data_2JIF
# 
_entry.id   2JIF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JIF         
PDBE  EBI-31677    
WWPDB D_1290031677 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JIF 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pike, A.C.W.'     1  
'Hozjan, V.'       2  
'Smee, C.'         3  
'Niesen, F.H.'     4  
'Kavanagh, K.L.'   5  
'Umeano, C.'       6  
'Turnbull, A.P.'   7  
'von Delft, F.'    8  
'Weigelt, J.'      9  
'Edwards, A.'      10 
'Arrowsmith, C.H.' 11 
'Sundstrom, M.'    12 
'Oppermann, U.'    13 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Short-Branched Chain Acyl-Coa Dehydrogenase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pike, A.C.W.'     1  
primary 'Hozjan, V.'       2  
primary 'Smee, C.'         3  
primary 'Niesen, F.H.'     4  
primary 'Kavanagh, K.L.'   5  
primary 'Umeano, C.'       6  
primary 'Turnbull, A.P.'   7  
primary 'von Delft, F.'    8  
primary 'Weigelt, J.'      9  
primary 'Edwards, A.'      10 
primary 'Arrowsmith, C.H.' 11 
primary 'Sundstrom, M.'    12 
primary 'Oppermann, U.'    13 
# 
_cell.entry_id           2JIF 
_cell.length_a           150.245 
_cell.length_b           150.245 
_cell.length_c           201.586 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JIF 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SHORT/BRANCHED CHAIN SPECIFIC ACYL-COA DEHYDROGENASE' 44474.492 4   1.3.99.- ? 'RESIDUES 52-432' ? 
2 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                          785.550   4   ?        ? ?                 ? 
3 non-polymer syn 'COENZYME A PERSULFIDE'                                799.599   4   ?        ? ?                 ? 
4 non-polymer syn 1,2-ETHANEDIOL                                         62.068    7   ?        ? ?                 ? 
5 non-polymer syn 'CHLORIDE ION'                                         35.453    10  ?        ? ?                 ? 
6 water       nat water                                                  18.015    913 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ACYL-COA DEHYDROGENASE, SBCAD, 2-METHYL BRANCHED CHAIN ACYL-COA DEHYDROGENASE, 2-MEBCAD, 2-METHYLBUTYRYL-COENZYME A DEHYDROGENASE, 2-METHYLBUTYRYL-COA DEHYDROGENASE
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMAPLQTFTDEEMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVD
PEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFAL
KTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENV
KVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARL
LTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHI
DAEY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMAPLQTFTDEEMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVD
PEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFAL
KTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENV
KVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARL
LTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHI
DAEY
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  ALA n 
1 25  PRO n 
1 26  LEU n 
1 27  GLN n 
1 28  THR n 
1 29  PHE n 
1 30  THR n 
1 31  ASP n 
1 32  GLU n 
1 33  GLU n 
1 34  MET n 
1 35  MET n 
1 36  ILE n 
1 37  LYS n 
1 38  SER n 
1 39  SER n 
1 40  VAL n 
1 41  LYS n 
1 42  LYS n 
1 43  PHE n 
1 44  ALA n 
1 45  GLN n 
1 46  GLU n 
1 47  GLN n 
1 48  ILE n 
1 49  ALA n 
1 50  PRO n 
1 51  LEU n 
1 52  VAL n 
1 53  SER n 
1 54  THR n 
1 55  MET n 
1 56  ASP n 
1 57  GLU n 
1 58  ASN n 
1 59  SER n 
1 60  LYS n 
1 61  MET n 
1 62  GLU n 
1 63  LYS n 
1 64  SER n 
1 65  VAL n 
1 66  ILE n 
1 67  GLN n 
1 68  GLY n 
1 69  LEU n 
1 70  PHE n 
1 71  GLN n 
1 72  GLN n 
1 73  GLY n 
1 74  LEU n 
1 75  MET n 
1 76  GLY n 
1 77  ILE n 
1 78  GLU n 
1 79  VAL n 
1 80  ASP n 
1 81  PRO n 
1 82  GLU n 
1 83  TYR n 
1 84  GLY n 
1 85  GLY n 
1 86  THR n 
1 87  GLY n 
1 88  ALA n 
1 89  SER n 
1 90  PHE n 
1 91  LEU n 
1 92  SER n 
1 93  THR n 
1 94  VAL n 
1 95  LEU n 
1 96  VAL n 
1 97  ILE n 
1 98  GLU n 
1 99  GLU n 
1 100 LEU n 
1 101 ALA n 
1 102 LYS n 
1 103 VAL n 
1 104 ASP n 
1 105 ALA n 
1 106 SER n 
1 107 VAL n 
1 108 ALA n 
1 109 VAL n 
1 110 PHE n 
1 111 CYS n 
1 112 GLU n 
1 113 ILE n 
1 114 GLN n 
1 115 ASN n 
1 116 THR n 
1 117 LEU n 
1 118 ILE n 
1 119 ASN n 
1 120 THR n 
1 121 LEU n 
1 122 ILE n 
1 123 ARG n 
1 124 LYS n 
1 125 HIS n 
1 126 GLY n 
1 127 THR n 
1 128 GLU n 
1 129 GLU n 
1 130 GLN n 
1 131 LYS n 
1 132 ALA n 
1 133 THR n 
1 134 TYR n 
1 135 LEU n 
1 136 PRO n 
1 137 GLN n 
1 138 LEU n 
1 139 THR n 
1 140 THR n 
1 141 GLU n 
1 142 LYS n 
1 143 VAL n 
1 144 GLY n 
1 145 SER n 
1 146 PHE n 
1 147 CYS n 
1 148 LEU n 
1 149 SER n 
1 150 GLU n 
1 151 ALA n 
1 152 GLY n 
1 153 ALA n 
1 154 GLY n 
1 155 SER n 
1 156 ASP n 
1 157 SER n 
1 158 PHE n 
1 159 ALA n 
1 160 LEU n 
1 161 LYS n 
1 162 THR n 
1 163 ARG n 
1 164 ALA n 
1 165 ASP n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 ASP n 
1 170 TYR n 
1 171 TYR n 
1 172 VAL n 
1 173 LEU n 
1 174 ASN n 
1 175 GLY n 
1 176 SER n 
1 177 LYS n 
1 178 MET n 
1 179 TRP n 
1 180 ILE n 
1 181 SER n 
1 182 SER n 
1 183 ALA n 
1 184 GLU n 
1 185 HIS n 
1 186 ALA n 
1 187 GLY n 
1 188 LEU n 
1 189 PHE n 
1 190 LEU n 
1 191 VAL n 
1 192 MET n 
1 193 ALA n 
1 194 ASN n 
1 195 VAL n 
1 196 ASP n 
1 197 PRO n 
1 198 THR n 
1 199 ILE n 
1 200 GLY n 
1 201 TYR n 
1 202 LYS n 
1 203 GLY n 
1 204 ILE n 
1 205 THR n 
1 206 SER n 
1 207 PHE n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 ARG n 
1 212 ASP n 
1 213 THR n 
1 214 PRO n 
1 215 GLY n 
1 216 LEU n 
1 217 HIS n 
1 218 ILE n 
1 219 GLY n 
1 220 LYS n 
1 221 PRO n 
1 222 GLU n 
1 223 ASN n 
1 224 LYS n 
1 225 LEU n 
1 226 GLY n 
1 227 LEU n 
1 228 ARG n 
1 229 ALA n 
1 230 SER n 
1 231 SER n 
1 232 THR n 
1 233 CYS n 
1 234 PRO n 
1 235 LEU n 
1 236 THR n 
1 237 PHE n 
1 238 GLU n 
1 239 ASN n 
1 240 VAL n 
1 241 LYS n 
1 242 VAL n 
1 243 PRO n 
1 244 GLU n 
1 245 ALA n 
1 246 ASN n 
1 247 ILE n 
1 248 LEU n 
1 249 GLY n 
1 250 GLN n 
1 251 ILE n 
1 252 GLY n 
1 253 HIS n 
1 254 GLY n 
1 255 TYR n 
1 256 LYS n 
1 257 TYR n 
1 258 ALA n 
1 259 ILE n 
1 260 GLY n 
1 261 SER n 
1 262 LEU n 
1 263 ASN n 
1 264 GLU n 
1 265 GLY n 
1 266 ARG n 
1 267 ILE n 
1 268 GLY n 
1 269 ILE n 
1 270 ALA n 
1 271 ALA n 
1 272 GLN n 
1 273 MET n 
1 274 LEU n 
1 275 GLY n 
1 276 LEU n 
1 277 ALA n 
1 278 GLN n 
1 279 GLY n 
1 280 CYS n 
1 281 PHE n 
1 282 ASP n 
1 283 TYR n 
1 284 THR n 
1 285 ILE n 
1 286 PRO n 
1 287 TYR n 
1 288 ILE n 
1 289 LYS n 
1 290 GLU n 
1 291 ARG n 
1 292 ILE n 
1 293 GLN n 
1 294 PHE n 
1 295 GLY n 
1 296 LYS n 
1 297 ARG n 
1 298 LEU n 
1 299 PHE n 
1 300 ASP n 
1 301 PHE n 
1 302 GLN n 
1 303 GLY n 
1 304 LEU n 
1 305 GLN n 
1 306 HIS n 
1 307 GLN n 
1 308 VAL n 
1 309 ALA n 
1 310 HIS n 
1 311 VAL n 
1 312 ALA n 
1 313 THR n 
1 314 GLN n 
1 315 LEU n 
1 316 GLU n 
1 317 ALA n 
1 318 ALA n 
1 319 ARG n 
1 320 LEU n 
1 321 LEU n 
1 322 THR n 
1 323 TYR n 
1 324 ASN n 
1 325 ALA n 
1 326 ALA n 
1 327 ARG n 
1 328 LEU n 
1 329 LEU n 
1 330 GLU n 
1 331 ALA n 
1 332 GLY n 
1 333 LYS n 
1 334 PRO n 
1 335 PHE n 
1 336 ILE n 
1 337 LYS n 
1 338 GLU n 
1 339 ALA n 
1 340 SER n 
1 341 MET n 
1 342 ALA n 
1 343 LYS n 
1 344 TYR n 
1 345 TYR n 
1 346 ALA n 
1 347 SER n 
1 348 GLU n 
1 349 ILE n 
1 350 ALA n 
1 351 GLY n 
1 352 GLN n 
1 353 THR n 
1 354 THR n 
1 355 SER n 
1 356 LYS n 
1 357 CYS n 
1 358 ILE n 
1 359 GLU n 
1 360 TRP n 
1 361 MET n 
1 362 GLY n 
1 363 GLY n 
1 364 VAL n 
1 365 GLY n 
1 366 TYR n 
1 367 THR n 
1 368 LYS n 
1 369 ASP n 
1 370 TYR n 
1 371 PRO n 
1 372 VAL n 
1 373 GLU n 
1 374 LYS n 
1 375 TYR n 
1 376 PHE n 
1 377 ARG n 
1 378 ASP n 
1 379 ALA n 
1 380 LYS n 
1 381 ILE n 
1 382 GLY n 
1 383 THR n 
1 384 ILE n 
1 385 TYR n 
1 386 GLU n 
1 387 GLY n 
1 388 ALA n 
1 389 SER n 
1 390 ASN n 
1 391 ILE n 
1 392 GLN n 
1 393 LEU n 
1 394 ASN n 
1 395 THR n 
1 396 ILE n 
1 397 ALA n 
1 398 LYS n 
1 399 HIS n 
1 400 ILE n 
1 401 ASP n 
1 402 ALA n 
1 403 GLU n 
1 404 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC28-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2JIF        1 ? ? 2JIF   ? 
2 UNP ACDSB_HUMAN 1 ? ? P45954 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JIF A 1  ? 23  ? 2JIF   29 ? 51  ? 29 51  
2 2 2JIF A 24 ? 404 ? P45954 52 ? 432 ? 52 432 
3 1 2JIF B 1  ? 23  ? 2JIF   29 ? 51  ? 29 51  
4 2 2JIF B 24 ? 404 ? P45954 52 ? 432 ? 52 432 
5 1 2JIF C 1  ? 23  ? 2JIF   29 ? 51  ? 29 51  
6 2 2JIF C 24 ? 404 ? P45954 52 ? 432 ? 52 432 
7 1 2JIF D 1  ? 23  ? 2JIF   29 ? 51  ? 29 51  
8 2 2JIF D 24 ? 404 ? P45954 52 ? 432 ? 52 432 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ?                 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE                      ?                 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ?                 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ?                 'C4 H7 N O4'           133.103 
CL  non-polymer         . 'CHLORIDE ION'                ?                 'Cl -1'                35.453  
COS non-polymer         . 'COENZYME A PERSULFIDE'       ?                 'C21 H36 N7 O16 P3 S2' 799.599 
CYS 'L-peptide linking' y CYSTEINE                      ?                 'C3 H7 N O2 S'         121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                'ETHYLENE GLYCOL' 'C2 H6 O2'             62.068  
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE' ?                 'C27 H33 N9 O15 P2'    785.550 
GLN 'L-peptide linking' y GLUTAMINE                     ?                 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ?                 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE                       ?                 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE                     ?                 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER                         ?                 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ?                 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE                       ?                 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE                        ?                 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE                    ?                 'C5 H11 N O2 S'        149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ?                 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE                       ?                 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE                        ?                 'C3 H7 N O3'           105.093 
THR 'L-peptide linking' y THREONINE                     ?                 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ?                 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE                      ?                 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE                        ?                 'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          2JIF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.7 
_exptl_crystal.density_percent_sol   66.7 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.30 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% PEG6000, 0.15M AMMONIUM CHLORIDE PH6.3, 10% ETHYLENE GLYCOL, pH 6.30' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-12-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.999 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JIF 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             70.360 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   175824 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.10000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.7000 
_reflns.B_iso_Wilson_estimate        25.84 
_reflns.pdbx_redundancy              6.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   95.7 
_reflns_shell.Rmerge_I_obs           0.66000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.600 
_reflns_shell.pdbx_redundancy        5.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JIF 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     166944 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             70.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.209 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  8809 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.934 
_refine.B_iso_mean                               22.76 
_refine.aniso_B[1][1]                            0.16000 
_refine.aniso_B[2][2]                            0.16000 
_refine.aniso_B[3][3]                            -0.23000 
_refine.aniso_B[1][2]                            0.08000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ACETOACETYL COA WAS ADDED TO THE PROTEIN PRIOR TO CRYSTALLIZATION. HOWEVER THE DENSITY IN THE ACTIVE SITE IS MORE CONSISTENT WITH AND HAS BEEN MODELLED AS COA PERSULPHIDE. COA PERSULPHIDE PRESUMABLY COPURIFIES WITH THE BACTERIALLY EXPRESSED ENZYME.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1JQI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.127 
_refine.pdbx_overall_ESU_R_Free                  0.120 
_refine.overall_SU_ML                            0.078 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.099 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11620 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         446 
_refine_hist.number_atoms_solvent             913 
_refine_hist.number_atoms_total               12979 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        70.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 12467 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 8258  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.287  2.005  ? 16907 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.040  3.003  ? 20072 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.114  5.000  ? 1520  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.155 24.826 ? 516   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.629 15.000 ? 2134  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.155 15.000 ? 48    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.079  0.200  ? 1895  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 13570 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2374  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.201  0.200  ? 2539  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.179  0.200  ? 8297  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.175  0.200  ? 5999  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085  0.200  ? 5933  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.137  0.200  ? 758   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.252  0.200  ? 19    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.195  0.200  ? 38    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.124  0.200  ? 24    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.642  1.500  ? 7857  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.145  1.500  ? 3126  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.943  2.000  ? 12091 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.627  3.000  ? 5486  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.439  4.500  ? 4812  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             11549 
_refine_ls_shell.R_factor_R_work                  0.2330 
_refine_ls_shell.percent_reflns_obs               94.03 
_refine_ls_shell.R_factor_R_free                  0.2880 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             620 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.868380  -0.495740 -0.012690 -0.495720 -0.868470 0.004750  -0.013380 0.002170  -0.999910 68.34785  257.93027 23.23913 
2 given ? -0.866590 0.499010  -0.003080 0.498950  0.866550  0.011920  0.008620  0.008790  -0.999920 156.32558 -41.68656 20.11056 
3 given ? -0.999840 0.005500  0.017250  -0.005770 -0.999870 -0.015340 0.017160  -0.015440 0.999730  224.22177 217.26875 -0.18842 
# 
_struct.entry_id                  2JIF 
_struct.title                     'Structure of human short-branched chain acyl-CoA dehydrogenase (ACADSB)' 
_struct.pdbx_descriptor           'SHORT/BRANCHED CHAIN SPECIFIC ACYL-COA DEHYDROGENASE (E.C.1.3.99.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JIF 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'MITOCHONDRION, OXIDOREDUCTASE, TRANSIT PEPTIDE, FATTY ACID METABOLISM, FAD, FLAVOPROTEIN, DISEASE MUTATION, LIPID METABOLISM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
GA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 30  ? ILE A 48  ? THR A 58  ILE A 76  1 ? 19 
HELX_P HELX_P2  2  LEU A 51  ? SER A 59  ? LEU A 79  SER A 87  1 ? 9  
HELX_P HELX_P3  3  GLU A 62  ? GLN A 72  ? GLU A 90  GLN A 100 1 ? 11 
HELX_P HELX_P4  4  ASP A 80  ? GLY A 84  ? ASP A 108 GLY A 112 5 ? 5  
HELX_P HELX_P5  5  SER A 89  ? LYS A 102 ? SER A 117 LYS A 130 1 ? 14 
HELX_P HELX_P6  6  ASP A 104 ? LEU A 117 ? ASP A 132 LEU A 145 1 ? 14 
HELX_P HELX_P7  7  LEU A 117 ? GLY A 126 ? LEU A 145 GLY A 154 1 ? 10 
HELX_P HELX_P8  8  THR A 127 ? GLU A 141 ? THR A 155 GLU A 169 1 ? 15 
HELX_P HELX_P9  9  ASP A 156 ? LEU A 160 ? ASP A 184 LEU A 188 5 ? 5  
HELX_P HELX_P10 10 ASP A 196 ? LYS A 202 ? ASP A 224 LYS A 230 5 ? 7  
HELX_P HELX_P11 11 HIS A 253 ? ARG A 291 ? HIS A 281 ARG A 319 1 ? 39 
HELX_P HELX_P12 12 PHE A 301 ? ALA A 331 ? PHE A 329 ALA A 359 1 ? 31 
HELX_P HELX_P13 13 PHE A 335 ? GLY A 362 ? PHE A 363 GLY A 390 1 ? 28 
HELX_P HELX_P14 14 GLY A 363 ? TYR A 366 ? GLY A 391 TYR A 394 5 ? 4  
HELX_P HELX_P15 15 PRO A 371 ? LYS A 380 ? PRO A 399 LYS A 408 1 ? 10 
HELX_P HELX_P16 16 ILE A 381 ? ILE A 384 ? ILE A 409 ILE A 412 5 ? 4  
HELX_P HELX_P17 17 ALA A 388 ? TYR A 404 ? ALA A 416 TYR A 432 1 ? 17 
HELX_P HELX_P18 18 THR B 30  ? ILE B 48  ? THR B 58  ILE B 76  1 ? 19 
HELX_P HELX_P19 19 LEU B 51  ? SER B 59  ? LEU B 79  SER B 87  1 ? 9  
HELX_P HELX_P20 20 GLU B 62  ? GLN B 72  ? GLU B 90  GLN B 100 1 ? 11 
HELX_P HELX_P21 21 ASP B 80  ? GLY B 84  ? ASP B 108 GLY B 112 5 ? 5  
HELX_P HELX_P22 22 SER B 89  ? ASP B 104 ? SER B 117 ASP B 132 1 ? 16 
HELX_P HELX_P23 23 ASP B 104 ? LEU B 117 ? ASP B 132 LEU B 145 1 ? 14 
HELX_P HELX_P24 24 LEU B 117 ? GLY B 126 ? LEU B 145 GLY B 154 1 ? 10 
HELX_P HELX_P25 25 THR B 127 ? THR B 139 ? THR B 155 THR B 167 1 ? 13 
HELX_P HELX_P26 26 ASP B 156 ? LEU B 160 ? ASP B 184 LEU B 188 5 ? 5  
HELX_P HELX_P27 27 ASP B 196 ? LYS B 202 ? ASP B 224 LYS B 230 5 ? 7  
HELX_P HELX_P28 28 HIS B 253 ? ARG B 291 ? HIS B 281 ARG B 319 1 ? 39 
HELX_P HELX_P29 29 PHE B 301 ? ALA B 331 ? PHE B 329 ALA B 359 1 ? 31 
HELX_P HELX_P30 30 PHE B 335 ? GLY B 362 ? PHE B 363 GLY B 390 1 ? 28 
HELX_P HELX_P31 31 GLY B 363 ? TYR B 366 ? GLY B 391 TYR B 394 5 ? 4  
HELX_P HELX_P32 32 PRO B 371 ? LYS B 380 ? PRO B 399 LYS B 408 1 ? 10 
HELX_P HELX_P33 33 ILE B 381 ? ILE B 384 ? ILE B 409 ILE B 412 5 ? 4  
HELX_P HELX_P34 34 ALA B 388 ? TYR B 404 ? ALA B 416 TYR B 432 1 ? 17 
HELX_P HELX_P35 35 THR C 30  ? ILE C 48  ? THR C 58  ILE C 76  1 ? 19 
HELX_P HELX_P36 36 LEU C 51  ? SER C 59  ? LEU C 79  SER C 87  1 ? 9  
HELX_P HELX_P37 37 GLU C 62  ? GLN C 72  ? GLU C 90  GLN C 100 1 ? 11 
HELX_P HELX_P38 38 ASP C 80  ? GLY C 84  ? ASP C 108 GLY C 112 5 ? 5  
HELX_P HELX_P39 39 SER C 89  ? ASP C 104 ? SER C 117 ASP C 132 1 ? 16 
HELX_P HELX_P40 40 ASP C 104 ? LEU C 117 ? ASP C 132 LEU C 145 1 ? 14 
HELX_P HELX_P41 41 LEU C 117 ? GLY C 126 ? LEU C 145 GLY C 154 1 ? 10 
HELX_P HELX_P42 42 THR C 127 ? THR C 139 ? THR C 155 THR C 167 1 ? 13 
HELX_P HELX_P43 43 ASP C 156 ? LEU C 160 ? ASP C 184 LEU C 188 5 ? 5  
HELX_P HELX_P44 44 ASP C 196 ? LYS C 202 ? ASP C 224 LYS C 230 5 ? 7  
HELX_P HELX_P45 45 HIS C 253 ? ARG C 291 ? HIS C 281 ARG C 319 1 ? 39 
HELX_P HELX_P46 46 PHE C 301 ? GLY C 332 ? PHE C 329 GLY C 360 1 ? 32 
HELX_P HELX_P47 47 PHE C 335 ? GLY C 362 ? PHE C 363 GLY C 390 1 ? 28 
HELX_P HELX_P48 48 GLY C 363 ? TYR C 366 ? GLY C 391 TYR C 394 5 ? 4  
HELX_P HELX_P49 49 PRO C 371 ? LYS C 380 ? PRO C 399 LYS C 408 1 ? 10 
HELX_P HELX_P50 50 ILE C 381 ? ILE C 384 ? ILE C 409 ILE C 412 5 ? 4  
HELX_P HELX_P51 51 ALA C 388 ? TYR C 404 ? ALA C 416 TYR C 432 1 ? 17 
HELX_P HELX_P52 52 THR D 30  ? ILE D 48  ? THR D 58  ILE D 76  1 ? 19 
HELX_P HELX_P53 53 LEU D 51  ? SER D 59  ? LEU D 79  SER D 87  1 ? 9  
HELX_P HELX_P54 54 GLU D 62  ? GLN D 72  ? GLU D 90  GLN D 100 1 ? 11 
HELX_P HELX_P55 55 ASP D 80  ? GLY D 84  ? ASP D 108 GLY D 112 5 ? 5  
HELX_P HELX_P56 56 SER D 89  ? ASP D 104 ? SER D 117 ASP D 132 1 ? 16 
HELX_P HELX_P57 57 ASP D 104 ? LEU D 117 ? ASP D 132 LEU D 145 1 ? 14 
HELX_P HELX_P58 58 LEU D 117 ? GLY D 126 ? LEU D 145 GLY D 154 1 ? 10 
HELX_P HELX_P59 59 THR D 127 ? GLU D 141 ? THR D 155 GLU D 169 1 ? 15 
HELX_P HELX_P60 60 ASP D 156 ? LEU D 160 ? ASP D 184 LEU D 188 5 ? 5  
HELX_P HELX_P61 61 ASP D 196 ? LYS D 202 ? ASP D 224 LYS D 230 5 ? 7  
HELX_P HELX_P62 62 HIS D 253 ? ARG D 291 ? HIS D 281 ARG D 319 1 ? 39 
HELX_P HELX_P63 63 PHE D 301 ? ALA D 331 ? PHE D 329 ALA D 359 1 ? 31 
HELX_P HELX_P64 64 PHE D 335 ? GLY D 362 ? PHE D 363 GLY D 390 1 ? 28 
HELX_P HELX_P65 65 GLY D 363 ? TYR D 366 ? GLY D 391 TYR D 394 5 ? 4  
HELX_P HELX_P66 66 PRO D 371 ? LYS D 380 ? PRO D 399 LYS D 408 1 ? 10 
HELX_P HELX_P67 67 ILE D 381 ? ILE D 384 ? ILE D 409 ILE D 412 5 ? 4  
HELX_P HELX_P68 68 ALA D 388 ? TYR D 404 ? ALA D 416 TYR D 432 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 2 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 2 ? 
CA ? 4 ? 
CB ? 4 ? 
CC ? 2 ? 
DA ? 4 ? 
DB ? 4 ? 
DC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CC 1 2 ? anti-parallel 
DA 1 2 ? parallel      
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 144 ? CYS A 147 ? GLY A 172 CYS A 175 
AA 2 LEU A 188 ? ASN A 194 ? LEU A 216 ASN A 222 
AA 3 ILE A 204 ? ASP A 210 ? ILE A 232 ASP A 238 
AA 4 ILE A 247 ? LEU A 248 ? ILE A 275 LEU A 276 
AB 1 ARG A 163 ? GLU A 167 ? ARG A 191 GLU A 195 
AB 2 TYR A 170 ? SER A 181 ? TYR A 198 SER A 209 
AB 3 THR A 232 ? PRO A 243 ? THR A 260 PRO A 271 
AB 4 LEU A 216 ? ILE A 218 ? LEU A 244 ILE A 246 
AC 1 ILE A 292 ? GLN A 293 ? ILE A 320 GLN A 321 
AC 2 LYS A 296 ? ARG A 297 ? LYS A 324 ARG A 325 
BA 1 GLY B 144 ? CYS B 147 ? GLY B 172 CYS B 175 
BA 2 LEU B 188 ? ASN B 194 ? LEU B 216 ASN B 222 
BA 3 ILE B 204 ? ASP B 210 ? ILE B 232 ASP B 238 
BA 4 ILE B 247 ? LEU B 248 ? ILE B 275 LEU B 276 
BB 1 ARG B 163 ? GLU B 167 ? ARG B 191 GLU B 195 
BB 2 TYR B 170 ? SER B 181 ? TYR B 198 SER B 209 
BB 3 THR B 232 ? PRO B 243 ? THR B 260 PRO B 271 
BB 4 LEU B 216 ? ILE B 218 ? LEU B 244 ILE B 246 
BC 1 ILE B 292 ? GLN B 293 ? ILE B 320 GLN B 321 
BC 2 LYS B 296 ? ARG B 297 ? LYS B 324 ARG B 325 
CA 1 GLY C 144 ? CYS C 147 ? GLY C 172 CYS C 175 
CA 2 LEU C 188 ? ASN C 194 ? LEU C 216 ASN C 222 
CA 3 ILE C 204 ? ASP C 210 ? ILE C 232 ASP C 238 
CA 4 ILE C 247 ? LEU C 248 ? ILE C 275 LEU C 276 
CB 1 ARG C 163 ? GLU C 167 ? ARG C 191 GLU C 195 
CB 2 TYR C 170 ? SER C 181 ? TYR C 198 SER C 209 
CB 3 THR C 232 ? PRO C 243 ? THR C 260 PRO C 271 
CB 4 LEU C 216 ? ILE C 218 ? LEU C 244 ILE C 246 
CC 1 ILE C 292 ? GLN C 293 ? ILE C 320 GLN C 321 
CC 2 LYS C 296 ? ARG C 297 ? LYS C 324 ARG C 325 
DA 1 GLY D 144 ? CYS D 147 ? GLY D 172 CYS D 175 
DA 2 LEU D 188 ? ASN D 194 ? LEU D 216 ASN D 222 
DA 3 ILE D 204 ? ASP D 210 ? ILE D 232 ASP D 238 
DA 4 ILE D 247 ? LEU D 248 ? ILE D 275 LEU D 276 
DB 1 ARG D 163 ? GLU D 167 ? ARG D 191 GLU D 195 
DB 2 TYR D 170 ? SER D 181 ? TYR D 198 SER D 209 
DB 3 THR D 232 ? PRO D 243 ? THR D 260 PRO D 271 
DB 4 LEU D 216 ? ILE D 218 ? LEU D 244 ILE D 246 
DC 1 ILE D 292 ? GLN D 293 ? ILE D 320 GLN D 321 
DC 2 LYS D 296 ? ARG D 297 ? LYS D 324 ARG D 325 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N SER A 145 ? N SER A 173 O LEU A 188 ? O LEU A 216 
AA 2 3 N ALA A 193 ? N ALA A 221 O THR A 205 ? O THR A 233 
AA 3 4 N SER A 206 ? N SER A 234 O LEU A 248 ? O LEU A 276 
AB 1 2 N GLU A 167 ? N GLU A 195 O TYR A 170 ? O TYR A 198 
AB 2 3 N ILE A 180 ? N ILE A 208 O CYS A 233 ? O CYS A 261 
AB 3 4 N THR A 236 ? N THR A 264 O HIS A 217 ? O HIS A 245 
AC 1 2 N GLN A 293 ? N GLN A 321 O LYS A 296 ? O LYS A 324 
BA 1 2 N SER B 145 ? N SER B 173 O LEU B 188 ? O LEU B 216 
BA 2 3 N ALA B 193 ? N ALA B 221 O THR B 205 ? O THR B 233 
BA 3 4 N SER B 206 ? N SER B 234 O LEU B 248 ? O LEU B 276 
BB 1 2 N GLU B 167 ? N GLU B 195 O TYR B 170 ? O TYR B 198 
BB 2 3 N ILE B 180 ? N ILE B 208 O CYS B 233 ? O CYS B 261 
BB 3 4 N THR B 236 ? N THR B 264 O HIS B 217 ? O HIS B 245 
BC 1 2 N GLN B 293 ? N GLN B 321 O LYS B 296 ? O LYS B 324 
CA 1 2 N SER C 145 ? N SER C 173 O LEU C 188 ? O LEU C 216 
CA 2 3 N ALA C 193 ? N ALA C 221 O THR C 205 ? O THR C 233 
CA 3 4 N SER C 206 ? N SER C 234 O LEU C 248 ? O LEU C 276 
CB 1 2 N GLU C 167 ? N GLU C 195 O TYR C 170 ? O TYR C 198 
CB 2 3 N ILE C 180 ? N ILE C 208 O CYS C 233 ? O CYS C 261 
CB 3 4 N THR C 236 ? N THR C 264 O HIS C 217 ? O HIS C 245 
CC 1 2 N GLN C 293 ? N GLN C 321 O LYS C 296 ? O LYS C 324 
DA 1 2 N SER D 145 ? N SER D 173 O LEU D 188 ? O LEU D 216 
DA 2 3 N ALA D 193 ? N ALA D 221 O THR D 205 ? O THR D 233 
DA 3 4 N SER D 206 ? N SER D 234 O LEU D 248 ? O LEU D 276 
DB 1 2 N GLU D 167 ? N GLU D 195 O TYR D 170 ? O TYR D 198 
DB 2 3 N ILE D 180 ? N ILE D 208 O CYS D 233 ? O CYS D 261 
DB 3 4 N THR D 236 ? N THR D 264 O HIS D 217 ? O HIS D 245 
DC 1 2 N GLN D 293 ? N GLN D 321 O LYS D 296 ? O LYS D 324 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A1436'  
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A1437'  
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B1436'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B1437'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B1438'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL C1436'  
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL C1437'  
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL D1439'  
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL D1440'  
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL D1441'  
BC2 Software ? ? ? ? 32 'BINDING SITE FOR RESIDUE FAD A1433' 
BC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE COS A1434' 
BC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A1435' 
BC5 Software ? ? ? ? 33 'BINDING SITE FOR RESIDUE FAD B1433' 
BC6 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE COS B1434' 
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO B1435' 
BC8 Software ? ? ? ? 31 'BINDING SITE FOR RESIDUE FAD C1433' 
BC9 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE COS C1434' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO C1435' 
CC2 Software ? ? ? ? 32 'BINDING SITE FOR RESIDUE FAD D1433' 
CC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE COS D1434' 
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO D1435' 
CC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D1436' 
CC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D1437' 
CC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO D1438' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 2  ASP A  80  ? ASP A 108  . ? 1_555 ? 
2   AC1 2  ARG A  123 ? ARG A 151  . ? 1_555 ? 
3   AC2 2  HIS A  185 ? HIS A 213  . ? 1_555 ? 
4   AC2 2  SER A  231 ? SER A 259  . ? 1_555 ? 
5   AC3 2  ASP B  80  ? ASP B 108  . ? 1_555 ? 
6   AC3 2  ARG B  123 ? ARG B 151  . ? 1_555 ? 
7   AC4 2  HIS B  185 ? HIS B 213  . ? 1_555 ? 
8   AC4 2  SER B  231 ? SER B 259  . ? 1_555 ? 
9   AC5 2  TYR A  345 ? TYR A 373  . ? 1_555 ? 
10  AC5 2  TYR B  345 ? TYR B 373  . ? 1_555 ? 
11  AC6 2  ASP C  80  ? ASP C 108  . ? 1_555 ? 
12  AC6 2  ARG C  123 ? ARG C 151  . ? 1_555 ? 
13  AC7 2  SER C  231 ? SER C 259  . ? 1_555 ? 
14  AC7 2  HOH FA .   ? HOH C 2141 . ? 1_555 ? 
15  AC8 2  ASP D  80  ? ASP D 108  . ? 1_555 ? 
16  AC8 2  ARG D  123 ? ARG D 151  . ? 1_555 ? 
17  AC9 2  HIS D  185 ? HIS D 213  . ? 1_555 ? 
18  AC9 2  SER D  231 ? SER D 259  . ? 1_555 ? 
19  BC1 2  TYR C  345 ? TYR C 373  . ? 1_555 ? 
20  BC1 2  TYR D  345 ? TYR D 373  . ? 1_555 ? 
21  BC2 32 PHE A  146 ? PHE A 174  . ? 1_555 ? 
22  BC2 32 LEU A  148 ? LEU A 176  . ? 1_555 ? 
23  BC2 32 SER A  149 ? SER A 177  . ? 1_555 ? 
24  BC2 32 GLY A  154 ? GLY A 182  . ? 1_555 ? 
25  BC2 32 SER A  155 ? SER A 183  . ? 1_555 ? 
26  BC2 32 TRP A  179 ? TRP A 207  . ? 1_555 ? 
27  BC2 32 SER A  181 ? SER A 209  . ? 1_555 ? 
28  BC2 32 THR A  232 ? THR A 260  . ? 1_555 ? 
29  BC2 32 ILE A  381 ? ILE A 409  . ? 1_555 ? 
30  BC2 32 ILE A  384 ? ILE A 412  . ? 1_555 ? 
31  BC2 32 ALA A  388 ? ALA A 416  . ? 1_555 ? 
32  BC2 32 ASN A  390 ? ASN A 418  . ? 1_555 ? 
33  BC2 32 ILE A  391 ? ILE A 419  . ? 1_555 ? 
34  BC2 32 ASN A  394 ? ASN A 422  . ? 1_555 ? 
35  BC2 32 COS F  .   ? COS A 1434 . ? 1_555 ? 
36  BC2 32 HOH DA .   ? HOH A 2182 . ? 1_555 ? 
37  BC2 32 HOH DA .   ? HOH A 2195 . ? 1_555 ? 
38  BC2 32 HOH DA .   ? HOH A 2196 . ? 1_555 ? 
39  BC2 32 HOH DA .   ? HOH A 2197 . ? 1_555 ? 
40  BC2 32 HOH DA .   ? HOH A 2198 . ? 1_555 ? 
41  BC2 32 HOH DA .   ? HOH A 2199 . ? 1_555 ? 
42  BC2 32 GLN B  302 ? GLN B 330  . ? 1_555 ? 
43  BC2 32 ARG C  291 ? ARG C 319  . ? 1_555 ? 
44  BC2 32 GLN C  293 ? GLN C 321  . ? 1_555 ? 
45  BC2 32 PHE C  294 ? PHE C 322  . ? 1_555 ? 
46  BC2 32 LEU C  298 ? LEU C 326  . ? 1_555 ? 
47  BC2 32 PHE C  301 ? PHE C 329  . ? 1_555 ? 
48  BC2 32 LEU C  304 ? LEU C 332  . ? 1_555 ? 
49  BC2 32 GLU C  359 ? GLU C 387  . ? 1_555 ? 
50  BC2 32 TRP C  360 ? TRP C 388  . ? 1_555 ? 
51  BC2 32 GLY C  363 ? GLY C 391  . ? 1_555 ? 
52  BC2 32 HOH FA .   ? HOH C 2203 . ? 1_555 ? 
53  BC3 19 SER A  155 ? SER A 183  . ? 1_555 ? 
54  BC3 19 SER A  157 ? SER A 185  . ? 1_555 ? 
55  BC3 19 TYR A  201 ? TYR A 229  . ? 1_555 ? 
56  BC3 19 LYS A  202 ? LYS A 230  . ? 1_555 ? 
57  BC3 19 TYR A  255 ? TYR A 283  . ? 1_555 ? 
58  BC3 19 ILE A  259 ? ILE A 287  . ? 1_555 ? 
59  BC3 19 LEU A  262 ? LEU A 290  . ? 1_555 ? 
60  BC3 19 ASN A  263 ? ASN A 291  . ? 1_555 ? 
61  BC3 19 ARG A  266 ? ARG A 294  . ? 1_555 ? 
62  BC3 19 TYR A  385 ? TYR A 413  . ? 1_555 ? 
63  BC3 19 GLU A  386 ? GLU A 414  . ? 1_555 ? 
64  BC3 19 GLY A  387 ? GLY A 415  . ? 1_555 ? 
65  BC3 19 ILE A  391 ? ILE A 419  . ? 1_555 ? 
66  BC3 19 FAD E  .   ? FAD A 1433 . ? 1_555 ? 
67  BC3 19 HOH DA .   ? HOH A 2062 . ? 1_555 ? 
68  BC3 19 HOH DA .   ? HOH A 2185 . ? 1_555 ? 
69  BC3 19 HOH DA .   ? HOH A 2201 . ? 1_555 ? 
70  BC3 19 HOH DA .   ? HOH A 2202 . ? 1_555 ? 
71  BC3 19 PHE C  294 ? PHE C 322  . ? 1_555 ? 
72  BC4 5  VAL A  103 ? VAL A 131  . ? 1_555 ? 
73  BC4 5  PRO A  371 ? PRO A 399  . ? 1_555 ? 
74  BC4 5  TYR A  375 ? TYR A 403  . ? 1_555 ? 
75  BC4 5  HOH DA .   ? HOH A 2203 . ? 1_555 ? 
76  BC4 5  HOH DA .   ? HOH A 2204 . ? 1_555 ? 
77  BC5 33 GLN A  302 ? GLN A 330  . ? 1_555 ? 
78  BC5 33 PHE B  146 ? PHE B 174  . ? 1_555 ? 
79  BC5 33 LEU B  148 ? LEU B 176  . ? 1_555 ? 
80  BC5 33 SER B  149 ? SER B 177  . ? 1_555 ? 
81  BC5 33 GLY B  154 ? GLY B 182  . ? 1_555 ? 
82  BC5 33 SER B  155 ? SER B 183  . ? 1_555 ? 
83  BC5 33 TRP B  179 ? TRP B 207  . ? 1_555 ? 
84  BC5 33 SER B  181 ? SER B 209  . ? 1_555 ? 
85  BC5 33 LYS B  224 ? LYS B 252  . ? 1_555 ? 
86  BC5 33 THR B  232 ? THR B 260  . ? 1_555 ? 
87  BC5 33 ILE B  381 ? ILE B 409  . ? 1_555 ? 
88  BC5 33 ILE B  384 ? ILE B 412  . ? 1_555 ? 
89  BC5 33 ALA B  388 ? ALA B 416  . ? 1_555 ? 
90  BC5 33 ASN B  390 ? ASN B 418  . ? 1_555 ? 
91  BC5 33 ASN B  394 ? ASN B 422  . ? 1_555 ? 
92  BC5 33 COS K  .   ? COS B 1434 . ? 1_555 ? 
93  BC5 33 HOH EA .   ? HOH B 2181 . ? 1_555 ? 
94  BC5 33 HOH EA .   ? HOH B 2193 . ? 1_555 ? 
95  BC5 33 HOH EA .   ? HOH B 2194 . ? 1_555 ? 
96  BC5 33 HOH EA .   ? HOH B 2195 . ? 1_555 ? 
97  BC5 33 HOH EA .   ? HOH B 2196 . ? 1_555 ? 
98  BC5 33 HOH EA .   ? HOH B 2197 . ? 1_555 ? 
99  BC5 33 HOH EA .   ? HOH B 2198 . ? 1_555 ? 
100 BC5 33 ARG D  291 ? ARG D 319  . ? 1_555 ? 
101 BC5 33 GLN D  293 ? GLN D 321  . ? 1_555 ? 
102 BC5 33 PHE D  294 ? PHE D 322  . ? 1_555 ? 
103 BC5 33 LEU D  298 ? LEU D 326  . ? 1_555 ? 
104 BC5 33 PHE D  301 ? PHE D 329  . ? 1_555 ? 
105 BC5 33 LEU D  304 ? LEU D 332  . ? 1_555 ? 
106 BC5 33 GLU D  359 ? GLU D 387  . ? 1_555 ? 
107 BC5 33 TRP D  360 ? TRP D 388  . ? 1_555 ? 
108 BC5 33 GLY D  363 ? GLY D 391  . ? 1_555 ? 
109 BC5 33 HOH GA .   ? HOH D 2227 . ? 1_555 ? 
110 BC6 18 SER B  155 ? SER B 183  . ? 1_555 ? 
111 BC6 18 SER B  157 ? SER B 185  . ? 1_555 ? 
112 BC6 18 PHE B  158 ? PHE B 186  . ? 1_555 ? 
113 BC6 18 TYR B  201 ? TYR B 229  . ? 1_555 ? 
114 BC6 18 TYR B  255 ? TYR B 283  . ? 1_555 ? 
115 BC6 18 ILE B  259 ? ILE B 287  . ? 1_555 ? 
116 BC6 18 LEU B  262 ? LEU B 290  . ? 1_555 ? 
117 BC6 18 ASN B  263 ? ASN B 291  . ? 1_555 ? 
118 BC6 18 ARG B  266 ? ARG B 294  . ? 1_555 ? 
119 BC6 18 TYR B  385 ? TYR B 413  . ? 1_555 ? 
120 BC6 18 GLU B  386 ? GLU B 414  . ? 1_555 ? 
121 BC6 18 GLY B  387 ? GLY B 415  . ? 1_555 ? 
122 BC6 18 ILE B  391 ? ILE B 419  . ? 1_555 ? 
123 BC6 18 FAD J  .   ? FAD B 1433 . ? 1_555 ? 
124 BC6 18 HOH EA .   ? HOH B 2200 . ? 1_555 ? 
125 BC6 18 HOH EA .   ? HOH B 2201 . ? 1_555 ? 
126 BC6 18 HOH EA .   ? HOH B 2202 . ? 1_555 ? 
127 BC6 18 PHE D  294 ? PHE D 322  . ? 1_555 ? 
128 BC7 6  ARG B  228 ? ARG B 256  . ? 1_555 ? 
129 BC7 6  HOH EA .   ? HOH B 2203 . ? 1_555 ? 
130 BC7 6  HOH EA .   ? HOH B 2204 . ? 1_555 ? 
131 BC7 6  ARG D  228 ? ARG D 256  . ? 1_555 ? 
132 BC7 6  HOH GA .   ? HOH D 2030 . ? 1_555 ? 
133 BC7 6  HOH GA .   ? HOH D 2231 . ? 1_555 ? 
134 BC8 31 ARG A  291 ? ARG A 319  . ? 1_555 ? 
135 BC8 31 GLN A  293 ? GLN A 321  . ? 1_555 ? 
136 BC8 31 PHE A  294 ? PHE A 322  . ? 1_555 ? 
137 BC8 31 LEU A  298 ? LEU A 326  . ? 1_555 ? 
138 BC8 31 PHE A  301 ? PHE A 329  . ? 1_555 ? 
139 BC8 31 LEU A  304 ? LEU A 332  . ? 1_555 ? 
140 BC8 31 GLU A  359 ? GLU A 387  . ? 1_555 ? 
141 BC8 31 TRP A  360 ? TRP A 388  . ? 1_555 ? 
142 BC8 31 GLY A  363 ? GLY A 391  . ? 1_555 ? 
143 BC8 31 HOH DA .   ? HOH A 2166 . ? 1_555 ? 
144 BC8 31 PHE C  146 ? PHE C 174  . ? 1_555 ? 
145 BC8 31 LEU C  148 ? LEU C 176  . ? 1_555 ? 
146 BC8 31 SER C  149 ? SER C 177  . ? 1_555 ? 
147 BC8 31 GLY C  154 ? GLY C 182  . ? 1_555 ? 
148 BC8 31 SER C  155 ? SER C 183  . ? 1_555 ? 
149 BC8 31 TRP C  179 ? TRP C 207  . ? 1_555 ? 
150 BC8 31 SER C  181 ? SER C 209  . ? 1_555 ? 
151 BC8 31 THR C  232 ? THR C 260  . ? 1_555 ? 
152 BC8 31 ILE C  381 ? ILE C 409  . ? 1_555 ? 
153 BC8 31 ILE C  384 ? ILE C 412  . ? 1_555 ? 
154 BC8 31 ALA C  388 ? ALA C 416  . ? 1_555 ? 
155 BC8 31 ASN C  390 ? ASN C 418  . ? 1_555 ? 
156 BC8 31 ASN C  394 ? ASN C 422  . ? 1_555 ? 
157 BC8 31 COS Q  .   ? COS C 1434 . ? 1_555 ? 
158 BC8 31 HOH FA .   ? HOH C 2113 . ? 1_555 ? 
159 BC8 31 HOH FA .   ? HOH C 2226 . ? 1_555 ? 
160 BC8 31 HOH FA .   ? HOH C 2227 . ? 1_555 ? 
161 BC8 31 HOH FA .   ? HOH C 2228 . ? 1_555 ? 
162 BC8 31 HOH FA .   ? HOH C 2229 . ? 1_555 ? 
163 BC8 31 HOH FA .   ? HOH C 2230 . ? 1_555 ? 
164 BC8 31 GLN D  302 ? GLN D 330  . ? 1_555 ? 
165 BC9 21 SER C  155 ? SER C 183  . ? 1_555 ? 
166 BC9 21 SER C  157 ? SER C 185  . ? 1_555 ? 
167 BC9 21 PHE C  158 ? PHE C 186  . ? 1_555 ? 
168 BC9 21 TYR C  201 ? TYR C 229  . ? 1_555 ? 
169 BC9 21 LYS C  202 ? LYS C 230  . ? 1_555 ? 
170 BC9 21 TYR C  255 ? TYR C 283  . ? 1_555 ? 
171 BC9 21 ILE C  259 ? ILE C 287  . ? 1_555 ? 
172 BC9 21 ASN C  263 ? ASN C 291  . ? 1_555 ? 
173 BC9 21 ARG C  266 ? ARG C 294  . ? 1_555 ? 
174 BC9 21 TYR C  385 ? TYR C 413  . ? 1_555 ? 
175 BC9 21 GLU C  386 ? GLU C 414  . ? 1_555 ? 
176 BC9 21 GLY C  387 ? GLY C 415  . ? 1_555 ? 
177 BC9 21 ILE C  391 ? ILE C 419  . ? 1_555 ? 
178 BC9 21 FAD P  .   ? FAD C 1433 . ? 1_555 ? 
179 BC9 21 HOH FA .   ? HOH C 2089 . ? 1_555 ? 
180 BC9 21 HOH FA .   ? HOH C 2220 . ? 1_555 ? 
181 BC9 21 HOH FA .   ? HOH C 2221 . ? 1_555 ? 
182 BC9 21 HOH FA .   ? HOH C 2231 . ? 1_555 ? 
183 BC9 21 HOH FA .   ? HOH C 2232 . ? 1_555 ? 
184 BC9 21 HOH FA .   ? HOH C 2233 . ? 1_555 ? 
185 BC9 21 HOH FA .   ? HOH C 2234 . ? 1_555 ? 
186 CC1 5  VAL C  103 ? VAL C 131  . ? 1_555 ? 
187 CC1 5  PRO C  371 ? PRO C 399  . ? 1_555 ? 
188 CC1 5  TYR C  375 ? TYR C 403  . ? 1_555 ? 
189 CC1 5  HOH FA .   ? HOH C 2235 . ? 1_555 ? 
190 CC1 5  HOH FA .   ? HOH C 2236 . ? 1_555 ? 
191 CC2 32 ARG B  291 ? ARG B 319  . ? 1_555 ? 
192 CC2 32 PHE B  294 ? PHE B 322  . ? 1_555 ? 
193 CC2 32 LEU B  298 ? LEU B 326  . ? 1_555 ? 
194 CC2 32 PHE B  301 ? PHE B 329  . ? 1_555 ? 
195 CC2 32 LEU B  304 ? LEU B 332  . ? 1_555 ? 
196 CC2 32 GLU B  359 ? GLU B 387  . ? 1_555 ? 
197 CC2 32 TRP B  360 ? TRP B 388  . ? 1_555 ? 
198 CC2 32 GLY B  363 ? GLY B 391  . ? 1_555 ? 
199 CC2 32 HOH EA .   ? HOH B 2165 . ? 1_555 ? 
200 CC2 32 GLN C  302 ? GLN C 330  . ? 1_555 ? 
201 CC2 32 PHE D  146 ? PHE D 174  . ? 1_555 ? 
202 CC2 32 LEU D  148 ? LEU D 176  . ? 1_555 ? 
203 CC2 32 SER D  149 ? SER D 177  . ? 1_555 ? 
204 CC2 32 GLY D  154 ? GLY D 182  . ? 1_555 ? 
205 CC2 32 SER D  155 ? SER D 183  . ? 1_555 ? 
206 CC2 32 TRP D  179 ? TRP D 207  . ? 1_555 ? 
207 CC2 32 ILE D  180 ? ILE D 208  . ? 1_555 ? 
208 CC2 32 SER D  181 ? SER D 209  . ? 1_555 ? 
209 CC2 32 ILE D  381 ? ILE D 409  . ? 1_555 ? 
210 CC2 32 ILE D  384 ? ILE D 412  . ? 1_555 ? 
211 CC2 32 ALA D  388 ? ALA D 416  . ? 1_555 ? 
212 CC2 32 ASN D  390 ? ASN D 418  . ? 1_555 ? 
213 CC2 32 ILE D  391 ? ILE D 419  . ? 1_555 ? 
214 CC2 32 ASN D  394 ? ASN D 422  . ? 1_555 ? 
215 CC2 32 COS V  .   ? COS D 1434 . ? 1_555 ? 
216 CC2 32 HOH GA .   ? HOH D 2241 . ? 1_555 ? 
217 CC2 32 HOH GA .   ? HOH D 2243 . ? 1_555 ? 
218 CC2 32 HOH GA .   ? HOH D 2255 . ? 1_555 ? 
219 CC2 32 HOH GA .   ? HOH D 2256 . ? 1_555 ? 
220 CC2 32 HOH GA .   ? HOH D 2257 . ? 1_555 ? 
221 CC2 32 HOH GA .   ? HOH D 2258 . ? 1_555 ? 
222 CC2 32 HOH GA .   ? HOH D 2259 . ? 1_555 ? 
223 CC3 23 SER D  155 ? SER D 183  . ? 1_555 ? 
224 CC3 23 SER D  157 ? SER D 185  . ? 1_555 ? 
225 CC3 23 PHE D  158 ? PHE D 186  . ? 1_555 ? 
226 CC3 23 TYR D  201 ? TYR D 229  . ? 1_555 ? 
227 CC3 23 TYR D  255 ? TYR D 283  . ? 1_555 ? 
228 CC3 23 ILE D  259 ? ILE D 287  . ? 1_555 ? 
229 CC3 23 LEU D  262 ? LEU D 290  . ? 1_555 ? 
230 CC3 23 ASN D  263 ? ASN D 291  . ? 1_555 ? 
231 CC3 23 ARG D  266 ? ARG D 294  . ? 1_555 ? 
232 CC3 23 ILE D  336 ? ILE D 364  . ? 1_555 ? 
233 CC3 23 TYR D  385 ? TYR D 413  . ? 1_555 ? 
234 CC3 23 GLU D  386 ? GLU D 414  . ? 1_555 ? 
235 CC3 23 GLY D  387 ? GLY D 415  . ? 1_555 ? 
236 CC3 23 ILE D  391 ? ILE D 419  . ? 1_555 ? 
237 CC3 23 FAD U  .   ? FAD D 1433 . ? 1_555 ? 
238 CC3 23 EDO Y  .   ? EDO D 1437 . ? 1_555 ? 
239 CC3 23 HOH GA .   ? HOH D 2097 . ? 1_555 ? 
240 CC3 23 HOH GA .   ? HOH D 2261 . ? 1_555 ? 
241 CC3 23 HOH GA .   ? HOH D 2262 . ? 1_555 ? 
242 CC3 23 HOH GA .   ? HOH D 2263 . ? 1_555 ? 
243 CC3 23 HOH GA .   ? HOH D 2264 . ? 1_555 ? 
244 CC3 23 HOH GA .   ? HOH D 2265 . ? 1_555 ? 
245 CC3 23 HOH GA .   ? HOH D 2267 . ? 1_555 ? 
246 CC4 6  LYS C  60  ? LYS C 88   . ? 1_555 ? 
247 CC4 6  GLN D  130 ? GLN D 158  . ? 1_555 ? 
248 CC4 6  TYR D  134 ? TYR D 162  . ? 1_555 ? 
249 CC4 6  LEU D  208 ? LEU D 236  . ? 1_555 ? 
250 CC4 6  ALA D  245 ? ALA D 273  . ? 1_555 ? 
251 CC4 6  ASN D  246 ? ASN D 274  . ? 1_555 ? 
252 CC5 5  LYS C  63  ? LYS C 91   . ? 1_555 ? 
253 CC5 5  VAL D  209 ? VAL D 237  . ? 1_555 ? 
254 CC5 5  ASP D  210 ? ASP D 238  . ? 1_555 ? 
255 CC5 5  THR D  213 ? THR D 241  . ? 1_555 ? 
256 CC5 5  ASN D  246 ? ASN D 274  . ? 1_555 ? 
257 CC6 5  PHE B  294 ? PHE B 322  . ? 1_555 ? 
258 CC6 5  ILE D  391 ? ILE D 419  . ? 1_555 ? 
259 CC6 5  ASN D  394 ? ASN D 422  . ? 1_555 ? 
260 CC6 5  COS V  .   ? COS D 1434 . ? 1_555 ? 
261 CC6 5  HOH GA .   ? HOH D 2267 . ? 1_555 ? 
262 CC7 4  VAL D  103 ? VAL D 131  . ? 1_555 ? 
263 CC7 4  PRO D  371 ? PRO D 399  . ? 1_555 ? 
264 CC7 4  TYR D  375 ? TYR D 403  . ? 1_555 ? 
265 CC7 4  HOH GA .   ? HOH D 2269 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JIF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JIF 
_atom_sites.fract_transf_matrix[1][1]   0.006656 
_atom_sites.fract_transf_matrix[1][2]   0.003843 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007685 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004961 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A  1 24  ? 81.060  118.210 13.517  1.00 46.86 ? 52   ALA A N     1 
ATOM   2     C  CA    . ALA A  1 24  ? 81.203  117.117 14.533  1.00 47.01 ? 52   ALA A CA    1 
ATOM   3     C  C     . ALA A  1 24  ? 82.542  116.391 14.368  1.00 46.84 ? 52   ALA A C     1 
ATOM   4     O  O     . ALA A  1 24  ? 83.028  116.237 13.239  1.00 47.40 ? 52   ALA A O     1 
ATOM   5     C  CB    . ALA A  1 24  ? 80.051  116.122 14.417  1.00 46.96 ? 52   ALA A CB    1 
ATOM   6     N  N     . PRO A  1 25  ? 83.149  115.937 15.488  1.00 46.50 ? 53   PRO A N     1 
ATOM   7     C  CA    . PRO A  1 25  ? 84.396  115.147 15.397  1.00 46.18 ? 53   PRO A CA    1 
ATOM   8     C  C     . PRO A  1 25  ? 84.270  113.899 14.501  1.00 45.89 ? 53   PRO A C     1 
ATOM   9     O  O     . PRO A  1 25  ? 83.189  113.313 14.415  1.00 45.70 ? 53   PRO A O     1 
ATOM   10    C  CB    . PRO A  1 25  ? 84.669  114.740 16.855  1.00 46.09 ? 53   PRO A CB    1 
ATOM   11    C  CG    . PRO A  1 25  ? 83.928  115.732 17.686  1.00 46.14 ? 53   PRO A CG    1 
ATOM   12    C  CD    . PRO A  1 25  ? 82.728  116.150 16.888  1.00 46.44 ? 53   PRO A CD    1 
ATOM   13    N  N     . LEU A  1 26  ? 85.369  113.504 13.849  1.00 45.48 ? 54   LEU A N     1 
ATOM   14    C  CA    . LEU A  1 26  ? 85.375  112.334 12.943  1.00 45.37 ? 54   LEU A CA    1 
ATOM   15    C  C     . LEU A  1 26  ? 84.970  111.024 13.638  1.00 45.14 ? 54   LEU A C     1 
ATOM   16    O  O     . LEU A  1 26  ? 84.491  110.100 12.985  1.00 45.57 ? 54   LEU A O     1 
ATOM   17    C  CB    . LEU A  1 26  ? 86.742  112.148 12.250  1.00 44.92 ? 54   LEU A CB    1 
ATOM   18    C  CG    . LEU A  1 26  ? 87.133  113.098 11.099  1.00 44.90 ? 54   LEU A CG    1 
ATOM   19    C  CD1   . LEU A  1 26  ? 88.582  112.869 10.676  1.00 43.47 ? 54   LEU A CD1   1 
ATOM   20    C  CD2   . LEU A  1 26  ? 86.214  112.975 9.874   1.00 43.65 ? 54   LEU A CD2   1 
ATOM   21    N  N     . GLN A  1 27  ? 85.155  110.940 14.951  1.00 44.90 ? 55   GLN A N     1 
ATOM   22    C  CA    . GLN A  1 27  ? 84.726  109.752 15.706  1.00 44.59 ? 55   GLN A CA    1 
ATOM   23    C  C     . GLN A  1 27  ? 83.268  109.838 16.242  1.00 43.53 ? 55   GLN A C     1 
ATOM   24    O  O     . GLN A  1 27  ? 82.848  108.998 17.043  1.00 43.76 ? 55   GLN A O     1 
ATOM   25    C  CB    . GLN A  1 27  ? 85.736  109.420 16.822  1.00 45.03 ? 55   GLN A CB    1 
ATOM   26    C  CG    . GLN A  1 27  ? 86.111  110.592 17.762  1.00 46.93 ? 55   GLN A CG    1 
ATOM   27    C  CD    . GLN A  1 27  ? 87.532  111.158 17.553  1.00 48.84 ? 55   GLN A CD    1 
ATOM   28    O  OE1   . GLN A  1 27  ? 87.779  112.320 17.868  1.00 49.49 ? 55   GLN A OE1   1 
ATOM   29    N  NE2   . GLN A  1 27  ? 88.468  110.328 17.059  1.00 48.87 ? 55   GLN A NE2   1 
ATOM   30    N  N     . THR A  1 28  ? 82.501  110.830 15.778  1.00 42.19 ? 56   THR A N     1 
ATOM   31    C  CA    . THR A  1 28  ? 81.052  110.919 16.057  1.00 41.07 ? 56   THR A CA    1 
ATOM   32    C  C     . THR A  1 28  ? 80.248  110.249 14.939  1.00 39.58 ? 56   THR A C     1 
ATOM   33    O  O     . THR A  1 28  ? 80.127  110.787 13.842  1.00 39.39 ? 56   THR A O     1 
ATOM   34    C  CB    . THR A  1 28  ? 80.576  112.385 16.206  1.00 41.24 ? 56   THR A CB    1 
ATOM   35    O  OG1   . THR A  1 28  ? 81.288  113.005 17.285  1.00 41.87 ? 56   THR A OG1   1 
ATOM   36    C  CG2   . THR A  1 28  ? 79.058  112.453 16.486  1.00 40.77 ? 56   THR A CG2   1 
ATOM   37    N  N     . PHE A  1 29  ? 79.698  109.078 15.235  1.00 37.90 ? 57   PHE A N     1 
ATOM   38    C  CA    . PHE A  1 29  ? 79.040  108.247 14.230  1.00 36.51 ? 57   PHE A CA    1 
ATOM   39    C  C     . PHE A  1 29  ? 77.520  108.422 14.249  1.00 35.41 ? 57   PHE A C     1 
ATOM   40    O  O     . PHE A  1 29  ? 76.965  108.998 15.186  1.00 34.64 ? 57   PHE A O     1 
ATOM   41    C  CB    . PHE A  1 29  ? 79.381  106.770 14.473  1.00 36.50 ? 57   PHE A CB    1 
ATOM   42    C  CG    . PHE A  1 29  ? 80.863  106.480 14.598  1.00 36.28 ? 57   PHE A CG    1 
ATOM   43    C  CD1   . PHE A  1 29  ? 81.770  106.957 13.655  1.00 36.43 ? 57   PHE A CD1   1 
ATOM   44    C  CD2   . PHE A  1 29  ? 81.344  105.691 15.649  1.00 36.26 ? 57   PHE A CD2   1 
ATOM   45    C  CE1   . PHE A  1 29  ? 83.137  106.673 13.770  1.00 35.69 ? 57   PHE A CE1   1 
ATOM   46    C  CE2   . PHE A  1 29  ? 82.702  105.399 15.770  1.00 35.72 ? 57   PHE A CE2   1 
ATOM   47    C  CZ    . PHE A  1 29  ? 83.601  105.886 14.825  1.00 36.33 ? 57   PHE A CZ    1 
ATOM   48    N  N     . THR A  1 30  ? 76.849  107.922 13.213  1.00 34.14 ? 58   THR A N     1 
ATOM   49    C  CA    . THR A  1 30  ? 75.396  107.838 13.227  1.00 33.32 ? 58   THR A CA    1 
ATOM   50    C  C     . THR A  1 30  ? 74.989  106.706 14.167  1.00 33.03 ? 58   THR A C     1 
ATOM   51    O  O     . THR A  1 30  ? 75.799  105.831 14.485  1.00 32.02 ? 58   THR A O     1 
ATOM   52    C  CB    . THR A  1 30  ? 74.799  107.568 11.834  1.00 33.31 ? 58   THR A CB    1 
ATOM   53    O  OG1   . THR A  1 30  ? 75.201  106.273 11.379  1.00 31.68 ? 58   THR A OG1   1 
ATOM   54    C  CG2   . THR A  1 30  ? 75.238  108.632 10.838  1.00 33.45 ? 58   THR A CG2   1 
ATOM   55    N  N     . ASP A  1 31  ? 73.740  106.732 14.613  1.00 32.52 ? 59   ASP A N     1 
ATOM   56    C  CA    . ASP A  1 31  ? 73.223  105.683 15.492  1.00 32.51 ? 59   ASP A CA    1 
ATOM   57    C  C     . ASP A  1 31  ? 73.400  104.295 14.847  1.00 32.15 ? 59   ASP A C     1 
ATOM   58    O  O     . ASP A  1 31  ? 73.829  103.362 15.520  1.00 31.44 ? 59   ASP A O     1 
ATOM   59    C  CB    . ASP A  1 31  ? 71.751  105.950 15.882  1.00 32.68 ? 59   ASP A CB    1 
ATOM   60    C  CG    . ASP A  1 31  ? 71.582  107.167 16.826  1.00 33.12 ? 59   ASP A CG    1 
ATOM   61    O  OD1   . ASP A  1 31  ? 72.575  107.624 17.444  1.00 34.65 ? 59   ASP A OD1   1 
ATOM   62    O  OD2   . ASP A  1 31  ? 70.445  107.672 16.949  1.00 33.48 ? 59   ASP A OD2   1 
ATOM   63    N  N     . GLU A  1 32  ? 73.122  104.174 13.546  1.00 32.02 ? 60   GLU A N     1 
ATOM   64    C  CA    . GLU A  1 32  ? 73.304  102.897 12.839  1.00 32.70 ? 60   GLU A CA    1 
ATOM   65    C  C     . GLU A  1 32  ? 74.771  102.464 12.796  1.00 32.18 ? 60   GLU A C     1 
ATOM   66    O  O     . GLU A  1 32  ? 75.080  101.279 12.962  1.00 31.30 ? 60   GLU A O     1 
ATOM   67    C  CB    . GLU A  1 32  ? 72.738  102.948 11.413  1.00 32.89 ? 60   GLU A CB    1 
ATOM   68    C  CG    . GLU A  1 32  ? 73.066  101.689 10.568  1.00 34.82 ? 60   GLU A CG    1 
ATOM   69    C  CD    . GLU A  1 32  ? 72.314  101.624 9.235   1.00 35.02 ? 60   GLU A CD    1 
ATOM   70    O  OE1   . GLU A  1 32  ? 72.397  102.592 8.449   1.00 38.47 ? 60   GLU A OE1   1 
ATOM   71    O  OE2   . GLU A  1 32  ? 71.647  100.597 8.968   1.00 39.80 ? 60   GLU A OE2   1 
ATOM   72    N  N     . GLU A  1 33  ? 75.664  103.422 12.552  1.00 32.10 ? 61   GLU A N     1 
ATOM   73    C  CA    . GLU A  1 33  ? 77.097  103.148 12.529  1.00 32.18 ? 61   GLU A CA    1 
ATOM   74    C  C     . GLU A  1 33  ? 77.581  102.651 13.895  1.00 32.79 ? 61   GLU A C     1 
ATOM   75    O  O     . GLU A  1 33  ? 78.334  101.683 13.959  1.00 32.30 ? 61   GLU A O     1 
ATOM   76    C  CB    . GLU A  1 33  ? 77.881  104.390 12.074  1.00 31.90 ? 61   GLU A CB    1 
ATOM   77    C  CG    . GLU A  1 33  ? 77.796  104.639 10.565  1.00 31.60 ? 61   GLU A CG    1 
ATOM   78    C  CD    . GLU A  1 33  ? 78.184  106.056 10.117  1.00 32.07 ? 61   GLU A CD    1 
ATOM   79    O  OE1   . GLU A  1 33  ? 78.533  106.924 10.954  1.00 31.14 ? 61   GLU A OE1   1 
ATOM   80    O  OE2   . GLU A  1 33  ? 78.144  106.293 8.893   1.00 30.74 ? 61   GLU A OE2   1 
ATOM   81    N  N     . MET A  1 34  ? 77.151  103.315 14.970  1.00 33.57 ? 62   MET A N     1 
ATOM   82    C  CA    . MET A  1 34  ? 77.477  102.891 16.340  1.00 35.17 ? 62   MET A CA    1 
ATOM   83    C  C     . MET A  1 34  ? 76.973  101.469 16.623  1.00 34.60 ? 62   MET A C     1 
ATOM   84    O  O     . MET A  1 34  ? 77.700  100.647 17.180  1.00 34.39 ? 62   MET A O     1 
ATOM   85    C  CB    . MET A  1 34  ? 76.876  103.853 17.383  1.00 35.35 ? 62   MET A CB    1 
ATOM   86    C  CG    . MET A  1 34  ? 77.477  105.271 17.428  1.00 36.20 ? 62   MET A CG    1 
ATOM   87    S  SD    . MET A  1 34  ? 76.747  106.259 18.781  1.00 39.76 ? 62   MET A SD    1 
ATOM   88    C  CE    . MET A  1 34  ? 76.445  107.841 17.992  1.00 38.25 ? 62   MET A CE    1 
ATOM   89    N  N     . MET A  1 35  ? 75.729  101.197 16.231  1.00 34.53 ? 63   MET A N     1 
ATOM   90    C  CA    . MET A  1 35  ? 75.093  99.892  16.462  1.00 34.91 ? 63   MET A CA    1 
ATOM   91    C  C     . MET A  1 35  ? 75.817  98.759  15.728  1.00 33.72 ? 63   MET A C     1 
ATOM   92    O  O     . MET A  1 35  ? 76.025  97.680  16.294  1.00 33.09 ? 63   MET A O     1 
ATOM   93    C  CB    . MET A  1 35  ? 73.616  99.923  16.039  1.00 34.71 ? 63   MET A CB    1 
ATOM   94    C  CG    . MET A  1 35  ? 72.686  100.655 17.016  1.00 36.47 ? 63   MET A CG    1 
ATOM   95    S  SD    . MET A  1 35  ? 70.923  100.579 16.603  1.00 37.91 ? 63   MET A SD    1 
ATOM   96    C  CE    . MET A  1 35  ? 70.698  101.977 15.491  1.00 38.47 ? 63   MET A CE    1 
ATOM   97    N  N     . ILE A  1 36  ? 76.182  99.004  14.470  1.00 32.89 ? 64   ILE A N     1 
ATOM   98    C  CA    . ILE A  1 36  ? 76.920  98.020  13.672  1.00 32.56 ? 64   ILE A CA    1 
ATOM   99    C  C     . ILE A  1 36  ? 78.326  97.767  14.252  1.00 32.44 ? 64   ILE A C     1 
ATOM   100   O  O     . ILE A  1 36  ? 78.763  96.617  14.332  1.00 32.01 ? 64   ILE A O     1 
ATOM   101   C  CB    . ILE A  1 36  ? 77.015  98.443  12.177  1.00 32.68 ? 64   ILE A CB    1 
ATOM   102   C  CG1   . ILE A  1 36  ? 75.632  98.401  11.521  1.00 33.27 ? 64   ILE A CG1   1 
ATOM   103   C  CG2   . ILE A  1 36  ? 77.965  97.526  11.413  1.00 33.13 ? 64   ILE A CG2   1 
ATOM   104   C  CD1   . ILE A  1 36  ? 75.545  99.071  10.137  1.00 31.98 ? 64   ILE A CD1   1 
ATOM   105   N  N     . LYS A  1 37  ? 79.023  98.827  14.667  1.00 32.16 ? 65   LYS A N     1 
ATOM   106   C  CA    . LYS A  1 37  ? 80.338  98.678  15.321  1.00 32.24 ? 65   LYS A CA    1 
ATOM   107   C  C     . LYS A  1 37  ? 80.272  97.764  16.558  1.00 31.98 ? 65   LYS A C     1 
ATOM   108   O  O     . LYS A  1 37  ? 81.068  96.830  16.694  1.00 31.52 ? 65   LYS A O     1 
ATOM   109   C  CB    . LYS A  1 37  ? 80.896  100.046 15.723  1.00 32.35 ? 65   LYS A CB    1 
ATOM   110   C  CG    . LYS A  1 37  ? 82.219  99.983  16.476  1.00 32.63 ? 65   LYS A CG    1 
ATOM   111   C  CD    . LYS A  1 37  ? 82.837  101.361 16.688  1.00 32.94 ? 65   LYS A CD    1 
ATOM   112   C  CE    . LYS A  1 37  ? 84.267  101.231 17.241  1.00 34.75 ? 65   LYS A CE    1 
ATOM   113   N  NZ    . LYS A  1 37  ? 84.640  102.370 18.103  1.00 36.26 ? 65   LYS A NZ    1 
ATOM   114   N  N     . SER A  1 38  ? 79.327  98.057  17.453  1.00 31.83 ? 66   SER A N     1 
ATOM   115   C  CA    . SER A  1 38  ? 79.105  97.261  18.663  1.00 32.14 ? 66   SER A CA    1 
ATOM   116   C  C     . SER A  1 38  ? 78.790  95.793  18.353  1.00 31.46 ? 66   SER A C     1 
ATOM   117   O  O     . SER A  1 38  ? 79.302  94.896  19.021  1.00 31.52 ? 66   SER A O     1 
ATOM   118   C  CB    . SER A  1 38  ? 77.951  97.852  19.490  1.00 32.52 ? 66   SER A CB    1 
ATOM   119   O  OG    . SER A  1 38  ? 78.287  99.151  19.953  1.00 34.54 ? 66   SER A OG    1 
ATOM   120   N  N     . SER A  1 39  ? 77.948  95.564  17.346  1.00 30.36 ? 67   SER A N     1 
ATOM   121   C  CA    . SER A  1 39  ? 77.573  94.209  16.936  1.00 30.13 ? 67   SER A CA    1 
ATOM   122   C  C     . SER A  1 39  ? 78.782  93.390  16.455  1.00 29.62 ? 67   SER A C     1 
ATOM   123   O  O     . SER A  1 39  ? 78.944  92.226  16.824  1.00 29.23 ? 67   SER A O     1 
ATOM   124   C  CB    A SER A  1 39  ? 76.494  94.257  15.847  0.50 30.13 ? 67   SER A CB    1 
ATOM   125   C  CB    B SER A  1 39  ? 76.510  94.267  15.832  0.50 30.17 ? 67   SER A CB    1 
ATOM   126   O  OG    A SER A  1 39  ? 75.257  94.687  16.389  0.50 29.96 ? 67   SER A OG    1 
ATOM   127   O  OG    B SER A  1 39  ? 76.045  92.970  15.507  0.50 30.36 ? 67   SER A OG    1 
ATOM   128   N  N     . VAL A  1 40  ? 79.623  94.006  15.636  1.00 28.75 ? 68   VAL A N     1 
ATOM   129   C  CA    . VAL A  1 40  ? 80.813  93.339  15.117  1.00 28.82 ? 68   VAL A CA    1 
ATOM   130   C  C     . VAL A  1 40  ? 81.849  93.071  16.221  1.00 28.77 ? 68   VAL A C     1 
ATOM   131   O  O     . VAL A  1 40  ? 82.477  92.016  16.236  1.00 28.12 ? 68   VAL A O     1 
ATOM   132   C  CB    . VAL A  1 40  ? 81.448  94.144  13.971  1.00 28.70 ? 68   VAL A CB    1 
ATOM   133   C  CG1   . VAL A  1 40  ? 82.753  93.487  13.496  1.00 28.42 ? 68   VAL A CG1   1 
ATOM   134   C  CG2   . VAL A  1 40  ? 80.450  94.270  12.824  1.00 28.70 ? 68   VAL A CG2   1 
ATOM   135   N  N     . LYS A  1 41  ? 82.013  94.022  17.137  1.00 29.39 ? 69   LYS A N     1 
ATOM   136   C  CA    . LYS A  1 41  ? 82.883  93.834  18.306  1.00 30.21 ? 69   LYS A CA    1 
ATOM   137   C  C     . LYS A  1 41  ? 82.498  92.562  19.076  1.00 30.38 ? 69   LYS A C     1 
ATOM   138   O  O     . LYS A  1 41  ? 83.359  91.746  19.416  1.00 29.51 ? 69   LYS A O     1 
ATOM   139   C  CB    . LYS A  1 41  ? 82.802  95.047  19.234  1.00 30.50 ? 69   LYS A CB    1 
ATOM   140   C  CG    . LYS A  1 41  ? 83.825  95.028  20.355  1.00 32.03 ? 69   LYS A CG    1 
ATOM   141   C  CD    . LYS A  1 41  ? 83.515  96.071  21.407  1.00 34.20 ? 69   LYS A CD    1 
ATOM   142   C  CE    . LYS A  1 41  ? 84.622  96.128  22.444  1.00 36.46 ? 69   LYS A CE    1 
ATOM   143   N  NZ    . LYS A  1 41  ? 84.112  96.536  23.791  1.00 39.06 ? 69   LYS A NZ    1 
ATOM   144   N  N     . LYS A  1 42  ? 81.200  92.404  19.317  1.00 30.75 ? 70   LYS A N     1 
ATOM   145   C  CA    . LYS A  1 42  ? 80.654  91.245  20.029  1.00 31.92 ? 70   LYS A CA    1 
ATOM   146   C  C     . LYS A  1 42  ? 80.889  89.956  19.240  1.00 31.80 ? 70   LYS A C     1 
ATOM   147   O  O     . LYS A  1 42  ? 81.374  88.969  19.794  1.00 31.34 ? 70   LYS A O     1 
ATOM   148   C  CB    . LYS A  1 42  ? 79.157  91.443  20.277  1.00 31.63 ? 70   LYS A CB    1 
ATOM   149   C  CG    . LYS A  1 42  ? 78.496  90.380  21.128  1.00 33.23 ? 70   LYS A CG    1 
ATOM   150   C  CD    . LYS A  1 42  ? 77.018  90.699  21.340  1.00 33.67 ? 70   LYS A CD    1 
ATOM   151   C  CE    . LYS A  1 42  ? 76.208  89.454  21.681  1.00 36.15 ? 70   LYS A CE    1 
ATOM   152   N  NZ    . LYS A  1 42  ? 76.615  88.879  22.986  1.00 38.55 ? 70   LYS A NZ    1 
ATOM   153   N  N     . PHE A  1 43  ? 80.536  89.985  17.953  1.00 32.14 ? 71   PHE A N     1 
ATOM   154   C  CA    . PHE A  1 43  ? 80.732  88.846  17.046  1.00 32.43 ? 71   PHE A CA    1 
ATOM   155   C  C     . PHE A  1 43  ? 82.192  88.410  16.992  1.00 32.68 ? 71   PHE A C     1 
ATOM   156   O  O     . PHE A  1 43  ? 82.492  87.222  17.105  1.00 32.37 ? 71   PHE A O     1 
ATOM   157   C  CB    . PHE A  1 43  ? 80.250  89.184  15.624  1.00 32.64 ? 71   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1 43  ? 80.683  88.185  14.577  1.00 32.23 ? 71   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1 43  ? 80.194  86.881  14.596  1.00 32.93 ? 71   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1 43  ? 81.579  88.546  13.575  1.00 32.76 ? 71   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1 43  ? 80.594  85.949  13.632  1.00 32.14 ? 71   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1 43  ? 81.979  87.625  12.615  1.00 32.07 ? 71   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1 43  ? 81.476  86.320  12.646  1.00 32.39 ? 71   PHE A CZ    1 
ATOM   164   N  N     . ALA A  1 44  ? 83.085  89.376  16.819  1.00 32.68 ? 72   ALA A N     1 
ATOM   165   C  CA    . ALA A  1 44  ? 84.508  89.103  16.688  1.00 33.65 ? 72   ALA A CA    1 
ATOM   166   C  C     . ALA A  1 44  ? 85.077  88.472  17.966  1.00 34.23 ? 72   ALA A C     1 
ATOM   167   O  O     . ALA A  1 44  ? 85.830  87.504  17.896  1.00 34.19 ? 72   ALA A O     1 
ATOM   168   C  CB    . ALA A  1 44  ? 85.262  90.389  16.337  1.00 32.89 ? 72   ALA A CB    1 
ATOM   169   N  N     . GLN A  1 45  ? 84.699  89.015  19.122  1.00 34.88 ? 73   GLN A N     1 
ATOM   170   C  CA    . GLN A  1 45  ? 85.163  88.489  20.409  1.00 35.94 ? 73   GLN A CA    1 
ATOM   171   C  C     . GLN A  1 45  ? 84.626  87.077  20.682  1.00 35.62 ? 73   GLN A C     1 
ATOM   172   O  O     . GLN A  1 45  ? 85.381  86.202  21.103  1.00 36.01 ? 73   GLN A O     1 
ATOM   173   C  CB    . GLN A  1 45  ? 84.825  89.472  21.554  1.00 36.10 ? 73   GLN A CB    1 
ATOM   174   C  CG    . GLN A  1 45  ? 85.719  90.734  21.512  1.00 37.29 ? 73   GLN A CG    1 
ATOM   175   C  CD    . GLN A  1 45  ? 85.381  91.811  22.558  1.00 37.82 ? 73   GLN A CD    1 
ATOM   176   O  OE1   . GLN A  1 45  ? 84.424  91.692  23.330  1.00 40.42 ? 73   GLN A OE1   1 
ATOM   177   N  NE2   . GLN A  1 45  ? 86.188  92.876  22.574  1.00 39.80 ? 73   GLN A NE2   1 
ATOM   178   N  N     . GLU A  1 46  ? 83.348  86.843  20.393  1.00 35.37 ? 74   GLU A N     1 
ATOM   179   C  CA    . GLU A  1 46  ? 82.715  85.547  20.664  1.00 35.49 ? 74   GLU A CA    1 
ATOM   180   C  C     . GLU A  1 46  ? 82.997  84.457  19.620  1.00 34.59 ? 74   GLU A C     1 
ATOM   181   O  O     . GLU A  1 46  ? 83.217  83.299  19.975  1.00 34.23 ? 74   GLU A O     1 
ATOM   182   C  CB    . GLU A  1 46  ? 81.199  85.724  20.814  1.00 35.69 ? 74   GLU A CB    1 
ATOM   183   C  CG    . GLU A  1 46  ? 80.822  86.635  21.978  1.00 37.16 ? 74   GLU A CG    1 
ATOM   184   C  CD    . GLU A  1 46  ? 79.325  86.853  22.131  1.00 37.34 ? 74   GLU A CD    1 
ATOM   185   O  OE1   . GLU A  1 46  ? 78.517  86.259  21.367  1.00 39.06 ? 74   GLU A OE1   1 
ATOM   186   O  OE2   . GLU A  1 46  ? 78.964  87.626  23.050  1.00 41.06 ? 74   GLU A OE2   1 
ATOM   187   N  N     . GLN A  1 47  ? 82.972  84.814  18.338  1.00 33.64 ? 75   GLN A N     1 
ATOM   188   C  CA    . GLN A  1 47  ? 83.059  83.816  17.269  1.00 33.22 ? 75   GLN A CA    1 
ATOM   189   C  C     . GLN A  1 47  ? 84.418  83.703  16.579  1.00 32.06 ? 75   GLN A C     1 
ATOM   190   O  O     . GLN A  1 47  ? 84.721  82.654  15.995  1.00 31.90 ? 75   GLN A O     1 
ATOM   191   C  CB    . GLN A  1 47  ? 81.981  84.081  16.223  1.00 33.65 ? 75   GLN A CB    1 
ATOM   192   C  CG    . GLN A  1 47  ? 80.551  84.095  16.782  1.00 36.12 ? 75   GLN A CG    1 
ATOM   193   C  CD    . GLN A  1 47  ? 80.051  82.737  17.238  1.00 39.76 ? 75   GLN A CD    1 
ATOM   194   O  OE1   . GLN A  1 47  ? 80.530  81.687  16.785  1.00 42.66 ? 75   GLN A OE1   1 
ATOM   195   N  NE2   . GLN A  1 47  ? 79.065  82.747  18.136  1.00 41.70 ? 75   GLN A NE2   1 
ATOM   196   N  N     . ILE A  1 48  ? 85.231  84.761  16.627  1.00 30.78 ? 76   ILE A N     1 
ATOM   197   C  CA    . ILE A  1 48  ? 86.504  84.782  15.901  1.00 29.94 ? 76   ILE A CA    1 
ATOM   198   C  C     . ILE A  1 48  ? 87.722  84.601  16.829  1.00 29.62 ? 76   ILE A C     1 
ATOM   199   O  O     . ILE A  1 48  ? 88.580  83.749  16.569  1.00 28.90 ? 76   ILE A O     1 
ATOM   200   C  CB    . ILE A  1 48  ? 86.641  86.082  15.044  1.00 29.77 ? 76   ILE A CB    1 
ATOM   201   C  CG1   . ILE A  1 48  ? 85.427  86.227  14.109  1.00 29.96 ? 76   ILE A CG1   1 
ATOM   202   C  CG2   . ILE A  1 48  ? 87.941  86.072  14.252  1.00 29.25 ? 76   ILE A CG2   1 
ATOM   203   C  CD1   . ILE A  1 48  ? 85.370  87.544  13.341  1.00 29.85 ? 76   ILE A CD1   1 
ATOM   204   N  N     . ALA A  1 49  ? 87.770  85.380  17.914  1.00 29.24 ? 77   ALA A N     1 
ATOM   205   C  CA    . ALA A  1 49  ? 88.917  85.402  18.830  1.00 29.36 ? 77   ALA A CA    1 
ATOM   206   C  C     . ALA A  1 49  ? 89.426  84.011  19.247  1.00 29.07 ? 77   ALA A C     1 
ATOM   207   O  O     . ALA A  1 49  ? 90.615  83.776  19.197  1.00 29.44 ? 77   ALA A O     1 
ATOM   208   C  CB    . ALA A  1 49  ? 88.613  86.261  20.075  1.00 29.10 ? 77   ALA A CB    1 
ATOM   209   N  N     . PRO A  1 50  ? 88.528  83.091  19.638  1.00 28.90 ? 78   PRO A N     1 
ATOM   210   C  CA    . PRO A  1 50  ? 88.945  81.720  19.998  1.00 29.00 ? 78   PRO A CA    1 
ATOM   211   C  C     . PRO A  1 50  ? 89.671  80.913  18.906  1.00 28.45 ? 78   PRO A C     1 
ATOM   212   O  O     . PRO A  1 50  ? 90.394  79.965  19.233  1.00 28.16 ? 78   PRO A O     1 
ATOM   213   C  CB    . PRO A  1 50  ? 87.618  81.034  20.357  1.00 29.01 ? 78   PRO A CB    1 
ATOM   214   C  CG    . PRO A  1 50  ? 86.707  82.140  20.699  1.00 29.72 ? 78   PRO A CG    1 
ATOM   215   C  CD    . PRO A  1 50  ? 87.080  83.277  19.825  1.00 28.89 ? 78   PRO A CD    1 
ATOM   216   N  N     . LEU A  1 51  ? 89.494  81.301  17.645  1.00 28.12 ? 79   LEU A N     1 
ATOM   217   C  CA    . LEU A  1 51  ? 89.992  80.547  16.489  1.00 27.97 ? 79   LEU A CA    1 
ATOM   218   C  C     . LEU A  1 51  ? 91.199  81.160  15.768  1.00 27.80 ? 79   LEU A C     1 
ATOM   219   O  O     . LEU A  1 51  ? 91.760  80.533  14.877  1.00 27.60 ? 79   LEU A O     1 
ATOM   220   C  CB    . LEU A  1 51  ? 88.853  80.378  15.480  1.00 28.12 ? 79   LEU A CB    1 
ATOM   221   C  CG    . LEU A  1 51  ? 87.649  79.581  15.965  1.00 28.47 ? 79   LEU A CG    1 
ATOM   222   C  CD1   . LEU A  1 51  ? 86.507  79.697  14.978  1.00 28.08 ? 79   LEU A CD1   1 
ATOM   223   C  CD2   . LEU A  1 51  ? 88.030  78.112  16.201  1.00 28.75 ? 79   LEU A CD2   1 
ATOM   224   N  N     . VAL A  1 52  ? 91.598  82.368  16.153  1.00 27.75 ? 80   VAL A N     1 
ATOM   225   C  CA    . VAL A  1 52  ? 92.626  83.126  15.439  1.00 28.06 ? 80   VAL A CA    1 
ATOM   226   C  C     . VAL A  1 52  ? 93.965  82.372  15.330  1.00 28.48 ? 80   VAL A C     1 
ATOM   227   O  O     . VAL A  1 52  ? 94.570  82.357  14.261  1.00 27.43 ? 80   VAL A O     1 
ATOM   228   C  CB    . VAL A  1 52  ? 92.817  84.522  16.078  1.00 28.27 ? 80   VAL A CB    1 
ATOM   229   C  CG1   . VAL A  1 52  ? 94.062  85.244  15.530  1.00 28.12 ? 80   VAL A CG1   1 
ATOM   230   C  CG2   . VAL A  1 52  ? 91.569  85.339  15.869  1.00 27.48 ? 80   VAL A CG2   1 
ATOM   231   N  N     . SER A  1 53  ? 94.394  81.715  16.415  1.00 29.02 ? 81   SER A N     1 
ATOM   232   C  CA    . SER A  1 53  ? 95.675  80.994  16.419  1.00 29.15 ? 81   SER A CA    1 
ATOM   233   C  C     . SER A  1 53  ? 95.671  79.761  15.506  1.00 29.04 ? 81   SER A C     1 
ATOM   234   O  O     . SER A  1 53  ? 96.622  79.549  14.749  1.00 28.70 ? 81   SER A O     1 
ATOM   235   C  CB    A SER A  1 53  ? 96.112  80.622  17.847  0.50 29.36 ? 81   SER A CB    1 
ATOM   236   C  CB    B SER A  1 53  ? 96.065  80.589  17.848  0.50 29.39 ? 81   SER A CB    1 
ATOM   237   O  OG    A SER A  1 53  ? 95.024  80.181  18.631  0.50 29.15 ? 81   SER A OG    1 
ATOM   238   O  OG    B SER A  1 53  ? 96.340  81.731  18.640  0.50 29.51 ? 81   SER A OG    1 
ATOM   239   N  N     . THR A  1 54  ? 94.603  78.969  15.577  1.00 29.13 ? 82   THR A N     1 
ATOM   240   C  CA    . THR A  1 54  ? 94.425  77.787  14.725  1.00 29.57 ? 82   THR A CA    1 
ATOM   241   C  C     . THR A  1 54  ? 94.380  78.141  13.243  1.00 28.64 ? 82   THR A C     1 
ATOM   242   O  O     . THR A  1 54  ? 94.996  77.470  12.424  1.00 27.78 ? 82   THR A O     1 
ATOM   243   C  CB    . THR A  1 54  ? 93.098  77.046  15.051  1.00 29.77 ? 82   THR A CB    1 
ATOM   244   O  OG1   . THR A  1 54  ? 92.991  76.871  16.465  1.00 33.35 ? 82   THR A OG1   1 
ATOM   245   C  CG2   . THR A  1 54  ? 93.039  75.676  14.368  1.00 30.08 ? 82   THR A CG2   1 
ATOM   246   N  N     . MET A  1 55  ? 93.619  79.174  12.903  1.00 28.21 ? 83   MET A N     1 
ATOM   247   C  CA    . MET A  1 55  ? 93.516  79.597  11.510  1.00 28.23 ? 83   MET A CA    1 
ATOM   248   C  C     . MET A  1 55  ? 94.882  80.057  10.983  1.00 28.20 ? 83   MET A C     1 
ATOM   249   O  O     . MET A  1 55  ? 95.251  79.751  9.854   1.00 28.21 ? 83   MET A O     1 
ATOM   250   C  CB    . MET A  1 55  ? 92.446  80.684  11.354  1.00 28.32 ? 83   MET A CB    1 
ATOM   251   C  CG    . MET A  1 55  ? 91.044  80.164  11.672  1.00 27.55 ? 83   MET A CG    1 
ATOM   252   S  SD    . MET A  1 55  ? 89.691  81.275  11.242  1.00 29.56 ? 83   MET A SD    1 
