 140 534 534 VAL VAL B . n 
B 1 141 GLY 141 535 535 GLY GLY B . n 
B 1 142 ASN 142 536 536 ASN ASN B . n 
B 1 143 LEU 143 537 537 LEU LEU B . n 
B 1 144 GLY 144 538 538 GLY GLY B . n 
B 1 145 LEU 145 539 539 LEU LEU B . n 
B 1 146 ALA 146 540 540 ALA ALA B . n 
B 1 147 THR 147 541 541 THR THR B . n 
B 1 148 SER 148 542 542 SER SER B . n 
B 1 149 PHE 149 543 543 PHE PHE B . n 
B 1 150 PHE 150 544 544 PHE PHE B . n 
B 1 151 ASN 151 545 545 ASN ASN B . n 
B 1 152 GLU 152 546 546 GLU GLU B . n 
B 1 153 ARG 153 547 547 ARG ARG B . n 
B 1 154 ASN 154 548 548 ASN ASN B . n 
B 1 155 ILE 155 549 549 ILE ILE B . n 
B 1 156 ASN 156 550 550 ASN ASN B . n 
B 1 157 ILE 157 551 551 ILE ILE B . n 
B 1 158 THR 158 552 552 THR THR B . n 
B 1 159 LYS 159 553 553 LYS LYS B . n 
B 1 160 ASP 160 554 554 ASP ASP B . n 
B 1 161 LEU 161 555 555 LEU LEU B . n 
B 1 162 LEU 162 556 556 LEU LEU B . n 
B 1 163 ASP 163 557 557 ASP ASP B . n 
B 1 164 LEU 164 558 558 LEU LEU B . n 
B 1 165 LEU 165 559 559 LEU LEU B . n 
B 1 166 VAL 166 560 560 VAL VAL B . n 
B 1 167 GLU 167 561 561 GLU GLU B . n 
B 1 168 ALA 168 562 562 ALA ALA B . n 
B 1 169 LYS 169 563 563 LYS LYS B . n 
B 1 170 GLN 170 564 564 GLN GLN B . n 
B 1 171 GLU 171 565 565 GLU GLU B . n 
B 1 172 VAL 172 566 566 VAL VAL B . n 
B 1 173 PRO 173 567 567 PRO PRO B . n 
B 1 174 SER 174 568 568 SER SER B . n 
B 1 175 TRP 175 569 569 TRP TRP B . n 
B 1 176 LEU 176 570 570 LEU LEU B . n 
B 1 177 GLU 177 571 571 GLU GLU B . n 
B 1 178 ASN 178 572 572 ASN ASN B . n 
B 1 179 MET 179 573 573 MET MET B . n 
B 1 180 ALA 180 574 574 ALA ALA B . n 
B 1 181 TYR 181 575 575 TYR TYR B . n 
B 1 182 GLU 182 576 ?   ?   ?   B . n 
B 1 183 HIS 183 577 ?   ?   ?   B . n 
B 1 184 HIS 184 578 ?   ?   ?   B . n 
B 1 185 TYR 185 579 ?   ?   ?   B . n 
C 1 1   MET 1   395 ?   ?   ?   C . n 
C 1 2   HIS 2   396 ?   ?   ?   C . n 
C 1 3   HIS 3   397 ?   ?   ?   C . n 
C 1 4   HIS 4   398 ?   ?   ?   C . n 
C 1 5   HIS 5   399 ?   ?   ?   C . n 
C 1 6   HIS 6   400 ?   ?   ?   C . n 
C 1 7   HIS 7   401 ?   ?   ?   C . n 
C 1 8   GLU 8   402 ?   ?   ?   C . n 
C 1 9   ASN 9   403 ?   ?   ?   C . n 
C 1 10  LEU 10  404 ?   ?   ?   C . n 
C 1 11  TYR 11  405 ?   ?   ?   C . n 
C 1 12  PHE 12  406 ?   ?   ?   C . n 
C 1 13  GLN 13  407 ?   ?   ?   C . n 
C 1 14  GLY 14  408 ?   ?   ?   C . n 
C 1 15  SER 15  409 ?   ?   ?   C . n 
C 1 16  THR 16  410 ?   ?   ?   C . n 
C 1 17  SER 17  411 411 SER SER C . n 
C 1 18  GLU 18  412 412 GLU GLU C . n 
C 1 19  ASN 19  413 413 ASN ASN C . n 