ATOM   253   C  CE    . MET A  1 55  ? 90.027  82.700  12.282  1.00 26.79 ? 83   MET A CE    1 
ATOM   254   N  N     . ASP A  1 56  ? 95.630  80.784  11.815  1.00 28.00 ? 84   ASP A N     1 
ATOM   255   C  CA    . ASP A  1 56  ? 96.980  81.222  11.473  1.00 28.22 ? 84   ASP A CA    1 
ATOM   256   C  C     . ASP A  1 56  ? 97.922  80.025  11.302  1.00 29.01 ? 84   ASP A C     1 
ATOM   257   O  O     . ASP A  1 56  ? 98.632  79.933  10.305  1.00 28.13 ? 84   ASP A O     1 
ATOM   258   C  CB    . ASP A  1 56  ? 97.521  82.162  12.561  1.00 28.06 ? 84   ASP A CB    1 
ATOM   259   C  CG    . ASP A  1 56  ? 98.967  82.516  12.358  1.00 28.02 ? 84   ASP A CG    1 
ATOM   260   O  OD1   . ASP A  1 56  ? 99.252  83.245  11.389  1.00 26.20 ? 84   ASP A OD1   1 
ATOM   261   O  OD2   . ASP A  1 56  ? 99.814  82.063  13.162  1.00 30.01 ? 84   ASP A OD2   1 
ATOM   262   N  N     . GLU A  1 57  ? 97.913  79.117  12.280  1.00 29.77 ? 85   GLU A N     1 
ATOM   263   C  CA    . GLU A  1 57  ? 98.787  77.957  12.255  1.00 31.42 ? 85   GLU A CA    1 
ATOM   264   C  C     . GLU A  1 57  ? 98.514  77.077  11.030  1.00 31.07 ? 85   GLU A C     1 
ATOM   265   O  O     . GLU A  1 57  ? 99.445  76.653  10.349  1.00 31.20 ? 85   GLU A O     1 
ATOM   266   C  CB    . GLU A  1 57  ? 98.652  77.142  13.552  1.00 31.62 ? 85   GLU A CB    1 
ATOM   267   C  CG    . GLU A  1 57  ? 99.791  76.132  13.760  1.00 33.93 ? 85   GLU A CG    1 
ATOM   268   C  CD    . GLU A  1 57  ? 99.661  75.330  15.063  1.00 34.58 ? 85   GLU A CD    1 
ATOM   269   O  OE1   . GLU A  1 57  ? 98.766  74.459  15.143  1.00 38.23 ? 85   GLU A OE1   1 
ATOM   270   O  OE2   . GLU A  1 57  ? 100.472 75.562  15.998  1.00 38.79 ? 85   GLU A OE2   1 
ATOM   271   N  N     . ASN A  1 58  ? 97.235  76.848  10.744  1.00 30.75 ? 86   ASN A N     1 
ATOM   272   C  CA    . ASN A  1 58  ? 96.808  75.973  9.663   1.00 31.34 ? 86   ASN A CA    1 
ATOM   273   C  C     . ASN A  1 58  ? 96.749  76.631  8.287   1.00 30.56 ? 86   ASN A C     1 
ATOM   274   O  O     . ASN A  1 58  ? 96.563  75.930  7.293   1.00 30.33 ? 86   ASN A O     1 
ATOM   275   C  CB    . ASN A  1 58  ? 95.402  75.438  9.945   1.00 31.19 ? 86   ASN A CB    1 
ATOM   276   C  CG    . ASN A  1 58  ? 95.339  74.516  11.138  1.00 33.42 ? 86   ASN A CG    1 
ATOM   277   O  OD1   . ASN A  1 58  ? 96.362  74.122  11.712  1.00 34.14 ? 86   ASN A OD1   1 
ATOM   278   N  ND2   . ASN A  1 58  ? 94.106  74.138  11.507  1.00 35.30 ? 86   ASN A ND2   1 
ATOM   279   N  N     . SER A  1 59  ? 96.871  77.954  8.237   1.00 30.59 ? 87   SER A N     1 
ATOM   280   C  CA    . SER A  1 59  ? 96.605  78.728  7.013   1.00 30.61 ? 87   SER A CA    1 
ATOM   281   C  C     . SER A  1 59  ? 95.234  78.396  6.432   1.00 30.37 ? 87   SER A C     1 
ATOM   282   O  O     . SER A  1 59  ? 95.107  78.163  5.240   1.00 29.85 ? 87   SER A O     1 
ATOM   283   C  CB    . SER A  1 59  ? 97.679  78.487  5.942   1.00 30.68 ? 87   SER A CB    1 
ATOM   284   O  OG    . SER A  1 59  ? 98.901  79.067  6.320   1.00 31.93 ? 87   SER A OG    1 
ATOM   285   N  N     . LYS A  1 60  ? 94.216  78.372  7.283   1.00 30.54 ? 88   LYS A N     1 
ATOM   286   C  CA    . LYS A  1 60  ? 92.892  77.935  6.865   1.00 30.82 ? 88   LYS A CA    1 
ATOM   287   C  C     . LYS A  1 60  ? 91.817  78.686  7.625   1.00 30.58 ? 88   LYS A C     1 
ATOM   288   O  O     . LYS A  1 60  ? 91.715  78.586  8.847   1.00 30.51 ? 88   LYS A O     1 
ATOM   289   C  CB    . LYS A  1 60  ? 92.725  76.431  7.086   1.00 31.41 ? 88   LYS A CB    1 
ATOM   290   C  CG    . LYS A  1 60  ? 91.424  75.852  6.537   1.00 33.53 ? 88   LYS A CG    1 
ATOM   291   C  CD    . LYS A  1 60  ? 91.093  74.522  7.208   1.00 36.78 ? 88   LYS A CD    1 
ATOM   292   C  CE    . LYS A  1 60  ? 89.639  74.122  7.000   1.00 38.49 ? 88   LYS A CE    1 
ATOM   293   N  NZ    . LYS A  1 60  ? 89.302  72.885  7.771   1.00 39.06 ? 88   LYS A NZ    1 
ATOM   294   N  N     . MET A  1 61  ? 91.027  79.444  6.877   1.00 30.29 ? 89   MET A N     1 
ATOM   295   C  CA    . MET A  1 61  ? 89.846  80.117  7.385   1.00 30.79 ? 89   MET A CA    1 
ATOM   296   C  C     . MET A  1 61  ? 88.774  79.072  7.744   1.00 30.49 ? 89   MET A C     1 
ATOM   297   O  O     . MET A  1 61  ? 88.474  78.175  6.948   1.00 30.69 ? 89   MET A O     1 
ATOM   298   C  CB    . MET A  1 61  ? 89.332  81.069  6.299   1.00 31.09 ? 89   MET A CB    1 
ATOM   299   C  CG    . MET A  1 61  ? 88.136  81.902  6.666   1.00 33.91 ? 89   MET A CG    1 
ATOM   300   S  SD    . MET A  1 61  ? 88.512  83.250  7.773   1.00 39.85 ? 89   MET A SD    1 
ATOM   301   C  CE    . MET A  1 61  ? 89.641  84.256  6.792   1.00 35.50 ? 89   MET A CE    1 
ATOM   302   N  N     . GLU A  1 62  ? 88.199  79.200  8.939   1.00 30.04 ? 90   GLU A N     1 
ATOM   303   C  CA    . GLU A  1 62  ? 87.141  78.299  9.404   1.00 29.94 ? 90   GLU A CA    1 
ATOM   304   C  C     . GLU A  1 62  ? 85.790  78.612  8.756   1.00 29.10 ? 90   GLU A C     1 
ATOM   305   O  O     . GLU A  1 62  ? 85.401  79.772  8.617   1.00 28.36 ? 90   GLU A O     1 
ATOM   306   C  CB    . GLU A  1 62  ? 87.007  78.376  10.929  1.00 30.29 ? 90   GLU A CB    1 
ATOM   307   C  CG    . GLU A  1 62  ? 88.176  77.755  11.701  1.00 31.38 ? 90   GLU A CG    1 
ATOM   308   C  CD    . GLU A  1 62  ? 88.252  76.233  11.540  1.00 33.12 ? 90   GLU A CD    1 
ATOM   309   O  OE1   . GLU A  1 62  ? 87.199  75.559  11.595  1.00 33.20 ? 90   GLU A OE1   1 
ATOM   310   O  OE2   . GLU A  1 62  ? 89.372  75.709  11.353  1.00 34.46 ? 90   GLU A OE2   1 
ATOM   311   N  N     . LYS A  1 63  ? 85.080  77.552  8.383   1.00 28.54 ? 91   LYS A N     1 
ATOM   312   C  CA    . LYS A  1 63  ? 83.749  77.644  7.806   1.00 28.36 ? 91   LYS A CA    1 
ATOM   313   C  C     . LYS A  1 63  ? 82.786  78.404  8.729   1.00 27.94 ? 91   LYS A C     1 
ATOM   314   O  O     . LYS A  1 63  ? 82.001  79.231  8.272   1.00 27.56 ? 91   LYS A O     1 
ATOM   315   C  CB    . LYS A  1 63  ? 83.223  76.231  7.536   1.00 28.54 ? 91   LYS A CB    1 
ATOM   316   C  CG    . LYS A  1 63  ? 82.102  76.146  6.544   1.00 28.86 ? 91   LYS A CG    1 
ATOM   317   C  CD    . LYS A  1 63  ? 81.665  74.706  6.319   1.00 29.13 ? 91   LYS A CD    1 
ATOM   318   N  N     . SER A  1 64  ? 82.853  78.122  10.027  1.00 27.78 ? 92   SER A N     1 
ATOM   319   C  CA    . SER A  1 64  ? 82.006  78.801  11.022  1.00 27.67 ? 92   SER A CA    1 
ATOM   320   C  C     . SER A  1 64  ? 82.142  80.332  10.954  1.00 27.39 ? 92   SER A C     1 
ATOM   321   O  O     . SER A  1 64  ? 81.166  81.059  11.091  1.00 26.44 ? 92   SER A O     1 
ATOM   322   C  CB    . SER A  1 64  ? 82.356  78.321  12.437  1.00 27.62 ? 92   SER A CB    1 
ATOM   323   O  OG    . SER A  1 64  ? 83.667  78.726  12.809  1.00 28.53 ? 92   SER A OG    1 
ATOM   324   N  N     . VAL A  1 65  ? 83.366  80.809  10.756  1.00 27.36 ? 93   VAL A N     1 
ATOM   325   C  CA    . VAL A  1 65  ? 83.629  82.250  10.695  1.00 27.60 ? 93   VAL A CA    1 
ATOM   326   C  C     . VAL A  1 65  ? 83.005  82.856  9.423   1.00 27.87 ? 93   VAL A C     1 
ATOM   327   O  O     . VAL A  1 65  ? 82.378  83.913  9.478   1.00 27.85 ? 93   VAL A O     1 
ATOM   328   C  CB    . VAL A  1 65  ? 85.159  82.549  10.804  1.00 27.50 ? 93   VAL A CB    1 
ATOM   329   C  CG1   . VAL A  1 65  ? 85.464  84.044  10.622  1.00 25.96 ? 93   VAL A CG1   1 
ATOM   330   C  CG2   . VAL A  1 65  ? 85.701  82.049  12.154  1.00 27.18 ? 93   VAL A CG2   1 
ATOM   331   N  N     . ILE A  1 66  ? 83.147  82.160  8.299   1.00 28.31 ? 94   ILE A N     1 
ATOM   332   C  CA    . ILE A  1 66  ? 82.612  82.626  7.017   1.00 28.87 ? 94   ILE A CA    1 
ATOM   333   C  C     . ILE A  1 66  ? 81.083  82.624  7.063   1.00 28.86 ? 94   ILE A C     1 
ATOM   334   O  O     . ILE A  1 66  ? 80.451  83.621  6.740   1.00 28.48 ? 94   ILE A O     1 
ATOM   335   C  CB    . ILE A  1 66  ? 83.075  81.730  5.841   1.00 29.10 ? 94   ILE A CB    1 
ATOM   336   C  CG1   . ILE A  1 66  ? 84.596  81.777  5.655   1.00 29.64 ? 94   ILE A CG1   1 
ATOM   337   C  CG2   . ILE A  1 66  ? 82.373  82.136  4.550   1.00 29.99 ? 94   ILE A CG2   1 
ATOM   338   C  CD1   . ILE A  1 66  ? 85.095  80.804  4.584   1.00 29.46 ? 94   ILE A CD1   1 
ATOM   339   N  N     . GLN A  1 67  ? 80.512  81.498  7.476   1.00 28.81 ? 95   GLN A N     1 
ATOM   340   C  CA    . GLN A  1 67  ? 79.079  81.391  7.749   1.00 29.61 ? 95   GLN A CA    1 
ATOM   341   C  C     . GLN A  1 67  ? 78.603  82.537  8.645   1.00 28.83 ? 95   GLN A C     1 
ATOM   342   O  O     . GLN A  1 67  ? 77.566  83.154  8.379   1.00 28.92 ? 95   GLN A O     1 
ATOM   343   C  CB    . GLN A  1 67  ? 78.751  80.043  8.399   1.00 29.49 ? 95   GLN A CB    1 
ATOM   344   C  CG    . GLN A  1 67  ? 78.801  78.859  7.438   1.00 31.59 ? 95   GLN A CG    1 
ATOM   345   C  CD    . GLN A  1 67  ? 78.472  77.521  8.113   1.00 31.90 ? 95   GLN A CD    1 
ATOM   346   O  OE1   . GLN A  1 67  ? 78.999  77.197  9.189   1.00 36.62 ? 95   GLN A OE1   1 
ATOM   347   N  NE2   . GLN A  1 67  ? 77.614  76.738  7.477   1.00 34.67 ? 95   GLN A NE2   1 
ATOM   348   N  N     . GLY A  1 68  ? 79.379  82.829  9.688   1.00 27.73 ? 96   GLY A N     1 
ATOM   349   C  CA    . GLY A  1 68  ? 79.043  83.883  10.641  1.00 27.22 ? 96   GLY A CA    1 
ATOM   350   C  C     . GLY A  1 68  ? 79.067  85.291  10.070  1.00 26.68 ? 96   GLY A C     1 
ATOM   351   O  O     . GLY A  1 68  ? 78.214  86.108  10.402  1.00 26.70 ? 96   GLY A O     1 
ATOM   352   N  N     . LEU A  1 69  ? 80.048  85.581  9.223   1.00 26.16 ? 97   LEU A N     1 
ATOM   353   C  CA    . LEU A  1 69  ? 80.075  86.843  8.499   1.00 26.40 ? 97   LEU A CA    1 
ATOM   354   C  C     . LEU A  1 69  ? 78.793  87.067  7.679   1.00 26.70 ? 97   LEU A C     1 
ATOM   355   O  O     . LEU A  1 69  ? 78.224  88.161  7.698   1.00 26.89 ? 97   LEU A O     1 
ATOM   356   C  CB    . LEU A  1 69  ? 81.303  86.912  7.595   1.00 26.35 ? 97   LEU A CB    1 
ATOM   357   C  CG    . LEU A  1 69  ? 82.621  87.141  8.337   1.00 26.21 ? 97   LEU A CG    1 
ATOM   358   C  CD1   . LEU A  1 69  ? 83.787  86.911  7.414   1.00 27.12 ? 97   LEU A CD1   1 
ATOM   359   C  CD2   . LEU A  1 69  ? 82.668  88.553  8.937   1.00 27.30 ? 97   LEU A CD2   1 
ATOM   360   N  N     . PHE A  1 70  ? 78.349  86.029  6.972   1.00 26.90 ? 98   PHE A N     1 
ATOM   361   C  CA    . PHE A  1 70  ? 77.111  86.096  6.183   1.00 27.27 ? 98   PHE A CA    1 
ATOM   362   C  C     . PHE A  1 70  ? 75.891  86.264  7.075   1.00 27.60 ? 98   PHE A C     1 
ATOM   363   O  O     . PHE A  1 70  ? 75.031  87.103  6.801   1.00 27.53 ? 98   PHE A O     1 
ATOM   364   C  CB    . PHE A  1 70  ? 76.963  84.853  5.286   1.00 27.32 ? 98   PHE A CB    1 
ATOM   365   C  CG    . PHE A  1 70  ? 77.843  84.887  4.054   1.00 27.75 ? 98   PHE A CG    1 
ATOM   366   C  CD1   . PHE A  1 70  ? 77.549  85.751  2.999   1.00 26.33 ? 98   PHE A CD1   1 
ATOM   367   C  CD2   . PHE A  1 70  ? 78.971  84.072  3.954   1.00 29.05 ? 98   PHE A CD2   1 
ATOM   368   C  CE1   . PHE A  1 70  ? 78.355  85.800  1.859   1.00 27.00 ? 98   PHE A CE1   1 
ATOM   369   C  CE2   . PHE A  1 70  ? 79.801  84.121  2.818   1.00 29.31 ? 98   PHE A CE2   1 
ATOM   370   C  CZ    . PHE A  1 70  ? 79.483  84.989  1.765   1.00 28.62 ? 98   PHE A CZ    1 
ATOM   371   N  N     . GLN A  1 71  ? 75.826  85.459  8.134   1.00 28.17 ? 99   GLN A N     1 
ATOM   372   C  CA    . GLN A  1 71  ? 74.709  85.465  9.081   1.00 28.83 ? 99   GLN A CA    1 
ATOM   373   C  C     . GLN A  1 71  ? 74.543  86.820  9.796   1.00 28.83 ? 99   GLN A C     1 
ATOM   374   O  O     . GLN A  1 71  ? 73.418  87.283  9.995   1.00 28.45 ? 99   GLN A O     1 
ATOM   375   C  CB    . GLN A  1 71  ? 74.888  84.316  10.089  1.00 29.10 ? 99   GLN A CB    1 
ATOM   376   C  CG    . GLN A  1 71  ? 73.747  84.128  11.106  1.00 31.74 ? 99   GLN A CG    1 
ATOM   377   C  CD    . GLN A  1 71  ? 74.079  84.624  12.524  1.00 35.26 ? 99   GLN A CD    1 
ATOM   378   O  OE1   . GLN A  1 71  ? 75.252  84.819  12.891  1.00 37.49 ? 99   GLN A OE1   1 
ATOM   379   N  NE2   . GLN A  1 71  ? 73.033  84.807  13.335  1.00 37.35 ? 99   GLN A NE2   1 
ATOM   380   N  N     . GLN A  1 72  ? 75.654  87.467  10.140  1.00 29.06 ? 100  GLN A N     1 
ATOM   381   C  CA    . GLN A  1 72  ? 75.617  88.785  10.794  1.00 29.83 ? 100  GLN A CA    1 
ATOM   382   C  C     . GLN A  1 72  ? 75.375  89.941  9.815   1.00 29.96 ? 100  GLN A C     1 
ATOM   383   O  O     . GLN A  1 72  ? 75.313  91.101  10.228  1.00 30.24 ? 100  GLN A O     1 
ATOM   384   C  CB    . GLN A  1 72  ? 76.917  89.045  11.569  1.00 30.15 ? 100  GLN A CB    1 
ATOM   385   C  CG    . GLN A  1 72  ? 77.131  88.114  12.759  1.00 31.54 ? 100  GLN A CG    1 
ATOM   386   C  CD    . GLN A  1 72  ? 76.185  88.390  13.917  1.00 32.94 ? 100  GLN A CD    1 
ATOM   387   O  OE1   . GLN A  1 72  ? 75.287  87.599  14.192  1.00 35.83 ? 100  GLN A OE1   1 
ATOM   388   N  NE2   . GLN A  1 72  ? 76.385  89.511  14.601  1.00 32.97 ? 100  GLN A NE2   1 
ATOM   389   N  N     . GLY A  1 73  ? 75.256  89.632  8.528   1.00 29.95 ? 101  GLY A N     1 
ATOM   390   C  CA    . GLY A  1 73  ? 74.990  90.649  7.515   1.00 30.11 ? 101  GLY A CA    1 
ATOM   391   C  C     . GLY A  1 73  ? 76.223  91.456  7.176   1.00 29.95 ? 101  GLY A C     1 
ATOM   392   O  O     . GLY A  1 73  ? 76.120  92.596  6.710   1.00 30.33 ? 101  GLY A O     1 
ATOM   393   N  N     . LEU A  1 74  ? 77.401  90.870  7.389   1.00 29.72 ? 102  LEU A N     1 
ATOM   394   C  CA    . LEU A  1 74  ? 78.651  91.614  7.220   1.00 29.34 ? 102  LEU A CA    1 
ATOM   395   C  C     . LEU A  1 74  ? 79.233  91.483  5.807   1.00 29.16 ? 102  LEU A C     1 
ATOM   396   O  O     . LEU A  1 74  ? 80.242  92.087  5.500   1.00 28.50 ? 102  LEU A O     1 
ATOM   397   C  CB    . LEU A  1 74  ? 79.673  91.194  8.293   1.00 29.56 ? 102  LEU A CB    1 
ATOM   398   C  CG    . LEU A  1 74  ? 79.238  91.478  9.735   1.00 28.55 ? 102  LEU A CG    1 
ATOM   399   C  CD1   . LEU A  1 74  ? 80.257  90.946  10.736  1.00 29.62 ? 102  LEU A CD1   1 
ATOM   400   C  CD2   . LEU A  1 74  ? 78.999  92.972  9.947   1.00 28.73 ? 102  LEU A CD2   1 
ATOM   401   N  N     . MET A  1 75  ? 78.567  90.717  4.946   1.00 29.17 ? 103  MET A N     1 
ATOM   402   C  CA    . MET A  1 75  ? 79.025  90.513  3.573   1.00 29.37 ? 103  MET A CA    1 
ATOM   403   C  C     . MET A  1 75  ? 78.194  91.290  2.545   1.00 29.69 ? 103  MET A C     1 
ATOM   404   O  O     . MET A  1 75  ? 78.432  91.168  1.345   1.00 30.67 ? 103  MET A O     1 
ATOM   405   C  CB    . MET A  1 75  ? 79.000  89.018  3.240   1.00 29.22 ? 103  MET A CB    1 
ATOM   406   C  CG    . MET A  1 75  ? 79.915  88.188  4.135   1.00 28.91 ? 103  MET A CG    1 
ATOM   407   S  SD    . MET A  1 75  ? 81.662  88.584  3.923   1.00 28.99 ? 103  MET A SD    1 
ATOM   408   C  CE    . MET A  1 75  ? 82.124  87.366  2.698   1.00 26.89 ? 103  MET A CE    1 
ATOM   409   N  N     . GLY A  1 76  ? 77.219  92.069  3.015   1.00 29.37 ? 104  GLY A N     1 
ATOM   410   C  CA    . GLY A  1 76  ? 76.410  92.934  2.153   1.00 28.85 ? 104  GLY A CA    1 
ATOM   411   C  C     . GLY A  1 76  ? 76.053  94.241  2.838   1.00 28.47 ? 104  GLY A C     1 
ATOM   412   O  O     . GLY A  1 76  ? 74.923  94.700  2.756   1.00 28.02 ? 104  GLY A O     1 
ATOM   413   N  N     . ILE A  1 77  ? 77.051  94.852  3.477   1.00 28.32 ? 105  ILE A N     1 
ATOM   414   C  CA    . ILE A  1 77  ? 76.855  96.002  4.359   1.00 28.03 ? 105  ILE A CA    1 
ATOM   415   C  C     . ILE A  1 77  ? 76.153  97.172  3.658   1.00 27.71 ? 105  ILE A C     1 
ATOM   416   O  O     . ILE A  1 77  ? 75.191  97.724  4.193   1.00 27.41 ? 105  ILE A O     1 
ATOM   417   C  CB    . ILE A  1 77  ? 78.209  96.474  4.985   1.00 28.20 ? 105  ILE A CB    1 
ATOM   418   C  CG1   . ILE A  1 77  ? 78.850  95.358  5.832   1.00 28.25 ? 105  ILE A CG1   1 
ATOM   419   C  CG2   . ILE A  1 77  ? 78.017  97.704  5.870   1.00 28.29 ? 105  ILE A CG2   1 
ATOM   420   C  CD1   . ILE A  1 77  ? 80.359  95.566  6.090   1.00 27.60 ? 105  ILE A CD1   1 
ATOM   421   N  N     . GLU A  1 78  ? 76.614  97.527  2.461   1.00 27.72 ? 106  GLU A N     1 
ATOM   422   C  CA    . GLU A  1 78  ? 76.054  98.654  1.714   1.00 27.86 ? 106  GLU A CA    1 
ATOM   423   C  C     . GLU A  1 78  ? 75.036  98.249  0.664   1.00 28.07 ? 106  GLU A C     1 
ATOM   424   O  O     . GLU A  1 78  ? 74.378  99.117  0.100   1.00 27.81 ? 106  GLU A O     1 
ATOM   425   C  CB    . GLU A  1 78  ? 77.162  99.439  1.012   1.00 27.95 ? 106  GLU A CB    1 
ATOM   426   C  CG    . GLU A  1 78  ? 78.157  100.069 1.936   1.00 29.21 ? 106  GLU A CG    1 
ATOM   427   C  CD    . GLU A  1 78  ? 79.424  100.447 1.215   1.00 31.18 ? 106  GLU A CD    1 
ATOM   428   O  OE1   . GLU A  1 78  ? 79.426  101.493 0.540   1.00 33.95 ? 106  GLU A OE1   1 
ATOM   429   O  OE2   . GLU A  1 78  ? 80.425  99.698  1.327   1.00 35.08 ? 106  GLU A OE2   1 
ATOM   430   N  N     . VAL A  1 79  ? 74.896  96.950  0.404   1.00 28.49 ? 107  VAL A N     1 
ATOM   431   C  CA    . VAL A  1 79  ? 73.921  96.469  -0.575  1.00 28.94 ? 107  VAL A CA    1 
ATOM   432   C  C     . VAL A  1 79  ? 72.495  96.771  -0.108  1.00 29.42 ? 107  VAL A C     1 
ATOM   433   O  O     . VAL A  1 79  ? 72.191  96.682  1.082   1.00 29.28 ? 107  VAL A O     1 
ATOM   434   C  CB    . VAL A  1 79  ? 74.090  94.956  -0.843  1.00 28.89 ? 107  VAL A CB    1 
ATOM   435   C  CG1   . VAL A  1 79  ? 72.985  94.432  -1.758  1.00 28.95 ? 107  VAL A CG1   1 
ATOM   436   C  CG2   . VAL A  1 79  ? 75.461  94.681  -1.437  1.00 29.65 ? 107  VAL A CG2   1 
ATOM   437   N  N     . ASP A  1 80  ? 71.625  97.132  -1.051  1.00 29.91 ? 108  ASP A N     1 
ATOM   438   C  CA    . ASP A  1 80  ? 70.230  97.444  -0.742  1.00 30.40 ? 108  ASP A CA    1 
ATOM   439   C  C     . ASP A  1 80  ? 69.543  96.207  -0.158  1.00 30.27 ? 108  ASP A C     1 
ATOM   440   O  O     . ASP A  1 80  ? 69.816  95.087  -0.595  1.00 29.50 ? 108  ASP A O     1 
ATOM   441   C  CB    . ASP A  1 80  ? 69.484  97.896  -2.012  1.00 30.60 ? 108  ASP A CB    1 
ATOM   442   C  CG    . ASP A  1 80  ? 68.150  98.603  -1.714  1.00 32.36 ? 108  ASP A CG    1 
ATOM   443   O  OD1   . ASP A  1 80  ? 68.152  99.840  -1.507  1.00 34.47 ? 108  ASP A OD1   1 
ATOM   444   O  OD2   . ASP A  1 80  ? 67.093  97.936  -1.730  1.00 33.13 ? 108  ASP A OD2   1 
ATOM   445   N  N     . PRO A  1 81  ? 68.677  96.404  0.852   1.00 30.58 ? 109  PRO A N     1 
ATOM   446   C  CA    . PRO A  1 81  ? 67.809  95.353  1.392   1.00 31.05 ? 109  PRO A CA    1 
ATOM   447   C  C     . PRO A  1 81  ? 66.983  94.555  0.361   1.00 31.21 ? 109  PRO A C     1 
ATOM   448   O  O     . PRO A  1 81  ? 66.633  93.405  0.643   1.00 31.05 ? 109  PRO A O     1 
ATOM   449   C  CB    . PRO A  1 81  ? 66.880  96.123  2.337   1.00 31.03 ? 109  PRO A CB    1 
ATOM   450   C  CG    . PRO A  1 81  ? 67.677  97.268  2.785   1.00 31.23 ? 109  PRO A CG    1 
ATOM   451   C  CD    . PRO A  1 81  ? 68.527  97.663  1.606   1.00 30.95 ? 109  PRO A CD    1 
ATOM   452   N  N     . GLU A  1 82  ? 66.687  95.133  -0.806  1.00 31.61 ? 110  GLU A N     1 
ATOM   453   C  CA    . GLU A  1 82  ? 65.950  94.400  -1.850  1.00 32.33 ? 110  GLU A CA    1 
ATOM   454   C  C     . GLU A  1 82  ? 66.765  93.219  -2.403  1.00 32.28 ? 110  GLU A C     1 
ATOM   455   O  O     . GLU A  1 82  ? 66.190  92.299  -2.998  1.00 31.75 ? 110  GLU A O     1 
ATOM   456   C  CB    . GLU A  1 82  ? 65.484  95.330  -2.989  1.00 32.36 ? 110  GLU A CB    1 
ATOM   457   C  CG    . GLU A  1 82  ? 66.553  95.690  -4.025  1.00 33.25 ? 110  GLU A CG    1 
ATOM   458   C  CD    . GLU A  1 82  ? 66.032  96.608  -5.123  1.00 33.42 ? 110  GLU A CD    1 
ATOM   459   O  OE1   . GLU A  1 82  ? 65.030  96.251  -5.774  1.00 34.58 ? 110  GLU A OE1   1 
ATOM   460   O  OE2   . GLU A  1 82  ? 66.636  97.685  -5.342  1.00 36.18 ? 110  GLU A OE2   1 
ATOM   461   N  N     . TYR A  1 83  ? 68.089  93.267  -2.212  1.00 32.15 ? 111  TYR A N     1 
ATOM   462   C  CA    . TYR A  1 83  ? 68.993  92.156  -2.537  1.00 32.40 ? 111  TYR A CA    1 
ATOM   463   C  C     . TYR A  1 83  ? 69.525  91.441  -1.288  1.00 32.30 ? 111  TYR A C     1 
ATOM   464   O  O     . TYR A  1 83  ? 70.542  90.747  -1.351  1.00 32.13 ? 111  TYR A O     1 
ATOM   465   C  CB    . TYR A  1 83  ? 70.192  92.658  -3.342  1.00 32.84 ? 111  TYR A CB    1 
ATOM   466   C  CG    . TYR A  1 83  ? 69.853  93.524  -4.537  1.00 33.48 ? 111  TYR A CG    1 
ATOM   467   C  CD1   . TYR A  1 83  ? 69.167  93.002  -5.632  1.00 34.05 ? 111  TYR A CD1   1 
ATOM   468   C  CD2   . TYR A  1 83  ? 70.235  94.859  -4.579  1.00 33.76 ? 111  TYR A CD2   1 
ATOM   469   C  CE1   . TYR A  1 83  ? 68.865  93.800  -6.737  1.00 34.75 ? 111  TYR A CE1   1 
ATOM   470   C  CE2   . TYR A  1 83  ? 69.933  95.665  -5.677  1.00 34.40 ? 111  TYR A CE2   1 
ATOM   471   C  CZ    . TYR A  1 83  ? 69.257  95.133  -6.751  1.00 34.13 ? 111  TYR A CZ    1 
ATOM   472   O  OH    . TYR A  1 83  ? 68.963  95.939  -7.833  1.00 34.85 ? 111  TYR A OH    1 
ATOM   473   N  N     . GLY A  1 84  ? 68.856  91.621  -0.152  1.00 32.43 ? 112  GLY A N     1 
ATOM   474   C  CA    . GLY A  1 84  ? 69.306  91.029  1.118   1.00 32.44 ? 112  GLY A CA    1 
ATOM   475   C  C     . GLY A  1 84  ? 70.468  91.691  1.843   1.00 32.49 ? 112  GLY A C     1 
ATOM   476   O  O     . GLY A  1 84  ? 71.078  91.070  2.722   1.00 32.54 ? 112  GLY A O     1 
ATOM   477   N  N     . GLY A  1 85  ? 70.785  92.941  1.494   1.00 32.12 ? 113  GLY A N     1 
ATOM   478   C  CA    . GLY A  1 85  ? 71.855  93.681  2.159   1.00 31.88 ? 113  GLY A CA    1 
ATOM   479   C  C     . GLY A  1 85  ? 71.353  94.550  3.299   1.00 31.73 ? 113  GLY A C     1 
ATOM   480   O  O     . GLY A  1 85  ? 70.161  94.588  3.579   1.00 31.58 ? 113  GLY A O     1 
ATOM   481   N  N     . THR A  1 86  ? 72.264  95.271  3.950   1.00 31.75 ? 114  THR A N     1 
ATOM   482   C  CA    . THR A  1 86  ? 71.898  96.117  5.088   1.00 31.77 ? 114  THR A CA    1 
ATOM   483   C  C     . THR A  1 86  ? 71.574  97.542  4.643   1.00 31.20 ? 114  THR A C     1 
ATOM   484   O  O     . THR A  1 86  ? 70.794  98.240  5.293   1.00 31.61 ? 114  THR A O     1 
ATOM   485   C  CB    . THR A  1 86  ? 73.010  96.117  6.155   1.00 32.44 ? 114  THR A CB    1 
ATOM   486   O  OG1   . THR A  1 86  ? 73.226  94.773  6.604   1.00 33.51 ? 114  THR A OG1   1 
ATOM   487   C  CG2   . THR A  1 86  ? 72.638  97.001  7.340   1.00 33.30 ? 114  THR A CG2   1 
ATOM   488   N  N     . GLY A  1 87  ? 72.146  97.973  3.526   1.00 30.26 ? 115  GLY A N     1 
ATOM   489   C  CA    . GLY A  1 87  ? 71.928  99.334  3.047   1.00 29.85 ? 115  GLY A CA    1 
ATOM   490   C  C     . GLY A  1 87  ? 72.533  100.378 3.973   1.00 29.20 ? 115  GLY A C     1 
ATOM   491   O  O     . GLY A  1 87  ? 72.013  101.494 4.093   1.00 28.93 ? 115  GLY A O     1 
ATOM   492   N  N     . ALA A  1 88  ? 73.633  100.013 4.631   1.00 28.55 ? 116  ALA A N     1 
ATOM   493   C  CA    . ALA A  1 88  ? 74.332  100.926 5.527   1.00 27.82 ? 116  ALA A CA    1 
ATOM   494   C  C     . ALA A  1 88  ? 75.303  101.823 4.756   1.00 27.50 ? 116  ALA A C     1 
ATOM   495   O  O     . ALA A  1 88  ? 75.485  101.696 3.543   1.00 26.77 ? 116  ALA A O     1 
ATOM   496   C  CB    . ALA A  1 88  ? 75.065  100.151 6.622   1.00 27.68 ? 116  ALA A CB    1 
ATOM   497   N  N     . SER A  1 89  ? 75.936  102.729 5.487   1.00 27.18 ? 117  SER A N     1 
ATOM   498   C  CA    . SER A  1 89  ? 76.842  103.710 4.900   1.00 26.74 ? 117  SER A CA    1 
ATOM   499   C  C     . SER A  1 89  ? 78.205  103.092 4.570   1.00 26.29 ? 117  SER A C     1 
ATOM   500   O  O     . SER A  1 89  ? 78.567  102.000 5.045   1.00 26.27 ? 117  SER A O     1 
ATOM   501   C  CB    . SER A  1 89  ? 76.994  104.890 5.863   1.00 26.63 ? 117  SER A CB    1 
ATOM   502   O  OG    . SER A  1 89  ? 77.712  104.488 7.026   1.00 26.67 ? 117  SER A OG    1 
ATOM   503   N  N     . PHE A  1 90  ? 78.975  103.779 3.748   1.00 25.95 ? 118  PHE A N     1 
ATOM   504   C  CA    . PHE A  1 90  ? 80.346  103.342 3.514   1.00 25.77 ? 118  PHE A CA    1 
ATOM   505   C  C     . PHE A  1 90  ? 81.178  103.378 4.822   1.00 25.73 ? 118  PHE A C     1 
ATOM   506   O  O     . PHE A  1 90  ? 81.990  102.488 5.069   1.00 25.07 ? 118  PHE A O     1 
ATOM   507   C  CB    . PHE A  1 90  ? 80.989  104.159 2.401   1.00 26.22 ? 118  PHE A CB    1 
ATOM   508   C  CG    . PHE A  1 90  ? 82.407  103.790 2.129   1.00 25.73 ? 118  PHE A CG    1 
ATOM   509   C  CD1   . PHE A  1 90  ? 82.708  102.643 1.425   1.00 26.48 ? 118  PHE A CD1   1 
ATOM   510   C  CD2   . PHE A  1 90  ? 83.441  104.584 2.580   1.00 26.54 ? 118  PHE A CD2   1 
ATOM   511   C  CE1   . PHE A  1 90  ? 84.006  102.288 1.175   1.00 26.48 ? 118  PHE A CE1   1 
ATOM   512   C  CE2   . PHE A  1 90  ? 84.759  104.234 2.342   1.00 27.40 ? 118  PHE A CE2   1 
ATOM   513   C  CZ    . PHE A  1 90  ? 85.050  103.084 1.643   1.00 28.00 ? 118  PHE A CZ    1 
ATOM   514   N  N     . LEU A  1 91  ? 80.958  104.368 5.682   1.00 25.55 ? 119  LEU A N     1 
ATOM   515   C  CA    . LEU A  1 91  ? 81.733  104.441 6.932   1.00 25.69 ? 119  LEU A CA    1 
ATOM   516   C  C     . LEU A  1 91  ? 81.472  103.210 7.833   1.00 25.49 ? 119  LEU A C     1 
ATOM   517   O  O     . LEU A  1 91  ? 82.373  102.746 8.525   1.00 24.04 ? 119  LEU A O     1 
ATOM   518   C  CB    . LEU A  1 91  ? 81.459  105.749 7.678   1.00 25.76 ? 119  LEU A CB    1 
ATOM   519   C  CG    . LEU A  1 91  ? 82.303  106.042 8.934   1.00 26.09 ? 119  LEU A CG    1 
ATOM   520   C  CD1   . LEU A  1 91  ? 83.833  105.979 8.684   1.00 25.24 ? 119  LEU A CD1   1 
ATOM   521   C  CD2   . LEU A  1 91  ? 81.890  107.397 9.541   1.00 26.56 ? 119  LEU A CD2   1 
ATOM   522   N  N     . SER A  1 92  ? 80.250  102.686 7.787   1.00 25.40 ? 120  SER A N     1 
ATOM   523   C  CA    . SER A  1 92  ? 79.895  101.428 8.460   1.00 26.22 ? 120  SER A CA    1 
ATOM   524   C  C     . SER A  1 92  ? 80.779  100.256 8.002   1.00 26.10 ? 120  SER A C     1 
ATOM   525   O  O     . SER A  1 92  ? 81.264  99.488  8.824   1.00 26.08 ? 120  SER A O     1 
ATOM   526   C  CB    . SER A  1 92  ? 78.428  101.067 8.215   1.00 26.12 ? 120  SER A CB    1 
ATOM   527   O  OG    . SER A  1 92  ? 77.546  101.941 8.880   1.00 27.08 ? 120  SER A OG    1 
ATOM   528   N  N     . THR A  1 93  ? 80.978  100.136 6.692   1.00 26.13 ? 121  THR A N     1 
ATOM   529   C  CA    . THR A  1 93  ? 81.903  99.145  6.128   1.00 25.99 ? 121  THR A CA    1 
ATOM   530   C  C     . THR A  1 93  ? 83.313  99.337  6.689   1.00 25.64 ? 121  THR A C     1 
ATOM   531   O  O     . THR A  1 93  ? 83.960  98.381  7.132   1.00 25.37 ? 121  THR A O     1 
ATOM   532   C  CB    . THR A  1 93  ? 81.925  99.241  4.594   1.00 26.13 ? 121  THR A CB    1 
ATOM   533   O  OG1   . THR A  1 93  ? 80.620  98.940  4.082   1.00 25.18 ? 121  THR A OG1   1 
ATOM   534   C  CG2   . THR A  1 93  ? 82.939  98.278  3.986   1.00 27.67 ? 121  THR A CG2   1 
ATOM   535   N  N     . VAL A  1 94  ? 83.781  100.580 6.684   1.00 24.94 ? 122  VAL A N     1 
ATOM   536   C  CA    . VAL A  1 94  ? 85.084  100.906 7.260   1.00 24.97 ? 122  VAL A CA    1 
ATOM   537   C  C     . VAL A  1 94  ? 85.162  100.495 8.723   1.00 24.71 ? 122  VAL A C     1 
ATOM   538   O  O     . VAL A  1 94  ? 86.166  99.902  9.146   1.00 25.22 ? 122  VAL A O     1 
ATOM   539   C  CB    . VAL A  1 94  ? 85.413  102.417 7.089   1.00 25.01 ? 122  VAL A CB    1 
ATOM   540   C  CG1   . VAL A  1 94  ? 86.563  102.858 8.001   1.00 24.91 ? 122  VAL A CG1   1 
ATOM   541   C  CG2   . VAL A  1 94  ? 85.728  102.700 5.626   1.00 24.47 ? 122  VAL A CG2   1 
ATOM   542   N  N     . LEU A  1 95  ? 84.108  100.782 9.487   1.00 24.14 ? 123  LEU A N     1 
ATOM   543   C  CA    . LEU A  1 95  ? 84.103  100.463 10.907  1.00 24.72 ? 123  LEU A CA    1 
ATOM   544   C  C     . LEU A  1 95  ? 84.044  98.943  11.129  1.00 24.85 ? 123  LEU A C     1 
ATOM   545   O  O     . LEU A  1 95  ? 84.661  98.430  12.045  1.00 24.96 ? 123  LEU A O     1 
ATOM   546   C  CB    . LEU A  1 95  ? 82.952  101.168 11.637  1.00 24.75 ? 123  LEU A CB    1 
ATOM   547   C  CG    . LEU A  1 95  ? 83.040  102.693 11.682  1.00 24.53 ? 123  LEU A CG    1 
ATOM   548   C  CD1   . LEU A  1 95  ? 81.753  103.308 12.213  1.00 23.81 ? 123  LEU A CD1   1 
ATOM   549   C  CD2   . LEU A  1 95  ? 84.255  103.133 12.511  1.00 24.85 ? 123  LEU A CD2   1 
ATOM   550   N  N     . VAL A  1 96  ? 83.303  98.234  10.286  1.00 25.03 ? 124  VAL A N     1 
ATOM   551   C  CA    . VAL A  1 96  ? 83.262  96.779  10.372  1.00 25.12 ? 124  VAL A CA    1 
ATOM   552   C  C     . VAL A  1 96  ? 84.650  96.187  10.108  1.00 25.01 ? 124  VAL A C     1 
ATOM   553   O  O     . VAL A  1 96  ? 85.110  95.296  10.845  1.00 25.50 ? 124  VAL A O     1 
ATOM   554   C  CB    . VAL A  1 96  ? 82.189  96.175  9.416   1.00 24.82 ? 124  VAL A CB    1 
ATOM   555   C  CG1   . VAL A  1 96  ? 82.398  94.671  9.247   1.00 24.89 ? 124  VAL A CG1   1 
ATOM   556   C  CG2   . VAL A  1 96  ? 80.782  96.462  9.937   1.00 25.50 ? 124  VAL A CG2   1 
ATOM   557   N  N     . ILE A  1 97  ? 85.337  96.700  9.092   1.00 25.08 ? 125  ILE A N     1 
ATOM   558   C  CA    . ILE A  1 97  ? 86.673  96.208  8.750   1.00 25.12 ? 125  ILE A CA    1 
ATOM   559   C  C     . ILE A  1 97  ? 87.674  96.481  9.892   1.00 25.07 ? 125  ILE A C     1 
ATOM   560   O  O     . ILE A  1 97  ? 88.441  95.594  10.280  1.00 24.71 ? 125  ILE A O     1 
ATOM   561   C  CB    . ILE A  1 97  ? 87.198  96.804  7.422   1.00 25.04 ? 125  ILE A CB    1 
ATOM   562   C  CG1   . ILE A  1 97  ? 86.310  96.396  6.237   1.00 25.72 ? 125  ILE A CG1   1 
ATOM   563   C  CG2   . ILE A  1 97  ? 88.650  96.337  7.150   1.00 25.44 ? 125  ILE A CG2   1 
ATOM   564   C  CD1   . ILE A  1 97  ? 86.623  97.172  4.936   1.00 25.06 ? 125  ILE A CD1   1 
ATOM   565   N  N     . GLU A  1 98  ? 87.616  97.686  10.448  1.00 25.01 ? 126  GLU A N     1 
ATOM   566   C  CA    . GLU A  1 98  ? 88.492  98.078  11.544  1.00 25.33 ? 126  GLU A CA    1 
ATOM   567   C  C     . GLU A  1 98  ? 88.263  97.164  12.742  1.00 25.32 ? 126  GLU A C     1 
ATOM   568   O  O     . GLU A  1 98  ? 89.195  96.612  13.300  1.00 25.10 ? 126  GLU A O     1 
ATOM   569   C  CB    . GLU A  1 98  ? 88.247  99.536  11.940  1.00 24.90 ? 126  GLU A CB    1 
ATOM   570   C  CG    . GLU A  1 98  ? 89.160  100.048 13.070  1.00 25.36 ? 126  GLU A CG    1 
ATOM   571   C  CD    . GLU A  1 98  ? 88.759  101.419 13.597  1.00 25.47 ? 126  GLU A CD    1 
ATOM   572   O  OE1   . GLU A  1 98  ? 87.792  102.023 13.086  1.00 26.52 ? 126  GLU A OE1   1 
ATOM   573   O  OE2   . GLU A  1 98  ? 89.426  101.912 14.524  1.00 27.37 ? 126  GLU A OE2   1 
ATOM   574   N  N     . GLU A  1 99  ? 87.001  96.987  13.096  1.00 26.05 ? 127  GLU A N     1 
ATOM   575   C  CA    . GLU A  1 99  ? 86.631  96.222  14.268  1.00 26.65 ? 127  GLU A CA    1 
ATOM   576   C  C     . GLU A  1 99  ? 87.013  94.727  14.151  1.00 26.23 ? 127  GLU A C     1 
ATOM   577   O  O     . GLU A  1 99  ? 87.487  94.117  15.125  1.00 26.01 ? 127  GLU A O     1 
ATOM   578   C  CB    . GLU A  1 99  ? 85.134  96.393  14.511  1.00 27.20 ? 127  GLU A CB    1 
ATOM   579   C  CG    . GLU A  1 99  ? 84.708  96.150  15.918  1.00 29.80 ? 127  GLU A CG    1 
ATOM   580   C  CD    . GLU A  1 99  ? 85.442  97.019  16.931  1.00 31.51 ? 127  GLU A CD    1 
ATOM   581   O  OE1   . GLU A  1 99  ? 85.739  98.207  16.659  1.00 32.78 ? 127  GLU A OE1   1 
ATOM   582   O  OE2   . GLU A  1 99  ? 85.720  96.484  18.010  1.00 34.45 ? 127  GLU A OE2   1 
ATOM   583   N  N     . LEU A  1 100 ? 86.846  94.158  12.957  1.00 25.75 ? 128  LEU A N     1 
ATOM   584   C  CA    . LEU A  1 100 ? 87.257  92.761  12.688  1.00 25.52 ? 128  LEU A CA    1 
ATOM   585   C  C     . LEU A  1 100 ? 88.782  92.576  12.781  1.00 24.84 ? 128  LEU A C     1 
ATOM   586   O  O     . LEU A  1 100 ? 89.275  91.586  13.344  1.00 24.53 ? 128  LEU A O     1 
ATOM   587   C  CB    . LEU A  1 100 ? 86.771  92.306  11.298  1.00 25.22 ? 128  LEU A CB    1 
ATOM   588   C  CG    . LEU A  1 100 ? 85.294  91.948  11.081  1.00 26.03 ? 128  LEU A CG    1 
ATOM   589   C  CD1   . LEU A  1 100 ? 85.019  91.667  9.585   1.00 25.98 ? 128  LEU A CD1   1 
ATOM   590   C  CD2   . LEU A  1 100 ? 84.855  90.765  11.957  1.00 24.64 ? 128  LEU A CD2   1 
ATOM   591   N  N     . ALA A  1 101 ? 89.520  93.527  12.222  1.00 24.46 ? 129  ALA A N     1 
ATOM   592   C  CA    . ALA A  1 101 ? 90.973  93.451  12.137  1.00 24.33 ? 129  ALA A CA    1 
ATOM   593   C  C     . ALA A  1 101 ? 91.634  93.614  13.512  1.00 24.34 ? 129  ALA A C     1 
ATOM   594   O  O     . ALA A  1 101 ? 92.753  93.151  13.711  1.00 24.03 ? 129  ALA A O     1 
ATOM   595   C  CB    . ALA A  1 101 ? 91.498  94.476  11.162  1.00 23.81 ? 129  ALA A CB    1 
ATOM   596   N  N     . LYS A  1 102 ? 90.937  94.273  14.443  1.00 24.63 ? 130  LYS A N     1 
ATOM   597   C  CA    . LYS A  1 102 ? 91.358  94.332  15.829  1.00 24.98 ? 130  LYS A CA    1 
ATOM   598   C  C     . LYS A  1 102 ? 91.523  92.934  16.430  1.00 25.29 ? 130  LYS A C     1 
ATOM   599   O  O     . LYS A  1 102 ? 92.295  92.751  17.374  1.00 25.73 ? 130  LYS A O     1 
ATOM   600   C  CB    . LYS A  1 102 ? 90.389  95.151  16.679  1.00 25.10 ? 130  LYS A CB    1 
ATOM   601   C  CG    . LYS A  1 102 ? 90.452  96.670  16.493  1.00 24.95 ? 130  LYS A CG    1 
ATOM   602   C  CD    . LYS A  1 102 ? 89.467  97.354  17.433  1.00 25.12 ? 130  LYS A CD    1 
ATOM   603   C  CE    . LYS A  1 102 ? 89.274  98.840  17.157  1.00 25.38 ? 130  LYS A CE    1 
ATOM   604   N  NZ    . LYS A  1 102 ? 88.348  99.482  18.185  1.00 25.35 ? 130  LYS A NZ    1 
ATOM   605   N  N     . VAL A  1 103 ? 90.782  91.964  15.899  1.00 25.91 ? 131  VAL A N     1 
ATOM   606   C  CA    . VAL A  1 103 ? 90.858  90.575  16.338  1.00 26.01 ? 131  VAL A CA    1 
ATOM   607   C  C     . VAL A  1 103 ? 91.665  89.747  15.330  1.00 26.21 ? 131  VAL A C     1 
ATOM   608   O  O     . VAL A  1 103 ? 92.564  89.018  15.724  1.00 26.56 ? 131  VAL A O     1 
ATOM   609   C  CB    . VAL A  1 103 ? 89.433  89.971  16.549  1.00 26.59 ? 131  VAL A CB    1 
ATOM   610   C  CG1   . VAL A  1 103 ? 89.504  88.493  16.894  1.00 25.72 ? 131  VAL A CG1   1 
ATOM   611   C  CG2   . VAL A  1 103 ? 88.664  90.743  17.658  1.00 26.28 ? 131  VAL A CG2   1 
ATOM   612   N  N     . ASP A  1 104 ? 91.352  89.868  14.036  1.00 25.99 ? 132  ASP A N     1 
ATOM   613   C  CA    . ASP A  1 104 ? 92.029  89.082  13.000  1.00 26.45 ? 132  ASP A CA    1 
ATOM   614   C  C     . ASP A  1 104 ? 92.002  89.787  11.639  1.00 26.31 ? 132  ASP A C     1 
ATOM   615   O  O     . ASP A  1 104 ? 90.952  89.911  11.005  1.00 26.10 ? 132  ASP A O     1 
ATOM   616   C  CB    . ASP A  1 104 ? 91.416  87.677  12.876  1.00 26.78 ? 132  ASP A CB    1 
ATOM   617   C  CG    . ASP A  1 104 ? 92.320  86.710  12.099  1.00 27.61 ? 132  ASP A CG    1 
ATOM   618   O  OD1   . ASP A  1 104 ? 93.277  87.181  11.440  1.00 28.74 ? 132  ASP A OD1   1 
ATOM   619   O  OD2   . ASP A  1 104 ? 92.095  85.478  12.183  1.00 31.47 ? 132  ASP A OD2   1 
ATOM   620   N  N     . ALA A  1 105 ? 93.174  90.240  11.204  1.00 26.14 ? 133  ALA A N     1 
ATOM   621   C  CA    . ALA A  1 105 ? 93.300  90.956  9.943   1.00 26.44 ? 133  ALA A CA    1 
ATOM   622   C  C     . ALA A  1 105 ? 92.923  90.088  8.747   1.00 26.23 ? 133  ALA A C     1 
ATOM   623   O  O     . ALA A  1 105 ? 92.458  90.618  7.746   1.00 27.25 ? 133  ALA A O     1 
ATOM   624   C  CB    . ALA A  1 105 ? 94.725  91.545  9.775   1.00 25.84 ? 133  ALA A CB    1 
ATOM   625   N  N     . SER A  1 106 ? 93.107  88.770  8.854   1.00 26.21 ? 134  SER A N     1 
ATOM   626   C  CA    . SER A  1 106 ? 92.704  87.843  7.782   1.00 26.62 ? 134  SER A CA    1 
ATOM   627   C  C     . SER A  1 106 ? 91.208  87.842  7.550   1.00 26.37 ? 134  SER A C     1 
ATOM   628   O  O     . SER A  1 106 ? 90.757  87.888  6.416   1.00 26.90 ? 134  SER A O     1 
ATOM   629   C  CB    . SER A  1 106 ? 93.166  86.414  8.071   1.00 26.29 ? 134  SER A CB    1 
ATOM   630   O  OG    . SER A  1 106 ? 94.571  86.330  8.015   1.00 28.81 ? 134  SER A OG    1 
ATOM   631   N  N     . VAL A  1 107 ? 90.441  87.760  8.630   1.00 26.31 ? 135  VAL A N     1 
ATOM   632   C  CA    . VAL A  1 107 ? 88.988  87.835  8.545   1.00 25.92 ? 135  VAL A CA    1 
ATOM   633   C  C     . VAL A  1 107 ? 88.537  89.213  8.029   1.00 26.38 ? 135  VAL A C     1 
ATOM   634   O  O     . VAL A  1 107 ? 87.572  89.312  7.270   1.00 25.84 ? 135  VAL A O     1 
ATOM   635   C  CB    . VAL A  1 107 ? 88.316  87.513  9.905   1.00 25.73 ? 135  VAL A CB    1 
ATOM   636   C  CG1   . VAL A  1 107 ? 86.780  87.587  9.796   1.00 24.36 ? 135  VAL A CG1   1 
ATOM   637   C  CG2   . VAL A  1 107 ? 88.754  86.132  10.405  1.00 25.70 ? 135  VAL A CG2   1 
ATOM   638   N  N     . ALA A  1 108 ? 89.231  90.266  8.449   1.00 26.77 ? 136  ALA A N     1 
ATOM   639   C  CA    . ALA A  1 108 ? 88.923  91.623  7.991   1.00 26.97 ? 136  ALA A CA    1 
ATOM   640   C  C     . ALA A  1 108 ? 89.070  91.761  6.472   1.00 27.37 ? 136  ALA A C     1 
ATOM   641   O  O     . ALA A  1 108 ? 88.208  92.360  5.821   1.00 27.83 ? 136  ALA A O     1 
ATOM   642   C  CB    . ALA A  1 108 ? 89.805  92.656  8.721   1.00 25.64 ? 136  ALA A CB    1 
ATOM   643   N  N     . VAL A  1 109 ? 90.141  91.208  5.906   1.00 27.67 ? 137  VAL A N     1 
ATOM   644   C  CA    . VAL A  1 109 ? 90.366  91.326  4.470   1.00 28.34 ? 137  VAL A CA    1 
ATOM   645   C  C     . VAL A  1 109 ? 89.340  90.519  3.671   1.00 28.57 ? 137  VAL A C     1 
ATOM   646   O  O     . VAL A  1 109 ? 88.877  90.975  2.636   1.00 27.37 ? 137  VAL A O     1 
ATOM   647   C  CB    . VAL A  1 109 ? 91.818  90.996  4.023   1.00 28.54 ? 137  VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1 109 ? 92.046  89.483  3.902   1.00 28.57 ? 137  VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1 109 ? 92.114  91.706  2.687   1.00 29.31 ? 137  VAL A CG2   1 
ATOM   650   N  N     . PHE A  1 110 ? 88.974  89.341  4.178   1.00 29.17 ? 138  PHE A N     1 
ATOM   651   C  CA    . PHE A  1 110 ? 87.865  88.549  3.628   1.00 29.60 ? 138  PHE A CA    1 
ATOM   652   C  C     . PHE A  1 110 ? 86.589  89.410  3.454   1.00 30.04 ? 138  PHE A C     1 
ATOM   653   O  O     . PHE A  1 110 ? 85.957  89.443  2.390   1.00 29.85 ? 138  PHE A O     1 
ATOM   654   C  CB    . PHE A  1 110 ? 87.601  87.359  4.561   1.00 29.77 ? 138  PHE A CB    1 
ATOM   655   C  CG    . PHE A  1 110 ? 86.734  86.299  3.970   1.00 30.16 ? 138  PHE A CG    1 
ATOM   656   C  CD1   . PHE A  1 110 ? 87.289  85.274  3.216   1.00 29.88 ? 138  PHE A CD1   1 
ATOM   657   C  CD2   . PHE A  1 110 ? 85.362  86.315  4.167   1.00 30.80 ? 138  PHE A CD2   1 
ATOM   658   C  CE1   . PHE A  1 110 ? 86.490  84.293  2.649   1.00 32.59 ? 138  PHE A CE1   1 
ATOM   659   C  CE2   . PHE A  1 110 ? 84.572  85.346  3.621   1.00 30.76 ? 138  PHE A CE2   1 
ATOM   660   C  CZ    . PHE A  1 110 ? 85.133  84.324  2.857   1.00 31.07 ? 138  PHE A CZ    1 
ATOM   661   N  N     . CYS A  1 111 ? 86.229  90.110  4.519   1.00 30.78 ? 139  CYS A N     1 
ATOM   662   C  CA    . CYS A  1 111 ? 85.094  91.030  4.516   1.00 30.81 ? 139  CYS A CA    1 
ATOM   663   C  C     . CYS A  1 111 ? 85.317  92.254  3.597   1.00 30.32 ? 139  CYS A C     1 
ATOM   664   O  O     . CYS A  1 111 ? 84.419  92.631  2.831   1.00 30.29 ? 139  CYS A O     1 
ATOM   665   C  CB    . CYS A  1 111 ? 84.830  91.481  5.957   1.00 31.03 ? 139  CYS A CB    1 
ATOM   666   S  SG    . CYS A  1 111 ? 83.485  92.636  6.170   1.00 33.52 ? 139  CYS A SG    1 
ATOM   667   N  N     . GLU A  1 112 ? 86.505  92.852  3.671   1.00 29.34 ? 140  GLU A N     1 
ATOM   668   C  CA    . GLU A  1 112 ? 86.873  94.003  2.839   1.00 29.31 ? 140  GLU A CA    1 
ATOM   669   C  C     . GLU A  1 112 ? 86.727  93.731  1.331   1.00 29.18 ? 140  GLU A C     1 
ATOM   670   O  O     . GLU A  1 112 ? 86.115  94.530  0.605   1.00 28.68 ? 140  GLU A O     1 
ATOM   671   C  CB    . GLU A  1 112 ? 88.295  94.481  3.167   1.00 29.77 ? 140  GLU A CB    1 
ATOM   672   C  CG    . GLU A  1 112 ? 88.720  95.772  2.453   1.00 30.49 ? 140  GLU A CG    1 
ATOM   673   C  CD    . GLU A  1 112 ? 89.366  95.558  1.092   1.00 32.52 ? 140  GLU A CD    1 
ATOM   674   O  OE1   . GLU A  1 112 ? 89.780  94.423  0.784   1.00 33.38 ? 140  GLU A OE1   1 
ATOM   675   O  OE2   . GLU A  1 112 ? 89.465  96.538  0.317   1.00 33.70 ? 140  GLU A OE2   1 
ATOM   676   N  N     . ILE A  1 113 ? 87.273  92.612  0.862   1.00 28.62 ? 141  ILE A N     1 
ATOM   677   C  CA    . ILE A  1 113 ? 87.185  92.270  -0.563  1.00 28.57 ? 141  ILE A CA    1 
ATOM   678   C  C     . ILE A  1 113 ? 85.714  92.148  -1.010  1.00 28.33 ? 141  ILE A C     1 
ATOM   679   O  O     . ILE A  1 113 ? 85.304  92.752  -2.014  1.00 27.58 ? 141  ILE A O     1 
ATOM   680   C  CB    . ILE A  1 113 ? 87.927  90.940  -0.880  1.00 28.97 ? 141  ILE A CB    1 
ATOM   681   C  CG1   . ILE A  1 113 ? 89.427  91.062  -0.610  1.00 29.41 ? 141  ILE A CG1   1 
ATOM   682   C  CG2   . ILE A  1 113 ? 87.717  90.526  -2.361  1.00 28.68 ? 141  ILE A CG2   1 
ATOM   683   C  CD1   . ILE A  1 113 ? 90.066  89.712  -0.259  1.00 31.11 ? 141  ILE A CD1   1 
ATOM   684   N  N     . GLN A  1 114 ? 84.920  91.392  -0.251  1.00 27.82 ? 142  GLN A N     1 
ATOM   685   C  CA    . GLN A  1 114 ? 83.509  91.174  -0.604  1.00 28.16 ? 142  GLN A CA    1 
ATOM   686   C  C     . GLN A  1 114 ? 82.785  92.505  -0.698  1.00 28.34 ? 142  GLN A C     1 
ATOM   687   O  O     . GLN A  1 114 ? 82.076  92.758  -1.665  1.00 28.15 ? 142  GLN A O     1 
ATOM   688   C  CB    . GLN A  1 114 ? 82.791  90.281  0.416   1.00 27.88 ? 142  GLN A CB    1 
ATOM   689   C  CG    . GLN A  1 114 ? 81.379  89.825  0.011   1.00 27.73 ? 142  GLN A CG    1 
ATOM   690   C  CD    . GLN A  1 114 ? 81.376  88.548  -0.819  1.00 26.77 ? 142  GLN A CD    1 
ATOM   691   O  OE1   . GLN A  1 114 ? 82.395  88.156  -1.379  1.00 25.83 ? 142  GLN A OE1   1 
ATOM   692   N  NE2   . GLN A  1 114 ? 80.229  87.886  -0.884  1.00 25.70 ? 142  GLN A NE2   1 
ATOM   693   N  N     . ASN A  1 115 ? 82.971  93.355  0.304   1.00 28.27 ? 143  ASN A N     1 
ATOM   694   C  CA    . ASN A  1 115 ? 82.199  94.596  0.388   1.00 28.94 ? 143  ASN A CA    1 
ATOM   695   C  C     . ASN A  1 115 ? 82.686  95.701  -0.545  1.00 29.46 ? 143  ASN A C     1 
ATOM   696   O  O     . ASN A  1 115 ? 81.917  96.245  -1.337  1.00 29.50 ? 143  ASN A O     1 
ATOM   697   C  CB    . ASN A  1 115 ? 82.188  95.093  1.827   1.00 28.77 ? 143  ASN A CB    1 
ATOM   698   C  CG    . ASN A  1 115 ? 81.235  94.309  2.684   1.00 29.42 ? 143  ASN A CG    1 
ATOM   699   O  OD1   . ASN A  1 115 ? 80.016  94.496  2.591   1.00 27.04 ? 143  ASN A OD1   1 
ATOM   700   N  ND2   . ASN A  1 115 ? 81.771  93.392  3.492   1.00 27.22 ? 143  ASN A ND2   1 
ATOM   701   N  N     . THR A  1 116 ? 83.971  95.999  -0.468  1.00 29.74 ? 144  THR A N     1 
ATOM   702   C  CA    . THR A  1 116 ? 84.523  97.184  -1.117  1.00 30.77 ? 144  THR A CA    1 
ATOM   703   C  C     . THR A  1 116 ? 84.990  96.923  -2.553  1.00 30.39 ? 144  THR A C     1 
ATOM   704   O  O     . THR A  1 116 ? 85.087  97.859  -3.340  1.00 31.03 ? 144  THR A O     1 
ATOM   705   C  CB    . THR A  1 116 ? 85.676  97.800  -0.286  1.00 30.86 ? 144  THR A CB    1 
ATOM   706   O  OG1   . THR A  1 116 ? 86.857  97.012  -0.454  1.00 34.51 ? 144  THR A OG1   1 
ATOM   707   C  CG2   . THR A  1 116 ? 85.312  97.842  1.178   1.00 30.02 ? 144  THR A CG2   1 
ATOM   708   N  N     . LEU A  1 117 ? 85.267  95.669  -2.905  1.00 30.09 ? 145  LEU A N     1 
ATOM   709   C  CA    . LEU A  1 117 ? 85.694  95.358  -4.266  1.00 30.08 ? 145  LEU A CA    1 
ATOM   710   C  C     . LEU A  1 117 ? 84.563  94.708  -5.036  1.00 30.03 ? 145  LEU A C     1 
ATOM   711   O  O     . LEU A  1 117 ? 84.064  95.299  -5.985  1.00 30.83 ? 145  LEU A O     1 
ATOM   712   C  CB    . LEU A  1 117 ? 86.956  94.485  -4.305  1.00 29.57 ? 145  LEU A CB    1 
ATOM   713   C  CG    . LEU A  1 117 ? 88.233  95.040  -3.657  1.00 30.68 ? 145  LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1 117 ? 89.442  94.156  -4.049  1.00 29.64 ? 145  LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1 117 ? 88.497  96.522  -3.997  1.00 29.77 ? 145  LEU A CD2   1 
ATOM   716   N  N     . ILE A  1 118 ? 84.134  93.525  -4.597  1.00 29.47 ? 146  ILE A N     1 
ATOM   717   C  CA    . ILE A  1 118 ? 83.157  92.719  -5.340  1.00 29.22 ? 146  ILE A CA    1 
ATOM   718   C  C     . ILE A  1 118 ? 81.748  93.348  -5.367  1.00 29.10 ? 146  ILE A C     1 
ATOM   719   O  O     . ILE A  1 118 ? 81.221  93.628  -6.439  1.00 29.03 ? 146  ILE A O     1 
ATOM   720   C  CB    . ILE A  1 118 ? 83.066  91.271  -4.794  1.00 29.04 ? 146  ILE A CB    1 
ATOM   721   C  CG1   . ILE A  1 118 ? 84.438  90.583  -4.785  1.00 28.61 ? 146  ILE A CG1   1 
ATOM   722   C  CG2   . ILE A  1 118 ? 82.021  90.441  -5.598  1.00 28.67 ? 146  ILE A CG2   1 
ATOM   723   C  CD1   . ILE A  1 118 ? 85.185  90.622  -6.102  1.00 29.05 ? 146  ILE A CD1   1 
ATOM   724   N  N     . ASN A  1 119 ? 81.152  93.569  -4.195  1.00 29.23 ? 147  ASN A N     1 
ATOM   725   C  CA    . ASN A  1 119 ? 79.820  94.173  -4.101  1.00 29.31 ? 147  ASN A CA    1 
ATOM   726   C  C     . ASN A  1 119 ? 79.741  95.555  -4.760  1.00 29.71 ? 147  ASN A C     1 
ATOM   727   O  O     . ASN A  1 119 ? 78.739  95.878  -5.401  1.00 28.85 ? 147  ASN A O     1 
ATOM   728   C  CB    . ASN A  1 119 ? 79.359  94.292  -2.642  1.00 29.59 ? 147  ASN A CB    1 
ATOM   729   C  CG    . ASN A  1 119 ? 78.998  92.958  -2.011  1.00 29.74 ? 147  ASN A CG    1 
ATOM   730   O  OD1   . ASN A  1 119 ? 78.892  91.926  -2.680  1.00 29.51 ? 147  ASN A OD1   1 
ATOM   731   N  ND2   . ASN A  1 119 ? 78.792  92.981  -0.696  1.00 31.34 ? 147  ASN A ND2   1 
ATOM   732   N  N     . THR A  1 120 ? 80.797  96.355  -4.608  1.00 29.70 ? 148  THR A N     1 
ATOM   733   C  CA    . THR A  1 120 ? 80.833  97.699  -5.184  1.00 30.41 ? 148  THR A CA    1 
ATOM   734   C  C     . THR A  1 120 ? 80.882  97.666  -6.716  1.00 30.11 ? 148  THR A C     1 
ATOM   735   O  O     . THR A  1 120 ? 80.113  98.367  -7.369  1.00 29.92 ? 148  THR A O     1 
ATOM   736   C  CB    . THR A  1 120 ? 81.997  98.518  -4.611  1.00 30.81 ? 148  THR A CB    1 
ATOM   737   O  OG1   . THR A  1 120 ? 81.705  98.811  -3.239  1.00 33.30 ? 148  THR A OG1   1 
ATOM   738   C  CG2   . THR A  1 120 ? 82.203  99.835  -5.372  1.00 31.36 ? 148  THR A CG2   1 
ATOM   739   N  N     . LEU A  1 121 ? 81.764  96.843  -7.272  1.00 29.76 ? 149  LEU A N     1 
ATOM   740   C  CA    . LEU A  1 121 ? 81.853  96.677  -8.720  1.00 29.91 ? 149  LEU A CA    1 
ATOM   741   C  C     . LEU A  1 121 ? 80.485  96.348  -9.349  1.00 29.44 ? 149  LEU A C     1 
ATOM   742   O  O     . LEU A  1 121 ? 80.080  96.977  -10.324 1.00 28.68 ? 149  LEU A O     1 
ATOM   743   C  CB    . LEU A  1 121 ? 82.885  95.596  -9.076  1.00 30.23 ? 149  LEU A CB    1 
ATOM   744   C  CG    . LEU A  1 121 ? 84.353  96.051  -9.053  1.00 31.47 ? 149  LEU A CG    1 
ATOM   745   C  CD1   . LEU A  1 121 ? 85.307  94.858  -8.998  1.00 32.45 ? 149  LEU A CD1   1 
ATOM   746   C  CD2   . LEU A  1 121 ? 84.666  96.919  -10.263 1.00 32.71 ? 149  LEU A CD2   1 
ATOM   747   N  N     . ILE A  1 122 ? 79.768  95.395  -8.759  1.00 29.37 ? 150  ILE A N     1 
ATOM   748   C  CA    . ILE A  1 122 ? 78.464  94.977  -9.272  1.00 29.19 ? 150  ILE A CA    1 
ATOM   749   C  C     . ILE A  1 122 ? 77.351  96.006  -8.968  1.00 29.48 ? 150  ILE A C     1 
ATOM   750   O  O     . ILE A  1 122 ? 76.501  96.271  -9.817  1.00 28.61 ? 150  ILE A O     1 
ATOM   751   C  CB    . ILE A  1 122 ? 78.098  93.549  -8.763  1.00 29.46 ? 150  ILE A CB    1 
ATOM   752   C  CG1   . ILE A  1 122 ? 79.131  92.536  -9.288  1.00 29.34 ? 150  ILE A CG1   1 
ATOM   753   C  CG2   . ILE A  1 122 ? 76.664  93.144  -9.207  1.00 27.68 ? 150  ILE A CG2   1 
ATOM   754   C  CD1   . ILE A  1 122 ? 79.137  91.200  -8.566  1.00 29.22 ? 150  ILE A CD1   1 
ATOM   755   N  N     . ARG A  1 123 ? 77.364  96.582  -7.767  1.00 29.52 ? 151  ARG A N     1 
ATOM   756   C  CA    . ARG A  1 123 ? 76.429  97.650  -7.424  1.00 29.94 ? 151  ARG A CA    1 
ATOM   757   C  C     . ARG A  1 123 ? 76.555  98.825  -8.381  1.00 29.60 ? 151  ARG A C     1 
ATOM   758   O  O     . ARG A  1 123 ? 75.554  99.361  -8.834  1.00 29.29 ? 151  ARG A O     1 
ATOM   759   C  CB    . ARG A  1 123 ? 76.679  98.176  -6.008  1.00 30.11 ? 151  ARG A CB    1 
ATOM   760   C  CG    A ARG A  1 123 ? 75.988  97.353  -4.940  0.50 30.69 ? 151  ARG A CG    1 
ATOM   761   C  CG    B ARG A  1 123 ? 76.038  97.375  -4.897  0.50 30.45 ? 151  ARG A CG    1 
ATOM   762   C  CD    A ARG A  1 123 ? 76.440  97.711  -3.545  0.50 31.78 ? 151  ARG A CD    1 
ATOM   763   C  CD    B ARG A  1 123 ? 76.660  97.713  -3.547  0.50 31.09 ? 151  ARG A CD    1 
ATOM   764   N  NE    A ARG A  1 123 ? 76.027  99.056  -3.124  0.50 32.07 ? 151  ARG A NE    1 
ATOM   765   N  NE    B ARG A  1 123 ? 76.999  99.133  -3.404  0.50 31.76 ? 151  ARG A NE    1 
ATOM   766   C  CZ    A ARG A  1 123 ? 76.848  100.028 -2.710  0.50 31.40 ? 151  ARG A CZ    1 
ATOM   767   C  CZ    B ARG A  1 123 ? 76.119  100.118 -3.203  0.50 31.98 ? 151  ARG A CZ    1 
ATOM   768   N  NH1   A ARG A  1 123 ? 78.171  99.859  -2.654  0.50 30.54 ? 151  ARG A NH1   1 
ATOM   769   N  NH1   B ARG A  1 123 ? 76.554  101.369 -3.086  0.50 32.34 ? 151  ARG A NH1   1 
ATOM   770   N  NH2   A ARG A  1 123 ? 76.334  101.197 -2.345  0.50 31.50 ? 151  ARG A NH2   1 
ATOM   771   N  NH2   B ARG A  1 123 ? 74.811  99.874  -3.125  0.50 31.79 ? 151  ARG A NH2   1 
ATOM   772   N  N     . LYS A  1 124 ? 77.788  99.239  -8.663  1.00 29.30 ? 152  LYS A N     1 
ATOM   773   C  CA    . LYS A  1 124 ? 78.017  100.450 -9.458  1.00 29.62 ? 152  LYS A CA    1 
ATOM   774   C  C     . LYS A  1 124 ? 77.956  100.242 -10.975 1.00 28.76 ? 152  LYS A C     1 
ATOM   775   O  O     . LYS A  1 124 ? 77.563  101.155 -11.701 1.00 28.39 ? 152  LYS A O     1 
ATOM   776   C  CB    . LYS A  1 124 ? 79.359  101.098 -9.083  1.00 30.39 ? 152  LYS A CB    1 
ATOM   777   C  CG    . LYS A  1 124 ? 79.513  101.454 -7.602  1.00 32.36 ? 152  LYS A CG    1 
ATOM   778   C  CD    . LYS A  1 124 ? 78.233  102.033 -6.992  1.00 35.86 ? 152  LYS A CD    1 
ATOM   779   C  CE    . LYS A  1 124 ? 78.521  102.772 -5.676  1.00 36.78 ? 152  LYS A CE    1 
ATOM   780   N  NZ    . LYS A  1 124 ? 79.456  102.015 -4.783  1.00 41.00 ? 152  LYS A NZ    1 
ATOM   781   N  N     . HIS A  1 125 ? 78.358  99.064  -11.449 1.00 27.62 ? 153  HIS A N     1 
ATOM   782   C  CA    . HIS A  1 125 ? 78.535  98.837  -12.883 1.00 27.39 ? 153  HIS A CA    1 
ATOM   783   C  C     . HIS A  1 125 ? 77.735  97.666  -13.453 1.00 27.16 ? 153  HIS A C     1 
ATOM   784   O  O     . HIS A  1 125 ? 77.901  97.324  -14.623 1.00 27.63 ? 153  HIS A O     1 
ATOM   785   C  CB    . HIS A  1 125 ? 80.017  98.637  -13.194 1.00 27.27 ? 153  HIS A CB    1 
ATOM   786   C  CG    . HIS A  1 125 ? 80.906  99.648  -12.547 1.00 26.30 ? 153  HIS A CG    1 
ATOM   787   N  ND1   . HIS A  1 125 ? 80.903  100.981 -12.902 1.00 25.39 ? 153  HIS A ND1   1 
ATOM   788   C  CD2   . HIS A  1 125 ? 81.830  99.518  -11.565 1.00 25.88 ? 153  HIS A CD2   1 
ATOM   789   C  CE1   . HIS A  1 125 ? 81.780  101.628 -12.158 1.00 27.07 ? 153  HIS A CE1   1 
ATOM   790   N  NE2   . HIS A  1 125 ? 82.365  100.760 -11.348 1.00 25.30 ? 153  HIS A NE2   1 
ATOM   791   N  N     . GLY A  1 126 ? 76.888  97.046  -12.638 1.00 26.76 ? 154  GLY A N     1 
ATOM   792   C  CA    . GLY A  1 126 ? 76.117  95.895  -13.081 1.00 26.71 ? 154  GLY A CA    1 
ATOM   793   C  C     . GLY A  1 126 ? 74.837  96.353  -13.744 1.00 26.57 ? 154  GLY A C     1 
ATOM   794   O  O     . GLY A  1 126 ? 74.328  97.428  -13.420 1.00 26.68 ? 154  GLY A O     1 
ATOM   795   N  N     . THR A  1 127 ? 74.319  95.551  -14.681 1.00 26.76 ? 155  THR A N     1 
ATOM   796   C  CA    . THR A  1 127 ? 72.969  95.763  -15.197 1.00 26.73 ? 155  THR A CA    1 
ATOM   797   C  C     . THR A  1 127 ? 71.985  95.378  -14.084 1.00 26.91 ? 155  THR A C     1 
ATOM   798   O  O     . THR A  1 127 ? 72.367  94.736  -13.098 1.00 26.48 ? 155  THR A O     1 
ATOM   799   C  CB    . THR A  1 127 ? 72.640  94.917  -16.492 1.00 26.58 ? 155  THR A CB    1 
ATOM   800   O  OG1   . THR A  1 127 ? 72.524  93.518  -16.172 1.00 26.87 ? 155  THR A OG1   1 
ATOM   801   C  CG2   . THR A  1 127 ? 73.684  95.093  -17.583 1.00 26.14 ? 155  THR A CG2   1 
ATOM   802   N  N     . GLU A  1 128 ? 70.721  95.756  -14.247 1.00 27.18 ? 156  GLU A N     1 
ATOM   803   C  CA    . GLU A  1 128 ? 69.687  95.408  -13.269 1.00 27.52 ? 156  GLU A CA    1 
ATOM   804   C  C     . GLU A  1 128 ? 69.586  93.886  -13.119 1.00 27.78 ? 156  GLU A C     1 
ATOM   805   O  O     . GLU A  1 128 ? 69.391  93.374  -12.009 1.00 27.68 ? 156  GLU A O     1 
ATOM   806   C  CB    . GLU A  1 128 ? 68.330  96.017  -13.659 1.00 28.01 ? 156  GLU A CB    1 
ATOM   807   C  CG    . GLU A  1 128 ? 68.314  97.552  -13.707 1.00 28.66 ? 156  GLU A CG    1 
ATOM   808   C  CD    . GLU A  1 128 ? 68.818  98.184  -12.416 1.00 29.93 ? 156  GLU A CD    1 
ATOM   809   O  OE1   . GLU A  1 128 ? 68.187  97.976  -11.366 1.00 31.43 ? 156  GLU A OE1   1 
ATOM   810   O  OE2   . GLU A  1 128 ? 69.852  98.886  -12.439 1.00 31.36 ? 156  GLU A OE2   1 
ATOM   811   N  N     . GLU A  1 129 ? 69.744  93.172  -14.233 1.00 27.81 ? 157  GLU A N     1 
ATOM   812   C  CA    . GLU A  1 129 ? 69.730  91.711  -14.237 1.00 28.32 ? 157  GLU A CA    1 
ATOM   813   C  C     . GLU A  1 129 ? 70.920  91.090  -13.482 1.00 27.82 ? 157  GLU A C     1 
ATOM   814   O  O     . GLU A  1 129 ? 70.744  90.148  -12.705 1.00 27.54 ? 157  GLU A O     1 
ATOM   815   C  CB    . GLU A  1 129 ? 69.683  91.207  -15.683 1.00 28.70 ? 157  GLU A CB    1 
ATOM   816   C  CG    . GLU A  1 129 ? 69.770  89.694  -15.832 1.00 29.63 ? 157  GLU A CG    1 
ATOM   817   C  CD    . GLU A  1 129 ? 69.331  89.205  -17.202 1.00 30.88 ? 157  GLU A CD    1 
ATOM   818   O  OE1   . GLU A  1 129 ? 68.785  90.009  -18.004 1.00 34.20 ? 157  GLU A OE1   1 
ATOM   819   O  OE2   . GLU A  1 129 ? 69.516  87.996  -17.474 1.00 35.68 ? 157  GLU A OE2   1 
ATOM   820   N  N     . GLN A  1 130 ? 72.121  91.610  -13.722 1.00 27.06 ? 158  GLN A N     1 
ATOM   821   C  CA    . GLN A  1 130 ? 73.316  91.159  -13.010 1.00 26.96 ? 158  GLN A CA    1 
ATOM   822   C  C     . GLN A  1 130 ? 73.216  91.443  -11.514 1.00 26.58 ? 158  GLN A C     1 
ATOM   823   O  O     . GLN A  1 130 ? 73.586  90.603  -10.696 1.00 26.15 ? 158  GLN A O     1 
ATOM   824   C  CB    . GLN A  1 130 ? 74.569  91.813  -13.586 1.00 26.96 ? 158  GLN A CB    1 
ATOM   825   C  CG    . GLN A  1 130 ? 75.023  91.214  -14.918 1.00 27.15 ? 158  GLN A CG    1 
ATOM   826   C  CD    . GLN A  1 130 ? 76.117  92.049  -15.609 1.00 27.43 ? 158  GLN A CD    1 
ATOM   827   O  OE1   . GLN A  1 130 ? 76.362  93.250  -15.276 1.00 25.99 ? 158  GLN A OE1   1 
ATOM   828   N  NE2   . GLN A  1 130 ? 76.782  91.418  -16.579 1.00 26.65 ? 158  GLN A NE2   1 
ATOM   829   N  N     . LYS A  1 131 ? 72.714  92.621  -11.151 1.00 26.46 ? 159  LYS A N     1 
ATOM   830   C  CA    . LYS A  1 131 ? 72.493  92.927  -9.742  1.00 26.72 ? 159  LYS A CA    1 
ATOM   831   C  C     . LYS A  1 131 ? 71.494  91.938  -9.128  1.00 26.69 ? 159  LYS A C     1 
ATOM   832   O  O     . LYS A  1 131 ? 71.736  91.394  -8.057  1.00 26.44 ? 159  LYS A O     1 
ATOM   833   C  CB    . LYS A  1 131 ? 71.966  94.339  -9.559  1.00 26.73 ? 159  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1 131 ? 72.958  95.448  -9.791  1.00 28.00 ? 159  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1 131 ? 72.302  96.766  -9.403  1.00 30.30 ? 159  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1 131 ? 72.667  97.907  -10.329 1.00 32.00 ? 159  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1 131 ? 71.541  98.878  -10.441 1.00 33.13 ? 159  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1 132 ? 70.379  91.713  -9.816  1.00 26.54 ? 160  ALA A N     1 
ATOM   839   C  CA    . ALA A  1 132 ? 69.338  90.792  -9.333  1.00 26.75 ? 160  ALA A CA    1 
ATOM   840   C  C     . ALA A  1 132 ? 69.832  89.345  -9.210  1.00 26.83 ? 160  ALA A C     1 
ATOM   841   O  O     . ALA A  1 132 ? 69.375  88.608  -8.346  1.00 26.77 ? 160  ALA A O     1 
ATOM   842   C  CB    . ALA A  1 132 ? 68.087  90.863  -10.229 1.00 26.61 ? 160  ALA A CB    1 
ATOM   843   N  N     . THR A  1 133 ? 70.775  88.950  -10.057 1.00 27.07 ? 161  THR A N     1 
ATOM   844   C  CA    . THR A  1 133 ? 71.311  87.593  -10.025 1.00 27.36 ? 161  THR A CA    1 
ATOM   845   C  C     . THR A  1 133 ? 72.367  87.388  -8.934  1.00 27.42 ? 161  THR A C     1 
ATOM   846   O  O     . THR A  1 133 ? 72.304  86.413  -8.175  1.00 26.77 ? 161  THR A O     1 
ATOM   847   C  CB    . THR A  1 133 ? 71.933  87.231  -11.376 1.00 27.40 ? 161  THR A CB    1 
ATOM   848   O  OG1   . THR A  1 133 ? 70.925  87.309  -12.385 1.00 27.50 ? 161  THR A OG1   1 
ATOM   849   C  CG2   . THR A  1 133 ? 72.503  85.820  -11.350 1.00 28.18 ? 161  THR A CG2   1 
ATOM   850   N  N     . TYR A  1 134 ? 73.323  88.317  -8.858  1.00 27.67 ? 162  TYR A N     1 
ATOM   851   C  CA    . TYR A  1 134 ? 74.525  88.125  -8.058  1.00 28.28 ? 162  TYR A CA    1 
ATOM   852   C  C     . TYR A  1 134 ? 74.431  88.685  -6.648  1.00 28.17 ? 162  TYR A C     1 
ATOM   853   O  O     . TYR A  1 134 ? 74.880  88.028  -5.710  1.00 28.10 ? 162  TYR A O     1 
ATOM   854   C  CB    . TYR A  1 134 ? 75.749  88.710  -8.781  1.00 29.00 ? 162  TYR A CB    1 
ATOM   855   C  CG    . TYR A  1 134 ? 76.137  87.891  -9.992  1.00 30.29 ? 162  TYR A CG    1 
ATOM   856   C  CD1   . TYR A  1 134 ? 76.751  86.653  -9.840  1.00 31.71 ? 162  TYR A CD1   1 
ATOM   857   C  CD2   . TYR A  1 134 ? 75.866  88.332  -11.285 1.00 30.58 ? 162  TYR A CD2   1 
ATOM   858   C  CE1   . TYR A  1 134 ? 77.099  85.883  -10.936 1.00 31.86 ? 162  TYR A CE1   1 
ATOM   859   C  CE2   . TYR A  1 134 ? 76.218  87.567  -12.391 1.00 31.26 ? 162  TYR A CE2   1 
ATOM   860   C  CZ    . TYR A  1 134 ? 76.831  86.344  -12.204 1.00 31.30 ? 162  TYR A CZ    1 
ATOM   861   O  OH    . TYR A  1 134 ? 77.196  85.577  -13.280 1.00 31.93 ? 162  TYR A OH    1 
ATOM   862   N  N     . LEU A  1 135 ? 73.850  89.874  -6.485  1.00 27.74 ? 163  LEU A N     1 
ATOM   863   C  CA    . LEU A  1 135 ? 73.853  90.523  -5.173  1.00 27.44 ? 163  LEU A CA    1 
ATOM   864   C  C     . LEU A  1 135 ? 73.171  89.724  -4.060  1.00 27.19 ? 163  LEU A C     1 
ATOM   865   O  O     . LEU A  1 135 ? 73.718  89.650  -2.951  1.00 27.02 ? 163  LEU A O     1 
ATOM   866   C  CB    . LEU A  1 135 ? 73.305  91.960  -5.239  1.00 27.28 ? 163  LEU A CB    1 
ATOM   867   C  CG    . LEU A  1 135 ? 74.225  93.000  -5.900  1.00 26.43 ? 163  LEU A CG    1 
ATOM   868   C  CD1   . LEU A  1 135 ? 73.537  94.349  -5.951  1.00 24.91 ? 163  LEU A CD1   1 
ATOM   869   C  CD2   . LEU A  1 135 ? 75.623  93.110  -5.212  1.00 25.51 ? 163  LEU A CD2   1 
ATOM   870   N  N     . PRO A  1 136 ? 71.999  89.120  -4.336  1.00 27.36 ? 164  PRO A N     1 
ATOM   871   C  CA    . PRO A  1 136 ? 71.395  88.221  -3.343  1.00 27.46 ? 164  PRO A CA    1 
ATOM   872   C  C     . PRO A  1 136 ? 72.276  87.036  -2.941  1.00 27.55 ? 164  PRO A C     1 
ATOM   873   O  O     . PRO A  1 136 ? 72.240  86.631  -1.780  1.00 27.56 ? 164  PRO A O     1 
ATOM   874   C  CB    . PRO A  1 136 ? 70.128  87.724  -4.045  1.00 27.34 ? 164  PRO A CB    1 
ATOM   875   C  CG    . PRO A  1 136 ? 69.816  88.760  -5.041  1.00 27.44 ? 164  PRO A CG    1 
ATOM   876   C  CD    . PRO A  1 136 ? 71.132  89.243  -5.530  1.00 27.00 ? 164  PRO A CD    1 
ATOM   877   N  N     . GLN A  1 137 ? 73.055  86.502  -3.887  1.00 27.45 ? 165  GLN A N     1 
ATOM   878   C  CA    . GLN A  1 137 ? 73.987  85.405  -3.612  1.00 27.26 ? 165  GLN A CA    1 
ATOM   879   C  C     . GLN A  1 137 ? 75.145  85.905  -2.752  1.00 26.98 ? 165  GLN A C     1 
ATOM   880   O  O     . GLN A  1 137 ? 75.500  85.269  -1.764  1.00 26.10 ? 165  GLN A O     1 
ATOM   881   C  CB    . GLN A  1 137 ? 74.541  84.799  -4.908  1.00 27.24 ? 165  GLN A CB    1 
ATOM   882   C  CG    . GLN A  1 137 ? 73.517  84.051  -5.775  1.00 27.63 ? 165  GLN A CG    1 
ATOM   883   C  CD    . GLN A  1 137 ? 74.097  83.576  -7.099  1.00 27.88 ? 165  GLN A CD    1 
ATOM   884   O  OE1   . GLN A  1 137 ? 75.212  83.923  -7.463  1.00 30.69 ? 165  GLN A OE1   1 
ATOM   885   N  NE2   . GLN A  1 137 ? 73.332  82.790  -7.828  1.00 30.14 ? 165  GLN A NE2   1 
ATOM   886   N  N     . LEU A  1 138 ? 75.713  87.048  -3.144  1.00 27.17 ? 166  LEU A N     1 
ATOM   887   C  CA    . LEU A  1 138 ? 76.859  87.639  -2.463  1.00 27.46 ? 166  LEU A CA    1 
ATOM   888   C  C     . LEU A  1 138 ? 76.542  88.178  -1.068  1.00 27.38 ? 166  LEU A C     1 
ATOM   889   O  O     . LEU A  1 138 ? 77.432  88.268  -0.248  1.00 27.19 ? 166  LEU A O     1 
ATOM   890   C  CB    . LEU A  1 138 ? 77.475  88.756  -3.315  1.00 27.74 ? 166  LEU A CB    1 
ATOM   891   C  CG    . LEU A  1 138 ? 78.093  88.318  -4.651  1.00 28.16 ? 166  LEU A CG    1 
ATOM   892   C  CD1   . LEU A  1 138 ? 78.320  89.522  -5.567  1.00 28.09 ? 166  LEU A CD1   1 
ATOM   893   C  CD2   . LEU A  1 138 ? 79.394  87.531  -4.440  1.00 27.50 ? 166  LEU A CD2   1 
ATOM   894   N  N     . THR A  1 139 ? 75.291  88.536  -0.795  1.00 27.70 ? 167  THR A N     1 
ATOM   895   C  CA    . THR A  1 139 ? 74.912  88.990  0.543   1.00 28.25 ? 167  THR A CA    1 
ATOM   896   C  C     . THR A  1 139 ? 74.579  87.836  1.497   1.00 28.53 ? 167  THR A C     1 
ATOM   897   O  O     . THR A  1 139 ? 74.506  88.056  2.702   1.00 28.68 ? 167  THR A O     1 
ATOM   898   C  CB    . THR A  1 139 ? 73.698  89.960  0.522   1.00 28.21 ? 167  THR A CB    1 
ATOM   899   O  OG1   . THR A  1 139 ? 72.521  89.271  0.069   1.00 28.01 ? 167  THR A OG1   1 
ATOM   900   C  CG2   . THR A  1 139 ? 73.997  91.176  -0.362  1.00 28.14 ? 167  THR A CG2   1 
ATOM   901   N  N     . THR A  1 140 ? 74.398  86.624  0.974   1.00 28.95 ? 168  THR A N     1 
ATOM   902   C  CA    . THR A  1 140 ? 73.889  85.510  1.790   1.00 29.45 ? 168  THR A CA    1 
ATOM   903   C  C     . THR A  1 140 ? 74.809  84.276  1.893   1.00 29.18 ? 168  THR A C     1 
ATOM   904   O  O     . THR A  1 140 ? 74.877  83.666  2.963   1.00 29.52 ? 168  THR A O     1 
ATOM   905   C  CB    . THR A  1 140 ? 72.468  85.067  1.335   1.00 29.92 ? 168  THR A CB    1 
ATOM   906   O  OG1   . THR A  1 140 ? 72.541  84.369  0.086   1.00 31.55 ? 168  THR A OG1   1 
ATOM   907   C  CG2   . THR A  1 140 ? 71.534  86.279  1.210   1.00 29.98 ? 168  THR A CG2   1 
ATOM   908   N  N     . GLU A  1 141 ? 75.504  83.907  0.813   1.00 28.75 ? 169  GLU A N     1 
ATOM   909   C  CA    . GLU A  1 141 ? 76.347  82.691  0.813   1.00 28.30 ? 169  GLU A CA    1 
ATOM   910   C  C     . GLU A  1 141 ? 77.537  82.643  -0.172  1.00 27.91 ? 169  GLU A C     1 
ATOM   911   O  O     . GLU A  1 141 ? 78.472  81.881  0.055   1.00 27.94 ? 169  GLU A O     1 
ATOM   912   C  CB    . GLU A  1 141 ? 75.481  81.445  0.585   1.00 28.54 ? 169  GLU A CB    1 
ATOM   913   C  CG    . GLU A  1 141 ? 74.755  81.395  -0.769  1.00 29.00 ? 169  GLU A CG    1 
ATOM   914   N  N     . LYS A  1 142 ? 77.511  83.413  -1.258  1.00 27.13 ? 170  LYS A N     1 
ATOM   915   C  CA    . LYS A  1 142 ? 78.565  83.321  -2.276  1.00 26.91 ? 170  LYS A CA    1 
ATOM   916   C  C     . LYS A  1 142 ? 79.721  84.283  -2.006  1.00 26.63 ? 170  LYS A C     1 
ATOM   917   O  O     . LYS A  1 142 ? 79.516  85.489  -1.912  1.00 26.74 ? 170  LYS A O     1 
ATOM   918   C  CB    . LYS A  1 142 ? 77.989  83.598  -3.671  1.00 26.87 ? 170  LYS A CB    1 
ATOM   919   C  CG    . LYS A  1 142 ? 78.959  83.317  -4.820  1.00 27.22 ? 170  LYS A CG    1 
ATOM   920   C  CD    . LYS A  1 142 ? 78.264  83.280  -6.185  1.00 27.39 ? 170  LYS A CD    1 
ATOM   921   C  CE    . LYS A  1 142 ? 77.547  81.958  -6.428  1.00 27.96 ? 170  LYS A CE    1 
ATOM   922   N  NZ    . LYS A  1 142 ? 77.000  81.864  -7.823  1.00 29.00 ? 170  LYS A NZ    1 