C 1 20  ILE 20  414 414 ILE ILE C . n 
C 1 21  THR 21  415 415 THR THR C . n 
C 1 22  GLN 22  416 416 GLN GLN C . n 
C 1 23  LYS 23  417 417 LYS LYS C . n 
C 1 24  VAL 24  418 418 VAL VAL C . n 
C 1 25  VAL 25  419 419 VAL VAL C . n 
C 1 26  TRP 26  420 420 TRP TRP C . n 
C 1 27  VAL 27  421 421 VAL VAL C . n 
C 1 28  GLU 28  422 422 GLU GLU C . n 
C 1 29  GLU 29  423 423 GLU GLU C . n 
C 1 30  SER 30  424 424 SER SER C . n 
C 1 31  ASP 31  425 425 ASP ASP C . n 
C 1 32  LYS 32  426 426 LYS LYS C . n 
C 1 33  ARG 33  427 427 ARG ARG C . n 
C 1 34  SER 34  428 428 SER SER C . n 
C 1 35  PHE 35  429 429 PHE PHE C . n 
C 1 36  LEU 36  430 430 LEU LEU C . n 
C 1 37  LEU 37  431 431 LEU LEU C . n 
C 1 38  ASP 38  432 432 ASP ASP C . n 
C 1 39  LEU 39  433 433 LEU LEU C . n 
C 1 40  LEU 40  434 434 LEU LEU C . n 
C 1 41  ASN 41  435 435 ASN ASN C . n 
C 1 42  ALA 42  436 ?   ?   ?   C . n 
C 1 43  THR 43  437 437 THR THR C . n 
C 1 44  GLY 44  438 438 GLY GLY C . n 
C 1 45  LYS 45  439 ?   ?   ?   C . n 
C 1 46  ASP 46  440 ?   ?   ?   C . n 
C 1 47  SER 47  441 441 SER SER C . n 
C 1 48  LEU 48  442 442 LEU LEU C . n 
C 1 49  THR 49  443 443 THR THR C . n 
C 1 50  LEU 50  444 444 LEU LEU C . n 
C 1 51  VAL 51  445 445 VAL VAL C . n 
C 1 52  PHE 52  446 446 PHE PHE C . n 
C 1 53  VAL 53  447 447 VAL VAL C . n 
C 1 54  GLU 54  448 448 GLU GLU C . n 
C 1 55  THR 55  449 449 THR THR C . n 
C 1 56  LYS 56  450 450 LYS LYS C . n 
C 1 57  LYS 57  451 451 LYS LYS C . n 
C 1 58  GLY 58  452 452 GLY GLY C . n 
C 1 59  ALA 59  453 453 ALA ALA C . n 
C 1 60  ASP 60  454 454 ASP ASP C . n 
C 1 61  SER 61  455 455 SER SER C . n 
C 1 62  LEU 62  456 456 LEU LEU C . n 
C 1 63  GLU 63  457 457 GLU GLU C . n 
C 1 64  ASP 64  458 458 ASP ASP C . n 
C 1 65  PHE 65  459 459 PHE PHE C . n 
C 1 66  LEU 66  460 460 LEU LEU C . n 
C 1 67  TYR 67  461 461 TYR TYR C . n 
C 1 68  HIS 68  462 462 HIS HIS C . n 
C 1 69  GLU 69  463 463 GLU GLU C . n 
C 1 70  GLY 70  464 464 GLY GLY C . n 
C 1 71  TYR 71  465 465 TYR TYR C . n 
C 1 72  ALA 72  466 466 ALA ALA C . n 
C 1 73  CYS 73  467 467 CYS CYS C . n 
C 1 74  THR 74  468 468 THR THR C . n 
C 1 75  SER 75  469 469 SER SER C . n 
C 1 76  ILE 76  470 470 ILE ILE C . n 
C 1 77  HIS 77  471 471 HIS HIS C . n 
C 1 78  GLY 78  472 472 GLY GLY C . n 
C 1 79  ASP 79  473 473 ASP ASP C . n 
C 1 80  ARG 80  474 474 ARG ARG C . n 
C 1 81  SER 81  475 475 SER SER C . n 
C 1 82  GLN 82  476 ?   ?   ?   C . n 
C 1 83  ARG 83  477 ?   ?   ?   C . n 
C 1 84  ASP 84  478 ?   ?   ?   C . n 
C 1 85  ARG 85  479 479 ARG ARG C . n 
C 1 86  GLU 86  480 480 GLU GLU C . n 
C 1 87  GLU 87  481 481 GLU GLU C . n 
C 1 88  ALA 88  482 482 ALA ALA C . n 
C 1 89  LEU 89  483 483 LEU LEU C . n 
C 1 90  HIS 90  484 484 HIS HIS C . n 
C 1 91  GLN 91  485 485 GLN GLN C . n 
C 1 92  PHE 92  486 486 PHE PHE C . n 
C 1 93  ARG 93  487 487 ARG ARG C . n 
C 1 94  SER 94  488 488 SER SER C . n 
C 1 95  GLY 95  489 489 GLY GLY C . n 
C 1 96  LYS 96  490 490 LYS LYS C . n 
C 1 97  SER 97  491 491 SER SER C . n 
C 1 98  PRO 98  492 492 PRO PRO C . n 
C 1 99  ILE 99  493 493 ILE ILE C . n 
C 1 100 LEU 100 494 494 LEU LEU C . n 
C 1 101 VAL 101 495 495 VAL VAL C . n 
C 1 102 ALA 102 496 496 ALA ALA C . n 
C 1 103 THR 103 497 497 THR THR C . n 
C 1 104 ALA 104 498 498 ALA ALA C . n 
C 1 105 VAL 105 499 499 VAL VAL C . n 
C 1 106 ALA 106 500 500 ALA ALA C . n 
C 1 107 ALA 107 501 501 ALA ALA C . n 
C 1 108 ARG 108 502 502 ARG ARG C . n 
C 1 109 GLY 109 503 503 GLY GLY C . n 
C 1 110 LEU 110 504 504 LEU LEU C . n 
C 1 111 ASP 111 505 505 ASP ASP C . n 
C 1 112 ILE 112 506 506 ILE ILE C . n 
C 1 113 SER 113 507 507 SER SER C . n 
C 1 114 ASN 114 508 508 ASN ASN C . n 
C 1 115 VAL 115 509 509 VAL VAL C . n 
C 1 116 LYS 116 510 510 LYS LYS C . n 
C 1 117 HIS 117 511 511 HIS HIS C . n 
C 1 118 VAL 118 512 512 VAL VAL C . n 
C 1 119 ILE 119 513 513 ILE ILE C . n 
C 1 120 ASN 120 514 514 ASN ASN C . n 
C 1 121 PHE 121 515 515 PHE PHE C . n 
C 1 122 ASP 122 516 516 ASP ASP C . n 
C 1 123 LEU 123 517 517 LEU LEU C . n 
C 1 124 PRO 124 518 518 PRO PRO C . n 
C 1 125 SER 125 519 519 SER SER C . n 
C 1 126 ASP 126 520 520 ASP ASP C . n 
C 1 127 ILE 127 521 521 ILE ILE C . n 
C 1 128 GLU 128 522 522 GLU GLU C . n 
C 1 129 GLU 129 523 523 GLU GLU C . n 
C 1 130 TYR 130 524 524 TYR TYR C . n 
C 1 131 VAL 131 525 525 VAL VAL C . n 
C 1 132 HIS 132 526 526 HIS HIS C . n 
C 1 133 ARG 133 527 527 ARG ARG C . n 
C 1 134 ILE 134 528 528 ILE ILE C . n 
C 1 135 GLY 135 529 529 GLY GLY C . n 
C 1 136 ARG 136 530 530 ARG ARG C . n 
C 1 137 THR 137 531 531 THR THR C . n 
C 1 138 GLY 138 532 532 GLY GLY C . n 
C 1 139 ARG 139 533 533 ARG ARG C . n 
C 1 140 VAL 140 534 534 VAL VAL C . n 
C 1 141 GLY 141 535 535 GLY GLY C . n 
C 1 142 ASN 142 536 536 ASN ASN C . n 
C 1 143 LEU 143 537 537 LEU LEU C . n 
C 1 144 GLY 144 538 538 GLY GLY C . n 
C 1 145 LEU 145 539 539 LEU LEU C . n 
C 1 146 ALA 146 540 540 ALA ALA C . n 
C 1 147 THR 147 541 541 THR THR C . n 
C 1 148 SER 148 542 542 SER SER C . n 
C 1 149 PHE 149 543 543 PHE PHE C . n 