ATOM   923   N  N     . VAL A  1 143 ? 80.930  83.738  -1.899  1.00 26.34 ? 171  VAL A N     1 
ATOM   924   C  CA    . VAL A  1 143 ? 82.153  84.539  -1.804  1.00 26.00 ? 171  VAL A CA    1 
ATOM   925   C  C     . VAL A  1 143 ? 82.673  84.914  -3.199  1.00 25.46 ? 171  VAL A C     1 
ATOM   926   O  O     . VAL A  1 143 ? 82.658  84.089  -4.112  1.00 25.28 ? 171  VAL A O     1 
ATOM   927   C  CB    . VAL A  1 143 ? 83.264  83.783  -1.022  1.00 26.24 ? 171  VAL A CB    1 
ATOM   928   C  CG1   . VAL A  1 143 ? 84.574  84.566  -1.032  1.00 24.98 ? 171  VAL A CG1   1 
ATOM   929   C  CG2   . VAL A  1 143 ? 82.816  83.505  0.401   1.00 26.07 ? 171  VAL A CG2   1 
ATOM   930   N  N     . GLY A  1 144 ? 83.130  86.157  -3.349  1.00 25.32 ? 172  GLY A N     1 
ATOM   931   C  CA    . GLY A  1 144 ? 83.750  86.637  -4.591  1.00 25.24 ? 172  GLY A CA    1 
ATOM   932   C  C     . GLY A  1 144 ? 85.258  86.853  -4.522  1.00 25.35 ? 172  GLY A C     1 
ATOM   933   O  O     . GLY A  1 144 ? 85.793  87.230  -3.467  1.00 25.52 ? 172  GLY A O     1 
ATOM   934   N  N     . SER A  1 145 ? 85.951  86.595  -5.638  1.00 25.38 ? 173  SER A N     1 
ATOM   935   C  CA    . SER A  1 145 ? 87.375  86.959  -5.789  1.00 25.86 ? 173  SER A CA    1 
ATOM   936   C  C     . SER A  1 145 ? 87.569  88.046  -6.860  1.00 25.56 ? 173  SER A C     1 
ATOM   937   O  O     . SER A  1 145 ? 86.914  88.047  -7.894  1.00 25.42 ? 173  SER A O     1 
ATOM   938   C  CB    . SER A  1 145 ? 88.236  85.736  -6.146  1.00 25.75 ? 173  SER A CB    1 
ATOM   939   O  OG    . SER A  1 145 ? 88.480  84.920  -5.010  1.00 26.39 ? 173  SER A OG    1 
ATOM   940   N  N     . PHE A  1 146 ? 88.490  88.954  -6.587  1.00 25.43 ? 174  PHE A N     1 
ATOM   941   C  CA    . PHE A  1 146 ? 88.858  90.050  -7.479  1.00 25.68 ? 174  PHE A CA    1 
ATOM   942   C  C     . PHE A  1 146 ? 90.165  89.638  -8.162  1.00 25.35 ? 174  PHE A C     1 
ATOM   943   O  O     . PHE A  1 146 ? 91.172  89.444  -7.487  1.00 25.64 ? 174  PHE A O     1 
ATOM   944   C  CB    . PHE A  1 146 ? 89.034  91.320  -6.628  1.00 26.16 ? 174  PHE A CB    1 
ATOM   945   C  CG    . PHE A  1 146 ? 89.453  92.550  -7.397  1.00 26.47 ? 174  PHE A CG    1 
ATOM   946   C  CD1   . PHE A  1 146 ? 88.530  93.297  -8.098  1.00 26.79 ? 174  PHE A CD1   1 
ATOM   947   C  CD2   . PHE A  1 146 ? 90.774  92.995  -7.349  1.00 27.85 ? 174  PHE A CD2   1 
ATOM   948   C  CE1   . PHE A  1 146 ? 88.923  94.467  -8.784  1.00 29.00 ? 174  PHE A CE1   1 
ATOM   949   C  CE2   . PHE A  1 146 ? 91.177  94.154  -8.028  1.00 27.96 ? 174  PHE A CE2   1 
ATOM   950   C  CZ    . PHE A  1 146 ? 90.255  94.892  -8.739  1.00 27.74 ? 174  PHE A CZ    1 
ATOM   951   N  N     . CYS A  1 147 ? 90.134  89.490  -9.487  1.00 25.06 ? 175  CYS A N     1 
ATOM   952   C  CA    . CYS A  1 147 ? 91.209  88.859  -10.259 1.00 25.17 ? 175  CYS A CA    1 
ATOM   953   C  C     . CYS A  1 147 ? 91.827  89.830  -11.273 1.00 25.02 ? 175  CYS A C     1 
ATOM   954   O  O     . CYS A  1 147 ? 91.446  89.876  -12.448 1.00 24.55 ? 175  CYS A O     1 
ATOM   955   C  CB    . CYS A  1 147 ? 90.693  87.597  -10.966 1.00 24.93 ? 175  CYS A CB    1 
ATOM   956   S  SG    . CYS A  1 147 ? 89.720  86.480  -9.910  1.00 26.77 ? 175  CYS A SG    1 
ATOM   957   N  N     . LEU A  1 148 ? 92.793  90.599  -10.795 1.00 24.98 ? 176  LEU A N     1 
ATOM   958   C  CA    . LEU A  1 148 ? 93.499  91.583  -11.602 1.00 25.13 ? 176  LEU A CA    1 
ATOM   959   C  C     . LEU A  1 148 ? 94.959  91.194  -11.850 1.00 25.06 ? 176  LEU A C     1 
ATOM   960   O  O     . LEU A  1 148 ? 95.410  91.155  -12.995 1.00 25.53 ? 176  LEU A O     1 
ATOM   961   C  CB    . LEU A  1 148 ? 93.433  92.943  -10.901 1.00 25.06 ? 176  LEU A CB    1 
ATOM   962   C  CG    . LEU A  1 148 ? 94.122  94.125  -11.594 1.00 25.87 ? 176  LEU A CG    1 
ATOM   963   C  CD1   . LEU A  1 148 ? 93.518  94.342  -12.979 1.00 26.04 ? 176  LEU A CD1   1 
ATOM   964   C  CD2   . LEU A  1 148 ? 94.037  95.386  -10.739 1.00 24.76 ? 176  LEU A CD2   1 
ATOM   965   N  N     . SER A  1 149 ? 95.695  90.917  -10.774 1.00 25.52 ? 177  SER A N     1 
ATOM   966   C  CA    . SER A  1 149 ? 97.150  90.767  -10.837 1.00 25.59 ? 177  SER A CA    1 
ATOM   967   C  C     . SER A  1 149 ? 97.599  89.489  -11.540 1.00 25.71 ? 177  SER A C     1 
ATOM   968   O  O     . SER A  1 149 ? 96.894  88.469  -11.539 1.00 25.95 ? 177  SER A O     1 
ATOM   969   C  CB    . SER A  1 149 ? 97.779  90.856  -9.423  1.00 25.52 ? 177  SER A CB    1 
ATOM   970   O  OG    . SER A  1 149 ? 97.415  92.076  -8.779  1.00 26.01 ? 177  SER A OG    1 
ATOM   971   N  N     . GLU A  1 150 ? 98.772  89.579  -12.162 1.00 25.70 ? 178  GLU A N     1 
ATOM   972   C  CA    . GLU A  1 150 ? 99.448  88.445  -12.780 1.00 25.91 ? 178  GLU A CA    1 
ATOM   973   C  C     . GLU A  1 150 ? 100.924 88.503  -12.390 1.00 25.98 ? 178  GLU A C     1 
ATOM   974   O  O     . GLU A  1 150 ? 101.396 89.507  -11.859 1.00 25.19 ? 178  GLU A O     1 
ATOM   975   C  CB    . GLU A  1 150 ? 99.283  88.490  -14.309 1.00 26.02 ? 178  GLU A CB    1 
ATOM   976   C  CG    . GLU A  1 150 ? 97.838  88.607  -14.733 1.00 25.84 ? 178  GLU A CG    1 
ATOM   977   C  CD    . GLU A  1 150 ? 97.605  88.625  -16.228 1.00 26.52 ? 178  GLU A CD    1 
ATOM   978   O  OE1   . GLU A  1 150 ? 98.580  88.578  -16.999 1.00 27.98 ? 178  GLU A OE1   1 
ATOM   979   O  OE2   . GLU A  1 150 ? 96.421  88.703  -16.631 1.00 25.90 ? 178  GLU A OE2   1 
ATOM   980   N  N     . ALA A  1 151 ? 101.658 87.431  -12.671 1.00 26.34 ? 179  ALA A N     1 
ATOM   981   C  CA    . ALA A  1 151 ? 103.091 87.402  -12.388 1.00 26.68 ? 179  ALA A CA    1 
ATOM   982   C  C     . ALA A  1 151 ? 103.829 88.546  -13.099 1.00 26.92 ? 179  ALA A C     1 
ATOM   983   O  O     . ALA A  1 151 ? 104.796 89.085  -12.565 1.00 27.22 ? 179  ALA A O     1 
ATOM   984   C  CB    . ALA A  1 151 ? 103.688 86.027  -12.773 1.00 26.02 ? 179  ALA A CB    1 
ATOM   985   N  N     . GLY A  1 152 ? 103.378 88.917  -14.297 1.00 26.89 ? 180  GLY A N     1 
ATOM   986   C  CA    . GLY A  1 152 ? 103.979 90.041  -15.032 1.00 27.12 ? 180  GLY A CA    1 
ATOM   987   C  C     . GLY A  1 152 ? 103.271 91.378  -14.882 1.00 27.20 ? 180  GLY A C     1 
ATOM   988   O  O     . GLY A  1 152 ? 103.644 92.354  -15.524 1.00 28.18 ? 180  GLY A O     1 
ATOM   989   N  N     . ALA A  1 153 ? 102.257 91.441  -14.025 1.00 26.84 ? 181  ALA A N     1 
ATOM   990   C  CA    . ALA A  1 153 ? 101.417 92.629  -13.917 1.00 26.66 ? 181  ALA A CA    1 
ATOM   991   C  C     . ALA A  1 153 ? 100.978 92.789  -12.468 1.00 26.43 ? 181  ALA A C     1 
ATOM   992   O  O     . ALA A  1 153 ? 99.885  92.378  -12.087 1.00 26.84 ? 181  ALA A O     1 
ATOM   993   C  CB    . ALA A  1 153 ? 100.199 92.512  -14.873 1.00 25.78 ? 181  ALA A CB    1 
ATOM   994   N  N     . GLY A  1 154 ? 101.870 93.334  -11.647 1.00 26.31 ? 182  GLY A N     1 
ATOM   995   C  CA    . GLY A  1 154 ? 101.566 93.592  -10.242 1.00 26.25 ? 182  GLY A CA    1 
ATOM   996   C  C     . GLY A  1 154 ? 101.241 95.053  -10.055 1.00 26.36 ? 182  GLY A C     1 
ATOM   997   O  O     . GLY A  1 154 ? 100.082 95.462  -10.165 1.00 26.63 ? 182  GLY A O     1 
ATOM   998   N  N     . SER A  1 155 ? 102.267 95.860  -9.791  1.00 26.11 ? 183  SER A N     1 
ATOM   999   C  CA    . SER A  1 155 ? 102.060 97.312  -9.721  1.00 25.53 ? 183  SER A CA    1 
ATOM   1000  C  C     . SER A  1 155 ? 101.561 97.808  -11.079 1.00 25.53 ? 183  SER A C     1 
ATOM   1001  O  O     . SER A  1 155 ? 100.703 98.681  -11.149 1.00 25.66 ? 183  SER A O     1 
ATOM   1002  C  CB    . SER A  1 155 ? 103.347 98.029  -9.309  1.00 25.18 ? 183  SER A CB    1 
ATOM   1003  O  OG    . SER A  1 155 ? 103.741 97.618  -8.018  1.00 24.58 ? 183  SER A OG    1 
ATOM   1004  N  N     . ASP A  1 156 ? 102.119 97.240  -12.147 1.00 25.38 ? 184  ASP A N     1 
ATOM   1005  C  CA    . ASP A  1 156 ? 101.705 97.511  -13.517 1.00 25.31 ? 184  ASP A CA    1 
ATOM   1006  C  C     . ASP A  1 156 ? 100.523 96.584  -13.900 1.00 25.50 ? 184  ASP A C     1 
ATOM   1007  O  O     . ASP A  1 156 ? 100.659 95.711  -14.756 1.00 24.57 ? 184  ASP A O     1 
ATOM   1008  C  CB    . ASP A  1 156 ? 102.919 97.321  -14.448 1.00 25.39 ? 184  ASP A CB    1 
ATOM   1009  C  CG    . ASP A  1 156 ? 102.686 97.827  -15.872 1.00 25.06 ? 184  ASP A CG    1 
ATOM   1010  O  OD1   . ASP A  1 156 ? 101.645 98.458  -16.147 1.00 26.16 ? 184  ASP A OD1   1 
ATOM   1011  O  OD2   . ASP A  1 156 ? 103.570 97.588  -16.719 1.00 25.17 ? 184  ASP A OD2   1 
ATOM   1012  N  N     . SER A  1 157 ? 99.374  96.805  -13.250 1.00 26.02 ? 185  SER A N     1 
ATOM   1013  C  CA    . SER A  1 157 ? 98.154  95.967  -13.420 1.00 27.15 ? 185  SER A CA    1 
ATOM   1014  C  C     . SER A  1 157 ? 97.702  95.894  -14.851 1.00 26.89 ? 185  SER A C     1 
ATOM   1015  O  O     . SER A  1 157 ? 97.243  94.854  -15.319 1.00 27.94 ? 185  SER A O     1 
ATOM   1016  C  CB    . SER A  1 157 ? 96.980  96.537  -12.615 1.00 26.92 ? 185  SER A CB    1 
ATOM   1017  O  OG    . SER A  1 157 ? 97.339  96.720  -11.272 1.00 28.99 ? 185  SER A OG    1 
ATOM   1018  N  N     . PHE A  1 158 ? 97.824  97.015  -15.551 1.00 27.42 ? 186  PHE A N     1 
ATOM   1019  C  CA    . PHE A  1 158 ? 97.279  97.137  -16.891 1.00 27.51 ? 186  PHE A CA    1 
ATOM   1020  C  C     . PHE A  1 158 ? 98.166  96.534  -17.971 1.00 27.23 ? 186  PHE A C     1 
ATOM   1021  O  O     . PHE A  1 158 ? 97.788  96.558  -19.141 1.00 26.69 ? 186  PHE A O     1 
ATOM   1022  C  CB    . PHE A  1 158 ? 96.942  98.602  -17.201 1.00 28.36 ? 186  PHE A CB    1 
ATOM   1023  C  CG    . PHE A  1 158 ? 95.942  99.213  -16.253 1.00 28.70 ? 186  PHE A CG    1 
ATOM   1024  C  CD1   . PHE A  1 158 ? 95.120  98.419  -15.445 1.00 29.75 ? 186  PHE A CD1   1 
ATOM   1025  C  CD2   . PHE A  1 158 ? 95.792  100.594 -16.198 1.00 31.01 ? 186  PHE A CD2   1 
ATOM   1026  C  CE1   . PHE A  1 158 ? 94.204  98.985  -14.587 1.00 30.05 ? 186  PHE A CE1   1 
ATOM   1027  C  CE2   . PHE A  1 158 ? 94.865  101.177 -15.333 1.00 31.62 ? 186  PHE A CE2   1 
ATOM   1028  C  CZ    . PHE A  1 158 ? 94.075  100.366 -14.524 1.00 30.74 ? 186  PHE A CZ    1 
ATOM   1029  N  N     . ALA A  1 159 ? 99.321  95.988  -17.578 1.00 26.80 ? 187  ALA A N     1 
ATOM   1030  C  CA    . ALA A  1 159 ? 100.148 95.141  -18.459 1.00 26.67 ? 187  ALA A CA    1 
ATOM   1031  C  C     . ALA A  1 159 ? 99.664  93.685  -18.456 1.00 26.61 ? 187  ALA A C     1 
ATOM   1032  O  O     . ALA A  1 159 ? 100.319 92.813  -19.027 1.00 26.16 ? 187  ALA A O     1 
ATOM   1033  C  CB    . ALA A  1 159 ? 101.584 95.176  -18.025 1.00 26.34 ? 187  ALA A CB    1 
ATOM   1034  N  N     . LEU A  1 160 ? 98.543  93.421  -17.791 1.00 26.89 ? 188  LEU A N     1 
ATOM   1035  C  CA    . LEU A  1 160 ? 97.962  92.071  -17.757 1.00 27.15 ? 188  LEU A CA    1 
ATOM   1036  C  C     . LEU A  1 160 ? 97.820  91.474  -19.166 1.00 27.46 ? 188  LEU A C     1 
ATOM   1037  O  O     . LEU A  1 160 ? 97.445  92.164  -20.129 1.00 27.17 ? 188  LEU A O     1 
ATOM   1038  C  CB    . LEU A  1 160 ? 96.619  92.063  -16.993 1.00 27.03 ? 188  LEU A CB    1 
ATOM   1039  C  CG    . LEU A  1 160 ? 95.402  92.814  -17.550 1.00 27.04 ? 188  LEU A CG    1 
ATOM   1040  C  CD1   . LEU A  1 160 ? 94.667  91.984  -18.594 1.00 26.32 ? 188  LEU A CD1   1 
ATOM   1041  C  CD2   . LEU A  1 160 ? 94.446  93.208  -16.414 1.00 26.47 ? 188  LEU A CD2   1 
ATOM   1042  N  N     . LYS A  1 161 ? 98.162  90.192  -19.264 1.00 28.28 ? 189  LYS A N     1 
ATOM   1043  C  CA    . LYS A  1 161 ? 98.191  89.457  -20.519 1.00 29.30 ? 189  LYS A CA    1 
ATOM   1044  C  C     . LYS A  1 161 ? 97.031  88.474  -20.695 1.00 28.97 ? 189  LYS A C     1 
ATOM   1045  O  O     . LYS A  1 161 ? 96.871  87.922  -21.777 1.00 28.89 ? 189  LYS A O     1 
ATOM   1046  C  CB    . LYS A  1 161 ? 99.514  88.702  -20.640 1.00 29.63 ? 189  LYS A CB    1 
ATOM   1047  C  CG    . LYS A  1 161 ? 100.716 89.618  -20.761 1.00 30.69 ? 189  LYS A CG    1 
ATOM   1048  C  CD    . LYS A  1 161 ? 101.983 88.831  -21.099 1.00 31.76 ? 189  LYS A CD    1 
ATOM   1049  C  CE    . LYS A  1 161 ? 103.193 89.753  -21.357 1.00 33.92 ? 189  LYS A CE    1 
ATOM   1050  N  NZ    . LYS A  1 161 ? 102.915 90.812  -22.395 1.00 36.69 ? 189  LYS A NZ    1 
ATOM   1051  N  N     . THR A  1 162 ? 96.217  88.250  -19.662 1.00 28.87 ? 190  THR A N     1 
ATOM   1052  C  CA    . THR A  1 162 ? 95.039  87.405  -19.842 1.00 28.71 ? 190  THR A CA    1 
ATOM   1053  C  C     . THR A  1 162 ? 94.177  88.033  -20.960 1.00 28.94 ? 190  THR A C     1 
ATOM   1054  O  O     . THR A  1 162 ? 93.877  89.234  -20.925 1.00 28.27 ? 190  THR A O     1 
ATOM   1055  C  CB    . THR A  1 162 ? 94.241  87.187  -18.526 1.00 28.78 ? 190  THR A CB    1 
ATOM   1056  O  OG1   . THR A  1 162 ? 95.043  86.457  -17.579 1.00 28.89 ? 190  THR A OG1   1 
ATOM   1057  C  CG2   . THR A  1 162 ? 92.955  86.412  -18.792 1.00 27.95 ? 190  THR A CG2   1 
ATOM   1058  N  N     . ARG A  1 163 ? 93.845  87.213  -21.964 1.00 29.05 ? 191  ARG A N     1 
ATOM   1059  C  CA    . ARG A  1 163 ? 93.082  87.628  -23.154 1.00 29.66 ? 191  ARG A CA    1 
ATOM   1060  C  C     . ARG A  1 163 ? 91.654  87.126  -23.141 1.00 28.98 ? 191  ARG A C     1 
ATOM   1061  O  O     . ARG A  1 163 ? 91.383  86.044  -22.629 1.00 28.01 ? 191  ARG A O     1 
ATOM   1062  C  CB    . ARG A  1 163 ? 93.705  87.037  -24.418 1.00 30.31 ? 191  ARG A CB    1 
ATOM   1063  C  CG    . ARG A  1 163 ? 95.022  87.648  -24.782 1.00 33.81 ? 191  ARG A CG    1 
ATOM   1064  C  CD    . ARG A  1 163 ? 95.555  87.068  -26.071 1.00 38.43 ? 191  ARG A CD    1 
ATOM   1065  N  NE    . ARG A  1 163 ? 94.768  87.467  -27.238 1.00 40.23 ? 191  ARG A NE    1 
ATOM   1066  C  CZ    . ARG A  1 163 ? 95.218  87.422  -28.489 1.00 42.36 ? 191  ARG A CZ    1 
ATOM   1067  N  NH1   . ARG A  1 163 ? 96.457  87.001  -28.745 1.00 44.09 ? 191  ARG A NH1   1 
ATOM   1068  N  NH2   . ARG A  1 163 ? 94.431  87.801  -29.493 1.00 42.50 ? 191  ARG A NH2   1 
ATOM   1069  N  N     . ALA A  1 164 ? 90.762  87.908  -23.748 1.00 28.56 ? 192  ALA A N     1 
ATOM   1070  C  CA    . ALA A  1 164 ? 89.401  87.479  -24.025 1.00 28.72 ? 192  ALA A CA    1 
ATOM   1071  C  C     . ALA A  1 164 ? 89.169  87.630  -25.522 1.00 28.76 ? 192  ALA A C     1 
ATOM   1072  O  O     . ALA A  1 164 ? 89.199  88.741  -26.038 1.00 28.34 ? 192  ALA A O     1 
ATOM   1073  C  CB    . ALA A  1 164 ? 88.400  88.316  -23.242 1.00 28.62 ? 192  ALA A CB    1 
ATOM   1074  N  N     . ASP A  1 165 ? 88.965  86.508  -26.209 1.00 29.33 ? 193  ASP A N     1 
ATOM   1075  C  CA    . ASP A  1 165 ? 88.718  86.496  -27.654 1.00 29.80 ? 193  ASP A CA    1 
ATOM   1076  C  C     . ASP A  1 165 ? 87.249  86.248  -27.950 1.00 30.07 ? 193  ASP A C     1 
ATOM   1077  O  O     . ASP A  1 165 ? 86.670  85.274  -27.460 1.00 29.68 ? 193  ASP A O     1 
ATOM   1078  C  CB    . ASP A  1 165 ? 89.542  85.398  -28.331 1.00 30.09 ? 193  ASP A CB    1 
ATOM   1079  C  CG    . ASP A  1 165 ? 91.031  85.669  -28.285 1.00 30.88 ? 193  ASP A CG    1 
ATOM   1080  O  OD1   . ASP A  1 165 ? 91.441  86.820  -28.527 1.00 32.95 ? 193  ASP A OD1   1 
ATOM   1081  O  OD2   . ASP A  1 165 ? 91.797  84.725  -28.013 1.00 33.86 ? 193  ASP A OD2   1 
ATOM   1082  N  N     . LYS A  1 166 ? 86.659  87.120  -28.770 1.00 30.36 ? 194  LYS A N     1 
ATOM   1083  C  CA    . LYS A  1 166 ? 85.260  86.988  -29.154 1.00 30.71 ? 194  LYS A CA    1 
ATOM   1084  C  C     . LYS A  1 166 ? 85.092  85.780  -30.071 1.00 30.81 ? 194  LYS A C     1 
ATOM   1085  O  O     . LYS A  1 166 ? 85.844  85.600  -31.032 1.00 30.73 ? 194  LYS A O     1 
ATOM   1086  C  CB    . LYS A  1 166 ? 84.734  88.257  -29.844 1.00 30.71 ? 194  LYS A CB    1 
ATOM   1087  C  CG    . LYS A  1 166 ? 83.211  88.402  -29.786 1.00 30.80 ? 194  LYS A CG    1 
ATOM   1088  C  CD    . LYS A  1 166 ? 82.689  89.428  -30.789 1.00 31.26 ? 194  LYS A CD    1 
ATOM   1089  N  N     . GLU A  1 167 ? 84.110  84.950  -29.741 1.00 31.12 ? 195  GLU A N     1 
ATOM   1090  C  CA    . GLU A  1 167 ? 83.745  83.798  -30.551 1.00 31.18 ? 195  GLU A CA    1 
ATOM   1091  C  C     . GLU A  1 167 ? 82.223  83.695  -30.534 1.00 31.51 ? 195  GLU A C     1 
ATOM   1092  O  O     . GLU A  1 167 ? 81.642  83.073  -29.636 1.00 32.02 ? 195  GLU A O     1 
ATOM   1093  C  CB    . GLU A  1 167 ? 84.393  82.529  -29.988 1.00 31.02 ? 195  GLU A CB    1 
ATOM   1094  N  N     . GLY A  1 168 ? 81.580  84.323  -31.519 1.00 31.52 ? 196  GLY A N     1 
ATOM   1095  C  CA    . GLY A  1 168 ? 80.124  84.443  -31.547 1.00 31.45 ? 196  GLY A CA    1 
ATOM   1096  C  C     . GLY A  1 168 ? 79.597  85.318  -30.419 1.00 31.40 ? 196  GLY A C     1 
ATOM   1097  O  O     . GLY A  1 168 ? 80.107  86.420  -30.187 1.00 31.86 ? 196  GLY A O     1 
ATOM   1098  N  N     . ASP A  1 169 ? 78.594  84.816  -29.700 1.00 31.21 ? 197  ASP A N     1 
ATOM   1099  C  CA    . ASP A  1 169 ? 78.007  85.526  -28.558 1.00 31.19 ? 197  ASP A CA    1 
ATOM   1100  C  C     . ASP A  1 169 ? 78.765  85.251  -27.235 1.00 31.11 ? 197  ASP A C     1 
ATOM   1101  O  O     . ASP A  1 169 ? 78.219  85.467  -26.154 1.00 30.70 ? 197  ASP A O     1 
ATOM   1102  C  CB    . ASP A  1 169 ? 76.518  85.148  -28.409 1.00 31.35 ? 197  ASP A CB    1 
ATOM   1103  C  CG    . ASP A  1 169 ? 75.635  85.740  -29.513 1.00 31.74 ? 197  ASP A CG    1 
ATOM   1104  O  OD1   . ASP A  1 169 ? 75.965  86.822  -30.054 1.00 32.39 ? 197  ASP A OD1   1 
ATOM   1105  O  OD2   . ASP A  1 169 ? 74.593  85.128  -29.828 1.00 32.36 ? 197  ASP A OD2   1 
ATOM   1106  N  N     . TYR A  1 170 ? 80.012  84.785  -27.332 1.00 31.05 ? 198  TYR A N     1 
ATOM   1107  C  CA    . TYR A  1 170 ? 80.826  84.443  -26.162 1.00 31.19 ? 198  TYR A CA    1 
ATOM   1108  C  C     . TYR A  1 170 ? 82.227  85.041  -26.262 1.00 30.72 ? 198  TYR A C     1 
ATOM   1109  O  O     . TYR A  1 170 ? 82.662  85.468  -27.334 1.00 30.28 ? 198  TYR A O     1 
ATOM   1110  C  CB    . TYR A  1 170 ? 80.945  82.919  -26.003 1.00 31.69 ? 198  TYR A CB    1 
ATOM   1111  C  CG    . TYR A  1 170 ? 79.615  82.198  -25.948 1.00 33.01 ? 198  TYR A CG    1 
ATOM   1112  C  CD1   . TYR A  1 170 ? 79.036  81.838  -24.728 1.00 33.83 ? 198  TYR A CD1   1 
ATOM   1113  C  CD2   . TYR A  1 170 ? 78.935  81.867  -27.118 1.00 33.05 ? 198  TYR A CD2   1 
ATOM   1114  C  CE1   . TYR A  1 170 ? 77.800  81.171  -24.683 1.00 33.94 ? 198  TYR A CE1   1 
ATOM   1115  C  CE2   . TYR A  1 170 ? 77.711  81.207  -27.081 1.00 34.19 ? 198  TYR A CE2   1 
ATOM   1116  C  CZ    . TYR A  1 170 ? 77.152  80.860  -25.863 1.00 33.45 ? 198  TYR A CZ    1 
ATOM   1117  O  OH    . TYR A  1 170 ? 75.940  80.209  -25.850 1.00 34.32 ? 198  TYR A OH    1 
ATOM   1118  N  N     . TYR A  1 171 ? 82.916  85.068  -25.120 1.00 30.19 ? 199  TYR A N     1 
ATOM   1119  C  CA    . TYR A  1 171 ? 84.332  85.410  -25.041 1.00 29.81 ? 199  TYR A CA    1 
ATOM   1120  C  C     . TYR A  1 171 ? 85.112  84.239  -24.466 1.00 29.03 ? 199  TYR A C     1 
ATOM   1121  O  O     . TYR A  1 171 ? 84.675  83.601  -23.509 1.00 29.13 ? 199  TYR A O     1 
ATOM   1122  C  CB    . TYR A  1 171 ? 84.542  86.660  -24.184 1.00 29.99 ? 199  TYR A CB    1 
ATOM   1123  C  CG    . TYR A  1 171 ? 84.267  87.912  -24.963 1.00 30.17 ? 199  TYR A CG    1 
ATOM   1124  C  CD1   . TYR A  1 171 ? 85.297  88.588  -25.610 1.00 29.61 ? 199  TYR A CD1   1 
ATOM   1125  C  CD2   . TYR A  1 171 ? 82.972  88.400  -25.090 1.00 29.65 ? 199  TYR A CD2   1 
ATOM   1126  C  CE1   . TYR A  1 171 ? 85.050  89.732  -26.346 1.00 30.31 ? 199  TYR A CE1   1 
ATOM   1127  C  CE2   . TYR A  1 171 ? 82.710  89.542  -25.835 1.00 30.54 ? 199  TYR A CE2   1 
ATOM   1128  C  CZ    . TYR A  1 171 ? 83.756  90.206  -26.455 1.00 30.74 ? 199  TYR A CZ    1 
ATOM   1129  O  OH    . TYR A  1 171 ? 83.509  91.340  -27.196 1.00 31.36 ? 199  TYR A OH    1 
ATOM   1130  N  N     . VAL A  1 172 ? 86.258  83.949  -25.069 1.00 28.22 ? 200  VAL A N     1 
ATOM   1131  C  CA    . VAL A  1 172 ? 87.092  82.828  -24.648 1.00 27.50 ? 200  VAL A CA    1 
ATOM   1132  C  C     . VAL A  1 172 ? 88.325  83.387  -23.952 1.00 26.92 ? 200  VAL A C     1 
ATOM   1133  O  O     . VAL A  1 172 ? 89.183  84.006  -24.583 1.00 26.79 ? 200  VAL A O     1 
ATOM   1134  C  CB    . VAL A  1 172 ? 87.495  81.944  -25.843 1.00 27.61 ? 200  VAL A CB    1 
ATOM   1135  C  CG1   . VAL A  1 172 ? 88.449  80.850  -25.404 1.00 27.78 ? 200  VAL A CG1   1 
ATOM   1136  C  CG2   . VAL A  1 172 ? 86.248  81.340  -26.495 1.00 26.85 ? 200  VAL A CG2   1 
ATOM   1137  N  N     . LEU A  1 173 ? 88.390  83.175  -22.642 1.00 26.37 ? 201  LEU A N     1 
ATOM   1138  C  CA    . LEU A  1 173 ? 89.475  83.708  -21.826 1.00 26.04 ? 201  LEU A CA    1 
ATOM   1139  C  C     . LEU A  1 173 ? 90.653  82.743  -21.769 1.00 25.76 ? 201  LEU A C     1 
ATOM   1140  O  O     . LEU A  1 173 ? 90.479  81.546  -21.512 1.00 25.43 ? 201  LEU A O     1 
ATOM   1141  C  CB    . LEU A  1 173 ? 88.994  84.024  -20.407 1.00 25.85 ? 201  LEU A CB    1 
ATOM   1142  C  CG    . LEU A  1 173 ? 88.328  85.385  -20.221 1.00 26.45 ? 201  LEU A CG    1 
ATOM   1143  C  CD1   . LEU A  1 173 ? 87.060  85.486  -21.054 1.00 26.40 ? 201  LEU A CD1   1 
ATOM   1144  C  CD2   . LEU A  1 173 ? 88.051  85.629  -18.739 1.00 26.32 ? 201  LEU A CD2   1 
ATOM   1145  N  N     . ASN A  1 174 ? 91.851  83.285  -21.989 1.00 25.72 ? 202  ASN A N     1 
ATOM   1146  C  CA    . ASN A  1 174 ? 93.099  82.535  -21.856 1.00 25.48 ? 202  ASN A CA    1 
ATOM   1147  C  C     . ASN A  1 174 ? 94.169  83.345  -21.139 1.00 25.80 ? 202  ASN A C     1 
ATOM   1148  O  O     . ASN A  1 174 ? 94.420  84.498  -21.485 1.00 25.63 ? 202  ASN A O     1 
ATOM   1149  C  CB    . ASN A  1 174 ? 93.621  82.108  -23.230 1.00 25.36 ? 202  ASN A CB    1 
ATOM   1150  C  CG    . ASN A  1 174 ? 92.979  80.829  -23.721 1.00 25.10 ? 202  ASN A CG    1 
ATOM   1151  O  OD1   . ASN A  1 174 ? 93.272  79.749  -23.213 1.00 25.51 ? 202  ASN A OD1   1 
ATOM   1152  N  ND2   . ASN A  1 174 ? 92.095  80.943  -24.703 1.00 22.77 ? 202  ASN A ND2   1 
ATOM   1153  N  N     . GLY A  1 175 ? 94.801  82.724  -20.147 1.00 26.03 ? 203  GLY A N     1 
ATOM   1154  C  CA    . GLY A  1 175 ? 95.869  83.356  -19.394 1.00 26.28 ? 203  GLY A CA    1 
ATOM   1155  C  C     . GLY A  1 175 ? 95.923  82.857  -17.964 1.00 26.52 ? 203  GLY A C     1 
ATOM   1156  O  O     . GLY A  1 175 ? 95.544  81.724  -17.653 1.00 26.57 ? 203  GLY A O     1 
ATOM   1157  N  N     . SER A  1 176 ? 96.392  83.718  -17.080 1.00 27.04 ? 204  SER A N     1 
ATOM   1158  C  CA    . SER A  1 176 ? 96.592  83.331  -15.700 1.00 27.26 ? 204  SER A CA    1 
ATOM   1159  C  C     . SER A  1 176 ? 96.496  84.548  -14.806 1.00 27.04 ? 204  SER A C     1 
ATOM   1160  O  O     . SER A  1 176 ? 96.646  85.678  -15.266 1.00 27.12 ? 204  SER A O     1 
ATOM   1161  C  CB    . SER A  1 176 ? 97.959  82.674  -15.558 1.00 27.74 ? 204  SER A CB    1 
ATOM   1162  O  OG    . SER A  1 176 ? 98.992  83.635  -15.736 1.00 29.30 ? 204  SER A OG    1 
ATOM   1163  N  N     . LYS A  1 177 ? 96.239  84.301  -13.527 1.00 26.77 ? 205  LYS A N     1 
ATOM   1164  C  CA    . LYS A  1 177 ? 96.242  85.332  -12.513 1.00 26.24 ? 205  LYS A CA    1 
ATOM   1165  C  C     . LYS A  1 177 ? 97.080  84.846  -11.348 1.00 26.50 ? 205  LYS A C     1 
ATOM   1166  O  O     . LYS A  1 177 ? 97.363  83.649  -11.220 1.00 26.19 ? 205  LYS A O     1 
ATOM   1167  C  CB    . LYS A  1 177 ? 94.818  85.666  -12.058 1.00 25.69 ? 205  LYS A CB    1 
ATOM   1168  C  CG    . LYS A  1 177 ? 93.944  86.292  -13.147 1.00 26.07 ? 205  LYS A CG    1 
ATOM   1169  C  CD    . LYS A  1 177 ? 94.429  87.676  -13.561 1.00 25.63 ? 205  LYS A CD    1 
ATOM   1170  C  CE    . LYS A  1 177 ? 93.544  88.288  -14.624 1.00 24.71 ? 205  LYS A CE    1 
ATOM   1171  N  NZ    . LYS A  1 177 ? 94.124  89.528  -15.242 1.00 24.91 ? 205  LYS A NZ    1 
ATOM   1172  N  N     . MET A  1 178 ? 97.501  85.799  -10.527 1.00 26.49 ? 206  MET A N     1 
ATOM   1173  C  CA    . MET A  1 178 ? 98.360  85.526  -9.391  1.00 26.63 ? 206  MET A CA    1 
ATOM   1174  C  C     . MET A  1 178 ? 97.832  86.342  -8.213  1.00 26.25 ? 206  MET A C     1 
ATOM   1175  O  O     . MET A  1 178 ? 97.266  87.430  -8.398  1.00 25.23 ? 206  MET A O     1 
ATOM   1176  C  CB    . MET A  1 178 ? 99.811  85.891  -9.749  1.00 27.38 ? 206  MET A CB    1 
ATOM   1177  C  CG    . MET A  1 178 ? 100.889 85.479  -8.734  1.00 29.45 ? 206  MET A CG    1 
ATOM   1178  S  SD    . MET A  1 178 ? 100.993 83.692  -8.480  1.00 36.49 ? 206  MET A SD    1 
ATOM   1179  C  CE    . MET A  1 178 ? 101.933 83.234  -9.921  1.00 33.46 ? 206  MET A CE    1 
ATOM   1180  N  N     . TRP A  1 179 ? 97.990  85.784  -7.011  1.00 26.08 ? 207  TRP A N     1 
ATOM   1181  C  CA    . TRP A  1 179 ? 97.723  86.482  -5.742  1.00 26.06 ? 207  TRP A CA    1 
ATOM   1182  C  C     . TRP A  1 179 ? 96.241  86.655  -5.441  1.00 25.24 ? 207  TRP A C     1 
ATOM   1183  O  O     . TRP A  1 179 ? 95.868  87.585  -4.750  1.00 26.24 ? 207  TRP A O     1 
ATOM   1184  C  CB    . TRP A  1 179 ? 98.396  87.867  -5.673  1.00 26.19 ? 207  TRP A CB    1 
ATOM   1185  C  CG    . TRP A  1 179 ? 99.818  87.894  -6.076  1.00 26.88 ? 207  TRP A CG    1 
ATOM   1186  C  CD1   . TRP A  1 179 ? 100.357 88.558  -7.142  1.00 26.63 ? 207  TRP A CD1   1 
ATOM   1187  C  CD2   . TRP A  1 179 ? 100.903 87.234  -5.420  1.00 26.96 ? 207  TRP A CD2   1 
ATOM   1188  N  NE1   . TRP A  1 179 ? 101.709 88.332  -7.205  1.00 26.52 ? 207  TRP A NE1   1 
ATOM   1189  C  CE2   . TRP A  1 179 ? 102.075 87.521  -6.164  1.00 27.43 ? 207  TRP A CE2   1 
ATOM   1190  C  CE3   . TRP A  1 179 ? 100.999 86.416  -4.291  1.00 26.72 ? 207  TRP A CE3   1 
ATOM   1191  C  CZ2   . TRP A  1 179 ? 103.331 87.029  -5.804  1.00 27.09 ? 207  TRP A CZ2   1 
ATOM   1192  C  CZ3   . TRP A  1 179 ? 102.257 85.929  -3.922  1.00 27.24 ? 207  TRP A CZ3   1 
ATOM   1193  C  CH2   . TRP A  1 179 ? 103.403 86.227  -4.688  1.00 27.30 ? 207  TRP A CH2   1 
ATOM   1194  N  N     . ILE A  1 180 ? 95.395  85.751  -5.905  1.00 25.47 ? 208  ILE A N     1 
ATOM   1195  C  CA    . ILE A  1 180 ? 93.955  85.984  -5.799  1.00 24.78 ? 208  ILE A CA    1 
ATOM   1196  C  C     . ILE A  1 180 ? 93.435  85.563  -4.431  1.00 24.58 ? 208  ILE A C     1 
ATOM   1197  O  O     . ILE A  1 180 ? 93.406  84.376  -4.095  1.00 23.52 ? 208  ILE A O     1 
ATOM   1198  C  CB    . ILE A  1 180 ? 93.160  85.271  -6.930  1.00 25.29 ? 208  ILE A CB    1 
ATOM   1199  C  CG1   . ILE A  1 180 ? 93.720  85.668  -8.307  1.00 25.19 ? 208  ILE A CG1   1 
ATOM   1200  C  CG2   . ILE A  1 180 ? 91.679  85.599  -6.815  1.00 23.50 ? 208  ILE A CG2   1 
ATOM   1201  C  CD1   . ILE A  1 180 ? 93.922  87.189  -8.500  1.00 24.53 ? 208  ILE A CD1   1 
ATOM   1202  N  N     . SER A  1 181 ? 93.014  86.560  -3.664  1.00 24.55 ? 209  SER A N     1 
ATOM   1203  C  CA    . SER A  1 181 ? 92.516  86.357  -2.331  1.00 25.02 ? 209  SER A CA    1 
ATOM   1204  C  C     . SER A  1 181 ? 91.122  85.729  -2.350  1.00 25.78 ? 209  SER A C     1 
ATOM   1205  O  O     . SER A  1 181 ? 90.299  86.026  -3.231  1.00 26.47 ? 209  SER A O     1 
ATOM   1206  C  CB    . SER A  1 181 ? 92.520  87.671  -1.542  1.00 25.11 ? 209  SER A CB    1 
ATOM   1207  O  OG    . SER A  1 181 ? 93.836  88.199  -1.425  1.00 24.96 ? 209  SER A OG    1 
ATOM   1208  N  N     . SER A  1 182 ? 90.896  84.830  -1.391  1.00 26.08 ? 210  SER A N     1 
ATOM   1209  C  CA    . SER A  1 182 ? 89.620  84.131  -1.199  1.00 26.76 ? 210  SER A CA    1 
ATOM   1210  C  C     . SER A  1 182 ? 89.281  83.095  -2.286  1.00 27.24 ? 210  SER A C     1 
ATOM   1211  O  O     . SER A  1 182 ? 88.167  82.566  -2.304  1.00 27.61 ? 210  SER A O     1 
ATOM   1212  C  CB    . SER A  1 182 ? 88.472  85.135  -1.020  1.00 26.75 ? 210  SER A CB    1 
ATOM   1213  O  OG    . SER A  1 182 ? 88.813  86.174  -0.101  1.00 26.40 ? 210  SER A OG    1 
ATOM   1214  N  N     . ALA A  1 183 ? 90.245  82.770  -3.150  1.00 28.17 ? 211  ALA A N     1 
ATOM   1215  C  CA    . ALA A  1 183 ? 89.993  81.908  -4.316  1.00 29.10 ? 211  ALA A CA    1 
ATOM   1216  C  C     . ALA A  1 183 ? 89.554  80.496  -3.923  1.00 29.93 ? 211  ALA A C     1 
ATOM   1217  O  O     . ALA A  1 183 ? 88.733  79.893  -4.599  1.00 29.30 ? 211  ALA A O     1 
ATOM   1218  C  CB    . ALA A  1 183 ? 91.217  81.836  -5.205  1.00 28.99 ? 211  ALA A CB    1 
ATOM   1219  N  N     . GLU A  1 184 ? 90.113  79.979  -2.834  1.00 30.74 ? 212  GLU A N     1 
ATOM   1220  C  CA    . GLU A  1 184 ? 89.774  78.638  -2.345  1.00 32.14 ? 212  GLU A CA    1 
ATOM   1221  C  C     . GLU A  1 184 ? 88.258  78.487  -2.075  1.00 31.95 ? 212  GLU A C     1 
ATOM   1222  O  O     . GLU A  1 184 ? 87.681  77.423  -2.276  1.00 31.50 ? 212  GLU A O     1 
ATOM   1223  C  CB    . GLU A  1 184 ? 90.597  78.360  -1.079  1.00 31.93 ? 212  GLU A CB    1 
ATOM   1224  C  CG    . GLU A  1 184 ? 91.016  76.933  -0.858  1.00 34.43 ? 212  GLU A CG    1 
ATOM   1225  C  CD    . GLU A  1 184 ? 91.925  76.801  0.358   1.00 34.66 ? 212  GLU A CD    1 
ATOM   1226  O  OE1   . GLU A  1 184 ? 92.878  77.601  0.478   1.00 38.67 ? 212  GLU A OE1   1 
ATOM   1227  O  OE2   . GLU A  1 184 ? 91.684  75.909  1.197   1.00 39.57 ? 212  GLU A OE2   1 
ATOM   1228  N  N     . HIS A  1 185 ? 87.613  79.569  -1.643  1.00 32.70 ? 213  HIS A N     1 
ATOM   1229  C  CA    . HIS A  1 185 ? 86.182  79.543  -1.298  1.00 33.05 ? 213  HIS A CA    1 
ATOM   1230  C  C     . HIS A  1 185 ? 85.262  80.220  -2.316  1.00 32.16 ? 213  HIS A C     1 
ATOM   1231  O  O     . HIS A  1 185 ? 84.048  79.971  -2.313  1.00 32.46 ? 213  HIS A O     1 
ATOM   1232  C  CB    . HIS A  1 185 ? 85.991  80.174  0.091   1.00 34.00 ? 213  HIS A CB    1 
ATOM   1233  C  CG    . HIS A  1 185 ? 86.377  79.257  1.209   1.00 35.81 ? 213  HIS A CG    1 
ATOM   1234  N  ND1   . HIS A  1 185 ? 87.563  79.380  1.902   1.00 38.05 ? 213  HIS A ND1   1 
ATOM   1235  C  CD2   . HIS A  1 185 ? 85.753  78.167  1.717   1.00 37.29 ? 213  HIS A CD2   1 
ATOM   1236  C  CE1   . HIS A  1 185 ? 87.638  78.424  2.812   1.00 38.46 ? 213  HIS A CE1   1 
ATOM   1237  N  NE2   . HIS A  1 185 ? 86.555  77.672  2.719   1.00 38.62 ? 213  HIS A NE2   1 
ATOM   1238  N  N     . ALA A  1 186 ? 85.836  81.045  -3.195  1.00 31.06 ? 214  ALA A N     1 
ATOM   1239  C  CA    . ALA A  1 186 ? 85.056  81.877  -4.125  1.00 30.26 ? 214  ALA A CA    1 
ATOM   1240  C  C     . ALA A  1 186 ? 84.166  81.079  -5.091  1.00 29.27 ? 214  ALA A C     1 
ATOM   1241  O  O     . ALA A  1 186 ? 84.613  80.129  -5.728  1.00 28.58 ? 214  ALA A O     1 
ATOM   1242  C  CB    . ALA A  1 186 ? 85.989  82.824  -4.918  1.00 29.47 ? 214  ALA A CB    1 
ATOM   1243  N  N     . GLY A  1 187 ? 82.896  81.469  -5.176  1.00 29.03 ? 215  GLY A N     1 
ATOM   1244  C  CA    . GLY A  1 187 ? 81.992  80.970  -6.210  1.00 28.25 ? 215  GLY A CA    1 
ATOM   1245  C  C     . GLY A  1 187 ? 81.961  81.881  -7.437  1.00 28.12 ? 215  GLY A C     1 
ATOM   1246  O  O     . GLY A  1 187 ? 81.575  81.452  -8.521  1.00 27.30 ? 215  GLY A O     1 
ATOM   1247  N  N     . LEU A  1 188 ? 82.371  83.143  -7.264  1.00 27.60 ? 216  LEU A N     1 
ATOM   1248  C  CA    . LEU A  1 188 ? 82.362  84.125  -8.348  1.00 27.56 ? 216  LEU A CA    1 
ATOM   1249  C  C     . LEU A  1 188 ? 83.730  84.786  -8.475  1.00 27.03 ? 216  LEU A C     1 
ATOM   1250  O  O     . LEU A  1 188 ? 84.296  85.248  -7.486  1.00 26.20 ? 216  LEU A O     1 
ATOM   1251  C  CB    . LEU A  1 188 ? 81.313  85.209  -8.085  1.00 27.63 ? 216  LEU A CB    1 
ATOM   1252  C  CG    . LEU A  1 188 ? 81.184  86.353  -9.106  1.00 27.87 ? 216  LEU A CG    1 
ATOM   1253  C  CD1   . LEU A  1 188 ? 80.703  85.853  -10.481 1.00 26.97 ? 216  LEU A CD1   1 
ATOM   1254  C  CD2   . LEU A  1 188 ? 80.225  87.413  -8.572  1.00 28.68 ? 216  LEU A CD2   1 
ATOM   1255  N  N     . PHE A  1 189 ? 84.234  84.837  -9.705  1.00 26.47 ? 217  PHE A N     1 
ATOM   1256  C  CA    . PHE A  1 189 ? 85.530  85.423  -10.008 1.00 26.33 ? 217  PHE A CA    1 
ATOM   1257  C  C     . PHE A  1 189 ? 85.329  86.618  -10.935 1.00 26.44 ? 217  PHE A C     1 
ATOM   1258  O  O     . PHE A  1 189 ? 84.796  86.468  -12.034 1.00 26.78 ? 217  PHE A O     1 
ATOM   1259  C  CB    . PHE A  1 189 ? 86.425  84.364  -10.665 1.00 26.21 ? 217  PHE A CB    1 
ATOM   1260  C  CG    . PHE A  1 189 ? 86.837  83.260  -9.724  1.00 25.50 ? 217  PHE A CG    1 
ATOM   1261  C  CD1   . PHE A  1 189 ? 88.046  83.335  -9.036  1.00 26.93 ? 217  PHE A CD1   1 
ATOM   1262  C  CD2   . PHE A  1 189 ? 86.003  82.173  -9.494  1.00 26.28 ? 217  PHE A CD2   1 
ATOM   1263  C  CE1   . PHE A  1 189 ? 88.424  82.340  -8.151  1.00 26.18 ? 217  PHE A CE1   1 
ATOM   1264  C  CE2   . PHE A  1 189 ? 86.377  81.167  -8.612  1.00 26.48 ? 217  PHE A CE2   1 
ATOM   1265  C  CZ    . PHE A  1 189 ? 87.599  81.258  -7.940  1.00 26.41 ? 217  PHE A CZ    1 
ATOM   1266  N  N     . LEU A  1 190 ? 85.714  87.808  -10.476 1.00 26.64 ? 218  LEU A N     1 
ATOM   1267  C  CA    . LEU A  1 190 ? 85.653  89.004  -11.321 1.00 26.55 ? 218  LEU A CA    1 
ATOM   1268  C  C     . LEU A  1 190 ? 87.010  89.145  -11.976 1.00 25.99 ? 218  LEU A C     1 
ATOM   1269  O  O     . LEU A  1 190 ? 87.985  89.507  -11.320 1.00 25.79 ? 218  LEU A O     1 
ATOM   1270  C  CB    . LEU A  1 190 ? 85.308  90.249  -10.529 1.00 26.71 ? 218  LEU A CB    1 
ATOM   1271  C  CG    . LEU A  1 190 ? 83.851  90.556  -10.225 1.00 28.15 ? 218  LEU A CG    1 
ATOM   1272  C  CD1   . LEU A  1 190 ? 83.198  89.414  -9.462  1.00 30.06 ? 218  LEU A CD1   1 
ATOM   1273  C  CD2   . LEU A  1 190 ? 83.771  91.863  -9.440  1.00 28.90 ? 218  LEU A CD2   1 
ATOM   1274  N  N     . VAL A  1 191 ? 87.060  88.828  -13.267 1.00 25.66 ? 219  VAL A N     1 
ATOM   1275  C  CA    . VAL A  1 191 ? 88.314  88.667  -13.975 1.00 25.23 ? 219  VAL A CA    1 
ATOM   1276  C  C     . VAL A  1 191 ? 88.530  89.808  -14.953 1.00 25.28 ? 219  VAL A C     1 
ATOM   1277  O  O     . VAL A  1 191 ? 87.689  90.080  -15.811 1.00 24.23 ? 219  VAL A O     1 
ATOM   1278  C  CB    . VAL A  1 191 ? 88.344  87.323  -14.729 1.00 25.39 ? 219  VAL A CB    1 
ATOM   1279  C  CG1   . VAL A  1 191 ? 89.720  87.075  -15.337 1.00 24.61 ? 219  VAL A CG1   1 
ATOM   1280  C  CG2   . VAL A  1 191 ? 87.937  86.180  -13.788 1.00 25.38 ? 219  VAL A CG2   1 
ATOM   1281  N  N     . MET A  1 192 ? 89.673  90.471  -14.814 1.00 25.09 ? 220  MET A N     1 
ATOM   1282  C  CA    . MET A  1 192 ? 90.093  91.479  -15.774 1.00 25.79 ? 220  MET A CA    1 
ATOM   1283  C  C     . MET A  1 192 ? 90.940  90.815  -16.866 1.00 25.47 ? 220  MET A C     1 
ATOM   1284  O  O     . MET A  1 192 ? 91.961  90.196  -16.591 1.00 25.33 ? 220  MET A O     1 
ATOM   1285  C  CB    . MET A  1 192 ? 90.853  92.624  -15.074 1.00 25.97 ? 220  MET A CB    1 
ATOM   1286  C  CG    . MET A  1 192 ? 89.955  93.805  -14.649 1.00 27.55 ? 220  MET A CG    1 
ATOM   1287  S  SD    . MET A  1 192 ? 88.591  93.341  -13.560 1.00 31.36 ? 220  MET A SD    1 
ATOM   1288  C  CE    . MET A  1 192 ? 89.460  92.879  -12.063 1.00 30.35 ? 220  MET A CE    1 
ATOM   1289  N  N     . ALA A  1 193 ? 90.475  90.946  -18.105 1.00 26.02 ? 221  ALA A N     1 
ATOM   1290  C  CA    . ALA A  1 193 ? 91.103  90.353  -19.280 1.00 26.16 ? 221  ALA A CA    1 
ATOM   1291  C  C     . ALA A  1 193 ? 91.053  91.383  -20.399 1.00 26.52 ? 221  ALA A C     1 
ATOM   1292  O  O     . ALA A  1 193 ? 90.174  92.243  -20.408 1.00 26.33 ? 221  ALA A O     1 
ATOM   1293  C  CB    . ALA A  1 193 ? 90.356  89.076  -19.698 1.00 26.03 ? 221  ALA A CB    1 
ATOM   1294  N  N     . ASN A  1 194 ? 92.001  91.307  -21.324 1.00 27.00 ? 222  ASN A N     1 
ATOM   1295  C  CA    . ASN A  1 194 ? 92.082  92.270  -22.417 1.00 27.51 ? 222  ASN A CA    1 
ATOM   1296  C  C     . ASN A  1 194 ? 91.453  91.711  -23.707 1.00 27.95 ? 222  ASN A C     1 
ATOM   1297  O  O     . ASN A  1 194 ? 91.888  90.682  -24.234 1.00 27.67 ? 222  ASN A O     1 
ATOM   1298  C  CB    . ASN A  1 194 ? 93.535  92.689  -22.648 1.00 27.74 ? 222  ASN A CB    1 
ATOM   1299  C  CG    . ASN A  1 194 ? 93.647  94.014  -23.383 1.00 27.85 ? 222  ASN A CG    1 
ATOM   1300  O  OD1   . ASN A  1 194 ? 92.905  94.267  -24.325 1.00 28.08 ? 222  ASN A OD1   1 
ATOM   1301  N  ND2   . ASN A  1 194 ? 94.574  94.862  -22.952 1.00 28.34 ? 222  ASN A ND2   1 
ATOM   1302  N  N     . VAL A  1 195 ? 90.426  92.394  -24.207 1.00 28.34 ? 223  VAL A N     1 
ATOM   1303  C  CA    . VAL A  1 195 ? 89.734  91.948  -25.419 1.00 29.04 ? 223  VAL A CA    1 
ATOM   1304  C  C     . VAL A  1 195 ? 90.448  92.394  -26.702 1.00 30.05 ? 223  VAL A C     1 
ATOM   1305  O  O     . VAL A  1 195 ? 90.152  91.895  -27.791 1.00 29.46 ? 223  VAL A O     1 
ATOM   1306  C  CB    . VAL A  1 195 ? 88.256  92.400  -25.449 1.00 28.77 ? 223  VAL A CB    1 
ATOM   1307  C  CG1   . VAL A  1 195 ? 87.523  91.857  -24.243 1.00 27.52 ? 223  VAL A CG1   1 
ATOM   1308  C  CG2   . VAL A  1 195 ? 88.148  93.927  -25.535 1.00 29.03 ? 223  VAL A CG2   1 
ATOM   1309  N  N     . ASP A  1 196 ? 91.379  93.335  -26.566 1.00 31.31 ? 224  ASP A N     1 
ATOM   1310  C  CA    . ASP A  1 196 ? 92.176  93.810  -27.691 1.00 32.42 ? 224  ASP A CA    1 
ATOM   1311  C  C     . ASP A  1 196 ? 93.506  94.367  -27.186 1.00 33.05 ? 224  ASP A C     1 
ATOM   1312  O  O     . ASP A  1 196 ? 93.609  95.565  -26.901 1.00 32.77 ? 224  ASP A O     1 
ATOM   1313  C  CB    . ASP A  1 196 ? 91.424  94.884  -28.484 1.00 32.59 ? 224  ASP A CB    1 
ATOM   1314  C  CG    . ASP A  1 196 ? 92.173  95.314  -29.746 1.00 33.57 ? 224  ASP A CG    1 
ATOM   1315  O  OD1   . ASP A  1 196 ? 93.211  94.692  -30.074 1.00 33.92 ? 224  ASP A OD1   1 
ATOM   1316  O  OD2   . ASP A  1 196 ? 91.716  96.274  -30.412 1.00 34.91 ? 224  ASP A OD2   1 
ATOM   1317  N  N     . PRO A  1 197 ? 94.524  93.493  -27.066 1.00 34.17 ? 225  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1 197 ? 95.819  93.898  -26.519 1.00 35.08 ? 225  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1 197 ? 96.544  94.982  -27.321 1.00 35.92 ? 225  PRO A C     1 
ATOM   1320  O  O     . PRO A  1 197 ? 97.412  95.650  -26.767 1.00 36.50 ? 225  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1 197 ? 96.630  92.595  -26.516 1.00 35.06 ? 225  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1 197 ? 95.616  91.499  -26.618 1.00 34.93 ? 225  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1 197 ? 94.507  92.062  -27.425 1.00 34.20 ? 225  PRO A CD    1 
ATOM   1324  N  N     . THR A  1 198 ? 96.178  95.177  -28.588 1.00 36.76 ? 226  THR A N     1 
ATOM   1325  C  CA    . THR A  1 198 ? 96.822  96.203  -29.422 1.00 37.41 ? 226  THR A CA    1 
ATOM   1326  C  C     . THR A  1 198 ? 96.419  97.638  -29.040 1.00 37.37 ? 226  THR A C     1 
ATOM   1327  O  O     . THR A  1 198 ? 97.081  98.590  -29.457 1.00 37.56 ? 226  THR A O     1 
ATOM   1328  C  CB    . THR A  1 198 ? 96.566  95.992  -30.942 1.00 37.38 ? 226  THR A CB    1 
ATOM   1329  O  OG1   . THR A  1 198 ? 95.245  96.434  -31.293 1.00 38.41 ? 226  THR A OG1   1 
ATOM   1330  C  CG2   . THR A  1 198 ? 96.756  94.529  -31.340 1.00 37.64 ? 226  THR A CG2   1 
ATOM   1331  N  N     . ILE A  1 199 ? 95.346  97.803  -28.261 1.00 37.25 ? 227  ILE A N     1 
ATOM   1332  C  CA    . ILE A  1 199 ? 94.985  99.136  -27.753 1.00 36.95 ? 227  ILE A CA    1 
ATOM   1333  C  C     . ILE A  1 199 ? 95.331  99.312  -26.270 1.00 36.45 ? 227  ILE A C     1 
ATOM   1334  O  O     . ILE A  1 199 ? 94.857  100.246 -25.622 1.00 36.62 ? 227  ILE A O     1 
ATOM   1335  C  CB    . ILE A  1 199 ? 93.505  99.509  -28.044 1.00 37.00 ? 227  ILE A CB    1 
ATOM   1336  C  CG1   . ILE A  1 199 ? 92.525  98.655  -27.237 1.00 37.22 ? 227  ILE A CG1   1 
ATOM   1337  C  CG2   . ILE A  1 199 ? 93.225  99.378  -29.535 1.00 37.16 ? 227  ILE A CG2   1 
ATOM   1338  C  CD1   . ILE A  1 199 ? 91.076  99.111  -27.402 1.00 37.17 ? 227  ILE A CD1   1 
ATOM   1339  N  N     . GLY A  1 200 ? 96.179  98.424  -25.752 1.00 35.72 ? 228  GLY A N     1 
ATOM   1340  C  CA    . GLY A  1 200 ? 96.676  98.529  -24.390 1.00 35.26 ? 228  GLY A CA    1 
ATOM   1341  C  C     . GLY A  1 200 ? 95.592  98.476  -23.327 1.00 34.80 ? 228  GLY A C     1 
ATOM   1342  O  O     . GLY A  1 200 ? 94.679  97.647  -23.392 1.00 34.39 ? 228  GLY A O     1 
ATOM   1343  N  N     . TYR A  1 201 ? 95.689  99.377  -22.354 1.00 34.29 ? 229  TYR A N     1 
ATOM   1344  C  CA    . TYR A  1 201 ? 94.800  99.349  -21.194 1.00 34.13 ? 229  TYR A CA    1 
ATOM   1345  C  C     . TYR A  1 201 ? 93.331  99.561  -21.544 1.00 33.26 ? 229  TYR A C     1 
ATOM   1346  O  O     . TYR A  1 201 ? 92.455  99.079  -20.831 1.00 32.87 ? 229  TYR A O     1 
ATOM   1347  C  CB    . TYR A  1 201 ? 95.260  100.327 -20.093 1.00 34.54 ? 229  TYR A CB    1 
ATOM   1348  C  CG    . TYR A  1 201 ? 95.117  101.829 -20.349 1.00 35.37 ? 229  TYR A CG    1 
ATOM   1349  C  CD1   . TYR A  1 201 ? 93.891  102.484 -20.188 1.00 35.55 ? 229  TYR A CD1   1 
ATOM   1350  C  CD2   . TYR A  1 201 ? 96.236  102.610 -20.661 1.00 37.35 ? 229  TYR A CD2   1 
ATOM   1351  C  CE1   . TYR A  1 201 ? 93.770  103.869 -20.390 1.00 35.42 ? 229  TYR A CE1   1 
ATOM   1352  C  CE2   . TYR A  1 201 ? 96.132  103.994 -20.850 1.00 37.48 ? 229  TYR A CE2   1 
ATOM   1353  C  CZ    . TYR A  1 201 ? 94.898  104.616 -20.718 1.00 36.52 ? 229  TYR A CZ    1 
ATOM   1354  O  OH    . TYR A  1 201 ? 94.814  105.979 -20.906 1.00 36.55 ? 229  TYR A OH    1 
ATOM   1355  N  N     . LYS A  1 202 ? 93.067  100.257 -22.648 1.00 32.72 ? 230  LYS A N     1 
ATOM   1356  C  CA    . LYS A  1 202 ? 91.691  100.490 -23.108 1.00 32.44 ? 230  LYS A CA    1 
ATOM   1357  C  C     . LYS A  1 202 ? 90.976  99.226  -23.629 1.00 31.38 ? 230  LYS A C     1 
ATOM   1358  O  O     . LYS A  1 202 ? 89.788  99.276  -23.954 1.00 30.71 ? 230  LYS A O     1 
ATOM   1359  C  CB    . LYS A  1 202 ? 91.676  101.604 -24.168 1.00 32.71 ? 230  LYS A CB    1 
ATOM   1360  C  CG    . LYS A  1 202 ? 92.140  102.967 -23.619 1.00 33.22 ? 230  LYS A CG    1 
ATOM   1361  C  CD    . LYS A  1 202 ? 91.973  104.079 -24.657 1.00 34.33 ? 230  LYS A CD    1 
ATOM   1362  C  CE    . LYS A  1 202 ? 92.382  105.459 -24.127 1.00 35.85 ? 230  LYS A CE    1 
ATOM   1363  N  NZ    . LYS A  1 202 ? 91.567  105.877 -22.948 1.00 37.73 ? 230  LYS A NZ    1 
ATOM   1364  N  N     . GLY A  1 203 ? 91.680  98.097  -23.704 1.00 30.09 ? 231  GLY A N     1 
ATOM   1365  C  CA    . GLY A  1 203 ? 91.040  96.825  -24.046 1.00 29.46 ? 231  GLY A CA    1 
ATOM   1366  C  C     . GLY A  1 203 ? 90.612  96.001  -22.839 1.00 28.56 ? 231  GLY A C     1 
ATOM   1367  O  O     . GLY A  1 203 ? 89.933  94.978  -22.992 1.00 28.05 ? 231  GLY A O     1 
ATOM   1368  N  N     . ILE A  1 204 ? 90.999  96.450  -21.640 1.00 27.59 ? 232  ILE A N     1 
ATOM   1369  C  CA    . ILE A  1 204 ? 90.771  95.693  -20.417 1.00 26.78 ? 232  ILE A CA    1 
ATOM   1370  C  C     . ILE A  1 204 ? 89.303  95.731  -20.024 1.00 25.97 ? 232  ILE A C     1 
ATOM   1371  O  O     . ILE A  1 204 ? 88.682  96.791  -19.960 1.00 25.46 ? 232  ILE A O     1 
ATOM   1372  C  CB    . ILE A  1 204 ? 91.650  96.189  -19.243 1.00 26.84 ? 232  ILE A CB    1 
ATOM   1373  C  CG1   . ILE A  1 204 ? 93.124  95.918  -19.545 1.00 27.82 ? 232  ILE A CG1   1 
ATOM   1374  C  CG2   . ILE A  1 204 ? 91.279  95.483  -17.943 1.00 26.02 ? 232  ILE A CG2   1 
ATOM   1375  C  CD1   . ILE A  1 204 ? 94.091  96.544  -18.563 1.00 26.84 ? 232  ILE A CD1   1 
ATOM   1376  N  N     . THR A  1 205 ? 88.773  94.546  -19.756 1.00 25.51 ? 233  THR A N     1 
ATOM   1377  C  CA    . THR A  1 205 ? 87.348  94.321  -19.597 1.00 25.48 ? 233  THR A CA    1 
ATOM   1378  C  C     . THR A  1 205 ? 87.167  93.403  -18.380 1.00 25.50 ? 233  THR A C     1 
ATOM   1379  O  O     . THR A  1 205 ? 87.980  92.501  -18.155 1.00 24.40 ? 233  THR A O     1 
ATOM   1380  C  CB    . THR A  1 205 ? 86.755  93.699  -20.910 1.00 25.55 ? 233  THR A CB    1 
ATOM   1381  O  OG1   . THR A  1 205 ? 87.038  94.564  -22.024 1.00 25.11 ? 233  THR A OG1   1 
ATOM   1382  C  CG2   . THR A  1 205 ? 85.240  93.457  -20.818 1.00 24.76 ? 233  THR A CG2   1 
ATOM   1383  N  N     . SER A  1 206 ? 86.127  93.675  -17.587 1.00 25.69 ? 234  SER A N     1 
ATOM   1384  C  CA    . SER A  1 206 ? 85.781  92.880  -16.403 1.00 25.96 ? 234  SER A CA    1 
ATOM   1385  C  C     . SER A  1 206 ? 84.771  91.788  -16.790 1.00 25.63 ? 234  SER A C     1 
ATOM   1386  O  O     . SER A  1 206 ? 83.776  92.078  -17.440 1.00 25.10 ? 234  SER A O     1 
ATOM   1387  C  CB    . SER A  1 206 ? 85.153  93.771  -15.326 1.00 25.90 ? 234  SER A CB    1 
ATOM   1388  O  OG    . SER A  1 206 ? 85.967  94.896  -15.040 1.00 27.72 ? 234  SER A OG    1 
ATOM   1389  N  N     . PHE A  1 207 ? 85.032  90.550  -16.374 1.00 25.36 ? 235  PHE A N     1 
ATOM   1390  C  CA    . PHE A  1 207 ? 84.160  89.423  -16.663 1.00 25.56 ? 235  PHE A CA    1 
ATOM   1391  C  C     . PHE A  1 207 ? 83.702  88.746  -15.373 1.00 25.81 ? 235  PHE A C     1 
ATOM   1392  O  O     . PHE A  1 207 ? 84.499  88.547  -14.464 1.00 25.66 ? 235  PHE A O     1 
ATOM   1393  C  CB    . PHE A  1 207 ? 84.884  88.394  -17.535 1.00 25.38 ? 235  PHE A CB    1 
ATOM   1394  C  CG    . PHE A  1 207 ? 85.155  88.865  -18.927 1.00 25.40 ? 235  PHE A CG    1 
ATOM   1395  C  CD1   . PHE A  1 207 ? 84.198  88.709  -19.924 1.00 25.06 ? 235  PHE A CD1   1 
ATOM   1396  C  CD2   . PHE A  1 207 ? 86.364  89.457  -19.251 1.00 25.06 ? 235  PHE A CD2   1 
ATOM   1397  C  CE1   . PHE A  1 207 ? 84.451  89.144  -21.218 1.00 25.59 ? 235  PHE A CE1   1 
ATOM   1398  C  CE2   . PHE A  1 207 ? 86.614  89.898  -20.546 1.00 25.31 ? 235  PHE A CE2   1 
ATOM   1399  C  CZ    . PHE A  1 207 ? 85.663  89.738  -21.523 1.00 25.09 ? 235  PHE A CZ    1 
ATOM   1400  N  N     . LEU A  1 208 ? 82.418  88.398  -15.320 1.00 26.08 ? 236  LEU A N     1 
ATOM   1401  C  CA    . LEU A  1 208 ? 81.844  87.589  -14.248 1.00 26.51 ? 236  LEU A CA    1 
ATOM   1402  C  C     . LEU A  1 208 ? 81.955  86.108  -14.619 1.00 26.20 ? 236  LEU A C     1 
ATOM   1403  O  O     . LEU A  1 208 ? 81.296  85.644  -15.545 1.00 26.59 ? 236  LEU A O     1 
ATOM   1404  C  CB    . LEU A  1 208 ? 80.369  87.952  -14.022 1.00 26.81 ? 236  LEU A CB    1 
ATOM   1405  C  CG    . LEU A  1 208 ? 80.129  89.400  -13.589 1.00 27.94 ? 236  LEU A CG    1 
ATOM   1406  C  CD1   . LEU A  1 208 ? 78.678  89.792  -13.828 1.00 28.38 ? 236  LEU A CD1   1 
ATOM   1407  C  CD2   . LEU A  1 208 ? 80.535  89.606  -12.136 1.00 29.19 ? 236  LEU A CD2   1 
ATOM   1408  N  N     . VAL A  1 209 ? 82.780  85.375  -13.877 1.00 26.14 ? 237  VAL A N     1 
ATOM   1409  C  CA    . VAL A  1 209 ? 83.097  83.991  -14.185 1.00 26.22 ? 237  VAL A CA    1 
ATOM   1410  C  C     . VAL A  1 209 ? 82.763  83.099  -12.986 1.00 26.78 ? 237  VAL A C     1 
ATOM   1411  O  O     . VAL A  1 209 ? 83.307  83.291  -11.883 1.00 26.24 ? 237  VAL A O     1 
ATOM   1412  C  CB    . VAL A  1 209 ? 84.596  83.828  -14.537 1.00 25.98 ? 237  VAL A CB    1 
ATOM   1413  C  CG1   . VAL A  1 209 ? 84.894  82.385  -14.983 1.00 26.27 ? 237  VAL A CG1   1 
ATOM   1414  C  CG2   . VAL A  1 209 ? 85.003  84.827  -15.607 1.00 25.28 ? 237  VAL A CG2   1 
ATOM   1415  N  N     . ASP A  1 210 ? 81.882  82.127  -13.212 1.00 27.29 ? 238  ASP A N     1 
ATOM   1416  C  CA    . ASP A  1 210 ? 81.492  81.170  -12.172 1.00 28.34 ? 238  ASP A CA    1 
ATOM   1417  C  C     . ASP A  1 210 ? 82.632  80.194  -11.893 1.00 28.80 ? 238  ASP A C     1 
ATOM   1418  O  O     . ASP A  1 210 ? 83.354  79.810  -12.811 1.00 29.13 ? 238  ASP A O     1 
ATOM   1419  C  CB    . ASP A  1 210 ? 80.243  80.373  -12.584 1.00 28.32 ? 238  ASP A CB    1 
ATOM   1420  C  CG    . ASP A  1 210 ? 79.020  81.253  -12.810 1.00 29.27 ? 238  ASP A CG    1 
ATOM   1421  O  OD1   . ASP A  1 210 ? 79.005  82.408  -12.345 1.00 30.52 ? 238  ASP A OD1   1 
ATOM   1422  O  OD2   . ASP A  1 210 ? 78.057  80.776  -13.455 1.00 32.60 ? 238  ASP A OD2   1 
ATOM   1423  N  N     . ARG A  1 211 ? 82.772  79.785  -10.631 1.00 29.59 ? 239  ARG A N     1 
ATOM   1424  C  CA    . ARG A  1 211 ? 83.802  78.820  -10.226 1.00 30.10 ? 239  ARG A CA    1 
ATOM   1425  C  C     . ARG A  1 211 ? 83.800  77.557  -11.087 1.00 30.88 ? 239  ARG A C     1 
ATOM   1426  O  O     . ARG A  1 211 ? 84.859  77.065  -11.470 1.00 31.31 ? 239  ARG A O     1 
ATOM   1427  C  CB    . ARG A  1 211 ? 83.631  78.419  -8.755  1.00 30.07 ? 239  ARG A CB    1 
ATOM   1428  C  CG    . ARG A  1 211 ? 84.744  77.523  -8.210  1.00 29.87 ? 239  ARG A CG    1 
ATOM   1429  C  CD    . ARG A  1 211 ? 84.429  77.036  -6.801  1.00 30.03 ? 239  ARG A CD    1 
ATOM   1430  N  NE    . ARG A  1 211 ? 85.515  76.237  -6.233  1.00 30.65 ? 239  ARG A NE    1 
ATOM   1431  C  CZ    . ARG A  1 211 ? 86.571  76.716  -5.569  1.00 30.83 ? 239  ARG A CZ    1 
ATOM   1432  N  NH1   . ARG A  1 211 ? 86.739  78.016  -5.366  1.00 29.27 ? 239  ARG A NH1   1 
ATOM   1433  N  NH2   . ARG A  1 211 ? 87.482  75.870  -5.099  1.00 31.53 ? 239  ARG A NH2   1 
ATOM   1434  N  N     . ASP A  1 212 ? 82.617  77.035  -11.390 1.00 31.17 ? 240  ASP A N     1 
ATOM   1435  C  CA    . ASP A  1 212 ? 82.526  75.747  -12.082 1.00 32.40 ? 240  ASP A CA    1 
ATOM   1436  C  C     . ASP A  1 212 ? 82.520  75.852  -13.619 1.00 31.89 ? 240  ASP A C     1 
ATOM   1437  O  O     . ASP A  1 212 ? 82.052  74.955  -14.292 1.00 32.98 ? 240  ASP A O     1 
ATOM   1438  C  CB    . ASP A  1 212 ? 81.307  74.954  -11.575 1.00 32.62 ? 240  ASP A CB    1 
ATOM   1439  C  CG    . ASP A  1 212 ? 81.620  74.133  -10.322 1.00 34.70 ? 240  ASP A CG    1 
ATOM   1440  O  OD1   . ASP A  1 212 ? 82.563  74.479  -9.564  1.00 34.76 ? 240  ASP A OD1   1 
ATOM   1441  O  OD2   . ASP A  1 212 ? 80.913  73.113  -10.121 1.00 39.76 ? 240  ASP A OD2   1 
ATOM   1442  N  N     . THR A  1 213 ? 83.067  76.936  -14.164 1.00 31.60 ? 241  THR A N     1 
ATOM   1443  C  CA    . THR A  1 213 ? 83.260  77.060  -15.608 1.00 30.83 ? 241  THR A CA    1 
ATOM   1444  C  C     . THR A  1 213 ? 84.444  76.177  -16.022 1.00 30.37 ? 241  THR A C     1 
ATOM   1445  O  O     . THR A  1 213 ? 85.530  76.293  -15.433 1.00 30.28 ? 241  THR A O     1 
ATOM   1446  C  CB    . THR A  1 213 ? 83.544  78.529  -16.013 1.00 30.76 ? 241  THR A CB    1 
ATOM   1447  O  OG1   . THR A  1 213 ? 82.530  79.385  -15.464 1.00 30.54 ? 241  THR A OG1   1 
ATOM   1448  C  CG2   . THR A  1 213 ? 83.571  78.683  -17.532 1.00 30.91 ? 241  THR A CG2   1 
ATOM   1449  N  N     . PRO A  1 214 ? 84.240  75.276  -17.010 1.00 29.80 ? 242  PRO A N     1 
ATOM   1450  C  CA    . PRO A  1 214 ? 85.346  74.460  -17.522 1.00 29.44 ? 242  PRO A CA    1 
ATOM   1451  C  C     . PRO A  1 214 ? 86.534  75.295  -18.008 1.00 28.97 ? 242  PRO A C     1 
ATOM   1452  O  O     . PRO A  1 214 ? 86.343  76.320  -18.662 1.00 28.60 ? 242  PRO A O     1 
ATOM   1453  C  CB    . PRO A  1 214 ? 84.725  73.701  -18.699 1.00 29.50 ? 242  PRO A CB    1 
ATOM   1454  C  CG    . PRO A  1 214 ? 83.256  73.727  -18.476 1.00 29.92 ? 242  PRO A CG    1 
ATOM   1455  C  CD    . PRO A  1 214 ? 82.961  74.961  -17.672 1.00 29.84 ? 242  PRO A CD    1 
ATOM   1456  N  N     . GLY A  1 215 ? 87.747  74.855  -17.687 1.00 28.48 ? 243  GLY A N     1 
ATOM   1457  C  CA    . GLY A  1 215 ? 88.954  75.570  -18.094 1.00 28.45 ? 243  GLY A CA    1 
ATOM   1458  C  C     . GLY A  1 215 ? 89.531  76.514  -17.046 1.00 28.34 ? 243  GLY A C     1 
ATOM   1459  O  O     . GLY A  1 215 ? 90.641  77.014  -17.222 1.00 28.46 ? 243  GLY A O     1 
ATOM   1460  N  N     . LEU A  1 216 ? 88.779  76.783  -15.978 1.00 28.41 ? 244  LEU A N     1 
ATOM   1461  C  CA    . LEU A  1 216 ? 89.260  77.603  -14.855 1.00 28.58 ? 244  LEU A CA    1 
ATOM   1462  C  C     . LEU A  1 216 ? 89.830  76.688  -13.772 1.00 28.64 ? 244  LEU A C     1 
ATOM   1463  O  O     . LEU A  1 216 ? 89.118  75.823  -13.260 1.00 28.84 ? 244  LEU A O     1 
ATOM   1464  C  CB    . LEU A  1 216 ? 88.130  78.473  -14.278 1.00 28.73 ? 244  LEU A CB    1 
ATOM   1465  C  CG    . LEU A  1 216 ? 88.374  79.241  -12.957 1.00 28.43 ? 244  LEU A CG    1 
ATOM   1466  C  CD1   . LEU A  1 216 ? 89.625  80.128  -12.971 1.00 28.47 ? 244  LEU A CD1   1 
ATOM   1467  C  CD2   . LEU A  1 216 ? 87.141  80.072  -12.613 1.00 28.58 ? 244  LEU A CD2   1 
ATOM   1468  N  N     . HIS A  1 217 ? 91.109  76.871  -13.441 1.00 28.22 ? 245  HIS A N     1 
ATOM   1469  C  CA    . HIS A  1 217 ? 91.779  76.047  -12.431 1.00 28.39 ? 245  HIS A CA    1 
ATOM   1470  C  C     . HIS A  1 217 ? 92.328  76.931  -11.321 1.00 28.45 ? 245  HIS A C     1 
ATOM   1471  O  O     . HIS A  1 217 ? 92.987  77.941  -11.583 1.00 28.13 ? 245  HIS A O     1 
ATOM   1472  C  CB    A HIS A  1 217 ? 92.898  75.219  -13.074 0.50 28.39 ? 245  HIS A CB    1 
ATOM   1473  C  CB    B HIS A  1 217 ? 92.917  75.222  -13.044 0.50 28.40 ? 245  HIS A CB    1 
ATOM   1474  C  CG    A HIS A  1 217 ? 92.416  74.276  -14.137 0.50 28.49 ? 245  HIS A CG    1 
ATOM   1475  C  CG    B HIS A  1 217 ? 93.698  74.426  -12.040 0.50 28.50 ? 245  HIS A CG    1 
ATOM   1476  N  ND1   A HIS A  1 217 ? 92.476  74.573  -15.482 0.50 29.08 ? 245  HIS A ND1   1 
ATOM   1477  N  ND1   B HIS A  1 217 ? 93.242  73.236  -11.515 0.50 28.65 ? 245  HIS A ND1   1 
ATOM   1478  C  CD2   A HIS A  1 217 ? 91.853  73.049  -14.049 0.50 28.59 ? 245  HIS A CD2   1 
ATOM   1479  C  CD2   B HIS A  1 217 ? 94.901  74.656  -11.457 0.50 29.23 ? 245  HIS A CD2   1 
ATOM   1480  C  CE1   A HIS A  1 217 ? 91.977  73.567  -16.176 0.50 28.41 ? 245  HIS A CE1   1 
ATOM   1481  C  CE1   B HIS A  1 217 ? 94.129  72.765  -10.656 0.50 28.53 ? 245  HIS A CE1   1 
ATOM   1482  N  NE2   A HIS A  1 217 ? 91.590  72.629  -15.331 0.50 28.54 ? 245  HIS A NE2   1 
ATOM   1483  N  NE2   B HIS A  1 217 ? 95.146  73.606  -10.606 0.50 28.30 ? 245  HIS A NE2   1 
ATOM   1484  N  N     . ILE A  1 218 ? 92.038  76.549  -10.082 1.00 28.82 ? 246  ILE A N     1 
ATOM   1485  C  CA    . ILE A  1 218 ? 92.515  77.274  -8.909  1.00 29.33 ? 246  ILE A CA    1 
ATOM   1486  C  C     . ILE A  1 218 ? 93.691  76.512  -8.331  1.00 29.55 ? 246  ILE A C     1 
ATOM   1487  O  O     . ILE A  1 218 ? 93.538  75.368  -7.911  1.00 29.16 ? 246  ILE A O     1 
ATOM   1488  C  CB    . ILE A  1 218 ? 91.393  77.446  -7.866  1.00 29.59 ? 246  ILE A CB    1 
ATOM   1489  C  CG1   . ILE A  1 218 ? 90.175  78.109  -8.526  1.00 30.50 ? 246  ILE A CG1   1 
ATOM   1490  C  CG2   . ILE A  1 218 ? 91.890  78.294  -6.668  1.00 29.57 ? 246  ILE A CG2   1 
ATOM   1491  C  CD1   . ILE A  1 218 ? 88.920  78.072  -7.698  1.00 31.78 ? 246  ILE A CD1   1 
ATOM   1492  N  N     . GLY A  1 219 ? 94.865  77.143  -8.330  1.00 29.94 ? 247  GLY A N     1 
ATOM   1493  C  CA    . GLY A  1 219 ? 96.096  76.497  -7.864  1.00 30.59 ? 247  GLY A CA    1 
ATOM   1494  C  C     . GLY A  1 219 ? 96.232  76.428  -6.349  1.00 31.12 ? 247  GLY A C     1 
ATOM   1495  O  O     . GLY A  1 219 ? 95.341  76.860  -5.607  1.00 31.22 ? 247  GLY A O     1 
ATOM   1496  N  N     . LYS A  1 220 ? 97.365  75.896  -5.894  1.00 32.01 ? 248  LYS A N     1 
ATOM   1497  C  CA    . LYS A  1 220 ? 97.674  75.790  -4.460  1.00 32.23 ? 248  LYS A CA    1 
ATOM   1498  C  C     . LYS A  1 220 ? 97.832  77.154  -3.773  1.00 32.20 ? 248  LYS A C     1 
ATOM   1499  O  O     . LYS A  1 220 ? 98.495  78.033  -4.305  1.00 32.30 ? 248  LYS A O     1 
ATOM   1500  C  CB    . LYS A  1 220 ? 98.965  74.983  -4.266  1.00 32.81 ? 248  LYS A CB    1 
ATOM   1501  N  N     . PRO A  1 221 ? 97.229  77.329  -2.581  1.00 31.99 ? 249  PRO A N     1 
ATOM   1502  C  CA    . PRO A  1 221 ? 97.408  78.561  -1.837  1.00 31.93 ? 249  PRO A CA    1 
ATOM   1503  C  C     . PRO A  1 221 ? 98.873  78.838  -1.535  1.00 31.36 ? 249  PRO A C     1 
ATOM   1504  O  O     . PRO A  1 221 ? 99.642  77.905  -1.310  1.00 31.06 ? 249  PRO A O     1 
ATOM   1505  C  CB    . PRO A  1 221 ? 96.637  78.315  -0.531  1.00 31.76 ? 249  PRO A CB    1 
ATOM   1506  C  CG    . PRO A  1 221 ? 95.696  77.260  -0.833  1.00 32.39 ? 249  PRO A CG    1 
ATOM   1507  C  CD    . PRO A  1 221 ? 96.335  76.397  -1.874  1.00 32.53 ? 249  PRO A CD    1 
ATOM   1508  N  N     . GLU A  1 222 ? 99.243  80.111  -1.566  1.00 30.64 ? 250  GLU A N     1 
ATOM   1509  C  CA    . GLU A  1 222 ? 100.579 80.539  -1.162  1.00 30.49 ? 250  GLU A CA    1 
ATOM   1510  C  C     . GLU A  1 222 ? 100.821 80.218  0.319   1.00 29.47 ? 250  GLU A C     1 
ATOM   1511  O  O     . GLU A  1 222 ? 99.905  80.269  1.144   1.00 28.58 ? 250  GLU A O     1 
ATOM   1512  C  CB    . GLU A  1 222 ? 100.759 82.049  -1.378  1.00 30.98 ? 250  GLU A CB    1 
ATOM   1513  C  CG    . GLU A  1 222 ? 100.596 82.535  -2.821  1.00 32.90 ? 250  GLU A CG    1 
ATOM   1514  C  CD    . GLU A  1 222 ? 101.784 82.227  -3.715  1.00 36.89 ? 250  GLU A CD    1 
ATOM   1515  O  OE1   . GLU A  1 222 ? 102.817 81.700  -3.234  1.00 39.08 ? 250  GLU A OE1   1 
ATOM   1516  O  OE2   . GLU A  1 222 ? 101.674 82.515  -4.930  1.00 41.08 ? 250  GLU A OE2   1 
ATOM   1517  N  N     . ASN A  1 223 ? 102.063 79.882  0.636   1.00 29.04 ? 251  ASN A N     1 
ATOM   1518  C  CA    . ASN A  1 223 ? 102.535 79.803  2.016   1.00 28.87 ? 251  ASN A CA    1 
ATOM   1519  C  C     . ASN A  1 223 ? 103.082 81.173  2.429   1.00 28.16 ? 251  ASN A C     1 
ATOM   1520  O  O     . ASN A  1 223 ? 104.141 81.588  1.957   1.00 28.23 ? 251  ASN A O     1 
ATOM   1521  C  CB    . ASN A  1 223 ? 103.601 78.714  2.089   1.00 29.43 ? 251  ASN A CB    1 
ATOM   1522  C  CG    . ASN A  1 223 ? 104.000 78.376  3.485   1.00 29.78 ? 251  ASN A CG    1 
ATOM   1523  O  OD1   . ASN A  1 223 ? 103.417 78.866  4.454   1.00 32.83 ? 251  ASN A OD1   1 
ATOM   1524  N  ND2   . ASN A  1 223 ? 105.013 77.533  3.610   1.00 29.89 ? 251  ASN A ND2   1 
ATOM   1525  N  N     . LYS A  1 224 ? 102.362 81.874  3.310   1.00 27.34 ? 252  LYS A N     1 
ATOM   1526  C  CA    . LYS A  1 224 ? 102.616 83.292  3.570   1.00 26.94 ? 252  LYS A CA    1 
ATOM   1527  C  C     . LYS A  1 224 ? 103.171 83.605  4.959   1.00 26.30 ? 252  LYS A C     1 
ATOM   1528  O  O     . LYS A  1 224 ? 102.974 82.866  5.913   1.00 26.46 ? 252  LYS A O     1 
ATOM   1529  C  CB    . LYS A  1 224 ? 101.339 84.106  3.348   1.00 26.78 ? 252  LYS A CB    1 
ATOM   1530  C  CG    . LYS A  1 224 ? 100.731 83.909  1.971   1.00 27.41 ? 252  LYS A CG    1 
ATOM   1531  C  CD    . LYS A  1 224 ? 99.706  84.953  1.593   1.00 27.04 ? 252  LYS A CD    1 
ATOM   1532  C  CE    . LYS A  1 224 ? 98.592  85.127  2.608   1.00 27.67 ? 252  LYS A CE    1 
ATOM   1533  N  NZ    . LYS A  1 224 ? 97.732  83.936  2.748   1.00 27.31 ? 252  LYS A NZ    1 
ATOM   1534  N  N     . LEU A  1 225 ? 103.851 84.743  5.035   1.00 26.11 ? 253  LEU A N     1 
ATOM   1535  C  CA    . LEU A  1 225 ? 104.352 85.313  6.281   1.00 24.94 ? 253  LEU A CA    1 
ATOM   1536  C  C     . LEU A  1 225 ? 103.239 85.555  7.304   1.00 25.20 ? 253  LEU A C     1 
ATOM   1537  O  O     . LEU A  1 225 ? 103.370 85.199  8.480   1.00 23.92 ? 253  LEU A O     1 
ATOM   1538  C  CB    . LEU A  1 225 ? 105.097 86.610  5.967   1.00 24.89 ? 253  LEU A CB    1 
ATOM   1539  C  CG    . LEU A  1 225 ? 105.512 87.520  7.116   1.00 23.94 ? 253  LEU A CG    1 
ATOM   1540  C  CD1   . LEU A  1 225 ? 106.368 86.758  8.137   1.00 23.05 ? 253  LEU A CD1   1 
ATOM   1541  C  CD2   . LEU A  1 225 ? 106.254 88.754  6.549   1.00 24.20 ? 253  LEU A CD2   1 
ATOM   1542  N  N     . GLY A  1 226 ? 102.151 86.158  6.837   1.00 24.99 ? 254  GLY A N     1 
ATOM   1543  C  CA    . GLY A  1 226 ? 101.003 86.491  7.663   1.00 25.39 ? 254  GLY A CA    1 
ATOM   1544  C  C     . GLY A  1 226 ? 99.767  86.497  6.782   1.00 25.60 ? 254  GLY A C     1 
ATOM   1545  O  O     . GLY A  1 226 ? 99.819  86.030  5.645   1.00 25.42 ? 254  GLY A O     1 
ATOM   1546  N  N     . LEU A  1 227 ? 98.662  87.024  7.300   1.00 26.39 ? 255  LEU A N     1 
ATOM   1547  C  CA    . LEU A  1 227 ? 97.370  86.954  6.598   1.00 26.97 ? 255  LEU A CA    1 
ATOM   1548  C  C     . LEU A  1 227 ? 97.114  85.510  6.147   1.00 26.76 ? 255  LEU A C     1 
ATOM   1549  O  O     . LEU A  1 227 ? 96.545  85.238  5.078   1.00 26.43 ? 255  LEU A O     1 
ATOM   1550  C  CB    . LEU A  1 227 ? 97.349  87.933  5.411   1.00 26.61 ? 255  LEU A CB    1 
ATOM   1551  C  CG    . LEU A  1 227 ? 96.015  88.619  5.137   1.00 28.96 ? 255  LEU A CG    1 
ATOM   1552  C  CD1   . LEU A  1 227 ? 95.759  89.672  6.234   1.00 26.87 ? 255  LEU A CD1   1 
ATOM   1553  C  CD2   . LEU A  1 227 ? 95.991  89.238  3.710   1.00 28.49 ? 255  LEU A CD2   1 
ATOM   1554  N  N     . ARG A  1 228 ? 97.509  84.566  6.991   1.00 27.17 ? 256  ARG A N     1 
ATOM   1555  C  CA    . ARG A  1 228 ? 97.599  83.180  6.553   1.00 26.39 ? 256  ARG A CA    1 
ATOM   1556  C  C     . ARG A  1 228 ? 96.251  82.508  6.365   1.00 26.45 ? 256  ARG A C     1 
ATOM   1557  O  O     . ARG A  1 228 ? 96.141  81.623  5.532   1.00 25.89 ? 256  ARG A O     1 
ATOM   1558  C  CB    . ARG A  1 228 ? 98.491  82.384  7.485   1.00 27.05 ? 256  ARG A CB    1 
ATOM   1559  C  CG    . ARG A  1 228 ? 99.979  82.739  7.300   1.00 27.22 ? 256  ARG A CG    1 
ATOM   1560  C  CD    . ARG A  1 228 ? 100.824 82.347  8.492   1.00 27.62 ? 256  ARG A CD    1 
ATOM   1561  N  NE    . ARG A  1 228 ? 100.809 80.924  8.776   1.00 28.84 ? 256  ARG A NE    1 
ATOM   1562  C  CZ    . ARG A  1 228 ? 101.443 79.983  8.077   1.00 30.95 ? 256  ARG A CZ    1 
ATOM   1563  N  NH1   . ARG A  1 228 ? 102.192 80.279  7.020   1.00 30.98 ? 256  ARG A NH1   1 
ATOM   1564  N  NH2   . ARG A  1 228 ? 101.320 78.717  8.447   1.00 30.22 ? 256  ARG A NH2   1 
ATOM   1565  N  N     . ALA A  1 229 ? 95.239  82.922  7.126   1.00 25.99 ? 257  ALA A N     1 
ATOM   1566  C  CA    . ALA A  1 229 ? 93.901  82.356  6.987   1.00 26.43 ? 257  ALA A CA    1 
ATOM   1567  C  C     . ALA A  1 229 ? 93.205  82.804  5.702   1.00 26.26 ? 257  ALA A C     1 
ATOM   1568  O  O     . ALA A  1 229 ? 92.243  82.179  5.283   1.00 26.37 ? 257  ALA A O     1 
ATOM   1569  C  CB    . ALA A  1 229 ? 93.034  82.681  8.226   1.00 26.41 ? 257  ALA A CB    1 
ATOM   1570  N  N     . SER A  1 230 ? 93.684  83.873  5.079   1.00 26.52 ? 258  SER A N     1 
ATOM   1571  C  CA    . SER A  1 230 ? 93.157  84.314  3.783   1.00 27.13 ? 258  SER A CA    1 
ATOM   1572  C  C     . SER A  1 230 ? 93.861  83.567  2.646   1.00 27.22 ? 258  SER A C     1 
ATOM   1573  O  O     . SER A  1 230 ? 95.043  83.800  2.390   1.00 28.25 ? 258  SER A O     1 
ATOM   1574  C  CB    . SER A  1 230 ? 93.339  85.827  3.630   1.00 27.14 ? 258  SER A CB    1 
ATOM   1575  O  OG    . SER A  1 230 ? 92.929  86.300  2.351   1.00 27.73 ? 258  SER A OG    1 
ATOM   1576  N  N     . SER A  1 231 ? 93.143  82.663  1.978   1.00 27.25 ? 259  SER A N     1 
ATOM   1577  C  CA    . SER A  1 231 ? 93.687  81.957  0.802   1.00 27.28 ? 259  SER A CA    1 
ATOM   1578  C  C     . SER A  1 231 ? 94.092  82.948  -0.285  1.00 27.21 ? 259  SER A C     1 
ATOM   1579  O  O     . SER A  1 231 ? 93.422  83.965  -0.509  1.00 26.90 ? 259  SER A O     1 
ATOM   1580  C  CB    . SER A  1 231 ? 92.726  80.892  0.252   1.00 27.66 ? 259  SER A CB    1 
ATOM   1581  O  OG    . SER A  1 231 ? 91.621  81.452  -0.423  1.00 27.24 ? 259  SER A OG    1 
ATOM   1582  N  N     . THR A  1 232 ? 95.239  82.662  -0.894  1.00 27.09 ? 260  THR A N     1 
ATOM   1583  C  CA    . THR A  1 232 ? 95.866  83.503  -1.895  1.00 27.10 ? 260  THR A CA    1 
ATOM   1584  C  C     . THR A  1 232 ? 96.378  82.506  -2.925  1.00 26.86 ? 260  THR A C     1 
ATOM   1585  O  O     . THR A  1 232 ? 97.303  81.741  -2.651  1.00 26.78 ? 260  THR A O     1 
ATOM   1586  C  CB    . THR A  1 232 ? 97.033  84.357  -1.277  1.00 27.63 ? 260  THR A CB    1 
ATOM   1587  O  OG1   . THR A  1 232 ? 96.581  85.027  -0.087  1.00 29.32 ? 260  THR A OG1   1 
ATOM   1588  C  CG2   . THR A  1 232 ? 97.506  85.408  -2.252  1.00 27.85 ? 260  THR A CG2   1 
ATOM   1589  N  N     . CYS A  1 233 ? 95.726  82.446  -4.082  1.00 26.73 ? 261  CYS A N     1 
ATOM   1590  C  CA    . CYS A  1 233 ? 95.970  81.366  -5.038  1.00 26.74 ? 261  CYS A CA    1 
ATOM   1591  C  C     . CYS A  1 233 ? 96.237  81.883  -6.440  1.00 26.28 ? 261  CYS A C     1 