C 1 150 PHE 150 544 544 PHE PHE C . n 
C 1 151 ASN 151 545 545 ASN ASN C . n 
C 1 152 GLU 152 546 546 GLU GLU C . n 
C 1 153 ARG 153 547 547 ARG ARG C . n 
C 1 154 ASN 154 548 548 ASN ASN C . n 
C 1 155 ILE 155 549 549 ILE ILE C . n 
C 1 156 ASN 156 550 550 ASN ASN C . n 
C 1 157 ILE 157 551 551 ILE ILE C . n 
C 1 158 THR 158 552 552 THR THR C . n 
C 1 159 LYS 159 553 553 LYS LYS C . n 
C 1 160 ASP 160 554 554 ASP ASP C . n 
C 1 161 LEU 161 555 555 LEU LEU C . n 
C 1 162 LEU 162 556 556 LEU LEU C . n 
C 1 163 ASP 163 557 557 ASP ASP C . n 
C 1 164 LEU 164 558 558 LEU LEU C . n 
C 1 165 LEU 165 559 559 LEU LEU C . n 
C 1 166 VAL 166 560 560 VAL VAL C . n 
C 1 167 GLU 167 561 561 GLU GLU C . n 
C 1 168 ALA 168 562 562 ALA ALA C . n 
C 1 169 LYS 169 563 563 LYS LYS C . n 
C 1 170 GLN 170 564 564 GLN GLN C . n 
C 1 171 GLU 171 565 565 GLU GLU C . n 
C 1 172 VAL 172 566 566 VAL VAL C . n 
C 1 173 PRO 173 567 567 PRO PRO C . n 
C 1 174 SER 174 568 568 SER SER C . n 
C 1 175 TRP 175 569 569 TRP TRP C . n 
C 1 176 LEU 176 570 570 LEU LEU C . n 
C 1 177 GLU 177 571 571 GLU GLU C . n 
C 1 178 ASN 178 572 572 ASN ASN C . n 
C 1 179 MET 179 573 573 MET MET C . n 
C 1 180 ALA 180 574 574 ALA ALA C . n 
C 1 181 TYR 181 575 ?   ?   ?   C . n 
C 1 182 GLU 182 576 ?   ?   ?   C . n 
C 1 183 HIS 183 577 ?   ?   ?   C . n 
C 1 184 HIS 184 578 ?   ?   ?   C . n 
C 1 185 TYR 185 579 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1  2001 2001 HOH HOH A . 
D 2 HOH 2  2002 2002 HOH HOH A . 
D 2 HOH 3  2003 2003 HOH HOH A . 
D 2 HOH 4  2004 2004 HOH HOH A . 
D 2 HOH 5  2005 2005 HOH HOH A . 
D 2 HOH 6  2006 2006 HOH HOH A . 
D 2 HOH 7  2007 2007 HOH HOH A . 
D 2 HOH 8  2008 2008 HOH HOH A . 
D 2 HOH 9  2009 2009 HOH HOH A . 
D 2 HOH 10 2010 2010 HOH HOH A . 
D 2 HOH 11 2011 2011 HOH HOH A . 
D 2 HOH 12 2012 2012 HOH HOH A . 
D 2 HOH 13 2013 2013 HOH HOH A . 
D 2 HOH 14 2014 2014 HOH HOH A . 
D 2 HOH 15 2015 2015 HOH HOH A . 
D 2 HOH 16 2016 2016 HOH HOH A . 
D 2 HOH 17 2017 2017 HOH HOH A . 
D 2 HOH 18 2018 2018 HOH HOH A . 
D 2 HOH 19 2019 2019 HOH HOH A . 
D 2 HOH 20 2020 2020 HOH HOH A . 
D 2 HOH 21 2021 2021 HOH HOH A . 
D 2 HOH 22 2022 2022 HOH HOH A . 
D 2 HOH 23 2023 2023 HOH HOH A . 
D 2 HOH 24 2024 2024 HOH HOH A . 
D 2 HOH 25 2025 2025 HOH HOH A . 
D 2 HOH 26 2026 2026 HOH HOH A . 
D 2 HOH 27 2027 2027 HOH HOH A . 
D 2 HOH 28 2028 2028 HOH HOH A . 
D 2 HOH 29 2029 2029 HOH HOH A . 
D 2 HOH 30 2030 2030 HOH HOH A . 
D 2 HOH 31 2031 2031 HOH HOH A . 
D 2 HOH 32 2032 2032 HOH HOH A . 
D 2 HOH 33 2033 2033 HOH HOH A . 