ATOM   1592  O  O     . CYS A  1 233 ? 95.678  82.893  -6.844  1.00 26.13 ? 261  CYS A O     1 
ATOM   1593  C  CB    . CYS A  1 233 ? 94.767  80.413  -5.128  1.00 26.79 ? 261  CYS A CB    1 
ATOM   1594  S  SG    . CYS A  1 233 ? 94.173  79.728  -3.582  1.00 28.81 ? 261  CYS A SG    1 
ATOM   1595  N  N     . PRO A  1 234 ? 97.072  81.161  -7.198  1.00 26.45 ? 262  PRO A N     1 
ATOM   1596  C  CA    . PRO A  1 234 ? 97.124  81.395  -8.639  1.00 26.60 ? 262  PRO A CA    1 
ATOM   1597  C  C     . PRO A  1 234 ? 95.907  80.823  -9.355  1.00 26.71 ? 262  PRO A C     1 
ATOM   1598  O  O     . PRO A  1 234 ? 95.310  79.840  -8.890  1.00 26.37 ? 262  PRO A O     1 
ATOM   1599  C  CB    . PRO A  1 234 ? 98.418  80.704  -9.067  1.00 26.58 ? 262  PRO A CB    1 
ATOM   1600  C  CG    . PRO A  1 234 ? 98.686  79.663  -8.013  1.00 26.81 ? 262  PRO A CG    1 
ATOM   1601  C  CD    . PRO A  1 234 ? 97.997  80.100  -6.756  1.00 26.45 ? 262  PRO A CD    1 
ATOM   1602  N  N     . LEU A  1 235 ? 95.525  81.457  -10.465 1.00 27.20 ? 263  LEU A N     1 
ATOM   1603  C  CA    . LEU A  1 235 ? 94.490  80.920  -11.369 1.00 27.04 ? 263  LEU A CA    1 
ATOM   1604  C  C     . LEU A  1 235 ? 95.070  80.742  -12.757 1.00 27.21 ? 263  LEU A C     1 
ATOM   1605  O  O     . LEU A  1 235 ? 95.956  81.487  -13.168 1.00 26.99 ? 263  LEU A O     1 
ATOM   1606  C  CB    . LEU A  1 235 ? 93.289  81.863  -11.468 1.00 27.01 ? 263  LEU A CB    1 
ATOM   1607  C  CG    . LEU A  1 235 ? 92.671  82.392  -10.169 1.00 27.85 ? 263  LEU A CG    1 
ATOM   1608  C  CD1   . LEU A  1 235 ? 91.570  83.408  -10.486 1.00 26.39 ? 263  LEU A CD1   1 
ATOM   1609  C  CD2   . LEU A  1 235 ? 92.132  81.247  -9.306  1.00 28.05 ? 263  LEU A CD2   1 
ATOM   1610  N  N     . THR A  1 236 ? 94.574  79.752  -13.484 1.00 27.30 ? 264  THR A N     1 
ATOM   1611  C  CA    . THR A  1 236 ? 94.848  79.642  -14.911 1.00 27.93 ? 264  THR A CA    1 
ATOM   1612  C  C     . THR A  1 236 ? 93.522  79.523  -15.679 1.00 27.95 ? 264  THR A C     1 
ATOM   1613  O  O     . THR A  1 236 ? 92.547  78.954  -15.179 1.00 27.83 ? 264  THR A O     1 
ATOM   1614  C  CB    . THR A  1 236 ? 95.756  78.432  -15.253 1.00 27.98 ? 264  THR A CB    1 
ATOM   1615  O  OG1   . THR A  1 236 ? 95.104  77.223  -14.875 1.00 29.16 ? 264  THR A OG1   1 
ATOM   1616  C  CG2   . THR A  1 236 ? 97.087  78.524  -14.534 1.00 28.06 ? 264  THR A CG2   1 
ATOM   1617  N  N     . PHE A  1 237 ? 93.510  80.089  -16.881 1.00 28.07 ? 265  PHE A N     1 
ATOM   1618  C  CA    . PHE A  1 237 ? 92.347  80.100  -17.758 1.00 28.42 ? 265  PHE A CA    1 
ATOM   1619  C  C     . PHE A  1 237 ? 92.731  79.433  -19.064 1.00 28.49 ? 265  PHE A C     1 
ATOM   1620  O  O     . PHE A  1 237 ? 93.546  79.965  -19.807 1.00 27.98 ? 265  PHE A O     1 
ATOM   1621  C  CB    . PHE A  1 237 ? 91.909  81.542  -18.037 1.00 28.74 ? 265  PHE A CB    1 
ATOM   1622  C  CG    . PHE A  1 237 ? 91.434  82.281  -16.816 1.00 29.11 ? 265  PHE A CG    1 
ATOM   1623  C  CD1   . PHE A  1 237 ? 90.084  82.297  -16.475 1.00 29.78 ? 265  PHE A CD1   1 
ATOM   1624  C  CD2   . PHE A  1 237 ? 92.330  82.956  -16.009 1.00 30.22 ? 265  PHE A CD2   1 
ATOM   1625  C  CE1   . PHE A  1 237 ? 89.642  82.972  -15.341 1.00 30.43 ? 265  PHE A CE1   1 
ATOM   1626  C  CE2   . PHE A  1 237 ? 91.897  83.634  -14.868 1.00 29.69 ? 265  PHE A CE2   1 
ATOM   1627  C  CZ    . PHE A  1 237 ? 90.555  83.636  -14.533 1.00 29.70 ? 265  PHE A CZ    1 
ATOM   1628  N  N     . GLU A  1 238 ? 92.163  78.257  -19.319 1.00 29.08 ? 266  GLU A N     1 
ATOM   1629  C  CA    . GLU A  1 238 ? 92.329  77.558  -20.592 1.00 29.94 ? 266  GLU A CA    1 
ATOM   1630  C  C     . GLU A  1 238 ? 91.016  77.521  -21.348 1.00 29.40 ? 266  GLU A C     1 
ATOM   1631  O  O     . GLU A  1 238 ? 90.139  76.735  -21.008 1.00 29.17 ? 266  GLU A O     1 
ATOM   1632  C  CB    . GLU A  1 238 ? 92.729  76.104  -20.364 1.00 30.13 ? 266  GLU A CB    1 
ATOM   1633  C  CG    . GLU A  1 238 ? 94.078  75.880  -19.744 1.00 31.64 ? 266  GLU A CG    1 
ATOM   1634  C  CD    . GLU A  1 238 ? 94.431  74.400  -19.717 1.00 31.95 ? 266  GLU A CD    1 
ATOM   1635  O  OE1   . GLU A  1 238 ? 93.972  73.653  -20.628 1.00 35.03 ? 266  GLU A OE1   1 
ATOM   1636  O  OE2   . GLU A  1 238 ? 95.160  74.000  -18.782 1.00 35.99 ? 266  GLU A OE2   1 
ATOM   1637  N  N     . ASN A  1 239 ? 90.887  78.355  -22.374 1.00 29.34 ? 267  ASN A N     1 
ATOM   1638  C  CA    . ASN A  1 239 ? 89.671  78.411  -23.182 1.00 29.11 ? 267  ASN A CA    1 
ATOM   1639  C  C     . ASN A  1 239 ? 88.401  78.433  -22.323 1.00 28.86 ? 267  ASN A C     1 
ATOM   1640  O  O     . ASN A  1 239 ? 87.466  77.661  -22.549 1.00 28.57 ? 267  ASN A O     1 
ATOM   1641  C  CB    . ASN A  1 239 ? 89.641  77.249  -24.183 1.00 29.42 ? 267  ASN A CB    1 
ATOM   1642  C  CG    . ASN A  1 239 ? 90.835  77.254  -25.122 1.00 29.73 ? 267  ASN A CG    1 
ATOM   1643  O  OD1   . ASN A  1 239 ? 91.258  78.304  -25.601 1.00 30.55 ? 267  ASN A OD1   1 
ATOM   1644  N  ND2   . ASN A  1 239 ? 91.379  76.074  -25.395 1.00 31.17 ? 267  ASN A ND2   1 
ATOM   1645  N  N     . VAL A  1 240 ? 88.396  79.320  -21.326 1.00 28.54 ? 268  VAL A N     1 
ATOM   1646  C  CA    . VAL A  1 240 ? 87.236  79.538  -20.462 1.00 28.53 ? 268  VAL A CA    1 
ATOM   1647  C  C     . VAL A  1 240 ? 86.195  80.348  -21.238 1.00 28.57 ? 268  VAL A C     1 
ATOM   1648  O  O     . VAL A  1 240 ? 86.429  81.515  -21.561 1.00 28.91 ? 268  VAL A O     1 
ATOM   1649  C  CB    . VAL A  1 240 ? 87.638  80.289  -19.153 1.00 28.52 ? 268  VAL A CB    1 
ATOM   1650  C  CG1   . VAL A  1 240 ? 86.405  80.756  -18.377 1.00 28.59 ? 268  VAL A CG1   1 
ATOM   1651  C  CG2   . VAL A  1 240 ? 88.496  79.400  -18.277 1.00 28.25 ? 268  VAL A CG2   1 
ATOM   1652  N  N     . LYS A  1 241 ? 85.051  79.730  -21.523 1.00 28.55 ? 269  LYS A N     1 
ATOM   1653  C  CA    . LYS A  1 241 ? 84.018  80.344  -22.355 1.00 28.77 ? 269  LYS A CA    1 
ATOM   1654  C  C     . LYS A  1 241 ? 83.032  81.117  -21.496 1.00 28.39 ? 269  LYS A C     1 
ATOM   1655  O  O     . LYS A  1 241 ? 82.368  80.553  -20.631 1.00 28.48 ? 269  LYS A O     1 
ATOM   1656  C  CB    . LYS A  1 241 ? 83.266  79.282  -23.157 1.00 28.63 ? 269  LYS A CB    1 
ATOM   1657  C  CG    . LYS A  1 241 ? 84.162  78.391  -24.014 1.00 30.38 ? 269  LYS A CG    1 
ATOM   1658  N  N     . VAL A  1 242 ? 82.935  82.413  -21.754 1.00 28.32 ? 270  VAL A N     1 
ATOM   1659  C  CA    . VAL A  1 242 ? 82.058  83.295  -20.998 1.00 28.12 ? 270  VAL A CA    1 
ATOM   1660  C  C     . VAL A  1 242 ? 81.023  83.909  -21.951 1.00 27.45 ? 270  VAL A C     1 
ATOM   1661  O  O     . VAL A  1 242 ? 81.397  84.420  -23.003 1.00 27.28 ? 270  VAL A O     1 
ATOM   1662  C  CB    . VAL A  1 242 ? 82.879  84.410  -20.316 1.00 28.01 ? 270  VAL A CB    1 
ATOM   1663  C  CG1   . VAL A  1 242 ? 82.020  85.179  -19.349 1.00 28.00 ? 270  VAL A CG1   1 
ATOM   1664  C  CG2   . VAL A  1 242 ? 84.088  83.815  -19.580 1.00 29.15 ? 270  VAL A CG2   1 
ATOM   1665  N  N     . PRO A  1 243 ? 79.723  83.856  -21.596 1.00 27.04 ? 271  PRO A N     1 
ATOM   1666  C  CA    . PRO A  1 243 ? 78.721  84.530  -22.430 1.00 26.47 ? 271  PRO A CA    1 
ATOM   1667  C  C     . PRO A  1 243 ? 78.961  86.039  -22.439 1.00 26.09 ? 271  PRO A C     1 
ATOM   1668  O  O     . PRO A  1 243 ? 79.412  86.587  -21.437 1.00 25.84 ? 271  PRO A O     1 
ATOM   1669  C  CB    . PRO A  1 243 ? 77.397  84.208  -21.731 1.00 26.46 ? 271  PRO A CB    1 
ATOM   1670  C  CG    . PRO A  1 243 ? 77.686  83.050  -20.837 1.00 26.95 ? 271  PRO A CG    1 
ATOM   1671  C  CD    . PRO A  1 243 ? 79.108  83.205  -20.425 1.00 27.14 ? 271  PRO A CD    1 
ATOM   1672  N  N     . GLU A  1 244 ? 78.670  86.703  -23.554 1.00 25.66 ? 272  GLU A N     1 
ATOM   1673  C  CA    . GLU A  1 244 ? 78.913  88.152  -23.664 1.00 25.34 ? 272  GLU A CA    1 
ATOM   1674  C  C     . GLU A  1 244 ? 78.136  88.962  -22.613 1.00 25.27 ? 272  GLU A C     1 
ATOM   1675  O  O     . GLU A  1 244 ? 78.567  90.057  -22.220 1.00 24.96 ? 272  GLU A O     1 
ATOM   1676  C  CB    . GLU A  1 244 ? 78.602  88.654  -25.069 1.00 25.29 ? 272  GLU A CB    1 
ATOM   1677  C  CG    . GLU A  1 244 ? 77.125  88.584  -25.458 1.00 25.05 ? 272  GLU A CG    1 
ATOM   1678  C  CD    . GLU A  1 244 ? 76.880  88.901  -26.930 1.00 25.35 ? 272  GLU A CD    1 
ATOM   1679  O  OE1   . GLU A  1 244 ? 77.842  89.253  -27.651 1.00 25.78 ? 272  GLU A OE1   1 
ATOM   1680  O  OE2   . GLU A  1 244 ? 75.716  88.802  -27.357 1.00 24.85 ? 272  GLU A OE2   1 
ATOM   1681  N  N     . ALA A  1 245 ? 77.017  88.408  -22.140 1.00 24.99 ? 273  ALA A N     1 
ATOM   1682  C  CA    . ALA A  1 245 ? 76.229  89.040  -21.080 1.00 25.17 ? 273  ALA A CA    1 
ATOM   1683  C  C     . ALA A  1 245 ? 76.969  89.116  -19.751 1.00 25.34 ? 273  ALA A C     1 
ATOM   1684  O  O     . ALA A  1 245 ? 76.628  89.952  -18.916 1.00 25.48 ? 273  ALA A O     1 
ATOM   1685  C  CB    . ALA A  1 245 ? 74.886  88.324  -20.897 1.00 25.38 ? 273  ALA A CB    1 
ATOM   1686  N  N     . ASN A  1 246 ? 77.975  88.253  -19.562 1.00 25.21 ? 274  ASN A N     1 
ATOM   1687  C  CA    . ASN A  1 246 ? 78.774  88.232  -18.333 1.00 25.42 ? 274  ASN A CA    1 
ATOM   1688  C  C     . ASN A  1 246 ? 79.859  89.303  -18.244 1.00 25.08 ? 274  ASN A C     1 
ATOM   1689  O  O     . ASN A  1 246 ? 80.550  89.372  -17.237 1.00 25.21 ? 274  ASN A O     1 
ATOM   1690  C  CB    . ASN A  1 246 ? 79.410  86.858  -18.121 1.00 25.58 ? 274  ASN A CB    1 
ATOM   1691  C  CG    . ASN A  1 246 ? 78.410  85.823  -17.641 1.00 26.42 ? 274  ASN A CG    1 
ATOM   1692  O  OD1   . ASN A  1 246 ? 77.242  85.851  -18.027 1.00 27.21 ? 274  ASN A OD1   1 
ATOM   1693  N  ND2   . ASN A  1 246 ? 78.862  84.914  -16.784 1.00 27.73 ? 274  ASN A ND2   1 
ATOM   1694  N  N     . ILE A  1 247 ? 80.023  90.121  -19.283 1.00 24.98 ? 275  ILE A N     1 
ATOM   1695  C  CA    . ILE A  1 247 ? 80.841  91.330  -19.161 1.00 24.82 ? 275  ILE A CA    1 
ATOM   1696  C  C     . ILE A  1 247 ? 80.164  92.211  -18.118 1.00 24.88 ? 275  ILE A C     1 
ATOM   1697  O  O     . ILE A  1 247 ? 78.952  92.477  -18.211 1.00 24.57 ? 275  ILE A O     1 
ATOM   1698  C  CB    . ILE A  1 247 ? 80.992  92.106  -20.507 1.00 24.82 ? 275  ILE A CB    1 
ATOM   1699  C  CG1   . ILE A  1 247 ? 81.775  91.276  -21.530 1.00 25.06 ? 275  ILE A CG1   1 
ATOM   1700  C  CG2   . ILE A  1 247 ? 81.705  93.456  -20.284 1.00 23.78 ? 275  ILE A CG2   1 
ATOM   1701  C  CD1   . ILE A  1 247 ? 81.522  91.665  -22.994 1.00 24.73 ? 275  ILE A CD1   1 
ATOM   1702  N  N     . LEU A  1 248 ? 80.937  92.607  -17.106 1.00 25.11 ? 276  LEU A N     1 
ATOM   1703  C  CA    . LEU A  1 248 ? 80.506  93.591  -16.122 1.00 25.47 ? 276  LEU A CA    1 
ATOM   1704  C  C     . LEU A  1 248 ? 80.856  94.989  -16.618 1.00 25.88 ? 276  LEU A C     1 
ATOM   1705  O  O     . LEU A  1 248 ? 82.032  95.307  -16.855 1.00 25.66 ? 276  LEU A O     1 
ATOM   1706  C  CB    . LEU A  1 248 ? 81.170  93.355  -14.758 1.00 25.50 ? 276  LEU A CB    1 
ATOM   1707  C  CG    . LEU A  1 248 ? 80.810  94.366  -13.654 1.00 25.37 ? 276  LEU A CG    1 
ATOM   1708  C  CD1   . LEU A  1 248 ? 79.343  94.197  -13.210 1.00 26.91 ? 276  LEU A CD1   1 
ATOM   1709  C  CD2   . LEU A  1 248 ? 81.770  94.226  -12.477 1.00 25.94 ? 276  LEU A CD2   1 
ATOM   1710  N  N     . GLY A  1 249 ? 79.825  95.822  -16.754 1.00 25.96 ? 277  GLY A N     1 
ATOM   1711  C  CA    . GLY A  1 249 ? 79.964  97.151  -17.326 1.00 26.14 ? 277  GLY A CA    1 
ATOM   1712  C  C     . GLY A  1 249 ? 80.306  97.154  -18.807 1.00 26.62 ? 277  GLY A C     1 
ATOM   1713  O  O     . GLY A  1 249 ? 80.036  96.193  -19.532 1.00 26.53 ? 277  GLY A O     1 
ATOM   1714  N  N     . GLN A  1 250 ? 80.922  98.247  -19.241 1.00 26.77 ? 278  GLN A N     1 
ATOM   1715  C  CA    . GLN A  1 250 ? 81.196  98.499  -20.644 1.00 27.38 ? 278  GLN A CA    1 
ATOM   1716  C  C     . GLN A  1 250 ? 82.503  97.831  -21.044 1.00 27.09 ? 278  GLN A C     1 
ATOM   1717  O  O     . GLN A  1 250 ? 83.530  97.880  -20.313 1.00 26.31 ? 278  GLN A O     1 
ATOM   1718  C  CB    . GLN A  1 250 ? 81.268  100.016 -20.866 1.00 27.29 ? 278  GLN A CB    1 
ATOM   1719  C  CG    . GLN A  1 250 ? 81.326  100.508 -22.293 1.00 29.40 ? 278  GLN A CG    1 
ATOM   1720  C  CD    . GLN A  1 250 ? 81.494  102.035 -22.356 1.00 30.20 ? 278  GLN A CD    1 
ATOM   1721  O  OE1   . GLN A  1 250 ? 81.065  102.759 -21.443 1.00 32.14 ? 278  GLN A OE1   1 
ATOM   1722  N  NE2   . GLN A  1 250 ? 82.154  102.522 -23.414 1.00 33.79 ? 278  GLN A NE2   1 
ATOM   1723  N  N     . ILE A  1 251 ? 82.465  97.194  -22.204 1.00 26.49 ? 279  ILE A N     1 
ATOM   1724  C  CA    . ILE A  1 251 ? 83.643  96.570  -22.778 1.00 26.90 ? 279  ILE A CA    1 
ATOM   1725  C  C     . ILE A  1 251 ? 84.774  97.613  -22.915 1.00 26.98 ? 279  ILE A C     1 
ATOM   1726  O  O     . ILE A  1 251 ? 84.555  98.742  -23.361 1.00 26.24 ? 279  ILE A O     1 
ATOM   1727  C  CB    . ILE A  1 251 ? 83.266  95.850  -24.106 1.00 27.07 ? 279  ILE A CB    1 
ATOM   1728  C  CG1   . ILE A  1 251 ? 84.343  94.868  -24.561 1.00 27.09 ? 279  ILE A CG1   1 
ATOM   1729  C  CG2   . ILE A  1 251 ? 82.900  96.842  -25.216 1.00 27.51 ? 279  ILE A CG2   1 
ATOM   1730  C  CD1   . ILE A  1 251 ? 83.784  93.903  -25.649 1.00 27.27 ? 279  ILE A CD1   1 
ATOM   1731  N  N     . GLY A  1 252 ? 85.968  97.260  -22.443 1.00 26.87 ? 280  GLY A N     1 
ATOM   1732  C  CA    . GLY A  1 252 ? 87.107  98.179  -22.483 1.00 27.23 ? 280  GLY A CA    1 
ATOM   1733  C  C     . GLY A  1 252 ? 87.181  99.220  -21.371 1.00 27.65 ? 280  GLY A C     1 
ATOM   1734  O  O     . GLY A  1 252 ? 88.088  100.046 -21.364 1.00 28.14 ? 280  GLY A O     1 
ATOM   1735  N  N     . HIS A  1 253 ? 86.250  99.189  -20.419 1.00 27.86 ? 281  HIS A N     1 
ATOM   1736  C  CA    . HIS A  1 253 ? 86.285  100.106 -19.278 1.00 27.97 ? 281  HIS A CA    1 
ATOM   1737  C  C     . HIS A  1 253 ? 86.658  99.402  -17.970 1.00 27.36 ? 281  HIS A C     1 
ATOM   1738  O  O     . HIS A  1 253 ? 86.589  100.007 -16.902 1.00 26.74 ? 281  HIS A O     1 
ATOM   1739  C  CB    . HIS A  1 253 ? 84.938  100.825 -19.134 1.00 28.60 ? 281  HIS A CB    1 
ATOM   1740  C  CG    . HIS A  1 253 ? 84.747  101.951 -20.103 1.00 30.63 ? 281  HIS A CG    1 
ATOM   1741  N  ND1   . HIS A  1 253 ? 84.309  103.199 -19.715 1.00 33.35 ? 281  HIS A ND1   1 
ATOM   1742  C  CD2   . HIS A  1 253 ? 84.917  102.015 -21.445 1.00 34.04 ? 281  HIS A CD2   1 
ATOM   1743  C  CE1   . HIS A  1 253 ? 84.227  103.986 -20.773 1.00 33.35 ? 281  HIS A CE1   1 
ATOM   1744  N  NE2   . HIS A  1 253 ? 84.591  103.292 -21.837 1.00 34.35 ? 281  HIS A NE2   1 
ATOM   1745  N  N     . GLY A  1 254 ? 87.069  98.134  -18.065 1.00 26.87 ? 282  GLY A N     1 
ATOM   1746  C  CA    . GLY A  1 254 ? 87.418  97.325  -16.899 1.00 26.62 ? 282  GLY A CA    1 
ATOM   1747  C  C     . GLY A  1 254 ? 88.605  97.857  -16.104 1.00 26.67 ? 282  GLY A C     1 
ATOM   1748  O  O     . GLY A  1 254 ? 88.702  97.631  -14.901 1.00 25.94 ? 282  GLY A O     1 
ATOM   1749  N  N     . TYR A  1 255 ? 89.514  98.547  -16.784 1.00 27.03 ? 283  TYR A N     1 
ATOM   1750  C  CA    . TYR A  1 255 ? 90.628  99.208  -16.123 1.00 27.58 ? 283  TYR A CA    1 
ATOM   1751  C  C     . TYR A  1 255 ? 90.093  100.327 -15.222 1.00 27.66 ? 283  TYR A C     1 
ATOM   1752  O  O     . TYR A  1 255 ? 90.552  100.483 -14.090 1.00 27.61 ? 283  TYR A O     1 
ATOM   1753  C  CB    . TYR A  1 255 ? 91.646  99.739  -17.149 1.00 28.04 ? 283  TYR A CB    1 
ATOM   1754  C  CG    . TYR A  1 255 ? 91.218  100.982 -17.891 1.00 28.77 ? 283  TYR A CG    1 
ATOM   1755  C  CD1   . TYR A  1 255 ? 91.528  102.253 -17.397 1.00 28.95 ? 283  TYR A CD1   1 
ATOM   1756  C  CD2   . TYR A  1 255 ? 90.512  100.897 -19.087 1.00 28.57 ? 283  TYR A CD2   1 
ATOM   1757  C  CE1   . TYR A  1 255 ? 91.134  103.398 -18.079 1.00 30.22 ? 283  TYR A CE1   1 
ATOM   1758  C  CE2   . TYR A  1 255 ? 90.115  102.041 -19.771 1.00 30.18 ? 283  TYR A CE2   1 
ATOM   1759  C  CZ    . TYR A  1 255 ? 90.429  103.278 -19.267 1.00 29.49 ? 283  TYR A CZ    1 
ATOM   1760  O  OH    . TYR A  1 255 ? 90.044  104.401 -19.939 1.00 31.12 ? 283  TYR A OH    1 
ATOM   1761  N  N     . LYS A  1 256 ? 89.098  101.069 -15.705 1.00 27.83 ? 284  LYS A N     1 
ATOM   1762  C  CA    . LYS A  1 256 ? 88.489  102.131 -14.898 1.00 28.15 ? 284  LYS A CA    1 
ATOM   1763  C  C     . LYS A  1 256 ? 87.727  101.573 -13.700 1.00 27.78 ? 284  LYS A C     1 
ATOM   1764  O  O     . LYS A  1 256 ? 87.846  102.097 -12.593 1.00 27.30 ? 284  LYS A O     1 
ATOM   1765  C  CB    . LYS A  1 256 ? 87.540  102.998 -15.722 1.00 28.18 ? 284  LYS A CB    1 
ATOM   1766  C  CG    . LYS A  1 256 ? 88.173  103.673 -16.917 1.00 29.98 ? 284  LYS A CG    1 
ATOM   1767  N  N     . TYR A  1 257 ? 86.936  100.527 -13.927 1.00 27.50 ? 285  TYR A N     1 
ATOM   1768  C  CA    . TYR A  1 257 ? 86.149  99.926  -12.854 1.00 27.46 ? 285  TYR A CA    1 
ATOM   1769  C  C     . TYR A  1 257 ? 87.073  99.346  -11.783 1.00 27.76 ? 285  TYR A C     1 
ATOM   1770  O  O     . TYR A  1 257 ? 86.824  99.517  -10.591 1.00 26.78 ? 285  TYR A O     1 
ATOM   1771  C  CB    . TYR A  1 257 ? 85.192  98.839  -13.376 1.00 27.47 ? 285  TYR A CB    1 
ATOM   1772  C  CG    . TYR A  1 257 ? 84.298  99.260  -14.540 1.00 26.72 ? 285  TYR A CG    1 
ATOM   1773  C  CD1   . TYR A  1 257 ? 83.769  100.543 -14.616 1.00 26.15 ? 285  TYR A CD1   1 
ATOM   1774  C  CD2   . TYR A  1 257 ? 83.986  98.366  -15.564 1.00 27.16 ? 285  TYR A CD2   1 
ATOM   1775  C  CE1   . TYR A  1 257 ? 82.958  100.931 -15.680 1.00 27.31 ? 285  TYR A CE1   1 
ATOM   1776  C  CE2   . TYR A  1 257 ? 83.169  98.752  -16.634 1.00 26.83 ? 285  TYR A CE2   1 
ATOM   1777  C  CZ    . TYR A  1 257 ? 82.659  100.032 -16.678 1.00 25.98 ? 285  TYR A CZ    1 
ATOM   1778  O  OH    . TYR A  1 257 ? 81.857  100.432 -17.729 1.00 28.05 ? 285  TYR A OH    1 
ATOM   1779  N  N     . ALA A  1 258 ? 88.143  98.685  -12.220 1.00 28.12 ? 286  ALA A N     1 
ATOM   1780  C  CA    . ALA A  1 258 ? 89.060  98.006  -11.318 1.00 28.51 ? 286  ALA A CA    1 
ATOM   1781  C  C     . ALA A  1 258 ? 89.752  99.003  -10.386 1.00 29.36 ? 286  ALA A C     1 
ATOM   1782  O  O     . ALA A  1 258 ? 89.726  98.837  -9.160  1.00 29.55 ? 286  ALA A O     1 
ATOM   1783  C  CB    . ALA A  1 258 ? 90.091  97.198  -12.112 1.00 28.17 ? 286  ALA A CB    1 
ATOM   1784  N  N     . ILE A  1 259 ? 90.351  100.040 -10.967 1.00 29.78 ? 287  ILE A N     1 
ATOM   1785  C  CA    . ILE A  1 259 ? 91.034  101.052 -10.176 1.00 29.98 ? 287  ILE A CA    1 
ATOM   1786  C  C     . ILE A  1 259 ? 90.044  101.944 -9.403  1.00 29.51 ? 287  ILE A C     1 
ATOM   1787  O  O     . ILE A  1 259 ? 90.361  102.422 -8.318  1.00 28.85 ? 287  ILE A O     1 
ATOM   1788  C  CB    . ILE A  1 259 ? 92.056  101.890 -11.031 1.00 30.67 ? 287  ILE A CB    1 
ATOM   1789  C  CG1   . ILE A  1 259 ? 93.009  102.688 -10.119 1.00 31.54 ? 287  ILE A CG1   1 
ATOM   1790  C  CG2   . ILE A  1 259 ? 91.341  102.819 -11.989 1.00 29.44 ? 287  ILE A CG2   1 
ATOM   1791  C  CD1   . ILE A  1 259 ? 93.709  101.884 -9.013  1.00 33.96 ? 287  ILE A CD1   1 
ATOM   1792  N  N     . GLY A  1 260 ? 88.845  102.146 -9.942  1.00 28.91 ? 288  GLY A N     1 
ATOM   1793  C  CA    . GLY A  1 260 ? 87.787  102.804 -9.185  1.00 29.36 ? 288  GLY A CA    1 
ATOM   1794  C  C     . GLY A  1 260 ? 87.481  102.074 -7.881  1.00 29.50 ? 288  GLY A C     1 
ATOM   1795  O  O     . GLY A  1 260 ? 87.385  102.690 -6.815  1.00 29.07 ? 288  GLY A O     1 
ATOM   1796  N  N     . SER A  1 261 ? 87.347  100.753 -7.959  1.00 29.64 ? 289  SER A N     1 
ATOM   1797  C  CA    . SER A  1 261 ? 87.003  99.963  -6.778  1.00 30.22 ? 289  SER A CA    1 
ATOM   1798  C  C     . SER A  1 261 ? 88.204  99.933  -5.802  1.00 29.77 ? 289  SER A C     1 
ATOM   1799  O  O     . SER A  1 261 ? 88.024  100.017 -4.577  1.00 29.29 ? 289  SER A O     1 
ATOM   1800  C  CB    . SER A  1 261 ? 86.537  98.556  -7.188  1.00 30.39 ? 289  SER A CB    1 
ATOM   1801  O  OG    . SER A  1 261 ? 87.644  97.756  -7.590  1.00 32.69 ? 289  SER A OG    1 
ATOM   1802  N  N     . LEU A  1 262 ? 89.414  99.861  -6.357  1.00 29.28 ? 290  LEU A N     1 
ATOM   1803  C  CA    . LEU A  1 262 ? 90.650  99.920  -5.569  1.00 29.64 ? 290  LEU A CA    1 
ATOM   1804  C  C     . LEU A  1 262 ? 90.866  101.246 -4.818  1.00 29.25 ? 290  LEU A C     1 
ATOM   1805  O  O     . LEU A  1 262 ? 91.460  101.224 -3.751  1.00 30.12 ? 290  LEU A O     1 
ATOM   1806  C  CB    . LEU A  1 262 ? 91.880  99.604  -6.441  1.00 29.25 ? 290  LEU A CB    1 
ATOM   1807  C  CG    . LEU A  1 262 ? 91.979  98.119  -6.820  1.00 30.92 ? 290  LEU A CG    1 
ATOM   1808  C  CD1   . LEU A  1 262 ? 92.999  97.872  -7.940  1.00 31.10 ? 290  LEU A CD1   1 
ATOM   1809  C  CD2   . LEU A  1 262 ? 92.329  97.296  -5.596  1.00 31.52 ? 290  LEU A CD2   1 
ATOM   1810  N  N     . ASN A  1 263 ? 90.404  102.374 -5.363  1.00 28.95 ? 291  ASN A N     1 
ATOM   1811  C  CA    . ASN A  1 263 ? 90.428  103.664 -4.640  1.00 29.20 ? 291  ASN A CA    1 
ATOM   1812  C  C     . ASN A  1 263 ? 89.605  103.583 -3.341  1.00 29.11 ? 291  ASN A C     1 
ATOM   1813  O  O     . ASN A  1 263 ? 90.032  104.086 -2.301  1.00 29.07 ? 291  ASN A O     1 
ATOM   1814  C  CB    . ASN A  1 263 ? 89.913  104.823 -5.524  1.00 29.35 ? 291  ASN A CB    1 
ATOM   1815  C  CG    . ASN A  1 263 ? 90.887  105.214 -6.641  1.00 29.55 ? 291  ASN A CG    1 
ATOM   1816  O  OD1   . ASN A  1 263 ? 92.098  105.036 -6.525  1.00 28.90 ? 291  ASN A OD1   1 
ATOM   1817  N  ND2   . ASN A  1 263 ? 90.349  105.768 -7.724  1.00 29.52 ? 291  ASN A ND2   1 
ATOM   1818  N  N     . GLU A  1 264 ? 88.444  102.925 -3.391  1.00 28.55 ? 292  GLU A N     1 
ATOM   1819  C  CA    . GLU A  1 264 ? 87.668  102.623 -2.183  1.00 28.77 ? 292  GLU A CA    1 
ATOM   1820  C  C     . GLU A  1 264 ? 88.306  101.525 -1.334  1.00 28.00 ? 292  GLU A C     1 
ATOM   1821  O  O     . GLU A  1 264 ? 88.287  101.597 -0.102  1.00 27.38 ? 292  GLU A O     1 
ATOM   1822  C  CB    . GLU A  1 264 ? 86.238  102.188 -2.528  1.00 29.10 ? 292  GLU A CB    1 
ATOM   1823  C  CG    . GLU A  1 264 ? 85.473  103.263 -3.229  1.00 31.56 ? 292  GLU A CG    1 
ATOM   1824  C  CD    . GLU A  1 264 ? 84.008  102.925 -3.423  1.00 34.33 ? 292  GLU A CD    1 
ATOM   1825  O  OE1   . GLU A  1 264 ? 83.427  102.176 -2.600  1.00 36.07 ? 292  GLU A OE1   1 
ATOM   1826  O  OE2   . GLU A  1 264 ? 83.449  103.437 -4.410  1.00 37.07 ? 292  GLU A OE2   1 
ATOM   1827  N  N     . GLY A  1 265 ? 88.846  100.505 -1.990  1.00 27.50 ? 293  GLY A N     1 
ATOM   1828  C  CA    . GLY A  1 265 ? 89.504  99.424  -1.291  1.00 27.74 ? 293  GLY A CA    1 
ATOM   1829  C  C     . GLY A  1 265 ? 90.701  99.936  -0.500  1.00 27.83 ? 293  GLY A C     1 
ATOM   1830  O  O     . GLY A  1 265 ? 91.107  99.332  0.476   1.00 28.85 ? 293  GLY A O     1 
ATOM   1831  N  N     . ARG A  1 266 ? 91.272  101.058 -0.924  1.00 27.95 ? 294  ARG A N     1 
ATOM   1832  C  CA    . ARG A  1 266 ? 92.416  101.626 -0.220  1.00 27.45 ? 294  ARG A CA    1 
ATOM   1833  C  C     . ARG A  1 266 ? 92.013  102.187 1.128   1.00 27.11 ? 294  ARG A C     1 
ATOM   1834  O  O     . ARG A  1 266 ? 92.784  102.081 2.087   1.00 26.67 ? 294  ARG A O     1 
ATOM   1835  C  CB    . ARG A  1 266 ? 93.146  102.641 -1.083  1.00 27.68 ? 294  ARG A CB    1 
ATOM   1836  C  CG    . ARG A  1 266 ? 94.011  101.902 -2.092  1.00 29.75 ? 294  ARG A CG    1 
ATOM   1837  C  CD    . ARG A  1 266 ? 94.383  102.719 -3.279  1.00 33.67 ? 294  ARG A CD    1 
ATOM   1838  N  NE    . ARG A  1 266 ? 95.071  101.892 -4.275  1.00 35.86 ? 294  ARG A NE    1 
ATOM   1839  C  CZ    . ARG A  1 266 ? 95.663  102.381 -5.364  1.00 37.69 ? 294  ARG A CZ    1 
ATOM   1840  N  NH1   . ARG A  1 266 ? 95.655  103.690 -5.615  1.00 38.53 ? 294  ARG A NH1   1 
ATOM   1841  N  NH2   . ARG A  1 266 ? 96.272  101.556 -6.202  1.00 36.96 ? 294  ARG A NH2   1 
ATOM   1842  N  N     . ILE A  1 267 ? 90.790  102.716 1.209   1.00 26.20 ? 295  ILE A N     1 
ATOM   1843  C  CA    . ILE A  1 267 ? 90.219  103.112 2.493   1.00 26.08 ? 295  ILE A CA    1 
ATOM   1844  C  C     . ILE A  1 267 ? 89.929  101.874 3.330   1.00 26.34 ? 295  ILE A C     1 
ATOM   1845  O  O     . ILE A  1 267 ? 90.170  101.876 4.544   1.00 27.04 ? 295  ILE A O     1 
ATOM   1846  C  CB    . ILE A  1 267 ? 88.936  103.973 2.337   1.00 25.82 ? 295  ILE A CB    1 
ATOM   1847  C  CG1   . ILE A  1 267 ? 89.202  105.159 1.402   1.00 25.56 ? 295  ILE A CG1   1 
ATOM   1848  C  CG2   . ILE A  1 267 ? 88.477  104.495 3.714   1.00 25.98 ? 295  ILE A CG2   1 
ATOM   1849  C  CD1   . ILE A  1 267 ? 87.971  105.963 1.070   1.00 24.91 ? 295  ILE A CD1   1 
ATOM   1850  N  N     . GLY A  1 268 ? 89.421  100.813 2.690   1.00 26.27 ? 296  GLY A N     1 
ATOM   1851  C  CA    . GLY A  1 268 ? 89.205  99.520  3.363   1.00 26.17 ? 296  GLY A CA    1 
ATOM   1852  C  C     . GLY A  1 268 ? 90.459  98.911  3.976   1.00 25.98 ? 296  GLY A C     1 
ATOM   1853  O  O     . GLY A  1 268 ? 90.429  98.372  5.092   1.00 25.32 ? 296  GLY A O     1 
ATOM   1854  N  N     . ILE A  1 269 ? 91.569  98.973  3.244   1.00 25.99 ? 297  ILE A N     1 
ATOM   1855  C  CA    . ILE A  1 269 ? 92.832  98.429  3.746   1.00 25.76 ? 297  ILE A CA    1 
ATOM   1856  C  C     . ILE A  1 269 ? 93.429  99.343  4.840   1.00 25.55 ? 297  ILE A C     1 
ATOM   1857  O  O     . ILE A  1 269 ? 93.969  98.859  5.825   1.00 24.97 ? 297  ILE A O     1 
ATOM   1858  C  CB    . ILE A  1 269 ? 93.836  98.169  2.599   1.00 26.04 ? 297  ILE A CB    1 
ATOM   1859  C  CG1   . ILE A  1 269 ? 93.287  97.070  1.652   1.00 26.18 ? 297  ILE A CG1   1 
ATOM   1860  C  CG2   . ILE A  1 269 ? 95.259  97.810  3.161   1.00 25.74 ? 297  ILE A CG2   1 
ATOM   1861  C  CD1   . ILE A  1 269 ? 92.884  95.710  2.295   1.00 24.53 ? 297  ILE A CD1   1 
ATOM   1862  N  N     . ALA A  1 270 ? 93.278  100.657 4.683   1.00 25.49 ? 298  ALA A N     1 
ATOM   1863  C  CA    . ALA A  1 270 ? 93.612  101.591 5.750   1.00 25.29 ? 298  ALA A CA    1 
ATOM   1864  C  C     . ALA A  1 270 ? 92.899  101.212 7.047   1.00 25.48 ? 298  ALA A C     1 
ATOM   1865  O  O     . ALA A  1 270 ? 93.513  101.215 8.123   1.00 25.84 ? 298  ALA A O     1 
ATOM   1866  C  CB    . ALA A  1 270 ? 93.260  103.016 5.360   1.00 24.82 ? 298  ALA A CB    1 
ATOM   1867  N  N     . ALA A  1 271 ? 91.613  100.881 6.937   1.00 24.72 ? 299  ALA A N     1 
ATOM   1868  C  CA    . ALA A  1 271 ? 90.815  100.461 8.094   1.00 24.97 ? 299  ALA A CA    1 
ATOM   1869  C  C     . ALA A  1 271 ? 91.315  99.138  8.690   1.00 24.53 ? 299  ALA A C     1 
ATOM   1870  O  O     . ALA A  1 271 ? 91.337  98.978  9.905   1.00 24.97 ? 299  ALA A O     1 
ATOM   1871  C  CB    . ALA A  1 271 ? 89.317  100.345 7.712   1.00 24.05 ? 299  ALA A CB    1 
ATOM   1872  N  N     . GLN A  1 272 ? 91.677  98.178  7.841   1.00 24.57 ? 300  GLN A N     1 
ATOM   1873  C  CA    . GLN A  1 272 ? 92.256  96.919  8.315   1.00 24.33 ? 300  GLN A CA    1 
ATOM   1874  C  C     . GLN A  1 272 ? 93.561  97.149  9.087   1.00 24.80 ? 300  GLN A C     1 
ATOM   1875  O  O     . GLN A  1 272 ? 93.774  96.582  10.162  1.00 24.37 ? 300  GLN A O     1 
ATOM   1876  C  CB    . GLN A  1 272 ? 92.546  95.990  7.142   1.00 24.59 ? 300  GLN A CB    1 
ATOM   1877  C  CG    . GLN A  1 272 ? 93.190  94.654  7.520   1.00 24.57 ? 300  GLN A CG    1 
ATOM   1878  C  CD    . GLN A  1 272 ? 93.972  94.038  6.381   1.00 25.31 ? 300  GLN A CD    1 
ATOM   1879  O  OE1   . GLN A  1 272 ? 94.522  94.753  5.531   1.00 26.24 ? 300  GLN A OE1   1 
ATOM   1880  N  NE2   . GLN A  1 272 ? 94.040  92.700  6.353   1.00 26.12 ? 300  GLN A NE2   1 
ATOM   1881  N  N     . MET A  1 273 ? 94.449  97.942  8.501   1.00 24.99 ? 301  MET A N     1 
ATOM   1882  C  CA    . MET A  1 273 ? 95.755  98.239  9.118   1.00 25.37 ? 301  MET A CA    1 
ATOM   1883  C  C     . MET A  1 273 ? 95.596  98.998  10.423  1.00 25.30 ? 301  MET A C     1 
ATOM   1884  O  O     . MET A  1 273 ? 96.291  98.722  11.409  1.00 25.27 ? 301  MET A O     1 
ATOM   1885  C  CB    . MET A  1 273 ? 96.610  99.027  8.139   1.00 25.01 ? 301  MET A CB    1 
ATOM   1886  C  CG    . MET A  1 273 ? 97.075  98.193  6.962   1.00 26.86 ? 301  MET A CG    1 
ATOM   1887  S  SD    . MET A  1 273 ? 98.299  96.963  7.461   1.00 28.26 ? 301  MET A SD    1 
ATOM   1888  C  CE    . MET A  1 273 ? 97.572  95.446  6.826   1.00 25.99 ? 301  MET A CE    1 
ATOM   1889  N  N     . LEU A  1 274 ? 94.668  99.943  10.414  1.00 25.65 ? 302  LEU A N     1 
ATOM   1890  C  CA    . LEU A  1 274 ? 94.282  100.687 11.610  1.00 26.31 ? 302  LEU A CA    1 
ATOM   1891  C  C     . LEU A  1 274 ? 93.786  99.766  12.712  1.00 26.03 ? 302  LEU A C     1 
ATOM   1892  O  O     . LEU A  1 274 ? 94.236  99.869  13.837  1.00 25.03 ? 302  LEU A O     1 
ATOM   1893  C  CB    . LEU A  1 274 ? 93.193  101.712 11.282  1.00 26.83 ? 302  LEU A CB    1 
ATOM   1894  C  CG    . LEU A  1 274 ? 92.585  102.527 12.439  1.00 26.74 ? 302  LEU A CG    1 
ATOM   1895  C  CD1   . LEU A  1 274 ? 93.660  103.401 13.127  1.00 27.42 ? 302  LEU A CD1   1 
ATOM   1896  C  CD2   . LEU A  1 274 ? 91.389  103.372 11.928  1.00 26.26 ? 302  LEU A CD2   1 
ATOM   1897  N  N     . GLY A  1 275 ? 92.841  98.885  12.382  1.00 25.51 ? 303  GLY A N     1 
ATOM   1898  C  CA    . GLY A  1 275 ? 92.254  98.012  13.373  1.00 25.53 ? 303  GLY A CA    1 
ATOM   1899  C  C     . GLY A  1 275 ? 93.253  97.026  13.954  1.00 25.41 ? 303  GLY A C     1 
ATOM   1900  O  O     . GLY A  1 275 ? 93.264  96.783  15.154  1.00 24.95 ? 303  GLY A O     1 
ATOM   1901  N  N     . LEU A  1 276 ? 94.081  96.434  13.098  1.00 25.44 ? 304  LEU A N     1 
ATOM   1902  C  CA    . LEU A  1 276 ? 95.095  95.498  13.571  1.00 26.21 ? 304  LEU A CA    1 
ATOM   1903  C  C     . LEU A  1 276 ? 96.129  96.184  14.471  1.00 25.93 ? 304  LEU A C     1 
ATOM   1904  O  O     . LEU A  1 276 ? 96.475  95.646  15.522  1.00 25.98 ? 304  LEU A O     1 
ATOM   1905  C  CB    . LEU A  1 276 ? 95.722  94.700  12.402  1.00 26.82 ? 304  LEU A CB    1 
ATOM   1906  C  CG    . LEU A  1 276 ? 96.984  95.082  11.656  1.00 28.31 ? 304  LEU A CG    1 
ATOM   1907  C  CD1   . LEU A  1 276 ? 98.202  94.831  12.566  1.00 26.45 ? 304  LEU A CD1   1 
ATOM   1908  C  CD2   . LEU A  1 276 ? 97.101  94.264  10.345  1.00 26.00 ? 304  LEU A CD2   1 
ATOM   1909  N  N     . ALA A  1 277 ? 96.554  97.394  14.098  1.00 26.36 ? 305  ALA A N     1 
ATOM   1910  C  CA    . ALA A  1 277 ? 97.504  98.159  14.914  1.00 25.88 ? 305  ALA A CA    1 
ATOM   1911  C  C     . ALA A  1 277 ? 96.873  98.532  16.252  1.00 26.17 ? 305  ALA A C     1 
ATOM   1912  O  O     . ALA A  1 277 ? 97.527  98.476  17.310  1.00 25.57 ? 305  ALA A O     1 
ATOM   1913  C  CB    . ALA A  1 277 ? 98.006  99.414  14.163  1.00 25.30 ? 305  ALA A CB    1 
ATOM   1914  N  N     . GLN A  1 278 ? 95.597  98.913  16.203  1.00 26.25 ? 306  GLN A N     1 
ATOM   1915  C  CA    . GLN A  1 278 ? 94.872  99.265  17.404  1.00 26.31 ? 306  GLN A CA    1 
ATOM   1916  C  C     . GLN A  1 278 ? 94.730  98.053  18.330  1.00 26.24 ? 306  GLN A C     1 
ATOM   1917  O  O     . GLN A  1 278 ? 94.988  98.174  19.522  1.00 25.98 ? 306  GLN A O     1 
ATOM   1918  C  CB    . GLN A  1 278 ? 93.506  99.858  17.077  1.00 26.66 ? 306  GLN A CB    1 
ATOM   1919  C  CG    . GLN A  1 278 ? 92.790  100.498 18.300  1.00 27.58 ? 306  GLN A CG    1 
ATOM   1920  C  CD    . GLN A  1 278 ? 93.507  101.744 18.841  1.00 28.37 ? 306  GLN A CD    1 
ATOM   1921  O  OE1   . GLN A  1 278 ? 93.700  102.728 18.123  1.00 29.86 ? 306  GLN A OE1   1 
ATOM   1922  N  NE2   . GLN A  1 278 ? 93.899  101.703 20.103  1.00 27.47 ? 306  GLN A NE2   1 
ATOM   1923  N  N     . GLY A  1 279 ? 94.340  96.904  17.774  1.00 26.07 ? 307  GLY A N     1 
ATOM   1924  C  CA    . GLY A  1 279 ? 94.236  95.655  18.535  1.00 25.86 ? 307  GLY A CA    1 
ATOM   1925  C  C     . GLY A  1 279 ? 95.535  95.290  19.228  1.00 26.13 ? 307  GLY A C     1 
ATOM   1926  O  O     . GLY A  1 279 ? 95.547  94.912  20.392  1.00 24.93 ? 307  GLY A O     1 
ATOM   1927  N  N     . CYS A  1 280 ? 96.632  95.402  18.494  1.00 26.57 ? 308  CYS A N     1 
ATOM   1928  C  CA    . CYS A  1 280 ? 97.945  95.097  19.020  1.00 26.64 ? 308  CYS A CA    1 
ATOM   1929  C  C     . CYS A  1 280 ? 98.280  96.050  20.167  1.00 25.97 ? 308  CYS A C     1 
ATOM   1930  O  O     . CYS A  1 280 ? 98.679  95.612  21.247  1.00 25.54 ? 308  CYS A O     1 
ATOM   1931  C  CB    . CYS A  1 280 ? 98.974  95.199  17.903  1.00 27.14 ? 308  CYS A CB    1 
ATOM   1932  S  SG    . CYS A  1 280 ? 100.597 94.601  18.323  1.00 28.78 ? 308  CYS A SG    1 
ATOM   1933  N  N     . PHE A  1 281 ? 98.072  97.341  19.925  1.00 26.20 ? 309  PHE A N     1 
ATOM   1934  C  CA    . PHE A  1 281 ? 98.289  98.385  20.917  1.00 26.50 ? 309  PHE A CA    1 
ATOM   1935  C  C     . PHE A  1 281 ? 97.442  98.125  22.162  1.00 26.97 ? 309  PHE A C     1 
ATOM   1936  O  O     . PHE A  1 281 ? 97.965  98.141  23.277  1.00 26.77 ? 309  PHE A O     1 
ATOM   1937  C  CB    . PHE A  1 281 ? 97.956  99.761  20.314  1.00 26.61 ? 309  PHE A CB    1 
ATOM   1938  C  CG    . PHE A  1 281 ? 98.366  100.920 21.164  1.00 26.11 ? 309  PHE A CG    1 
ATOM   1939  C  CD1   . PHE A  1 281 ? 99.665  101.430 21.104  1.00 25.60 ? 309  PHE A CD1   1 
ATOM   1940  C  CD2   . PHE A  1 281 ? 97.456  101.543 21.982  1.00 26.03 ? 309  PHE A CD2   1 
ATOM   1941  C  CE1   . PHE A  1 281 ? 100.040 102.526 21.891  1.00 23.28 ? 309  PHE A CE1   1 
ATOM   1942  C  CE2   . PHE A  1 281 ? 97.833  102.648 22.759  1.00 25.57 ? 309  PHE A CE2   1 
ATOM   1943  C  CZ    . PHE A  1 281 ? 99.113  103.130 22.707  1.00 24.49 ? 309  PHE A CZ    1 
ATOM   1944  N  N     . ASP A  1 282 ? 96.148  97.860  21.955  1.00 26.99 ? 310  ASP A N     1 
ATOM   1945  C  CA    . ASP A  1 282 ? 95.197  97.624  23.038  1.00 27.51 ? 310  ASP A CA    1 
ATOM   1946  C  C     . ASP A  1 282 ? 95.600  96.435  23.912  1.00 27.41 ? 310  ASP A C     1 
ATOM   1947  O  O     . ASP A  1 282 ? 95.422  96.478  25.119  1.00 26.81 ? 310  ASP A O     1 
ATOM   1948  C  CB    . ASP A  1 282 ? 93.788  97.370  22.491  1.00 27.35 ? 310  ASP A CB    1 
ATOM   1949  C  CG    . ASP A  1 282 ? 93.110  98.629  21.938  1.00 28.54 ? 310  ASP A CG    1 
ATOM   1950  O  OD1   . ASP A  1 282 ? 93.599  99.758  22.155  1.00 29.41 ? 310  ASP A OD1   1 
ATOM   1951  O  OD2   . ASP A  1 282 ? 92.044  98.474  21.299  1.00 29.79 ? 310  ASP A OD2   1 
ATOM   1952  N  N     . TYR A  1 283 ? 96.140  95.388  23.295  1.00 27.64 ? 311  TYR A N     1 
ATOM   1953  C  CA    . TYR A  1 283 ? 96.653  94.244  24.037  1.00 28.34 ? 311  TYR A CA    1 
ATOM   1954  C  C     . TYR A  1 283 ? 97.907  94.578  24.874  1.00 28.17 ? 311  TYR A C     1 
ATOM   1955  O  O     . TYR A  1 283 ? 98.058  94.115  26.023  1.00 28.26 ? 311  TYR A O     1 
ATOM   1956  C  CB    . TYR A  1 283 ? 96.955  93.076  23.085  1.00 28.84 ? 311  TYR A CB    1 
ATOM   1957  C  CG    . TYR A  1 283 ? 97.458  91.885  23.827  1.00 29.38 ? 311  TYR A CG    1 
ATOM   1958  C  CD1   . TYR A  1 283 ? 96.574  90.961  24.366  1.00 29.47 ? 311  TYR A CD1   1 
ATOM   1959  C  CD2   . TYR A  1 283 ? 98.824  91.707  24.052  1.00 30.58 ? 311  TYR A CD2   1 
ATOM   1960  C  CE1   . TYR A  1 283 ? 97.028  89.880  25.104  1.00 30.08 ? 311  TYR A CE1   1 
ATOM   1961  C  CE2   . TYR A  1 283 ? 99.287  90.623  24.789  1.00 30.72 ? 311  TYR A CE2   1 
ATOM   1962  C  CZ    . TYR A  1 283 ? 98.393  89.717  25.304  1.00 29.81 ? 311  TYR A CZ    1 
ATOM   1963  O  OH    . TYR A  1 283 ? 98.850  88.634  26.021  1.00 31.33 ? 311  TYR A OH    1 
ATOM   1964  N  N     . THR A  1 284 ? 98.798  95.381  24.295  1.00 27.85 ? 312  THR A N     1 
ATOM   1965  C  CA    . THR A  1 284 ? 100.125 95.608  24.862  1.00 27.61 ? 312  THR A CA    1 
ATOM   1966  C  C     . THR A  1 284 ? 100.136 96.538  26.081  1.00 27.67 ? 312  THR A C     1 
ATOM   1967  O  O     . THR A  1 284 ? 100.895 96.299  27.033  1.00 28.02 ? 312  THR A O     1 
ATOM   1968  C  CB    . THR A  1 284 ? 101.096 96.082  23.761  1.00 27.64 ? 312  THR A CB    1 
ATOM   1969  O  OG1   . THR A  1 284 ? 101.099 95.113  22.710  1.00 28.61 ? 312  THR A OG1   1 
ATOM   1970  C  CG2   . THR A  1 284 ? 102.511 96.270  24.299  1.00 27.20 ? 312  THR A CG2   1 
ATOM   1971  N  N     . ILE A  1 285 ? 99.288  97.568  26.090  1.00 27.37 ? 313  ILE A N     1 
ATOM   1972  C  CA    . ILE A  1 285 ? 99.310  98.543  27.191  1.00 26.77 ? 313  ILE A CA    1 
ATOM   1973  C  C     . ILE A  1 285 ? 99.052  97.936  28.594  1.00 26.54 ? 313  ILE A C     1 
ATOM   1974  O  O     . ILE A  1 285 ? 99.851  98.166  29.500  1.00 25.45 ? 313  ILE A O     1 
ATOM   1975  C  CB    . ILE A  1 285 ? 98.414  99.807  26.919  1.00 27.34 ? 313  ILE A CB    1 
ATOM   1976  C  CG1   . ILE A  1 285 ? 98.776  100.472 25.588  1.00 26.77 ? 313  ILE A CG1   1 
ATOM   1977  C  CG2   . ILE A  1 285 ? 98.555  100.835 28.047  1.00 26.94 ? 313  ILE A CG2   1 
ATOM   1978  C  CD1   . ILE A  1 285 ? 100.256 100.764 25.358  1.00 26.69 ? 313  ILE A CD1   1 
ATOM   1979  N  N     . PRO A  1 286 ? 97.975  97.131  28.776  1.00 26.56 ? 314  PRO A N     1 
ATOM   1980  C  CA    . PRO A  1 286 ? 97.844  96.433  30.064  1.00 26.87 ? 314  PRO A CA    1 
ATOM   1981  C  C     . PRO A  1 286 ? 99.081  95.593  30.461  1.00 27.02 ? 314  PRO A C     1 
ATOM   1982  O  O     . PRO A  1 286 ? 99.438  95.547  31.634  1.00 26.44 ? 314  PRO A O     1 
ATOM   1983  C  CB    . PRO A  1 286 ? 96.616  95.547  29.868  1.00 27.12 ? 314  PRO A CB    1 
ATOM   1984  C  CG    . PRO A  1 286 ? 95.808  96.255  28.809  1.00 27.15 ? 314  PRO A CG    1 
ATOM   1985  C  CD    . PRO A  1 286 ? 96.839  96.845  27.878  1.00 26.77 ? 314  PRO A CD    1 
ATOM   1986  N  N     . TYR A  1 287 ? 99.742  94.964  29.495  1.00 27.01 ? 315  TYR A N     1 
ATOM   1987  C  CA    . TYR A  1 287 ? 100.945 94.202  29.805  1.00 27.18 ? 315  TYR A CA    1 
ATOM   1988  C  C     . TYR A  1 287 ? 102.062 95.075  30.415  1.00 26.71 ? 315  TYR A C     1 
ATOM   1989  O  O     . TYR A  1 287 ? 102.667 94.719  31.443  1.00 25.50 ? 315  TYR A O     1 
ATOM   1990  C  CB    . TYR A  1 287 ? 101.469 93.438  28.563  1.00 27.63 ? 315  TYR A CB    1 
ATOM   1991  C  CG    . TYR A  1 287 ? 102.654 92.567  28.913  1.00 28.06 ? 315  TYR A CG    1 
ATOM   1992  C  CD1   . TYR A  1 287 ? 102.477 91.294  29.456  1.00 28.62 ? 315  TYR A CD1   1 
ATOM   1993  C  CD2   . TYR A  1 287 ? 103.958 93.039  28.745  1.00 29.30 ? 315  TYR A CD2   1 
ATOM   1994  C  CE1   . TYR A  1 287 ? 103.585 90.509  29.817  1.00 29.39 ? 315  TYR A CE1   1 
ATOM   1995  C  CE2   . TYR A  1 287 ? 105.056 92.273  29.091  1.00 30.15 ? 315  TYR A CE2   1 
ATOM   1996  C  CZ    . TYR A  1 287 ? 104.873 91.013  29.631  1.00 29.60 ? 315  TYR A CZ    1 
ATOM   1997  O  OH    . TYR A  1 287 ? 105.993 90.265  29.993  1.00 29.49 ? 315  TYR A OH    1 
ATOM   1998  N  N     . ILE A  1 288 ? 102.357 96.194  29.760  1.00 26.64 ? 316  ILE A N     1 
ATOM   1999  C  CA    . ILE A  1 288 ? 103.450 97.063  30.207  1.00 27.15 ? 316  ILE A CA    1 
ATOM   2000  C  C     . ILE A  1 288 ? 103.090 97.804  31.491  1.00 26.81 ? 316  ILE A C     1 
ATOM   2001  O  O     . ILE A  1 288 ? 103.977 98.191  32.250  1.00 26.67 ? 316  ILE A O     1 
ATOM   2002  C  CB    . ILE A  1 288 ? 103.968 98.006  29.090  1.00 27.26 ? 316  ILE A CB    1 
ATOM   2003  C  CG1   . ILE A  1 288 ? 102.881 98.948  28.551  1.00 27.39 ? 316  ILE A CG1   1 
ATOM   2004  C  CG2   . ILE A  1 288 ? 104.541 97.181  27.942  1.00 27.75 ? 316  ILE A CG2   1 
ATOM   2005  C  CD1   . ILE A  1 288 ? 103.466 100.093 27.727  1.00 27.98 ? 316  ILE A CD1   1 
ATOM   2006  N  N     . LYS A  1 289 ? 101.789 97.933  31.758  1.00 27.08 ? 317  LYS A N     1 
ATOM   2007  C  CA    . LYS A  1 289 ? 101.302 98.409  33.067  1.00 27.71 ? 317  LYS A CA    1 
ATOM   2008  C  C     . LYS A  1 289 ? 101.568 97.420  34.213  1.00 27.85 ? 317  LYS A C     1 
ATOM   2009  O  O     . LYS A  1 289 ? 101.825 97.829  35.342  1.00 27.73 ? 317  LYS A O     1 
ATOM   2010  C  CB    . LYS A  1 289 ? 99.804  98.738  33.012  1.00 27.39 ? 317  LYS A CB    1 
ATOM   2011  C  CG    . LYS A  1 289 ? 99.488  99.990  32.191  1.00 27.65 ? 317  LYS A CG    1 
ATOM   2012  C  CD    . LYS A  1 289 ? 98.001  100.306 32.170  1.00 27.11 ? 317  LYS A CD    1 
ATOM   2013  C  CE    . LYS A  1 289 ? 97.465  100.612 33.561  1.00 28.13 ? 317  LYS A CE    1 
ATOM   2014  N  NZ    . LYS A  1 289 ? 96.283  101.494 33.503  1.00 26.97 ? 317  LYS A NZ    1 
ATOM   2015  N  N     . GLU A  1 290 ? 101.505 96.127  33.917  1.00 27.99 ? 318  GLU A N     1 
ATOM   2016  C  CA    . GLU A  1 290 ? 101.604 95.090  34.958  1.00 28.48 ? 318  GLU A CA    1 
ATOM   2017  C  C     . GLU A  1 290 ? 102.988 94.493  35.127  1.00 27.69 ? 318  GLU A C     1 
ATOM   2018  O  O     . GLU A  1 290 ? 103.324 94.057  36.209  1.00 27.40 ? 318  GLU A O     1 
ATOM   2019  C  CB    . GLU A  1 290 ? 100.640 93.956  34.648  1.00 29.33 ? 318  GLU A CB    1 
ATOM   2020  C  CG    . GLU A  1 290 ? 99.220  94.346  34.971  1.00 32.89 ? 318  GLU A CG    1 
ATOM   2021  C  CD    . GLU A  1 290 ? 98.187  93.613  34.158  1.00 38.27 ? 318  GLU A CD    1 
ATOM   2022  O  OE1   . GLU A  1 290 ? 98.540  92.888  33.181  1.00 42.61 ? 318  GLU A OE1   1 
ATOM   2023  O  OE2   . GLU A  1 290 ? 96.996  93.792  34.507  1.00 42.64 ? 318  GLU A OE2   1 
ATOM   2024  N  N     . ARG A  1 291 ? 103.763 94.441  34.050  1.00 26.99 ? 319  ARG A N     1 
ATOM   2025  C  CA    . ARG A  1 291 ? 105.099 93.848  34.101  1.00 27.15 ? 319  ARG A CA    1 
ATOM   2026  C  C     . ARG A  1 291 ? 106.027 94.788  34.868  1.00 26.62 ? 319  ARG A C     1 
ATOM   2027  O  O     . ARG A  1 291 ? 106.124 95.965  34.527  1.00 26.48 ? 319  ARG A O     1 
ATOM   2028  C  CB    . ARG A  1 291 ? 105.643 93.584  32.688  1.00 27.23 ? 319  ARG A CB    1 
ATOM   2029  C  CG    . ARG A  1 291 ? 106.738 92.488  32.614  1.00 27.84 ? 319  ARG A CG    1 
ATOM   2030  C  CD    . ARG A  1 291 ? 108.068 92.914  33.230  1.00 28.23 ? 319  ARG A CD    1 
ATOM   2031  N  NE    . ARG A  1 291 ? 109.148 92.025  32.785  1.00 27.00 ? 319  ARG A NE    1 
ATOM   2032  C  CZ    . ARG A  1 291 ? 109.387 90.810  33.273  1.00 27.42 ? 319  ARG A CZ    1 
ATOM   2033  N  NH1   . ARG A  1 291 ? 108.677 90.311  34.286  1.00 27.32 ? 319  ARG A NH1   1 
ATOM   2034  N  NH2   . ARG A  1 291 ? 110.375 90.097  32.749  1.00 28.30 ? 319  ARG A NH2   1 
ATOM   2035  N  N     . ILE A  1 292 ? 106.688 94.250  35.895  1.00 26.35 ? 320  ILE A N     1 
ATOM   2036  C  CA    . ILE A  1 292 ? 107.634 94.978  36.740  1.00 26.59 ? 320  ILE A CA    1 
ATOM   2037  C  C     . ILE A  1 292 ? 109.097 94.544  36.493  1.00 26.20 ? 320  ILE A C     1 
ATOM   2038  O  O     . ILE A  1 292 ? 109.429 93.346  36.510  1.00 25.29 ? 320  ILE A O     1 
ATOM   2039  C  CB    . ILE A  1 292 ? 107.276 94.795  38.252  1.00 26.85 ? 320  ILE A CB    1 
ATOM   2040  C  CG1   . ILE A  1 292 ? 105.827 95.243  38.546  1.00 27.53 ? 320  ILE A CG1   1 
ATOM   2041  C  CG2   . ILE A  1 292 ? 108.260 95.535  39.171  1.00 26.97 ? 320  ILE A CG2   1 
ATOM   2042  C  CD1   . ILE A  1 292 ? 105.512 96.675  38.172  1.00 28.85 ? 320  ILE A CD1   1 
ATOM   2043  N  N     . GLN A  1 293 ? 109.956 95.534  36.248  1.00 26.15 ? 321  GLN A N     1 
ATOM   2044  C  CA    . GLN A  1 293 ? 111.419 95.358  36.264  1.00 26.46 ? 321  GLN A CA    1 
ATOM   2045  C  C     . GLN A  1 293 ? 112.032 96.542  36.997  1.00 26.44 ? 321  GLN A C     1 
ATOM   2046  O  O     . GLN A  1 293 ? 111.496 97.650  36.929  1.00 25.83 ? 321  GLN A O     1 
ATOM   2047  C  CB    . GLN A  1 293 ? 111.995 95.270  34.836  1.00 26.51 ? 321  GLN A CB    1 
ATOM   2048  C  CG    . GLN A  1 293 ? 111.656 93.980  34.105  1.00 26.36 ? 321  GLN A CG    1 
ATOM   2049  C  CD    . GLN A  1 293 ? 112.453 92.789  34.612  1.00 27.29 ? 321  GLN A CD    1 
ATOM   2050  O  OE1   . GLN A  1 293 ? 113.580 92.556  34.165  1.00 26.47 ? 321  GLN A OE1   1 
ATOM   2051  N  NE2   . GLN A  1 293 ? 111.873 92.024  35.557  1.00 25.20 ? 321  GLN A NE2   1 
ATOM   2052  N  N     . PHE A  1 294 ? 113.138 96.300  37.703  1.00 26.91 ? 322  PHE A N     1 
ATOM   2053  C  CA    . PHE A  1 294 ? 113.841 97.329  38.480  1.00 27.45 ? 322  PHE A CA    1 
ATOM   2054  C  C     . PHE A  1 294 ? 112.883 98.035  39.447  1.00 28.08 ? 322  PHE A C     1 
ATOM   2055  O  O     . PHE A  1 294 ? 113.009 99.238  39.690  1.00 27.69 ? 322  PHE A O     1 
ATOM   2056  C  CB    . PHE A  1 294 ? 114.495 98.374  37.566  1.00 27.65 ? 322  PHE A CB    1 
ATOM   2057  C  CG    . PHE A  1 294 ? 115.397 97.800  36.512  1.00 28.01 ? 322  PHE A CG    1 
ATOM   2058  C  CD1   . PHE A  1 294 ? 116.743 97.539  36.794  1.00 29.43 ? 322  PHE A CD1   1 
ATOM   2059  C  CD2   . PHE A  1 294 ? 114.915 97.547  35.240  1.00 28.08 ? 322  PHE A CD2   1 
ATOM   2060  C  CE1   . PHE A  1 294 ? 117.589 97.034  35.809  1.00 29.37 ? 322  PHE A CE1   1 
ATOM   2061  C  CE2   . PHE A  1 294 ? 115.751 97.027  34.244  1.00 30.26 ? 322  PHE A CE2   1 
ATOM   2062  C  CZ    . PHE A  1 294 ? 117.092 96.774  34.531  1.00 28.84 ? 322  PHE A CZ    1 
ATOM   2063  N  N     . GLY A  1 295 ? 111.916 97.280  39.972  1.00 28.69 ? 323  GLY A N     1 
ATOM   2064  C  CA    . GLY A  1 295 ? 110.936 97.816  40.915  1.00 29.68 ? 323  GLY A CA    1 
ATOM   2065  C  C     . GLY A  1 295 ? 109.857 98.712  40.331  1.00 30.08 ? 323  GLY A C     1 
ATOM   2066  O  O     . GLY A  1 295 ? 109.021 99.224  41.078  1.00 30.68 ? 323  GLY A O     1 
ATOM   2067  N  N     . LYS A  1 296 ? 109.871 98.901  39.011  1.00 30.23 ? 324  LYS A N     1 
ATOM   2068  C  CA    . LYS A  1 296 ? 108.933 99.782  38.324  1.00 31.07 ? 324  LYS A CA    1 
ATOM   2069  C  C     . LYS A  1 296 ? 108.117 99.024  37.284  1.00 30.23 ? 324  LYS A C     1 
ATOM   2070  O  O     . LYS A  1 296 ? 108.609 98.059  36.684  1.00 30.07 ? 324  LYS A O     1 
ATOM   2071  C  CB    . LYS A  1 296 ? 109.685 100.900 37.596  1.00 30.94 ? 324  LYS A CB    1 
ATOM   2072  C  CG    . LYS A  1 296 ? 110.371 101.911 38.518  1.00 33.10 ? 324  LYS A CG    1 
ATOM   2073  C  CD    . LYS A  1 296 ? 111.305 102.832 37.728  1.00 33.78 ? 324  LYS A CD    1 
ATOM   2074  C  CE    . LYS A  1 296 ? 110.616 103.482 36.523  1.00 36.65 ? 324  LYS A CE    1 
ATOM   2075  N  NZ    . LYS A  1 296 ? 111.256 104.779 36.090  1.00 39.06 ? 324  LYS A NZ    1 
ATOM   2076  N  N     . ARG A  1 297 ? 106.883 99.484  37.065  1.00 29.43 ? 325  ARG A N     1 
ATOM   2077  C  CA    . ARG A  1 297 ? 106.122 99.139  35.862  1.00 29.12 ? 325  ARG A CA    1 
ATOM   2078  C  C     . ARG A  1 297 ? 106.940 99.557  34.648  1.00 28.60 ? 325  ARG A C     1 
ATOM   2079  O  O     . ARG A  1 297 ? 107.545 100.639 34.644  1.00 28.17 ? 325  ARG A O     1 
ATOM   2080  C  CB    . ARG A  1 297 ? 104.775 99.889  35.788  1.00 29.32 ? 325  ARG A CB    1 
ATOM   2081  C  CG    . ARG A  1 297 ? 103.847 99.771  36.993  1.00 29.50 ? 325  ARG A CG    1 
ATOM   2082  C  CD    . ARG A  1 297 ? 102.493 100.457 36.721  1.00 30.19 ? 325  ARG A CD    1 
ATOM   2083  N  NE    . ARG A  1 297 ? 102.644 101.877 36.389  1.00 30.60 ? 325  ARG A NE    1 
ATOM   2084  C  CZ    . ARG A  1 297 ? 101.779 102.595 35.672  1.00 30.48 ? 325  ARG A CZ    1 
ATOM   2085  N  NH1   . ARG A  1 297 ? 100.649 102.069 35.208  1.00 29.67 ? 325  ARG A NH1   1 
ATOM   2086  N  NH2   . ARG A  1 297 ? 102.034 103.878 35.439  1.00 30.94 ? 325  ARG A NH2   1 
ATOM   2087  N  N     . LEU A  1 298 ? 106.940 98.717  33.614  1.00 27.76 ? 326  LEU A N     1 
ATOM   2088  C  CA    . LEU A  1 298 ? 107.600 99.043  32.344  1.00 27.92 ? 326  LEU A CA    1 
ATOM   2089  C  C     . LEU A  1 298 ? 107.080 100.377 31.788  1.00 28.26 ? 326  LEU A C     1 
ATOM   2090  O  O     . LEU A  1 298 ? 107.837 101.156 31.206  1.00 27.17 ? 326  LEU A O     1 
ATOM   2091  C  CB    . LEU A  1 298 ? 107.386 97.936  31.304  1.00 27.17 ? 326  LEU A CB    1 
ATOM   2092  C  CG    . LEU A  1 298 ? 107.988 96.546  31.582  1.00 27.68 ? 326  LEU A CG    1 
ATOM   2093  C  CD1   . LEU A  1 298 ? 107.602 95.578  30.451  1.00 23.78 ? 326  LEU A CD1   1 
ATOM   2094  C  CD2   . LEU A  1 298 ? 109.510 96.592  31.787  1.00 25.32 ? 326  LEU A CD2   1 
ATOM   2095  N  N     . PHE A  1 299 ? 105.783 100.623 31.990  1.00 28.72 ? 327  PHE A N     1 
ATOM   2096  C  CA    . PHE A  1 299 ? 105.135 101.860 31.556  1.00 28.99 ? 327  PHE A CA    1 
ATOM   2097  C  C     . PHE A  1 299 ? 105.758 103.104 32.210  1.00 28.98 ? 327  PHE A C     1 
ATOM   2098  O  O     . PHE A  1 299 ? 105.688 104.198 31.655  1.00 29.27 ? 327  PHE A O     1 
ATOM   2099  C  CB    . PHE A  1 299 ? 103.628 101.794 31.856  1.00 29.53 ? 327  PHE A CB    1 
ATOM   2100  C  CG    . PHE A  1 299 ? 102.818 102.865 31.160  1.00 29.02 ? 327  PHE A CG    1 
ATOM   2101  C  CD1   . PHE A  1 299 ? 102.151 102.583 29.991  1.00 29.77 ? 327  PHE A CD1   1 
ATOM   2102  C  CD2   . PHE A  1 299 ? 102.728 104.150 31.693  1.00 29.69 ? 327  PHE A CD2   1 
ATOM   2103  C  CE1   . PHE A  1 299 ? 101.402 103.560 29.337  1.00 30.37 ? 327  PHE A CE1   1 
ATOM   2104  C  CE2   . PHE A  1 299 ? 101.983 105.135 31.056  1.00 30.87 ? 327  PHE A CE2   1 
ATOM   2105  C  CZ    . PHE A  1 299 ? 101.324 104.829 29.859  1.00 31.03 ? 327  PHE A CZ    1 
ATOM   2106  N  N     . ASP A  1 300 ? 106.388 102.943 33.370  1.00 29.10 ? 328  ASP A N     1 
ATOM   2107  C  CA    . ASP A  1 300 ? 107.015 104.073 34.051  1.00 29.31 ? 328  ASP A CA    1 
ATOM   2108  C  C     . ASP A  1 300 ? 108.448 104.407 33.625  1.00 28.79 ? 328  ASP A C     1 
ATOM   2109  O  O     . ASP A  1 300 ? 109.042 105.354 34.162  1.00 29.17 ? 328  ASP A O     1 
ATOM   2110  C  CB    . ASP A  1 300 ? 106.967 103.868 35.561  1.00 29.64 ? 328  ASP A CB    1 
ATOM   2111  C  CG    . ASP A  1 300 ? 105.551 103.984 36.114  1.00 31.41 ? 328  ASP A CG    1 
ATOM   2112  O  OD1   . ASP A  1 300 ? 104.750 104.781 35.565  1.00 34.67 ? 328  ASP A OD1   1 
ATOM   2113  O  OD2   . ASP A  1 300 ? 105.250 103.284 37.083  1.00 30.96 ? 328  ASP A OD2   1 
ATOM   2114  N  N     . PHE A  1 301 ? 109.020 103.645 32.702  1.00 27.74 ? 329  PHE A N     1 
ATOM   2115  C  CA    . PHE A  1 301 ? 110.284 104.060 32.099  1.00 27.31 ? 329  PHE A CA    1 
ATOM   2116  C  C     . PHE A  1 301 ? 109.975 105.062 31.003  1.00 26.92 ? 329  PHE A C     1 
ATOM   2117  O  O     . PHE A  1 301 ? 109.279 104.738 30.051  1.00 26.63 ? 329  PHE A O     1 
ATOM   2118  C  CB    . PHE A  1 301 ? 111.045 102.862 31.564  1.00 27.61 ? 329  PHE A CB    1 
ATOM   2119  C  CG    . PHE A  1 301 ? 111.512 101.953 32.647  1.00 27.71 ? 329  PHE A CG    1 
ATOM   2120  C  CD1   . PHE A  1 301 ? 112.502 102.366 33.519  1.00 29.25 ? 329  PHE A CD1   1 
ATOM   2121  C  CD2   . PHE A  1 301 ? 110.936 100.700 32.824  1.00 28.82 ? 329  PHE A CD2   1 
ATOM   2122  C  CE1   . PHE A  1 301 ? 112.931 101.540 34.555  1.00 29.83 ? 329  PHE A CE1   1 
ATOM   2123  C  CE2   . PHE A  1 301 ? 111.356 99.865  33.863  1.00 28.16 ? 329  PHE A CE2   1 
ATOM   2124  C  CZ    . PHE A  1 301 ? 112.353 100.290 34.725  1.00 29.30 ? 329  PHE A CZ    1 
ATOM   2125  N  N     . GLN A  1 302 ? 110.471 106.282 31.163  1.00 26.82 ? 330  GLN A N     1 
ATOM   2126  C  CA    . GLN A  1 302 ? 110.086 107.383 30.272  1.00 26.71 ? 330  GLN A CA    1 
ATOM   2127  C  C     . GLN A  1 302 ? 110.400 107.127 28.792  1.00 26.78 ? 330  GLN A C     1 
ATOM   2128  O  O     . GLN A  1 302 ? 109.634 107.519 27.928  1.00 26.58 ? 330  GLN A O     1 
ATOM   2129  C  CB    . GLN A  1 302 ? 110.698 108.703 30.735  1.00 26.20 ? 330  GLN A CB    1 
ATOM   2130  C  CG    . GLN A  1 302 ? 110.103 109.911 30.027  1.00 25.55 ? 330  GLN A CG    1 
ATOM   2131  C  CD    . GLN A  1 302 ? 110.763 111.190 30.415  1.00 25.63 ? 330  GLN A CD    1 
ATOM   2132  O  OE1   . GLN A  1 302 ? 111.920 111.415 30.077  1.00 24.45 ? 330  GLN A OE1   1 
ATOM   2133  N  NE2   . GLN A  1 302 ? 110.044 112.043 31.137  1.00 24.71 ? 330  GLN A NE2   1 
ATOM   2134  N  N     . GLY A  1 303 ? 111.502 106.444 28.492  1.00 27.21 ? 331  GLY A N     1 
ATOM   2135  C  CA    . GLY A  1 303 ? 111.796 106.087 27.109  1.00 28.09 ? 331  GLY A CA    1 
ATOM   2136  C  C     . GLY A  1 303 ? 110.695 105.270 26.458  1.00 28.83 ? 331  GLY A C     1 
ATOM   2137  O  O     . GLY A  1 303 ? 110.287 105.522 25.321  1.00 28.68 ? 331  GLY A O     1 
ATOM   2138  N  N     . LEU A  1 304 ? 110.207 104.297 27.208  1.00 29.53 ? 332  LEU A N     1 
ATOM   2139  C  CA    . LEU A  1 304 ? 109.125 103.450 26.763  1.00 30.48 ? 332  LEU A CA    1 
ATOM   2140  C  C     . LEU A  1 304 ? 107.810 104.244 26.711  1.00 29.66 ? 332  LEU A C     1 
ATOM   2141  O  O     . LEU A  1 304 ? 107.029 104.100 25.778  1.00 29.57 ? 332  LEU A O     1 
ATOM   2142  C  CB    . LEU A  1 304 ? 109.052 102.234 27.695  1.00 31.15 ? 332  LEU A CB    1 
ATOM   2143  C  CG    . LEU A  1 304 ? 108.262 101.017 27.234  1.00 33.61 ? 332  LEU A CG    1 
ATOM   2144  C  CD1   . LEU A  1 304 ? 108.726 99.759  27.986  1.00 34.47 ? 332  LEU A CD1   1 
ATOM   2145  C  CD2   . LEU A  1 304 ? 106.796 101.286 27.508  1.00 33.80 ? 332  LEU A CD2   1 
ATOM   2146  N  N     . GLN A  1 305 ? 107.577 105.097 27.699  1.00 29.03 ? 333  GLN A N     1 
ATOM   2147  C  CA    . GLN A  1 305 ? 106.411 105.985 27.681  1.00 29.04 ? 333  GLN A CA    1 
ATOM   2148  C  C     . GLN A  1 305 ? 106.325 106.890 26.450  1.00 28.10 ? 333  GLN A C     1 
ATOM   2149  O  O     . GLN A  1 305 ? 105.246 107.116 25.901  1.00 26.82 ? 333  GLN A O     1 
ATOM   2150  C  CB    . GLN A  1 305 ? 106.449 106.925 28.864  1.00 29.15 ? 333  GLN A CB    1 
ATOM   2151  C  CG    . GLN A  1 305 ? 105.404 106.722 29.860  1.00 31.82 ? 333  GLN A CG    1 
ATOM   2152  C  CD    . GLN A  1 305 ? 105.587 107.682 30.992  1.00 34.79 ? 333  GLN A CD    1 
ATOM   2153  O  OE1   . GLN A  1 305 ? 105.493 108.908 30.799  1.00 36.57 ? 333  GLN A OE1   1 
ATOM   2154  N  NE2   . GLN A  1 305 ? 105.907 107.156 32.170  1.00 36.90 ? 333  GLN A NE2   1 
ATOM   2155  N  N     . HIS A  1 306 ? 107.458 107.473 26.081  1.00 26.63 ? 334  HIS A N     1 
ATOM   2156  C  CA    . HIS A  1 306 ? 107.493 108.357 24.933  1.00 26.23 ? 334  HIS A CA    1 
ATOM   2157  C  C     . HIS A  1 306 ? 107.239 107.583 23.643  1.00 26.26 ? 334  HIS A C     1 
ATOM   2158  O  O     . HIS A  1 306 ? 106.567 108.095 22.763  1.00 25.98 ? 334  HIS A O     1 
ATOM   2159  C  CB    . HIS A  1 306 ? 108.823 109.099 24.871  1.00 25.96 ? 334  HIS A CB    1 
ATOM   2160  C  CG    . HIS A  1 306 ? 108.948 110.183 25.892  1.00 24.74 ? 334  HIS A CG    1 
ATOM   2161  N  ND1   . HIS A  1 306 ? 110.038 111.020 25.949  1.00 24.14 ? 334  HIS A ND1   1 
ATOM   2162  C  CD2   . HIS A  1 306 ? 108.116 110.578 26.887  1.00 23.37 ? 334  HIS A CD2   1 
ATOM   2163  C  CE1   . HIS A  1 306 ? 109.877 111.877 26.939  1.00 26.38 ? 334  HIS A CE1   1 
ATOM   2164  N  NE2   . HIS A  1 306 ? 108.714 111.634 27.519  1.00 24.30 ? 334  HIS A NE2   1 
ATOM   2165  N  N     . GLN A  1 307 ? 107.780 106.368 23.528  1.00 26.51 ? 335  GLN A N     1 
ATOM   2166  C  CA    . GLN A  1 307 ? 107.509 105.502 22.362  1.00 27.28 ? 335  GLN A CA    1 
ATOM   2167  C  C     . GLN A  1 307 ? 106.032 105.176 22.245  1.00 26.55 ? 335  GLN A C     1 
ATOM   2168  O  O     . GLN A  1 307 ? 105.483 105.212 21.158  1.00 25.63 ? 335  GLN A O     1 
ATOM   2169  C  CB    . GLN A  1 307 ? 108.301 104.196 22.422  1.00 27.24 ? 335  GLN A CB    1 
ATOM   2170  C  CG    . GLN A  1 307 ? 109.809 104.390 22.340  1.00 29.07 ? 335  GLN A CG    1 
ATOM   2171  C  CD    . GLN A  1 307 ? 110.578 103.114 22.653  1.00 30.11 ? 335  GLN A CD    1 
ATOM   2172  O  OE1   . GLN A  1 307 ? 110.105 102.003 22.378  1.00 32.97 ? 335  GLN A OE1   1 
ATOM   2173  N  NE2   . GLN A  1 307 ? 111.774 103.268 23.231  1.00 31.78 ? 335  GLN A NE2   1 
ATOM   2174  N  N     . VAL A  1 308 ? 105.416 104.853 23.382  1.00 25.79 ? 336  VAL A N     1 
ATOM   2175  C  CA    . VAL A  1 308 ? 103.982 104.600 23.473  1.00 25.57 ? 336  VAL A CA    1 
ATOM   2176  C  C     . VAL A  1 308 ? 103.133 105.810 23.050  1.00 24.71 ? 336  VAL A C     1 
ATOM   2177  O  O     . VAL A  1 308 ? 102.199 105.695 22.255  1.00 23.25 ? 336  VAL A O     1 
ATOM   2178  C  CB    . VAL A  1 308 ? 103.597 104.127 24.917  1.00 25.49 ? 336  VAL A CB    1 
ATOM   2179  C  CG1   . VAL A  1 308 ? 102.105 104.082 25.081  1.00 25.64 ? 336  VAL A CG1   1 
ATOM   2180  C  CG2   . VAL A  1 308 ? 104.213 102.738 25.204  1.00 26.92 ? 336  VAL A CG2   1 
ATOM   2181  N  N     . ALA A  1 309 ? 103.482 106.968 23.577  1.00 23.91 ? 337  ALA A N     1 
ATOM   2182  C  CA    . ALA A  1 309 ? 102.769 108.205 23.255  1.00 24.01 ? 337  ALA A CA    1 
ATOM   2183  C  C     . ALA A  1 309 ? 102.942 108.592 21.785  1.00 24.08 ? 337  ALA A C     1 
ATOM   2184  O  O     . ALA A  1 309 ? 101.984 109.046 21.156  1.00 23.59 ? 337  ALA A O     1 
ATOM   2185  C  CB    . ALA A  1 309 ? 103.203 109.345 24.189  1.00 22.45 ? 337  ALA A CB    1 
ATOM   2186  N  N     . HIS A  1 310 ? 104.144 108.377 21.239  1.00 24.46 ? 338  HIS A N     1 
ATOM   2187  C  CA    . HIS A  1 310 ? 104.406 108.615 19.820  1.00 25.11 ? 338  HIS A CA    1 
ATOM   2188  C  C     . HIS A  1 310 ? 103.544 107.693 18.930  1.00 25.13 ? 338  HIS A C     1 
ATOM   2189  O  O     . HIS A  1 310 ? 102.864 108.148 17.985  1.00 22.68 ? 338  HIS A O     1 
ATOM   2190  C  CB    . HIS A  1 310 ? 105.904 108.462 19.516  1.00 26.84 ? 338  HIS A CB    1 
ATOM   2191  C  CG    . HIS A  1 310 ? 106.244 108.652 18.070  1.00 28.85 ? 338  HIS A CG    1 
ATOM   2192  N  ND1   . HIS A  1 310 ? 106.277 109.889 17.469  1.00 33.43 ? 338  HIS A ND1   1 
ATOM   2193  C  CD2   . HIS A  1 310 ? 106.504 107.752 17.089  1.00 32.73 ? 338  HIS A CD2   1 
ATOM   2194  C  CE1   . HIS A  1 310 ? 106.573 109.751 16.187  1.00 32.30 ? 338  HIS A CE1   1 
ATOM   2195  N  NE2   . HIS A  1 310 ? 106.718 108.465 15.930  1.00 33.20 ? 338  HIS A NE2   1 
ATOM   2196  N  N     . VAL A  1 311 ? 103.554 106.408 19.257  1.00 24.96 ? 339  VAL A N     1 
ATOM   2197  C  CA    . VAL A  1 311 ? 102.715 105.430 18.566  1.00 25.39 ? 339  VAL A CA    1 
ATOM   2198  C  C     . VAL A  1 311 ? 101.214 105.758 18.690  1.00 24.94 ? 339  VAL A C     1 
ATOM   2199  O  O     . VAL A  1 311 ? 100.499 105.702 17.692  1.00 25.74 ? 339  VAL A O     1 
ATOM   2200  C  CB    . VAL A  1 311 ? 103.009 104.014 19.061  1.00 25.73 ? 339  VAL A CB    1 
ATOM   2201  C  CG1   . VAL A  1 311 ? 101.910 103.024 18.629  1.00 26.20 ? 339  VAL A CG1   1 
ATOM   2202  C  CG2   . VAL A  1 311 ? 104.399 103.557 18.539  1.00 26.32 ? 339  VAL A CG2   1 
ATOM   2203  N  N     . ALA A  1 312 ? 100.756 106.122 19.888  1.00 24.14 ? 340  ALA A N     1 
ATOM   2204  C  CA    . ALA A  1 312 ? 99.356  106.545 20.087  1.00 24.40 ? 340  ALA A CA    1 
ATOM   2205  C  C     . ALA A  1 312 ? 98.964  107.703 19.166  1.00 23.97 ? 340  ALA A C     1 
ATOM   2206  O  O     . ALA A  1 312 ? 97.857  107.721 18.616  1.00 23.97 ? 340  ALA A O     1 
ATOM   2207  C  CB    . ALA A  1 312 ? 99.110  106.942 21.533  1.00 23.82 ? 340  ALA A CB    1 
ATOM   2208  N  N     . THR A  1 313 ? 99.867  108.670 19.021  1.00 24.16 ? 341  THR A N     1 
ATOM   2209  C  CA    . THR A  1 313 ? 99.634  109.835 18.155  1.00 24.33 ? 341  THR A CA    1 
ATOM   2210  C  C     . THR A  1 313 ? 99.460  109.414 16.693  1.00 24.79 ? 341  THR A C     1 
ATOM   2211  O  O     . THR A  1 313 ? 98.556  109.882 15.996  1.00 23.90 ? 341  THR A O     1 
ATOM   2212  C  CB    . THR A  1 313 ? 100.760 110.870 18.289  1.00 24.50 ? 341  THR A CB    1 
ATOM   2213  O  OG1   . THR A  1 313 ? 100.901 111.249 19.661  1.00 23.78 ? 341  THR A OG1   1 
ATOM   2214  C  CG2   . THR A  1 313 ? 100.469 112.139 17.422  1.00 23.92 ? 341  THR A CG2   1 
ATOM   2215  N  N     . GLN A  1 314 ? 100.320 108.504 16.247  1.00 26.06 ? 342  GLN A N     1 
ATOM   2216  C  CA    . GLN A  1 314 ? 100.244 107.939 14.894  1.00 27.22 ? 342  GLN A CA    1 
ATOM   2217  C  C     . GLN A  1 314 ? 98.967  107.160 14.627  1.00 26.58 ? 342  GLN A C     1 
ATOM   2218  O  O     . GLN A  1 314 ? 98.380  107.261 13.536  1.00 26.56 ? 342  GLN A O     1 
ATOM   2219  C  CB    . GLN A  1 314 ? 101.450 107.029 14.646  1.00 26.96 ? 342  GLN A CB    1 
ATOM   2220  C  CG    . GLN A  1 314 ? 102.759 107.760 14.590  1.00 29.42 ? 342  GLN A CG    1 
ATOM   2221  C  CD    . GLN A  1 314 ? 103.933 106.800 14.409  1.00 30.55 ? 342  GLN A CD    1 
ATOM   2222  O  OE1   . GLN A  1 314 ? 104.029 105.764 15.097  1.00 36.82 ? 342  GLN A OE1   1 
ATOM   2223  N  NE2   . GLN A  1 314 ? 104.820 107.125 13.472  1.00 34.25 ? 342  GLN A NE2   1 
ATOM   2224  N  N     . LEU A  1 315 ? 98.536  106.370 15.608  1.00 26.53 ? 343  LEU A N     1 
ATOM   2225  C  CA    . LEU A  1 315 ? 97.262  105.644 15.505  1.00 26.24 ? 343  LEU A CA    1 
ATOM   2226  C  C     . LEU A  1 315 ? 96.102  106.599 15.351  1.00 26.04 ? 343  LEU A C     1 
ATOM   2227  O  O     . LEU A  1 315 ? 95.213  106.374 14.544  1.00 25.53 ? 343  LEU A O     1 
ATOM   2228  C  CB    . LEU A  1 315 ? 97.021  104.775 16.739  1.00 26.74 ? 343  LEU A CB    1 
ATOM   2229  C  CG    . LEU A  1 315 ? 97.819  103.474 16.804  1.00 27.80 ? 343  LEU A CG    1 
ATOM   2230  C  CD1   . LEU A  1 315 ? 97.731  102.812 18.184  1.00 28.10 ? 343  LEU A CD1   1 
ATOM   2231  C  CD2   . LEU A  1 315 ? 97.327  102.533 15.724  1.00 30.10 ? 343  LEU A CD2   1 
ATOM   2232  N  N     . GLU A  1 316 ? 96.135  107.675 16.140  1.00 25.78 ? 344  GLU A N     1 
ATOM   2233  C  CA    . GLU A  1 316 ? 95.100  108.690 16.136  1.00 25.52 ? 344  GLU A CA    1 
ATOM   2234  C  C     . GLU A  1 316 ? 95.025  109.378 14.769  1.00 25.26 ? 344  GLU A C     1 
ATOM   2235  O  O     . GLU A  1 316 ? 93.934  109.568 14.206  1.00 23.91 ? 344  GLU A O     1 
ATOM   2236  C  CB    . GLU A  1 316 ? 95.370  109.714 17.241  1.00 25.78 ? 344  GLU A CB    1 
ATOM   2237  C  CG    . GLU A  1 316 ? 94.277  110.767 17.420  1.00 27.36 ? 344  GLU A CG    1 
ATOM   2238  C  CD    . GLU A  1 316 ? 93.054  110.267 18.181  1.00 32.65 ? 344  GLU A CD    1 
ATOM   2239  O  OE1   . GLU A  1 316 ? 93.146  109.215 18.864  1.00 34.58 ? 344  GLU A OE1   1 
ATOM   2240  O  OE2   . GLU A  1 316 ? 92.002  110.956 18.114  1.00 33.41 ? 344  GLU A OE2   1 
ATOM   2241  N  N     . ALA A  1 317 ? 96.194  109.750 14.253  1.00 24.66 ? 345  ALA A N     1 
ATOM   2242  C  CA    . ALA A  1 317 ? 96.315  110.353 12.935  1.00 24.64 ? 345  ALA A CA    1 
ATOM   2243  C  C     . ALA A  1 317 ? 95.845  109.396 11.822  1.00 24.78 ? 345  ALA A C     1 
ATOM   2244  O  O     . ALA A  1 317 ? 95.164  109.828 10.910  1.00 25.14 ? 345  ALA A O     1 
ATOM   2245  C  CB    . ALA A  1 317 ? 97.746  110.786 12.677  1.00 24.02 ? 345  ALA A CB    1 
ATOM   2246  N  N     . ALA A  1 318 ? 96.203  108.113 11.906  1.00 24.87 ? 346  ALA A N     1 
ATOM   2247  C  CA    . ALA A  1 318 ? 95.724  107.127 10.950  1.00 25.39 ? 346  ALA A CA    1 
ATOM   2248  C  C     . ALA A  1 318 ? 94.196  106.958 10.985  1.00 25.08 ? 346  ALA A C     1 
ATOM   2249  O  O     . ALA A  1 318 ? 93.573  106.821 9.926   1.00 25.09 ? 346  ALA A O     1 
ATOM   2250  C  CB    . ALA A  1 318 ? 96.423  105.778 11.119  1.00 24.67 ? 346  ALA A CB    1 
ATOM   2251  N  N     . ARG A  1 319 ? 93.611  106.928 12.183  1.00 25.08 ? 347  ARG A N     1 
ATOM   2252  C  CA    . ARG A  1 319 ? 92.142  106.889 12.327  1.00 25.37 ? 347  ARG A CA    1 
ATOM   2253  C  C     . ARG A  1 319 ? 91.491  108.066 11.622  1.00 24.68 ? 347  ARG A C     1 
ATOM   2254  O  O     . ARG A  1 319 ? 90.527  107.884 10.863  1.00 24.52 ? 347  ARG A O     1 
ATOM   2255  C  CB    . ARG A  1 319 ? 91.703  106.851 13.800  1.00 25.35 ? 347  ARG A CB    1 
ATOM   2256  C  CG    . ARG A  1 319 ? 90.204  106.636 14.013  1.00 25.71 ? 347  ARG A CG    1 
ATOM   2257  C  CD    . ARG A  1 319 ? 89.863  106.023 15.374  1.00 26.60 ? 347  ARG A CD    1 
ATOM   2258  N  NE    . ARG A  1 319 ? 90.313  104.627 15.446  1.00 28.10 ? 347  ARG A NE    1 
ATOM   2259  C  CZ    . ARG A  1 319 ? 91.383  104.185 16.112  1.00 29.58 ? 347  ARG A CZ    1 
ATOM   2260  N  NH1   . ARG A  1 319 ? 91.688  102.886 16.086  1.00 28.70 ? 347  ARG A NH1   1 
ATOM   2261  N  NH2   . ARG A  1 319 ? 92.156  105.021 16.810  1.00 32.57 ? 347  ARG A NH2   1 