D 2 HOH 34 2034 2034 HOH HOH A . 
D 2 HOH 35 2035 2035 HOH HOH A . 
D 2 HOH 36 2036 2036 HOH HOH A . 
D 2 HOH 37 2037 2037 HOH HOH A . 
D 2 HOH 38 2038 2038 HOH HOH A . 
D 2 HOH 39 2039 2039 HOH HOH A . 
D 2 HOH 40 2040 2040 HOH HOH A . 
D 2 HOH 41 2041 2041 HOH HOH A . 
D 2 HOH 42 2042 2042 HOH HOH A . 
D 2 HOH 43 2043 2043 HOH HOH A . 
D 2 HOH 44 2044 2044 HOH HOH A . 
D 2 HOH 45 2045 2045 HOH HOH A . 
D 2 HOH 46 2046 2046 HOH HOH A . 
D 2 HOH 47 2047 2047 HOH HOH A . 
D 2 HOH 48 2048 2048 HOH HOH A . 
D 2 HOH 49 2049 2049 HOH HOH A . 
D 2 HOH 50 2050 2050 HOH HOH A . 
E 2 HOH 1  2001 2001 HOH HOH B . 
E 2 HOH 2  2002 2002 HOH HOH B . 
E 2 HOH 3  2003 2003 HOH HOH B . 
E 2 HOH 4  2004 2004 HOH HOH B . 
E 2 HOH 5  2005 2005 HOH HOH B . 
E 2 HOH 6  2006 2006 HOH HOH B . 
E 2 HOH 7  2007 2007 HOH HOH B . 
E 2 HOH 8  2008 2008 HOH HOH B . 
E 2 HOH 9  2009 2009 HOH HOH B . 
E 2 HOH 10 2010 2010 HOH HOH B . 
E 2 HOH 11 2011 2011 HOH HOH B . 
E 2 HOH 12 2012 2012 HOH HOH B . 
E 2 HOH 13 2013 2013 HOH HOH B . 
E 2 HOH 14 2014 2014 HOH HOH B . 
E 2 HOH 15 2015 2015 HOH HOH B . 
E 2 HOH 16 2016 2016 HOH HOH B . 
E 2 HOH 17 2017 2017 HOH HOH B . 
E 2 HOH 18 2018 2018 HOH HOH B . 
E 2 HOH 19 2019 2019 HOH HOH B . 
E 2 HOH 20 2020 2020 HOH HOH B . 
E 2 HOH 21 2021 2021 HOH HOH B . 
E 2 HOH 22 2022 2022 HOH HOH B . 
E 2 HOH 23 2023 2023 HOH HOH B . 
E 2 HOH 24 2024 2024 HOH HOH B . 
E 2 HOH 25 2025 2025 HOH HOH B . 
E 2 HOH 26 2026 2026 HOH HOH B . 
E 2 HOH 27 2027 2027 HOH HOH B . 
E 2 HOH 28 2028 2028 HOH HOH B . 
E 2 HOH 29 2029 2029 HOH HOH B . 
E 2 HOH 30 2030 2030 HOH HOH B . 
E 2 HOH 31 2031 2031 HOH HOH B . 
E 2 HOH 32 2032 2032 HOH HOH B . 
E 2 HOH 33 2033 2033 HOH HOH B . 
E 2 HOH 34 2034 2034 HOH HOH B . 
E 2 HOH 35 2035 2035 HOH HOH B . 
E 2 HOH 36 2036 2036 HOH HOH B . 
E 2 HOH 37 2037 2037 HOH HOH B . 
E 2 HOH 38 2038 2038 HOH HOH B . 
E 2 HOH 39 2039 2039 HOH HOH B . 
E 2 HOH 40 2040 2040 HOH HOH B . 
E 2 HOH 41 2041 2041 HOH HOH B . 
E 2 HOH 42 2042 2042 HOH HOH B . 
E 2 HOH 43 2043 2043 HOH HOH B . 
E 2 HOH 44 2044 2044 HOH HOH B . 
E 2 HOH 45 2045 2045 HOH HOH B . 
E 2 HOH 46 2046 2046 HOH HOH B . 
E 2 HOH 47 2047 2047 HOH HOH B . 
E 2 HOH 48 2048 2048 HOH HOH B . 
E 2 HOH 49 2049 2049 HOH HOH B . 
E 2 HOH 50 2050 2050 HOH HOH B . 