ATOM   2262  N  N     . LEU A  1 320 ? 92.000  109.272 11.868  1.00 24.50 ? 348  LEU A N     1 
ATOM   2263  C  CA    . LEU A  1 320 ? 91.383  110.478 11.295  1.00 24.62 ? 348  LEU A CA    1 
ATOM   2264  C  C     . LEU A  1 320 ? 91.516  110.505 9.768   1.00 24.48 ? 348  LEU A C     1 
ATOM   2265  O  O     . LEU A  1 320 ? 90.568  110.825 9.071   1.00 24.68 ? 348  LEU A O     1 
ATOM   2266  C  CB    . LEU A  1 320 ? 91.956  111.758 11.920  1.00 24.38 ? 348  LEU A CB    1 
ATOM   2267  C  CG    . LEU A  1 320 ? 91.699  111.948 13.417  1.00 25.58 ? 348  LEU A CG    1 
ATOM   2268  C  CD1   . LEU A  1 320 ? 92.373  113.213 13.934  1.00 23.94 ? 348  LEU A CD1   1 
ATOM   2269  C  CD2   . LEU A  1 320 ? 90.199  111.972 13.704  1.00 26.89 ? 348  LEU A CD2   1 
ATOM   2270  N  N     . LEU A  1 321 ? 92.693  110.162 9.251   1.00 24.76 ? 349  LEU A N     1 
ATOM   2271  C  CA    . LEU A  1 321 ? 92.879  110.043 7.792   1.00 24.67 ? 349  LEU A CA    1 
ATOM   2272  C  C     . LEU A  1 321 ? 91.890  109.042 7.185   1.00 24.84 ? 349  LEU A C     1 
ATOM   2273  O  O     . LEU A  1 321 ? 91.307  109.297 6.138   1.00 24.02 ? 349  LEU A O     1 
ATOM   2274  C  CB    . LEU A  1 321 ? 94.306  109.613 7.447   1.00 24.39 ? 349  LEU A CB    1 
ATOM   2275  C  CG    . LEU A  1 321 ? 95.420  110.660 7.589   1.00 24.75 ? 349  LEU A CG    1 
ATOM   2276  C  CD1   . LEU A  1 321 ? 96.782  109.968 7.399   1.00 24.37 ? 349  LEU A CD1   1 
ATOM   2277  C  CD2   . LEU A  1 321 ? 95.259  111.859 6.595   1.00 23.09 ? 349  LEU A CD2   1 
ATOM   2278  N  N     . THR A  1 322 ? 91.699  107.918 7.872   1.00 24.83 ? 350  THR A N     1 
ATOM   2279  C  CA    . THR A  1 322 ? 90.845  106.854 7.373   1.00 24.45 ? 350  THR A CA    1 
ATOM   2280  C  C     . THR A  1 322 ? 89.372  107.287 7.348   1.00 24.33 ? 350  THR A C     1 
ATOM   2281  O  O     . THR A  1 322 ? 88.728  107.172 6.325   1.00 23.35 ? 350  THR A O     1 
ATOM   2282  C  CB    . THR A  1 322 ? 91.011  105.567 8.197   1.00 24.71 ? 350  THR A CB    1 
ATOM   2283  O  OG1   . THR A  1 322 ? 92.375  105.135 8.112   1.00 24.96 ? 350  THR A OG1   1 
ATOM   2284  C  CG2   . THR A  1 322 ? 90.092  104.450 7.666   1.00 23.96 ? 350  THR A CG2   1 
ATOM   2285  N  N     . TYR A  1 323 ? 88.875  107.798 8.471   1.00 24.52 ? 351  TYR A N     1 
ATOM   2286  C  CA    . TYR A  1 323 ? 87.497  108.248 8.582   1.00 25.22 ? 351  TYR A CA    1 
ATOM   2287  C  C     . TYR A  1 323 ? 87.228  109.455 7.680   1.00 25.09 ? 351  TYR A C     1 
ATOM   2288  O  O     . TYR A  1 323 ? 86.160  109.538 7.080   1.00 24.66 ? 351  TYR A O     1 
ATOM   2289  C  CB    . TYR A  1 323 ? 87.138  108.583 10.042  1.00 25.57 ? 351  TYR A CB    1 
ATOM   2290  C  CG    . TYR A  1 323 ? 87.197  107.414 11.049  1.00 25.98 ? 351  TYR A CG    1 
ATOM   2291  C  CD1   . TYR A  1 323 ? 87.464  106.092 10.650  1.00 26.57 ? 351  TYR A CD1   1 
ATOM   2292  C  CD2   . TYR A  1 323 ? 86.931  107.641 12.400  1.00 26.81 ? 351  TYR A CD2   1 
ATOM   2293  C  CE1   . TYR A  1 323 ? 87.493  105.049 11.583  1.00 26.16 ? 351  TYR A CE1   1 
ATOM   2294  C  CE2   . TYR A  1 323 ? 86.957  106.611 13.332  1.00 25.58 ? 351  TYR A CE2   1 
ATOM   2295  C  CZ    . TYR A  1 323 ? 87.231  105.321 12.919  1.00 26.00 ? 351  TYR A CZ    1 
ATOM   2296  O  OH    . TYR A  1 323 ? 87.269  104.320 13.860  1.00 27.13 ? 351  TYR A OH    1 
ATOM   2297  N  N     . ASN A  1 324 ? 88.193  110.374 7.557   1.00 24.57 ? 352  ASN A N     1 
ATOM   2298  C  CA    . ASN A  1 324 ? 88.002  111.527 6.670   1.00 24.66 ? 352  ASN A CA    1 
ATOM   2299  C  C     . ASN A  1 324 ? 87.880  111.123 5.201   1.00 24.10 ? 352  ASN A C     1 
ATOM   2300  O  O     . ASN A  1 324 ? 87.025  111.644 4.488   1.00 22.79 ? 352  ASN A O     1 
ATOM   2301  C  CB    . ASN A  1 324 ? 89.105  112.587 6.832   1.00 24.67 ? 352  ASN A CB    1 
ATOM   2302  C  CG    . ASN A  1 324 ? 88.686  113.957 6.290   1.00 25.62 ? 352  ASN A CG    1 
ATOM   2303  O  OD1   . ASN A  1 324 ? 87.704  114.540 6.746   1.00 26.19 ? 352  ASN A OD1   1 
ATOM   2304  N  ND2   . ASN A  1 324 ? 89.409  114.454 5.295   1.00 25.17 ? 352  ASN A ND2   1 
ATOM   2305  N  N     . ALA A  1 325 ? 88.733  110.204 4.756   1.00 24.39 ? 353  ALA A N     1 
ATOM   2306  C  CA    . ALA A  1 325 ? 88.652  109.686 3.381   1.00 24.84 ? 353  ALA A CA    1 
ATOM   2307  C  C     . ALA A  1 325 ? 87.275  109.080 3.133   1.00 24.99 ? 353  ALA A C     1 
ATOM   2308  O  O     . ALA A  1 325 ? 86.661  109.350 2.107   1.00 25.15 ? 353  ALA A O     1 
ATOM   2309  C  CB    . ALA A  1 325 ? 89.770  108.642 3.096   1.00 23.96 ? 353  ALA A CB    1 
ATOM   2310  N  N     . ALA A  1 326 ? 86.787  108.285 4.089   1.00 25.89 ? 354  ALA A N     1 
ATOM   2311  C  CA    . ALA A  1 326 ? 85.432  107.710 4.015   1.00 26.04 ? 354  ALA A CA    1 
ATOM   2312  C  C     . ALA A  1 326 ? 84.339  108.771 3.932   1.00 26.50 ? 354  ALA A C     1 
ATOM   2313  O  O     . ALA A  1 326 ? 83.382  108.643 3.155   1.00 25.65 ? 354  ALA A O     1 
ATOM   2314  C  CB    . ALA A  1 326 ? 85.162  106.781 5.210   1.00 26.16 ? 354  ALA A CB    1 
ATOM   2315  N  N     . ARG A  1 327 ? 84.460  109.805 4.748   1.00 26.88 ? 355  ARG A N     1 
ATOM   2316  C  CA    . ARG A  1 327 ? 83.460  110.865 4.765   1.00 27.59 ? 355  ARG A CA    1 
ATOM   2317  C  C     . ARG A  1 327 ? 83.497  111.694 3.487   1.00 26.86 ? 355  ARG A C     1 
ATOM   2318  O  O     . ARG A  1 327 ? 82.458  112.139 3.020   1.00 25.95 ? 355  ARG A O     1 
ATOM   2319  C  CB    . ARG A  1 327 ? 83.628  111.760 5.990   1.00 28.45 ? 355  ARG A CB    1 
ATOM   2320  C  CG    . ARG A  1 327 ? 82.964  111.172 7.222   1.00 32.96 ? 355  ARG A CG    1 
ATOM   2321  C  CD    . ARG A  1 327 ? 83.295  111.941 8.468   1.00 39.27 ? 355  ARG A CD    1 
ATOM   2322  N  NE    . ARG A  1 327 ? 83.203  111.056 9.628   1.00 42.85 ? 355  ARG A NE    1 
ATOM   2323  C  CZ    . ARG A  1 327 ? 82.355  111.186 10.644  1.00 44.65 ? 355  ARG A CZ    1 
ATOM   2324  N  NH1   . ARG A  1 327 ? 81.500  112.209 10.720  1.00 46.94 ? 355  ARG A NH1   1 
ATOM   2325  N  NH2   . ARG A  1 327 ? 82.388  110.287 11.620  1.00 44.27 ? 355  ARG A NH2   1 
ATOM   2326  N  N     . LEU A  1 328 ? 84.686  111.883 2.922   1.00 26.08 ? 356  LEU A N     1 
ATOM   2327  C  CA    . LEU A  1 328 ? 84.814  112.558 1.627   1.00 26.03 ? 356  LEU A CA    1 
ATOM   2328  C  C     . LEU A  1 328 ? 84.084  111.774 0.531   1.00 25.93 ? 356  LEU A C     1 
ATOM   2329  O  O     . LEU A  1 328 ? 83.313  112.349 -0.219  1.00 25.18 ? 356  LEU A O     1 
ATOM   2330  C  CB    . LEU A  1 328 ? 86.290  112.789 1.251   1.00 25.72 ? 356  LEU A CB    1 
ATOM   2331  C  CG    . LEU A  1 328 ? 87.006  113.902 2.040   1.00 25.33 ? 356  LEU A CG    1 
ATOM   2332  C  CD1   . LEU A  1 328 ? 88.522  113.848 1.808   1.00 25.06 ? 356  LEU A CD1   1 
ATOM   2333  C  CD2   . LEU A  1 328 ? 86.431  115.283 1.703   1.00 25.48 ? 356  LEU A CD2   1 
ATOM   2334  N  N     . LEU A  1 329 ? 84.307  110.465 0.470   1.00 26.62 ? 357  LEU A N     1 
ATOM   2335  C  CA    . LEU A  1 329 ? 83.625  109.591 -0.495  1.00 27.11 ? 357  LEU A CA    1 
ATOM   2336  C  C     . LEU A  1 329 ? 82.096  109.666 -0.366  1.00 27.67 ? 357  LEU A C     1 
ATOM   2337  O  O     . LEU A  1 329 ? 81.385  109.777 -1.366  1.00 27.53 ? 357  LEU A O     1 
ATOM   2338  C  CB    . LEU A  1 329 ? 84.100  108.144 -0.321  1.00 27.20 ? 357  LEU A CB    1 
ATOM   2339  C  CG    . LEU A  1 329 ? 83.505  107.039 -1.204  1.00 27.89 ? 357  LEU A CG    1 
ATOM   2340  C  CD1   . LEU A  1 329 ? 84.388  105.811 -1.170  1.00 26.86 ? 357  LEU A CD1   1 
ATOM   2341  C  CD2   . LEU A  1 329 ? 82.064  106.674 -0.793  1.00 29.02 ? 357  LEU A CD2   1 
ATOM   2342  N  N     . GLU A  1 330 ? 81.596  109.598 0.868   1.00 28.19 ? 358  GLU A N     1 
ATOM   2343  C  CA    . GLU A  1 330 ? 80.147  109.685 1.126   1.00 28.17 ? 358  GLU A CA    1 
ATOM   2344  C  C     . GLU A  1 330 ? 79.531  111.019 0.714   1.00 28.21 ? 358  GLU A C     1 
ATOM   2345  O  O     . GLU A  1 330 ? 78.362  111.070 0.325   1.00 27.70 ? 358  GLU A O     1 
ATOM   2346  C  CB    . GLU A  1 330 ? 79.864  109.455 2.610   1.00 28.09 ? 358  GLU A CB    1 
ATOM   2347  C  CG    . GLU A  1 330 ? 80.164  108.046 3.069   1.00 27.85 ? 358  GLU A CG    1 
ATOM   2348  C  CD    . GLU A  1 330 ? 79.776  107.818 4.518   1.00 28.98 ? 358  GLU A CD    1 
ATOM   2349  O  OE1   . GLU A  1 330 ? 79.771  108.791 5.308   1.00 31.46 ? 358  GLU A OE1   1 
ATOM   2350  O  OE2   . GLU A  1 330 ? 79.467  106.666 4.865   1.00 28.25 ? 358  GLU A OE2   1 
ATOM   2351  N  N     . ALA A  1 331 ? 80.312  112.095 0.810   1.00 28.36 ? 359  ALA A N     1 
ATOM   2352  C  CA    . ALA A  1 331 ? 79.832  113.426 0.466   1.00 28.73 ? 359  ALA A CA    1 
ATOM   2353  C  C     . ALA A  1 331 ? 79.916  113.721 -1.039  1.00 29.05 ? 359  ALA A C     1 
ATOM   2354  O  O     . ALA A  1 331 ? 79.569  114.815 -1.470  1.00 29.34 ? 359  ALA A O     1 
ATOM   2355  C  CB    . ALA A  1 331 ? 80.603  114.473 1.249   1.00 29.18 ? 359  ALA A CB    1 
ATOM   2356  N  N     . GLY A  1 332 ? 80.373  112.752 -1.831  1.00 29.45 ? 360  GLY A N     1 
ATOM   2357  C  CA    . GLY A  1 332 ? 80.583  112.951 -3.264  1.00 29.42 ? 360  GLY A CA    1 
ATOM   2358  C  C     . GLY A  1 332 ? 81.708  113.930 -3.565  1.00 29.62 ? 360  GLY A C     1 
ATOM   2359  O  O     . GLY A  1 332 ? 81.703  114.582 -4.610  1.00 29.13 ? 360  GLY A O     1 
ATOM   2360  N  N     . LYS A  1 333 ? 82.674  114.030 -2.649  1.00 29.72 ? 361  LYS A N     1 
ATOM   2361  C  CA    . LYS A  1 333 ? 83.813  114.934 -2.802  1.00 30.05 ? 361  LYS A CA    1 
ATOM   2362  C  C     . LYS A  1 333 ? 85.024  114.167 -3.314  1.00 29.83 ? 361  LYS A C     1 
ATOM   2363  O  O     . LYS A  1 333 ? 85.066  112.928 -3.212  1.00 29.64 ? 361  LYS A O     1 
ATOM   2364  C  CB    . LYS A  1 333 ? 84.148  115.626 -1.466  1.00 30.39 ? 361  LYS A CB    1 
ATOM   2365  C  CG    . LYS A  1 333 ? 83.021  116.480 -0.883  1.00 31.75 ? 361  LYS A CG    1 
ATOM   2366  C  CD    . LYS A  1 333 ? 82.394  117.397 -1.943  1.00 33.43 ? 361  LYS A CD    1 
ATOM   2367  C  CE    . LYS A  1 333 ? 81.480  118.485 -1.346  1.00 34.85 ? 361  LYS A CE    1 
ATOM   2368  N  N     . PRO A  1 334 ? 86.011  114.891 -3.879  1.00 29.32 ? 362  PRO A N     1 
ATOM   2369  C  CA    . PRO A  1 334 ? 87.241  114.222 -4.283  1.00 29.23 ? 362  PRO A CA    1 
ATOM   2370  C  C     . PRO A  1 334 ? 87.854  113.490 -3.089  1.00 28.36 ? 362  PRO A C     1 
ATOM   2371  O  O     . PRO A  1 334 ? 87.986  114.080 -2.017  1.00 28.56 ? 362  PRO A O     1 
ATOM   2372  C  CB    . PRO A  1 334 ? 88.140  115.378 -4.749  1.00 29.20 ? 362  PRO A CB    1 
ATOM   2373  C  CG    . PRO A  1 334 ? 87.218  116.462 -5.120  1.00 30.20 ? 362  PRO A CG    1 
ATOM   2374  C  CD    . PRO A  1 334 ? 86.051  116.334 -4.178  1.00 29.90 ? 362  PRO A CD    1 
ATOM   2375  N  N     . PHE A  1 335 ? 88.180  112.215 -3.265  1.00 28.03 ? 363  PHE A N     1 
ATOM   2376  C  CA    . PHE A  1 335 ? 88.690  111.395 -2.176  1.00 28.34 ? 363  PHE A CA    1 
ATOM   2377  C  C     . PHE A  1 335 ? 89.919  110.532 -2.534  1.00 28.00 ? 363  PHE A C     1 
ATOM   2378  O  O     . PHE A  1 335 ? 90.480  109.907 -1.646  1.00 27.58 ? 363  PHE A O     1 
ATOM   2379  C  CB    . PHE A  1 335 ? 87.570  110.492 -1.629  1.00 28.86 ? 363  PHE A CB    1 
ATOM   2380  C  CG    . PHE A  1 335 ? 87.241  109.342 -2.530  1.00 28.86 ? 363  PHE A CG    1 
ATOM   2381  C  CD1   . PHE A  1 335 ? 87.906  108.137 -2.406  1.00 29.98 ? 363  PHE A CD1   1 
ATOM   2382  C  CD2   . PHE A  1 335 ? 86.293  109.480 -3.530  1.00 30.76 ? 363  PHE A CD2   1 
ATOM   2383  C  CE1   . PHE A  1 335 ? 87.628  107.068 -3.265  1.00 30.61 ? 363  PHE A CE1   1 
ATOM   2384  C  CE2   . PHE A  1 335 ? 86.004  108.414 -4.385  1.00 31.20 ? 363  PHE A CE2   1 
ATOM   2385  C  CZ    . PHE A  1 335 ? 86.681  107.211 -4.249  1.00 31.12 ? 363  PHE A CZ    1 
ATOM   2386  N  N     . ILE A  1 336 ? 90.327  110.486 -3.805  1.00 27.42 ? 364  ILE A N     1 
ATOM   2387  C  CA    . ILE A  1 336 ? 91.408  109.579 -4.224  1.00 27.51 ? 364  ILE A CA    1 
ATOM   2388  C  C     . ILE A  1 336 ? 92.751  109.894 -3.522  1.00 27.24 ? 364  ILE A C     1 
ATOM   2389  O  O     . ILE A  1 336 ? 93.392  108.997 -2.992  1.00 26.98 ? 364  ILE A O     1 
ATOM   2390  C  CB    . ILE A  1 336 ? 91.596  109.538 -5.763  1.00 27.01 ? 364  ILE A CB    1 
ATOM   2391  C  CG1   . ILE A  1 336 ? 90.322  109.012 -6.457  1.00 28.27 ? 364  ILE A CG1   1 
ATOM   2392  C  CG2   . ILE A  1 336 ? 92.781  108.639 -6.132  1.00 26.77 ? 364  ILE A CG2   1 
ATOM   2393  C  CD1   . ILE A  1 336 ? 90.307  109.284 -7.977  1.00 27.24 ? 364  ILE A CD1   1 
ATOM   2394  N  N     . LYS A  1 337 ? 93.160  111.163 -3.492  1.00 27.34 ? 365  LYS A N     1 
ATOM   2395  C  CA    . LYS A  1 337 ? 94.399  111.531 -2.773  1.00 27.00 ? 365  LYS A CA    1 
ATOM   2396  C  C     . LYS A  1 337 ? 94.330  111.138 -1.287  1.00 26.70 ? 365  LYS A C     1 
ATOM   2397  O  O     . LYS A  1 337 ? 95.277  110.589 -0.714  1.00 24.60 ? 365  LYS A O     1 
ATOM   2398  C  CB    . LYS A  1 337 ? 94.648  113.030 -2.877  1.00 27.55 ? 365  LYS A CB    1 
ATOM   2399  C  CG    . LYS A  1 337 ? 95.959  113.478 -2.217  1.00 27.44 ? 365  LYS A CG    1 
ATOM   2400  C  CD    . LYS A  1 337 ? 96.119  114.988 -2.242  1.00 27.50 ? 365  LYS A CD    1 
ATOM   2401  C  CE    . LYS A  1 337 ? 95.207  115.647 -1.238  1.00 28.08 ? 365  LYS A CE    1 
ATOM   2402  N  NZ    . LYS A  1 337 ? 95.369  117.107 -1.173  1.00 27.43 ? 365  LYS A NZ    1 
ATOM   2403  N  N     . GLU A  1 338 ? 93.180  111.408 -0.680  1.00 26.11 ? 366  GLU A N     1 
ATOM   2404  C  CA    . GLU A  1 338 ? 92.977  111.144 0.728   1.00 25.72 ? 366  GLU A CA    1 
ATOM   2405  C  C     . GLU A  1 338 ? 92.935  109.649 1.024   1.00 25.25 ? 366  GLU A C     1 
ATOM   2406  O  O     . GLU A  1 338 ? 93.402  109.209 2.071   1.00 24.20 ? 366  GLU A O     1 
ATOM   2407  C  CB    . GLU A  1 338 ? 91.690  111.840 1.204   1.00 26.17 ? 366  GLU A CB    1 
ATOM   2408  C  CG    . GLU A  1 338 ? 91.779  113.370 1.163   1.00 28.29 ? 366  GLU A CG    1 
ATOM   2409  C  CD    . GLU A  1 338 ? 91.500  114.042 -0.206  1.00 30.30 ? 366  GLU A CD    1 
ATOM   2410  O  OE1   . GLU A  1 338 ? 91.208  113.390 -1.247  1.00 29.57 ? 366  GLU A OE1   1 
ATOM   2411  O  OE2   . GLU A  1 338 ? 91.569  115.285 -0.224  1.00 33.52 ? 366  GLU A OE2   1 
ATOM   2412  N  N     . ALA A  1 339 ? 92.365  108.869 0.103   1.00 25.15 ? 367  ALA A N     1 
ATOM   2413  C  CA    . ALA A  1 339 ? 92.347  107.416 0.232   1.00 24.95 ? 367  ALA A CA    1 
ATOM   2414  C  C     . ALA A  1 339 ? 93.764  106.855 0.206   1.00 25.17 ? 367  ALA A C     1 
ATOM   2415  O  O     . ALA A  1 339 ? 94.112  105.987 1.008   1.00 24.58 ? 367  ALA A O     1 
ATOM   2416  C  CB    . ALA A  1 339 ? 91.492  106.780 -0.875  1.00 24.74 ? 367  ALA A CB    1 
ATOM   2417  N  N     . SER A  1 340 ? 94.575  107.370 -0.715  1.00 25.94 ? 368  SER A N     1 
ATOM   2418  C  CA    . SER A  1 340 ? 95.978  106.978 -0.839  1.00 25.65 ? 368  SER A CA    1 
ATOM   2419  C  C     . SER A  1 340 ? 96.775  107.382 0.401   1.00 25.57 ? 368  SER A C     1 
ATOM   2420  O  O     . SER A  1 340 ? 97.569  106.590 0.934   1.00 24.95 ? 368  SER A O     1 
ATOM   2421  C  CB    . SER A  1 340 ? 96.601  107.597 -2.097  1.00 26.45 ? 368  SER A CB    1 
ATOM   2422  O  OG    . SER A  1 340 ? 96.132  106.948 -3.258  1.00 28.41 ? 368  SER A OG    1 
ATOM   2423  N  N     . MET A  1 341 ? 96.550  108.605 0.877   1.00 24.89 ? 369  MET A N     1 
ATOM   2424  C  CA    . MET A  1 341 ? 97.185  109.061 2.105   1.00 24.57 ? 369  MET A CA    1 
ATOM   2425  C  C     . MET A  1 341 ? 96.831  108.154 3.279   1.00 24.81 ? 369  MET A C     1 
ATOM   2426  O  O     . MET A  1 341 ? 97.711  107.748 4.025   1.00 24.32 ? 369  MET A O     1 
ATOM   2427  C  CB    . MET A  1 341 ? 96.781  110.486 2.415   1.00 24.60 ? 369  MET A CB    1 
ATOM   2428  C  CG    . MET A  1 341 ? 97.377  111.518 1.509   1.00 23.51 ? 369  MET A CG    1 
ATOM   2429  S  SD    . MET A  1 341 ? 96.792  113.150 1.960   1.00 24.67 ? 369  MET A SD    1 
ATOM   2430  C  CE    . MET A  1 341 ? 97.961  114.227 1.106   1.00 23.34 ? 369  MET A CE    1 
ATOM   2431  N  N     . ALA A  1 342 ? 95.544  107.807 3.418   1.00 25.32 ? 370  ALA A N     1 
ATOM   2432  C  CA    . ALA A  1 342 ? 95.098  106.917 4.503   1.00 24.99 ? 370  ALA A CA    1 
ATOM   2433  C  C     . ALA A  1 342 ? 95.733  105.542 4.425   1.00 25.39 ? 370  ALA A C     1 
ATOM   2434  O  O     . ALA A  1 342 ? 96.202  105.013 5.438   1.00 25.28 ? 370  ALA A O     1 
ATOM   2435  C  CB    . ALA A  1 342 ? 93.562  106.776 4.530   1.00 24.34 ? 370  ALA A CB    1 
ATOM   2436  N  N     . LYS A  1 343 ? 95.718  104.935 3.237   1.00 26.12 ? 371  LYS A N     1 
ATOM   2437  C  CA    . LYS A  1 343 ? 96.270  103.600 3.063   1.00 26.13 ? 371  LYS A CA    1 
ATOM   2438  C  C     . LYS A  1 343 ? 97.778  103.575 3.292   1.00 26.50 ? 371  LYS A C     1 
ATOM   2439  O  O     . LYS A  1 343 ? 98.301  102.656 3.952   1.00 24.70 ? 371  LYS A O     1 
ATOM   2440  C  CB    . LYS A  1 343 ? 95.920  103.039 1.682   1.00 26.58 ? 371  LYS A CB    1 
ATOM   2441  C  CG    . LYS A  1 343 ? 96.190  101.523 1.518   1.00 27.39 ? 371  LYS A CG    1 
ATOM   2442  C  CD    . LYS A  1 343 ? 97.618  101.228 1.050   1.00 27.72 ? 371  LYS A CD    1 
ATOM   2443  C  CE    . LYS A  1 343 ? 97.762  99.815  0.596   1.00 28.91 ? 371  LYS A CE    1 
ATOM   2444  N  NZ    . LYS A  1 343 ? 99.178  99.483  0.373   1.00 28.36 ? 371  LYS A NZ    1 
ATOM   2445  N  N     . TYR A  1 344 ? 98.478  104.572 2.748   1.00 26.26 ? 372  TYR A N     1 
ATOM   2446  C  CA    . TYR A  1 344 ? 99.920  104.663 2.938   1.00 26.70 ? 372  TYR A CA    1 
ATOM   2447  C  C     . TYR A  1 344 ? 100.275 104.830 4.428   1.00 26.79 ? 372  TYR A C     1 
ATOM   2448  O  O     . TYR A  1 344 ? 101.062 104.049 4.985   1.00 26.30 ? 372  TYR A O     1 
ATOM   2449  C  CB    . TYR A  1 344 ? 100.512 105.812 2.118   1.00 27.13 ? 372  TYR A CB    1 
ATOM   2450  C  CG    . TYR A  1 344 ? 101.932 106.200 2.501   1.00 28.27 ? 372  TYR A CG    1 
ATOM   2451  C  CD1   . TYR A  1 344 ? 103.018 105.423 2.093   1.00 27.53 ? 372  TYR A CD1   1 
ATOM   2452  C  CD2   . TYR A  1 344 ? 102.188 107.343 3.239   1.00 29.94 ? 372  TYR A CD2   1 
ATOM   2453  C  CE1   . TYR A  1 344 ? 104.303 105.760 2.422   1.00 29.92 ? 372  TYR A CE1   1 
ATOM   2454  C  CE2   . TYR A  1 344 ? 103.486 107.696 3.587   1.00 29.73 ? 372  TYR A CE2   1 
ATOM   2455  C  CZ    . TYR A  1 344 ? 104.537 106.903 3.169   1.00 29.30 ? 372  TYR A CZ    1 
ATOM   2456  O  OH    . TYR A  1 344 ? 105.828 107.244 3.486   1.00 30.80 ? 372  TYR A OH    1 
ATOM   2457  N  N     . TYR A  1 345 ? 99.683  105.842 5.045   1.00 26.81 ? 373  TYR A N     1 
ATOM   2458  C  CA    . TYR A  1 345 ? 99.962  106.172 6.432   1.00 27.09 ? 373  TYR A CA    1 
ATOM   2459  C  C     . TYR A  1 345 ? 99.589  105.048 7.415   1.00 26.61 ? 373  TYR A C     1 
ATOM   2460  O  O     . TYR A  1 345 ? 100.426 104.640 8.238   1.00 25.53 ? 373  TYR A O     1 
ATOM   2461  C  CB    . TYR A  1 345 ? 99.294  107.494 6.815   1.00 27.73 ? 373  TYR A CB    1 
ATOM   2462  C  CG    . TYR A  1 345 ? 99.797  108.025 8.112   1.00 29.11 ? 373  TYR A CG    1 
ATOM   2463  C  CD1   . TYR A  1 345 ? 100.938 108.808 8.164   1.00 30.32 ? 373  TYR A CD1   1 
ATOM   2464  C  CD2   . TYR A  1 345 ? 99.162  107.706 9.306   1.00 30.28 ? 373  TYR A CD2   1 
ATOM   2465  C  CE1   . TYR A  1 345 ? 101.428 109.295 9.390   1.00 31.22 ? 373  TYR A CE1   1 
ATOM   2466  C  CE2   . TYR A  1 345 ? 99.641  108.175 10.518  1.00 29.84 ? 373  TYR A CE2   1 
ATOM   2467  C  CZ    . TYR A  1 345 ? 100.772 108.960 10.564  1.00 30.24 ? 373  TYR A CZ    1 
ATOM   2468  O  OH    . TYR A  1 345 ? 101.249 109.416 11.798  1.00 30.93 ? 373  TYR A OH    1 
ATOM   2469  N  N     . ALA A  1 346 ? 98.361  104.549 7.322   1.00 26.17 ? 374  ALA A N     1 
ATOM   2470  C  CA    . ALA A  1 346 ? 97.898  103.450 8.186   1.00 26.42 ? 374  ALA A CA    1 
ATOM   2471  C  C     . ALA A  1 346 ? 98.753  102.188 8.042   1.00 26.63 ? 374  ALA A C     1 
ATOM   2472  O  O     . ALA A  1 346 ? 99.130  101.580 9.044   1.00 25.73 ? 374  ALA A O     1 
ATOM   2473  C  CB    . ALA A  1 346 ? 96.413  103.126 7.926   1.00 26.21 ? 374  ALA A CB    1 
ATOM   2474  N  N     . SER A  1 347 ? 99.064  101.792 6.806   1.00 26.41 ? 375  SER A N     1 
ATOM   2475  C  CA    . SER A  1 347 ? 99.912  100.615 6.607   1.00 26.76 ? 375  SER A CA    1 
ATOM   2476  C  C     . SER A  1 347 ? 101.307 100.812 7.214   1.00 26.30 ? 375  SER A C     1 
ATOM   2477  O  O     . SER A  1 347 ? 101.820 99.930  7.891   1.00 27.32 ? 375  SER A O     1 
ATOM   2478  C  CB    . SER A  1 347 ? 100.026 100.229 5.128   1.00 26.71 ? 375  SER A CB    1 
ATOM   2479  O  OG    . SER A  1 347 ? 100.650 101.237 4.357   1.00 28.01 ? 375  SER A OG    1 
ATOM   2480  N  N     . GLU A  1 348 ? 101.900 101.967 6.970   1.00 26.82 ? 376  GLU A N     1 
ATOM   2481  C  CA    . GLU A  1 348 ? 103.240 102.265 7.460   1.00 27.59 ? 376  GLU A CA    1 
ATOM   2482  C  C     . GLU A  1 348 ? 103.257 102.298 8.996   1.00 27.33 ? 376  GLU A C     1 
ATOM   2483  O  O     . GLU A  1 348 ? 104.121 101.690 9.618   1.00 26.95 ? 376  GLU A O     1 
ATOM   2484  C  CB    . GLU A  1 348 ? 103.774 103.571 6.857   1.00 28.51 ? 376  GLU A CB    1 
ATOM   2485  C  CG    . GLU A  1 348 ? 103.999 103.539 5.324   1.00 29.70 ? 376  GLU A CG    1 
ATOM   2486  C  CD    . GLU A  1 348 ? 105.237 102.736 4.858   1.00 32.68 ? 376  GLU A CD    1 
ATOM   2487  O  OE1   . GLU A  1 348 ? 106.123 102.441 5.679   1.00 31.09 ? 376  GLU A OE1   1 
ATOM   2488  O  OE2   . GLU A  1 348 ? 105.312 102.381 3.653   1.00 32.77 ? 376  GLU A OE2   1 
ATOM   2489  N  N     . ILE A  1 349 ? 102.271 102.946 9.611   1.00 26.82 ? 377  ILE A N     1 
ATOM   2490  C  CA    A ILE A  1 349 ? 102.286 103.003 11.070  0.50 26.69 ? 377  ILE A CA    1 
ATOM   2491  C  CA    B ILE A  1 349 ? 102.136 103.041 11.072  0.50 27.07 ? 377  ILE A CA    1 
ATOM   2492  C  C     . ILE A  1 349 ? 101.826 101.687 11.722  1.00 26.71 ? 377  ILE A C     1 
ATOM   2493  O  O     . ILE A  1 349 ? 102.228 101.402 12.851  1.00 26.87 ? 377  ILE A O     1 
ATOM   2494  C  CB    A ILE A  1 349 ? 101.581 104.271 11.633  0.50 26.63 ? 377  ILE A CB    1 
ATOM   2495  C  CB    B ILE A  1 349 ? 101.002 104.054 11.444  0.50 27.29 ? 377  ILE A CB    1 
ATOM   2496  C  CG1   A ILE A  1 349 ? 100.057 104.182 11.487  0.50 25.44 ? 377  ILE A CG1   1 
ATOM   2497  C  CG1   B ILE A  1 349 ? 101.427 105.495 11.130  0.50 27.36 ? 377  ILE A CG1   1 
ATOM   2498  C  CG2   A ILE A  1 349 ? 102.157 105.521 10.967  0.50 26.29 ? 377  ILE A CG2   1 
ATOM   2499  C  CG2   B ILE A  1 349 ? 100.567 103.910 12.905  0.50 27.54 ? 377  ILE A CG2   1 
ATOM   2500  C  CD1   A ILE A  1 349 ? 99.393  103.474 12.630  0.50 24.56 ? 377  ILE A CD1   1 
ATOM   2501  C  CD1   B ILE A  1 349 ? 102.909 105.774 11.215  0.50 27.38 ? 377  ILE A CD1   1 
ATOM   2502  N  N     . ALA A  1 350 ? 101.053 100.857 11.017  1.00 26.58 ? 378  ALA A N     1 
ATOM   2503  C  CA    . ALA A  1 350 ? 100.751 99.508  11.510  1.00 26.54 ? 378  ALA A CA    1 
ATOM   2504  C  C     . ALA A  1 350 ? 102.021 98.662  11.629  1.00 26.22 ? 378  ALA A C     1 
ATOM   2505  O  O     . ALA A  1 350 ? 102.168 97.884  12.568  1.00 25.79 ? 378  ALA A O     1 
ATOM   2506  C  CB    . ALA A  1 350 ? 99.715  98.797  10.625  1.00 26.41 ? 378  ALA A CB    1 
ATOM   2507  N  N     . GLY A  1 351 ? 102.934 98.810  10.669  1.00 26.13 ? 379  GLY A N     1 
ATOM   2508  C  CA    . GLY A  1 351 ? 104.226 98.148  10.738  1.00 26.92 ? 379  GLY A CA    1 
ATOM   2509  C  C     . GLY A  1 351 ? 105.023 98.614  11.950  1.00 27.21 ? 379  GLY A C     1 
ATOM   2510  O  O     . GLY A  1 351 ? 105.547 97.794  12.712  1.00 26.42 ? 379  GLY A O     1 
ATOM   2511  N  N     . GLN A  1 352 ? 105.062 99.932  12.151  1.00 28.11 ? 380  GLN A N     1 
ATOM   2512  C  CA    . GLN A  1 352 ? 105.838 100.533 13.252  1.00 28.64 ? 380  GLN A CA    1 
ATOM   2513  C  C     . GLN A  1 352 ? 105.227 100.181 14.608  1.00 27.91 ? 380  GLN A C     1 
ATOM   2514  O  O     . GLN A  1 352 ? 105.936 99.877  15.555  1.00 27.43 ? 380  GLN A O     1 
ATOM   2515  C  CB    . GLN A  1 352 ? 105.933 102.064 13.079  1.00 29.03 ? 380  GLN A CB    1 
ATOM   2516  C  CG    . GLN A  1 352 ? 106.652 102.489 11.813  1.00 30.16 ? 380  GLN A CG    1 
ATOM   2517  C  CD    . GLN A  1 352 ? 106.667 104.007 11.585  1.00 31.82 ? 380  GLN A CD    1 
ATOM   2518  O  OE1   . GLN A  1 352 ? 106.685 104.789 12.527  1.00 36.98 ? 380  GLN A OE1   1 
ATOM   2519  N  NE2   . GLN A  1 352 ? 106.669 104.418 10.314  1.00 35.47 ? 380  GLN A NE2   1 
ATOM   2520  N  N     . THR A  1 353 ? 103.901 100.225 14.684  1.00 27.48 ? 381  THR A N     1 
ATOM   2521  C  CA    . THR A  1 353 ? 103.162 99.916  15.903  1.00 27.24 ? 381  THR A CA    1 
ATOM   2522  C  C     . THR A  1 353 ? 103.404 98.488  16.372  1.00 27.02 ? 381  THR A C     1 
ATOM   2523  O  O     . THR A  1 353 ? 103.734 98.273  17.531  1.00 25.83 ? 381  THR A O     1 
ATOM   2524  C  CB    . THR A  1 353 ? 101.632 100.113 15.734  1.00 26.97 ? 381  THR A CB    1 
ATOM   2525  O  OG1   . THR A  1 353 ? 101.357 101.476 15.405  1.00 27.84 ? 381  THR A OG1   1 
ATOM   2526  C  CG2   . THR A  1 353 ? 100.878 99.735  17.019  1.00 27.46 ? 381  THR A CG2   1 
ATOM   2527  N  N     . THR A  1 354 ? 103.233 97.533  15.461  1.00 26.69 ? 382  THR A N     1 
ATOM   2528  C  CA    . THR A  1 354 ? 103.352 96.129  15.790  1.00 27.18 ? 382  THR A CA    1 
ATOM   2529  C  C     . THR A  1 354 ? 104.820 95.782  16.125  1.00 27.43 ? 382  THR A C     1 
ATOM   2530  O  O     . THR A  1 354 ? 105.084 94.983  17.019  1.00 26.86 ? 382  THR A O     1 
ATOM   2531  C  CB    . THR A  1 354 ? 102.802 95.216  14.657  1.00 27.11 ? 382  THR A CB    1 
ATOM   2532  O  OG1   . THR A  1 354 ? 103.480 95.502  13.431  1.00 26.87 ? 382  THR A OG1   1 
ATOM   2533  C  CG2   . THR A  1 354 ? 101.267 95.418  14.455  1.00 26.45 ? 382  THR A CG2   1 
ATOM   2534  N  N     . SER A  1 355 ? 105.757 96.394  15.404  1.00 27.67 ? 383  SER A N     1 
ATOM   2535  C  CA    . SER A  1 355 ? 107.190 96.209  15.650  1.00 27.90 ? 383  SER A CA    1 
ATOM   2536  C  C     . SER A  1 355 ? 107.572 96.704  17.051  1.00 28.46 ? 383  SER A C     1 
ATOM   2537  O  O     . SER A  1 355 ? 108.286 96.009  17.792  1.00 28.16 ? 383  SER A O     1 
ATOM   2538  C  CB    . SER A  1 355 ? 108.013 96.948  14.580  1.00 28.03 ? 383  SER A CB    1 
ATOM   2539  O  OG    . SER A  1 355 ? 109.404 96.885  14.861  1.00 29.28 ? 383  SER A OG    1 
ATOM   2540  N  N     . LYS A  1 356 ? 107.075 97.892  17.414  1.00 28.27 ? 384  LYS A N     1 
ATOM   2541  C  CA    . LYS A  1 356 ? 107.280 98.428  18.749  1.00 28.28 ? 384  LYS A CA    1 
ATOM   2542  C  C     . LYS A  1 356 ? 106.583 97.629  19.845  1.00 27.57 ? 384  LYS A C     1 
ATOM   2543  O  O     . LYS A  1 356 ? 107.165 97.434  20.886  1.00 26.27 ? 384  LYS A O     1 
ATOM   2544  C  CB    . LYS A  1 356 ? 106.873 99.905  18.834  1.00 28.95 ? 384  LYS A CB    1 
ATOM   2545  C  CG    . LYS A  1 356 ? 107.855 100.833 18.184  1.00 30.85 ? 384  LYS A CG    1 
ATOM   2546  C  CD    . LYS A  1 356 ? 109.172 100.903 18.942  1.00 34.03 ? 384  LYS A CD    1 
ATOM   2547  C  CE    . LYS A  1 356 ? 110.187 101.728 18.151  1.00 37.43 ? 384  LYS A CE    1 
ATOM   2548  N  NZ    . LYS A  1 356 ? 111.562 101.637 18.681  1.00 38.96 ? 384  LYS A NZ    1 
ATOM   2549  N  N     . CYS A  1 357 ? 105.360 97.153  19.612  1.00 27.33 ? 385  CYS A N     1 
ATOM   2550  C  CA    . CYS A  1 357 ? 104.670 96.326  20.606  1.00 27.36 ? 385  CYS A CA    1 
ATOM   2551  C  C     . CYS A  1 357 ? 105.446 95.064  20.976  1.00 27.07 ? 385  CYS A C     1 
ATOM   2552  O  O     . CYS A  1 357 ? 105.489 94.700  22.151  1.00 27.09 ? 385  CYS A O     1 
ATOM   2553  C  CB    . CYS A  1 357 ? 103.223 95.986  20.181  1.00 27.26 ? 385  CYS A CB    1 
ATOM   2554  S  SG    . CYS A  1 357 ? 102.035 97.389  20.335  1.00 29.45 ? 385  CYS A SG    1 
ATOM   2555  N  N     . ILE A  1 358 ? 106.055 94.394  19.996  1.00 26.78 ? 386  ILE A N     1 
ATOM   2556  C  CA    . ILE A  1 358 ? 106.894 93.219  20.272  1.00 27.06 ? 386  ILE A CA    1 
ATOM   2557  C  C     . ILE A  1 358 ? 108.049 93.604  21.228  1.00 26.76 ? 386  ILE A C     1 
ATOM   2558  O  O     . ILE A  1 358 ? 108.325 92.906  22.190  1.00 27.06 ? 386  ILE A O     1 
ATOM   2559  C  CB    . ILE A  1 358 ? 107.514 92.584  18.976  1.00 26.90 ? 386  ILE A CB    1 
ATOM   2560  C  CG1   . ILE A  1 358 ? 106.437 91.911  18.125  1.00 28.36 ? 386  ILE A CG1   1 
ATOM   2561  C  CG2   . ILE A  1 358 ? 108.624 91.553  19.356  1.00 26.98 ? 386  ILE A CG2   1 
ATOM   2562  C  CD1   . ILE A  1 358 ? 106.948 91.291  16.810  1.00 27.60 ? 386  ILE A CD1   1 
ATOM   2563  N  N     . GLU A  1 359 ? 108.694 94.725  20.956  1.00 26.59 ? 387  GLU A N     1 
ATOM   2564  C  CA    . GLU A  1 359 ? 109.779 95.242  21.824  1.00 27.18 ? 387  GLU A CA    1 
ATOM   2565  C  C     . GLU A  1 359 ? 109.309 95.594  23.245  1.00 26.20 ? 387  GLU A C     1 
ATOM   2566  O  O     . GLU A  1 359 ? 109.998 95.286  24.229  1.00 26.17 ? 387  GLU A O     1 
ATOM   2567  C  CB    . GLU A  1 359 ? 110.436 96.461  21.187  1.00 27.19 ? 387  GLU A CB    1 
ATOM   2568  C  CG    . GLU A  1 359 ? 111.198 96.133  19.923  1.00 28.97 ? 387  GLU A CG    1 
ATOM   2569  C  CD    . GLU A  1 359 ? 111.744 97.362  19.209  1.00 29.62 ? 387  GLU A CD    1 
ATOM   2570  O  OE1   . GLU A  1 359 ? 111.657 98.502  19.749  1.00 35.65 ? 387  GLU A OE1   1 
ATOM   2571  O  OE2   . GLU A  1 359 ? 112.271 97.180  18.095  1.00 32.07 ? 387  GLU A OE2   1 
ATOM   2572  N  N     . TRP A  1 360 ? 108.139 96.207  23.345  1.00 25.84 ? 388  TRP A N     1 
ATOM   2573  C  CA    . TRP A  1 360 ? 107.589 96.574  24.656  1.00 25.80 ? 388  TRP A CA    1 
ATOM   2574  C  C     . TRP A  1 360 ? 107.264 95.327  25.462  1.00 25.92 ? 388  TRP A C     1 
ATOM   2575  O  O     . TRP A  1 360 ? 107.447 95.323  26.673  1.00 24.90 ? 388  TRP A O     1 
ATOM   2576  C  CB    . TRP A  1 360 ? 106.338 97.442  24.534  1.00 25.87 ? 388  TRP A CB    1 
ATOM   2577  C  CG    . TRP A  1 360 ? 106.559 98.729  23.783  1.00 25.53 ? 388  TRP A CG    1 
ATOM   2578  C  CD1   . TRP A  1 360 ? 107.745 99.395  23.597  1.00 25.90 ? 388  TRP A CD1   1 
ATOM   2579  C  CD2   . TRP A  1 360 ? 105.555 99.504  23.124  1.00 26.58 ? 388  TRP A CD2   1 
ATOM   2580  N  NE1   . TRP A  1 360 ? 107.531 100.526 22.840  1.00 26.30 ? 388  TRP A NE1   1 
ATOM   2581  C  CE2   . TRP A  1 360 ? 106.194 100.620 22.548  1.00 26.52 ? 388  TRP A CE2   1 
ATOM   2582  C  CE3   . TRP A  1 360 ? 104.167 99.361  22.966  1.00 27.17 ? 388  TRP A CE3   1 
ATOM   2583  C  CZ2   . TRP A  1 360 ? 105.491 101.590 21.814  1.00 26.97 ? 388  TRP A CZ2   1 
ATOM   2584  C  CZ3   . TRP A  1 360 ? 103.478 100.314 22.240  1.00 26.60 ? 388  TRP A CZ3   1 
ATOM   2585  C  CH2   . TRP A  1 360 ? 104.141 101.414 21.673  1.00 26.62 ? 388  TRP A CH2   1 
ATOM   2586  N  N     . MET A  1 361 ? 106.784 94.288  24.786  1.00 26.21 ? 389  MET A N     1 
ATOM   2587  C  CA    . MET A  1 361 ? 106.505 93.004  25.442  1.00 27.33 ? 389  MET A CA    1 
ATOM   2588  C  C     . MET A  1 361 ? 107.785 92.276  25.897  1.00 27.00 ? 389  MET A C     1 
ATOM   2589  O  O     . MET A  1 361 ? 107.753 91.506  26.852  1.00 28.10 ? 389  MET A O     1 
ATOM   2590  C  CB    . MET A  1 361 ? 105.746 92.056  24.509  1.00 27.70 ? 389  MET A CB    1 
ATOM   2591  C  CG    . MET A  1 361 ? 104.389 92.512  23.981  1.00 31.45 ? 389  MET A CG    1 
ATOM   2592  S  SD    . MET A  1 361 ? 103.039 92.513  25.158  1.00 36.56 ? 389  MET A SD    1 
ATOM   2593  C  CE    . MET A  1 361 ? 102.917 90.775  25.585  1.00 34.08 ? 389  MET A CE    1 
ATOM   2594  N  N     . GLY A  1 362 ? 108.887 92.472  25.175  1.00 26.61 ? 390  GLY A N     1 
ATOM   2595  C  CA    . GLY A  1 362 ? 110.129 91.722  25.399  1.00 26.22 ? 390  GLY A CA    1 
ATOM   2596  C  C     . GLY A  1 362 ? 110.014 90.286  24.890  1.00 25.74 ? 390  GLY A C     1 
ATOM   2597  O  O     . GLY A  1 362 ? 109.281 90.017  23.940  1.00 26.11 ? 390  GLY A O     1 
ATOM   2598  N  N     . GLY A  1 363 ? 110.709 89.363  25.555  1.00 25.15 ? 391  GLY A N     1 
ATOM   2599  C  CA    . GLY A  1 363 ? 110.771 87.972  25.110  1.00 25.06 ? 391  GLY A CA    1 
ATOM   2600  C  C     . GLY A  1 363 ? 109.429 87.333  24.771  1.00 24.58 ? 391  GLY A C     1 
ATOM   2601  O  O     . GLY A  1 363 ? 109.288 86.673  23.723  1.00 23.61 ? 391  GLY A O     1 
ATOM   2602  N  N     . VAL A  1 364 ? 108.437 87.525  25.649  1.00 24.19 ? 392  VAL A N     1 
ATOM   2603  C  CA    . VAL A  1 364 ? 107.100 86.947  25.422  1.00 24.08 ? 392  VAL A CA    1 
ATOM   2604  C  C     . VAL A  1 364 ? 106.450 87.417  24.102  1.00 24.00 ? 392  VAL A C     1 
ATOM   2605  O  O     . VAL A  1 364 ? 105.698 86.667  23.477  1.00 23.60 ? 392  VAL A O     1 
ATOM   2606  C  CB    . VAL A  1 364 ? 106.122 87.208  26.604  1.00 24.53 ? 392  VAL A CB    1 
ATOM   2607  C  CG1   . VAL A  1 364 ? 106.534 86.441  27.850  1.00 23.37 ? 392  VAL A CG1   1 
ATOM   2608  C  CG2   . VAL A  1 364 ? 105.959 88.720  26.865  1.00 23.72 ? 392  VAL A CG2   1 
ATOM   2609  N  N     . GLY A  1 365 ? 106.735 88.651  23.696  1.00 23.72 ? 393  GLY A N     1 
ATOM   2610  C  CA    . GLY A  1 365 ? 106.263 89.189  22.419  1.00 24.30 ? 393  GLY A CA    1 
ATOM   2611  C  C     . GLY A  1 365 ? 106.774 88.444  21.186  1.00 24.12 ? 393  GLY A C     1 
ATOM   2612  O  O     . GLY A  1 365 ? 106.123 88.459  20.125  1.00 24.50 ? 393  GLY A O     1 
ATOM   2613  N  N     . TYR A  1 366 ? 107.910 87.770  21.334  1.00 23.34 ? 394  TYR A N     1 
ATOM   2614  C  CA    . TYR A  1 366 ? 108.528 87.001  20.243  1.00 23.99 ? 394  TYR A CA    1 
ATOM   2615  C  C     . TYR A  1 366 ? 107.984 85.576  20.165  1.00 23.71 ? 394  TYR A C     1 
ATOM   2616  O  O     . TYR A  1 366 ? 108.388 84.799  19.292  1.00 23.97 ? 394  TYR A O     1 
ATOM   2617  C  CB    . TYR A  1 366 ? 110.061 86.998  20.424  1.00 23.80 ? 394  TYR A CB    1 
ATOM   2618  C  CG    . TYR A  1 366 ? 110.881 86.773  19.156  1.00 25.09 ? 394  TYR A CG    1 
ATOM   2619  C  CD1   . TYR A  1 366 ? 110.898 87.717  18.128  1.00 25.40 ? 394  TYR A CD1   1 
ATOM   2620  C  CD2   . TYR A  1 366 ? 111.665 85.623  19.000  1.00 25.49 ? 394  TYR A CD2   1 
ATOM   2621  C  CE1   . TYR A  1 366 ? 111.648 87.515  16.965  1.00 24.98 ? 394  TYR A CE1   1 
ATOM   2622  C  CE2   . TYR A  1 366 ? 112.430 85.418  17.841  1.00 25.11 ? 394  TYR A CE2   1 
ATOM   2623  C  CZ    . TYR A  1 366 ? 112.411 86.374  16.834  1.00 24.74 ? 394  TYR A CZ    1 
ATOM   2624  O  OH    . TYR A  1 366 ? 113.153 86.188  15.696  1.00 25.40 ? 394  TYR A OH    1 
ATOM   2625  N  N     . THR A  1 367 ? 107.079 85.212  21.079  1.00 23.35 ? 395  THR A N     1 
ATOM   2626  C  CA    . THR A  1 367 ? 106.505 83.868  21.078  1.00 23.36 ? 395  THR A CA    1 
ATOM   2627  C  C     . THR A  1 367 ? 105.069 83.855  20.557  1.00 23.71 ? 395  THR A C     1 
ATOM   2628  O  O     . THR A  1 367 ? 104.319 84.840  20.694  1.00 23.01 ? 395  THR A O     1 
ATOM   2629  C  CB    . THR A  1 367 ? 106.536 83.215  22.488  1.00 23.69 ? 395  THR A CB    1 
ATOM   2630  O  OG1   . THR A  1 367 ? 105.551 83.841  23.335  1.00 23.67 ? 395  THR A OG1   1 
ATOM   2631  C  CG2   . THR A  1 367 ? 107.933 83.351  23.130  1.00 23.41 ? 395  THR A CG2   1 
ATOM   2632  N  N     . LYS A  1 368 ? 104.701 82.710  19.978  1.00 24.61 ? 396  LYS A N     1 
ATOM   2633  C  CA    . LYS A  1 368 ? 103.372 82.472  19.420  1.00 25.88 ? 396  LYS A CA    1 
ATOM   2634  C  C     . LYS A  1 368 ? 102.287 82.157  20.471  1.00 26.49 ? 396  LYS A C     1 
ATOM   2635  O  O     . LYS A  1 368 ? 101.104 82.098  20.138  1.00 25.90 ? 396  LYS A O     1 
ATOM   2636  C  CB    . LYS A  1 368 ? 103.436 81.354  18.358  1.00 25.69 ? 396  LYS A CB    1 
ATOM   2637  C  CG    . LYS A  1 368 ? 104.347 81.723  17.176  1.00 26.40 ? 396  LYS A CG    1 
ATOM   2638  C  CD    . LYS A  1 368 ? 104.143 80.835  15.961  1.00 26.79 ? 396  LYS A CD    1 
ATOM   2639  C  CE    . LYS A  1 368 ? 105.035 81.276  14.795  1.00 27.10 ? 396  LYS A CE    1 
ATOM   2640  N  NZ    . LYS A  1 368 ? 104.541 82.459  14.059  1.00 24.62 ? 396  LYS A NZ    1 
ATOM   2641  N  N     . ASP A  1 369 ? 102.695 81.978  21.725  1.00 27.08 ? 397  ASP A N     1 
ATOM   2642  C  CA    . ASP A  1 369 ? 101.764 81.939  22.857  1.00 28.29 ? 397  ASP A CA    1 
ATOM   2643  C  C     . ASP A  1 369 ? 101.107 83.297  23.140  1.00 28.19 ? 397  ASP A C     1 
ATOM   2644  O  O     . ASP A  1 369 ? 100.119 83.370  23.856  1.00 27.95 ? 397  ASP A O     1 
ATOM   2645  C  CB    . ASP A  1 369 ? 102.507 81.469  24.096  1.00 29.18 ? 397  ASP A CB    1 
ATOM   2646  C  CG    . ASP A  1 369 ? 103.257 80.173  23.852  1.00 32.28 ? 397  ASP A CG    1 
ATOM   2647  O  OD1   . ASP A  1 369 ? 102.835 79.151  24.391  1.00 36.52 ? 397  ASP A OD1   1 
ATOM   2648  O  OD2   . ASP A  1 369 ? 104.237 80.178  23.068  1.00 38.16 ? 397  ASP A OD2   1 
ATOM   2649  N  N     . TYR A  1 370 ? 101.684 84.366  22.604  1.00 27.53 ? 398  TYR A N     1 
ATOM   2650  C  CA    . TYR A  1 370 ? 101.143 85.704  22.741  1.00 27.85 ? 398  TYR A CA    1 
ATOM   2651  C  C     . TYR A  1 370 ? 100.747 86.184  21.354  1.00 28.12 ? 398  TYR A C     1 
ATOM   2652  O  O     . TYR A  1 370 ? 101.291 85.707  20.359  1.00 27.72 ? 398  TYR A O     1 
ATOM   2653  C  CB    . TYR A  1 370 ? 102.191 86.632  23.395  1.00 28.08 ? 398  TYR A CB    1 
ATOM   2654  C  CG    . TYR A  1 370 ? 102.395 86.356  24.873  1.00 28.14 ? 398  TYR A CG    1 
ATOM   2655  C  CD1   . TYR A  1 370 ? 101.928 87.249  25.839  1.00 29.50 ? 398  TYR A CD1   1 
ATOM   2656  C  CD2   . TYR A  1 370 ? 103.054 85.193  25.306  1.00 28.12 ? 398  TYR A CD2   1 
ATOM   2657  C  CE1   . TYR A  1 370 ? 102.119 86.996  27.212  1.00 28.95 ? 398  TYR A CE1   1 
ATOM   2658  C  CE2   . TYR A  1 370 ? 103.235 84.924  26.655  1.00 28.83 ? 398  TYR A CE2   1 
ATOM   2659  C  CZ    . TYR A  1 370 ? 102.772 85.834  27.600  1.00 29.54 ? 398  TYR A CZ    1 
ATOM   2660  O  OH    . TYR A  1 370 ? 102.956 85.567  28.925  1.00 29.76 ? 398  TYR A OH    1 
ATOM   2661  N  N     . PRO A  1 371 ? 99.780  87.124  21.273  1.00 28.82 ? 399  PRO A N     1 
ATOM   2662  C  CA    . PRO A  1 371 ? 99.188  87.493  19.988  1.00 28.19 ? 399  PRO A CA    1 
ATOM   2663  C  C     . PRO A  1 371 ? 99.923  88.554  19.183  1.00 27.91 ? 399  PRO A C     1 
ATOM   2664  O  O     . PRO A  1 371 ? 99.539  88.810  18.050  1.00 28.27 ? 399  PRO A O     1 
ATOM   2665  C  CB    . PRO A  1 371 ? 97.818  88.029  20.410  1.00 28.38 ? 399  PRO A CB    1 
ATOM   2666  C  CG    . PRO A  1 371 ? 98.127  88.740  21.701  1.00 28.86 ? 399  PRO A CG    1 
ATOM   2667  C  CD    . PRO A  1 371 ? 99.151  87.871  22.386  1.00 28.79 ? 399  PRO A CD    1 
ATOM   2668  N  N     . VAL A  1 372 ? 100.965 89.177  19.744  1.00 27.56 ? 400  VAL A N     1 
ATOM   2669  C  CA    . VAL A  1 372 ? 101.552 90.347  19.121  1.00 27.03 ? 400  VAL A CA    1 
ATOM   2670  C  C     . VAL A  1 372 ? 102.413 89.978  17.884  1.00 26.74 ? 400  VAL A C     1 
ATOM   2671  O  O     . VAL A  1 372 ? 102.438 90.729  16.910  1.00 25.95 ? 400  VAL A O     1 
ATOM   2672  C  CB    A VAL A  1 372 ? 102.367 91.159  20.170  0.50 27.28 ? 400  VAL A CB    1 
ATOM   2673  C  CB    B VAL A  1 372 ? 102.323 91.283  20.118  0.50 27.28 ? 400  VAL A CB    1 
ATOM   2674  C  CG1   A VAL A  1 372 ? 103.045 92.333  19.548  0.50 26.46 ? 400  VAL A CG1   1 
ATOM   2675  C  CG1   B VAL A  1 372 ? 101.382 91.758  21.232  0.50 27.36 ? 400  VAL A CG1   1 
ATOM   2676  C  CG2   A VAL A  1 372 ? 101.455 91.604  21.330  0.50 27.06 ? 400  VAL A CG2   1 
ATOM   2677  C  CG2   B VAL A  1 372 ? 103.550 90.599  20.711  0.50 27.32 ? 400  VAL A CG2   1 
ATOM   2678  N  N     . GLU A  1 373 ? 103.081 88.827  17.901  1.00 26.09 ? 401  GLU A N     1 
ATOM   2679  C  CA    . GLU A  1 373 ? 103.880 88.415  16.738  1.00 25.60 ? 401  GLU A CA    1 
ATOM   2680  C  C     . GLU A  1 373 ? 103.011 88.187  15.483  1.00 25.15 ? 401  GLU A C     1 
ATOM   2681  O  O     . GLU A  1 373 ? 103.483 88.426  14.370  1.00 25.47 ? 401  GLU A O     1 
ATOM   2682  C  CB    . GLU A  1 373 ? 104.793 87.217  17.054  1.00 25.84 ? 401  GLU A CB    1 
ATOM   2683  C  CG    . GLU A  1 373 ? 104.082 85.895  17.377  1.00 26.61 ? 401  GLU A CG    1 
ATOM   2684  C  CD    . GLU A  1 373 ? 103.654 85.101  16.167  1.00 25.85 ? 401  GLU A CD    1 
ATOM   2685  O  OE1   . GLU A  1 373 ? 102.524 84.532  16.184  1.00 22.47 ? 401  GLU A OE1   1 
ATOM   2686  O  OE2   . GLU A  1 373 ? 104.471 84.997  15.224  1.00 26.45 ? 401  GLU A OE2   1 
ATOM   2687  N  N     . LYS A  1 374 ? 101.763 87.734  15.654  1.00 24.11 ? 402  LYS A N     1 
ATOM   2688  C  CA    . LYS A  1 374 ? 100.835 87.584  14.514  1.00 24.05 ? 402  LYS A CA    1 
ATOM   2689  C  C     . LYS A  1 374 ? 100.418 88.941  13.942  1.00 23.95 ? 402  LYS A C     1 
ATOM   2690  O  O     . LYS A  1 374 ? 100.433 89.127  12.731  1.00 24.00 ? 402  LYS A O     1 
ATOM   2691  C  CB    . LYS A  1 374 ? 99.611  86.732  14.866  1.00 23.94 ? 402  LYS A CB    1 
ATOM   2692  C  CG    . LYS A  1 374 ? 98.671  86.501  13.695  1.00 23.69 ? 402  LYS A CG    1 
ATOM   2693  C  CD    . LYS A  1 374 ? 97.498  85.643  14.078  1.00 23.44 ? 402  LYS A CD    1 
ATOM   2694  C  CE    . LYS A  1 374 ? 96.431  85.644  12.976  1.00 25.12 ? 402  LYS A CE    1 
ATOM   2695  N  NZ    . LYS A  1 374 ? 95.831  86.995  12.783  1.00 24.47 ? 402  LYS A NZ    1 
ATOM   2696  N  N     . TYR A  1 375 ? 100.074 89.900  14.796  1.00 24.57 ? 403  TYR A N     1 
ATOM   2697  C  CA    . TYR A  1 375 ? 99.810  91.259  14.320  1.00 24.88 ? 403  TYR A CA    1 
ATOM   2698  C  C     . TYR A  1 375 ? 100.983 91.794  13.497  1.00 25.03 ? 403  TYR A C     1 
ATOM   2699  O  O     . TYR A  1 375 ? 100.786 92.392  12.456  1.00 25.12 ? 403  TYR A O     1 
ATOM   2700  C  CB    . TYR A  1 375 ? 99.527  92.212  15.471  1.00 24.78 ? 403  TYR A CB    1 
ATOM   2701  C  CG    . TYR A  1 375 ? 98.200  92.037  16.162  1.00 25.15 ? 403  TYR A CG    1 
ATOM   2702  C  CD1   . TYR A  1 375 ? 96.985  92.176  15.466  1.00 26.33 ? 403  TYR A CD1   1 
ATOM   2703  C  CD2   . TYR A  1 375 ? 98.144  91.791  17.538  1.00 25.49 ? 403  TYR A CD2   1 
ATOM   2704  C  CE1   . TYR A  1 375 ? 95.757  92.047  16.136  1.00 25.29 ? 403  TYR A CE1   1 
ATOM   2705  C  CE2   . TYR A  1 375 ? 96.950  91.666  18.200  1.00 26.52 ? 403  TYR A CE2   1 
ATOM   2706  C  CZ    . TYR A  1 375 ? 95.755  91.795  17.505  1.00 26.86 ? 403  TYR A CZ    1 
ATOM   2707  O  OH    . TYR A  1 375 ? 94.580  91.666  18.213  1.00 24.99 ? 403  TYR A OH    1 
ATOM   2708  N  N     . PHE A  1 376 ? 102.204 91.588  13.989  1.00 25.06 ? 404  PHE A N     1 
ATOM   2709  C  CA    . PHE A  1 376 ? 103.415 92.017  13.283  1.00 24.69 ? 404  PHE A CA    1 
ATOM   2710  C  C     . PHE A  1 376 ? 103.554 91.403  11.883  1.00 24.77 ? 404  PHE A C     1 
ATOM   2711  O  O     . PHE A  1 376 ? 103.824 92.108  10.919  1.00 24.30 ? 404  PHE A O     1 
ATOM   2712  C  CB    . PHE A  1 376 ? 104.627 91.724  14.171  1.00 25.45 ? 404  PHE A CB    1 
ATOM   2713  C  CG    . PHE A  1 376 ? 105.967 91.943  13.538  1.00 23.86 ? 404  PHE A CG    1 
ATOM   2714  C  CD1   . PHE A  1 376 ? 106.540 93.193  13.511  1.00 24.91 ? 404  PHE A CD1   1 
ATOM   2715  C  CD2   . PHE A  1 376 ? 106.710 90.855  13.063  1.00 26.13 ? 404  PHE A CD2   1 
ATOM   2716  C  CE1   . PHE A  1 376 ? 107.815 93.388  12.986  1.00 25.49 ? 404  PHE A CE1   1 
ATOM   2717  C  CE2   . PHE A  1 376 ? 107.984 91.050  12.538  1.00 24.79 ? 404  PHE A CE2   1 
ATOM   2718  C  CZ    . PHE A  1 376 ? 108.528 92.324  12.500  1.00 24.57 ? 404  PHE A CZ    1 
ATOM   2719  N  N     . ARG A  1 377 ? 103.363 90.101  11.781  1.00 24.85 ? 405  ARG A N     1 
ATOM   2720  C  CA    . ARG A  1 377 ? 103.423 89.389  10.497  1.00 25.36 ? 405  ARG A CA    1 
ATOM   2721  C  C     . ARG A  1 377 ? 102.297 89.787  9.537   1.00 25.45 ? 405  ARG A C     1 
ATOM   2722  O  O     . ARG A  1 377 ? 102.528 89.918  8.331   1.00 25.41 ? 405  ARG A O     1 
ATOM   2723  C  CB    . ARG A  1 377 ? 103.381 87.886  10.730  1.00 24.78 ? 405  ARG A CB    1 
ATOM   2724  C  CG    . ARG A  1 377 ? 104.618 87.356  11.405  1.00 24.49 ? 405  ARG A CG    1 
ATOM   2725  C  CD    . ARG A  1 377 ? 104.578 85.840  11.546  1.00 24.13 ? 405  ARG A CD    1 
ATOM   2726  N  NE    . ARG A  1 377 ? 103.622 85.407  12.560  1.00 24.47 ? 405  ARG A NE    1 
ATOM   2727  C  CZ    . ARG A  1 377 ? 102.472 84.763  12.342  1.00 25.62 ? 405  ARG A CZ    1 
ATOM   2728  N  NH1   . ARG A  1 377 ? 102.037 84.468  11.113  1.00 25.74 ? 405  ARG A NH1   1 
ATOM   2729  N  NH2   . ARG A  1 377 ? 101.731 84.425  13.387  1.00 24.81 ? 405  ARG A NH2   1 
ATOM   2730  N  N     . ASP A  1 378 ? 101.088 89.955  10.083  1.00 26.26 ? 406  ASP A N     1 
ATOM   2731  C  CA    . ASP A  1 378 ? 99.934  90.408  9.310   1.00 26.66 ? 406  ASP A CA    1 
ATOM   2732  C  C     . ASP A  1 378 ? 100.102 91.842  8.790   1.00 26.94 ? 406  ASP A C     1 
ATOM   2733  O  O     . ASP A  1 378 ? 99.719  92.138  7.648   1.00 26.24 ? 406  ASP A O     1 
ATOM   2734  C  CB    . ASP A  1 378 ? 98.640  90.353  10.131  1.00 26.52 ? 406  ASP A CB    1 
ATOM   2735  C  CG    . ASP A  1 378 ? 98.171  88.929  10.461  1.00 26.42 ? 406  ASP A CG    1 
ATOM   2736  O  OD1   . ASP A  1 378 ? 98.702  87.909  9.938   1.00 26.86 ? 406  ASP A OD1   1 
ATOM   2737  O  OD2   . ASP A  1 378 ? 97.216  88.843  11.263  1.00 27.07 ? 406  ASP A OD2   1 
ATOM   2738  N  N     . ALA A  1 379 ? 100.663 92.732  9.620   1.00 27.22 ? 407  ALA A N     1 
ATOM   2739  C  CA    . ALA A  1 379 ? 100.755 94.149  9.260   1.00 27.53 ? 407  ALA A CA    1 
ATOM   2740  C  C     . ALA A  1 379 ? 101.608 94.385  8.022   1.00 27.84 ? 407  ALA A C     1 
ATOM   2741  O  O     . ALA A  1 379 ? 101.368 95.348  7.266   1.00 28.30 ? 407  ALA A O     1 
ATOM   2742  C  CB    . ALA A  1 379 ? 101.305 95.002  10.458  1.00 27.04 ? 407  ALA A CB    1 
ATOM   2743  N  N     . LYS A  1 380 ? 102.612 93.531  7.823   1.00 27.75 ? 408  LYS A N     1 
ATOM   2744  C  CA    . LYS A  1 380 ? 103.595 93.728  6.754   1.00 28.23 ? 408  LYS A CA    1 
ATOM   2745  C  C     . LYS A  1 380 ? 102.944 93.684  5.338   1.00 28.36 ? 408  LYS A C     1 
ATOM   2746  O  O     . LYS A  1 380 ? 103.396 94.372  4.448   1.00 28.43 ? 408  LYS A O     1 
ATOM   2747  C  CB    . LYS A  1 380 ? 104.783 92.735  6.921   1.00 28.45 ? 408  LYS A CB    1 
ATOM   2748  C  CG    . LYS A  1 380 ? 106.001 92.923  5.963   1.00 28.90 ? 408  LYS A CG    1 
ATOM   2749  C  CD    . LYS A  1 380 ? 106.867 94.162  6.276   1.00 29.87 ? 408  LYS A CD    1 
ATOM   2750  C  CE    . LYS A  1 380 ? 106.757 95.220  5.206   1.00 29.98 ? 408  LYS A CE    1 
ATOM   2751  N  NZ    . LYS A  1 380 ? 107.423 96.491  5.604   1.00 30.51 ? 408  LYS A NZ    1 
ATOM   2752  N  N     . ILE A  1 381 ? 101.863 92.925  5.140   1.00 28.94 ? 409  ILE A N     1 
ATOM   2753  C  CA    . ILE A  1 381 ? 101.181 92.892  3.832   1.00 29.14 ? 409  ILE A CA    1 
ATOM   2754  C  C     . ILE A  1 381 ? 100.625 94.274  3.409   1.00 29.25 ? 409  ILE A C     1 
ATOM   2755  O  O     . ILE A  1 381 ? 100.498 94.566  2.220   1.00 29.25 ? 409  ILE A O     1 
ATOM   2756  C  CB    . ILE A  1 381 ? 100.044 91.821  3.791   1.00 29.54 ? 409  ILE A CB    1 
ATOM   2757  C  CG1   . ILE A  1 381 ? 99.580  91.556  2.344   1.00 30.45 ? 409  ILE A CG1   1 
ATOM   2758  C  CG2   . ILE A  1 381 ? 98.834  92.244  4.638   1.00 29.75 ? 409  ILE A CG2   1 
ATOM   2759  C  CD1   . ILE A  1 381 ? 100.662 91.296  1.350   1.00 29.02 ? 409  ILE A CD1   1 
ATOM   2760  N  N     . GLY A  1 382 ? 100.304 95.108  4.397   1.00 29.17 ? 410  GLY A N     1 
ATOM   2761  C  CA    . GLY A  1 382 ? 99.679  96.392  4.179   1.00 29.69 ? 410  GLY A CA    1 
ATOM   2762  C  C     . GLY A  1 382 ? 100.434 97.363  3.286   1.00 29.75 ? 410  GLY A C     1 
ATOM   2763  O  O     . GLY A  1 382 ? 99.814  98.174  2.621   1.00 29.89 ? 410  GLY A O     1 
ATOM   2764  N  N     . THR A  1 383 ? 101.757 97.265  3.256   1.00 30.22 ? 411  THR A N     1 
ATOM   2765  C  CA    . THR A  1 383 ? 102.573 98.152  2.427   1.00 30.70 ? 411  THR A CA    1 
ATOM   2766  C  C     . THR A  1 383 ? 102.781 97.606  1.014   1.00 30.85 ? 411  THR A C     1 
ATOM   2767  O  O     . THR A  1 383 ? 103.465 98.236  0.193   1.00 30.08 ? 411  THR A O     1 
ATOM   2768  C  CB    . THR A  1 383 ? 103.940 98.488  3.103   1.00 31.11 ? 411  THR A CB    1 
ATOM   2769  O  OG1   . THR A  1 383 ? 104.751 97.313  3.196   1.00 30.94 ? 411  THR A OG1   1 
ATOM   2770  C  CG2   . THR A  1 383 ? 103.724 99.109  4.483   1.00 31.45 ? 411  THR A CG2   1 
ATOM   2771  N  N     . ILE A  1 384 ? 102.153 96.458  0.724   1.00 31.06 ? 412  ILE A N     1 
ATOM   2772  C  CA    . ILE A  1 384 ? 102.357 95.748  -0.528  1.00 31.86 ? 412  ILE A CA    1 
ATOM   2773  C  C     . ILE A  1 384 ? 101.078 95.653  -1.365  1.00 31.28 ? 412  ILE A C     1 
ATOM   2774  O  O     . ILE A  1 384 ? 101.035 96.124  -2.495  1.00 31.54 ? 412  ILE A O     1 
ATOM   2775  C  CB    . ILE A  1 384 ? 102.922 94.305  -0.278  1.00 31.86 ? 412  ILE A CB    1 
ATOM   2776  C  CG1   . ILE A  1 384 ? 104.271 94.366  0.456   1.00 32.74 ? 412  ILE A CG1   1 
ATOM   2777  C  CG2   . ILE A  1 384 ? 103.027 93.547  -1.608  1.00 33.86 ? 412  ILE A CG2   1 
ATOM   2778  C  CD1   . ILE A  1 384 ? 104.797 93.009  0.930   1.00 32.84 ? 412  ILE A CD1   1 
ATOM   2779  N  N     . TYR A  1 385 ? 100.035 95.050  -0.817  1.00 31.02 ? 413  TYR A N     1 
ATOM   2780  C  CA    . TYR A  1 385 ? 98.835  94.859  -1.588  1.00 30.80 ? 413  TYR A CA    1 
ATOM   2781  C  C     . TYR A  1 385 ? 97.930  96.099  -1.625  1.00 31.10 ? 413  TYR A C     1 
ATOM   2782  O  O     . TYR A  1 385 ? 98.131  97.074  -0.888  1.00 31.77 ? 413  TYR A O     1 
ATOM   2783  C  CB    . TYR A  1 385 ? 98.102  93.550  -1.208  1.00 30.67 ? 413  TYR A CB    1 
ATOM   2784  C  CG    . TYR A  1 385 ? 97.337  93.477  0.094   1.00 29.82 ? 413  TYR A CG    1 
ATOM   2785  C  CD1   . TYR A  1 385 ? 96.637  92.320  0.408   1.00 30.10 ? 413  TYR A CD1   1 
ATOM   2786  C  CD2   . TYR A  1 385 ? 97.292  94.532  1.006   1.00 29.59 ? 413  TYR A CD2   1 
ATOM   2787  C  CE1   . TYR A  1 385 ? 95.933  92.205  1.590   1.00 29.49 ? 413  TYR A CE1   1 
ATOM   2788  C  CE2   . TYR A  1 385 ? 96.582  94.419  2.216   1.00 27.77 ? 413  TYR A CE2   1 
ATOM   2789  C  CZ    . TYR A  1 385 ? 95.912  93.254  2.490   1.00 29.76 ? 413  TYR A CZ    1 
ATOM   2790  O  OH    . TYR A  1 385 ? 95.207  93.109  3.658   1.00 31.29 ? 413  TYR A OH    1 
ATOM   2791  N  N     . GLU A  1 386 ? 96.968  96.039  -2.538  1.00 31.36 ? 414  GLU A N     1 
ATOM   2792  C  CA    . GLU A  1 386 ? 96.098  97.146  -2.884  1.00 31.58 ? 414  GLU A CA    1 
ATOM   2793  C  C     . GLU A  1 386 ? 96.906  98.402  -3.268  1.00 30.63 ? 414  GLU A C     1 
ATOM   2794  O  O     . GLU A  1 386 ? 96.488  99.535  -2.997  1.00 30.90 ? 414  GLU A O     1 
ATOM   2795  C  CB    . GLU A  1 386 ? 95.083  97.389  -1.759  1.00 32.51 ? 414  GLU A CB    1 
ATOM   2796  C  CG    . GLU A  1 386 ? 93.943  96.290  -1.717  1.00 36.78 ? 414  GLU A CG    1 
ATOM   2797  C  CD    . GLU A  1 386 ? 92.571  96.907  -1.781  1.00 40.58 ? 414  GLU A CD    1 
ATOM   2798  O  OE1   . GLU A  1 386 ? 92.511  98.093  -2.177  1.00 45.83 ? 414  GLU A OE1   1 
ATOM   2799  O  OE2   . GLU A  1 386 ? 91.561  96.229  -1.474  1.00 41.71 ? 414  GLU A OE2   1 
ATOM   2800  N  N     . GLY A  1 387 ? 98.045  98.179  -3.927  1.00 29.03 ? 415  GLY A N     1 
ATOM   2801  C  CA    . GLY A  1 387 ? 98.915  99.257  -4.382  1.00 28.62 ? 415  GLY A CA    1 
ATOM   2802  C  C     . GLY A  1 387 ? 100.001 99.505  -3.343  1.00 27.50 ? 415  GLY A C     1 
ATOM   2803  O  O     . GLY A  1 387 ? 99.736  100.030 -2.266  1.00 26.71 ? 415  GLY A O     1 
ATOM   2804  N  N     . ALA A  1 388 ? 101.213 99.069  -3.648  1.00 27.53 ? 416  ALA A N     1 
ATOM   2805  C  CA    . ALA A  1 388 ? 102.318 99.170  -2.712  1.00 27.19 ? 416  ALA A CA    1 
ATOM   2806  C  C     . ALA A  1 388 ? 102.529 100.637 -2.314  1.00 26.86 ? 416  ALA A C     1 
ATOM   2807  O  O     . ALA A  1 388 ? 102.080 101.541 -2.994  1.00 27.06 ? 416  ALA A O     1 
ATOM   2808  C  CB    . ALA A  1 388 ? 103.591 98.593  -3.321  1.00 27.20 ? 416  ALA A CB    1 
ATOM   2809  N  N     . SER A  1 389 ? 103.240 100.862 -1.220  1.00 27.13 ? 417  SER A N     1 
ATOM   2810  C  CA    . SER A  1 389 ? 103.504 102.231 -0.750  1.00 26.85 ? 417  SER A CA    1 
ATOM   2811  C  C     . SER A  1 389 ? 104.008 103.212 -1.812  1.00 26.27 ? 417  SER A C     1 
ATOM   2812  O  O     . SER A  1 389 ? 103.499 104.342 -1.886  1.00 25.93 ? 417  SER A O     1 
ATOM   2813  C  CB    . SER A  1 389 ? 104.435 102.210 0.456   1.00 26.84 ? 417  SER A CB    1 
ATOM   2814  O  OG    . SER A  1 389 ? 103.753 101.704 1.585   1.00 28.37 ? 417  SER A OG    1 
ATOM   2815  N  N     . ASN A  1 390 ? 104.985 102.803 -2.623  1.00 25.32 ? 418  ASN A N     1 
ATOM   2816  C  CA    . ASN A  1 390 ? 105.491 103.661 -3.702  1.00 25.29 ? 418  ASN A CA    1 
ATOM   2817  C  C     . ASN A  1 390 ? 104.394 104.106 -4.659  1.00 25.28 ? 418  ASN A C     1 
ATOM   2818  O  O     . ASN A  1 390 ? 104.364 105.259 -5.076  1.00 24.84 ? 418  ASN A O     1 
ATOM   2819  C  CB    . ASN A  1 390 ? 106.617 102.987 -4.502  1.00 24.94 ? 418  ASN A CB    1 
ATOM   2820  C  CG    . ASN A  1 390 ? 107.945 102.905 -3.733  1.00 25.52 ? 418  ASN A CG    1 
ATOM   2821  O  OD1   . ASN A  1 390 ? 108.038 103.266 -2.545  1.00 26.01 ? 418  ASN A OD1   1 
ATOM   2822  N  ND2   . ASN A  1 390 ? 108.992 102.436 -4.424  1.00 24.47 ? 418  ASN A ND2   1 
ATOM   2823  N  N     . ILE A  1 391 ? 103.490 103.183 -4.996  1.00 25.40 ? 419  ILE A N     1 
ATOM   2824  C  CA    . ILE A  1 391 ? 102.369 103.461 -5.876  1.00 25.97 ? 419  ILE A CA    1 
ATOM   2825  C  C     . ILE A  1 391 ? 101.429 104.478 -5.213  1.00 25.27 ? 419  ILE A C     1 
ATOM   2826  O  O     . ILE A  1 391 ? 100.915 105.377 -5.870  1.00 25.93 ? 419  ILE A O     1 
ATOM   2827  C  CB    . ILE A  1 391 ? 101.615 102.137 -6.242  1.00 26.04 ? 419  ILE A CB    1 
ATOM   2828  C  CG1   . ILE A  1 391 ? 102.569 101.129 -6.915  1.00 27.60 ? 419  ILE A CG1   1 
ATOM   2829  C  CG2   . ILE A  1 391 ? 100.343 102.414 -7.077  1.00 28.38 ? 419  ILE A CG2   1 
ATOM   2830  C  CD1   . ILE A  1 391 ? 103.506 101.676 -7.968  1.00 29.06 ? 419  ILE A CD1   1 
ATOM   2831  N  N     . GLN A  1 392 ? 101.229 104.356 -3.909  1.00 24.72 ? 420  GLN A N     1 
ATOM   2832  C  CA    . GLN A  1 392 ? 100.404 105.317 -3.178  1.00 24.73 ? 420  GLN A CA    1 
ATOM   2833  C  C     . GLN A  1 392 ? 101.026 106.727 -3.248  1.00 24.68 ? 420  GLN A C     1 
ATOM   2834  O  O     . GLN A  1 392 ? 100.337 107.725 -3.503  1.00 23.97 ? 420  GLN A O     1 
ATOM   2835  C  CB    . GLN A  1 392 ? 100.229 104.876 -1.718  1.00 24.61 ? 420  GLN A CB    1 
ATOM   2836  C  CG    . GLN A  1 392 ? 99.548  103.513 -1.513  1.00 25.84 ? 420  GLN A CG    1 
ATOM   2837  C  CD    . GLN A  1 392 ? 98.170  103.428 -2.149  1.00 26.37 ? 420  GLN A CD    1 
ATOM   2838  O  OE1   . GLN A  1 392 ? 97.474  104.440 -2.312  1.00 26.32 ? 420  GLN A OE1   1 
ATOM   2839  N  NE2   . GLN A  1 392 ? 97.766  102.217 -2.508  1.00 26.80 ? 420  GLN A NE2   1 
ATOM   2840  N  N     . LEU A  1 393 ? 102.342 106.795 -3.050  1.00 24.17 ? 421  LEU A N     1 
ATOM   2841  C  CA    . LEU A  1 393 ? 103.054 108.067 -3.102  1.00 24.40 ? 421  LEU A CA    1 
ATOM   2842  C  C     . LEU A  1 393 ? 102.984 108.681 -4.501  1.00 24.28 ? 421  LEU A C     1 
ATOM   2843  O  O     . LEU A  1 393 ? 102.759 109.881 -4.641  1.00 24.21 ? 421  LEU A O     1 
ATOM   2844  C  CB    . LEU A  1 393 ? 104.504 107.901 -2.644  1.00 24.17 ? 421  LEU A CB    1 
ATOM   2845  C  CG    . LEU A  1 393 ? 104.724 107.477 -1.183  1.00 25.02 ? 421  LEU A CG    1 
ATOM   2846  C  CD1   . LEU A  1 393 ? 106.220 107.310 -0.894  1.00 25.45 ? 421  LEU A CD1   1 
ATOM   2847  C  CD2   . LEU A  1 393 ? 104.094 108.460 -0.180  1.00 24.41 ? 421  LEU A CD2   1 
ATOM   2848  N  N     . ASN A  1 394 ? 103.139 107.849 -5.534  1.00 24.55 ? 422  ASN A N     1 
ATOM   2849  C  CA    . ASN A  1 394 ? 102.990 108.297 -6.916  1.00 24.58 ? 422  ASN A CA    1 
ATOM   2850  C  C     . ASN A  1 394 ? 101.608 108.901 -7.193  1.00 24.27 ? 422  ASN A C     1 
ATOM   2851  O  O     . ASN A  1 394 ? 101.486 109.939 -7.847  1.00 23.21 ? 422  ASN A O     1 
ATOM   2852  C  CB    . ASN A  1 394 ? 103.190 107.125 -7.890  1.00 25.39 ? 422  ASN A CB    1 
ATOM   2853  C  CG    . ASN A  1 394 ? 104.622 106.618 -7.935  1.00 25.36 ? 422  ASN A CG    1 
ATOM   2854  O  OD1   . ASN A  1 394 ? 105.554 107.259 -7.448  1.00 24.90 ? 422  ASN A OD1   1 
ATOM   2855  N  ND2   . ASN A  1 394 ? 104.799 105.443 -8.536  1.00 26.00 ? 422  ASN A ND2   1 
ATOM   2856  N  N     . THR A  1 395 ? 100.576 108.206 -6.731  1.00 24.20 ? 423  THR A N     1 
ATOM   2857  C  CA    . THR A  1 395 ? 99.196  108.673 -6.848  1.00 24.12 ? 423  THR A CA    1 
ATOM   2858  C  C     . THR A  1 395 ? 99.009  110.012 -6.117  1.00 23.35 ? 423  THR A C     1 
ATOM   2859  O  O     . THR A  1 395 ? 98.460  110.942 -6.672  1.00 23.23 ? 423  THR A O     1 
ATOM   2860  C  CB    . THR A  1 395 ? 98.198  107.643 -6.285  1.00 24.06 ? 423  THR A CB    1 
ATOM   2861  O  OG1   . THR A  1 395 ? 98.314  106.414 -7.011  1.00 25.65 ? 423  THR A OG1   1 
ATOM   2862  C  CG2   . THR A  1 395 ? 96.743  108.186 -6.367  1.00 24.43 ? 423  THR A CG2   1 
ATOM   2863  N  N     . ILE A  1 396 ? 99.486  110.095 -4.874  1.00 23.96 ? 424  ILE A N     1 
ATOM   2864  C  CA    . ILE A  1 396 ? 99.392  111.335 -4.090  1.00 23.57 ? 424  ILE A CA    1 
ATOM   2865  C  C     . ILE A  1 396 ? 100.066 112.482 -4.838  1.00 24.30 ? 424  ILE A C     1 
ATOM   2866  O  O     . ILE A  1 396 ? 99.515  113.577 -4.930  1.00 23.62 ? 424  ILE A O     1 
ATOM   2867  C  CB    . ILE A  1 396 ? 99.951  111.183 -2.653  1.00 23.62 ? 424  ILE A CB    1 
ATOM   2868  C  CG1   . ILE A  1 396 ? 99.062  110.234 -1.831  1.00 23.92 ? 424  ILE A CG1   1 
ATOM   2869  C  CG2   . ILE A  1 396 ? 100.081 112.573 -1.933  1.00 22.28 ? 424  ILE A CG2   1 
ATOM   2870  C  CD1   . ILE A  1 396 ? 99.749  109.596 -0.635  1.00 22.38 ? 424  ILE A CD1   1 
ATOM   2871  N  N     . ALA A  1 397 ? 101.254 112.217 -5.379  1.00 25.31 ? 425  ALA A N     1 
ATOM   2872  C  CA    . ALA A  1 397 ? 102.032 113.233 -6.093  1.00 25.80 ? 425  ALA A CA    1 
ATOM   2873  C  C     . ALA A  1 397 ? 101.292 113.745 -7.317  1.00 25.92 ? 425  ALA A C     1 
ATOM   2874  O  O     . ALA A  1 397 ? 101.316 114.936 -7.569  1.00 25.71 ? 425  ALA A O     1 
ATOM   2875  C  CB    . ALA A  1 397 ? 103.432 112.687 -6.489  1.00 25.06 ? 425  ALA A CB    1 
ATOM   2876  N  N     . LYS A  1 398 ? 100.647 112.852 -8.078  1.00 26.78 ? 426  LYS A N     1 
ATOM   2877  C  CA    . LYS A  1 398 ? 99.868  113.253 -9.257  1.00 27.59 ? 426  LYS A CA    1 
ATOM   2878  C  C     . LYS A  1 398 ? 98.773  114.249 -8.891  1.00 26.61 ? 426  LYS A C     1 
ATOM   2879  O  O     . LYS A  1 398 ? 98.556  115.237 -9.589  1.00 26.23 ? 426  LYS A O     1 
ATOM   2880  C  CB    . LYS A  1 398 ? 99.277  112.039 -9.993  1.00 28.09 ? 426  LYS A CB    1 
ATOM   2881  C  CG    . LYS A  1 398 ? 100.317 111.303 -10.811 1.00 30.77 ? 426  LYS A CG    1 
ATOM   2882  C  CD    . LYS A  1 398 ? 99.792  110.060 -11.524 1.00 31.13 ? 426  LYS A CD    1 
ATOM   2883  C  CE    . LYS A  1 398 ? 100.660 109.756 -12.765 1.00 35.56 ? 426  LYS A CE    1 
ATOM   2884  N  N     . HIS A  1 399 ? 98.129  114.022 -7.751  1.00 26.45 ? 427  HIS A N     1 
ATOM   2885  C  CA    . HIS A  1 399 ? 97.079  114.929 -7.276  1.00 25.93 ? 427  HIS A CA    1 
ATOM   2886  C  C     . HIS A  1 399 ? 97.623  116.272 -6.782  1.00 25.17 ? 427  HIS A C     1 
ATOM   2887  O  O     . HIS A  1 399 ? 97.045  117.313 -7.033  1.00 24.80 ? 427  HIS A O     1 
ATOM   2888  C  CB    . HIS A  1 399 ? 96.211  114.220 -6.226  1.00 25.71 ? 427  HIS A CB    1 
ATOM   2889  C  CG    . HIS A  1 399 ? 95.263  113.244 -6.839  1.00 27.22 ? 427  HIS A CG    1 
ATOM   2890  N  ND1   . HIS A  1 399 ? 93.975  113.589 -7.202  1.00 28.37 ? 427  HIS A ND1   1 
ATOM   2891  C  CD2   . HIS A  1 399 ? 95.437  111.961 -7.233  1.00 29.18 ? 427  HIS A CD2   1 
ATOM   2892  C  CE1   . HIS A  1 399 ? 93.386  112.542 -7.754  1.00 29.17 ? 427  HIS A CE1   1 
ATOM   2893  N  NE2   . HIS A  1 399 ? 94.251  111.544 -7.790  1.00 28.91 ? 427  HIS A NE2   1 
ATOM   2894  N  N     . ILE A  1 400 ? 98.759  116.236 -6.104  1.00 25.34 ? 428  ILE A N     1 
ATOM   2895  C  CA    . ILE A  1 400 ? 99.434  117.460 -5.678  1.00 25.15 ? 428  ILE A CA    1 
ATOM   2896  C  C     . ILE A  1 400 ? 99.793  118.317 -6.896  1.00 25.26 ? 428  ILE A C     1 
ATOM   2897  O  O     . ILE A  1 400 ? 99.589  119.521 -6.878  1.00 24.98 ? 428  ILE A O     1 
ATOM   2898  C  CB    A ILE A  1 400 ? 100.688 117.147 -4.820  0.50 24.97 ? 428  ILE A CB    1 
ATOM   2899  C  CB    B ILE A  1 400 ? 100.682 117.141 -4.820  0.50 24.88 ? 428  ILE A CB    1 
ATOM   2900  C  CG1   A ILE A  1 400 ? 100.274 116.526 -3.477  0.50 24.81 ? 428  ILE A CG1   1 
ATOM   2901  C  CG1   B ILE A  1 400 ? 100.256 116.519 -3.485  0.50 24.50 ? 428  ILE A CG1   1 
ATOM   2902  C  CG2   A ILE A  1 400 ? 101.536 118.404 -4.579  0.50 24.73 ? 428  ILE A CG2   1 
ATOM   2903  C  CG2   B ILE A  1 400 ? 101.524 118.395 -4.560  0.50 24.67 ? 428  ILE A CG2   1 
ATOM   2904  C  CD1   A ILE A  1 400 ? 99.627  117.499 -2.507  0.50 23.95 ? 428  ILE A CD1   1 
ATOM   2905  C  CD1   B ILE A  1 400 ? 101.375 115.795 -2.766  0.50 22.87 ? 428  ILE A CD1   1 
ATOM   2906  N  N     . ASP A  1 401 ? 100.280 117.682 -7.963  1.00 25.81 ? 429  ASP A N     1 
ATOM   2907  C  CA    . ASP A  1 401 ? 100.623 118.382 -9.208  1.00 26.23 ? 429  ASP A CA    1 
ATOM   2908  C  C     . ASP A  1 401 ? 99.406  119.124 -9.799  1.00 27.07 ? 429  ASP A C     1 
ATOM   2909  O  O     . ASP A  1 401 ? 99.514  120.283 -10.246 1.00 26.96 ? 429  ASP A O     1 
ATOM   2910  C  CB    . ASP A  1 401 ? 101.179 117.364 -10.209 1.00 26.34 ? 429  ASP A CB    1 
ATOM   2911  C  CG    . ASP A  1 401 ? 101.938 117.992 -11.356 1.00 26.35 ? 429  ASP A CG    1 
ATOM   2912  O  OD1   . ASP A  1 401 ? 102.242 119.196 -11.331 1.00 25.89 ? 429  ASP A OD1   1 
ATOM   2913  O  OD2   . ASP A  1 401 ? 102.231 117.254 -12.314 1.00 26.99 ? 429  ASP A OD2   1 
ATOM   2914  N  N     . ALA A  1 402 ? 98.252  118.456 -9.783  1.00 27.38 ? 430  ALA A N     1 
ATOM   2915  C  CA    . ALA A  1 402 ? 97.002  119.022 -10.281 1.00 28.43 ? 430  ALA A CA    1 
ATOM   2916  C  C     . ALA A  1 402 ? 96.491  120.183 -9.425  1.00 29.10 ? 430  ALA A C     1 
ATOM   2917  O  O     . ALA A  1 402 ? 95.768  121.030 -9.918  1.00 29.51 ? 430  ALA A O     1 
ATOM   2918  C  CB    . ALA A  1 402 ? 95.934  117.923 -10.375 1.00 28.07 ? 430  ALA A CB    1 
ATOM   2919  N  N     . GLU A  1 403 ? 96.886  120.220 -8.153  1.00 30.43 ? 431  GLU A N     1 
ATOM   2920  C  CA    . GLU A  1 403 ? 96.412  121.213 -7.185  1.00 31.50 ? 431  GLU A CA    1 
ATOM   2921  C  C     . GLU A  1 403 ? 97.193  122.535 -7.184  1.00 31.53 ? 431  GLU A C     1 
ATOM   2922  O  O     . GLU A  1 403 ? 96.703  123.536 -6.648  1.00 31.44 ? 431  GLU A O     1 
ATOM   2923  C  CB    . GLU A  1 403 ? 96.410  120.598 -5.773  1.00 31.70 ? 431  GLU A CB    1 
ATOM   2924  C  CG    . GLU A  1 403 ? 95.262  119.629 -5.560  1.00 32.88 ? 431  GLU A CG    1 
ATOM   2925  C  CD    . GLU A  1 403 ? 95.399  118.748 -4.318  1.00 34.22 ? 431  GLU A CD    1 
ATOM   2926  O  OE1   . GLU A  1 403 ? 96.052  119.164 -3.340  1.00 38.29 ? 431  GLU A OE1   1 
ATOM   2927  O  OE2   . GLU A  1 403 ? 94.823  117.633 -4.328  1.00 39.59 ? 431  GLU A OE2   1 
ATOM   2928  N  N     . TYR A  1 404 ? 98.385  122.546 -7.791  1.00 31.41 ? 432  TYR A N     1 
ATOM   2929  C  CA    . TYR A  1 404 ? 99.235  123.740 -7.847  1.00 31.81 ? 432  TYR A CA    1 
ATOM   2930  C  C     . TYR A  1 404 ? 99.626  124.146 -9.263  1.00 32.40 ? 432  TYR A C     1 
ATOM   2931  O  O     . TYR A  1 404 ? 100.255 125.180 -9.480  1.00 34.43 ? 432  TYR A O     1 
ATOM   2932  C  CB    . TYR A  1 404 ? 100.513 123.503 -7.045  1.00 31.28 ? 432  TYR A CB    1 
ATOM   2933  C  CG    . TYR A  1 404 ? 100.280 123.362 -5.568  1.00 30.11 ? 432  TYR A CG    1 
ATOM   2934  C  CD1   . TYR A  1 404 ? 100.044 122.127 -5.010  1.00 29.37 ? 432  TYR A CD1   1 
ATOM   2935  C  CD2   . TYR A  1 404 ? 100.286 124.473 -4.729  1.00 30.30 ? 432  TYR A CD2   1 
ATOM   2936  C  CE1   . TYR A  1 404 ? 99.836  121.980 -3.661  1.00 30.50 ? 432  TYR A CE1   1 
ATOM   2937  C  CE2   . TYR A  1 404 ? 100.061 124.333 -3.367  1.00 29.83 ? 432  TYR A CE2   1 
ATOM   2938  C  CZ    . TYR A  1 404 ? 99.850  123.084 -2.842  1.00 29.46 ? 432  TYR A CZ    1 
ATOM   2939  O  OH    . TYR A  1 404 ? 99.630  122.902 -1.499  1.00 29.50 ? 432  TYR A OH    1 
ATOM   2940  O  OXT   . TYR A  1 404 ? 99.364  123.474 -10.232 1.00 32.67 ? 432  TYR A OXT   1 
ATOM   2941  N  N     . THR B  1 28  ? 84.793  120.915 6.379   1.00 46.29 ? 56   THR B N     1 
ATOM   2942  C  CA    . THR B  1 28  ? 83.483  121.618 6.236   1.00 46.34 ? 56   THR B CA    1 
ATOM   2943  C  C     . THR B  1 28  ? 83.219  122.519 7.452   1.00 45.83 ? 56   THR B C     1 
ATOM   2944  O  O     . THR B  1 28  ? 83.118  122.037 8.585   1.00 46.37 ? 56   THR B O     1 
ATOM   2945  C  CB    . THR B  1 28  ? 82.308  120.621 6.047   1.00 46.48 ? 56   THR B CB    1 
ATOM   2946  O  OG1   . THR B  1 28  ? 81.075  121.343 5.924   1.00 46.95 ? 56   THR B OG1   1 
ATOM   2947  C  CG2   . THR B  1 28  ? 82.208  119.631 7.223   1.00 46.90 ? 56   THR B CG2   1 
ATOM   2948  N  N     . PHE B  1 29  ? 83.096  123.822 7.204   1.00 44.61 ? 57   PHE B N     1 
ATOM   2949  C  CA    . PHE B  1 29  ? 82.971  124.809 8.267   1.00 43.39 ? 57   PHE B CA    1 
ATOM   2950  C  C     . PHE B  1 29  ? 81.642  125.541 8.165   1.00 42.33 ? 57   PHE B C     1 
ATOM   2951  O  O     . PHE B  1 29  ? 80.960  125.461 7.146   1.00 42.00 ? 57   PHE B O     1 
ATOM   2952  C  CB    . PHE B  1 29  ? 84.111  125.830 8.172   1.00 43.47 ? 57   PHE B CB    1 
ATOM   2953  C  CG    . PHE B  1 29  ? 85.491  125.220 8.107   1.00 43.59 ? 57   PHE B CG    1 
ATOM   2954  C  CD1   . PHE B  1 29  ? 85.918  124.309 9.066   1.00 43.67 ? 57   PHE B CD1   1 
ATOM   2955  C  CD2   . PHE B  1 29  ? 86.377  125.587 7.094   1.00 43.98 ? 57   PHE B CD2   1 
ATOM   2956  C  CE1   . PHE B  1 29  ? 87.201  123.763 9.006   1.00 43.44 ? 57   PHE B CE1   1 
ATOM   2957  C  CE2   . PHE B  1 29  ? 87.654  125.051 7.028   1.00 43.65 ? 57   PHE B CE2   1 
ATOM   2958  C  CZ    . PHE B  1 29  ? 88.067  124.136 7.986   1.00 43.56 ? 57   PHE B CZ    1 
ATOM   2959  N  N     . THR B  1 30  ? 81.281  126.270 9.217   1.00 41.21 ? 58   THR B N     1 
ATOM   2960  C  CA    . THR B  1 30  ? 80.088  127.116 9.174   1.00 40.30 ? 58   THR B CA    1 
ATOM   2961  C  C     . THR B  1 30  ? 80.340  128.315 8.266   1.00 39.64 ? 58   THR B C     1 
ATOM   2962  O  O     . THR B  1 30  ? 81.485  128.646 7.976   1.00 38.87 ? 58   THR B O     1 
ATOM   2963  C  CB    . THR B  1 30  ? 79.671  127.615 10.572  1.00 40.30 ? 58   THR B CB    1 
ATOM   2964  O  OG1   . THR B  1 30  ? 80.728  128.386 11.159  1.00 40.04 ? 58   THR B OG1   1 
ATOM   2965  C  CG2   . THR B  1 30  ? 79.327  126.448 11.481  1.00 40.66 ? 58   THR B CG2   1 
ATOM   2966  N  N     . ASP B  1 31  ? 79.262  128.957 7.816   1.00 39.27 ? 59   ASP B N     1 
ATOM   2967  C  CA    . ASP B  1 31  ? 79.362  130.153 6.975   1.00 38.96 ? 59   ASP B CA    1 
ATOM   2968  C  C     . ASP B  1 31  ? 80.255  131.227 7.617   1.00 38.47 ? 59   ASP B C     1 
ATOM   2969  O  O     . ASP B  1 31  ? 81.053  131.855 6.928   1.00 38.02 ? 59   ASP B O     1 
ATOM   2970  C  CB    . ASP B  1 31  ? 77.964  130.736 6.667   1.00 39.32 ? 59   ASP B CB    1 
ATOM   2971  C  CG    . ASP B  1 31  ? 77.146  129.868 5.695   1.00 39.74 ? 59   ASP B CG    1 
ATOM   2972  O  OD1   . ASP B  1 31  ? 77.691  128.907 5.107   1.00 40.23 ? 59   ASP B OD1   1 
ATOM   2973  O  OD2   . ASP B  1 31  ? 75.940  130.166 5.513   1.00 41.83 ? 59   ASP B OD2   1 
ATOM   2974  N  N     . GLU B  1 32  ? 80.127  131.420 8.932   1.00 38.00 ? 60   GLU B N     1 
ATOM   2975  C  CA    . GLU B  1 32  ? 80.928  132.416 9.641   1.00 38.04 ? 60   GLU B CA    1 
ATOM   2976  C  C     . GLU B  1 32  ? 82.412  132.046 9.650   1.00 37.27 ? 60   GLU B C     1 
ATOM   2977  O  O     . GLU B  1 32  ? 83.250  132.897 9.389   1.00 36.97 ? 60   GLU B O     1 
ATOM   2978  C  CB    . GLU B  1 32  ? 80.433  132.627 11.076  1.00 38.10 ? 60   GLU B CB    1 
ATOM   2979  C  CG    . GLU B  1 32  ? 81.111  133.825 11.777  1.00 39.39 ? 60   GLU B CG    1 
ATOM   2980  C  CD    . GLU B  1 32  ? 80.371  134.309 13.018  1.00 39.67 ? 60   GLU B CD    1 
ATOM   2981  O  OE1   . GLU B  1 32  ? 80.571  133.726 14.107  1.00 41.49 ? 60   GLU B OE1   1 
ATOM   2982  O  OE2   . GLU B  1 32  ? 79.598  135.287 12.906  1.00 43.10 ? 60   GLU B OE2   1 
ATOM   2983  N  N     . GLU B  1 33  ? 82.717  130.782 9.951   1.00 36.72 ? 61   GLU B N     1 
ATOM   2984  C  CA    . GLU B  1 33  ? 84.092  130.268 9.943   1.00 36.53 ? 61   GLU B CA    1 
ATOM   2985  C  C     . GLU B  1 33  ? 84.768  130.422 8.570   1.00 36.82 ? 61   GLU B C     1 
ATOM   2986  O  O     . GLU B  1 33  ? 85.921  130.847 8.494   1.00 36.53 ? 61   GLU B O     1 
ATOM   2987  C  CB    . GLU B  1 33  ? 84.116  128.804 10.414  1.00 36.36 ? 61   GLU B CB    1 
ATOM   2988  C  CG    . GLU B  1 33  ? 83.889  128.643 11.931  1.00 35.94 ? 61   GLU B CG    1 
ATOM   2989  C  CD    . GLU B  1 33  ? 83.412  127.247 12.365  1.00 35.77 ? 61   GLU B CD    1 
ATOM   2990  O  OE1   . GLU B  1 33  ? 83.340  126.330 11.527  1.00 32.15 ? 61   GLU B OE1   1 
ATOM   2991  O  OE2   . GLU B  1 33  ? 83.094  127.071 13.566  1.00 36.01 ? 61   GLU B OE2   1 
ATOM   2992  N  N     . MET B  1 34  ? 84.043  130.089 7.501   1.00 37.42 ? 62   MET B N     1 
ATOM   2993  C  CA    . MET B  1 34  ? 84.506  130.300 6.116   1.00 38.22 ? 62   MET B CA    1 
ATOM   2994  C  C     . MET B  1 34  ? 84.741  131.784 5.803   1.00 37.76 ? 62   MET B C     1 
ATOM   2995  O  O     . MET B  1 34  ? 85.719  132.133 5.148   1.00 37.64 ? 62   MET B O     1 
ATOM   2996  C  CB    . MET B  1 34  ? 83.471  129.776 5.103   1.00 38.31 ? 62   MET B CB    1 
ATOM   2997  C  CG    . MET B  1 34  ? 83.249  128.268 5.076   1.00 39.31 ? 62   MET B CG    1 
ATOM   2998  S  SD    . MET B  1 34  ? 82.199  127.739 3.689   1.00 40.98 ? 62   MET B SD    1 
ATOM   2999  C  CE    . MET B  1 34  ? 80.734  128.756 3.871   1.00 41.33 ? 62   MET B CE    1 
ATOM   3000  N  N     . MET B  1 35  ? 83.822  132.643 6.244   1.00 37.53 ? 63   MET B N     1 
ATOM   3001  C  CA    . MET B  1 35  ? 83.942  134.084 6.005   1.00 37.66 ? 63   MET B CA    1 
ATOM   3002  C  C     . MET B  1 35  ? 85.144  134.677 6.745   1.00 36.72 ? 63   MET B C     1 
ATOM   3003  O  O     . MET B  1 35  ? 85.906  135.458 6.177   1.00 36.23 ? 63   MET B O     1 
ATOM   3004  C  CB    . MET B  1 35  ? 82.657  134.824 6.402   1.00 37.70 ? 63   MET B CB    1 
ATOM   3005  C  CG    . MET B  1 35  ? 81.576  134.819 5.325   1.00 38.47 ? 63   MET B CG    1 
ATOM   3006  S  SD    . MET B  1 35  ? 80.116  135.780 5.775   1.00 40.08 ? 63   MET B SD    1 
ATOM   3007  C  CE    . MET B  1 35  ? 80.857  137.366 6.195   1.00 41.09 ? 63   MET B CE    1 
ATOM   3008  N  N     . ILE B  1 36  ? 85.315  134.296 8.007   1.00 35.96 ? 64   ILE B N     1 
ATOM   3009  C  CA    . ILE B  1 36  ? 86.435  134.792 8.803   1.00 35.47 ? 64   ILE B CA    1 
ATOM   3010  C  C     . ILE B  1 36  ? 87.765  134.349 8.179   1.00 34.65 ? 64   ILE B C     1 
ATOM   3011  O  O     . ILE B  1 36  ? 88.682  135.154 8.026   1.00 33.94 ? 64   ILE B O     1 
ATOM   3012  C  CB    . ILE B  1 36  ? 86.342  134.340 10.287  1.00 35.47 ? 64   ILE B CB    1 
ATOM   3013  C  CG1   . ILE B  1 36  ? 85.120  134.972 10.960  1.00 35.82 ? 64   ILE B CG1   1 
ATOM   3014  C  CG2   . ILE B  1 36  ? 87.559  134.787 11.059  1.00 35.70 ? 64   ILE B CG2   1 
ATOM   3015  C  CD1   . ILE B  1 36  ? 84.825  134.432 12.351  1.00 35.90 ? 64   ILE B CD1   1 
ATOM   3016  N  N     . LYS B  1 37  ? 87.856  133.082 7.794   1.00 34.26 ? 65   LYS B N     1 
ATOM   3017  C  CA    . LYS B  1 37  ? 89.069  132.561 7.161   1.00 34.41 ? 65   LYS B CA    1 
ATOM   3018  C  C     . LYS B  1 37  ? 89.400  133.329 5.877   1.00 34.22 ? 65   LYS B C     1 
ATOM   3019  O  O     . LYS B  1 37  ? 90.571  133.653 5.607   1.00 33.74 ? 65   LYS B O     1 
ATOM   3020  C  CB    . LYS B  1 37  ? 88.911  131.075 6.837   1.00 34.41 ? 65   LYS B CB    1 
ATOM   3021  C  CG    . LYS B  1 37  ? 90.176  130.410 6.307   1.00 34.81 ? 65   LYS B CG    1 
ATOM   3022  C  CD    . LYS B  1 37  ? 89.895  129.027 5.743   1.00 35.33 ? 65   LYS B CD    1 
ATOM   3023  C  CE    . LYS B  1 37  ? 91.159  128.424 5.109   1.00 36.69 ? 65   LYS B CE    1 
ATOM   3024  N  NZ    . LYS B  1 37  ? 90.904  127.084 4.505   1.00 39.31 ? 65   LYS B NZ    1 
ATOM   3025  N  N     . SER B  1 38  ? 88.368  133.592 5.081   1.00 33.42 ? 66   SER B N     1 
ATOM   3026  C  CA    . SER B  1 38  ? 88.542  134.249 3.796   1.00 33.64 ? 66   SER B CA    1 
ATOM   3027  C  C     . SER B  1 38  ? 89.002  135.699 3.969   1.00 33.01 ? 66   SER B C     1 
ATOM   3028  O  O     . SER B  1 38  ? 89.892  136.145 3.254   1.00 32.71 ? 66   SER B O     1 
ATOM   3029  C  CB    . SER B  1 38  ? 87.246  134.175 2.988   1.00 33.99 ? 66   SER B CB    1 
ATOM   3030  O  OG    . SER B  1 38  ? 87.395  134.803 1.727   1.00 36.27 ? 66   SER B OG    1 
ATOM   3031  N  N     . SER B  1 39  ? 88.424  136.419 4.932   1.00 32.42 ? 67   SER B N     1 
ATOM   3032  C  CA    . SER B  1 39  ? 88.841  137.796 5.200   1.00 32.53 ? 67   SER B CA    1 
ATOM   3033  C  C     . SER B  1 39  ? 90.252  137.873 5.798   1.00 31.91 ? 67   SER B C     1 
ATOM   3034  O  O     . SER B  1 39  ? 90.986  138.814 5.513   1.00 31.35 ? 67   SER B O     1 
ATOM   3035  C  CB    . SER B  1 39  ? 87.840  138.522 6.109   1.00 32.53 ? 67   SER B CB    1 
ATOM   3036  O  OG    . SER B  1 39  ? 87.962  138.067 7.443   1.00 35.02 ? 67   SER B OG    1 
ATOM   3037  N  N     . VAL B  1 40  ? 90.627  136.892 6.620   1.00 31.72 ? 68   VAL B N     1 
ATOM   3038  C  CA    . VAL B  1 40  ? 91.968  136.857 7.208   1.00 31.84 ? 68   VAL B CA    1 
ATOM   3039  C  C     . VAL B  1 40  ? 93.020  136.617 6.125   1.00 31.87 ? 68   VAL B C     1 
ATOM   3040  O  O     . VAL B  1 40  ? 94.048  137.291 6.105   1.00 31.66 ? 68   VAL B O     1 
ATOM   3041  C  CB    . VAL B  1 40  ? 92.082  135.794 8.321   1.00 31.90 ? 68   VAL B CB    1 
ATOM   3042  C  CG1   . VAL B  1 40  ? 93.541  135.609 8.763   1.00 31.83 ? 68   VAL B CG1   1 
ATOM   3043  C  CG2   . VAL B  1 40  ? 91.212  136.205 9.496   1.00 32.41 ? 68   VAL B CG2   1 
ATOM   3044  N  N     . LYS B  1 41  ? 92.746  135.679 5.221   1.00 32.11 ? 69   LYS B N     1 
ATOM   3045  C  CA    . LYS B  1 41  ? 93.614  135.441 4.061   1.00 33.03 ? 69   LYS B CA    1 
ATOM   3046  C  C     . LYS B  1 41  ? 93.894  136.740 3.285   1.00 33.00 ? 69   LYS B C     1 
ATOM   3047  O  O     . LYS B  1 41  ? 95.040  137.062 2.980   1.00 32.69 ? 69   LYS B O     1 
ATOM   3048  C  CB    . LYS B  1 41  ? 92.984  134.393 3.132   1.00 33.10 ? 69   LYS B CB    1 
ATOM   3049  C  CG    . LYS B  1 41  ? 93.886  133.948 1.991   1.00 33.68 ? 69   LYS B CG    1 
ATOM   3050  C  CD    . LYS B  1 41  ? 93.158  133.037 1.019   1.00 34.72 ? 69   LYS B CD    1 
ATOM   3051  C  CE    . LYS B  1 41  ? 94.089  132.594 -0.114  1.00 36.80 ? 69   LYS B CE    1 
ATOM   3052  N  NZ    . LYS B  1 41  ? 93.342  132.036 -1.286  1.00 37.86 ? 69   LYS B NZ    1 
ATOM   3053  N  N     . LYS B  1 42  ? 92.839  137.489 2.988   1.00 33.50 ? 70   LYS B N     1 
ATOM   3054  C  CA    . LYS B  1 42  ? 92.967  138.774 2.292   1.00 34.07 ? 70   LYS B CA    1 
ATOM   3055  C  C     . LYS B  1 42  ? 93.821  139.780 3.089   1.00 33.89 ? 70   LYS B C     1 
ATOM   3056  O  O     . LYS B  1 42  ? 94.781  140.346 2.563   1.00 33.76 ? 70   LYS B O     1 
ATOM   3057  C  CB    . LYS B  1 42  ? 91.570  139.346 2.021   1.00 34.11 ? 70   LYS B CB    1 
ATOM   3058  C  CG    . LYS B  1 42  ? 91.533  140.589 1.155   1.00 35.08 ? 70   LYS B CG    1 
ATOM   3059  C  CD    . LYS B  1 42  ? 90.087  140.966 0.818   1.00 35.48 ? 70   LYS B CD    1 
ATOM   3060  C  CE    . LYS B  1 42  ? 89.961  142.406 0.331   1.00 37.43 ? 70   LYS B CE    1 
ATOM   3061  N  NZ    . LYS B  1 42  ? 90.559  142.605 -1.016  1.00 38.79 ? 70   LYS B NZ    1 
ATOM   3062  N  N     . PHE B  1 43  ? 93.472  139.980 4.358   1.00 33.81 ? 71   PHE B N     1 
ATOM   3063  C  CA    . PHE B  1 43  ? 94.205  140.891 5.248   1.00 33.90 ? 71   PHE B CA    1 
ATOM   3064  C  C     . PHE B  1 43  ? 95.698  140.536 5.331   1.00 34.42 ? 71   PHE B C     1 
ATOM   3065  O  O     . PHE B  1 43  ? 96.557  141.413 5.274   1.00 34.51 ? 71   PHE B O     1 
ATOM   3066  C  CB    . PHE B  1 43  ? 93.566  140.888 6.647   1.00 33.69 ? 71   PHE B CB    1 
ATOM   3067  C  CG    . PHE B  1 43  ? 94.421  141.518 7.711   1.00 33.32 ? 71   PHE B CG    1 
ATOM   3068  C  CD1   . PHE B  1 43  ? 94.629  142.889 7.735   1.00 33.42 ? 71   PHE B CD1   1 
ATOM   3069  C  CD2   . PHE B  1 43  ? 95.023  140.740 8.689   1.00 33.36 ? 71   PHE B CD2   1 
ATOM   3070  C  CE1   . PHE B  1 43  ? 95.435  143.471 8.716   1.00 33.57 ? 71   PHE B CE1   1 
ATOM   3071  C  CE2   . PHE B  1 43  ? 95.816  141.318 9.671   1.00 33.36 ? 71   PHE B CE2   1 
ATOM   3072  C  CZ    . PHE B  1 43  ? 96.025  142.687 9.678   1.00 33.26 ? 71   PHE B CZ    1 
ATOM   3073  N  N     . ALA B  1 44  ? 95.985  139.245 5.447   1.00 34.72 ? 72   ALA B N     1 
ATOM   3074  C  CA    . ALA B  1 44  ? 97.350  138.733 5.566   1.00 35.49 ? 72   ALA B CA    1 
ATOM   3075  C  C     . ALA B  1 44  ? 98.185  138.998 4.311   1.00 36.08 ? 72   ALA B C     1 
ATOM   3076  O  O     . ALA B  1 44  ? 99.345  139.391 4.408   1.00 35.84 ? 72   ALA B O     1 
ATOM   3077  C  CB    . ALA B  1 44  ? 97.319  137.235 5.871   1.00 34.69 ? 72   ALA B CB    1 
ATOM   3078  N  N     . GLN B  1 45  ? 97.592  138.785 3.140   1.00 36.94 ? 73   GLN B N     1 
ATOM   3079  C  CA    . GLN B  1 45  ? 98.301  139.004 1.872   1.00 37.88 ? 73   GLN B CA    1 
ATOM   3080  C  C     . GLN B  1 45  ? 98.547  140.478 1.556   1.00 37.51 ? 73   GLN B C     1 
ATOM   3081  O  O     . GLN B  1 45  ? 99.576  140.822 0.985   1.00 38.11 ? 73   GLN B O     1 
ATOM   3082  C  CB    . GLN B  1 45  ? 97.591  138.275 0.720   1.00 38.01 ? 73   GLN B CB    1 
ATOM   3083  C  CG    . GLN B  1 45  ? 97.845  136.757 0.806   1.00 39.65 ? 73   GLN B CG    1 
ATOM   3084  C  CD    . GLN B  1 45  ? 97.029  135.900 -0.168  1.00 39.71 ? 73   GLN B CD    1 
ATOM   3085  O  OE1   . GLN B  1 45  ? 96.407  136.402 -1.110  1.00 42.65 ? 73   GLN B OE1   1 
ATOM   3086  N  NE2   . GLN B  1 45  ? 97.050  134.581 0.060   1.00 42.28 ? 73   GLN B NE2   1 
ATOM   3087  N  N     . GLU B  1 46  ? 97.634  141.347 1.970   1.00 37.29 ? 74   GLU B N     1 
ATOM   3088  C  CA    . GLU B  1 46  ? 97.699  142.754 1.620   1.00 37.12 ? 74   GLU B CA    1 
ATOM   3089  C  C     . GLU B  1 46  ? 98.433  143.592 2.661   1.00 36.12 ? 74   GLU B C     1 
ATOM   3090  O  O     . GLU B  1 46  ? 99.163  144.519 2.315   1.00 35.93 ? 74   GLU B O     1 
ATOM   3091  C  CB    . GLU B  1 46  ? 96.279  143.291 1.403   1.00 37.26 ? 74   GLU B CB    1 
ATOM   3092  C  CG    . GLU B  1 46  ? 95.535  142.537 0.292   1.00 38.33 ? 74   GLU B CG    1 
ATOM   3093  C  CD    . GLU B  1 46  ? 94.111  143.003 0.092   1.00 38.64 ? 74   GLU B CD    1 
ATOM   3094  O  OE1   . GLU B  1 46  ? 93.587  143.759 0.943   1.00 40.56 ? 74   GLU B OE1   1 
ATOM   3095  O  OE2   . GLU B  1 46  ? 93.511  142.594 -0.926  1.00 41.68 ? 74   GLU B OE2   1 
ATOM   3096  N  N     . GLN B  1 47  ? 98.237  143.266 3.932   1.00 35.06 ? 75   GLN B N     1 
ATOM   3097  C  CA    . GLN B  1 47  ? 98.774  144.070 5.023   1.00 34.46 ? 75   GLN B CA    1 
ATOM   3098  C  C     . GLN B  1 47  ? 100.006 143.466 5.706   1.00 33.07 ? 75   GLN B C     1 
ATOM   3099  O  O     . GLN B  1 47  ? 100.819 144.200 6.269   1.00 33.15 ? 75   GLN B O     1 
ATOM   3100  C  CB    . GLN B  1 47  ? 97.677  144.333 6.063   1.00 34.69 ? 75   GLN B CB    1 
ATOM   3101  C  CG    . GLN B  1 47  ? 96.506  145.174 5.536   1.00 36.90 ? 75   GLN B CG    1 
ATOM   3102  C  CD    . GLN B  1 47  ? 96.896  146.614 5.231   1.00 39.38 ? 75   GLN B CD    1 
ATOM   3103  O  OE1   . GLN B  1 47  ? 96.503  147.174 4.200   1.00 41.64 ? 75   GLN B OE1   1 
ATOM   3104  N  NE2   . GLN B  1 47  ? 97.675  147.223 6.126   1.00 40.62 ? 75   GLN B NE2   1 
ATOM   3105  N  N     . ILE B  1 48  ? 100.151 142.145 5.673   1.00 31.42 ? 76   ILE B N     1 
ATOM   3106  C  CA    . ILE B  1 48  ? 101.238 141.502 6.405   1.00 30.20 ? 76   ILE B CA    1 
ATOM   3107  C  C     . ILE B  1 48  ? 102.375 141.066 5.486   1.00 29.55 ? 76   ILE B C     1 
ATOM   3108  O  O     . ILE B  1 48  ? 103.519 141.401 5.752   1.00 28.83 ? 76   ILE B O     1 
ATOM   3109  C  CB    . ILE B  1 48  ? 100.752 140.295 7.234   1.00 30.29 ? 76   ILE B CB    1 
ATOM   3110  C  CG1   . ILE B  1 48  ? 99.611  140.709 8.175   1.00 30.05 ? 76   ILE B CG1   1 
ATOM   3111  C  CG2   . ILE B  1 48  ? 101.930 139.671 8.019   1.00 29.68 ? 76   ILE B CG2   1 
ATOM   3112  C  CD1   . ILE B  1 48  ? 99.053  139.559 9.011   1.00 29.47 ? 76   ILE B CD1   1 
ATOM   3113  N  N     . ALA B  1 49  ? 102.058 140.340 4.412   1.00 28.92 ? 77   ALA B N     1 
ATOM   3114  C  CA    . ALA B  1 49  ? 103.074 139.757 3.516   1.00 29.02 ? 77   ALA B CA    1 
ATOM   3115  C  C     . ALA B  1 49  ? 104.186 140.732 3.103   1.00 28.93 ? 77   ALA B C     1 
ATOM   3116  O  O     . ALA B  1 49  ? 105.366 140.359 3.114   1.00 28.85 ? 77   ALA B O     1 
ATOM   3117  C  CB    . ALA B  1 49  ? 102.423 139.131 2.270   1.00 28.86 ? 77   ALA B CB    1 
ATOM   3118  N  N     . PRO B  1 50  ? 103.822 141.978 2.741   1.00 29.26 ? 78   PRO B N     1 
ATOM   3119  C  CA    . PRO B  1 50  ? 104.863 142.934 2.348   1.00 29.48 ? 78   PRO B CA    1 
ATOM   3120  C  C     . PRO B  1 50  ? 105.852 143.301 3.461   1.00 29.65 ? 78   PRO B C     1 
ATOM   3121  O  O     . PRO B  1 50  ? 106.922 143.842 3.171   1.00 30.32 ? 78   PRO B O     1 
ATOM   3122  C  CB    . PRO B  1 50  ? 104.062 144.171 1.936   1.00 29.64 ? 78   PRO B CB    1 
ATOM   3123  C  CG    . PRO B  1 50  ? 102.664 143.662 1.657   1.00 29.41 ? 78   PRO B CG    1 
ATOM   3124  C  CD    . PRO B  1 50  ? 102.475 142.583 2.654   1.00 28.96 ? 78   PRO B CD    1 
ATOM   3125  N  N     . LEU B  1 51  ? 105.493 143.028 4.713   1.00 29.00 ? 79   LEU B N     1 
ATOM   3126  C  CA    . LEU B  1 51  ? 106.285 143.457 5.857   1.00 28.88 ? 79   LEU B CA    1 
ATOM   3127  C  C     . LEU B  1 51  ? 107.059 142.334 6.536   1.00 28.54 ? 79   LEU B C     1 
ATOM   3128  O  O     . LEU B  1 51  ? 107.859 142.609 7.420   1.00 28.70 ? 79   LEU B O     1 
ATOM   3129  C  CB    . LEU B  1 51  ? 105.377 144.142 6.883   1.00 28.85 ? 79   LEU B CB    1 
ATOM   3130  C  CG    . LEU B  1 51  ? 104.647 145.406 6.391   1.00 29.55 ? 79   LEU B CG    1 
ATOM   3131  C  CD1   . LEU B  1 51  ? 103.735 145.955 7.479   1.00 30.28 ? 79   LEU B CD1   1 
ATOM   3132  C  CD2   . LEU B  1 51  ? 105.627 146.486 5.929   1.00 30.41 ? 79   LEU B CD2   1 
ATOM   3133  N  N     . VAL B  1 52  ? 106.825 141.090 6.119   1.00 28.05 ? 80   VAL B N     1 
ATOM   3134  C  CA    . VAL B  1 52  ? 107.351 139.907 6.810   1.00 28.02 ? 80   VAL B CA    1 
ATOM   3135  C  C     . VAL B  1 52  ? 108.887 139.913 6.925   1.00 28.74 ? 80   VAL B C     1 
ATOM   3136  O  O     . VAL B  1 52  ? 109.434 139.674 8.007   1.00 28.67 ? 80   VAL B O     1 
ATOM   3137  C  CB    . VAL B  1 52  ? 106.858 138.593 6.135   1.00 27.71 ? 80   VAL B CB    1 
ATOM   3138  C  CG1   . VAL B  1 52  ? 107.587 137.360 6.700   1.00 26.55 ? 80   VAL B CG1   1 
ATOM   3139  C  CG2   . VAL B  1 52  ? 105.340 138.446 6.298   1.00 26.07 ? 80   VAL B CG2   1 
ATOM   3140  N  N     . SER B  1 53  ? 109.563 140.174 5.812   1.00 29.21 ? 81   SER B N     1 
ATOM   3141  C  CA    . SER B  1 53  ? 111.029 140.199 5.763   1.00 29.95 ? 81   SER B CA    1 
ATOM   3142  C  C     . SER B  1 53  ? 111.643 141.226 6.696   1.00 29.85 ? 81   SER B C     1 
ATOM   3143  O  O     . SER B  1 53  ? 112.578 140.918 7.438   1.00 29.61 ? 81   SER B O     1 
ATOM   3144  C  CB    . SER B  1 53  ? 111.513 140.511 4.341   1.00 30.26 ? 81   SER B CB    1 
ATOM   3145  O  OG    . SER B  1 53  ? 111.420 139.349 3.565   1.00 31.54 ? 81   SER B OG    1 
ATOM   3146  N  N     . THR B  1 54  ? 111.112 142.444 6.641   1.00 30.18 ? 82   THR B N     1 
ATOM   3147  C  CA    . THR B  1 54  ? 111.613 143.550 7.438   1.00 30.57 ? 82   THR B CA    1 
ATOM   3148  C  C     . THR B  1 54  ? 111.373 143.330 8.920   1.00 30.06 ? 82   THR B C     1 
ATOM   3149  O  O     . THR B  1 54  ? 112.231 143.646 9.743   1.00 30.39 ? 82   THR B O     1 
ATOM   3150  C  CB    . THR B  1 54  ? 110.954 144.882 7.017   1.00 30.96 ? 82   THR B CB    1 
ATOM   3151  O  OG1   . THR B  1 54  ? 111.046 145.028 5.599   1.00 32.65 ? 82   THR B OG1   1 
ATOM   3152  C  CG2   . THR B  1 54  ? 111.634 146.063 7.684   1.00 32.14 ? 82   THR B CG2   1 
ATOM   3153  N  N     . MET B  1 55  ? 110.197 142.815 9.262   1.00 29.34 ? 83   MET B N     1 
ATOM   3154  C  CA    . MET B  1 55  ? 109.878 142.546 10.658  1.00 29.36 ? 83   MET B CA    1 
ATOM   3155  C  C     . MET B  1 55  ? 110.823 141.478 11.212  1.00 28.95 ? 83   MET B C     1 
ATOM   3156  O  O     . MET B  1 55  ? 111.293 141.588 12.336  1.00 28.56 ? 83   MET B O     1 
ATOM   3157  C  CB    . MET B  1 55  ? 108.411 142.137 10.805  1.00 29.13 ? 83   MET B CB    1 
ATOM   3158  C  CG    . MET B  1 55  ? 107.472 143.287 10.461  1.00 29.60 ? 83   MET B CG    1 
ATOM   3159  S  SD    . MET B  1 55  ? 105.785 143.022 10.972  1.00 30.18 ? 83   MET B SD    1 
ATOM   3160  C  CE    . MET B  1 55  ? 105.365 141.540 10.067  1.00 27.94 ? 83   MET B CE    1 
ATOM   3161  N  N     . ASP B  1 56  ? 111.119 140.481 10.388  1.00 28.78 ? 84   ASP B N     1 
ATOM   3162  C  CA    . ASP B  1 56  ? 112.069 139.428 10.734  1.00 29.62 ? 84   ASP B CA    1 
ATOM   3163  C  C     . ASP B  1 56  ? 113.491 139.976 10.861  1.00 30.01 ? 84   ASP B C     1 
ATOM   3164  O  O     . ASP B  1 56  ? 114.143 139.771 11.873  1.00 29.26 ? 84   ASP B O     1 
ATOM   3165  C  CB    . ASP B  1 56  ? 112.017 138.316 9.685   1.00 29.24 ? 84   ASP B CB    1 
ATOM   3166  C  CG    . ASP B  1 56  ? 113.105 137.273 9.872   1.00 29.79 ? 84   ASP B CG    1 
ATOM   3167  O  OD1   . ASP B  1 56  ? 113.012 136.450 10.804  1.00 29.61 ? 84   ASP B OD1   1 
ATOM   3168  O  OD2   . ASP B  1 56  ? 114.042 137.254 9.052   1.00 30.77 ? 84   ASP B OD2   1 
ATOM   3169  N  N     . GLU B  1 57  ? 113.954 140.690 9.838   1.00 31.16 ? 85   GLU B N     1 
ATOM   3170  C  CA    . GLU B  1 57  ? 115.289 141.294 9.864   1.00 32.31 ? 85   GLU B CA    1 
ATOM   3171  C  C     . GLU B  1 57  ? 115.497 142.194 11.100  1.00 31.64 ? 85   GLU B C     1 
ATOM   3172  O  O     . GLU B  1 57  ? 116.529 142.124 11.780  1.00 31.52 ? 85   GLU B O     1 
ATOM   3173  C  CB    . GLU B  1 57  ? 115.524 142.090 8.575   1.00 32.50 ? 85   GLU B CB    1 
ATOM   3174  C  CG    . GLU B  1 57  ? 116.970 142.548 8.371   1.00 35.43 ? 85   GLU B CG    1 
ATOM   3175  C  CD    . GLU B  1 57  ? 117.104 143.624 7.297   1.00 36.13 ? 85   GLU B CD    1 
ATOM   3176  O  OE1   . GLU B  1 57  ? 116.373 143.556 6.275   1.00 42.48 ? 85   GLU B OE1   1 
ATOM   3177  O  OE2   . GLU B  1 57  ? 117.935 144.546 7.477   1.00 41.27 ? 85   GLU B OE2   1 
ATOM   3178  N  N     . ASN B  1 58  ? 114.507 143.023 11.396  1.00 31.20 ? 86   ASN B N     1 
ATOM   3179  C  CA    . ASN B  1 58  ? 114.607 143.996 12.478  1.00 31.25 ? 86   ASN B CA    1 
ATOM   3180  C  C     . ASN B  1 58  ? 114.192 143.490 13.859  1.00 30.49 ? 86   ASN B C     1 
ATOM   3181  O  O     . ASN B  1 58  ? 114.329 144.233 14.835  1.00 29.84 ? 86   ASN B O     1 
ATOM   3182  C  CB    . ASN B  1 58  ? 113.742 145.224 12.152  1.00 31.55 ? 86   ASN B CB    1 
ATOM   3183  C  CG    . ASN B  1 58  ? 114.209 145.967 10.911  1.00 33.67 ? 86   ASN B CG    1 
ATOM   3184  O  OD1   . ASN B  1 58  ? 115.350 145.812 10.451  1.00 35.48 ? 86   ASN B OD1   1 
ATOM   3185  N  ND2   . ASN B  1 58  ? 113.319 146.799 10.365  1.00 36.86 ? 86   ASN B ND2   1 
ATOM   3186  N  N     . SER B  1 59  ? 113.681 142.257 13.940  1.00 29.71 ? 87   SER B N     1 
ATOM   3187  C  CA    . SER B  1 59  ? 113.073 141.713 15.169  1.00 29.80 ? 87   SER B CA    1 
ATOM   3188  C  C     . SER B  1 59  ? 112.066 142.701 15.759  1.00 29.51 ? 87   SER B C     1 
ATOM   3189  O  O     . SER B  1 59  ? 112.145 143.048 16.933  1.00 28.81 ? 87   SER B O     1 
ATOM   3190  C  CB    . SER B  1 59  ? 114.123 141.375 16.231  1.00 29.87 ? 87   SER B CB    1 
ATOM   3191  O  OG    . SER B  1 59  ? 114.952 140.318 15.817  1.00 31.48 ? 87   SER B OG    1 
ATOM   3192  N  N     . LYS B  1 60  ? 111.134 143.160 14.932  1.00 29.55 ? 88   LYS B N     1 
ATOM   3193  C  CA    . LYS B  1 60  ? 110.192 144.189 15.342  1.00 30.47 ? 88   LYS B CA    1 
ATOM   3194  C  C     . LYS B  1 60  ? 108.871 144.038 14.606  1.00 30.54 ? 88   LYS B C     1 
ATOM   3195  O  O     . LYS B  1 60  ? 108.819 144.086 13.382  1.00 30.66 ? 88   LYS B O     1 
ATOM   3196  C  CB    . LYS B  1 60  ? 110.786 145.581 15.084  1.00 30.45 ? 88   LYS B CB    1 
ATOM   3197  C  CG    . LYS B  1 60  ? 109.992 146.735 15.691  1.00 31.27 ? 88   LYS B CG    1 
ATOM   3198  C  CD    . LYS B  1 60  ? 110.519 148.085 15.218  1.00 31.43 ? 88   LYS B CD    1 
ATOM   3199  N  N     . MET B  1 61  ? 107.808 143.850 15.375  1.00 30.94 ? 89   MET B N     1 
ATOM   3200  C  CA    . MET B  1 61  ? 106.450 143.845 14.858  1.00 31.38 ? 89   MET B CA    1 
ATOM   3201  C  C     . MET B  1 61  ? 106.048 145.270 14.451  1.00 30.95 ? 89   MET B C     1 
ATOM   3202  O  O     . MET B  1 61  ? 106.306 146.220 15.187  1.00 30.67 ? 89   MET B O     1 
ATOM   3203  C  CB    . MET B  1 61  ? 105.533 143.317 15.957  1.00 31.90 ? 89   MET B CB    1 
ATOM   3204  C  CG    . MET B  1 61  ? 104.055 143.315 15.667  1.00 34.28 ? 89   MET B CG    1 
ATOM   3205  S  SD    . MET B  1 61  ? 103.397 141.858 14.877  1.00 38.68 ? 89   MET B SD    1 
ATOM   3206  C  CE    . MET B  1 61  ? 104.365 140.491 15.540  1.00 36.99 ? 89   MET B CE    1 
ATOM   3207  N  N     . GLU B  1 62  ? 105.413 145.417 13.291  1.00 30.59 ? 90   GLU B N     1 
ATOM   3208  C  CA    . GLU B  1 62  ? 104.964 146.742 12.826  1.00 30.84 ? 90   GLU B CA    1 
ATOM   3209  C  C     . GLU B  1 62  ? 103.671 147.162 13.533  1.00 29.90 ? 90   GLU B C     1 
ATOM   3210  O  O     . GLU B  1 62  ? 102.761 146.350 13.702  1.00 29.25 ? 90   GLU B O     1 
ATOM   3211  C  CB    . GLU B  1 62  ? 104.772 146.736 11.305  1.00 31.28 ? 90   GLU B CB    1 
ATOM   3212  C  CG    . GLU B  1 62  ? 106.081 146.797 10.525  1.00 33.50 ? 90   GLU B CG    1 
ATOM   3213  C  CD    . GLU B  1 62  ? 106.749 148.158 10.619  1.00 36.38 ? 90   GLU B CD    1 
ATOM   3214  O  OE1   . GLU B  1 62  ? 106.132 149.162 10.195  1.00 39.43 ? 90   GLU B OE1   1 
ATOM   3215  O  OE2   . GLU B  1 62  ? 107.889 148.233 11.128  1.00 38.50 ? 90   GLU B OE2   1 
ATOM   3216  N  N     . LYS B  1 63  ? 103.593 148.421 13.963  1.00 29.78 ? 91   LYS B N     1 
ATOM   3217  C  CA    . LYS B  1 63  ? 102.386 148.902 14.635  1.00 29.56 ? 91   LYS B CA    1 
ATOM   3218  C  C     . LYS B  1 63  ? 101.190 148.822 13.673  1.00 29.19 ? 91   LYS B C     1 
ATOM   3219  O  O     . LYS B  1 63  ? 100.063 148.598 14.104  1.00 29.29 ? 91   LYS B O     1 
ATOM   3220  C  CB    . LYS B  1 63  ? 102.565 150.318 15.224  1.00 29.90 ? 91   LYS B CB    1 
ATOM   3221  C  CG    . LYS B  1 63  ? 101.891 151.430 14.449  1.00 30.54 ? 91   LYS B CG    1 
ATOM   3222  N  N     . SER B  1 64  ? 101.446 148.976 12.376  1.00 28.63 ? 92   SER B N     1 
ATOM   3223  C  CA    . SER B  1 64  ? 100.394 148.880 11.362  1.00 28.36 ? 92   SER B CA    1 
ATOM   3224  C  C     . SER B  1 64  ? 99.752  147.490 11.324  1.00 28.18 ? 92   SER B C     1 
ATOM   3225  O  O     . SER B  1 64  ? 98.544  147.360 11.140  1.00 27.95 ? 92   SER B O     1 
ATOM   3226  C  CB    . SER B  1 64  ? 100.933 149.275 9.981   1.00 28.34 ? 92   SER B CB    1 
ATOM   3227  O  OG    . SER B  1 64  ? 101.794 148.296 9.444   1.00 28.26 ? 92   SER B OG    1 
ATOM   3228  N  N     . VAL B  1 65  ? 100.564 146.455 11.529  1.00 27.86 ? 93   VAL B N     1 
ATOM   3229  C  CA    . VAL B  1 65  ? 100.070 145.087 11.599  1.00 27.98 ? 93   VAL B CA    1 
ATOM   3230  C  C     . VAL B  1 65  ? 99.240  144.857 12.865  1.00 28.14 ? 93   VAL B C     1 
ATOM   3231  O  O     . VAL B  1 65  ? 98.154  144.285 12.797  1.00 28.01 ? 93   VAL B O     1 
ATOM   3232  C  CB    . VAL B  1 65  ? 101.233 144.086 11.539  1.00 27.92 ? 93   VAL B CB    1 
ATOM   3233  C  CG1   . VAL B  1 65  ? 100.732 142.658 11.761  1.00 27.60 ? 93   VAL B CG1   1 
ATOM   3234  C  CG2   . VAL B  1 65  ? 101.968 144.247 10.205  1.00 26.81 ? 93   VAL B CG2   1 
ATOM   3235  N  N     . ILE B  1 66  ? 99.748  145.326 14.003  1.00 28.57 ? 94   ILE B N     1 
ATOM   3236  C  CA    . ILE B  1 66  ? 99.051  145.204 15.280  1.00 29.08 ? 94   ILE B CA    1 
ATOM   3237  C  C     . ILE B  1 66  ? 97.722  145.941 15.218  1.00 29.19 ? 94   ILE B C     1 
ATOM   3238  O  O     . ILE B  1 66  ? 96.699  145.393 15.605  1.00 29.38 ? 94   ILE B O     1 
ATOM   3239  C  CB    . ILE B  1 66  ? 99.882  145.764 16.465  1.00 29.37 ? 94   ILE B CB    1 
ATOM   3240  C  CG1   . ILE B  1 66  ? 101.203 145.002 16.625  1.00 29.25 ? 94   ILE B CG1   1 
ATOM   3241  C  CG2   . ILE B  1 66  ? 99.083  145.685 17.775  1.00 29.22 ? 94   ILE B CG2   1 
ATOM   3242  C  CD1   . ILE B  1 66  ? 102.098 145.582 17.704  1.00 29.81 ? 94   ILE B CD1   1 
ATOM   3243  N  N     . GLN B  1 67  ? 97.747  147.177 14.720  1.00 29.30 ? 95   GLN B N     1 
ATOM   3244  C  CA    . GLN B  1 67  ? 96.530  147.972 14.535  1.00 29.62 ? 95   GLN B CA    1 
ATOM   3245  C  C     . GLN B  1 67  ? 95.525  147.241 13.648  1.00 29.09 ? 95   GLN B C     1 
ATOM   3246  O  O     . GLN B  1 67  ? 94.337  147.211 13.946  1.00 29.30 ? 95   GLN B O     1 
ATOM   3247  C  CB    . GLN B  1 67  ? 96.860  149.331 13.919  1.00 29.53 ? 95   GLN B CB    1 
ATOM   3248  C  CG    . GLN B  1 67  ? 97.459  150.322 14.901  1.00 30.82 ? 95   GLN B CG    1 
ATOM   3249  C  CD    . GLN B  1 67  ? 97.745  151.665 14.265  1.00 31.33 ? 95   GLN B CD    1 
ATOM   3250  O  OE1   . GLN B  1 67  ? 98.253  151.739 13.145  1.00 35.91 ? 95   GLN B OE1   1 
ATOM   3251  N  NE2   . GLN B  1 67  ? 97.417  152.736 14.971  1.00 33.07 ? 95   GLN B NE2   1 
ATOM   3252  N  N     . GLY B  1 68  ? 96.014  146.653 12.561  1.00 28.46 ? 96   GLY B N     1 
ATOM   3253  C  CA    . GLY B  1 68  ? 95.171  145.880 11.648  1.00 28.11 ? 96   GLY B CA    1 
ATOM   3254  C  C     . GLY B  1 68  ? 94.498  144.677 12.292  1.00 27.86 ? 96   GLY B C     1 
ATOM   3255  O  O     . GLY B  1 68  ? 93.324  144.402 12.022  1.00 27.69 ? 96   GLY B O     1 
ATOM   3256  N  N     . LEU B  1 69  ? 95.240  143.958 13.138  1.00 27.52 ? 97   LEU B N     1 
ATOM   3257  C  CA    . LEU B  1 69  ? 94.685  142.836 13.897  1.00 27.44 ? 97   LEU B CA    1 
ATOM   3258  C  C     . LEU B  1 69  ? 93.489  143.250 14.752  1.00 27.17 ? 97   LEU B C     1 
ATOM   3259  O  O     . LEU B  1 69  ? 92.441  142.601 14.725  1.00 27.05 ? 97   LEU B O     1 
ATOM   3260  C  CB    . LEU B  1 69  ? 95.760  142.188 14.781  1.00 27.44 ? 97   LEU B CB    1 
ATOM   3261  C  CG    . LEU B  1 69  ? 96.875  141.415 14.071  1.00 28.32 ? 97   LEU B CG    1 
ATOM   3262  C  CD1   . LEU B  1 69  ? 97.930  140.956 15.078  1.00 27.60 ? 97   LEU B CD1   1 
ATOM   3263  C  CD2   . LEU B  1 69  ? 96.326  140.217 13.310  1.00 28.76 ? 97   LEU B CD2   1 
ATOM   3264  N  N     . PHE B  1 70  ? 93.646  144.345 15.497  1.00 27.05 ? 98   PHE B N     1 
ATOM   3265  C  CA    . PHE B  1 70  ? 92.563  144.894 16.303  1.00 26.75 ? 98   PHE B CA    1 
ATOM   3266  C  C     . PHE B  1 70  ? 91.407  145.374 15.414  1.00 27.26 ? 98   PHE B C     1 
ATOM   3267  O  O     . PHE B  1 70  ? 90.247  145.044 15.668  1.00 26.23 ? 98   PHE B O     1 
ATOM   3268  C  CB    . PHE B  1 70  ? 93.067  146.049 17.190  1.00 26.41 ? 98   PHE B CB    1 
ATOM   3269  C  CG    . PHE B  1 70  ? 93.796  145.594 18.432  1.00 26.36 ? 98   PHE B CG    1 
ATOM   3270  C  CD1   . PHE B  1 70  ? 93.103  145.030 19.490  1.00 25.57 ? 98   PHE B CD1   1 
ATOM   3271  C  CD2   . PHE B  1 70  ? 95.178  145.726 18.539  1.00 27.02 ? 98   PHE B CD2   1 
ATOM   3272  C  CE1   . PHE B  1 70  ? 93.771  144.613 20.639  1.00 26.21 ? 98   PHE B CE1   1 
ATOM   3273  C  CE2   . PHE B  1 70  ? 95.851  145.306 19.689  1.00 27.11 ? 98   PHE B CE2   1 
ATOM   3274  C  CZ    . PHE B  1 70  ? 95.142  144.752 20.737  1.00 26.21 ? 98   PHE B CZ    1 
ATOM   3275  N  N     . GLN B  1 71  ? 91.738  146.145 14.378  1.00 27.95 ? 99   GLN B N     1 
ATOM   3276  C  CA    . GLN B  1 71  ? 90.739  146.706 13.455  1.00 28.96 ? 99   GLN B CA    1 
ATOM   3277  C  C     . GLN B  1 71  ? 89.902  145.635 12.747  1.00 28.87 ? 99   GLN B C     1 
ATOM   3278  O  O     . GLN B  1 71  ? 88.706  145.823 12.534  1.00 28.28 ? 99   GLN B O     1 
ATOM   3279  C  CB    . GLN B  1 71  ? 91.418  147.597 12.410  1.00 29.01 ? 99   GLN B CB    1 
ATOM   3280  C  CG    . GLN B  1 71  ? 91.832  148.981 12.934  1.00 30.95 ? 99   GLN B CG    1 
ATOM   3281  C  CD    . GLN B  1 71  ? 92.720  149.775 11.948  1.00 30.99 ? 99   GLN B CD    1 
ATOM   3282  O  OE1   . GLN B  1 71  ? 93.487  149.196 11.164  1.00 34.14 ? 99   GLN B OE1   1 
ATOM   3283  N  NE2   . GLN B  1 71  ? 92.629  151.099 12.011  1.00 30.56 ? 99   GLN B NE2   1 
ATOM   3284  N  N     . GLN B  1 72  ? 90.544  144.524 12.382  1.00 29.29 ? 100  GLN B N     1 
ATOM   3285  C  CA    . GLN B  1 72  ? 89.879  143.394 11.724  1.00 29.71 ? 100  GLN B CA    1 
ATOM   3286  C  C     . GLN B  1 72  ? 89.072  142.500 12.682  1.00 29.56 ? 100  GLN B C     1 
ATOM   3287  O  O     . GLN B  1 72  ? 88.474  141.513 12.246  1.00 29.57 ? 100  GLN B O     1 
ATOM   3288  C  CB    . GLN B  1 72  ? 90.924  142.524 11.002  1.00 30.02 ? 100  GLN B CB    1 
ATOM   3289  C  CG    . GLN B  1 72  ? 91.563  143.183 9.778   1.00 31.50 ? 100  GLN B CG    1 
ATOM   3290  C  CD    . GLN B  1 72  ? 90.627  143.257 8.572   1.00 33.47 ? 100  GLN B CD    1 
ATOM   3291  O  OE1   . GLN B  1 72  ? 90.045  142.254 8.149   1.00 35.30 ? 100  GLN B OE1   1 
ATOM   3292  N  NE2   . GLN B  1 72  ? 90.500  144.446 8.005   1.00 34.29 ? 100  GLN B NE2   1 
ATOM   3293  N  N     . GLY B  1 73  ? 89.068  142.834 13.974  1.00 29.18 ? 101  GLY B N     1 
ATOM   3294  C  CA    . GLY B  1 73  ? 88.361  142.055 14.990  1.00 28.91 ? 101  GLY B CA    1 
ATOM   3295  C  C     . GLY B  1 73  ? 89.041  140.748 15.358  1.00 28.56 ? 101  GLY B C     1 
ATOM   3296  O  O     . GLY B  1 73  ? 88.397  139.840 15.882  1.00 28.92 ? 101  GLY B O     1 
ATOM   3297  N  N     . LEU B  1 74  ? 90.346  140.658 15.107  1.00 28.04 ? 102  LEU B N     1 
ATOM   3298  C  CA    . LEU B  1 74  ? 91.084  139.410 15.251  1.00 27.68 ? 102  LEU B CA    1 
ATOM   3299  C  C     . LEU B  1 74  ? 91.705  139.226 16.631  1.00 27.74 ? 102  LEU B C     1 
ATOM   3300  O  O     . LEU B  1 74  ? 92.253  138.164 16.927  1.00 27.33 ? 102  LEU B O     1 
ATOM   3301  C  CB    . LEU B  1 74  ? 92.171  139.323 14.176  1.00 27.35 ? 102  LEU B CB    1 
ATOM   3302  C  CG    . LEU B  1 74  ? 91.662  139.363 12.734  1.00 26.20 ? 102  LEU B CG    1 
ATOM   3303  C  CD1   . LEU B  1 74  ? 92.822  139.226 11.750  1.00 25.65 ? 102  LEU B CD1   1 
ATOM   3304  C  CD2   . LEU B  1 74  ? 90.606  138.278 12.499  1.00 25.54 ? 102  LEU B CD2   1 
ATOM   3305  N  N     . MET B  1 75  ? 91.590  140.251 17.473  1.00 27.84 ? 103  MET B N     1 
ATOM   3306  C  CA    . MET B  1 75  ? 92.116  140.214 18.832  1.00 28.06 ? 103  MET B CA    1 
ATOM   3307  C  C     . MET B  1 75  ? 91.015  139.961 19.859  1.00 28.44 ? 103  MET B C     1 
ATOM   3308  O  O     . MET B  1 75  ? 91.275  139.947 21.061  1.00 29.54 ? 103  MET B O     1 
ATOM   3309  C  CB    . MET B  1 75  ? 92.835  141.529 19.129  1.00 28.08 ? 103  MET B CB    1 
ATOM   3310  C  CG    . MET B  1 75  ? 94.044  141.760 18.217  1.00 28.04 ? 103  MET B CG    1 
ATOM   3311  S  SD    . MET B  1 75  ? 95.353  140.544 18.462  1.00 28.02 ? 103  MET B SD    1 
ATOM   3312  C  CE    . MET B  1 75  ? 96.291  141.370 19.763  1.00 27.78 ? 103  MET B CE    1 
ATOM   3313  N  N     . GLY B  1 76  ? 89.787  139.755 19.389  1.00 28.06 ? 104  GLY B N     1 
ATOM   3314  C  CA    . GLY B  1 76  ? 88.655  139.493 20.276  1.00 27.85 ? 104  GLY B CA    1 
ATOM   3315  C  C     . GLY B  1 76  ? 87.678  138.525 19.648  1.00 27.53 ? 104  GLY B C     1 
ATOM   3316  O  O     . GLY B  1 76  ? 86.471  138.701 19.763  1.00 27.44 ? 104  GLY B O     1 
ATOM   3317  N  N     . ILE B  1 77  ? 88.222  137.474 19.030  1.00 27.52 ? 105  ILE B N     1 
ATOM   3318  C  CA    . ILE B  1 77  ? 87.477  136.583 18.136  1.00 27.27 ? 105  ILE B CA    1 
ATOM   3319  C  C     . ILE B  1 77  ? 86.255  135.943 18.801  1.00 27.21 ? 105  ILE B C     1 
ATOM   3320  O  O     . ILE B  1 77  ? 85.159  135.974 18.247  1.00 26.99 ? 105  ILE B O     1 
ATOM   3321  C  CB    . ILE B  1 77  ? 88.392  135.478 17.531  1.00 27.35 ? 105  ILE B CB    1 
ATOM   3322  C  CG1   . ILE B  1 77  ? 89.529  136.106 16.704  1.00 27.17 ? 105  ILE B CG1   1 
ATOM   3323  C  CG2   . ILE B  1 77  ? 87.568  134.515 16.667  1.00 27.52 ? 105  ILE B CG2   1 
ATOM   3324  C  CD1   . ILE B  1 77  ? 90.568  135.117 16.194  1.00 27.19 ? 105  ILE B CD1   1 
ATOM   3325  N  N     . GLU B  1 78  ? 86.446  135.378 19.986  1.00 27.38 ? 106  GLU B N     1 
ATOM   3326  C  CA    . GLU B  1 78  ? 85.371  134.691 20.695  1.00 27.61 ? 106  GLU B CA    1 
ATOM   3327  C  C     . GLU B  1 78  ? 84.715  135.555 21.779  1.00 27.61 ? 106  GLU B C     1 
ATOM   3328  O  O     . GLU B  1 78  ? 83.787  135.108 22.444  1.00 27.69 ? 106  GLU B O     1 
ATOM   3329  C  CB    . GLU B  1 78  ? 85.902  133.410 21.331  1.00 27.97 ? 106  GLU B CB    1 
ATOM   3330  C  CG    . GLU B  1 78  ? 86.512  132.431 20.366  1.00 28.70 ? 106  GLU B CG    1 
ATOM   3331  C  CD    . GLU B  1 78  ? 87.426  131.436 21.056  1.00 31.51 ? 106  GLU B CD    1 
ATOM   3332  O  OE1   . GLU B  1 78  ? 86.923  130.650 21.892  1.00 32.77 ? 106  GLU B OE1   1 
ATOM   3333  O  OE2   . GLU B  1 78  ? 88.646  131.423 20.745  1.00 32.57 ? 106  GLU B OE2   1 
ATOM   3334  N  N     . VAL B  1 79  ? 85.191  136.785 21.954  1.00 27.52 ? 107  VAL B N     1 
ATOM   3335  C  CA    . VAL B  1 79  ? 84.635  137.685 22.972  1.00 27.21 ? 107  VAL B CA    1 
ATOM   3336  C  C     . VAL B  1 79  ? 83.247  138.154 22.528  1.00 27.53 ? 107  VAL B C     1 
ATOM   3337  O  O     . VAL B  1 79  ? 82.995  138.370 21.345  1.00 27.01 ? 107  VAL B O     1 
ATOM   3338  C  CB    . VAL B  1 79  ? 85.580  138.887 23.256  1.00 27.01 ? 107  VAL B CB    1 
ATOM   3339  C  CG1   . VAL B  1 79  ? 84.944  139.883 24.232  1.00 26.95 ? 107  VAL B CG1   1 
ATOM   3340  C  CG2   . VAL B  1 79  ? 86.936  138.379 23.791  1.00 27.83 ? 107  VAL B CG2   1 
ATOM   3341  N  N     . ASP B  1 80  ? 82.343  138.278 23.488  1.00 27.98 ? 108  ASP B N     1 
ATOM   3342  C  CA    . ASP B  1 80  ? 80.985  138.721 23.203  1.00 28.65 ? 108  ASP B CA    1 
ATOM   3343  C  C     . ASP B  1 80  ? 81.015  140.150 22.622  1.00 28.96 ? 108  ASP B C     1 
ATOM   3344  O  O     . ASP B  1 80  ? 81.817  140.976 23.065  1.00 28.78 ? 108  ASP B O     1 
ATOM   3345  C  CB    . ASP B  1 80  ? 80.150  138.652 24.484  1.00 28.70 ? 108  ASP B CB    1 
ATOM   3346  C  CG    . ASP B  1 80  ? 78.656  138.569 24.211  1.00 30.05 ? 108  ASP B CG    1 
ATOM   3347  O  OD1   . ASP B  1 80  ? 78.069  139.587 23.791  1.00 29.99 ? 108  ASP B OD1   1 
ATOM   3348  O  OD2   . ASP B  1 80  ? 78.074  137.482 24.428  1.00 31.26 ? 108  ASP B OD2   1 
ATOM   3349  N  N     . PRO B  1 81  ? 80.176  140.431 21.597  1.00 29.57 ? 109  PRO B N     1 
ATOM   3350  C  CA    . PRO B  1 81  ? 79.946  141.793 21.078  1.00 30.04 ? 109  PRO B CA    1 
ATOM   3351  C  C     . PRO B  1 81  ? 79.677  142.882 22.134  1.00 30.65 ? 109  PRO B C     1 
ATOM   3352  O  O     . PRO B  1 81  ? 79.946  144.056 21.871  1.00 30.58 ? 109  PRO B O     1 
ATOM   3353  C  CB    . PRO B  1 81  ? 78.722  141.613 20.175  1.00 30.09 ? 109  PRO B CB    1 
ATOM   3354  C  CG    . PRO B  1 81  ? 78.834  140.222 19.684  1.00 29.83 ? 109  PRO B CG    1 
ATOM   3355  C  CD    . PRO B  1 81  ? 79.432  139.425 20.812  1.00 29.42 ? 109  PRO B CD    1 
ATOM   3356  N  N     . GLU B  1 82  ? 79.135  142.492 23.293  1.00 31.27 ? 110  GLU B N     1 
ATOM   3357  C  CA    . GLU B  1 82  ? 79.050  143.359 24.483  1.00 31.91 ? 110  GLU B CA    1 
ATOM   3358  C  C     . GLU B  1 82  ? 80.331  144.149 24.729  1.00 31.74 ? 110  GLU B C     1 
ATOM   3359  O  O     . GLU B  1 82  ? 80.289  145.337 25.072  1.00 31.43 ? 110  GLU B O     1 
ATOM   3360  C  CB    . GLU B  1 82  ? 78.828  142.516 25.746  1.00 32.10 ? 110  GLU B CB    1 
ATOM   3361  C  CG    . GLU B  1 82  ? 77.418  142.112 26.057  1.00 32.96 ? 110  GLU B CG    1 
ATOM   3362  C  CD    . GLU B  1 82  ? 77.297  141.556 27.474  1.00 33.16 ? 110  GLU B CD    1 
ATOM   3363  O  OE1   . GLU B  1 82  ? 76.633  142.199 28.311  1.00 35.03 ? 110  GLU B OE1   1 
ATOM   3364  O  OE2   . GLU B  1 82  ? 77.887  140.490 27.754  1.00 36.11 ? 110  GLU B OE2   1 
ATOM   3365  N  N     . TYR B  1 83  ? 81.462  143.455 24.592  1.00 31.51 ? 111  TYR B N     1 
ATOM   3366  C  CA    . TYR B  1 83  ? 82.779  143.993 24.925  1.00 31.64 ? 111  TYR B CA    1 
ATOM   3367  C  C     . TYR B  1 83  ? 83.609  144.326 23.685  1.00 31.49 ? 111  TYR B C     1 
ATOM   3368  O  O     . TYR B  1 83  ? 84.840  144.370 23.755  1.00 31.44 ? 111  TYR B O     1 
ATOM   3369  C  CB    . TYR B  1 83  ? 83.556  142.976 25.769  1.00 31.98 ? 111  TYR B CB    1 
ATOM   3370  C  CG    . TYR B  1 83  ? 82.830  142.455 27.000  1.00 32.55 ? 111  TYR B CG    1 
ATOM   3371  C  CD1   . TYR B  1 83  ? 82.522  143.299 28.069  1.00 33.55 ? 111  TYR B CD1   1 
ATOM   3372  C  CD2   . TYR B  1 83  ? 82.489  141.113 27.111  1.00 33.21 ? 111  TYR B CD2   1 
ATOM   3373  C  CE1   . TYR B  1 83  ? 81.868  142.814 29.211  1.00 33.74 ? 111  TYR B CE1   1 
ATOM   3374  C  CE2   . TYR B  1 83  ? 81.848  140.620 28.242  1.00 33.05 ? 111  TYR B CE2   1 
ATOM   3375  C  CZ    . TYR B  1 83  ? 81.543  141.468 29.285  1.00 33.09 ? 111  TYR B CZ    1 
ATOM   3376  O  OH    . TYR B  1 83  ? 80.909  140.958 30.392  1.00 33.02 ? 111  TYR B OH    1 
ATOM   3377  N  N     . GLY B  1 84  ? 82.938  144.549 22.557  1.00 31.20 ? 112  GLY B N     1 
ATOM   3378  C  CA    . GLY B  1 84  ? 83.604  144.812 21.286  1.00 31.11 ? 112  GLY B CA    1 
ATOM   3379  C  C     . GLY B  1 84  ? 84.196  143.578 20.623  1.00 31.08 ? 112  GLY B C     1 
ATOM   3380  O  O     . GLY B  1 84  ? 85.034  143.699 19.730  1.00 31.04 ? 112  GLY B O     1 
ATOM   3381  N  N     . GLY B  1 85  ? 83.761  142.394 21.049  1.00 30.93 ? 113  GLY B N     1 
ATOM   3382  C  CA    . GLY B  1 85  ? 84.260  141.140 20.489  1.00 31.20 ? 113  GLY B CA    1 
ATOM   3383  C  C     . GLY B  1 85  ? 83.527  140.740 19.218  1.00 31.20 ? 113  GLY B C     1 
ATOM   3384  O  O     . GLY B  1 85  ? 82.597  141.419 18.800  1.00 30.99 ? 113  GLY B O     1 
ATOM   3385  N  N     . THR B  1 86  ? 83.951  139.638 18.599  1.00 31.27 ? 114  THR B N     1 
ATOM   3386  C  CA    . THR B  1 86  ? 83.333  139.181 17.348  1.00 31.36 ? 114  THR B CA    1 
ATOM   3387  C  C     . THR B  1 86  ? 82.287  138.088 17.593  1.00 31.11 ? 114  THR B C     1 
ATOM   3388  O  O     . THR B  1 86  ? 81.449  137.824 16.734  1.00 31.25 ? 114  THR B O     1 
ATOM   3389  C  CB    . THR B  1 86  ? 84.395  138.713 16.337  1.00 31.74 ? 114  THR B CB    1 
ATOM   3390  O  OG1   . THR B  1 86  ? 85.452  139.685 16.273  1.00 32.62 ? 114  THR B OG1   1 
ATOM   3391  C  CG2   . THR B  1 86  ? 83.784  138.535 14.954  1.00 31.97 ? 114  THR B CG2   1 
ATOM   3392  N  N     . GLY B  1 87  ? 82.323  137.470 18.771  1.00 30.78 ? 115  GLY B N     1 
ATOM   3393  C  CA    . GLY B  1 87  ? 81.333  136.465 19.150  1.00 30.57 ? 115  GLY B CA    1 
ATOM   3394  C  C     . GLY B  1 87  ? 81.386  135.183 18.332  1.00 30.48 ? 115  GLY B C     1 
ATOM   3395  O  O     . GLY B  1 87  ? 80.363  134.507 18.180  1.00 30.78 ? 115  GLY B O     1 
ATOM   3396  N  N     . ALA B  1 88  ? 82.572  134.841 17.825  1.00 29.67 ? 116  ALA B N     1 
ATOM   3397  C  CA    . ALA B  1 88  ? 82.756  133.688 16.936  1.00 29.63 ? 116  ALA B CA    1 
ATOM   3398  C  C     . ALA B  1 88  ? 83.151  132.417 17.694  1.00 29.54 ? 116  ALA B C     1 
ATOM   3399  O  O     . ALA B  1 88  ? 83.362  132.438 18.905  1.00 29.60 ? 116  ALA B O     1 
ATOM   3400  C  CB    . ALA B  1 88  ? 83.801  134.007 15.871  1.00 29.25 ? 116  ALA B CB    1 
ATOM   3401  N  N     . SER B  1 89  ? 83.264  131.312 16.961  1.00 29.29 ? 117  SER B N     1 
ATOM   3402  C  CA    . SER B  1 89  ? 83.570  130.007 17.548  1.00 28.82 ? 117  SER B CA    1 
ATOM   3403  C  C     . SER B  1 89  ? 85.065  129.831 17.813  1.00 28.28 ? 117  SER B C     1 
ATOM   3404  O  O     . SER B  1 89  ? 85.889  130.558 17.257  1.00 27.58 ? 117  SER B O     1 
ATOM   3405  C  CB    . SER B  1 89  ? 83.089  128.903 16.610  1.00 28.74 ? 117  SER B CB    1 
ATOM   3406  O  OG    . SER B  1 89  ? 83.908  128.835 15.453  1.00 30.09 ? 117  SER B OG    1 
ATOM   3407  N  N     . PHE B  1 90  ? 85.403  128.851 18.654  1.00 27.76 ? 118  PHE B N     1 
ATOM   3408  C  CA    . PHE B  1 90  ? 86.801  128.502 18.907  1.00 27.62 ? 118  PHE B CA    1 
ATOM   3409  C  C     . PHE B  1 90  ? 87.498  128.030 17.640  1.00 27.29 ? 118  PHE B C     1 
ATOM   3410  O  O     . PHE B  1 90  ? 88.659  128.357 17.428  1.00 26.46 ? 118  PHE B O     1 
ATOM   3411  C  CB    . PHE B  1 90  ? 86.931  127.432 19.997  1.00 27.83 ? 118  PHE B CB    1 
ATOM   3412  C  CG    . PHE B  1 90  ? 88.345  127.007 20.248  1.00 27.88 ? 118  PHE B CG    1 
ATOM   3413  C  CD1   . PHE B  1 90  ? 89.250  127.884 20.834  1.00 28.11 ? 118  PHE B CD1   1 
ATOM   3414  C  CD2   . PHE B  1 90  ? 88.790  125.749 19.863  1.00 27.85 ? 118  PHE B CD2   1 
ATOM   3415  C  CE1   . PHE B  1 90  ? 90.566  127.504 21.050  1.00 29.11 ? 118  PHE B CE1   1 
ATOM   3416  C  CE2   . PHE B  1 90  ? 90.096  125.365 20.082  1.00 28.77 ? 118  PHE B CE2   1 
ATOM   3417  C  CZ    . PHE B  1 90  ? 90.988  126.237 20.681  1.00 28.47 ? 118  PHE B CZ    1 
ATOM   3418  N  N     . LEU B  1 91  ? 86.790  127.276 16.799  1.00 27.16 ? 119  LEU B N     1 
ATOM   3419  C  CA    . LEU B  1 91  ? 87.357  126.841 15.521  1.00 27.71 ? 119  LEU B CA    1 
ATOM   3420  C  C     . LEU B  1 91  ? 87.681  128.026 14.598  1.00 26.93 ? 119  LEU B C     1 
ATOM   3421  O  O     . LEU B  1 91  ? 88.616  127.939 13.820  1.00 26.27 ? 119  LEU B O     1 
ATOM   3422  C  CB    . LEU B  1 91  ? 86.454  125.824 14.803  1.00 27.76 ? 119  LEU B CB    1 
ATOM   3423  C  CG    . LEU B  1 91  ? 87.124  125.076 13.630  1.00 29.38 ? 119  LEU B CG    1 
ATOM   3424  C  CD1   . LEU B  1 91  ? 88.453  124.436 14.023  1.00 30.93 ? 119  LEU B CD1   1 
ATOM   3425  C  CD2   . LEU B  1 91  ? 86.201  124.029 13.077  1.00 29.72 ? 119  LEU B CD2   1 
ATOM   3426  N  N     . SER B  1 92  ? 86.933  129.128 14.707  1.00 26.73 ? 120  SER B N     1 
ATOM   3427  C  CA    . SER B  1 92  ? 87.260  130.371 13.991  1.00 26.77 ? 120  SER B CA    1 
ATOM   3428  C  C     . SER B  1 92  ? 88.623  130.929 14.428  1.00 26.70 ? 120  SER B C     1 
ATOM   3429  O  O     . SER B  1 92  ? 89.408  131.389 13.601  1.00 26.57 ? 120  SER B O     1 
ATOM   3430  C  CB    . SER B  1 92  ? 86.189  131.454 14.201  1.00 27.00 ? 120  SER B CB    1 
ATOM   3431  O  OG    . SER B  1 92  ? 84.899  131.044 13.772  1.00 27.08 ? 120  SER B OG    1 
ATOM   3432  N  N     . THR B  1 93  ? 88.884  130.902 15.731  1.00 26.53 ? 121  THR B N     1 
ATOM   3433  C  CA    . THR B  1 93  ? 90.189  131.289 16.268  1.00 26.58 ? 121  THR B CA    1 
ATOM   3434  C  C     . THR B  1 93  ? 91.309  130.402 15.714  1.00 26.22 ? 121  THR B C     1 
ATOM   3435  O  O     . THR B  1 93  ? 92.374  130.898 15.344  1.00 25.69 ? 121  THR B O     1 
ATOM   3436  C  CB    . THR B  1 93  ? 90.187  131.229 17.806  1.00 26.62 ? 121  THR B CB    1 
ATOM   3437  O  OG1   . THR B  1 93  ? 89.275  132.215 18.309  1.00 26.94 ? 121  THR B OG1   1 
ATOM   3438  C  CG2   . THR B  1 93  ? 91.584  131.459 18.374  1.00 27.02 ? 121  THR B CG2   1 
ATOM   3439  N  N     . VAL B  1 94  ? 91.058  129.099 15.643  1.00 26.11 ? 122  VAL B N     1 
ATOM   3440  C  CA    . VAL B  1 94  ? 92.032  128.154 15.084  1.00 26.19 ? 122  VAL B CA    1 
ATOM   3441  C  C     . VAL B  1 94  ? 92.319  128.455 13.614  1.00 25.75 ? 122  VAL B C     1 
ATOM   3442  O  O     . VAL B  1 94  ? 93.482  128.494 13.200  1.00 25.77 ? 122  VAL B O     1 
ATOM   3443  C  CB    . VAL B  1 94  ? 91.557  126.692 15.230  1.00 26.13 ? 122  VAL B CB    1 
ATOM   3444  C  CG1   . VAL B  1 94  ? 92.481  125.724 14.461  1.00 26.88 ? 122  VAL B CG1   1 
ATOM   3445  C  CG2   . VAL B  1 94  ? 91.466  126.312 16.703  1.00 26.96 ? 122  VAL B CG2   1 
ATOM   3446  N  N     . LEU B  1 95  ? 91.255  128.660 12.840  1.00 25.71 ? 123  LEU B N     1 
ATOM   3447  C  CA    . LEU B  1 95  ? 91.373  129.006 11.421  1.00 25.86 ? 123  LEU B CA    1 
ATOM   3448  C  C     . LEU B  1 95  ? 92.100  130.341 11.200  1.00 25.77 ? 123  LEU B C     1 
ATOM   3449  O  O     . LEU B  1 95  ? 92.911  130.461 10.282  1.00 25.75 ? 123  LEU B O     1 
ATOM   3450  C  CB    . LEU B  1 95  ? 90.002  129.009 10.748  1.00 26.34 ? 123  LEU B CB    1 
ATOM   3451  C  CG    . LEU B  1 95  ? 89.288  127.658 10.606  1.00 28.09 ? 123  LEU B CG    1 
ATOM   3452  C  CD1   . LEU B  1 95  ? 87.883  127.871 10.052  1.00 27.26 ? 123  LEU B CD1   1 
ATOM   3453  C  CD2   . LEU B  1 95  ? 90.086  126.658 9.734   1.00 28.47 ? 123  LEU B CD2   1 
ATOM   3454  N  N     . VAL B  1 96  ? 91.846  131.327 12.061  1.00 25.50 ? 124  VAL B N     1 
ATOM   3455  C  CA    . VAL B  1 96  ? 92.557  132.614 11.979  1.00 25.36 ? 124  VAL B CA    1 
ATOM   3456  C  C     . VAL B  1 96  ? 94.053  132.445 12.240  1.00 25.11 ? 124  VAL B C     1 
ATOM   3457  O  O     . VAL B  1 96  ? 94.865  132.958 11.488  1.00 25.11 ? 124  VAL B O     1 
ATOM   3458  C  CB    . VAL B  1 96  ? 91.995  133.676 12.950  1.00 25.00 ? 124  VAL B CB    1 
ATOM   3459  C  CG1   . VAL B  1 96  ? 92.899  134.945 12.974  1.00 23.90 ? 124  VAL B CG1   1 
ATOM   3460  C  CG2   . VAL B  1 96  ? 90.561  134.023 12.584  1.00 26.17 ? 124  VAL B CG2   1 
ATOM   3461  N  N     . ILE B  1 97  ? 94.408  131.725 13.298  1.00 24.75 ? 125  ILE B N     1 
ATOM   3462  C  CA    . ILE B  1 97  ? 95.809  131.502 13.630  1.00 24.50 ? 125  ILE B CA    1 
ATOM   3463  C  C     . ILE B  1 97  ? 96.524  130.758 12.485  1.00 24.38 ? 125  ILE B C     1 
ATOM   3464  O  O     . ILE B  1 97  ? 97.611  131.146 12.043  1.00 23.56 ? 125  ILE B O     1 
ATOM   3465  C  CB    . ILE B  1 97  ? 95.958  130.741 14.966  1.00 24.87 ? 125  ILE B CB    1 
ATOM   3466  C  CG1   . ILE B  1 97  ? 95.404  131.582 16.135  1.00 25.50 ? 125  ILE B CG1   1 
ATOM   3467  C  CG2   . ILE B  1 97  ? 97.429  130.401 15.219  1.00 23.65 ? 125  ILE B CG2   1 
ATOM   3468  C  CD1   . ILE B  1 97  ? 94.993  130.744 17.343  1.00 26.91 ? 125  ILE B CD1   1 
ATOM   3469  N  N     . GLU B  1 98  ? 95.900  129.701 11.993  1.00 24.13 ? 126  GLU B N     1 
ATOM   3470  C  CA    . GLU B  1 98  ? 96.428  128.977 10.838  1.00 24.70 ? 126  GLU B CA    1 
ATOM   3471  C  C     . GLU B  1 98  ? 96.625  129.894 9.610   1.00 24.89 ? 126  GLU B C     1 
ATOM   3472  O  O     . GLU B  1 98  ? 97.670  129.849 8.983   1.00 25.39 ? 126  GLU B O     1 
ATOM   3473  C  CB    . GLU B  1 98  ? 95.504  127.801 10.486  1.00 24.35 ? 126  GLU B CB    1 
ATOM   3474  C  CG    . GLU B  1 98  ? 96.008  126.926 9.366   1.00 24.98 ? 126  GLU B CG    1 
ATOM   3475  C  CD    . GLU B  1 98  ? 95.003  125.901 8.902   1.00 25.57 ? 126  GLU B CD    1 
ATOM   3476  O  OE1   . GLU B  1 98  ? 93.881  125.847 9.436   1.00 27.15 ? 126  GLU B OE1   1 
ATOM   3477  O  OE2   . GLU B  1 98  ? 95.336  125.153 7.970   1.00 28.48 ? 126  GLU B OE2   1 
ATOM   3478  N  N     . GLU B  1 99  ? 95.625  130.709 9.275   1.00 25.87 ? 127  GLU B N     1 
ATOM   3479  C  CA    . GLU B  1 99  ? 95.715  131.602 8.109   1.00 26.36 ? 127  GLU B CA    1 
ATOM   3480  C  C     . GLU B  1 99  ? 96.803  132.676 8.269   1.00 25.90 ? 127  GLU B C     1 
ATOM   3481  O  O     . GLU B  1 99  ? 97.538  132.942 7.334   1.00 26.41 ? 127  GLU B O     1 
ATOM   3482  C  CB    . GLU B  1 99  ? 94.379  132.272 7.793   1.00 26.70 ? 127  GLU B CB    1 
ATOM   3483  C  CG    . GLU B  1 99  ? 93.423  131.435 6.951   1.00 29.48 ? 127  GLU B CG    1 
ATOM   3484  C  CD    . GLU B  1 99  ? 93.991  130.986 5.607   1.00 29.30 ? 127  GLU B CD    1 
ATOM   3485  O  OE1   . GLU B  1 99  ? 94.577  131.792 4.847   1.00 31.28 ? 127  GLU B OE1   1 
ATOM   3486  O  OE2   . GLU B  1 99  ? 93.829  129.802 5.301   1.00 33.49 ? 127  GLU B OE2   1 
ATOM   3487  N  N     . LEU B  1 100 ? 96.910  133.277 9.446   1.00 25.10 ? 128  LEU B N     1 
ATOM   3488  C  CA    . LEU B  1 100 ? 97.992  134.226 9.710   1.00 24.81 ? 128  LEU B CA    1 
ATOM   3489  C  C     . LEU B  1 100 ? 99.360  133.539 9.610   1.00 24.67 ? 128  LEU B C     1 
ATOM   3490  O  O     . LEU B  1 100 ? 100.291 134.083 9.016   1.00 24.00 ? 128  LEU B O     1 
ATOM   3491  C  CB    . LEU B  1 100 ? 97.841  134.857 11.095  1.00 24.86 ? 128  LEU B CB    1 
ATOM   3492  C  CG    . LEU B  1 100 ? 96.642  135.765 11.364  1.00 24.72 ? 128  LEU B CG    1 
ATOM   3493  C  CD1   . LEU B  1 100 ? 96.619  136.156 12.854  1.00 24.43 ? 128  LEU B CD1   1 
ATOM   3494  C  CD2   . LEU B  1 100 ? 96.630  137.015 10.451  1.00 24.40 ? 128  LEU B CD2   1 
ATOM   3495  N  N     . ALA B  1 101 ? 99.477  132.345 10.191  1.00 23.94 ? 129  ALA B N     1 
ATOM   3496  C  CA    . ALA B  1 101 ? 100.736 131.613 10.190  1.00 24.51 ? 129  ALA B CA    1 
ATOM   3497  C  C     . ALA B  1 101 ? 101.227 131.218 8.775   1.00 24.58 ? 129  ALA B C     1 
ATOM   3498  O  O     . ALA B  1 101 ? 102.441 131.084 8.567   1.00 24.21 ? 129  ALA B O     1 
ATOM   3499  C  CB    . ALA B  1 101 ? 100.651 130.375 11.098  1.00 23.72 ? 129  ALA B CB    1 
ATOM   3500  N  N     . LYS B  1 102 ? 100.299 131.061 7.826   1.00 25.13 ? 130  LYS B N     1 
ATOM   3501  C  CA    . LYS B  1 102 ? 100.645 130.795 6.417   1.00 25.63 ? 130  LYS B CA    1 
ATOM   3502  C  C     . LYS B  1 102 ? 101.509 131.912 5.830   1.00 26.26 ? 130  LYS B C     1 
ATOM   3503  O  O     . LYS B  1 102 ? 102.343 131.654 4.949   1.00 26.63 ? 130  LYS B O     1 
ATOM   3504  C  CB    . LYS B  1 102 ? 99.392  130.603 5.545   1.00 25.41 ? 130  LYS B CB    1 
ATOM   3505  C  CG    . LYS B  1 102 ? 98.719  129.256 5.696   1.00 24.57 ? 130  LYS B CG    1 
ATOM   3506  C  CD    . LYS B  1 102 ? 97.556  129.117 4.735   1.00 26.36 ? 130  LYS B CD    1 
ATOM   3507  C  CE    . LYS B  1 102 ? 96.640  127.955 5.105   1.00 27.42 ? 130  LYS B CE    1 
ATOM   3508  N  NZ    . LYS B  1 102 ? 95.420  127.965 4.273   1.00 28.26 ? 130  LYS B NZ    1 
ATOM   3509  N  N     . VAL B  1 103 ? 101.301 133.134 6.328   1.00 26.50 ? 131  VAL B N     1 
ATOM   3510  C  CA    . VAL B  1 103 ? 102.100 134.295 5.956   1.00 26.62 ? 131  VAL B CA    1 
ATOM   3511  C  C     . VAL B  1 103 ? 103.213 134.622 6.978   1.00 27.13 ? 131  VAL B C     1 
ATOM   3512  O  O     . VAL B  1 103 ? 104.356 134.834 6.582   1.00 27.44 ? 131  VAL B O     1 
ATOM   3513  C  CB    . VAL B  1 103 ? 101.207 135.541 5.722   1.00 26.78 ? 131  VAL B CB    1 
ATOM   3514  C  CG1   . VAL B  1 103 ? 102.065 136.810 5.518   1.00 24.98 ? 131  VAL B CG1   1 
ATOM   3515  C  CG2   . VAL B  1 103 ? 100.278 135.309 4.529   1.00 26.06 ? 131  VAL B CG2   1 
ATOM   3516  N  N     . ASP B  1 104 ? 102.877 134.691 8.270   1.00 27.18 ? 132  ASP B N     1 
ATOM   3517  C  CA    . ASP B  1 104 ? 103.879 134.970 9.314   1.00 27.37 ? 132  ASP B CA    1 
ATOM   3518  C  C     . ASP B  1 104 ? 103.528 134.357 10.675  1.00 26.89 ? 132  ASP B C     1 
ATOM   3519  O  O     . ASP B  1 104 ? 102.629 134.843 11.381  1.00 27.43 ? 132  ASP B O     1 
ATOM   3520  C  CB    . ASP B  1 104 ? 104.085 136.478 9.469   1.00 27.78 ? 132  ASP B CB    1 
ATOM   3521  C  CG    . ASP B  1 104 ? 105.386 136.832 10.203  1.00 27.77 ? 132  ASP B CG    1 
ATOM   3522  O  OD1   . ASP B  1 104 ? 105.996 135.967 10.869  1.00 28.29 ? 132  ASP B OD1   1 
ATOM   3523  O  OD2   . ASP B  1 104 ? 105.807 137.995 10.100  1.00 28.82 ? 132  ASP B OD2   1 
ATOM   3524  N  N     . ALA B  1 105 ? 104.269 133.318 11.048  1.00 26.43 ? 133  ALA B N     1 
ATOM   3525  C  CA    . ALA B  1 105 ? 104.081 132.638 12.339  1.00 26.55 ? 133  ALA B CA    1 
ATOM   3526  C  C     . ALA B  1 105 ? 104.167 133.602 13.533  1.00 25.99 ? 133  ALA B C     1 
ATOM   3527  O  O     . ALA B  1 105 ? 103.528 133.378 14.553  1.00 26.27 ? 133  ALA B O     1 
ATOM   3528  C  CB    . ALA B  1 105 ? 105.097 131.522 12.504  1.00 26.06 ? 133  ALA B CB    1 
ATOM   3529  N  N     . SER B  1 106 ? 104.972 134.652 13.399  1.00 26.02 ? 134  SER B N     1 
ATOM   3530  C  CA    . SER B  1 106 ? 105.143 135.638 14.459  1.00 26.00 ? 134  SER B CA    1 
ATOM   3531  C  C     . SER B  1 106 ? 103.848 136.392 14.704  1.00 25.98 ? 134  SER B C     1 
ATOM   3532  O  O     . SER B  1 106 ? 103.467 136.623 15.849  1.00 25.83 ? 134  SER B O     1 
ATOM   3533  C  CB    . SER B  1 106 ? 106.245 136.641 14.111  1.00 25.69 ? 134  SER B CB    1 
ATOM   3534  O  OG    . SER B  1 106 ? 107.517 136.027 14.110  1.00 27.16 ? 134  SER B OG    1 
ATOM   3535  N  N     . VAL B  1 107 ? 103.201 136.820 13.622  1.00 26.13 ? 135  VAL B N     1 
ATOM   3536  C  CA    . VAL B  1 107 ? 101.896 137.477 13.731  1.00 25.95 ? 135  VAL B CA    1 
ATOM   3537  C  C     . VAL B  1 107 ? 100.844 136.519 14.289  1.00 26.02 ? 135  VAL B C     1 
ATOM   3538  O  O     . VAL B  1 107 ? 99.977  136.937 15.069  1.00 26.38 ? 135  VAL B O     1 
ATOM   3539  C  CB    . VAL B  1 107 ? 101.426 138.084 12.380  1.00 25.77 ? 135  VAL B CB    1 
ATOM   3540  C  CG1   . VAL B  1 107 ? 100.031 138.727 12.527  1.00 26.49 ? 135  VAL B CG1   1 
ATOM   3541  C  CG2   . VAL B  1 107 ? 102.435 139.113 11.897  1.00 24.81 ? 135  VAL B CG2   1 
ATOM   3542  N  N     . ALA B  1 108 ? 100.932 135.240 13.914  1.00 26.12 ? 136  ALA B N     1 
ATOM   3543  C  CA    . ALA B  1 108 ? 99.974  134.237 14.364  1.00 26.09 ? 136  ALA B CA    1 
ATOM   3544  C  C     . ALA B  1 108 ? 100.013 134.060 15.886  1.00 26.51 ? 136  ALA B C     1 
ATOM   3545  O  O     . ALA B  1 108 ? 98.964  134.055 16.542  1.00 25.75 ? 136  ALA B O     1 
ATOM   3546  C  CB    . ALA B  1 108 ? 100.198 132.890 13.638  1.00 25.45 ? 136  ALA B CB    1 
ATOM   3547  N  N     . VAL B  1 109 ? 101.217 133.960 16.450  1.00 27.09 ? 137  VAL B N     1 
ATOM   3548  C  CA    . VAL B  1 109 ? 101.356 133.738 17.898  1.00 27.41 ? 137  VAL B CA    1 
ATOM   3549  C  C     . VAL B  1 109 ? 100.862 134.953 18.705  1.00 27.50 ? 137  VAL B C     1 
ATOM   3550  O  O     . VAL B  1 109 ? 100.235 134.788 19.746  1.00 27.32 ? 137  VAL B O     1 
ATOM   3551  C  CB    . VAL B  1 109 ? 102.811 133.285 18.320  1.00 26.85 ? 137  VAL B CB    1 
ATOM   3552  C  CG1   . VAL B  1 109 ? 103.838 134.414 18.179  1.00 27.12 ? 137  VAL B CG1   1 
ATOM   3553  C  CG2   . VAL B  1 109 ? 102.810 132.724 19.747  1.00 26.41 ? 137  VAL B CG2   1 
ATOM   3554  N  N     . PHE B  1 110 ? 101.119 136.157 18.200  1.00 28.25 ? 138  PHE B N     1 
ATOM   3555  C  CA    . PHE B  1 110 ? 100.599 137.388 18.785  1.00 28.73 ? 138  PHE B CA    1 
ATOM   3556  C  C     . PHE B  1 110 ? 99.070  137.275 18.933  1.00 29.07 ? 138  PHE B C     1 
ATOM   3557  O  O     . PHE B  1 110 ? 98.488  137.531 20.002  1.00 28.59 ? 138  PHE B O     1 
ATOM   3558  C  CB    . PHE B  1 110 ? 101.009 138.556 17.870  1.00 29.71 ? 138  PHE B CB    1 
ATOM   3559  C  CG    . PHE B  1 110 ? 100.783 139.923 18.442  1.00 29.85 ? 138  PHE B CG    1 
ATOM   3560  C  CD1   . PHE B  1 110 ? 101.707 140.496 19.304  1.00 30.86 ? 138  PHE B CD1   1 
ATOM   3561  C  CD2   . PHE B  1 110 ? 99.690  140.668 18.057  1.00 31.54 ? 138  PHE B CD2   1 
ATOM   3562  C  CE1   . PHE B  1 110 ? 101.517 141.773 19.811  1.00 31.97 ? 138  PHE B CE1   1 
ATOM   3563  C  CE2   . PHE B  1 110 ? 99.488  141.939 18.559  1.00 31.40 ? 138  PHE B CE2   1 
ATOM   3564  C  CZ    . PHE B  1 110 ? 100.409 142.493 19.443  1.00 31.53 ? 138  PHE B CZ    1 
ATOM   3565  N  N     . CYS B  1 111 ? 98.436  136.830 17.859  1.00 29.43 ? 139  CYS B N     1 
ATOM   3566  C  CA    . CYS B  1 111 ? 97.002  136.592 17.834  1.00 29.62 ? 139  CYS B CA    1 
ATOM   3567  C  C     . CYS B  1 111 ? 96.569  135.453 18.769  1.00 29.09 ? 139  CYS B C     1 
ATOM   3568  O  O     . CYS B  1 111 ? 95.558  135.566 19.463  1.00 29.27 ? 139  CYS B O     1 
ATOM   3569  C  CB    . CYS B  1 111 ? 96.587  136.287 16.399  1.00 29.83 ? 139  CYS B CB    1 
ATOM   3570  S  SG    . CYS B  1 111 ? 94.845  136.073 16.188  1.00 31.38 ? 139  CYS B SG    1 
ATOM   3571  N  N     . GLU B  1 112 ? 97.349  134.377 18.802  1.00 29.01 ? 140  GLU B N     1 
ATOM   3572  C  CA    . GLU B  1 112 ? 97.024  133.194 19.606  1.00 28.56 ? 140  GLU B CA    1 
ATOM   3573  C  C     . GLU B  1 112 ? 97.099  133.472 21.107  1.00 27.97 ? 140  GLU B C     1 
ATOM   3574  O  O     . GLU B  1 112 ? 96.233  133.024 21.864  1.00 27.58 ? 140  GLU B O     1 
ATOM   3575  C  CB    . GLU B  1 112 ? 97.933  132.017 19.222  1.00 28.76 ? 140  GLU B CB    1 
ATOM   3576  C  CG    . GLU B  1 112 ? 97.712  130.712 20.041  1.00 29.43 ? 140  GLU B CG    1 
ATOM   3577  C  CD    . GLU B  1 112 ? 98.568  130.593 21.315  1.00 32.03 ? 140  GLU B CD    1 
ATOM   3578  O  OE1   . GLU B  1 112 ? 99.542  131.361 21.506  1.00 32.24 ? 140  GLU B OE1   1 
ATOM   3579  O  OE2   . GLU B  1 112 ? 98.285  129.688 22.132  1.00 33.49 ? 140  GLU B OE2   1 
ATOM   3580  N  N     . ILE B  1 113 ? 98.122  134.211 21.538  1.00 27.55 ? 141  ILE B N     1 
ATOM   3581  C  CA    . ILE B  1 113 ? 98.237  134.598 22.949  1.00 26.90 ? 141  ILE B CA    1 
ATOM   3582  C  C     . ILE B  1 113 ? 97.044  135.445 23.401  1.00 26.53 ? 141  ILE B C     1 
ATOM   3583  O  O     . ILE B  1 113 ? 96.459  135.170 24.448  1.00 25.80 ? 141  ILE B O     1 
ATOM   3584  C  CB    . ILE B  1 113 ? 99.547  135.362 23.255  1.00 27.14 ? 141  ILE B CB    1 
ATOM   3585  C  CG1   . ILE B  1 113 ? 100.762 134.454 23.027  1.00 27.03 ? 141  ILE B CG1   1 
ATOM   3586  C  CG2   . ILE B  1 113 ? 99.535  135.904 24.704  1.00 26.57 ? 141  ILE B CG2   1 
ATOM   3587  C  CD1   . ILE B  1 113 ? 102.047 135.206 22.735  1.00 25.69 ? 141  ILE B CD1   1 
ATOM   3588  N  N     . GLN B  1 114 ? 96.685  136.459 22.611  1.00 26.19 ? 142  GLN B N     1 
ATOM   3589  C  CA    . GLN B  1 114 ? 95.574  137.349 22.947  1.00 26.01 ? 142  GLN B CA    1 
ATOM   3590  C  C     . GLN B  1 114 ? 94.265  136.564 23.108  1.00 26.42 ? 142  GLN B C     1 
ATOM   3591  O  O     . GLN B  1 114 ? 93.579  136.690 24.121  1.00 25.63 ? 142  GLN B O     1 
ATOM   3592  C  CB    . GLN B  1 114 ? 95.391  138.435 21.879  1.00 25.76 ? 142  GLN B CB    1 
ATOM   3593  C  CG    . GLN B  1 114 ? 94.408  139.546 22.271  1.00 24.99 ? 142  GLN B CG    1 
ATOM   3594  C  CD    . GLN B  1 114 ? 95.036  140.659 23.109  1.00 23.88 ? 142  GLN B CD    1 
ATOM   3595  O  OE1   . GLN B  1 114 ? 96.138  140.522 23.623  1.00 22.08 ? 142  GLN B OE1   1 
ATOM   3596  N  NE2   . GLN B  1 114 ? 94.316  141.773 23.251  1.00 22.45 ? 142  GLN B NE2   1 
ATOM   3597  N  N     . ASN B  1 115 ? 93.941  135.744 22.114  1.00 26.54 ? 143  ASN B N     1 
ATOM   3598  C  CA    . ASN B  1 115 ? 92.666  135.018 22.100  1.00 27.46 ? 143  ASN B CA    1 
ATOM   3599  C  C     . ASN B  1 115 ? 92.607  133.777 23.006  1.00 28.23 ? 143  ASN B C     1 
ATOM   3600  O  O     . ASN B  1 115 ? 91.647  133.613 23.778  1.00 28.85 ? 143  ASN B O     1 
ATOM   3601  C  CB    . ASN B  1 115 ? 92.297  134.625 20.662  1.00 26.73 ? 143  ASN B CB    1 