E 2 HOH 51 2051 2051 HOH HOH B . 
E 2 HOH 52 2052 2052 HOH HOH B . 
E 2 HOH 53 2053 2053 HOH HOH B . 
E 2 HOH 54 2054 2054 HOH HOH B . 
E 2 HOH 55 2055 2055 HOH HOH B . 
E 2 HOH 56 2056 2056 HOH HOH B . 
E 2 HOH 57 2057 2057 HOH HOH B . 
E 2 HOH 58 2058 2058 HOH HOH B . 
E 2 HOH 59 2059 2059 HOH HOH B . 
E 2 HOH 60 2060 2060 HOH HOH B . 
E 2 HOH 61 2061 2061 HOH HOH B . 
E 2 HOH 62 2062 2062 HOH HOH B . 
E 2 HOH 63 2063 2063 HOH HOH B . 
F 2 HOH 1  2001 2001 HOH HOH C . 
F 2 HOH 2  2002 2002 HOH HOH C . 
F 2 HOH 3  2003 2003 HOH HOH C . 
F 2 HOH 4  2004 2004 HOH HOH C . 
F 2 HOH 5  2005 2005 HOH HOH C . 
F 2 HOH 6  2006 2006 HOH HOH C . 
F 2 HOH 7  2007 2007 HOH HOH C . 
F 2 HOH 8  2008 2008 HOH HOH C . 
F 2 HOH 9  2009 2009 HOH HOH C . 
F 2 HOH 10 2010 2010 HOH HOH C . 
F 2 HOH 11 2011 2011 HOH HOH C . 
F 2 HOH 12 2012 2012 HOH HOH C . 
F 2 HOH 13 2013 2013 HOH HOH C . 
F 2 HOH 14 2014 2014 HOH HOH C . 
F 2 HOH 15 2015 2015 HOH HOH C . 
F 2 HOH 16 2016 2016 HOH HOH C . 
F 2 HOH 17 2017 2017 HOH HOH C . 
F 2 HOH 18 2018 2018 HOH HOH C . 
F 2 HOH 19 2019 2019 HOH HOH C . 
F 2 HOH 20 2020 2020 HOH HOH C . 
F 2 HOH 21 2021 2021 HOH HOH C . 
F 2 HOH 22 2022 2022 HOH HOH C . 
F 2 HOH 23 2023 2023 HOH HOH C . 
F 2 HOH 24 2024 2024 HOH HOH C . 
F 2 HOH 25 2025 2025 HOH HOH C . 
F 2 HOH 26 2026 2026 HOH HOH C . 
F 2 HOH 27 2027 2027 HOH HOH C . 
F 2 HOH 28 2028 2028 HOH HOH C . 
F 2 HOH 29 2029 2029 HOH HOH C . 
F 2 HOH 30 2030 2030 HOH HOH C . 
F 2 HOH 31 2031 2031 HOH HOH C . 
F 2 HOH 32 2032 2032 HOH HOH C . 
F 2 HOH 33 2033 2033 HOH HOH C . 
F 2 HOH 34 2034 2034 HOH HOH C . 
F 2 HOH 35 2035 2035 HOH HOH C . 
F 2 HOH 36 2036 2036 HOH HOH C . 
F 2 HOH 37 2037 2037 HOH HOH C . 
F 2 HOH 38 2038 2038 HOH HOH C . 
F 2 HOH 39 2039 2039 HOH HOH C . 
F 2 HOH 40 2040 2040 HOH HOH C . 
F 2 HOH 41 2041 2041 HOH HOH C . 
F 2 HOH 42 2042 2042 HOH HOH C . 
F 2 HOH 43 2043 2043 HOH HOH C . 
F 2 HOH 44 2044 2044 HOH HOH C . 
F 2 HOH 45 2045 2045 HOH HOH C . 
F 2 HOH 46 2046 2046 HOH HOH C . 
F 2 HOH 47 2047 2047 HOH HOH C . 
F 2 HOH 48 2048 2048 HOH HOH C . 
F 2 HOH 49 2049 2049 HOH HOH C . 
F 2 HOH 50 2050 2050 HOH HOH C . 
F 2 HOH 51 2051 2051 HOH HOH C . 
F 2 HOH 52 2052 2052 HOH HOH C . 
F 2 HOH 53 2053 2053 HOH HOH C . 
F 2 HOH 54 2054 2054 HOH HOH C . 
F 2 HOH 55 2055 2055 HOH HOH C . 