ATOM   3602  C  CG    . ASN B  1 115 ? 91.854  135.814 19.826  1.00 26.36 ? 143  ASN B CG    1 
ATOM   3603  O  OD1   . ASN B  1 115 ? 90.705  136.272 19.919  1.00 23.63 ? 143  ASN B OD1   1 
ATOM   3604  N  ND2   . ASN B  1 115 ? 92.759  136.320 19.000  1.00 26.19 ? 143  ASN B ND2   1 
ATOM   3605  N  N     . THR B  1 116 ? 93.606  132.902 22.907  1.00 29.01 ? 144  THR B N     1 
ATOM   3606  C  CA    . THR B  1 116 ? 93.523  131.585 23.563  1.00 29.96 ? 144  THR B CA    1 
ATOM   3607  C  C     . THR B  1 116 ? 94.029  131.571 25.003  1.00 30.08 ? 144  THR B C     1 
ATOM   3608  O  O     . THR B  1 116 ? 93.625  130.707 25.786  1.00 30.81 ? 144  THR B O     1 
ATOM   3609  C  CB    . THR B  1 116 ? 94.214  130.446 22.757  1.00 30.01 ? 144  THR B CB    1 
ATOM   3610  O  OG1   . THR B  1 116 ? 95.635  130.480 22.967  1.00 33.12 ? 144  THR B OG1   1 
ATOM   3611  C  CG2   . THR B  1 116 ? 93.900  130.566 21.262  1.00 29.92 ? 144  THR B CG2   1 
ATOM   3612  N  N     . LEU B  1 117 ? 94.872  132.538 25.365  1.00 30.01 ? 145  LEU B N     1 
ATOM   3613  C  CA    . LEU B  1 117 ? 95.431  132.591 26.711  1.00 29.87 ? 145  LEU B CA    1 
ATOM   3614  C  C     . LEU B  1 117 ? 94.812  133.730 27.516  1.00 29.72 ? 145  LEU B C     1 
ATOM   3615  O  O     . LEU B  1 117 ? 94.255  133.489 28.592  1.00 30.76 ? 145  LEU B O     1 
ATOM   3616  C  CB    . LEU B  1 117 ? 96.967  132.695 26.667  1.00 29.78 ? 145  LEU B CB    1 
ATOM   3617  C  CG    . LEU B  1 117 ? 97.731  131.588 25.916  1.00 30.54 ? 145  LEU B CG    1 
ATOM   3618  C  CD1   . LEU B  1 117 ? 99.237  131.799 26.064  1.00 29.64 ? 145  LEU B CD1   1 
ATOM   3619  C  CD2   . LEU B  1 117 ? 97.342  130.168 26.365  1.00 29.29 ? 145  LEU B CD2   1 
ATOM   3620  N  N     . ILE B  1 118 ? 94.848  134.950 26.980  1.00 28.60 ? 146  ILE B N     1 
ATOM   3621  C  CA    . ILE B  1 118 ? 94.437  136.138 27.747  1.00 28.04 ? 146  ILE B CA    1 
ATOM   3622  C  C     . ILE B  1 118 ? 92.913  136.308 27.798  1.00 28.08 ? 146  ILE B C     1 
ATOM   3623  O  O     . ILE B  1 118 ? 92.317  136.303 28.875  1.00 27.60 ? 146  ILE B O     1 
ATOM   3624  C  CB    . ILE B  1 118 ? 95.075  137.436 27.200  1.00 27.68 ? 146  ILE B CB    1 
ATOM   3625  C  CG1   . ILE B  1 118 ? 96.602  137.302 27.076  1.00 26.91 ? 146  ILE B CG1   1 
ATOM   3626  C  CG2   . ILE B  1 118 ? 94.709  138.637 28.113  1.00 27.74 ? 146  ILE B CG2   1 
ATOM   3627  C  CD1   . ILE B  1 118 ? 97.309  137.042 28.364  1.00 27.22 ? 146  ILE B CD1   1 
ATOM   3628  N  N     . ASN B  1 119 ? 92.297  136.454 26.631  1.00 28.11 ? 147  ASN B N     1 
ATOM   3629  C  CA    . ASN B  1 119 ? 90.852  136.597 26.523  1.00 28.48 ? 147  ASN B CA    1 
ATOM   3630  C  C     . ASN B  1 119 ? 90.084  135.458 27.193  1.00 28.85 ? 147  ASN B C     1 
ATOM   3631  O  O     . ASN B  1 119 ? 89.129  135.698 27.930  1.00 28.99 ? 147  ASN B O     1 
ATOM   3632  C  CB    . ASN B  1 119 ? 90.445  136.726 25.051  1.00 28.45 ? 147  ASN B CB    1 
ATOM   3633  C  CG    . ASN B  1 119 ? 90.786  138.085 24.465  1.00 28.71 ? 147  ASN B CG    1 
ATOM   3634  O  OD1   . ASN B  1 119 ? 91.234  138.990 25.175  1.00 29.23 ? 147  ASN B OD1   1 
ATOM   3635  N  ND2   . ASN B  1 119 ? 90.570  138.239 23.162  1.00 29.24 ? 147  ASN B ND2   1 
ATOM   3636  N  N     . THR B  1 120 ? 90.514  134.228 26.947  1.00 29.72 ? 148  THR B N     1 
ATOM   3637  C  CA    . THR B  1 120 ? 89.870  133.044 27.507  1.00 30.36 ? 148  THR B CA    1 
ATOM   3638  C  C     . THR B  1 120 ? 89.854  133.037 29.039  1.00 30.28 ? 148  THR B C     1 
ATOM   3639  O  O     . THR B  1 120 ? 88.811  132.797 29.645  1.00 30.18 ? 148  THR B O     1 
ATOM   3640  C  CB    . THR B  1 120 ? 90.547  131.757 26.990  1.00 30.90 ? 148  THR B CB    1 
ATOM   3641  O  OG1   . THR B  1 120 ? 90.264  131.607 25.589  1.00 31.31 ? 148  THR B OG1   1 
ATOM   3642  C  CG2   . THR B  1 120 ? 90.046  130.531 27.752  1.00 31.70 ? 148  THR B CG2   1 
ATOM   3643  N  N     . LEU B  1 121 ? 91.002  133.311 29.653  1.00 30.15 ? 149  LEU B N     1 
ATOM   3644  C  CA    . LEU B  1 121 ? 91.114  133.335 31.110  1.00 30.29 ? 149  LEU B CA    1 
ATOM   3645  C  C     . LEU B  1 121 ? 90.212  134.390 31.735  1.00 29.76 ? 149  LEU B C     1 
ATOM   3646  O  O     . LEU B  1 121 ? 89.570  134.130 32.749  1.00 29.58 ? 149  LEU B O     1 
ATOM   3647  C  CB    . LEU B  1 121 ? 92.569  133.559 31.548  1.00 30.69 ? 149  LEU B CB    1 
ATOM   3648  C  CG    . LEU B  1 121 ? 93.450  132.311 31.456  1.00 32.51 ? 149  LEU B CG    1 
ATOM   3649  C  CD1   . LEU B  1 121 ? 94.933  132.651 31.562  1.00 33.94 ? 149  LEU B CD1   1 
ATOM   3650  C  CD2   . LEU B  1 121 ? 93.043  131.323 32.535  1.00 34.87 ? 149  LEU B CD2   1 
ATOM   3651  N  N     . ILE B  1 122 ? 90.154  135.569 31.123  1.00 29.44 ? 150  ILE B N     1 
ATOM   3652  C  CA    . ILE B  1 122 ? 89.307  136.657 31.625  1.00 29.39 ? 150  ILE B CA    1 
ATOM   3653  C  C     . ILE B  1 122 ? 87.811  136.356 31.402  1.00 29.68 ? 150  ILE B C     1 
ATOM   3654  O  O     . ILE B  1 122 ? 86.993  136.604 32.291  1.00 28.76 ? 150  ILE B O     1 
ATOM   3655  C  CB    . ILE B  1 122 ? 89.713  138.022 31.010  1.00 29.29 ? 150  ILE B CB    1 
ATOM   3656  C  CG1   . ILE B  1 122 ? 91.110  138.423 31.511  1.00 28.99 ? 150  ILE B CG1   1 
ATOM   3657  C  CG2   . ILE B  1 122 ? 88.696  139.101 31.364  1.00 28.99 ? 150  ILE B CG2   1 
ATOM   3658  C  CD1   . ILE B  1 122 ? 91.757  139.529 30.730  1.00 28.11 ? 150  ILE B CD1   1 
ATOM   3659  N  N     . ARG B  1 123 ? 87.459  135.810 30.236  1.00 30.17 ? 151  ARG B N     1 
ATOM   3660  C  CA    . ARG B  1 123 ? 86.083  135.336 29.997  1.00 31.13 ? 151  ARG B CA    1 
ATOM   3661  C  C     . ARG B  1 123 ? 85.640  134.276 31.014  1.00 31.63 ? 151  ARG B C     1 
ATOM   3662  O  O     . ARG B  1 123 ? 84.549  134.371 31.579  1.00 31.69 ? 151  ARG B O     1 
ATOM   3663  C  CB    . ARG B  1 123 ? 85.920  134.769 28.580  1.00 30.95 ? 151  ARG B CB    1 
ATOM   3664  C  CG    A ARG B  1 123 ? 85.978  135.789 27.460  0.50 31.62 ? 151  ARG B CG    1 
ATOM   3665  C  CG    B ARG B  1 123 ? 85.937  135.845 27.504  0.50 31.12 ? 151  ARG B CG    1 
ATOM   3666  C  CD    A ARG B  1 123 ? 85.871  135.123 26.079  0.50 31.90 ? 151  ARG B CD    1 
ATOM   3667  C  CD    B ARG B  1 123 ? 85.583  135.311 26.123  0.50 31.01 ? 151  ARG B CD    1 
ATOM   3668  N  NE    A ARG B  1 123 ? 84.472  134.960 25.665  0.50 33.09 ? 151  ARG B NE    1 
ATOM   3669  N  NE    B ARG B  1 123 ? 86.447  134.205 25.716  0.50 30.31 ? 151  ARG B NE    1 
ATOM   3670  C  CZ    A ARG B  1 123 ? 83.760  133.834 25.748  0.50 33.40 ? 151  ARG B CZ    1 
ATOM   3671  C  CZ    B ARG B  1 123 ? 86.037  133.034 25.220  0.50 30.27 ? 151  ARG B CZ    1 
ATOM   3672  N  NH1   A ARG B  1 123 ? 84.291  132.705 26.213  0.50 33.52 ? 151  ARG B NH1   1 
ATOM   3673  N  NH1   B ARG B  1 123 ? 84.744  132.771 25.027  0.50 29.74 ? 151  ARG B NH1   1 
ATOM   3674  N  NH2   A ARG B  1 123 ? 82.491  133.840 25.344  0.50 32.93 ? 151  ARG B NH2   1 
ATOM   3675  N  NH2   B ARG B  1 123 ? 86.940  132.116 24.894  0.50 29.54 ? 151  ARG B NH2   1 
ATOM   3676  N  N     . LYS B  1 124 ? 86.482  133.270 31.243  1.00 32.30 ? 152  LYS B N     1 
ATOM   3677  C  CA    . LYS B  1 124 ? 86.114  132.158 32.116  1.00 33.15 ? 152  LYS B CA    1 
ATOM   3678  C  C     . LYS B  1 124 ? 86.129  132.539 33.602  1.00 32.89 ? 152  LYS B C     1 
ATOM   3679  O  O     . LYS B  1 124 ? 85.197  132.199 34.325  1.00 32.76 ? 152  LYS B O     1 
ATOM   3680  C  CB    . LYS B  1 124 ? 87.002  130.931 31.863  1.00 33.51 ? 152  LYS B CB    1 
ATOM   3681  C  CG    . LYS B  1 124 ? 86.661  130.164 30.576  1.00 34.72 ? 152  LYS B CG    1 
ATOM   3682  C  CD    . LYS B  1 124 ? 87.565  128.938 30.382  1.00 35.23 ? 152  LYS B CD    1 
ATOM   3683  C  CE    . LYS B  1 124 ? 87.126  128.060 29.193  1.00 36.97 ? 152  LYS B CE    1 
ATOM   3684  N  NZ    . LYS B  1 124 ? 88.040  128.160 28.016  1.00 38.04 ? 152  LYS B NZ    1 
ATOM   3685  N  N     . HIS B  1 125 ? 87.157  133.259 34.053  1.00 32.64 ? 153  HIS B N     1 
ATOM   3686  C  CA    . HIS B  1 125 ? 87.363  133.471 35.496  1.00 32.30 ? 153  HIS B CA    1 
ATOM   3687  C  C     . HIS B  1 125 ? 87.226  134.903 35.989  1.00 32.25 ? 153  HIS B C     1 
ATOM   3688  O  O     . HIS B  1 125 ? 87.376  135.161 37.187  1.00 32.24 ? 153  HIS B O     1 
ATOM   3689  C  CB    . HIS B  1 125 ? 88.728  132.919 35.904  1.00 32.41 ? 153  HIS B CB    1 
ATOM   3690  C  CG    . HIS B  1 125 ? 88.979  131.529 35.409  1.00 32.74 ? 153  HIS B CG    1 
ATOM   3691  N  ND1   . HIS B  1 125 ? 88.413  130.416 35.996  1.00 33.67 ? 153  HIS B ND1   1 
ATOM   3692  C  CD2   . HIS B  1 125 ? 89.721  131.073 34.373  1.00 33.24 ? 153  HIS B CD2   1 
ATOM   3693  C  CE1   . HIS B  1 125 ? 88.804  129.334 35.348  1.00 32.76 ? 153  HIS B CE1   1 
ATOM   3694  N  NE2   . HIS B  1 125 ? 89.596  129.705 34.358  1.00 33.75 ? 153  HIS B NE2   1 
ATOM   3695  N  N     . GLY B  1 126 ? 86.923  135.832 35.088  1.00 31.99 ? 154  GLY B N     1 
ATOM   3696  C  CA    . GLY B  1 126 ? 86.780  137.230 35.458  1.00 31.83 ? 154  GLY B CA    1 
ATOM   3697  C  C     . GLY B  1 126 ? 85.458  137.518 36.145  1.00 31.76 ? 154  GLY B C     1 
ATOM   3698  O  O     . GLY B  1 126 ? 84.442  136.886 35.850  1.00 31.34 ? 154  GLY B O     1 
ATOM   3699  N  N     . THR B  1 127 ? 85.473  138.475 37.067  1.00 32.02 ? 155  THR B N     1 
ATOM   3700  C  CA    . THR B  1 127 ? 84.235  139.029 37.611  1.00 32.30 ? 155  THR B CA    1 
ATOM   3701  C  C     . THR B  1 127 ? 83.616  139.881 36.511  1.00 32.50 ? 155  THR B C     1 
ATOM   3702  O  O     . THR B  1 127 ? 84.280  140.195 35.520  1.00 32.11 ? 155  THR B O     1 
ATOM   3703  C  CB    . THR B  1 127 ? 84.479  139.893 38.866  1.00 32.33 ? 155  THR B CB    1 
ATOM   3704  O  OG1   . THR B  1 127 ? 85.269  141.037 38.522  1.00 32.42 ? 155  THR B OG1   1 
ATOM   3705  C  CG2   . THR B  1 127 ? 85.196  139.083 39.947  1.00 32.71 ? 155  THR B CG2   1 
ATOM   3706  N  N     . GLU B  1 128 ? 82.351  140.258 36.677  1.00 32.77 ? 156  GLU B N     1 
ATOM   3707  C  CA    . GLU B  1 128 ? 81.663  141.043 35.652  1.00 33.11 ? 156  GLU B CA    1 
ATOM   3708  C  C     . GLU B  1 128 ? 82.294  142.437 35.507  1.00 32.78 ? 156  GLU B C     1 
ATOM   3709  O  O     . GLU B  1 128 ? 82.282  143.018 34.418  1.00 32.81 ? 156  GLU B O     1 
ATOM   3710  C  CB    . GLU B  1 128 ? 80.153  141.127 35.946  1.00 33.73 ? 156  GLU B CB    1 
ATOM   3711  C  CG    . GLU B  1 128 ? 79.437  139.757 35.937  1.00 35.29 ? 156  GLU B CG    1 
ATOM   3712  C  CD    . GLU B  1 128 ? 79.556  139.012 34.601  1.00 37.44 ? 156  GLU B CD    1 
ATOM   3713  O  OE1   . GLU B  1 128 ? 78.976  139.495 33.602  1.00 38.76 ? 156  GLU B OE1   1 
ATOM   3714  O  OE2   . GLU B  1 128 ? 80.225  137.944 34.547  1.00 39.30 ? 156  GLU B OE2   1 
ATOM   3715  N  N     . GLU B  1 129 ? 82.861  142.954 36.598  1.00 32.32 ? 157  GLU B N     1 
ATOM   3716  C  CA    . GLU B  1 129 ? 83.563  144.240 36.576  1.00 31.81 ? 157  GLU B CA    1 
ATOM   3717  C  C     . GLU B  1 129 ? 84.914  144.117 35.876  1.00 31.20 ? 157  GLU B C     1 
ATOM   3718  O  O     . GLU B  1 129 ? 85.292  145.000 35.107  1.00 31.29 ? 157  GLU B O     1 
ATOM   3719  C  CB    . GLU B  1 129 ? 83.764  144.783 37.994  1.00 31.85 ? 157  GLU B CB    1 
ATOM   3720  N  N     . GLN B  1 130 ? 85.643  143.036 36.156  1.00 30.52 ? 158  GLN B N     1 
ATOM   3721  C  CA    . GLN B  1 130 ? 86.927  142.765 35.480  1.00 29.94 ? 158  GLN B CA    1 
ATOM   3722  C  C     . GLN B  1 130 ? 86.728  142.613 33.971  1.00 29.53 ? 158  GLN B C     1 
ATOM   3723  O  O     . GLN B  1 130 ? 87.502  143.155 33.179  1.00 29.69 ? 158  GLN B O     1 
ATOM   3724  C  CB    . GLN B  1 130 ? 87.604  141.516 36.057  1.00 29.80 ? 158  GLN B CB    1 
ATOM   3725  C  CG    . GLN B  1 130 ? 88.254  141.736 37.414  1.00 29.89 ? 158  GLN B CG    1 
ATOM   3726  C  CD    . GLN B  1 130 ? 88.789  140.460 38.040  1.00 29.66 ? 158  GLN B CD    1 
ATOM   3727  O  OE1   . GLN B  1 130 ? 88.410  139.355 37.655  1.00 29.48 ? 158  GLN B OE1   1 
ATOM   3728  N  NE2   . GLN B  1 130 ? 89.672  140.610 39.024  1.00 28.84 ? 158  GLN B NE2   1 
ATOM   3729  N  N     . LYS B  1 131 ? 85.688  141.878 33.583  1.00 29.04 ? 159  LYS B N     1 
ATOM   3730  C  CA    . LYS B  1 131 ? 85.314  141.742 32.176  1.00 29.01 ? 159  LYS B CA    1 
ATOM   3731  C  C     . LYS B  1 131 ? 84.966  143.086 31.550  1.00 28.50 ? 159  LYS B C     1 
ATOM   3732  O  O     . LYS B  1 131 ? 85.432  143.393 30.460  1.00 28.14 ? 159  LYS B O     1 
ATOM   3733  C  CB    . LYS B  1 131 ? 84.108  140.821 32.015  1.00 29.21 ? 159  LYS B CB    1 
ATOM   3734  C  CG    . LYS B  1 131 ? 84.367  139.348 32.237  1.00 30.43 ? 159  LYS B CG    1 
ATOM   3735  C  CD    . LYS B  1 131 ? 83.086  138.583 31.951  1.00 32.49 ? 159  LYS B CD    1 
ATOM   3736  C  CE    . LYS B  1 131 ? 83.152  137.132 32.353  1.00 33.53 ? 159  LYS B CE    1 
ATOM   3737  N  NZ    . LYS B  1 131 ? 81.838  136.696 32.930  1.00 34.47 ? 159  LYS B NZ    1 
ATOM   3738  N  N     . ALA B  1 132 ? 84.132  143.869 32.240  1.00 28.04 ? 160  ALA B N     1 
ATOM   3739  C  CA    . ALA B  1 132 ? 83.701  145.195 31.766  1.00 27.73 ? 160  ALA B CA    1 
ATOM   3740  C  C     . ALA B  1 132 ? 84.871  146.172 31.610  1.00 27.57 ? 160  ALA B C     1 
ATOM   3741  O  O     . ALA B  1 132 ? 84.861  147.027 30.726  1.00 27.06 ? 160  ALA B O     1 
ATOM   3742  C  CB    . ALA B  1 132 ? 82.643  145.790 32.719  1.00 27.65 ? 160  ALA B CB    1 
ATOM   3743  N  N     . THR B  1 133 ? 85.869  146.041 32.482  1.00 27.67 ? 161  THR B N     1 
ATOM   3744  C  CA    . THR B  1 133 ? 87.079  146.857 32.417  1.00 27.83 ? 161  THR B CA    1 
ATOM   3745  C  C     . THR B  1 133 ? 88.008  146.424 31.282  1.00 27.65 ? 161  THR B C     1 
ATOM   3746  O  O     . THR B  1 133 ? 88.335  147.225 30.401  1.00 27.42 ? 161  THR B O     1 
ATOM   3747  C  CB    . THR B  1 133 ? 87.875  146.763 33.729  1.00 27.90 ? 161  THR B CB    1 
ATOM   3748  O  OG1   . THR B  1 133 ? 87.050  147.185 34.819  1.00 28.18 ? 161  THR B OG1   1 
ATOM   3749  C  CG2   . THR B  1 133 ? 89.127  147.629 33.664  1.00 28.42 ? 161  THR B CG2   1 
ATOM   3750  N  N     . TYR B  1 134 ? 88.431  145.161 31.317  1.00 27.75 ? 162  TYR B N     1 
ATOM   3751  C  CA    . TYR B  1 134 ? 89.524  144.677 30.450  1.00 27.93 ? 162  TYR B CA    1 
ATOM   3752  C  C     . TYR B  1 134 ? 89.105  144.193 29.063  1.00 27.35 ? 162  TYR B C     1 
ATOM   3753  O  O     . TYR B  1 134 ? 89.833  144.426 28.094  1.00 26.79 ? 162  TYR B O     1 
ATOM   3754  C  CB    . TYR B  1 134 ? 90.368  143.597 31.159  1.00 28.38 ? 162  TYR B CB    1 
ATOM   3755  C  CG    . TYR B  1 134 ? 91.195  144.168 32.293  1.00 29.35 ? 162  TYR B CG    1 
ATOM   3756  C  CD1   . TYR B  1 134 ? 92.275  145.003 32.032  1.00 30.14 ? 162  TYR B CD1   1 
ATOM   3757  C  CD2   . TYR B  1 134 ? 90.870  143.913 33.628  1.00 30.21 ? 162  TYR B CD2   1 
ATOM   3758  C  CE1   . TYR B  1 134 ? 93.026  145.556 33.063  1.00 30.69 ? 162  TYR B CE1   1 
ATOM   3759  C  CE2   . TYR B  1 134 ? 91.620  144.464 34.674  1.00 30.18 ? 162  TYR B CE2   1 
ATOM   3760  C  CZ    . TYR B  1 134 ? 92.696  145.285 34.382  1.00 30.28 ? 162  TYR B CZ    1 
ATOM   3761  O  OH    . TYR B  1 134 ? 93.446  145.845 35.398  1.00 30.15 ? 162  TYR B OH    1 
ATOM   3762  N  N     . LEU B  1 135 ? 87.959  143.524 28.941  1.00 26.77 ? 163  LEU B N     1 
ATOM   3763  C  CA    . LEU B  1 135 ? 87.623  142.923 27.642  1.00 26.60 ? 163  LEU B CA    1 
ATOM   3764  C  C     . LEU B  1 135 ? 87.428  143.956 26.520  1.00 26.58 ? 163  LEU B C     1 
ATOM   3765  O  O     . LEU B  1 135 ? 87.884  143.718 25.409  1.00 26.93 ? 163  LEU B O     1 
ATOM   3766  C  CB    . LEU B  1 135 ? 86.444  141.942 27.730  1.00 26.17 ? 163  LEU B CB    1 
ATOM   3767  C  CG    . LEU B  1 135 ? 86.735  140.598 28.414  1.00 25.20 ? 163  LEU B CG    1 
ATOM   3768  C  CD1   . LEU B  1 135 ? 85.435  139.831 28.605  1.00 22.96 ? 163  LEU B CD1   1 
ATOM   3769  C  CD2   . LEU B  1 135 ? 87.768  139.746 27.656  1.00 24.13 ? 163  LEU B CD2   1 
ATOM   3770  N  N     . PRO B  1 136 ? 86.750  145.089 26.795  1.00 27.09 ? 164  PRO B N     1 
ATOM   3771  C  CA    . PRO B  1 136 ? 86.685  146.170 25.794  1.00 27.25 ? 164  PRO B CA    1 
ATOM   3772  C  C     . PRO B  1 136 ? 88.045  146.697 25.337  1.00 27.55 ? 164  PRO B C     1 
ATOM   3773  O  O     . PRO B  1 136 ? 88.179  147.090 24.176  1.00 27.78 ? 164  PRO B O     1 
ATOM   3774  C  CB    . PRO B  1 136 ? 85.895  147.269 26.513  1.00 27.21 ? 164  PRO B CB    1 
ATOM   3775  C  CG    . PRO B  1 136 ? 85.064  146.539 27.500  1.00 27.12 ? 164  PRO B CG    1 
ATOM   3776  C  CD    . PRO B  1 136 ? 85.944  145.418 27.985  1.00 26.85 ? 164  PRO B CD    1 
ATOM   3777  N  N     . GLN B  1 137 ? 89.029  146.720 26.238  1.00 27.61 ? 165  GLN B N     1 
ATOM   3778  C  CA    . GLN B  1 137 ? 90.390  147.153 25.899  1.00 27.52 ? 165  GLN B CA    1 
ATOM   3779  C  C     . GLN B  1 137 ? 91.091  146.067 25.080  1.00 27.68 ? 165  GLN B C     1 
ATOM   3780  O  O     . GLN B  1 137 ? 91.704  146.336 24.046  1.00 27.43 ? 165  GLN B O     1 
ATOM   3781  C  CB    . GLN B  1 137 ? 91.207  147.445 27.169  1.00 27.40 ? 165  GLN B CB    1 
ATOM   3782  C  CG    . GLN B  1 137 ? 90.648  148.556 28.084  1.00 27.63 ? 165  GLN B CG    1 
ATOM   3783  C  CD    . GLN B  1 137 ? 91.398  148.674 29.414  1.00 27.60 ? 165  GLN B CD    1 
ATOM   3784  O  OE1   . GLN B  1 137 ? 92.203  147.812 29.778  1.00 28.18 ? 165  GLN B OE1   1 
ATOM   3785  N  NE2   . GLN B  1 137 ? 91.129  149.741 30.143  1.00 27.68 ? 165  GLN B NE2   1 
ATOM   3786  N  N     . LEU B  1 138 ? 90.987  144.828 25.546  1.00 27.76 ? 166  LEU B N     1 
ATOM   3787  C  CA    . LEU B  1 138 ? 91.652  143.710 24.888  1.00 27.93 ? 166  LEU B CA    1 
ATOM   3788  C  C     . LEU B  1 138 ? 91.133  143.443 23.476  1.00 27.86 ? 166  LEU B C     1 
ATOM   3789  O  O     . LEU B  1 138 ? 91.858  142.874 22.662  1.00 27.57 ? 166  LEU B O     1 
ATOM   3790  C  CB    . LEU B  1 138 ? 91.545  142.442 25.737  1.00 28.04 ? 166  LEU B CB    1 
ATOM   3791  C  CG    . LEU B  1 138 ? 92.351  142.445 27.039  1.00 28.86 ? 166  LEU B CG    1 
ATOM   3792  C  CD1   . LEU B  1 138 ? 91.945  141.257 27.909  1.00 28.85 ? 166  LEU B CD1   1 
ATOM   3793  C  CD2   . LEU B  1 138 ? 93.861  142.425 26.743  1.00 27.86 ? 166  LEU B CD2   1 
ATOM   3794  N  N     . THR B  1 139 ? 89.894  143.846 23.185  1.00 27.81 ? 167  THR B N     1 
ATOM   3795  C  CA    . THR B  1 139 ? 89.334  143.692 21.836  1.00 28.07 ? 167  THR B CA    1 
ATOM   3796  C  C     . THR B  1 139 ? 89.647  144.872 20.896  1.00 28.19 ? 167  THR B C     1 
ATOM   3797  O  O     . THR B  1 139 ? 89.463  144.754 19.686  1.00 28.34 ? 167  THR B O     1 
ATOM   3798  C  CB    . THR B  1 139 ? 87.797  143.478 21.865  1.00 27.81 ? 167  THR B CB    1 
ATOM   3799  O  OG1   . THR B  1 139 ? 87.144  144.641 22.400  1.00 28.75 ? 167  THR B OG1   1 
ATOM   3800  C  CG2   . THR B  1 139 ? 87.439  142.255 22.694  1.00 27.50 ? 167  THR B CG2   1 
ATOM   3801  N  N     . THR B  1 140 ? 90.146  145.984 21.435  1.00 28.34 ? 168  THR B N     1 
ATOM   3802  C  CA    . THR B  1 140 ? 90.246  147.238 20.668  1.00 28.62 ? 168  THR B CA    1 
ATOM   3803  C  C     . THR B  1 140 ? 91.678  147.790 20.532  1.00 28.74 ? 168  THR B C     1 
ATOM   3804  O  O     . THR B  1 140 ? 92.071  148.222 19.445  1.00 29.07 ? 168  THR B O     1 
ATOM   3805  C  CB    A THR B  1 140 ? 89.335  148.338 21.256  0.50 28.58 ? 168  THR B CB    1 
ATOM   3806  C  CB    B THR B  1 140 ? 89.319  148.318 21.279  0.50 28.67 ? 168  THR B CB    1 
ATOM   3807  O  OG1   A THR B  1 140 ? 89.544  148.435 22.669  0.50 27.95 ? 168  THR B OG1   1 
ATOM   3808  O  OG1   B THR B  1 140 ? 87.986  147.800 21.370  0.50 29.34 ? 168  THR B OG1   1 
ATOM   3809  C  CG2   A THR B  1 140 ? 87.870  148.027 20.976  0.50 28.90 ? 168  THR B CG2   1 
ATOM   3810  C  CG2   B THR B  1 140 ? 89.305  149.590 20.431  0.50 28.69 ? 168  THR B CG2   1 
ATOM   3811  N  N     . GLU B  1 141 ? 92.461  147.780 21.608  1.00 28.92 ? 169  GLU B N     1 
ATOM   3812  C  CA    . GLU B  1 141 ? 93.800  148.386 21.552  1.00 29.03 ? 169  GLU B CA    1 
ATOM   3813  C  C     . GLU B  1 141 ? 94.873  147.787 22.468  1.00 28.42 ? 169  GLU B C     1 
ATOM   3814  O  O     . GLU B  1 141 ? 96.058  147.901 22.160  1.00 28.85 ? 169  GLU B O     1 
ATOM   3815  C  CB    . GLU B  1 141 ? 93.710  149.900 21.799  1.00 29.46 ? 169  GLU B CB    1 
ATOM   3816  C  CG    . GLU B  1 141 ? 93.400  150.316 23.253  1.00 31.39 ? 169  GLU B CG    1 
ATOM   3817  C  CD    . GLU B  1 141 ? 92.016  150.911 23.442  1.00 34.79 ? 169  GLU B CD    1 
ATOM   3818  O  OE1   . GLU B  1 141 ? 91.792  152.073 23.013  1.00 37.22 ? 169  GLU B OE1   1 
ATOM   3819  O  OE2   . GLU B  1 141 ? 91.158  150.238 24.058  1.00 37.10 ? 169  GLU B OE2   1 
ATOM   3820  N  N     . LYS B  1 142 ? 94.478  147.161 23.574  1.00 27.55 ? 170  LYS B N     1 
ATOM   3821  C  CA    . LYS B  1 142 ? 95.435  146.704 24.582  1.00 26.98 ? 170  LYS B CA    1 
ATOM   3822  C  C     . LYS B  1 142 ? 95.895  145.260 24.359  1.00 26.21 ? 170  LYS B C     1 
ATOM   3823  O  O     . LYS B  1 142 ? 95.082  144.348 24.270  1.00 25.59 ? 170  LYS B O     1 
ATOM   3824  C  CB    . LYS B  1 142 ? 94.832  146.850 25.984  1.00 27.01 ? 170  LYS B CB    1 
ATOM   3825  C  CG    . LYS B  1 142 ? 95.818  146.565 27.112  1.00 27.22 ? 170  LYS B CG    1 
ATOM   3826  C  CD    . LYS B  1 142 ? 95.237  146.914 28.471  1.00 26.68 ? 170  LYS B CD    1 
ATOM   3827  C  CE    . LYS B  1 142 ? 95.329  148.403 28.781  1.00 26.48 ? 170  LYS B CE    1 
ATOM   3828  N  NZ    . LYS B  1 142 ? 94.740  148.700 30.113  1.00 25.41 ? 170  LYS B NZ    1 
ATOM   3829  N  N     . VAL B  1 143 ? 97.210  145.077 24.296  1.00 25.80 ? 171  VAL B N     1 
ATOM   3830  C  CA    . VAL B  1 143 ? 97.827  143.766 24.154  1.00 25.22 ? 171  VAL B CA    1 
ATOM   3831  C  C     . VAL B  1 143 ? 98.078  143.148 25.536  1.00 25.43 ? 171  VAL B C     1 
ATOM   3832  O  O     . VAL B  1 143 ? 98.483  143.838 26.463  1.00 26.25 ? 171  VAL B O     1 
ATOM   3833  C  CB    . VAL B  1 143 ? 99.151  143.874 23.334  1.00 25.40 ? 171  VAL B CB    1 
ATOM   3834  C  CG1   . VAL B  1 143 ? 99.947  142.560 23.348  1.00 23.57 ? 171  VAL B CG1   1 
ATOM   3835  C  CG2   . VAL B  1 143 ? 98.852  144.324 21.904  1.00 25.00 ? 171  VAL B CG2   1 
ATOM   3836  N  N     . GLY B  1 144 ? 97.825  141.847 25.668  1.00 25.38 ? 172  GLY B N     1 
ATOM   3837  C  CA    . GLY B  1 144 ? 98.075  141.117 26.911  1.00 25.14 ? 172  GLY B CA    1 
ATOM   3838  C  C     . GLY B  1 144 ? 99.243  140.155 26.800  1.00 24.89 ? 172  GLY B C     1 
ATOM   3839  O  O     . GLY B  1 144 ? 99.473  139.576 25.742  1.00 25.26 ? 172  GLY B O     1 
ATOM   3840  N  N     . SER B  1 145 ? 99.998  139.999 27.885  1.00 25.08 ? 173  SER B N     1 
ATOM   3841  C  CA    . SER B  1 145 ? 101.050 138.976 27.972  1.00 25.30 ? 173  SER B CA    1 
ATOM   3842  C  C     . SER B  1 145 ? 100.708 137.987 29.081  1.00 25.74 ? 173  SER B C     1 
ATOM   3843  O  O     . SER B  1 145 ? 100.214 138.378 30.153  1.00 25.47 ? 173  SER B O     1 
ATOM   3844  C  CB    . SER B  1 145 ? 102.418 139.594 28.276  1.00 25.33 ? 173  SER B CB    1 
ATOM   3845  O  OG    . SER B  1 145 ? 102.991 140.234 27.151  1.00 25.46 ? 173  SER B OG    1 
ATOM   3846  N  N     . PHE B  1 146 ? 101.006 136.723 28.803  1.00 25.90 ? 174  PHE B N     1 
ATOM   3847  C  CA    . PHE B  1 146 ? 100.816 135.594 29.697  1.00 26.54 ? 174  PHE B CA    1 
ATOM   3848  C  C     . PHE B  1 146 ? 102.175 135.314 30.351  1.00 26.47 ? 174  PHE B C     1 
ATOM   3849  O  O     . PHE B  1 146 ? 103.149 135.056 29.650  1.00 26.26 ? 174  PHE B O     1 
ATOM   3850  C  CB    . PHE B  1 146 ? 100.331 134.398 28.865  1.00 26.96 ? 174  PHE B CB    1 
ATOM   3851  C  CG    . PHE B  1 146 ? 100.079 133.136 29.660  1.00 28.16 ? 174  PHE B CG    1 
ATOM   3852  C  CD1   . PHE B  1 146 ? 98.834  132.890 30.226  1.00 29.33 ? 174  PHE B CD1   1 
ATOM   3853  C  CD2   . PHE B  1 146 ? 101.077 132.169 29.798  1.00 28.66 ? 174  PHE B CD2   1 
ATOM   3854  C  CE1   . PHE B  1 146 ? 98.589  131.718 30.943  1.00 28.75 ? 174  PHE B CE1   1 
ATOM   3855  C  CE2   . PHE B  1 146 ? 100.842 131.008 30.527  1.00 30.00 ? 174  PHE B CE2   1 
ATOM   3856  C  CZ    . PHE B  1 146 ? 99.592  130.786 31.103  1.00 28.46 ? 174  PHE B CZ    1 
ATOM   3857  N  N     . CYS B  1 147 ? 102.239 135.396 31.686  1.00 26.41 ? 175  CYS B N     1 
ATOM   3858  C  CA    . CYS B  1 147 ? 103.504 135.361 32.433  1.00 26.52 ? 175  CYS B CA    1 
ATOM   3859  C  C     . CYS B  1 147 ? 103.598 134.206 33.438  1.00 26.58 ? 175  CYS B C     1 
ATOM   3860  O  O     . CYS B  1 147 ? 103.260 134.355 34.617  1.00 26.59 ? 175  CYS B O     1 
ATOM   3861  C  CB    . CYS B  1 147 ? 103.729 136.688 33.173  1.00 26.45 ? 175  CYS B CB    1 
ATOM   3862  S  SG    . CYS B  1 147 ? 103.529 138.158 32.147  1.00 27.62 ? 175  CYS B SG    1 
ATOM   3863  N  N     . LEU B  1 148 ? 104.086 133.071 32.960  1.00 26.87 ? 176  LEU B N     1 
ATOM   3864  C  CA    . LEU B  1 148 ? 104.261 131.878 33.788  1.00 27.35 ? 176  LEU B CA    1 
ATOM   3865  C  C     . LEU B  1 148 ? 105.743 131.554 34.047  1.00 27.40 ? 176  LEU B C     1 
ATOM   3866  O  O     . LEU B  1 148 ? 106.190 131.490 35.208  1.00 28.37 ? 176  LEU B O     1 
ATOM   3867  C  CB    . LEU B  1 148 ? 103.582 130.689 33.108  1.00 27.15 ? 176  LEU B CB    1 
ATOM   3868  C  CG    . LEU B  1 148 ? 103.592 129.356 33.854  1.00 27.41 ? 176  LEU B CG    1 
ATOM   3869  C  CD1   . LEU B  1 148 ? 102.904 129.472 35.209  1.00 26.43 ? 176  LEU B CD1   1 
ATOM   3870  C  CD2   . LEU B  1 148 ? 102.920 128.302 32.993  1.00 27.76 ? 176  LEU B CD2   1 
ATOM   3871  N  N     . SER B  1 149 ? 106.489 131.363 32.961  1.00 27.38 ? 177  SER B N     1 
ATOM   3872  C  CA    . SER B  1 149 ? 107.845 130.800 32.998  1.00 27.25 ? 177  SER B CA    1 
ATOM   3873  C  C     . SER B  1 149 ? 108.895 131.685 33.660  1.00 27.11 ? 177  SER B C     1 
ATOM   3874  O  O     . SER B  1 149 ? 108.799 132.913 33.648  1.00 27.12 ? 177  SER B O     1 
ATOM   3875  C  CB    . SER B  1 149 ? 108.318 130.461 31.570  1.00 27.32 ? 177  SER B CB    1 
ATOM   3876  O  OG    . SER B  1 149 ? 107.384 129.631 30.905  1.00 28.45 ? 177  SER B OG    1 
ATOM   3877  N  N     . GLU B  1 150 ? 109.902 131.028 34.231  1.00 26.99 ? 178  GLU B N     1 
ATOM   3878  C  CA    . GLU B  1 150 ? 111.044 131.684 34.864  1.00 26.82 ? 178  GLU B CA    1 
ATOM   3879  C  C     . GLU B  1 150 ? 112.318 130.934 34.463  1.00 26.98 ? 178  GLU B C     1 
ATOM   3880  O  O     . GLU B  1 150 ? 112.244 129.837 33.899  1.00 26.33 ? 178  GLU B O     1 
ATOM   3881  C  CB    . GLU B  1 150 ? 110.883 131.665 36.378  1.00 26.73 ? 178  GLU B CB    1 
ATOM   3882  C  CG    . GLU B  1 150 ? 109.503 132.127 36.833  1.00 26.94 ? 178  GLU B CG    1 
ATOM   3883  C  CD    . GLU B  1 150 ? 109.412 132.397 38.311  1.00 26.60 ? 178  GLU B CD    1 
ATOM   3884  O  OE1   . GLU B  1 150 ? 110.394 132.112 39.037  1.00 26.46 ? 178  GLU B OE1   1 
ATOM   3885  O  OE2   . GLU B  1 150 ? 108.352 132.901 38.745  1.00 27.92 ? 178  GLU B OE2   1 
ATOM   3886  N  N     . ALA B  1 151 ? 113.471 131.536 34.749  1.00 27.24 ? 179  ALA B N     1 
ATOM   3887  C  CA    . ALA B  1 151 ? 114.769 130.888 34.528  1.00 27.70 ? 179  ALA B CA    1 
ATOM   3888  C  C     . ALA B  1 151 ? 114.833 129.493 35.168  1.00 27.73 ? 179  ALA B C     1 
ATOM   3889  O  O     . ALA B  1 151 ? 115.337 128.551 34.550  1.00 27.60 ? 179  ALA B O     1 
ATOM   3890  C  CB    . ALA B  1 151 ? 115.913 131.764 35.055  1.00 27.33 ? 179  ALA B CB    1 
ATOM   3891  N  N     . GLY B  1 152 ? 114.320 129.382 36.391  1.00 27.72 ? 180  GLY B N     1 
ATOM   3892  C  CA    . GLY B  1 152 ? 114.311 128.123 37.150  1.00 28.04 ? 180  GLY B CA    1 
ATOM   3893  C  C     . GLY B  1 152 ? 113.039 127.289 36.989  1.00 27.84 ? 180  GLY B C     1 
ATOM   3894  O  O     . GLY B  1 152 ? 112.898 126.250 37.635  1.00 27.78 ? 180  GLY B O     1 
ATOM   3895  N  N     . ALA B  1 153 ? 112.116 127.738 36.133  1.00 27.74 ? 181  ALA B N     1 
ATOM   3896  C  CA    . ALA B  1 153 ? 110.809 127.086 35.974  1.00 27.49 ? 181  ALA B CA    1 
ATOM   3897  C  C     . ALA B  1 153 ? 110.296 127.207 34.538  1.00 27.44 ? 181  ALA B C     1 
ATOM   3898  O  O     . ALA B  1 153 ? 109.509 128.092 34.219  1.00 27.62 ? 181  ALA B O     1 
ATOM   3899  C  CB    . ALA B  1 153 ? 109.783 127.678 36.979  1.00 27.14 ? 181  ALA B CB    1 
ATOM   3900  N  N     . GLY B  1 154 ? 110.761 126.315 33.665  1.00 27.32 ? 182  GLY B N     1 
ATOM   3901  C  CA    . GLY B  1 154 ? 110.273 126.251 32.290  1.00 26.97 ? 182  GLY B CA    1 
ATOM   3902  C  C     . GLY B  1 154 ? 109.288 125.115 32.147  1.00 27.00 ? 182  GLY B C     1 
ATOM   3903  O  O     . GLY B  1 154 ? 108.078 125.304 32.300  1.00 26.34 ? 182  GLY B O     1 
ATOM   3904  N  N     . SER B  1 155 ? 109.811 123.918 31.883  1.00 26.85 ? 183  SER B N     1 
ATOM   3905  C  CA    . SER B  1 155 ? 108.968 122.716 31.838  1.00 26.87 ? 183  SER B CA    1 
ATOM   3906  C  C     . SER B  1 155 ? 108.322 122.506 33.209  1.00 26.75 ? 183  SER B C     1 
ATOM   3907  O  O     . SER B  1 155 ? 107.153 122.169 33.294  1.00 27.11 ? 183  SER B O     1 
ATOM   3908  C  CB    . SER B  1 155 ? 109.780 121.481 31.438  1.00 26.48 ? 183  SER B CB    1 
ATOM   3909  O  OG    . SER B  1 155 ? 110.290 121.624 30.123  1.00 27.50 ? 183  SER B OG    1 
ATOM   3910  N  N     . ASP B  1 156 ? 109.097 122.741 34.263  1.00 26.62 ? 184  ASP B N     1 
ATOM   3911  C  CA    . ASP B  1 156 ? 108.621 122.693 35.645  1.00 27.09 ? 184  ASP B CA    1 
ATOM   3912  C  C     . ASP B  1 156 ? 108.062 124.078 36.052  1.00 26.96 ? 184  ASP B C     1 
ATOM   3913  O  O     . ASP B  1 156 ? 108.585 124.736 36.951  1.00 26.79 ? 184  ASP B O     1 
ATOM   3914  C  CB    . ASP B  1 156 ? 109.767 122.248 36.552  1.00 26.82 ? 184  ASP B CB    1 
ATOM   3915  C  CG    . ASP B  1 156 ? 109.329 121.946 37.973  1.00 27.50 ? 184  ASP B CG    1 
ATOM   3916  O  OD1   . ASP B  1 156 ? 108.114 121.983 38.266  1.00 29.37 ? 184  ASP B OD1   1 
ATOM   3917  O  OD2   . ASP B  1 156 ? 110.228 121.691 38.804  1.00 25.40 ? 184  ASP B OD2   1 
ATOM   3918  N  N     . SER B  1 157 ? 106.992 124.485 35.373  1.00 27.25 ? 185  SER B N     1 
ATOM   3919  C  CA    . SER B  1 157 ? 106.322 125.782 35.592  1.00 28.19 ? 185  SER B CA    1 
ATOM   3920  C  C     . SER B  1 157 ? 105.954 126.034 37.045  1.00 28.25 ? 185  SER B C     1 
ATOM   3921  O  O     . SER B  1 157 ? 106.115 127.153 37.569  1.00 28.57 ? 185  SER B O     1 
ATOM   3922  C  CB    . SER B  1 157 ? 105.024 125.834 34.776  1.00 28.13 ? 185  SER B CB    1 
ATOM   3923  O  OG    . SER B  1 157 ? 105.285 125.791 33.401  1.00 30.06 ? 185  SER B OG    1 
ATOM   3924  N  N     . PHE B  1 158 ? 105.445 124.992 37.700  1.00 28.54 ? 186  PHE B N     1 
ATOM   3925  C  CA    . PHE B  1 158 ? 104.915 125.137 39.043  1.00 28.83 ? 186  PHE B CA    1 
ATOM   3926  C  C     . PHE B  1 158 ? 106.005 125.245 40.104  1.00 28.84 ? 186  PHE B C     1 
ATOM   3927  O  O     . PHE B  1 158 ? 105.687 125.424 41.284  1.00 28.01 ? 186  PHE B O     1 
ATOM   3928  C  CB    . PHE B  1 158 ? 103.948 123.995 39.387  1.00 29.44 ? 186  PHE B CB    1 
ATOM   3929  C  CG    . PHE B  1 158 ? 102.727 123.915 38.492  1.00 29.81 ? 186  PHE B CG    1 
ATOM   3930  C  CD1   . PHE B  1 158 ? 102.315 124.995 37.703  1.00 30.18 ? 186  PHE B CD1   1 
ATOM   3931  C  CD2   . PHE B  1 158 ? 101.960 122.755 38.474  1.00 31.04 ? 186  PHE B CD2   1 
ATOM   3932  C  CE1   . PHE B  1 158 ? 101.186 124.899 36.891  1.00 30.21 ? 186  PHE B CE1   1 
ATOM   3933  C  CE2   . PHE B  1 158 ? 100.819 122.663 37.676  1.00 30.43 ? 186  PHE B CE2   1 
ATOM   3934  C  CZ    . PHE B  1 158 ? 100.437 123.737 36.881  1.00 30.73 ? 186  PHE B CZ    1 
ATOM   3935  N  N     . ALA B  1 159 ? 107.275 125.157 39.690  1.00 28.59 ? 187  ALA B N     1 
ATOM   3936  C  CA    . ALA B  1 159 ? 108.405 125.495 40.580  1.00 28.72 ? 187  ALA B CA    1 
ATOM   3937  C  C     . ALA B  1 159 ? 108.734 126.994 40.531  1.00 28.60 ? 187  ALA B C     1 
ATOM   3938  O  O     . ALA B  1 159 ? 109.784 127.429 41.041  1.00 28.89 ? 187  ALA B O     1 
ATOM   3939  C  CB    . ALA B  1 159 ? 109.641 124.677 40.220  1.00 28.35 ? 187  ALA B CB    1 
ATOM   3940  N  N     . LEU B  1 160 ? 107.851 127.783 39.923  1.00 28.33 ? 188  LEU B N     1 
ATOM   3941  C  CA    . LEU B  1 160 ? 108.031 129.235 39.856  1.00 28.01 ? 188  LEU B CA    1 
ATOM   3942  C  C     . LEU B  1 160 ? 108.196 129.846 41.251  1.00 28.11 ? 188  LEU B C     1 
ATOM   3943  O  O     . LEU B  1 160 ? 107.526 129.445 42.207  1.00 27.36 ? 188  LEU B O     1 
ATOM   3944  C  CB    . LEU B  1 160 ? 106.872 129.895 39.101  1.00 27.89 ? 188  LEU B CB    1 
ATOM   3945  C  CG    . LEU B  1 160 ? 105.473 129.835 39.715  1.00 27.23 ? 188  LEU B CG    1 
ATOM   3946  C  CD1   . LEU B  1 160 ? 105.238 131.042 40.632  1.00 25.44 ? 188  LEU B CD1   1 
ATOM   3947  C  CD2   . LEU B  1 160 ? 104.449 129.779 38.600  1.00 24.23 ? 188  LEU B CD2   1 
ATOM   3948  N  N     . LYS B  1 161 ? 109.119 130.801 41.349  1.00 28.39 ? 189  LYS B N     1 
ATOM   3949  C  CA    . LYS B  1 161 ? 109.514 131.387 42.622  1.00 29.26 ? 189  LYS B CA    1 
ATOM   3950  C  C     . LYS B  1 161 ? 109.001 132.809 42.827  1.00 28.47 ? 189  LYS B C     1 
ATOM   3951  O  O     . LYS B  1 161 ? 109.187 133.364 43.913  1.00 28.91 ? 189  LYS B O     1 
ATOM   3952  C  CB    . LYS B  1 161 ? 111.047 131.337 42.763  1.00 30.03 ? 189  LYS B CB    1 
ATOM   3953  C  CG    . LYS B  1 161 ? 111.620 129.911 42.859  1.00 32.11 ? 189  LYS B CG    1 
ATOM   3954  C  CD    . LYS B  1 161 ? 111.153 129.174 44.141  1.00 34.82 ? 189  LYS B CD    1 
ATOM   3955  C  CE    . LYS B  1 161 ? 111.713 127.728 44.242  1.00 35.96 ? 189  LYS B CE    1 
ATOM   3956  N  NZ    . LYS B  1 161 ? 110.906 126.680 43.521  1.00 36.82 ? 189  LYS B NZ    1 
ATOM   3957  N  N     . THR B  1 162 ? 108.368 133.404 41.810  1.00 27.71 ? 190  THR B N     1 
ATOM   3958  C  CA    . THR B  1 162 ? 107.721 134.709 41.988  1.00 27.04 ? 190  THR B CA    1 
ATOM   3959  C  C     . THR B  1 162 ? 106.645 134.569 43.069  1.00 26.99 ? 190  THR B C     1 
ATOM   3960  O  O     . THR B  1 162 ? 105.745 133.726 42.962  1.00 26.28 ? 190  THR B O     1 
ATOM   3961  C  CB    . THR B  1 162 ? 107.091 135.276 40.683  1.00 26.92 ? 190  THR B CB    1 
ATOM   3962  O  OG1   . THR B  1 162 ? 108.121 135.559 39.725  1.00 26.28 ? 190  THR B OG1   1 
ATOM   3963  C  CG2   . THR B  1 162 ? 106.308 136.579 40.975  1.00 26.56 ? 190  THR B CG2   1 
ATOM   3964  N  N     . ARG B  1 163 ? 106.765 135.393 44.110  1.00 26.99 ? 191  ARG B N     1 
ATOM   3965  C  CA    . ARG B  1 163 ? 105.929 135.283 45.301  1.00 27.36 ? 191  ARG B CA    1 
ATOM   3966  C  C     . ARG B  1 163 ? 104.992 136.481 45.387  1.00 26.87 ? 191  ARG B C     1 
ATOM   3967  O  O     . ARG B  1 163 ? 105.296 137.551 44.857  1.00 26.35 ? 191  ARG B O     1 
ATOM   3968  C  CB    . ARG B  1 163 ? 106.796 135.167 46.571  1.00 27.48 ? 191  ARG B CB    1 
ATOM   3969  C  CG    . ARG B  1 163 ? 107.755 136.329 46.819  1.00 28.33 ? 191  ARG B CG    1 
ATOM   3970  C  CD    . ARG B  1 163 ? 108.521 136.173 48.133  1.00 29.45 ? 191  ARG B CD    1 
ATOM   3971  N  NE    . ARG B  1 163 ? 109.363 137.338 48.426  1.00 31.40 ? 191  ARG B NE    1 
ATOM   3972  C  CZ    . ARG B  1 163 ? 110.537 137.610 47.846  1.00 32.45 ? 191  ARG B CZ    1 
ATOM   3973  N  NH1   . ARG B  1 163 ? 111.050 136.799 46.923  1.00 33.63 ? 191  ARG B NH1   1 
ATOM   3974  N  NH2   . ARG B  1 163 ? 111.210 138.707 48.193  1.00 32.48 ? 191  ARG B NH2   1 
ATOM   3975  N  N     . ALA B  1 164 ? 103.849 136.279 46.036  1.00 26.60 ? 192  ALA B N     1 
ATOM   3976  C  CA    . ALA B  1 164 ? 102.860 137.331 46.249  1.00 26.43 ? 192  ALA B CA    1 
ATOM   3977  C  C     . ALA B  1 164 ? 102.539 137.402 47.738  1.00 26.27 ? 192  ALA B C     1 
ATOM   3978  O  O     . ALA B  1 164 ? 102.047 136.440 48.309  1.00 26.30 ? 192  ALA B O     1 
ATOM   3979  C  CB    . ALA B  1 164 ? 101.599 137.048 45.435  1.00 26.16 ? 192  ALA B CB    1 
ATOM   3980  N  N     . ASP B  1 165 ? 102.846 138.531 48.365  1.00 26.39 ? 193  ASP B N     1 
ATOM   3981  C  CA    . ASP B  1 165 ? 102.527 138.749 49.783  1.00 26.58 ? 193  ASP B CA    1 
ATOM   3982  C  C     . ASP B  1 165 ? 101.336 139.692 49.933  1.00 26.13 ? 193  ASP B C     1 
ATOM   3983  O  O     . ASP B  1 165 ? 101.383 140.819 49.445  1.00 25.98 ? 193  ASP B O     1 
ATOM   3984  C  CB    . ASP B  1 165 ? 103.728 139.350 50.520  1.00 26.91 ? 193  ASP B CB    1 
ATOM   3985  C  CG    . ASP B  1 165 ? 104.960 138.467 50.458  1.00 28.05 ? 193  ASP B CG    1 
ATOM   3986  O  OD1   . ASP B  1 165 ? 104.815 137.228 50.475  1.00 31.92 ? 193  ASP B OD1   1 
ATOM   3987  O  OD2   . ASP B  1 165 ? 106.077 139.017 50.394  1.00 29.46 ? 193  ASP B OD2   1 
ATOM   3988  N  N     . LYS B  1 166 ? 100.285 139.232 50.615  1.00 25.76 ? 194  LYS B N     1 
ATOM   3989  C  CA    . LYS B  1 166 ? 99.138  140.086 50.935  1.00 25.37 ? 194  LYS B CA    1 
ATOM   3990  C  C     . LYS B  1 166 ? 99.523  141.115 51.993  1.00 25.13 ? 194  LYS B C     1 
ATOM   3991  O  O     . LYS B  1 166 ? 100.006 140.748 53.065  1.00 25.14 ? 194  LYS B O     1 
ATOM   3992  C  CB    . LYS B  1 166 ? 97.960  139.256 51.442  1.00 25.21 ? 194  LYS B CB    1 
ATOM   3993  C  CG    . LYS B  1 166 ? 96.634  140.012 51.451  1.00 25.28 ? 194  LYS B CG    1 
ATOM   3994  C  CD    . LYS B  1 166 ? 95.561  139.242 52.201  1.00 25.59 ? 194  LYS B CD    1 
ATOM   3995  C  CE    . LYS B  1 166 ? 94.173  139.843 51.996  1.00 25.42 ? 194  LYS B CE    1 
ATOM   3996  N  NZ    . LYS B  1 166 ? 94.031  141.141 52.684  1.00 25.47 ? 194  LYS B NZ    1 
ATOM   3997  N  N     . GLU B  1 167 ? 99.312  142.395 51.686  1.00 24.78 ? 195  GLU B N     1 
ATOM   3998  C  CA    . GLU B  1 167 ? 99.509  143.481 52.650  1.00 24.58 ? 195  GLU B CA    1 
ATOM   3999  C  C     . GLU B  1 167 ? 98.256  144.355 52.695  1.00 24.55 ? 195  GLU B C     1 
ATOM   4000  O  O     . GLU B  1 167 ? 98.207  145.417 52.065  1.00 24.49 ? 195  GLU B O     1 
ATOM   4001  C  CB    . GLU B  1 167 ? 100.727 144.335 52.273  1.00 24.41 ? 195  GLU B CB    1 
ATOM   4002  C  CG    . GLU B  1 167 ? 101.979 143.553 51.904  1.00 24.59 ? 195  GLU B CG    1 
ATOM   4003  C  CD    . GLU B  1 167 ? 102.637 142.841 53.073  1.00 23.49 ? 195  GLU B CD    1 
ATOM   4004  O  OE1   . GLU B  1 167 ? 102.095 142.854 54.198  1.00 23.35 ? 195  GLU B OE1   1 
ATOM   4005  O  OE2   . GLU B  1 167 ? 103.718 142.262 52.845  1.00 23.80 ? 195  GLU B OE2   1 
ATOM   4006  N  N     . GLY B  1 168 ? 97.246  143.902 53.434  1.00 24.46 ? 196  GLY B N     1 
ATOM   4007  C  CA    . GLY B  1 168 ? 95.941  144.569 53.446  1.00 24.68 ? 196  GLY B CA    1 
ATOM   4008  C  C     . GLY B  1 168 ? 95.238  144.525 52.089  1.00 24.84 ? 196  GLY B C     1 
ATOM   4009  O  O     . GLY B  1 168 ? 94.902  143.448 51.598  1.00 24.65 ? 196  GLY B O     1 
ATOM   4010  N  N     . ASP B  1 169 ? 95.039  145.694 51.471  1.00 25.21 ? 197  ASP B N     1 
ATOM   4011  C  CA    . ASP B  1 169 ? 94.223  145.804 50.248  1.00 25.28 ? 197  ASP B CA    1 
ATOM   4012  C  C     . ASP B  1 169 ? 94.983  145.511 48.937  1.00 24.89 ? 197  ASP B C     1 
ATOM   4013  O  O     . ASP B  1 169 ? 94.486  145.770 47.837  1.00 24.12 ? 197  ASP B O     1 
ATOM   4014  C  CB    . ASP B  1 169 ? 93.487  147.160 50.200  1.00 26.01 ? 197  ASP B CB    1 
ATOM   4015  C  CG    . ASP B  1 169 ? 94.403  148.355 49.856  1.00 28.42 ? 197  ASP B CG    1 
ATOM   4016  O  OD1   . ASP B  1 169 ? 95.722  148.157 49.725  1.00 28.47 ? 197  ASP B OD1   1 
ATOM   4017  O  OD2   . ASP B  1 169 ? 93.739  149.560 49.819  1.00 32.19 ? 197  ASP B OD2   1 
ATOM   4018  N  N     . TYR B  1 170 ? 96.188  144.971 49.052  1.00 24.20 ? 198  TYR B N     1 
ATOM   4019  C  CA    . TYR B  1 170 ? 96.986  144.685 47.876  1.00 24.05 ? 198  TYR B CA    1 
ATOM   4020  C  C     . TYR B  1 170 ? 97.979  143.560 48.128  1.00 23.74 ? 198  TYR B C     1 
ATOM   4021  O  O     . TYR B  1 170 ? 98.194  143.142 49.267  1.00 23.38 ? 198  TYR B O     1 
ATOM   4022  C  CB    . TYR B  1 170 ? 97.707  145.956 47.404  1.00 23.97 ? 198  TYR B CB    1 
ATOM   4023  C  CG    . TYR B  1 170 ? 98.922  146.323 48.225  1.00 24.11 ? 198  TYR B CG    1 
ATOM   4024  C  CD1   . TYR B  1 170 ? 100.189 145.904 47.838  1.00 23.26 ? 198  TYR B CD1   1 
ATOM   4025  C  CD2   . TYR B  1 170 ? 98.808  147.084 49.384  1.00 22.99 ? 198  TYR B CD2   1 
ATOM   4026  C  CE1   . TYR B  1 170 ? 101.308 146.226 48.581  1.00 23.49 ? 198  TYR B CE1   1 
ATOM   4027  C  CE2   . TYR B  1 170 ? 99.929  147.417 50.135  1.00 23.66 ? 198  TYR B CE2   1 
ATOM   4028  C  CZ    . TYR B  1 170 ? 101.185 146.979 49.718  1.00 23.53 ? 198  TYR B CZ    1 
ATOM   4029  O  OH    . TYR B  1 170 ? 102.314 147.290 50.445  1.00 23.95 ? 198  TYR B OH    1 
ATOM   4030  N  N     . TYR B  1 171 ? 98.575  143.093 47.035  1.00 23.72 ? 199  TYR B N     1 
ATOM   4031  C  CA    . TYR B  1 171 ? 99.551  142.013 47.032  1.00 23.68 ? 199  TYR B CA    1 
ATOM   4032  C  C     . TYR B  1 171 ? 100.871 142.526 46.471  1.00 23.75 ? 199  TYR B C     1 
ATOM   4033  O  O     . TYR B  1 171 ? 100.879 143.210 45.448  1.00 23.33 ? 199  TYR B O     1 
ATOM   4034  C  CB    . TYR B  1 171 ? 99.042  140.852 46.164  1.00 23.89 ? 199  TYR B CB    1 
ATOM   4035  C  CG    . TYR B  1 171 ? 98.030  139.979 46.866  1.00 23.71 ? 199  TYR B CG    1 
ATOM   4036  C  CD1   . TYR B  1 171 ? 98.420  138.805 47.494  1.00 23.54 ? 199  TYR B CD1   1 
ATOM   4037  C  CD2   . TYR B  1 171 ? 96.686  140.346 46.928  1.00 24.52 ? 199  TYR B CD2   1 
ATOM   4038  C  CE1   . TYR B  1 171 ? 97.496  138.006 48.153  1.00 25.22 ? 199  TYR B CE1   1 
ATOM   4039  C  CE2   . TYR B  1 171 ? 95.753  139.557 47.590  1.00 24.41 ? 199  TYR B CE2   1 
ATOM   4040  C  CZ    . TYR B  1 171 ? 96.166  138.387 48.198  1.00 24.78 ? 199  TYR B CZ    1 
ATOM   4041  O  OH    . TYR B  1 171 ? 95.252  137.598 48.854  1.00 26.27 ? 199  TYR B OH    1 
ATOM   4042  N  N     . VAL B  1 172 ? 101.978 142.198 47.138  1.00 23.66 ? 200  VAL B N     1 
ATOM   4043  C  CA    . VAL B  1 172 ? 103.311 142.554 46.648  1.00 23.53 ? 200  VAL B CA    1 
ATOM   4044  C  C     . VAL B  1 172 ? 103.883 141.349 45.905  1.00 23.77 ? 200  VAL B C     1 
ATOM   4045  O  O     . VAL B  1 172 ? 103.999 140.267 46.480  1.00 23.92 ? 200  VAL B O     1 
ATOM   4046  C  CB    . VAL B  1 172 ? 104.290 142.945 47.789  1.00 23.38 ? 200  VAL B CB    1 
ATOM   4047  C  CG1   . VAL B  1 172 ? 105.470 143.708 47.217  1.00 23.19 ? 200  VAL B CG1   1 
ATOM   4048  C  CG2   . VAL B  1 172 ? 103.605 143.773 48.854  1.00 23.98 ? 200  VAL B CG2   1 
ATOM   4049  N  N     . LEU B  1 173 ? 104.210 141.538 44.626  1.00 23.50 ? 201  LEU B N     1 
ATOM   4050  C  CA    . LEU B  1 173 ? 104.828 140.503 43.804  1.00 23.58 ? 201  LEU B CA    1 
ATOM   4051  C  C     . LEU B  1 173 ? 106.329 140.738 43.700  1.00 23.54 ? 201  LEU B C     1 
ATOM   4052  O  O     . LEU B  1 173 ? 106.779 141.860 43.426  1.00 22.95 ? 201  LEU B O     1 
ATOM   4053  C  CB    . LEU B  1 173 ? 104.199 140.451 42.404  1.00 23.29 ? 201  LEU B CB    1 
ATOM   4054  C  CG    . LEU B  1 173 ? 102.926 139.611 42.269  1.00 23.33 ? 201  LEU B CG    1 
ATOM   4055  C  CD1   . LEU B  1 173 ? 101.833 140.093 43.221  1.00 23.99 ? 201  LEU B CD1   1 
ATOM   4056  C  CD2   . LEU B  1 173 ? 102.440 139.608 40.814  1.00 24.33 ? 201  LEU B CD2   1 
ATOM   4057  N  N     . ASN B  1 174 ? 107.095 139.672 43.938  1.00 23.63 ? 202  ASN B N     1 
ATOM   4058  C  CA    . ASN B  1 174 ? 108.552 139.726 43.890  1.00 23.85 ? 202  ASN B CA    1 
ATOM   4059  C  C     . ASN B  1 174 ? 109.099 138.510 43.180  1.00 24.31 ? 202  ASN B C     1 
ATOM   4060  O  O     . ASN B  1 174 ? 108.753 137.378 43.514  1.00 24.35 ? 202  ASN B O     1 
ATOM   4061  C  CB    . ASN B  1 174 ? 109.157 139.821 45.296  1.00 23.89 ? 202  ASN B CB    1 
ATOM   4062  C  CG    . ASN B  1 174 ? 109.250 141.238 45.790  1.00 23.42 ? 202  ASN B CG    1 
ATOM   4063  O  OD1   . ASN B  1 174 ? 110.043 142.027 45.278  1.00 22.76 ? 202  ASN B OD1   1 
ATOM   4064  N  ND2   . ASN B  1 174 ? 108.448 141.574 46.798  1.00 22.67 ? 202  ASN B ND2   1 
ATOM   4065  N  N     . GLY B  1 175 ? 109.957 138.756 42.196  1.00 24.88 ? 203  GLY B N     1 
ATOM   4066  C  CA    . GLY B  1 175 ? 110.568 137.684 41.420  1.00 25.09 ? 203  GLY B CA    1 
ATOM   4067  C  C     . GLY B  1 175 ? 110.911 138.124 40.015  1.00 25.44 ? 203  GLY B C     1 
ATOM   4068  O  O     . GLY B  1 175 ? 111.118 139.294 39.739  1.00 25.33 ? 203  GLY B O     1 
ATOM   4069  N  N     . SER B  1 176 ? 110.977 137.168 39.114  1.00 26.37 ? 204  SER B N     1 
ATOM   4070  C  CA    . SER B  1 176 ? 111.329 137.461 37.747  1.00 27.33 ? 204  SER B CA    1 
ATOM   4071  C  C     . SER B  1 176 ? 110.618 136.458 36.862  1.00 27.46 ? 204  SER B C     1 
ATOM   4072  O  O     . SER B  1 176 ? 110.298 135.352 37.314  1.00 28.13 ? 204  SER B O     1 
ATOM   4073  C  CB    . SER B  1 176 ? 112.845 137.351 37.571  1.00 27.46 ? 204  SER B CB    1 
ATOM   4074  O  OG    . SER B  1 176 ? 113.239 135.985 37.556  1.00 29.19 ? 204  SER B OG    1 
ATOM   4075  N  N     . LYS B  1 177 ? 110.355 136.847 35.618  1.00 27.64 ? 205  LYS B N     1 
ATOM   4076  C  CA    . LYS B  1 177 ? 109.828 135.923 34.616  1.00 27.76 ? 205  LYS B CA    1 
ATOM   4077  C  C     . LYS B  1 177 ? 110.728 135.947 33.388  1.00 28.18 ? 205  LYS B C     1 
ATOM   4078  O  O     . LYS B  1 177 ? 111.460 136.909 33.137  1.00 28.19 ? 205  LYS B O     1 
ATOM   4079  C  CB    . LYS B  1 177 ? 108.392 136.291 34.228  1.00 27.85 ? 205  LYS B CB    1 
ATOM   4080  C  CG    . LYS B  1 177 ? 107.390 136.266 35.400  1.00 26.90 ? 205  LYS B CG    1 
ATOM   4081  C  CD    . LYS B  1 177 ? 107.207 134.868 35.913  1.00 26.41 ? 205  LYS B CD    1 
ATOM   4082  C  CE    . LYS B  1 177 ? 106.037 134.709 36.859  1.00 26.62 ? 205  LYS B CE    1 
ATOM   4083  N  NZ    . LYS B  1 177 ? 105.910 133.274 37.269  1.00 25.50 ? 205  LYS B NZ    1 
ATOM   4084  N  N     . MET B  1 178 ? 110.664 134.878 32.623  1.00 28.57 ? 206  MET B N     1 
ATOM   4085  C  CA    . MET B  1 178 ? 111.487 134.745 31.438  1.00 29.04 ? 206  MET B CA    1 
ATOM   4086  C  C     . MET B  1 178 ? 110.614 134.340 30.271  1.00 28.45 ? 206  MET B C     1 
ATOM   4087  O  O     . MET B  1 178 ? 109.596 133.658 30.453  1.00 27.82 ? 206  MET B O     1 
ATOM   4088  C  CB    . MET B  1 178 ? 112.566 133.684 31.684  1.00 29.58 ? 206  MET B CB    1 
ATOM   4089  C  CG    . MET B  1 178 ? 113.642 133.597 30.617  1.00 32.52 ? 206  MET B CG    1 
ATOM   4090  S  SD    . MET B  1 178 ? 114.731 135.017 30.607  1.00 37.91 ? 206  MET B SD    1 
ATOM   4091  C  CE    . MET B  1 178 ? 115.923 134.509 31.858  1.00 40.42 ? 206  MET B CE    1 
ATOM   4092  N  N     . TRP B  1 179 ? 111.041 134.753 29.075  1.00 28.16 ? 207  TRP B N     1 
ATOM   4093  C  CA    . TRP B  1 179 ? 110.446 134.343 27.806  1.00 28.18 ? 207  TRP B CA    1 
ATOM   4094  C  C     . TRP B  1 179 ? 109.048 134.913 27.617  1.00 27.25 ? 207  TRP B C     1 
ATOM   4095  O  O     . TRP B  1 179 ? 108.211 134.266 26.996  1.00 27.74 ? 207  TRP B O     1 
ATOM   4096  C  CB    . TRP B  1 179 ? 110.384 132.796 27.639  1.00 28.47 ? 207  TRP B CB    1 
ATOM   4097  C  CG    . TRP B  1 179 ? 111.616 132.066 28.079  1.00 29.28 ? 207  TRP B CG    1 
ATOM   4098  C  CD1   . TRP B  1 179 ? 111.743 131.223 29.149  1.00 29.67 ? 207  TRP B CD1   1 
ATOM   4099  C  CD2   . TRP B  1 179 ? 112.909 132.137 27.471  1.00 30.30 ? 207  TRP B CD2   1 
ATOM   4100  N  NE1   . TRP B  1 179 ? 113.037 130.760 29.241  1.00 29.54 ? 207  TRP B NE1   1 
ATOM   4101  C  CE2   . TRP B  1 179 ? 113.774 131.309 28.228  1.00 29.70 ? 207  TRP B CE2   1 
ATOM   4102  C  CE3   . TRP B  1 179 ? 113.426 132.837 26.374  1.00 29.37 ? 207  TRP B CE3   1 
ATOM   4103  C  CZ2   . TRP B  1 179 ? 115.118 131.168 27.927  1.00 28.81 ? 207  TRP B CZ2   1 
ATOM   4104  C  CZ3   . TRP B  1 179 ? 114.765 132.677 26.061  1.00 29.33 ? 207  TRP B CZ3   1 
ATOM   4105  C  CH2   . TRP B  1 179 ? 115.595 131.858 26.842  1.00 29.95 ? 207  TRP B CH2   1 
ATOM   4106  N  N     . ILE B  1 180 ? 108.775 136.118 28.110  1.00 26.72 ? 208  ILE B N     1 
ATOM   4107  C  CA    . ILE B  1 180 ? 107.405 136.630 27.988  1.00 25.34 ? 208  ILE B CA    1 
ATOM   4108  C  C     . ILE B  1 180 ? 107.144 137.221 26.602  1.00 25.03 ? 208  ILE B C     1 
ATOM   4109  O  O     . ILE B  1 180 ? 107.690 138.262 26.232  1.00 25.24 ? 208  ILE B O     1 
ATOM   4110  C  CB    . ILE B  1 180 ? 107.036 137.605 29.121  1.00 25.26 ? 208  ILE B CB    1 
ATOM   4111  C  CG1   . ILE B  1 180 ? 107.285 136.945 30.481  1.00 24.95 ? 208  ILE B CG1   1 
ATOM   4112  C  CG2   . ILE B  1 180 ? 105.579 138.034 29.003  1.00 24.61 ? 208  ILE B CG2   1 
ATOM   4113  C  CD1   . ILE B  1 180 ? 106.686 135.569 30.650  1.00 25.88 ? 208  ILE B CD1   1 
ATOM   4114  N  N     . SER B  1 181 ? 106.296 136.534 25.842  1.00 24.97 ? 209  SER B N     1 
ATOM   4115  C  CA    . SER B  1 181 ? 105.903 136.976 24.508  1.00 24.94 ? 209  SER B CA    1 
ATOM   4116  C  C     . SER B  1 181 ? 105.026 138.211 24.552  1.00 25.10 ? 209  SER B C     1 
ATOM   4117  O  O     . SER B  1 181 ? 104.178 138.338 25.428  1.00 25.65 ? 209  SER B O     1 
ATOM   4118  C  CB    . SER B  1 181 ? 105.168 135.860 23.762  1.00 24.79 ? 209  SER B CB    1 
ATOM   4119  O  OG    . SER B  1 181 ? 106.029 134.759 23.554  1.00 24.39 ? 209  SER B OG    1 
ATOM   4120  N  N     . SER B  1 182 ? 105.239 139.098 23.579  1.00 25.94 ? 210  SER B N     1 
ATOM   4121  C  CA    . SER B  1 182 ? 104.488 140.347 23.398  1.00 26.06 ? 210  SER B CA    1 
ATOM   4122  C  C     . SER B  1 182 ? 104.758 141.403 24.466  1.00 26.69 ? 210  SER B C     1 
ATOM   4123  O  O     . SER B  1 182 ? 104.098 142.440 24.466  1.00 26.36 ? 210  SER B O     1 
ATOM   4124  C  CB    . SER B  1 182 ? 102.968 140.098 23.310  1.00 26.61 ? 210  SER B CB    1 
ATOM   4125  O  OG    . SER B  1 182 ? 102.640 139.020 22.447  1.00 26.03 ? 210  SER B OG    1 
ATOM   4126  N  N     . ALA B  1 183 ? 105.750 141.169 25.332  1.00 27.17 ? 211  ALA B N     1 
ATOM   4127  C  CA    . ALA B  1 183 ? 105.990 142.017 26.494  1.00 27.81 ? 211  ALA B CA    1 
ATOM   4128  C  C     . ALA B  1 183 ? 106.308 143.462 26.114  1.00 28.47 ? 211  ALA B C     1 
ATOM   4129  O  O     . ALA B  1 183 ? 105.936 144.388 26.831  1.00 28.15 ? 211  ALA B O     1 
ATOM   4130  C  CB    . ALA B  1 183 ? 107.108 141.438 27.356  1.00 27.67 ? 211  ALA B CB    1 
ATOM   4131  N  N     . GLU B  1 184 ? 106.970 143.649 24.976  1.00 29.51 ? 212  GLU B N     1 
ATOM   4132  C  CA    . GLU B  1 184 ? 107.367 144.981 24.526  1.00 31.22 ? 212  GLU B CA    1 
ATOM   4133  C  C     . GLU B  1 184 ? 106.181 145.932 24.282  1.00 30.99 ? 212  GLU B C     1 
ATOM   4134  O  O     . GLU B  1 184 ? 106.325 147.141 24.409  1.00 31.37 ? 212  GLU B O     1 
ATOM   4135  C  CB    . GLU B  1 184 ? 108.234 144.881 23.264  1.00 31.00 ? 212  GLU B CB    1 
ATOM   4136  C  CG    . GLU B  1 184 ? 109.157 146.068 23.069  1.00 33.61 ? 212  GLU B CG    1 
ATOM   4137  C  CD    . GLU B  1 184 ? 110.144 145.892 21.923  1.00 34.17 ? 212  GLU B CD    1 
ATOM   4138  O  OE1   . GLU B  1 184 ? 109.861 145.092 21.001  1.00 38.26 ? 212  GLU B OE1   1 
ATOM   4139  O  OE2   . GLU B  1 184 ? 111.203 146.571 21.947  1.00 39.04 ? 212  GLU B OE2   1 
ATOM   4140  N  N     . HIS B  1 185 ? 105.023 145.372 23.943  1.00 31.42 ? 213  HIS B N     1 
ATOM   4141  C  CA    . HIS B  1 185 ? 103.824 146.141 23.599  1.00 31.84 ? 213  HIS B CA    1 
ATOM   4142  C  C     . HIS B  1 185 ? 102.680 145.992 24.609  1.00 30.88 ? 213  HIS B C     1 
ATOM   4143  O  O     . HIS B  1 185 ? 101.762 146.805 24.610  1.00 31.12 ? 213  HIS B O     1 
ATOM   4144  C  CB    . HIS B  1 185 ? 103.322 145.716 22.211  1.00 32.60 ? 213  HIS B CB    1 
ATOM   4145  C  CG    . HIS B  1 185 ? 104.190 146.193 21.088  1.00 35.15 ? 213  HIS B CG    1 
ATOM   4146  N  ND1   . HIS B  1 185 ? 104.914 145.334 20.285  1.00 38.42 ? 213  HIS B ND1   1 
ATOM   4147  C  CD2   . HIS B  1 185 ? 104.466 147.446 20.649  1.00 37.26 ? 213  HIS B CD2   1 
ATOM   4148  C  CE1   . HIS B  1 185 ? 105.592 146.039 19.394  1.00 39.15 ? 213  HIS B CE1   1 
ATOM   4149  N  NE2   . HIS B  1 185 ? 105.337 147.322 19.594  1.00 38.44 ? 213  HIS B NE2   1 
ATOM   4150  N  N     . ALA B  1 186 ? 102.755 144.976 25.470  1.00 29.43 ? 214  ALA B N     1 
ATOM   4151  C  CA    . ALA B  1 186 ? 101.657 144.614 26.374  1.00 28.63 ? 214  ALA B CA    1 
ATOM   4152  C  C     . ALA B  1 186 ? 101.293 145.688 27.400  1.00 27.91 ? 214  ALA B C     1 
ATOM   4153  O  O     . ALA B  1 186 ? 102.149 146.189 28.116  1.00 27.93 ? 214  ALA B O     1 
ATOM   4154  C  CB    . ALA B  1 186 ? 101.985 143.310 27.090  1.00 28.24 ? 214  ALA B CB    1 
ATOM   4155  N  N     . GLY B  1 187 ? 100.008 146.021 27.469  1.00 27.26 ? 215  GLY B N     1 
ATOM   4156  C  CA    . GLY B  1 187 ? 99.484  146.912 28.491  1.00 26.66 ? 215  GLY B CA    1 
ATOM   4157  C  C     . GLY B  1 187 ? 98.955  146.163 29.704  1.00 26.30 ? 215  GLY B C     1 
ATOM   4158  O  O     . GLY B  1 187 ? 98.750  146.757 30.770  1.00 26.23 ? 215  GLY B O     1 
ATOM   4159  N  N     . LEU B  1 188 ? 98.712  144.868 29.530  1.00 25.65 ? 216  LEU B N     1 
ATOM   4160  C  CA    . LEU B  1 188 ? 98.251  143.999 30.598  1.00 25.64 ? 216  LEU B CA    1 
ATOM   4161  C  C     . LEU B  1 188 ? 99.161  142.776 30.683  1.00 25.39 ? 216  LEU B C     1 
ATOM   4162  O  O     . LEU B  1 188 ? 99.507  142.168 29.667  1.00 25.40 ? 216  LEU B O     1 
ATOM   4163  C  CB    . LEU B  1 188 ? 96.804  143.558 30.350  1.00 25.87 ? 216  LEU B CB    1 
ATOM   4164  C  CG    . LEU B  1 188 ? 96.157  142.619 31.382  1.00 26.16 ? 216  LEU B CG    1 
ATOM   4165  C  CD1   . LEU B  1 188 ? 95.986  143.302 32.757  1.00 26.36 ? 216  LEU B CD1   1 
ATOM   4166  C  CD2   . LEU B  1 188 ? 94.810  142.120 30.878  1.00 26.35 ? 216  LEU B CD2   1 
ATOM   4167  N  N     . PHE B  1 189 ? 99.553  142.440 31.903  1.00 25.08 ? 217  PHE B N     1 
ATOM   4168  C  CA    . PHE B  1 189 ? 100.307 141.240 32.189  1.00 24.88 ? 217  PHE B CA    1 
ATOM   4169  C  C     . PHE B  1 189 ? 99.482  140.376 33.133  1.00 25.35 ? 217  PHE B C     1 
ATOM   4170  O  O     . PHE B  1 189 ? 99.022  140.834 34.199  1.00 24.46 ? 217  PHE B O     1 
ATOM   4171  C  CB    . PHE B  1 189 ? 101.666 141.590 32.797  1.00 24.96 ? 217  PHE B CB    1 
ATOM   4172  C  CG    . PHE B  1 189 ? 102.554 142.363 31.868  1.00 24.56 ? 217  PHE B CG    1 
ATOM   4173  C  CD1   . PHE B  1 189 ? 103.506 141.712 31.089  1.00 25.04 ? 217  PHE B CD1   1 
ATOM   4174  C  CD2   . PHE B  1 189 ? 102.419 143.738 31.745  1.00 24.48 ? 217  PHE B CD2   1 
ATOM   4175  C  CE1   . PHE B  1 189 ? 104.325 142.425 30.217  1.00 25.21 ? 217  PHE B CE1   1 
ATOM   4176  C  CE2   . PHE B  1 189 ? 103.229 144.456 30.887  1.00 25.02 ? 217  PHE B CE2   1 
ATOM   4177  C  CZ    . PHE B  1 189 ? 104.186 143.801 30.117  1.00 24.87 ? 217  PHE B CZ    1 
ATOM   4178  N  N     . LEU B  1 190 ? 99.250  139.142 32.704  1.00 25.77 ? 218  LEU B N     1 
ATOM   4179  C  CA    . LEU B  1 190 ? 98.550  138.152 33.500  1.00 26.34 ? 218  LEU B CA    1 
ATOM   4180  C  C     . LEU B  1 190 ? 99.637  137.277 34.140  1.00 26.20 ? 218  LEU B C     1 
ATOM   4181  O  O     . LEU B  1 190 ? 100.292 136.497 33.459  1.00 25.74 ? 218  LEU B O     1 
ATOM   4182  C  CB    . LEU B  1 190 ? 97.594  137.366 32.604  1.00 26.82 ? 218  LEU B CB    1 
ATOM   4183  C  CG    . LEU B  1 190 ? 96.383  136.698 33.254  1.00 28.10 ? 218  LEU B CG    1 
ATOM   4184  C  CD1   . LEU B  1 190 ? 95.302  136.402 32.209  1.00 28.89 ? 218  LEU B CD1   1 
ATOM   4185  C  CD2   . LEU B  1 190 ? 96.831  135.421 33.965  1.00 30.07 ? 218  LEU B CD2   1 
ATOM   4186  N  N     . VAL B  1 191 ? 99.834  137.447 35.448  1.00 26.45 ? 219  VAL B N     1 
ATOM   4187  C  CA    . VAL B  1 191 ? 101.004 136.922 36.145  1.00 26.70 ? 219  VAL B CA    1 
ATOM   4188  C  C     . VAL B  1 191 ? 100.645 135.825 37.148  1.00 27.32 ? 219  VAL B C     1 
ATOM   4189  O  O     . VAL B  1 191 ? 99.706  135.969 37.939  1.00 26.71 ? 219  VAL B O     1 
ATOM   4190  C  CB    . VAL B  1 191 ? 101.756 138.057 36.888  1.00 26.49 ? 219  VAL B CB    1 
ATOM   4191  C  CG1   . VAL B  1 191 ? 103.050 137.539 37.512  1.00 26.79 ? 219  VAL B CG1   1 
ATOM   4192  C  CG2   . VAL B  1 191 ? 102.047 139.216 35.942  1.00 26.96 ? 219  VAL B CG2   1 
ATOM   4193  N  N     . MET B  1 192 ? 101.417 134.736 37.105  1.00 28.12 ? 220  MET B N     1 
ATOM   4194  C  CA    . MET B  1 192 ? 101.316 133.644 38.075  1.00 29.00 ? 220  MET B CA    1 
ATOM   4195  C  C     . MET B  1 192 ? 102.369 133.825 39.144  1.00 28.99 ? 220  MET B C     1 
ATOM   4196  O  O     . MET B  1 192 ? 103.568 133.834 38.847  1.00 29.28 ? 220  MET B O     1 
ATOM   4197  C  CB    . MET B  1 192 ? 101.536 132.275 37.423  1.00 29.55 ? 220  MET B CB    1 
ATOM   4198  C  CG    . MET B  1 192 ? 100.791 132.060 36.150  1.00 31.55 ? 220  MET B CG    1 
ATOM   4199  S  SD    . MET B  1 192 ? 99.040  132.265 36.335  1.00 32.92 ? 220  MET B SD    1 
ATOM   4200  C  CE    . MET B  1 192 ? 98.662  132.965 34.743  1.00 33.90 ? 220  MET B CE    1 
ATOM   4201  N  N     . ALA B  1 193 ? 101.908 133.948 40.382  1.00 29.25 ? 221  ALA B N     1 
ATOM   4202  C  CA    . ALA B  1 193 ? 102.772 134.146 41.533  1.00 29.27 ? 221  ALA B CA    1 
ATOM   4203  C  C     . ALA B  1 193 ? 102.260 133.272 42.673  1.00 29.44 ? 221  ALA B C     1 
ATOM   4204  O  O     . ALA B  1 193 ? 101.064 132.982 42.764  1.00 28.70 ? 221  ALA B O     1 
ATOM   4205  C  CB    . ALA B  1 193 ? 102.787 135.608 41.938  1.00 29.10 ? 221  ALA B CB    1 
ATOM   4206  N  N     . ASN B  1 194 ? 103.176 132.855 43.537  1.00 29.93 ? 222  ASN B N     1 
ATOM   4207  C  CA    . ASN B  1 194 ? 102.845 131.955 44.633  1.00 30.51 ? 222  ASN B CA    1 
ATOM   4208  C  C     . ASN B  1 194 ? 102.610 132.735 45.940  1.00 31.18 ? 222  ASN B C     1 
ATOM   4209  O  O     . ASN B  1 194 ? 103.510 133.424 46.432  1.00 31.11 ? 222  ASN B O     1 
ATOM   4210  C  CB    . ASN B  1 194 ? 103.957 130.900 44.788  1.00 30.26 ? 222  ASN B CB    1 
ATOM   4211  C  CG    . ASN B  1 194 ? 103.477 129.638 45.495  1.00 29.82 ? 222  ASN B CG    1 
ATOM   4212  O  OD1   . ASN B  1 194 ? 102.669 129.704 46.416  1.00 27.90 ? 222  ASN B OD1   1 
ATOM   4213  N  ND2   . ASN B  1 194 ? 103.972 128.482 45.057  1.00 27.01 ? 222  ASN B ND2   1 
ATOM   4214  N  N     . VAL B  1 195 ? 101.399 132.626 46.487  1.00 32.02 ? 223  VAL B N     1 
ATOM   4215  C  CA    . VAL B  1 195 ? 101.044 133.285 47.767  1.00 32.93 ? 223  VAL B CA    1 
ATOM   4216  C  C     . VAL B  1 195 ? 101.406 132.458 49.014  1.00 33.92 ? 223  VAL B C     1 
ATOM   4217  O  O     . VAL B  1 195 ? 101.344 132.965 50.130  1.00 34.21 ? 223  VAL B O     1 
ATOM   4218  C  CB    . VAL B  1 195 ? 99.538  133.653 47.843  1.00 32.87 ? 223  VAL B CB    1 
ATOM   4219  C  CG1   . VAL B  1 195 ? 99.163  134.635 46.746  1.00 32.87 ? 223  VAL B CG1   1 
ATOM   4220  C  CG2   . VAL B  1 195 ? 98.672  132.409 47.772  1.00 32.46 ? 223  VAL B CG2   1 
ATOM   4221  N  N     . ASP B  1 196 ? 101.752 131.186 48.835  1.00 35.14 ? 224  ASP B N     1 
ATOM   4222  C  CA    . ASP B  1 196 ? 102.273 130.377 49.938  1.00 36.16 ? 224  ASP B CA    1 
ATOM   4223  C  C     . ASP B  1 196 ? 103.093 129.199 49.403  1.00 36.65 ? 224  ASP B C     1 
ATOM   4224  O  O     . ASP B  1 196 ? 102.553 128.121 49.157  1.00 36.89 ? 224  ASP B O     1 
ATOM   4225  C  CB    . ASP B  1 196 ? 101.139 129.892 50.849  1.00 36.39 ? 224  ASP B CB    1 
ATOM   4226  C  CG    . ASP B  1 196 ? 101.649 129.387 52.194  1.00 37.20 ? 224  ASP B CG    1 
ATOM   4227  O  OD1   . ASP B  1 196 ? 102.256 128.299 52.240  1.00 37.42 ? 224  ASP B OD1   1 
ATOM   4228  O  OD2   . ASP B  1 196 ? 101.436 130.080 53.210  1.00 40.02 ? 224  ASP B OD2   1 
ATOM   4229  N  N     . PRO B  1 197 ? 104.402 129.413 49.194  1.00 37.46 ? 225  PRO B N     1 
ATOM   4230  C  CA    . PRO B  1 197 ? 105.287 128.347 48.692  1.00 38.26 ? 225  PRO B CA    1 
ATOM   4231  C  C     . PRO B  1 197 ? 105.367 127.054 49.530  1.00 38.90 ? 225  PRO B C     1 
ATOM   4232  O  O     . PRO B  1 197 ? 105.783 126.027 48.995  1.00 39.35 ? 225  PRO B O     1 
ATOM   4233  C  CB    . PRO B  1 197 ? 106.657 129.035 48.612  1.00 38.35 ? 225  PRO B CB    1 
ATOM   4234  C  CG    . PRO B  1 197 ? 106.343 130.499 48.493  1.00 37.93 ? 225  PRO B CG    1 
ATOM   4235  C  CD    . PRO B  1 197 ? 105.119 130.694 49.341  1.00 37.36 ? 225  PRO B CD    1 
ATOM   4236  N  N     . THR B  1 198 ? 104.962 127.076 50.802  1.00 39.69 ? 226  THR B N     1 
ATOM   4237  C  CA    . THR B  1 198 ? 104.928 125.835 51.594  1.00 40.01 ? 226  THR B CA    1 
ATOM   4238  C  C     . THR B  1 198 ? 103.884 124.858 51.022  1.00 40.23 ? 226  THR B C     1 
ATOM   4239  O  O     . THR B  1 198 ? 104.099 123.640 51.027  1.00 40.60 ? 226  THR B O     1 
ATOM   4240  C  CB    . THR B  1 198 ? 104.672 126.076 53.107  1.00 40.25 ? 226  THR B CB    1 
ATOM   4241  O  OG1   . THR B  1 198 ? 103.273 126.273 53.356  1.00 40.72 ? 226  THR B OG1   1 
ATOM   4242  C  CG2   . THR B  1 198 ? 105.469 127.275 53.619  1.00 40.18 ? 226  THR B CG2   1 
ATOM   4243  N  N     . ILE B  1 199 ? 102.778 125.406 50.504  1.00 39.99 ? 227  ILE B N     1 
ATOM   4244  C  CA    . ILE B  1 199 ? 101.735 124.618 49.829  1.00 39.63 ? 227  ILE B CA    1 
ATOM   4245  C  C     . ILE B  1 199 ? 102.147 124.193 48.415  1.00 39.33 ? 227  ILE B C     1 
ATOM   4246  O  O     . ILE B  1 199 ? 101.432 123.425 47.751  1.00 39.24 ? 227  ILE B O     1 
ATOM   4247  C  CB    . ILE B  1 199 ? 100.399 125.409 49.740  1.00 39.69 ? 227  ILE B CB    1 
ATOM   4248  N  N     . GLY B  1 200 ? 103.293 124.693 47.953  1.00 38.84 ? 228  GLY B N     1 
ATOM   4249  C  CA    . GLY B  1 200 ? 103.791 124.382 46.620  1.00 38.22 ? 228  GLY B CA    1 
ATOM   4250  C  C     . GLY B  1 200 ? 102.891 124.993 45.562  1.00 37.79 ? 228  GLY B C     1 
ATOM   4251  O  O     . GLY B  1 200 ? 102.473 126.147 45.685  1.00 37.29 ? 228  GLY B O     1 
ATOM   4252  N  N     . TYR B  1 201 ? 102.569 124.200 44.542  1.00 37.24 ? 229  TYR B N     1 
ATOM   4253  C  CA    . TYR B  1 201 ? 101.793 124.675 43.398  1.00 37.03 ? 229  TYR B CA    1 
ATOM   4254  C  C     . TYR B  1 201 ? 100.368 125.122 43.751  1.00 36.27 ? 229  TYR B C     1 
ATOM   4255  O  O     . TYR B  1 201 ? 99.772  125.926 43.031  1.00 36.09 ? 229  TYR B O     1 
ATOM   4256  C  CB    . TYR B  1 201 ? 101.765 123.614 42.293  1.00 37.67 ? 229  TYR B CB    1 
ATOM   4257  C  CG    . TYR B  1 201 ? 100.984 122.349 42.597  1.00 38.32 ? 229  TYR B CG    1 
ATOM   4258  C  CD1   . TYR B  1 201 ? 101.627 121.213 43.085  1.00 39.64 ? 229  TYR B CD1   1 
ATOM   4259  C  CD2   . TYR B  1 201 ? 99.610  122.276 42.357  1.00 39.09 ? 229  TYR B CD2   1 
ATOM   4260  C  CE1   . TYR B  1 201 ? 100.923 120.037 43.348  1.00 40.27 ? 229  TYR B CE1   1 
ATOM   4261  C  CE2   . TYR B  1 201 ? 98.888  121.112 42.621  1.00 39.82 ? 229  TYR B CE2   1 
ATOM   4262  C  CZ    . TYR B  1 201 ? 99.551  119.993 43.116  1.00 40.40 ? 229  TYR B CZ    1 
ATOM   4263  O  OH    . TYR B  1 201 ? 98.854  118.832 43.375  1.00 40.15 ? 229  TYR B OH    1 
ATOM   4264  N  N     . LYS B  1 202 ? 99.833  124.611 44.857  1.00 35.18 ? 230  LYS B N     1 
ATOM   4265  C  CA    . LYS B  1 202 ? 98.508  125.015 45.328  1.00 34.54 ? 230  LYS B CA    1 
ATOM   4266  C  C     . LYS B  1 202 ? 98.478  126.441 45.911  1.00 33.66 ? 230  LYS B C     1 
ATOM   4267  O  O     . LYS B  1 202 ? 97.404  126.960 46.214  1.00 33.06 ? 230  LYS B O     1 
ATOM   4268  C  CB    . LYS B  1 202 ? 97.977  124.009 46.350  1.00 34.79 ? 230  LYS B CB    1 
ATOM   4269  C  CG    . LYS B  1 202 ? 97.562  122.685 45.739  1.00 36.06 ? 230  LYS B CG    1 
ATOM   4270  C  CD    . LYS B  1 202 ? 97.346  121.646 46.817  1.00 37.83 ? 230  LYS B CD    1 
ATOM   4271  C  CE    . LYS B  1 202 ? 96.886  120.314 46.252  1.00 39.30 ? 230  LYS B CE    1 