F 2 HOH 56 2056 2056 HOH HOH C . 
F 2 HOH 57 2057 2057 HOH HOH C . 
F 2 HOH 58 2058 2058 HOH HOH C . 
F 2 HOH 59 2059 2059 HOH HOH C . 
F 2 HOH 60 2060 2060 HOH HOH C . 
F 2 HOH 61 2061 2061 HOH HOH C . 
F 2 HOH 62 2062 2062 HOH HOH C . 
F 2 HOH 63 2063 2063 HOH HOH C . 
F 2 HOH 64 2064 2064 HOH HOH C . 
F 2 HOH 65 2065 2065 HOH HOH C . 
F 2 HOH 66 2066 2066 HOH HOH C . 
F 2 HOH 67 2067 2067 HOH HOH C . 
F 2 HOH 68 2068 2068 HOH HOH C . 
F 2 HOH 69 2069 2069 HOH HOH C . 
F 2 HOH 70 2070 2070 HOH HOH C . 
F 2 HOH 71 2071 2071 HOH HOH C . 
F 2 HOH 72 2072 2072 HOH HOH C . 
F 2 HOH 73 2073 2073 HOH HOH C . 
F 2 HOH 74 2074 2074 HOH HOH C . 
F 2 HOH 75 2075 2075 HOH HOH C . 
F 2 HOH 76 2076 2076 HOH HOH C . 
F 2 HOH 77 2077 2077 HOH HOH C . 
F 2 HOH 78 2078 2078 HOH HOH C . 
F 2 HOH 79 2079 2079 HOH HOH C . 
F 2 HOH 80 2080 2080 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D 
2 1 B,E 
3 1 C,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-05-13 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-05-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' Other                       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 5.4200  12.3610 59.9140 -0.0483 -0.0214 -0.0124 0.0257  0.0101 -0.0246 3.8156 2.0639 5.1522 
-0.0403 0.5638 1.0025  0.1718  -0.1067 -0.2711 0.1053 0.0604  0.0037  0.6675  0.2340  -0.2322 
'X-RAY DIFFRACTION' 2 ? refined -9.2100 40.4340 55.0360 -0.0546 0.0562  -0.0535 -0.0204 0.0303 0.0355  3.2175 2.4328 2.9587 0.2942 
0.0123 -1.1866 -0.0665 0.3259  0.1496  0.1014 -0.0914 -0.1061 -0.3563 0.1940  0.1579  
'X-RAY DIFFRACTION' 3 ? refined 20.6290 30.2500 83.3460 -0.0213 0.0575  -0.0062 0.0240  0.0624 -0.0421 2.2663 2.4233 2.5952 0.1414 
0.2339 -0.2414 0.0156  -0.0936 0.0505  0.2756 -0.0242 -0.0147 -0.1015 -0.0628 0.0086  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 410 ? ? A 575 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 408 ? ? B 575 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 411 ? ? C 574 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0019 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 C ASN 508  ? ? O C HOH 2043 ? ? 1.96 
2 1 O   C HOH 2046 ? ? O C HOH 2048 ? ? 2.06 
3 1 NZ  A LYS 510  ? ? O A HOH 2026 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2001 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2026 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_546 
_pdbx_validate_symm_contact.dist              2.05 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              483 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              483 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              483 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.68 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            15.38 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 395 ? A MET 1   
2  1 Y 1 A HIS 396 ? A HIS 2   
3  1 Y 1 A HIS 397 ? A HIS 3   
4  1 Y 1 A HIS 398 ? A HIS 4   
5  1 Y 1 A HIS 399 ? A HIS 5   
6  1 Y 1 A HIS 400 ? A HIS 6   
7  1 Y 1 A HIS 401 ? A HIS 7   
8  1 Y 1 A GLU 402 ? A GLU 8   
9  1 Y 1 A ASN 403 ? A ASN 9   
10 1 Y 1 A LEU 404 ? A LEU 10  
11 1 Y 1 A TYR 405 ? A TYR 11  
12 1 Y 1 A PHE 406 ? A PHE 12  
13 1 Y 1 A GLN 407 ? A GLN 13  
14 1 Y 1 A GLY 408 ? A GLY 14  
15 1 Y 1 A SER 409 ? A SER 15  
16 1 Y 1 A GLY 438 ? A GLY 44  
17 1 Y 1 A GLY 472 ? A GLY 78  
18 1 Y 1 A ASP 473 ? A ASP 79  
19 1 Y 1 A ARG 474 ? A ARG 80  
20 1 Y 1 A SER 475 ? A SER 81  
21 1 Y 1 A GLN 476 ? A GLN 82  
22 1 Y 1 A ARG 477 ? A ARG 83  
23 1 Y 1 A ASP 478 ? A ASP 84  
24 1 Y 1 A ARG 479 ? A ARG 85  
25 1 Y 1 A VAL 499 ? A VAL 105 
26 1 Y 1 A ALA 500 ? A ALA 106 
27 1 Y 1 A ALA 501 ? A ALA 107 
28 1 Y 1 A ARG 502 ? A ARG 108 
29 1 Y 1 A GLY 503 ? A GLY 109 
30 1 Y 1 A LEU 504 ? A LEU 110 
31 1 Y 1 A GLU 576 ? A GLU 182 
32 1 Y 1 A HIS 577 ? A HIS 183 
33 1 Y 1 A HIS 578 ? A HIS 184 
34 1 Y 1 A TYR 579 ? A TYR 185 
35 1 Y 1 B MET 395 ? B MET 1   
36 1 Y 1 B HIS 396 ? B HIS 2   
37 1 Y 1 B HIS 397 ? B HIS 3   
38 1 Y 1 B HIS 398 ? B HIS 4   
39 1 Y 1 B HIS 399 ? B HIS 5   
40 1 Y 1 B HIS 400 ? B HIS 6   
41 1 Y 1 B HIS 401 ? B HIS 7   
42 1 Y 1 B GLU 402 ? B GLU 8   
43 1 Y 1 B ASN 403 ? B ASN 9   
44 1 Y 1 B LEU 404 ? B LEU 10  
45 1 Y 1 B TYR 405 ? B TYR 11  
46 1 Y 1 B PHE 406 ? B PHE 12  
47 1 Y 1 B GLN 407 ? B GLN 13  
48 1 Y 1 B LYS 439 ? B LYS 45  
49 1 Y 1 B ASP 440 ? B ASP 46  
50 1 Y 1 B ALA 501 ? B ALA 107 
51 1 Y 1 B ARG 502 ? B ARG 108 
52 1 Y 1 B GLY 503 ? B GLY 109 
53 1 Y 1 B LEU 504 ? B LEU 110 
54 1 Y 1 B ASP 505 ? B ASP 111 
55 1 Y 1 B GLU 576 ? B GLU 182 
56 1 Y 1 B HIS 577 ? B HIS 183 
57 1 Y 1 B HIS 578 ? B HIS 184 
58 1 Y 1 B TYR 579 ? B TYR 185 
59 1 Y 1 C MET 395 ? C MET 1   
60 1 Y 1 C HIS 396 ? C HIS 2   
61 1 Y 1 C HIS 397 ? C HIS 3   
62 1 Y 1 C HIS 398 ? C HIS 4   
63 1 Y 1 C HIS 399 ? C HIS 5   
64 1 Y 1 C HIS 400 ? C HIS 6   
65 1 Y 1 C HIS 401 ? C HIS 7   
66 1 Y 1 C GLU 402 ? C GLU 8   
67 1 Y 1 C ASN 403 ? C ASN 9   
68 1 Y 1 C LEU 404 ? C LEU 10  
69 1 Y 1 C TYR 405 ? C TYR 11  
70 1 Y 1 C PHE 406 ? C PHE 12  
71 1 Y 1 C GLN 407 ? C GLN 13  
72 1 Y 1 C GLY 408 ? C GLY 14  
73 1 Y 1 C SER 409 ? C SER 15  
74 1 Y 1 C THR 410 ? C THR 16  
75 1 Y 1 C ALA 436 ? C ALA 42  
76 1 Y 1 C LYS 439 ? C LYS 45  
77 1 Y 1 C ASP 440 ? C ASP 46  
78 1 Y 1 C GLN 476 ? C GLN 82  
79 1 Y 1 C ARG 477 ? C ARG 83  
80 1 Y 1 C ASP 478 ? C ASP 84  
81 1 Y 1 C TYR 575 ? C TYR 181 
82 1 Y 1 C GLU 576 ? C GLU 182 
83 1 Y 1 C HIS 577 ? C HIS 183 
84 1 Y 1 C HIS 578 ? C HIS 184 
85 1 Y 1 C TYR 579 ? C TYR 185 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#