ATOM   4272  N  NZ    . LYS B  1 202 ? 95.460  120.345 45.801  1.00 40.77 ? 230  LYS B NZ    1 
ATOM   4273  N  N     . GLY B  1 203 ? 99.646  127.070 46.062  1.00 32.64 ? 231  GLY B N     1 
ATOM   4274  C  CA    . GLY B  1 203 ? 99.718  128.490 46.398  1.00 31.87 ? 231  GLY B CA    1 
ATOM   4275  C  C     . GLY B  1 203 ? 99.728  129.412 45.182  1.00 31.04 ? 231  GLY B C     1 
ATOM   4276  O  O     . GLY B  1 203 ? 99.636  130.639 45.328  1.00 31.04 ? 231  GLY B O     1 
ATOM   4277  N  N     . ILE B  1 204 ? 99.823  128.832 43.986  1.00 30.06 ? 232  ILE B N     1 
ATOM   4278  C  CA    . ILE B  1 204 ? 99.936  129.618 42.754  1.00 29.26 ? 232  ILE B CA    1 
ATOM   4279  C  C     . ILE B  1 204 ? 98.617  130.312 42.399  1.00 28.88 ? 232  ILE B C     1 
ATOM   4280  O  O     . ILE B  1 204 ? 97.559  129.684 42.335  1.00 28.58 ? 232  ILE B O     1 
ATOM   4281  C  CB    . ILE B  1 204 ? 100.416 128.772 41.550  1.00 29.48 ? 232  ILE B CB    1 
ATOM   4282  C  CG1   . ILE B  1 204 ? 101.822 128.212 41.816  1.00 29.34 ? 232  ILE B CG1   1 
ATOM   4283  C  CG2   . ILE B  1 204 ? 100.400 129.617 40.269  1.00 28.31 ? 232  ILE B CG2   1 
ATOM   4284  C  CD1   . ILE B  1 204 ? 102.345 127.289 40.723  1.00 28.45 ? 232  ILE B CD1   1 
ATOM   4285  N  N     . THR B  1 205 ? 98.711  131.612 42.148  1.00 28.21 ? 233  THR B N     1 
ATOM   4286  C  CA    . THR B  1 205 ? 97.544  132.487 42.010  1.00 27.92 ? 233  THR B CA    1 
ATOM   4287  C  C     . THR B  1 205 ? 97.791  133.390 40.808  1.00 27.64 ? 233  THR B C     1 
ATOM   4288  O  O     . THR B  1 205 ? 98.945  133.702 40.497  1.00 27.23 ? 233  THR B O     1 
ATOM   4289  C  CB    . THR B  1 205 ? 97.365  133.323 43.292  1.00 27.84 ? 233  THR B CB    1 
ATOM   4290  O  OG1   . THR B  1 205 ? 97.238  132.437 44.417  1.00 28.33 ? 233  THR B OG1   1 
ATOM   4291  C  CG2   . THR B  1 205 ? 96.120  134.245 43.221  1.00 27.24 ? 233  THR B CG2   1 
ATOM   4292  N  N     . SER B  1 206 ? 96.727  133.799 40.121  1.00 27.57 ? 234  SER B N     1 
ATOM   4293  C  CA    . SER B  1 206 ? 96.894  134.633 38.933  1.00 27.95 ? 234  SER B CA    1 
ATOM   4294  C  C     . SER B  1 206 ? 96.417  136.073 39.162  1.00 27.60 ? 234  SER B C     1 
ATOM   4295  O  O     . SER B  1 206 ? 95.376  136.313 39.777  1.00 27.03 ? 234  SER B O     1 
ATOM   4296  C  CB    . SER B  1 206 ? 96.268  133.979 37.688  1.00 28.41 ? 234  SER B CB    1 
ATOM   4297  O  OG    . SER B  1 206 ? 94.865  134.012 37.710  1.00 30.63 ? 234  SER B OG    1 
ATOM   4298  N  N     . PHE B  1 207 ? 97.223  137.021 38.683  1.00 27.16 ? 235  PHE B N     1 
ATOM   4299  C  CA    . PHE B  1 207 ? 97.013  138.442 38.928  1.00 27.03 ? 235  PHE B CA    1 
ATOM   4300  C  C     . PHE B  1 207 ? 96.988  139.210 37.610  1.00 26.80 ? 235  PHE B C     1 
ATOM   4301  O  O     . PHE B  1 207 ? 97.799  138.954 36.718  1.00 26.90 ? 235  PHE B O     1 
ATOM   4302  C  CB    . PHE B  1 207 ? 98.150  139.010 39.781  1.00 26.72 ? 235  PHE B CB    1 
ATOM   4303  C  CG    . PHE B  1 207 ? 98.292  138.371 41.130  1.00 26.60 ? 235  PHE B CG    1 
ATOM   4304  C  CD1   . PHE B  1 207 ? 97.669  138.925 42.245  1.00 27.11 ? 235  PHE B CD1   1 
ATOM   4305  C  CD2   . PHE B  1 207 ? 99.086  137.246 41.300  1.00 26.35 ? 235  PHE B CD2   1 
ATOM   4306  C  CE1   . PHE B  1 207 ? 97.815  138.341 43.503  1.00 27.16 ? 235  PHE B CE1   1 
ATOM   4307  C  CE2   . PHE B  1 207 ? 99.242  136.660 42.556  1.00 26.78 ? 235  PHE B CE2   1 
ATOM   4308  C  CZ    . PHE B  1 207 ? 98.607  137.208 43.657  1.00 26.85 ? 235  PHE B CZ    1 
ATOM   4309  N  N     . LEU B  1 208 ? 96.066  140.157 37.521  1.00 26.56 ? 236  LEU B N     1 
ATOM   4310  C  CA    . LEU B  1 208 ? 96.018  141.147 36.448  1.00 26.69 ? 236  LEU B CA    1 
ATOM   4311  C  C     . LEU B  1 208 ? 96.881  142.349 36.810  1.00 26.64 ? 236  LEU B C     1 
ATOM   4312  O  O     . LEU B  1 208 ? 96.549  143.098 37.726  1.00 26.79 ? 236  LEU B O     1 
ATOM   4313  C  CB    . LEU B  1 208 ? 94.574  141.601 36.226  1.00 26.62 ? 236  LEU B CB    1 
ATOM   4314  C  CG    . LEU B  1 208 ? 93.643  140.444 35.861  1.00 27.16 ? 236  LEU B CG    1 
ATOM   4315  C  CD1   . LEU B  1 208 ? 92.194  140.843 35.998  1.00 26.16 ? 236  LEU B CD1   1 
ATOM   4316  C  CD2   . LEU B  1 208 ? 93.958  139.957 34.455  1.00 27.89 ? 236  LEU B CD2   1 
ATOM   4317  N  N     . VAL B  1 209 ? 97.989  142.521 36.091  1.00 26.69 ? 237  VAL B N     1 
ATOM   4318  C  CA    . VAL B  1 209 ? 98.966  143.562 36.380  1.00 26.98 ? 237  VAL B CA    1 
ATOM   4319  C  C     . VAL B  1 209 ? 99.065  144.524 35.198  1.00 27.50 ? 237  VAL B C     1 
ATOM   4320  O  O     . VAL B  1 209 ? 99.356  144.104 34.076  1.00 27.29 ? 237  VAL B O     1 
ATOM   4321  C  CB    . VAL B  1 209 ? 100.372 142.972 36.667  1.00 27.00 ? 237  VAL B CB    1 
ATOM   4322  C  CG1   . VAL B  1 209 ? 101.341 144.077 37.097  1.00 26.31 ? 237  VAL B CG1   1 
ATOM   4323  C  CG2   . VAL B  1 209 ? 100.296 141.867 37.724  1.00 27.00 ? 237  VAL B CG2   1 
ATOM   4324  N  N     . ASP B  1 210 ? 98.814  145.807 35.458  1.00 28.02 ? 238  ASP B N     1 
ATOM   4325  C  CA    . ASP B  1 210 ? 98.967  146.859 34.453  1.00 28.85 ? 238  ASP B CA    1 
ATOM   4326  C  C     . ASP B  1 210 ? 100.449 147.150 34.187  1.00 29.31 ? 238  ASP B C     1 
ATOM   4327  O  O     . ASP B  1 210 ? 101.264 147.180 35.115  1.00 29.54 ? 238  ASP B O     1 
ATOM   4328  C  CB    . ASP B  1 210 ? 98.292  148.164 34.910  1.00 29.04 ? 238  ASP B CB    1 
ATOM   4329  C  CG    . ASP B  1 210 ? 96.778  148.028 35.135  1.00 29.43 ? 238  ASP B CG    1 
ATOM   4330  O  OD1   . ASP B  1 210 ? 96.141  147.081 34.639  1.00 29.39 ? 238  ASP B OD1   1 
ATOM   4331  O  OD2   . ASP B  1 210 ? 96.216  148.907 35.813  1.00 31.34 ? 238  ASP B OD2   1 
ATOM   4332  N  N     . ARG B  1 211 ? 100.774 147.414 32.925  1.00 29.77 ? 239  ARG B N     1 
ATOM   4333  C  CA    . ARG B  1 211 ? 102.142 147.703 32.494  1.00 30.16 ? 239  ARG B CA    1 
ATOM   4334  C  C     . ARG B  1 211 ? 102.841 148.730 33.380  1.00 30.94 ? 239  ARG B C     1 
ATOM   4335  O  O     . ARG B  1 211 ? 103.895 148.459 33.957  1.00 31.05 ? 239  ARG B O     1 
ATOM   4336  C  CB    . ARG B  1 211 ? 102.147 148.214 31.051  1.00 30.04 ? 239  ARG B CB    1 
ATOM   4337  C  CG    . ARG B  1 211 ? 103.534 148.300 30.428  1.00 29.80 ? 239  ARG B CG    1 
ATOM   4338  C  CD    . ARG B  1 211 ? 103.531 149.012 29.089  1.00 29.70 ? 239  ARG B CD    1 
ATOM   4339  N  NE    . ARG B  1 211 ? 104.888 149.082 28.547  1.00 29.49 ? 239  ARG B NE    1 
ATOM   4340  C  CZ    . ARG B  1 211 ? 105.495 148.125 27.848  1.00 29.90 ? 239  ARG B CZ    1 
ATOM   4341  N  NH1   . ARG B  1 211 ? 104.883 146.980 27.563  1.00 30.20 ? 239  ARG B NH1   1 
ATOM   4342  N  NH2   . ARG B  1 211 ? 106.738 148.315 27.427  1.00 29.98 ? 239  ARG B NH2   1 
ATOM   4343  N  N     . ASP B  1 212 ? 102.258 149.913 33.480  1.00 31.77 ? 240  ASP B N     1 
ATOM   4344  C  CA    . ASP B  1 212 ? 102.928 151.017 34.155  1.00 32.51 ? 240  ASP B CA    1 
ATOM   4345  C  C     . ASP B  1 212 ? 102.598 151.012 35.648  1.00 32.07 ? 240  ASP B C     1 
ATOM   4346  O  O     . ASP B  1 212 ? 101.874 151.874 36.145  1.00 32.57 ? 240  ASP B O     1 
ATOM   4347  C  CB    . ASP B  1 212 ? 102.581 152.347 33.466  1.00 33.05 ? 240  ASP B CB    1 
ATOM   4348  C  CG    . ASP B  1 212 ? 102.970 152.352 31.976  1.00 34.47 ? 240  ASP B CG    1 
ATOM   4349  O  OD1   . ASP B  1 212 ? 104.094 151.912 31.633  1.00 34.78 ? 240  ASP B OD1   1 
ATOM   4350  O  OD2   . ASP B  1 212 ? 102.145 152.799 31.147  1.00 37.90 ? 240  ASP B OD2   1 
ATOM   4351  N  N     . THR B  1 213 ? 103.117 149.990 36.329  1.00 31.61 ? 241  THR B N     1 
ATOM   4352  C  CA    . THR B  1 213 ? 103.115 149.888 37.785  1.00 31.35 ? 241  THR B CA    1 
ATOM   4353  C  C     . THR B  1 213 ? 104.580 149.943 38.225  1.00 30.55 ? 241  THR B C     1 
ATOM   4354  O  O     . THR B  1 213 ? 105.426 149.301 37.593  1.00 30.35 ? 241  THR B O     1 
ATOM   4355  C  CB    . THR B  1 213 ? 102.527 148.547 38.289  1.00 31.62 ? 241  THR B CB    1 
ATOM   4356  O  OG1   . THR B  1 213 ? 101.286 148.258 37.627  1.00 33.08 ? 241  THR B OG1   1 
ATOM   4357  C  CG2   . THR B  1 213 ? 102.286 148.611 39.789  1.00 32.10 ? 241  THR B CG2   1 
ATOM   4358  N  N     . PRO B  1 214 ? 104.894 150.709 39.292  1.00 29.62 ? 242  PRO B N     1 
ATOM   4359  C  CA    . PRO B  1 214 ? 106.276 150.718 39.800  1.00 29.01 ? 242  PRO B CA    1 
ATOM   4360  C  C     . PRO B  1 214 ? 106.841 149.332 40.167  1.00 28.32 ? 242  PRO B C     1 
ATOM   4361  O  O     . PRO B  1 214 ? 106.136 148.502 40.739  1.00 27.82 ? 242  PRO B O     1 
ATOM   4362  C  CB    . PRO B  1 214 ? 106.185 151.615 41.044  1.00 28.96 ? 242  PRO B CB    1 
ATOM   4363  C  CG    . PRO B  1 214 ? 105.022 152.507 40.779  1.00 29.29 ? 242  PRO B CG    1 
ATOM   4364  C  CD    . PRO B  1 214 ? 104.034 151.649 40.040  1.00 29.53 ? 242  PRO B CD    1 
ATOM   4365  N  N     . GLY B  1 215 ? 108.105 149.100 39.827  1.00 28.00 ? 243  GLY B N     1 
ATOM   4366  C  CA    . GLY B  1 215 ? 108.780 147.836 40.138  1.00 27.94 ? 243  GLY B CA    1 
ATOM   4367  C  C     . GLY B  1 215 ? 108.751 146.772 39.045  1.00 27.88 ? 243  GLY B C     1 
ATOM   4368  O  O     . GLY B  1 215 ? 109.465 145.780 39.137  1.00 26.92 ? 243  GLY B O     1 
ATOM   4369  N  N     . LEU B  1 216 ? 107.919 146.979 38.025  1.00 28.13 ? 244  LEU B N     1 
ATOM   4370  C  CA    . LEU B  1 216 ? 107.784 146.051 36.906  1.00 28.64 ? 244  LEU B CA    1 
ATOM   4371  C  C     . LEU B  1 216 ? 108.704 146.514 35.776  1.00 28.85 ? 244  LEU B C     1 
ATOM   4372  O  O     . LEU B  1 216 ? 108.459 147.552 35.151  1.00 28.74 ? 244  LEU B O     1 
ATOM   4373  C  CB    . LEU B  1 216 ? 106.328 146.002 36.421  1.00 28.60 ? 244  LEU B CB    1 
ATOM   4374  C  CG    . LEU B  1 216 ? 106.042 145.163 35.166  1.00 29.05 ? 244  LEU B CG    1 
ATOM   4375  C  CD1   . LEU B  1 216 ? 106.672 143.792 35.264  1.00 30.15 ? 244  LEU B CD1   1 
ATOM   4376  C  CD2   . LEU B  1 216 ? 104.541 145.044 34.948  1.00 29.19 ? 244  LEU B CD2   1 
ATOM   4377  N  N     . HIS B  1 217 ? 109.783 145.772 35.551  1.00 28.80 ? 245  HIS B N     1 
ATOM   4378  C  CA    . HIS B  1 217 ? 110.751 146.138 34.526  1.00 29.44 ? 245  HIS B CA    1 
ATOM   4379  C  C     . HIS B  1 217 ? 110.730 145.090 33.424  1.00 29.28 ? 245  HIS B C     1 
ATOM   4380  O  O     . HIS B  1 217 ? 110.841 143.888 33.681  1.00 28.50 ? 245  HIS B O     1 
ATOM   4381  C  CB    . HIS B  1 217 ? 112.163 146.282 35.108  1.00 29.92 ? 245  HIS B CB    1 
ATOM   4382  C  CG    . HIS B  1 217 ? 112.222 147.113 36.352  1.00 31.84 ? 245  HIS B CG    1 
ATOM   4383  N  ND1   . HIS B  1 217 ? 112.416 146.568 37.605  1.00 33.45 ? 245  HIS B ND1   1 
ATOM   4384  C  CD2   . HIS B  1 217 ? 112.093 148.449 36.538  1.00 34.17 ? 245  HIS B CD2   1 
ATOM   4385  C  CE1   . HIS B  1 217 ? 112.412 147.534 38.506  1.00 33.86 ? 245  HIS B CE1   1 
ATOM   4386  N  NE2   . HIS B  1 217 ? 112.215 148.685 37.886  1.00 34.80 ? 245  HIS B NE2   1 
ATOM   4387  N  N     . ILE B  1 218 ? 110.563 145.571 32.199  1.00 29.63 ? 246  ILE B N     1 
ATOM   4388  C  CA    . ILE B  1 218 ? 110.543 144.737 31.012  1.00 29.99 ? 246  ILE B CA    1 
ATOM   4389  C  C     . ILE B  1 218 ? 111.928 144.879 30.387  1.00 30.22 ? 246  ILE B C     1 
ATOM   4390  O  O     . ILE B  1 218 ? 112.344 145.989 30.035  1.00 29.79 ? 246  ILE B O     1 
ATOM   4391  C  CB    . ILE B  1 218 ? 109.418 145.210 30.052  1.00 30.15 ? 246  ILE B CB    1 
ATOM   4392  C  CG1   . ILE B  1 218 ? 108.083 145.286 30.813  1.00 30.58 ? 246  ILE B CG1   1 
ATOM   4393  C  CG2   . ILE B  1 218 ? 109.300 144.294 28.833  1.00 30.01 ? 246  ILE B CG2   1 
ATOM   4394  C  CD1   . ILE B  1 218 ? 107.029 146.128 30.143  1.00 31.04 ? 246  ILE B CD1   1 
ATOM   4395  N  N     . GLY B  1 219 ? 112.657 143.767 30.296  1.00 30.32 ? 247  GLY B N     1 
ATOM   4396  C  CA    . GLY B  1 219 ? 114.000 143.764 29.723  1.00 31.04 ? 247  GLY B CA    1 
ATOM   4397  C  C     . GLY B  1 219 ? 113.999 143.840 28.206  1.00 31.53 ? 247  GLY B C     1 
ATOM   4398  O  O     . GLY B  1 219 ? 112.941 143.849 27.588  1.00 31.99 ? 247  GLY B O     1 
ATOM   4399  N  N     . LYS B  1 220 ? 115.184 143.892 27.602  1.00 32.46 ? 248  LYS B N     1 
ATOM   4400  C  CA    . LYS B  1 220 ? 115.294 143.984 26.133  1.00 33.14 ? 248  LYS B CA    1 
ATOM   4401  C  C     . LYS B  1 220 ? 114.870 142.671 25.483  1.00 33.12 ? 248  LYS B C     1 
ATOM   4402  O  O     . LYS B  1 220 ? 115.142 141.595 26.025  1.00 33.04 ? 248  LYS B O     1 
ATOM   4403  C  CB    . LYS B  1 220 ? 116.720 144.344 25.692  1.00 33.51 ? 248  LYS B CB    1 
ATOM   4404  C  CG    . LYS B  1 220 ? 117.044 145.833 25.797  1.00 33.83 ? 248  LYS B CG    1 
ATOM   4405  N  N     . PRO B  1 221 ? 114.175 142.749 24.334  1.00 33.38 ? 249  PRO B N     1 
ATOM   4406  C  CA    . PRO B  1 221 ? 113.777 141.510 23.649  1.00 33.15 ? 249  PRO B CA    1 
ATOM   4407  C  C     . PRO B  1 221 ? 114.943 140.549 23.396  1.00 32.72 ? 249  PRO B C     1 
ATOM   4408  O  O     . PRO B  1 221 ? 116.055 140.984 23.127  1.00 33.15 ? 249  PRO B O     1 
ATOM   4409  C  CB    . PRO B  1 221 ? 113.176 141.995 22.318  1.00 33.40 ? 249  PRO B CB    1 
ATOM   4410  C  CG    . PRO B  1 221 ? 113.351 143.516 22.291  1.00 33.64 ? 249  PRO B CG    1 
ATOM   4411  C  CD    . PRO B  1 221 ? 113.691 143.967 23.654  1.00 33.48 ? 249  PRO B CD    1 
ATOM   4412  N  N     . GLU B  1 222 ? 114.689 139.251 23.506  1.00 32.17 ? 250  GLU B N     1 
ATOM   4413  C  CA    . GLU B  1 222 ? 115.685 138.249 23.122  1.00 31.90 ? 250  GLU B CA    1 
ATOM   4414  C  C     . GLU B  1 222 ? 116.007 138.379 21.630  1.00 30.53 ? 250  GLU B C     1 
ATOM   4415  O  O     . GLU B  1 222 ? 115.152 138.738 20.818  1.00 29.86 ? 250  GLU B O     1 
ATOM   4416  C  CB    . GLU B  1 222 ? 115.192 136.817 23.382  1.00 32.06 ? 250  GLU B CB    1 
ATOM   4417  C  CG    . GLU B  1 222 ? 114.853 136.465 24.828  1.00 35.70 ? 250  GLU B CG    1 
ATOM   4418  C  CD    . GLU B  1 222 ? 116.061 136.417 25.772  1.00 39.61 ? 250  GLU B CD    1 
ATOM   4419  O  OE1   . GLU B  1 222 ? 117.201 136.136 25.319  1.00 40.83 ? 250  GLU B OE1   1 
ATOM   4420  O  OE2   . GLU B  1 222 ? 115.849 136.652 26.992  1.00 41.68 ? 250  GLU B OE2   1 
ATOM   4421  N  N     . ASN B  1 223 ? 117.257 138.078 21.300  1.00 29.62 ? 251  ASN B N     1 
ATOM   4422  C  CA    . ASN B  1 223 ? 117.728 137.974 19.937  1.00 28.66 ? 251  ASN B CA    1 
ATOM   4423  C  C     . ASN B  1 223 ? 117.584 136.505 19.545  1.00 27.64 ? 251  ASN B C     1 
ATOM   4424  O  O     . ASN B  1 223 ? 118.339 135.650 20.018  1.00 27.80 ? 251  ASN B O     1 
ATOM   4425  C  CB    . ASN B  1 223 ? 119.192 138.445 19.882  1.00 28.74 ? 251  ASN B CB    1 
ATOM   4426  C  CG    . ASN B  1 223 ? 119.741 138.522 18.476  1.00 29.35 ? 251  ASN B CG    1 
ATOM   4427  O  OD1   . ASN B  1 223 ? 119.009 138.375 17.492  1.00 29.59 ? 251  ASN B OD1   1 
ATOM   4428  N  ND2   . ASN B  1 223 ? 121.051 138.763 18.371  1.00 30.63 ? 251  ASN B ND2   1 
ATOM   4429  N  N     . LYS B  1 224 ? 116.582 136.206 18.726  1.00 26.54 ? 252  LYS B N     1 
ATOM   4430  C  CA    . LYS B  1 224 ? 116.152 134.819 18.509  1.00 26.00 ? 252  LYS B CA    1 
ATOM   4431  C  C     . LYS B  1 224 ? 116.464 134.277 17.115  1.00 25.31 ? 252  LYS B C     1 
ATOM   4432  O  O     . LYS B  1 224 ? 116.646 135.029 16.159  1.00 24.54 ? 252  LYS B O     1 
ATOM   4433  C  CB    . LYS B  1 224 ? 114.650 134.655 18.772  1.00 25.94 ? 252  LYS B CB    1 
ATOM   4434  C  CG    . LYS B  1 224 ? 114.183 135.216 20.103  1.00 26.18 ? 252  LYS B CG    1 
ATOM   4435  C  CD    . LYS B  1 224 ? 112.812 134.720 20.498  1.00 25.74 ? 252  LYS B CD    1 
ATOM   4436  C  CE    . LYS B  1 224 ? 111.677 135.141 19.549  1.00 25.30 ? 252  LYS B CE    1 
ATOM   4437  N  NZ    . LYS B  1 224 ? 111.430 136.583 19.418  1.00 24.34 ? 252  LYS B NZ    1 
ATOM   4438  N  N     . LEU B  1 225 ? 116.488 132.951 17.033  1.00 24.76 ? 253  LEU B N     1 
ATOM   4439  C  CA    . LEU B  1 225 ? 116.652 132.227 15.784  1.00 24.43 ? 253  LEU B CA    1 
ATOM   4440  C  C     . LEU B  1 225 ? 115.514 132.547 14.806  1.00 24.74 ? 253  LEU B C     1 
ATOM   4441  O  O     . LEU B  1 225 ? 115.758 132.828 13.635  1.00 24.12 ? 253  LEU B O     1 
ATOM   4442  C  CB    . LEU B  1 225 ? 116.729 130.709 16.062  1.00 24.34 ? 253  LEU B CB    1 
ATOM   4443  C  CG    . LEU B  1 225 ? 116.620 129.725 14.885  1.00 24.48 ? 253  LEU B CG    1 
ATOM   4444  C  CD1   . LEU B  1 225 ? 117.757 129.937 13.853  1.00 22.61 ? 253  LEU B CD1   1 
ATOM   4445  C  CD2   . LEU B  1 225 ? 116.612 128.302 15.403  1.00 23.60 ? 253  LEU B CD2   1 
ATOM   4446  N  N     . GLY B  1 226 ? 114.281 132.522 15.305  1.00 24.33 ? 254  GLY B N     1 
ATOM   4447  C  CA    . GLY B  1 226 ? 113.091 132.800 14.504  1.00 24.74 ? 254  GLY B CA    1 
ATOM   4448  C  C     . GLY B  1 226 ? 112.009 133.388 15.394  1.00 24.58 ? 254  GLY B C     1 
ATOM   4449  O  O     . GLY B  1 226 ? 112.288 133.794 16.530  1.00 24.53 ? 254  GLY B O     1 
ATOM   4450  N  N     . LEU B  1 227 ? 110.776 133.421 14.898  1.00 25.23 ? 255  LEU B N     1 
ATOM   4451  C  CA    . LEU B  1 227 ? 109.697 134.182 15.549  1.00 26.12 ? 255  LEU B CA    1 
ATOM   4452  C  C     . LEU B  1 227 ? 110.188 135.572 15.997  1.00 25.84 ? 255  LEU B C     1 
ATOM   4453  O  O     . LEU B  1 227 ? 109.814 136.075 17.068  1.00 25.39 ? 255  LEU B O     1 
ATOM   4454  C  CB    . LEU B  1 227 ? 109.143 133.433 16.770  1.00 27.03 ? 255  LEU B CB    1 
ATOM   4455  C  CG    . LEU B  1 227 ? 108.016 132.403 16.707  1.00 31.10 ? 255  LEU B CG    1 
ATOM   4456  C  CD1   . LEU B  1 227 ? 107.182 132.604 17.995  1.00 33.16 ? 255  LEU B CD1   1 
ATOM   4457  C  CD2   . LEU B  1 227 ? 107.146 132.453 15.448  1.00 31.82 ? 255  LEU B CD2   1 
ATOM   4458  N  N     . ARG B  1 228 ? 111.018 136.191 15.163  1.00 25.48 ? 256  ARG B N     1 
ATOM   4459  C  CA    . ARG B  1 228 ? 111.782 137.363 15.562  1.00 25.35 ? 256  ARG B CA    1 
ATOM   4460  C  C     . ARG B  1 228 ? 110.937 138.624 15.762  1.00 25.41 ? 256  ARG B C     1 
ATOM   4461  O  O     . ARG B  1 228 ? 111.285 139.462 16.583  1.00 24.20 ? 256  ARG B O     1 
ATOM   4462  C  CB    . ARG B  1 228 ? 112.934 137.593 14.577  1.00 25.56 ? 256  ARG B CB    1 
ATOM   4463  C  CG    . ARG B  1 228 ? 114.039 136.539 14.755  1.00 25.25 ? 256  ARG B CG    1 
ATOM   4464  C  CD    . ARG B  1 228 ? 115.005 136.510 13.613  1.00 27.33 ? 256  ARG B CD    1 
ATOM   4465  N  NE    . ARG B  1 228 ? 115.619 137.804 13.322  1.00 28.20 ? 256  ARG B NE    1 
ATOM   4466  C  CZ    . ARG B  1 228 ? 116.659 138.335 13.965  1.00 30.44 ? 256  ARG B CZ    1 
ATOM   4467  N  NH1   . ARG B  1 228 ? 117.253 137.718 14.981  1.00 30.65 ? 256  ARG B NH1   1 
ATOM   4468  N  NH2   . ARG B  1 228 ? 117.121 139.515 13.581  1.00 31.26 ? 256  ARG B NH2   1 
ATOM   4469  N  N     . ALA B  1 229 ? 109.814 138.732 15.045  1.00 25.68 ? 257  ALA B N     1 
ATOM   4470  C  CA    . ALA B  1 229 ? 108.912 139.880 15.170  1.00 25.86 ? 257  ALA B CA    1 
ATOM   4471  C  C     . ALA B  1 229 ? 108.047 139.819 16.446  1.00 26.36 ? 257  ALA B C     1 
ATOM   4472  O  O     . ALA B  1 229 ? 107.461 140.825 16.846  1.00 26.41 ? 257  ALA B O     1 
ATOM   4473  C  CB    . ALA B  1 229 ? 108.016 140.013 13.919  1.00 25.12 ? 257  ALA B CB    1 
ATOM   4474  N  N     . SER B  1 230 ? 107.962 138.647 17.065  1.00 26.98 ? 258  SER B N     1 
ATOM   4475  C  CA    . SER B  1 230 ? 107.260 138.491 18.343  1.00 27.42 ? 258  SER B CA    1 
ATOM   4476  C  C     . SER B  1 230 ? 108.247 138.775 19.478  1.00 27.86 ? 258  SER B C     1 
ATOM   4477  O  O     . SER B  1 230 ? 109.230 138.047 19.645  1.00 27.92 ? 258  SER B O     1 
ATOM   4478  C  CB    . SER B  1 230 ? 106.648 137.091 18.466  1.00 27.49 ? 258  SER B CB    1 
ATOM   4479  O  OG    . SER B  1 230 ? 106.194 136.833 19.785  1.00 27.43 ? 258  SER B OG    1 
ATOM   4480  N  N     . SER B  1 231 ? 108.000 139.851 20.231  1.00 27.90 ? 259  SER B N     1 
ATOM   4481  C  CA    . SER B  1 231 ? 108.908 140.249 21.301  1.00 27.83 ? 259  SER B CA    1 
ATOM   4482  C  C     . SER B  1 231 ? 108.892 139.180 22.380  1.00 27.78 ? 259  SER B C     1 
ATOM   4483  O  O     . SER B  1 231 ? 107.843 138.633 22.700  1.00 28.33 ? 259  SER B O     1 
ATOM   4484  C  CB    . SER B  1 231 ? 108.564 141.631 21.875  1.00 28.08 ? 259  SER B CB    1 
ATOM   4485  O  OG    . SER B  1 231 ? 107.345 141.642 22.590  1.00 27.32 ? 259  SER B OG    1 
ATOM   4486  N  N     . THR B  1 232 ? 110.076 138.861 22.897  1.00 27.65 ? 260  THR B N     1 
ATOM   4487  C  CA    . THR B  1 232 ? 110.231 137.880 23.962  1.00 27.14 ? 260  THR B CA    1 
ATOM   4488  C  C     . THR B  1 232 ? 111.172 138.470 25.008  1.00 26.92 ? 260  THR B C     1 
ATOM   4489  O  O     . THR B  1 232 ? 112.383 138.576 24.781  1.00 26.28 ? 260  THR B O     1 
ATOM   4490  C  CB    . THR B  1 232 ? 110.792 136.559 23.426  1.00 27.76 ? 260  THR B CB    1 
ATOM   4491  O  OG1   . THR B  1 232 ? 110.029 136.144 22.285  1.00 28.34 ? 260  THR B OG1   1 
ATOM   4492  C  CG2   . THR B  1 232 ? 110.744 135.479 24.504  1.00 26.15 ? 260  THR B CG2   1 
ATOM   4493  N  N     . CYS B  1 233 ? 110.612 138.873 26.143  1.00 26.38 ? 261  CYS B N     1 
ATOM   4494  C  CA    . CYS B  1 233 ? 111.369 139.649 27.113  1.00 26.78 ? 261  CYS B CA    1 
ATOM   4495  C  C     . CYS B  1 233 ? 111.413 139.027 28.513  1.00 26.65 ? 261  CYS B C     1 
ATOM   4496  O  O     . CYS B  1 233 ? 110.444 138.399 28.961  1.00 26.17 ? 261  CYS B O     1 
ATOM   4497  C  CB    . CYS B  1 233 ? 110.777 141.051 27.218  1.00 27.10 ? 261  CYS B CB    1 
ATOM   4498  S  SG    . CYS B  1 233 ? 110.570 141.918 25.656  1.00 29.12 ? 261  CYS B SG    1 
ATOM   4499  N  N     . PRO B  1 234 ? 112.538 139.229 29.223  1.00 27.34 ? 262  PRO B N     1 
ATOM   4500  C  CA    . PRO B  1 234 ? 112.535 138.954 30.655  1.00 27.88 ? 262  PRO B CA    1 
ATOM   4501  C  C     . PRO B  1 234 ? 111.754 140.034 31.409  1.00 27.85 ? 262  PRO B C     1 
ATOM   4502  O  O     . PRO B  1 234 ? 111.734 141.202 30.992  1.00 27.43 ? 262  PRO B O     1 
ATOM   4503  C  CB    . PRO B  1 234 ? 114.019 138.997 31.048  1.00 28.24 ? 262  PRO B CB    1 
ATOM   4504  C  CG    . PRO B  1 234 ? 114.733 139.697 29.919  1.00 28.55 ? 262  PRO B CG    1 
ATOM   4505  C  CD    . PRO B  1 234 ? 113.833 139.736 28.731  1.00 27.36 ? 262  PRO B CD    1 
ATOM   4506  N  N     . LEU B  1 235 ? 111.121 139.639 32.507  1.00 28.19 ? 263  LEU B N     1 
ATOM   4507  C  CA    . LEU B  1 235 ? 110.463 140.582 33.412  1.00 28.61 ? 263  LEU B CA    1 
ATOM   4508  C  C     . LEU B  1 235 ? 111.100 140.469 34.779  1.00 28.48 ? 263  LEU B C     1 
ATOM   4509  O  O     . LEU B  1 235 ? 111.425 139.367 35.232  1.00 28.71 ? 263  LEU B O     1 
ATOM   4510  C  CB    . LEU B  1 235 ? 108.977 140.270 33.567  1.00 28.73 ? 263  LEU B CB    1 
ATOM   4511  C  CG    . LEU B  1 235 ? 108.086 140.213 32.332  1.00 29.83 ? 263  LEU B CG    1 
ATOM   4512  C  CD1   . LEU B  1 235 ? 106.652 140.051 32.790  1.00 30.96 ? 263  LEU B CD1   1 
ATOM   4513  C  CD2   . LEU B  1 235 ? 108.241 141.446 31.438  1.00 31.14 ? 263  LEU B CD2   1 
ATOM   4514  N  N     . THR B  1 236 ? 111.298 141.605 35.427  1.00 28.11 ? 264  THR B N     1 
ATOM   4515  C  CA    . THR B  1 236 ? 111.667 141.613 36.832  1.00 28.09 ? 264  THR B CA    1 
ATOM   4516  C  C     . THR B  1 236 ? 110.549 142.309 37.619  1.00 27.37 ? 264  THR B C     1 
ATOM   4517  O  O     . THR B  1 236 ? 110.049 143.368 37.215  1.00 26.42 ? 264  THR B O     1 
ATOM   4518  C  CB    . THR B  1 236 ? 113.029 142.293 37.074  1.00 28.23 ? 264  THR B CB    1 
ATOM   4519  O  OG1   . THR B  1 236 ? 112.972 143.658 36.661  1.00 30.70 ? 264  THR B OG1   1 
ATOM   4520  C  CG2   . THR B  1 236 ? 114.138 141.594 36.297  1.00 28.01 ? 264  THR B CG2   1 
ATOM   4521  N  N     . PHE B  1 237 ? 110.152 141.677 38.723  1.00 27.10 ? 265  PHE B N     1 
ATOM   4522  C  CA    . PHE B  1 237 ? 109.159 142.218 39.648  1.00 26.85 ? 265  PHE B CA    1 
ATOM   4523  C  C     . PHE B  1 237 ? 109.850 142.570 40.950  1.00 26.86 ? 265  PHE B C     1 
ATOM   4524  O  O     . PHE B  1 237 ? 110.147 141.692 41.759  1.00 27.22 ? 265  PHE B O     1 
ATOM   4525  C  CB    . PHE B  1 237 ? 108.050 141.197 39.920  1.00 26.72 ? 265  PHE B CB    1 
ATOM   4526  C  CG    . PHE B  1 237 ? 107.196 140.888 38.719  1.00 26.29 ? 265  PHE B CG    1 
ATOM   4527  C  CD1   . PHE B  1 237 ? 105.942 141.471 38.568  1.00 25.99 ? 265  PHE B CD1   1 
ATOM   4528  C  CD2   . PHE B  1 237 ? 107.646 140.019 37.735  1.00 26.84 ? 265  PHE B CD2   1 
ATOM   4529  C  CE1   . PHE B  1 237 ? 105.148 141.190 37.458  1.00 25.31 ? 265  PHE B CE1   1 
ATOM   4530  C  CE2   . PHE B  1 237 ? 106.853 139.727 36.622  1.00 26.03 ? 265  PHE B CE2   1 
ATOM   4531  C  CZ    . PHE B  1 237 ? 105.608 140.318 36.481  1.00 26.46 ? 265  PHE B CZ    1 
ATOM   4532  N  N     . GLU B  1 238 ? 110.117 143.856 41.136  1.00 26.60 ? 266  GLU B N     1 
ATOM   4533  C  CA    . GLU B  1 238 ? 110.665 144.359 42.375  1.00 26.67 ? 266  GLU B CA    1 
ATOM   4534  C  C     . GLU B  1 238 ? 109.543 145.055 43.126  1.00 25.45 ? 266  GLU B C     1 
ATOM   4535  O  O     . GLU B  1 238 ? 109.222 146.208 42.847  1.00 25.12 ? 266  GLU B O     1 
ATOM   4536  C  CB    . GLU B  1 238 ? 111.803 145.333 42.108  1.00 26.87 ? 266  GLU B CB    1 
ATOM   4537  C  CG    . GLU B  1 238 ? 113.003 144.720 41.413  1.00 28.74 ? 266  GLU B CG    1 
ATOM   4538  C  CD    . GLU B  1 238 ? 114.050 145.763 41.058  1.00 28.85 ? 266  GLU B CD    1 
ATOM   4539  O  OE1   . GLU B  1 238 ? 114.091 146.816 41.722  1.00 33.07 ? 266  GLU B OE1   1 
ATOM   4540  O  OE2   . GLU B  1 238 ? 114.821 145.531 40.108  1.00 33.04 ? 266  GLU B OE2   1 
ATOM   4541  N  N     . ASN B  1 239 ? 108.943 144.334 44.068  1.00 24.55 ? 267  ASN B N     1 
ATOM   4542  C  CA    . ASN B  1 239 ? 107.884 144.873 44.920  1.00 23.91 ? 267  ASN B CA    1 
ATOM   4543  C  C     . ASN B  1 239 ? 106.779 145.512 44.079  1.00 23.13 ? 267  ASN B C     1 
ATOM   4544  O  O     . ASN B  1 239 ? 106.445 146.686 44.239  1.00 23.08 ? 267  ASN B O     1 
ATOM   4545  C  CB    . ASN B  1 239 ? 108.464 145.855 45.935  1.00 24.20 ? 267  ASN B CB    1 
ATOM   4546  C  CG    . ASN B  1 239 ? 109.356 145.175 46.953  1.00 25.12 ? 267  ASN B CG    1 
ATOM   4547  O  OD1   . ASN B  1 239 ? 108.888 144.317 47.715  1.00 27.44 ? 267  ASN B OD1   1 
ATOM   4548  N  ND2   . ASN B  1 239 ? 110.637 145.567 46.991  1.00 23.50 ? 267  ASN B ND2   1 
ATOM   4549  N  N     . VAL B  1 240 ? 106.240 144.711 43.165  1.00 22.27 ? 268  VAL B N     1 
ATOM   4550  C  CA    . VAL B  1 240 ? 105.169 145.141 42.280  1.00 21.67 ? 268  VAL B CA    1 
ATOM   4551  C  C     . VAL B  1 240 ? 103.847 144.966 43.020  1.00 21.50 ? 268  VAL B C     1 
ATOM   4552  O  O     . VAL B  1 240 ? 103.524 143.881 43.488  1.00 21.63 ? 268  VAL B O     1 
ATOM   4553  C  CB    . VAL B  1 240 ? 105.178 144.341 40.965  1.00 21.41 ? 268  VAL B CB    1 
ATOM   4554  C  CG1   . VAL B  1 240 ? 103.901 144.608 40.162  1.00 21.20 ? 268  VAL B CG1   1 
ATOM   4555  C  CG2   . VAL B  1 240 ? 106.413 144.698 40.164  1.00 20.56 ? 268  VAL B CG2   1 
ATOM   4556  N  N     . LYS B  1 241 ? 103.085 146.040 43.133  1.00 21.74 ? 269  LYS B N     1 
ATOM   4557  C  CA    . LYS B  1 241 ? 101.917 146.032 44.003  1.00 21.78 ? 269  LYS B CA    1 
ATOM   4558  C  C     . LYS B  1 241 ? 100.662 145.918 43.158  1.00 22.12 ? 269  LYS B C     1 
ATOM   4559  O  O     . LYS B  1 241 ? 100.431 146.745 42.290  1.00 22.75 ? 269  LYS B O     1 
ATOM   4560  C  CB    . LYS B  1 241 ? 101.917 147.274 44.864  1.00 21.65 ? 269  LYS B CB    1 
ATOM   4561  C  CG    . LYS B  1 241 ? 103.171 147.403 45.722  1.00 20.36 ? 269  LYS B CG    1 
ATOM   4562  C  CD    . LYS B  1 241 ? 103.229 148.766 46.350  1.00 18.71 ? 269  LYS B CD    1 
ATOM   4563  C  CE    . LYS B  1 241 ? 104.547 149.027 47.028  1.00 17.27 ? 269  LYS B CE    1 
ATOM   4564  N  NZ    . LYS B  1 241 ? 104.605 150.432 47.492  1.00 15.98 ? 269  LYS B NZ    1 
ATOM   4565  N  N     . VAL B  1 242 ? 99.896  144.851 43.383  1.00 22.33 ? 270  VAL B N     1 
ATOM   4566  C  CA    . VAL B  1 242 ? 98.668  144.584 42.640  1.00 22.11 ? 270  VAL B CA    1 
ATOM   4567  C  C     . VAL B  1 242 ? 97.487  144.681 43.627  1.00 22.42 ? 270  VAL B C     1 
ATOM   4568  O  O     . VAL B  1 242 ? 97.493  144.015 44.668  1.00 21.30 ? 270  VAL B O     1 
ATOM   4569  C  CB    . VAL B  1 242 ? 98.713  143.194 41.966  1.00 22.46 ? 270  VAL B CB    1 
ATOM   4570  C  CG1   . VAL B  1 242 ? 97.518  142.994 41.038  1.00 22.13 ? 270  VAL B CG1   1 
ATOM   4571  C  CG2   . VAL B  1 242 ? 100.033 143.010 41.184  1.00 21.68 ? 270  VAL B CG2   1 
ATOM   4572  N  N     . PRO B  1 243 ? 96.476  145.516 43.305  1.00 22.76 ? 271  PRO B N     1 
ATOM   4573  C  CA    . PRO B  1 243 ? 95.298  145.595 44.162  1.00 23.33 ? 271  PRO B CA    1 
ATOM   4574  C  C     . PRO B  1 243 ? 94.591  144.249 44.289  1.00 23.79 ? 271  PRO B C     1 
ATOM   4575  O  O     . PRO B  1 243 ? 94.540  143.492 43.329  1.00 23.46 ? 271  PRO B O     1 
ATOM   4576  C  CB    . PRO B  1 243 ? 94.396  146.630 43.470  1.00 23.39 ? 271  PRO B CB    1 
ATOM   4577  C  CG    . PRO B  1 243 ? 95.013  146.953 42.189  1.00 22.76 ? 271  PRO B CG    1 
ATOM   4578  C  CD    . PRO B  1 243 ? 96.393  146.412 42.139  1.00 22.93 ? 271  PRO B CD    1 
ATOM   4579  N  N     . GLU B  1 244 ? 94.044  143.958 45.469  1.00 24.48 ? 272  GLU B N     1 
ATOM   4580  C  CA    . GLU B  1 244 ? 93.412  142.658 45.703  1.00 24.97 ? 272  GLU B CA    1 
ATOM   4581  C  C     . GLU B  1 244 ? 92.259  142.405 44.726  1.00 24.94 ? 272  GLU B C     1 
ATOM   4582  O  O     . GLU B  1 244 ? 91.947  141.255 44.401  1.00 24.73 ? 272  GLU B O     1 
ATOM   4583  C  CB    . GLU B  1 244 ? 92.945  142.525 47.153  1.00 24.86 ? 272  GLU B CB    1 
ATOM   4584  C  CG    . GLU B  1 244 ? 91.802  143.438 47.544  1.00 25.91 ? 272  GLU B CG    1 
ATOM   4585  C  CD    . GLU B  1 244 ? 91.501  143.390 49.031  1.00 26.22 ? 272  GLU B CD    1 
ATOM   4586  O  OE1   . GLU B  1 244 ? 91.863  142.382 49.684  1.00 28.46 ? 272  GLU B OE1   1 
ATOM   4587  O  OE2   . GLU B  1 244 ? 90.900  144.359 49.542  1.00 27.50 ? 272  GLU B OE2   1 
ATOM   4588  N  N     . ALA B  1 245 ? 91.656  143.489 44.242  1.00 24.94 ? 273  ALA B N     1 
ATOM   4589  C  CA    . ALA B  1 245 ? 90.612  143.418 43.220  1.00 25.19 ? 273  ALA B CA    1 
ATOM   4590  C  C     . ALA B  1 245 ? 91.106  142.773 41.915  1.00 25.17 ? 273  ALA B C     1 
ATOM   4591  O  O     . ALA B  1 245 ? 90.309  142.243 41.140  1.00 25.21 ? 273  ALA B O     1 
ATOM   4592  C  CB    . ALA B  1 245 ? 90.053  144.828 42.947  1.00 25.23 ? 273  ALA B CB    1 
ATOM   4593  N  N     . ASN B  1 246 ? 92.418  142.805 41.690  1.00 25.29 ? 274  ASN B N     1 
ATOM   4594  C  CA    . ASN B  1 246 ? 93.016  142.310 40.447  1.00 25.35 ? 274  ASN B CA    1 
ATOM   4595  C  C     . ASN B  1 246 ? 93.450  140.839 40.465  1.00 25.65 ? 274  ASN B C     1 
ATOM   4596  O  O     . ASN B  1 246 ? 94.117  140.398 39.528  1.00 25.20 ? 274  ASN B O     1 
ATOM   4597  C  CB    . ASN B  1 246 ? 94.205  143.191 40.039  1.00 25.26 ? 274  ASN B CB    1 
ATOM   4598  C  CG    . ASN B  1 246 ? 93.780  144.487 39.368  1.00 25.89 ? 274  ASN B CG    1 
ATOM   4599  O  OD1   . ASN B  1 246 ? 92.724  145.040 39.662  1.00 25.21 ? 274  ASN B OD1   1 
ATOM   4600  N  ND2   . ASN B  1 246 ? 94.621  144.985 38.469  1.00 27.32 ? 274  ASN B ND2   1 
ATOM   4601  N  N     . ILE B  1 247 ? 93.086  140.086 41.507  1.00 25.96 ? 275  ILE B N     1 
ATOM   4602  C  CA    . ILE B  1 247 ? 93.265  138.634 41.487  1.00 26.94 ? 275  ILE B CA    1 
ATOM   4603  C  C     . ILE B  1 247 ? 92.223  138.042 40.542  1.00 27.53 ? 275  ILE B C     1 
ATOM   4604  O  O     . ILE B  1 247 ? 91.030  138.305 40.679  1.00 27.20 ? 275  ILE B O     1 
ATOM   4605  C  CB    . ILE B  1 247 ? 93.099  137.967 42.872  1.00 26.83 ? 275  ILE B CB    1 
ATOM   4606  C  CG1   . ILE B  1 247 ? 94.182  138.422 43.848  1.00 27.43 ? 275  ILE B CG1   1 
ATOM   4607  C  CG2   . ILE B  1 247 ? 93.172  136.446 42.754  1.00 26.57 ? 275  ILE B CG2   1 
ATOM   4608  C  CD1   . ILE B  1 247 ? 93.875  138.030 45.298  1.00 27.41 ? 275  ILE B CD1   1 
ATOM   4609  N  N     . LEU B  1 248 ? 92.689  137.261 39.575  1.00 28.51 ? 276  LEU B N     1 
ATOM   4610  C  CA    . LEU B  1 248 ? 91.812  136.558 38.647  1.00 29.09 ? 276  LEU B CA    1 
ATOM   4611  C  C     . LEU B  1 248 ? 91.453  135.180 39.219  1.00 29.54 ? 276  LEU B C     1 
ATOM   4612  O  O     . LEU B  1 248 ? 92.322  134.313 39.392  1.00 29.87 ? 276  LEU B O     1 
ATOM   4613  C  CB    . LEU B  1 248 ? 92.492  136.414 37.283  1.00 29.28 ? 276  LEU B CB    1 
ATOM   4614  C  CG    . LEU B  1 248 ? 91.660  135.841 36.135  1.00 29.00 ? 276  LEU B CG    1 
ATOM   4615  C  CD1   . LEU B  1 248 ? 90.555  136.817 35.757  1.00 29.36 ? 276  LEU B CD1   1 
ATOM   4616  C  CD2   . LEU B  1 248 ? 92.563  135.549 34.940  1.00 29.13 ? 276  LEU B CD2   1 
ATOM   4617  N  N     . GLY B  1 249 ? 90.170  134.994 39.512  1.00 30.00 ? 277  GLY B N     1 
ATOM   4618  C  CA    . GLY B  1 249 ? 89.668  133.730 40.030  1.00 30.39 ? 277  GLY B CA    1 
ATOM   4619  C  C     . GLY B  1 249 ? 89.897  133.591 41.522  1.00 30.66 ? 277  GLY B C     1 
ATOM   4620  O  O     . GLY B  1 249 ? 89.882  134.583 42.262  1.00 30.75 ? 277  GLY B O     1 
ATOM   4621  N  N     . GLN B  1 250 ? 90.109  132.352 41.956  1.00 30.98 ? 278  GLN B N     1 
ATOM   4622  C  CA    . GLN B  1 250 ? 90.309  132.028 43.365  1.00 31.42 ? 278  GLN B CA    1 
ATOM   4623  C  C     . GLN B  1 250 ? 91.805  131.940 43.674  1.00 31.27 ? 278  GLN B C     1 
ATOM   4624  O  O     . GLN B  1 250 ? 92.601  131.549 42.816  1.00 31.28 ? 278  GLN B O     1 
ATOM   4625  C  CB    . GLN B  1 250 ? 89.600  130.707 43.702  1.00 31.64 ? 278  GLN B CB    1 
ATOM   4626  C  CG    . GLN B  1 250 ? 89.853  130.179 45.112  1.00 32.54 ? 278  GLN B CG    1 
ATOM   4627  N  N     . ILE B  1 251 ? 92.174  132.317 44.899  1.00 31.08 ? 279  ILE B N     1 
ATOM   4628  C  CA    . ILE B  1 251 ? 93.555  132.212 45.365  1.00 31.03 ? 279  ILE B CA    1 
ATOM   4629  C  C     . ILE B  1 251 ? 93.946  130.744 45.381  1.00 31.04 ? 279  ILE B C     1 
ATOM   4630  O  O     . ILE B  1 251 ? 93.159  129.894 45.804  1.00 30.89 ? 279  ILE B O     1 
ATOM   4631  C  CB    . ILE B  1 251 ? 93.732  132.807 46.791  1.00 30.99 ? 279  ILE B CB    1 
ATOM   4632  C  CG1   . ILE B  1 251 ? 93.513  134.319 46.773  1.00 30.84 ? 279  ILE B CG1   1 
ATOM   4633  C  CG2   . ILE B  1 251 ? 95.125  132.506 47.342  1.00 30.97 ? 279  ILE B CG2   1 
ATOM   4634  C  CD1   . ILE B  1 251 ? 93.596  134.971 48.153  1.00 31.34 ? 279  ILE B CD1   1 
ATOM   4635  N  N     . GLY B  1 252 ? 95.153  130.450 44.907  1.00 31.34 ? 280  GLY B N     1 
ATOM   4636  C  CA    . GLY B  1 252 ? 95.657  129.079 44.859  1.00 31.69 ? 280  GLY B CA    1 
ATOM   4637  C  C     . GLY B  1 252 ? 95.151  128.232 43.697  1.00 31.88 ? 280  GLY B C     1 
ATOM   4638  O  O     . GLY B  1 252 ? 95.494  127.051 43.600  1.00 31.57 ? 280  GLY B O     1 
ATOM   4639  N  N     . HIS B  1 253 ? 94.338  128.826 42.821  1.00 32.32 ? 281  HIS B N     1 
ATOM   4640  C  CA    . HIS B  1 253 ? 93.793  128.132 41.643  1.00 32.45 ? 281  HIS B CA    1 
ATOM   4641  C  C     . HIS B  1 253 ? 94.454  128.595 40.344  1.00 32.03 ? 281  HIS B C     1 
ATOM   4642  O  O     . HIS B  1 253 ? 94.091  128.127 39.257  1.00 31.57 ? 281  HIS B O     1 
ATOM   4643  C  CB    . HIS B  1 253 ? 92.283  128.351 41.547  1.00 32.97 ? 281  HIS B CB    1 
ATOM   4644  C  CG    . HIS B  1 253 ? 91.491  127.584 42.558  1.00 34.14 ? 281  HIS B CG    1 
ATOM   4645  N  ND1   . HIS B  1 253 ? 90.290  126.981 42.253  1.00 35.78 ? 281  HIS B ND1   1 
ATOM   4646  C  CD2   . HIS B  1 253 ? 91.725  127.320 43.865  1.00 36.28 ? 281  HIS B CD2   1 
ATOM   4647  C  CE1   . HIS B  1 253 ? 89.814  126.386 43.333  1.00 36.48 ? 281  HIS B CE1   1 
ATOM   4648  N  NE2   . HIS B  1 253 ? 90.666  126.575 44.324  1.00 36.69 ? 281  HIS B NE2   1 
ATOM   4649  N  N     . GLY B  1 254 ? 95.417  129.511 40.460  1.00 31.66 ? 282  GLY B N     1 
ATOM   4650  C  CA    . GLY B  1 254 ? 96.172  130.008 39.310  1.00 31.27 ? 282  GLY B CA    1 
ATOM   4651  C  C     . GLY B  1 254 ? 96.896  128.924 38.529  1.00 31.33 ? 282  GLY B C     1 
ATOM   4652  O  O     . GLY B  1 254 ? 97.004  129.021 37.305  1.00 30.94 ? 282  GLY B O     1 
ATOM   4653  N  N     . TYR B  1 255 ? 97.391  127.895 39.228  1.00 31.16 ? 283  TYR B N     1 
ATOM   4654  C  CA    . TYR B  1 255 ? 98.030  126.747 38.562  1.00 31.35 ? 283  TYR B CA    1 
ATOM   4655  C  C     . TYR B  1 255 ? 97.049  126.036 37.623  1.00 31.24 ? 283  TYR B C     1 
ATOM   4656  O  O     . TYR B  1 255 ? 97.425  125.599 36.530  1.00 30.20 ? 283  TYR B O     1 
ATOM   4657  C  CB    . TYR B  1 255 ? 98.649  125.760 39.578  1.00 31.72 ? 283  TYR B CB    1 
ATOM   4658  C  CG    . TYR B  1 255 ? 97.679  124.839 40.308  1.00 32.46 ? 283  TYR B CG    1 
ATOM   4659  C  CD1   . TYR B  1 255 ? 97.350  123.588 39.780  1.00 32.99 ? 283  TYR B CD1   1 
ATOM   4660  C  CD2   . TYR B  1 255 ? 97.114  125.200 41.532  1.00 32.41 ? 283  TYR B CD2   1 
ATOM   4661  C  CE1   . TYR B  1 255 ? 96.464  122.735 40.436  1.00 32.63 ? 283  TYR B CE1   1 
ATOM   4662  C  CE2   . TYR B  1 255 ? 96.225  124.341 42.197  1.00 32.96 ? 283  TYR B CE2   1 
ATOM   4663  C  CZ    . TYR B  1 255 ? 95.912  123.110 41.637  1.00 32.89 ? 283  TYR B CZ    1 
ATOM   4664  O  OH    . TYR B  1 255 ? 95.036  122.252 42.273  1.00 33.32 ? 283  TYR B OH    1 
ATOM   4665  N  N     . LYS B  1 256 ? 95.792  125.947 38.052  1.00 31.08 ? 284  LYS B N     1 
ATOM   4666  C  CA    . LYS B  1 256 ? 94.732  125.325 37.267  1.00 31.70 ? 284  LYS B CA    1 
ATOM   4667  C  C     . LYS B  1 256 ? 94.344  126.161 36.040  1.00 31.94 ? 284  LYS B C     1 
ATOM   4668  O  O     . LYS B  1 256 ? 94.081  125.619 34.955  1.00 31.44 ? 284  LYS B O     1 
ATOM   4669  C  CB    . LYS B  1 256 ? 93.512  125.066 38.152  1.00 31.72 ? 284  LYS B CB    1 
ATOM   4670  C  CG    . LYS B  1 256 ? 92.176  125.192 37.435  1.00 33.45 ? 284  LYS B CG    1 
ATOM   4671  N  N     . TYR B  1 257 ? 94.304  127.477 36.217  1.00 32.36 ? 285  TYR B N     1 
ATOM   4672  C  CA    . TYR B  1 257 ? 93.956  128.386 35.128  1.00 32.95 ? 285  TYR B CA    1 
ATOM   4673  C  C     . TYR B  1 257 ? 95.071  128.391 34.111  1.00 33.40 ? 285  TYR B C     1 
ATOM   4674  O  O     . TYR B  1 257 ? 94.818  128.340 32.915  1.00 33.61 ? 285  TYR B O     1 
ATOM   4675  C  CB    . TYR B  1 257 ? 93.712  129.811 35.641  1.00 33.01 ? 285  TYR B CB    1 
ATOM   4676  C  CG    . TYR B  1 257 ? 92.745  129.915 36.791  1.00 33.13 ? 285  TYR B CG    1 
ATOM   4677  C  CD1   . TYR B  1 257 ? 91.651  129.060 36.893  1.00 32.89 ? 285  TYR B CD1   1 
ATOM   4678  C  CD2   . TYR B  1 257 ? 92.911  130.892 37.776  1.00 33.43 ? 285  TYR B CD2   1 
ATOM   4679  C  CE1   . TYR B  1 257 ? 90.764  129.161 37.952  1.00 33.18 ? 285  TYR B CE1   1 
ATOM   4680  C  CE2   . TYR B  1 257 ? 92.026  131.001 38.838  1.00 32.88 ? 285  TYR B CE2   1 
ATOM   4681  C  CZ    . TYR B  1 257 ? 90.952  130.138 38.922  1.00 33.31 ? 285  TYR B CZ    1 
ATOM   4682  O  OH    . TYR B  1 257 ? 90.066  130.244 39.975  1.00 33.72 ? 285  TYR B OH    1 
ATOM   4683  N  N     . ALA B  1 258 ? 96.308  128.439 34.605  1.00 33.93 ? 286  ALA B N     1 
ATOM   4684  C  CA    . ALA B  1 258 ? 97.488  128.388 33.758  1.00 34.43 ? 286  ALA B CA    1 
ATOM   4685  C  C     . ALA B  1 258 ? 97.405  127.199 32.811  1.00 34.77 ? 286  ALA B C     1 
ATOM   4686  O  O     . ALA B  1 258 ? 97.351  127.376 31.590  1.00 34.66 ? 286  ALA B O     1 
ATOM   4687  C  CB    . ALA B  1 258 ? 98.768  128.297 34.612  1.00 34.54 ? 286  ALA B CB    1 
ATOM   4688  N  N     . ILE B  1 259 ? 97.363  125.990 33.378  1.00 34.60 ? 287  ILE B N     1 
ATOM   4689  C  CA    . ILE B  1 259 ? 97.441  124.775 32.570  1.00 34.68 ? 287  ILE B CA    1 
ATOM   4690  C  C     . ILE B  1 259 ? 96.168  124.535 31.737  1.00 34.24 ? 287  ILE B C     1 
ATOM   4691  O  O     . ILE B  1 259 ? 96.248  123.978 30.640  1.00 33.76 ? 287  ILE B O     1 
ATOM   4692  C  CB    . ILE B  1 259 ? 97.851  123.533 33.423  1.00 34.90 ? 287  ILE B CB    1 
ATOM   4693  C  CG1   . ILE B  1 259 ? 98.341  122.378 32.524  1.00 36.19 ? 287  ILE B CG1   1 
ATOM   4694  C  CG2   . ILE B  1 259 ? 96.712  123.099 34.330  1.00 33.63 ? 287  ILE B CG2   1 
ATOM   4695  C  CD1   . ILE B  1 259 ? 99.460  122.722 31.502  1.00 36.83 ? 287  ILE B CD1   1 
ATOM   4696  N  N     . GLY B  1 260 ? 95.023  125.001 32.233  1.00 33.67 ? 288  GLY B N     1 
ATOM   4697  C  CA    . GLY B  1 260 ? 93.781  124.971 31.466  1.00 33.56 ? 288  GLY B CA    1 
ATOM   4698  C  C     . GLY B  1 260 ? 93.851  125.796 30.183  1.00 33.53 ? 288  GLY B C     1 
ATOM   4699  O  O     . GLY B  1 260 ? 93.506  125.313 29.096  1.00 32.95 ? 288  GLY B O     1 
ATOM   4700  N  N     . SER B  1 261 ? 94.307  127.043 30.300  1.00 33.25 ? 289  SER B N     1 
ATOM   4701  C  CA    . SER B  1 261 ? 94.417  127.914 29.132  1.00 32.99 ? 289  SER B CA    1 
ATOM   4702  C  C     . SER B  1 261 ? 95.445  127.340 28.162  1.00 32.63 ? 289  SER B C     1 
ATOM   4703  O  O     . SER B  1 261 ? 95.243  127.375 26.944  1.00 32.06 ? 289  SER B O     1 
ATOM   4704  C  CB    . SER B  1 261 ? 94.760  129.358 29.548  1.00 33.26 ? 289  SER B CB    1 
ATOM   4705  O  OG    . SER B  1 261 ? 96.038  129.428 30.165  1.00 33.93 ? 289  SER B OG    1 
ATOM   4706  N  N     . LEU B  1 262 ? 96.522  126.776 28.713  1.00 32.02 ? 290  LEU B N     1 
ATOM   4707  C  CA    . LEU B  1 262 ? 97.573  126.141 27.920  1.00 31.98 ? 290  LEU B CA    1 
ATOM   4708  C  C     . LEU B  1 262 ? 97.121  124.848 27.208  1.00 31.38 ? 290  LEU B C     1 
ATOM   4709  O  O     . LEU B  1 262 ? 97.637  124.527 26.141  1.00 31.25 ? 290  LEU B O     1 
ATOM   4710  C  CB    . LEU B  1 262 ? 98.820  125.877 28.781  1.00 31.79 ? 290  LEU B CB    1 
ATOM   4711  C  CG    . LEU B  1 262 ? 99.561  127.143 29.262  1.00 33.05 ? 290  LEU B CG    1 
ATOM   4712  C  CD1   . LEU B  1 262 ? 100.383 126.866 30.522  1.00 33.61 ? 290  LEU B CD1   1 
ATOM   4713  C  CD2   . LEU B  1 262 ? 100.453 127.747 28.160  1.00 32.92 ? 290  LEU B CD2   1 
ATOM   4714  N  N     . ASN B  1 263 ? 96.175  124.111 27.785  1.00 30.67 ? 291  ASN B N     1 
ATOM   4715  C  CA    . ASN B  1 263 ? 95.558  122.991 27.066  1.00 30.61 ? 291  ASN B CA    1 
ATOM   4716  C  C     . ASN B  1 263 ? 94.894  123.480 25.776  1.00 30.25 ? 291  ASN B C     1 
ATOM   4717  O  O     . ASN B  1 263 ? 95.040  122.867 24.705  1.00 29.76 ? 291  ASN B O     1 
ATOM   4718  C  CB    . ASN B  1 263 ? 94.542  122.246 27.936  1.00 30.52 ? 291  ASN B CB    1 
ATOM   4719  C  CG    . ASN B  1 263 ? 95.199  121.383 29.003  1.00 31.51 ? 291  ASN B CG    1 
ATOM   4720  O  OD1   . ASN B  1 263 ? 96.318  120.892 28.828  1.00 32.41 ? 291  ASN B OD1   1 
ATOM   4721  N  ND2   . ASN B  1 263 ? 94.497  121.186 30.110  1.00 29.69 ? 291  ASN B ND2   1 
ATOM   4722  N  N     . GLU B  1 264 ? 94.194  124.603 25.879  1.00 29.70 ? 292  GLU B N     1 
ATOM   4723  C  CA    . GLU B  1 264 ? 93.590  125.256 24.717  1.00 30.45 ? 292  GLU B CA    1 
ATOM   4724  C  C     . GLU B  1 264 ? 94.665  125.902 23.815  1.00 29.29 ? 292  GLU B C     1 
ATOM   4725  O  O     . GLU B  1 264 ? 94.595  125.806 22.593  1.00 28.80 ? 292  GLU B O     1 
ATOM   4726  C  CB    . GLU B  1 264 ? 92.554  126.292 25.181  1.00 31.08 ? 292  GLU B CB    1 
ATOM   4727  C  CG    . GLU B  1 264 ? 91.690  126.826 24.071  1.00 33.03 ? 292  GLU B CG    1 
ATOM   4728  C  CD    . GLU B  1 264 ? 90.520  127.665 24.572  1.00 33.13 ? 292  GLU B CD    1 
ATOM   4729  O  OE1   . GLU B  1 264 ? 89.823  127.259 25.538  1.00 37.66 ? 292  GLU B OE1   1 
ATOM   4730  O  OE2   . GLU B  1 264 ? 90.297  128.741 23.981  1.00 38.74 ? 292  GLU B OE2   1 
ATOM   4731  N  N     . GLY B  1 265 ? 95.672  126.519 24.432  1.00 28.49 ? 293  GLY B N     1 
ATOM   4732  C  CA    . GLY B  1 265 ? 96.788  127.103 23.719  1.00 28.57 ? 293  GLY B CA    1 
ATOM   4733  C  C     . GLY B  1 265 ? 97.520  126.087 22.861  1.00 27.98 ? 293  GLY B C     1 
ATOM   4734  O  O     . GLY B  1 265 ? 98.059  126.421 21.819  1.00 28.17 ? 293  GLY B O     1 
ATOM   4735  N  N     . ARG B  1 266 ? 97.533  124.836 23.300  1.00 27.55 ? 294  ARG B N     1 
ATOM   4736  C  CA    . ARG B  1 266 ? 98.189  123.785 22.543  1.00 27.44 ? 294  ARG B CA    1 
ATOM   4737  C  C     . ARG B  1 266 ? 97.522  123.553 21.190  1.00 26.13 ? 294  ARG B C     1 
ATOM   4738  O  O     . ARG B  1 266 ? 98.204  123.269 20.227  1.00 25.12 ? 294  ARG B O     1 
ATOM   4739  C  CB    . ARG B  1 266 ? 98.295  122.501 23.371  1.00 28.01 ? 294  ARG B CB    1 
ATOM   4740  C  CG    A ARG B  1 266 ? 99.516  122.603 24.284  0.50 28.20 ? 294  ARG B CG    1 
ATOM   4741  C  CG    B ARG B  1 266 ? 99.470  122.453 24.351  0.50 29.61 ? 294  ARG B CG    1 
ATOM   4742  C  CD    A ARG B  1 266 ? 99.464  121.757 25.519  0.50 28.15 ? 294  ARG B CD    1 
ATOM   4743  C  CD    B ARG B  1 266 ? 99.007  122.043 25.737  0.50 31.56 ? 294  ARG B CD    1 
ATOM   4744  N  NE    A ARG B  1 266 ? 100.506 122.181 26.462  0.50 27.20 ? 294  ARG B NE    1 
ATOM   4745  N  NE    B ARG B  1 266 ? 99.776  120.952 26.335  0.50 32.55 ? 294  ARG B NE    1 
ATOM   4746  C  CZ    A ARG B  1 266 ? 100.708 121.631 27.657  0.50 26.84 ? 294  ARG B CZ    1 
ATOM   4747  C  CZ    B ARG B  1 266 ? 99.249  119.860 26.885  0.50 32.04 ? 294  ARG B CZ    1 
ATOM   4748  N  NH1   A ARG B  1 266 ? 99.941  120.637 28.092  0.50 26.42 ? 294  ARG B NH1   1 
ATOM   4749  N  NH1   B ARG B  1 266 ? 97.928  119.666 26.918  0.50 31.61 ? 294  ARG B NH1   1 
ATOM   4750  N  NH2   A ARG B  1 266 ? 101.680 122.092 28.422  0.50 27.13 ? 294  ARG B NH2   1 
ATOM   4751  N  NH2   B ARG B  1 266 ? 100.059 118.946 27.404  0.50 31.83 ? 294  ARG B NH2   1 
ATOM   4752  N  N     . ILE B  1 267 ? 96.208  123.721 21.123  1.00 25.32 ? 295  ILE B N     1 
ATOM   4753  C  CA    . ILE B  1 267 ? 95.494  123.650 19.852  1.00 24.86 ? 295  ILE B CA    1 
ATOM   4754  C  C     . ILE B  1 267 ? 95.874  124.863 18.997  1.00 25.10 ? 295  ILE B C     1 
ATOM   4755  O  O     . ILE B  1 267 ? 96.035  124.741 17.784  1.00 25.37 ? 295  ILE B O     1 
ATOM   4756  C  CB    . ILE B  1 267 ? 93.979  123.582 20.053  1.00 24.83 ? 295  ILE B CB    1 
ATOM   4757  C  CG1   . ILE B  1 267 ? 93.616  122.411 20.984  1.00 24.87 ? 295  ILE B CG1   1 
ATOM   4758  C  CG2   . ILE B  1 267 ? 93.259  123.408 18.706  1.00 24.47 ? 295  ILE B CG2   1 
ATOM   4759  C  CD1   . ILE B  1 267 ? 92.151  122.311 21.334  1.00 24.55 ? 295  ILE B CD1   1 
ATOM   4760  N  N     . GLY B  1 268 ? 96.024  126.022 19.643  1.00 24.55 ? 296  GLY B N     1 
ATOM   4761  C  CA    . GLY B  1 268 ? 96.445  127.245 18.981  1.00 25.08 ? 296  GLY B CA    1 
ATOM   4762  C  C     . GLY B  1 268 ? 97.833  127.155 18.364  1.00 24.91 ? 296  GLY B C     1 
ATOM   4763  O  O     . GLY B  1 268 ? 98.042  127.606 17.246  1.00 25.91 ? 296  GLY B O     1 
ATOM   4764  N  N     . ILE B  1 269 ? 98.786  126.583 19.093  1.00 24.53 ? 297  ILE B N     1 
ATOM   4765  C  CA    . ILE B  1 269 ? 100.121 126.391 18.549  1.00 24.26 ? 297  ILE B CA    1 
ATOM   4766  C  C     . ILE B  1 269 ? 100.137 125.313 17.456  1.00 23.83 ? 297  ILE B C     1 
ATOM   4767  O  O     . ILE B  1 269 ? 100.867 125.441 16.485  1.00 23.88 ? 297  ILE B O     1 
ATOM   4768  C  CB    . ILE B  1 269 ? 101.163 126.114 19.654  1.00 24.05 ? 297  ILE B CB    1 
ATOM   4769  C  CG1   . ILE B  1 269 ? 101.223 127.298 20.610  1.00 24.18 ? 297  ILE B CG1   1 
ATOM   4770  C  CG2   . ILE B  1 269 ? 102.577 125.872 19.065  1.00 23.31 ? 297  ILE B CG2   1 
ATOM   4771  C  CD1   . ILE B  1 269 ? 101.542 128.668 19.941  1.00 23.36 ? 297  ILE B CD1   1 
ATOM   4772  N  N     . ALA B  1 270 ? 99.322  124.270 17.599  1.00 23.71 ? 298  ALA B N     1 
ATOM   4773  C  CA    . ALA B  1 270 ? 99.186  123.285 16.530  1.00 23.56 ? 298  ALA B CA    1 
ATOM   4774  C  C     . ALA B  1 270 ? 98.741  123.963 15.220  1.00 23.60 ? 298  ALA B C     1 
ATOM   4775  O  O     . ALA B  1 270 ? 99.315  123.709 14.165  1.00 23.71 ? 298  ALA B O     1 
ATOM   4776  C  CB    . ALA B  1 270 ? 98.218  122.183 16.931  1.00 23.09 ? 298  ALA B CB    1 
ATOM   4777  N  N     . ALA B  1 271 ? 97.759  124.856 15.324  1.00 23.38 ? 299  ALA B N     1 
ATOM   4778  C  CA    . ALA B  1 271 ? 97.253  125.647 14.194  1.00 23.72 ? 299  ALA B CA    1 
ATOM   4779  C  C     . ALA B  1 271 ? 98.308  126.572 13.597  1.00 23.56 ? 299  ALA B C     1 
ATOM   4780  O  O     . ALA B  1 271 ? 98.395  126.712 12.384  1.00 23.45 ? 299  ALA B O     1 
ATOM   4781  C  CB    . ALA B  1 271 ? 96.031  126.463 14.629  1.00 22.57 ? 299  ALA B CB    1 
ATOM   4782  N  N     . GLN B  1 272 ? 99.090  127.216 14.460  1.00 23.98 ? 300  GLN B N     1 
ATOM   4783  C  CA    . GLN B  1 272 ? 100.229 128.024 14.022  1.00 24.56 ? 300  GLN B CA    1 
ATOM   4784  C  C     . GLN B  1 272 ? 101.246 127.197 13.241  1.00 24.92 ? 300  GLN B C     1 
ATOM   4785  O  O     . GLN B  1 272 ? 101.696 127.601 12.165  1.00 24.69 ? 300  GLN B O     1 
ATOM   4786  C  CB    . GLN B  1 272 ? 100.940 128.684 15.208  1.00 25.09 ? 300  GLN B CB    1 
ATOM   4787  C  CG    . GLN B  1 272 ? 102.189 129.506 14.794  1.00 24.29 ? 300  GLN B CG    1 
ATOM   4788  C  CD    . GLN B  1 272 ? 103.157 129.702 15.913  1.00 25.15 ? 300  GLN B CD    1 
ATOM   4789  O  OE1   . GLN B  1 272 ? 103.318 128.830 16.781  1.00 26.37 ? 300  GLN B OE1   1 
ATOM   4790  N  NE2   . GLN B  1 272 ? 103.841 130.846 15.906  1.00 24.02 ? 300  GLN B NE2   1 
ATOM   4791  N  N     . MET B  1 273 ? 101.622 126.051 13.805  1.00 24.94 ? 301  MET B N     1 
ATOM   4792  C  CA    . MET B  1 273 ? 102.598 125.188 13.175  1.00 25.11 ? 301  MET B CA    1 
ATOM   4793  C  C     . MET B  1 273 ? 102.057 124.598 11.853  1.00 24.68 ? 301  MET B C     1 
ATOM   4794  O  O     . MET B  1 273 ? 102.788 124.499 10.868  1.00 24.00 ? 301  MET B O     1 
ATOM   4795  C  CB    . MET B  1 273 ? 103.015 124.089 14.154  1.00 25.12 ? 301  MET B CB    1 
ATOM   4796  C  CG    . MET B  1 273 ? 103.862 124.614 15.299  1.00 27.09 ? 301  MET B CG    1 
ATOM   4797  S  SD    . MET B  1 273 ? 105.528 125.083 14.763  1.00 27.46 ? 301  MET B SD    1 
ATOM   4798  C  CE    . MET B  1 273 ? 105.654 126.765 15.387  1.00 27.28 ? 301  MET B CE    1 
ATOM   4799  N  N     . LEU B  1 274 ? 100.782 124.228 11.864  1.00 25.19 ? 302  LEU B N     1 
ATOM   4800  C  CA    . LEU B  1 274 ? 100.059 123.781 10.672  1.00 25.62 ? 302  LEU B CA    1 
ATOM   4801  C  C     . LEU B  1 274 ? 100.089 124.833 9.561   1.00 25.75 ? 302  LEU B C     1 
ATOM   4802  O  O     . LEU B  1 274 ? 100.459 124.531 8.419   1.00 24.94 ? 302  LEU B O     1 
ATOM   4803  C  CB    . LEU B  1 274 ? 98.618  123.434 11.032  1.00 25.77 ? 302  LEU B CB    1 
ATOM   4804  C  CG    . LEU B  1 274 ? 97.671  123.068 9.884   1.00 26.34 ? 302  LEU B CG    1 
ATOM   4805  C  CD1   . LEU B  1 274 ? 98.213  121.821 9.120   1.00 25.99 ? 302  LEU B CD1   1 
ATOM   4806  C  CD2   . LEU B  1 274 ? 96.241  122.881 10.429  1.00 25.85 ? 302  LEU B CD2   1 
ATOM   4807  N  N     . GLY B  1 275 ? 99.713  126.064 9.908   1.00 25.73 ? 303  GLY B N     1 
ATOM   4808  C  CA    . GLY B  1 275 ? 99.691  127.163 8.946   1.00 25.75 ? 303  GLY B CA    1 
ATOM   4809  C  C     . GLY B  1 275 ? 101.049 127.483 8.362   1.00 26.00 ? 303  GLY B C     1 
ATOM   4810  O  O     . GLY B  1 275 ? 101.185 127.670 7.166   1.00 26.58 ? 303  GLY B O     1 
ATOM   4811  N  N     . LEU B  1 276 ? 102.053 127.547 9.226   1.00 26.56 ? 304  LEU B N     1 
ATOM   4812  C  CA    . LEU B  1 276 ? 103.431 127.836 8.856   1.00 26.85 ? 304  LEU B CA    1 
ATOM   4813  C  C     . LEU B  1 276 ? 103.931 126.790 7.851   1.00 26.67 ? 304  LEU B C     1 
ATOM   4814  O  O     . LEU B  1 276 ? 104.490 127.121 6.809   1.00 26.05 ? 304  LEU B O     1 
ATOM   4815  C  CB    . LEU B  1 276 ? 104.256 127.801 10.151  1.00 27.69 ? 304  LEU B CB    1 
ATOM   4816  C  CG    . LEU B  1 276 ? 105.740 127.986 10.324  1.00 29.41 ? 304  LEU B CG    1 
ATOM   4817  C  CD1   . LEU B  1 276 ? 106.025 128.006 11.847  1.00 28.37 ? 304  LEU B CD1   1 
ATOM   4818  C  CD2   . LEU B  1 276 ? 106.563 126.919 9.594   1.00 27.33 ? 304  LEU B CD2   1 
ATOM   4819  N  N     . ALA B  1 277 ? 103.718 125.520 8.182   1.00 26.74 ? 305  ALA B N     1 
ATOM   4820  C  CA    . ALA B  1 277 ? 104.149 124.414 7.334   1.00 26.54 ? 305  ALA B CA    1 
ATOM   4821  C  C     . ALA B  1 277 ? 103.407 124.402 5.995   1.00 26.51 ? 305  ALA B C     1 
ATOM   4822  O  O     . ALA B  1 277 ? 104.015 124.172 4.941   1.00 26.51 ? 305  ALA B O     1 
ATOM   4823  C  CB    . ALA B  1 277 ? 103.986 123.074 8.080   1.00 25.67 ? 305  ALA B CB    1 
ATOM   4824  N  N     . GLN B  1 278 ? 102.102 124.648 6.035   1.00 26.64 ? 306  GLN B N     1 
ATOM   4825  C  CA    . GLN B  1 278 ? 101.284 124.716 4.826   1.00 26.87 ? 306  GLN B CA    1 
ATOM   4826  C  C     . GLN B  1 278 ? 101.686 125.873 3.899   1.00 27.15 ? 306  GLN B C     1 
ATOM   4827  O  O     . GLN B  1 278 ? 101.757 125.690 2.692   1.00 27.33 ? 306  GLN B O     1 
ATOM   4828  C  CB    . GLN B  1 278 ? 99.796  124.824 5.174   1.00 26.84 ? 306  GLN B CB    1 
ATOM   4829  C  CG    . GLN B  1 278 ? 98.877  124.588 3.971   1.00 29.00 ? 306  GLN B CG    1 
ATOM   4830  C  CD    . GLN B  1 278 ? 98.896  123.133 3.492   1.00 31.08 ? 306  GLN B CD    1 
ATOM   4831  O  OE1   . GLN B  1 278 ? 98.630  122.213 4.268   1.00 36.26 ? 306  GLN B OE1   1 
ATOM   4832  N  NE2   . GLN B  1 278 ? 99.196  122.926 2.221   1.00 27.78 ? 306  GLN B NE2   1 
ATOM   4833  N  N     . GLY B  1 279 ? 101.927 127.059 4.461   1.00 27.05 ? 307  GLY B N     1 
ATOM   4834  C  CA    . GLY B  1 279 ? 102.418 128.204 3.682   1.00 26.54 ? 307  GLY B CA    1 
ATOM   4835  C  C     . GLY B  1 279 ? 103.759 127.924 3.004   1.00 26.50 ? 307  GLY B C     1 
ATOM   4836  O  O     . GLY B  1 279 ? 103.975 128.267 1.835   1.00 24.59 ? 307  GLY B O     1 
ATOM   4837  N  N     . CYS B  1 280 ? 104.657 127.285 3.741   1.00 26.62 ? 308  CYS B N     1 
ATOM   4838  C  CA    . CYS B  1 280 ? 105.954 126.891 3.211   1.00 26.65 ? 308  CYS B CA    1 
ATOM   4839  C  C     . CYS B  1 280 ? 105.812 125.890 2.055   1.00 26.26 ? 308  CYS B C     1 
ATOM   4840  O  O     . CYS B  1 280 ? 106.421 126.063 0.990   1.00 25.31 ? 308  CYS B O     1 
ATOM   4841  C  CB    . CYS B  1 280 ? 106.827 126.296 4.330   1.00 26.85 ? 308  CYS B CB    1 
ATOM   4842  S  SG    . CYS B  1 280 ? 108.573 126.027 3.866   1.00 28.87 ? 308  CYS B SG    1 
ATOM   4843  N  N     . PHE B  1 281 ? 104.992 124.867 2.272   1.00 26.44 ? 309  PHE B N     1 
ATOM   4844  C  CA    . PHE B  1 281 ? 104.711 123.828 1.274   1.00 26.64 ? 309  PHE B CA    1 
ATOM   4845  C  C     . PHE B  1 281 ? 104.076 124.430 0.008   1.00 26.59 ? 309  PHE B C     1 
ATOM   4846  O  O     . PHE B  1 281 ? 104.487 124.116 -1.114  1.00 26.28 ? 309  PHE B O     1 
ATOM   4847  C  CB    . PHE B  1 281 ? 103.790 122.755 1.899   1.00 26.46 ? 309  PHE B CB    1 
ATOM   4848  C  CG    . PHE B  1 281 ? 103.543 121.553 1.024   1.00 25.97 ? 309  PHE B CG    1 
ATOM   4849  C  CD1   . PHE B  1 281 ? 104.349 120.424 1.116   1.00 26.79 ? 309  PHE B CD1   1 
ATOM   4850  C  CD2   . PHE B  1 281 ? 102.469 121.529 0.140   1.00 26.99 ? 309  PHE B CD2   1 
ATOM   4851  C  CE1   . PHE B  1 281 ? 104.099 119.299 0.306   1.00 25.50 ? 309  PHE B CE1   1 
ATOM   4852  C  CE2   . PHE B  1 281 ? 102.218 120.412 -0.659  1.00 27.02 ? 309  PHE B CE2   1 
ATOM   4853  C  CZ    . PHE B  1 281 ? 103.041 119.300 -0.570  1.00 25.90 ? 309  PHE B CZ    1 
ATOM   4854  N  N     . ASP B  1 282 ? 103.071 125.281 0.208   1.00 27.31 ? 310  ASP B N     1 
ATOM   4855  C  CA    . ASP B  1 282 ? 102.323 125.928 -0.876  1.00 27.23 ? 310  ASP B CA    1 
ATOM   4856  C  C     . ASP B  1 282 ? 103.206 126.824 -1.748  1.00 27.06 ? 310  ASP B C     1 
ATOM   4857  O  O     . ASP B  1 282 ? 102.976 126.936 -2.948  1.00 26.51 ? 310  ASP B O     1 
ATOM   4858  C  CB    . ASP B  1 282 ? 101.174 126.796 -0.339  1.00 27.72 ? 310  ASP B CB    1 
ATOM   4859  C  CG    . ASP B  1 282 ? 100.015 125.991 0.285   1.00 29.20 ? 310  ASP B CG    1 
ATOM   4860  O  OD1   . ASP B  1 282 ? 99.926  124.755 0.139   1.00 30.25 ? 310  ASP B OD1   1 
ATOM   4861  O  OD2   . ASP B  1 282 ? 99.197  126.639 0.964   1.00 29.57 ? 310  ASP B OD2   1 
ATOM   4862  N  N     . TYR B  1 283 ? 104.158 127.515 -1.128  1.00 27.05 ? 311  TYR B N     1 
ATOM   4863  C  CA    . TYR B  1 283 ? 105.153 128.280 -1.850  1.00 27.26 ? 311  TYR B CA    1 
ATOM   4864  C  C     . TYR B  1 283 ? 106.113 127.382 -2.669  1.00 26.96 ? 311  TYR B C     1 
ATOM   4865  O  O     . TYR B  1 283 ? 106.498 127.713 -3.787  1.00 26.44 ? 311  TYR B O     1 
ATOM   4866  C  CB    . TYR B  1 283 ? 105.980 129.139 -0.879  1.00 27.89 ? 311  TYR B CB    1 
ATOM   4867  C  CG    . TYR B  1 283 ? 107.018 129.923 -1.622  1.00 29.22 ? 311  TYR B CG    1 
ATOM   4868  C  CD1   . TYR B  1 283 ? 106.715 131.172 -2.152  1.00 29.10 ? 311  TYR B CD1   1 
ATOM   4869  C  CD2   . TYR B  1 283 ? 108.300 129.389 -1.847  1.00 29.40 ? 311  TYR B CD2   1 
ATOM   4870  C  CE1   . TYR B  1 283 ? 107.660 131.891 -2.874  1.00 29.95 ? 311  TYR B CE1   1 
ATOM   4871  C  CE2   . TYR B  1 283 ? 109.251 130.102 -2.564  1.00 30.24 ? 311  TYR B CE2   1 
ATOM   4872  C  CZ    . TYR B  1 283 ? 108.920 131.351 -3.077  1.00 29.85 ? 311  TYR B CZ    1 
ATOM   4873  O  OH    . TYR B  1 283 ? 109.846 132.077 -3.795  1.00 31.15 ? 311  TYR B OH    1 
ATOM   4874  N  N     . THR B  1 284 ? 106.488 126.244 -2.104  1.00 26.30 ? 312  THR B N     1 
ATOM   4875  C  CA    . THR B  1 284 ? 107.559 125.431 -2.670  1.00 26.62 ? 312  THR B CA    1 
ATOM   4876  C  C     . THR B  1 284 ? 107.095 124.614 -3.885  1.00 26.26 ? 312  THR B C     1 
ATOM   4877  O  O     . THR B  1 284 ? 107.858 124.406 -4.817  1.00 26.32 ? 312  THR B O     1 
ATOM   4878  C  CB    . THR B  1 284 ? 108.174 124.518 -1.552  1.00 26.66 ? 312  THR B CB    1 
ATOM   4879  O  OG1   . THR B  1 284 ? 108.676 125.361 -0.500  1.00 26.89 ? 312  THR B OG1   1 
ATOM   4880  C  CG2   . THR B  1 284 ? 109.302 123.607 -2.074  1.00 26.28 ? 312  THR B CG2   1 
ATOM   4881  N  N     . ILE B  1 285 ? 105.851 124.154 -3.886  1.00 26.25 ? 313  ILE B N     1 
ATOM   4882  C  CA    . ILE B  1 285 ? 105.421 123.249 -4.947  1.00 26.31 ? 313  ILE B CA    1 
ATOM   4883  C  C     . ILE B  1 285 ? 105.451 123.925 -6.326  1.00 25.89 ? 313  ILE B C     1 
ATOM   4884  O  O     . ILE B  1 285 ? 105.953 123.318 -7.268  1.00 26.05 ? 313  ILE B O     1 
ATOM   4885  C  CB    . ILE B  1 285 ? 104.053 122.553 -4.674  1.00 26.51 ? 313  ILE B CB    1 
ATOM   4886  C  CG1   . ILE B  1 285 ? 104.072 121.740 -3.359  1.00 26.37 ? 313  ILE B CG1   1 
ATOM   4887  C  CG2   . ILE B  1 285 ? 103.667 121.672 -5.862  1.00 26.64 ? 313  ILE B CG2   1 
ATOM   4888  C  CD1   . ILE B  1 285 ? 105.325 120.833 -3.102  1.00 26.79 ? 313  ILE B CD1   1 
ATOM   4889  N  N     . PRO B  1 286 ? 104.936 125.163 -6.454  1.00 25.75 ? 314  PRO B N     1 
ATOM   4890  C  CA    . PRO B  1 286 ? 105.086 125.880 -7.729  1.00 26.08 ? 314  PRO B CA    1 
ATOM   4891  C  C     . PRO B  1 286 ? 106.536 126.015 -8.214  1.00 25.68 ? 314  PRO B C     1 
ATOM   4892  O  O     . PRO B  1 286 ? 106.786 125.884 -9.394  1.00 25.50 ? 314  PRO B O     1 
ATOM   4893  C  CB    . PRO B  1 286 ? 104.463 127.248 -7.445  1.00 26.41 ? 314  PRO B CB    1 
ATOM   4894  C  CG    . PRO B  1 286 ? 103.483 126.982 -6.329  1.00 26.24 ? 314  PRO B CG    1 
ATOM   4895  C  CD    . PRO B  1 286 ? 104.138 125.943 -5.487  1.00 26.17 ? 314  PRO B CD    1 
ATOM   4896  N  N     . TYR B  1 287 ? 107.479 126.238 -7.308  1.00 25.33 ? 315  TYR B N     1 
ATOM   4897  C  CA    . TYR B  1 287 ? 108.880 126.356 -7.706  1.00 24.78 ? 315  TYR B CA    1 
ATOM   4898  C  C     . TYR B  1 287 ? 109.422 125.055 -8.323  1.00 24.68 ? 315  TYR B C     1 
ATOM   4899  O  O     . TYR B  1 287 ? 110.072 125.080 -9.365  1.00 24.08 ? 315  TYR B O     1 
ATOM   4900  C  CB    . TYR B  1 287 ? 109.751 126.778 -6.525  1.00 24.86 ? 315  TYR B CB    1 
ATOM   4901  C  CG    . TYR B  1 287 ? 111.206 126.923 -6.898  1.00 24.60 ? 315  TYR B CG    1 
ATOM   4902  C  CD1   . TYR B  1 287 ? 111.690 128.115 -7.421  1.00 26.35 ? 315  TYR B CD1   1 
ATOM   4903  C  CD2   . TYR B  1 287 ? 112.095 125.855 -6.757  1.00 25.37 ? 315  TYR B CD2   1 
ATOM   4904  C  CE1   . TYR B  1 287 ? 113.030 128.255 -7.787  1.00 26.67 ? 315  TYR B CE1   1 
ATOM   4905  C  CE2   . TYR B  1 287 ? 113.437 125.984 -7.131  1.00 25.57 ? 315  TYR B CE2   1 
ATOM   4906  C  CZ    . TYR B  1 287 ? 113.890 127.183 -7.647  1.00 25.20 ? 315  TYR B CZ    1 
ATOM   4907  O  OH    . TYR B  1 287 ? 115.222 127.335 -8.013  1.00 26.28 ? 315  TYR B OH    1 
ATOM   4908  N  N     . ILE B  1 288 ? 109.144 123.923 -7.687  1.00 24.77 ? 316  ILE B N     1 
ATOM   4909  C  CA    . ILE B  1 288 ? 109.686 122.642 -8.151  1.00 25.55 ? 316  ILE B CA    1 
ATOM   4910  C  C     . ILE B  1 288 ? 108.961 122.135 -9.408  1.00 25.38 ? 316  ILE B C     1 
ATOM   4911  O  O     . ILE B  1 288 ? 109.498 121.315 -10.148 1.00 24.75 ? 316  ILE B O     1 
ATOM   4912  C  CB    . ILE B  1 288 ? 109.722 121.549 -7.028  1.00 25.29 ? 316  ILE B CB    1 
ATOM   4913  C  CG1   . ILE B  1 288 ? 108.317 121.210 -6.483  1.00 26.82 ? 316  ILE B CG1   1 
ATOM   4914  C  CG2   . ILE B  1 288 ? 110.681 121.962 -5.921  1.00 26.58 ? 316  ILE B CG2   1 
ATOM   4915  C  CD1   . ILE B  1 288 ? 108.286 119.981 -5.552  1.00 26.72 ? 316  ILE B CD1   1 
ATOM   4916  N  N     . LYS B  1 289 ? 107.749 122.623 -9.644  1.00 25.25 ? 317  LYS B N     1 
ATOM   4917  C  CA    . LYS B  1 289 ? 107.075 122.396 -10.924 1.00 25.86 ? 317  LYS B CA    1 
ATOM   4918  C  C     . LYS B  1 289 ? 107.721 123.217 -12.060 1.00 26.34 ? 317  LYS B C     1 
ATOM   4919  O  O     . LYS B  1 289 ? 107.743 122.777 -13.199 1.00 26.02 ? 317  LYS B O     1 
ATOM   4920  C  CB    . LYS B  1 289 ? 105.573 122.727 -10.823 1.00 25.64 ? 317  LYS B CB    1 
ATOM   4921  C  CG    . LYS B  1 289 ? 104.756 121.698 -10.039 1.00 27.09 ? 317  LYS B CG    1 
ATOM   4922  C  CD    . LYS B  1 289 ? 103.246 121.997 -10.014 1.00 25.81 ? 317  LYS B CD    1 
ATOM   4923  C  CE    . LYS B  1 289 ? 102.679 122.172 -11.407 1.00 27.02 ? 317  LYS B CE    1 
ATOM   4924  N  NZ    . LYS B  1 289 ? 101.214 121.971 -11.494 1.00 25.35 ? 317  LYS B NZ    1 
ATOM   4925  N  N     . GLU B  1 290 ? 108.233 124.405 -11.735 1.00 27.31 ? 318  GLU B N     1 
ATOM   4926  C  CA    . GLU B  1 290 ? 108.738 125.366 -12.728 1.00 28.60 ? 318  GLU B CA    1 
ATOM   4927  C  C     . GLU B  1 290 ? 110.231 125.157 -13.021 1.00 27.01 ? 318  GLU B C     1 
ATOM   4928  O  O     . GLU B  1 290 ? 110.683 125.372 -14.134 1.00 26.22 ? 318  GLU B O     1 
ATOM   4929  C  CB    . GLU B  1 290 ? 108.529 126.813 -12.229 1.00 28.63 ? 318  GLU B CB    1 
ATOM   4930  C  CG    . GLU B  1 290 ? 107.062 127.234 -12.108 1.00 32.98 ? 318  GLU B CG    1 
ATOM   4931  C  CD    . GLU B  1 290 ? 106.795 128.475 -11.186 1.00 34.24 ? 318  GLU B CD    1 
ATOM   4932  O  OE1   . GLU B  1 290 ? 107.658 128.846 -10.332 1.00 41.40 ? 318  GLU B OE1   1 
ATOM   4933  O  OE2   . GLU B  1 290 ? 105.687 129.066 -11.318 1.00 40.76 ? 318  GLU B OE2   1 
ATOM   4934  N  N     . ARG B  1 291 ? 110.990 124.767 -12.004 1.00 26.20 ? 319  ARG B N     1 
ATOM   4935  C  CA    . ARG B  1 291 ? 112.457 124.647 -12.117 1.00 25.54 ? 319  ARG B CA    1 
ATOM   4936  C  C     . ARG B  1 291 ? 112.835 123.364 -12.885 1.00 24.86 ? 319  ARG B C     1 
ATOM   4937  O  O     . ARG B  1 291 ? 112.351 122.280 -12.571 1.00 24.51 ? 319  ARG B O     1 
ATOM   4938  C  CB    . ARG B  1 291 ? 113.078 124.649 -10.714 1.00 25.68 ? 319  ARG B CB    1 
ATOM   4939  C  CG    . ARG B  1 291 ? 114.554 125.065 -10.632 1.00 26.21 ? 319  ARG B CG    1 
ATOM   4940  C  CD    . ARG B  1 291 ? 115.521 124.061 -11.231 1.00 25.10 ? 319  ARG B CD    1 
ATOM   4941  N  NE    . ARG B  1 291 ? 116.888 124.301 -10.747 1.00 24.13 ? 319  ARG B NE    1 
ATOM   4942  C  CZ    . ARG B  1 291 ? 117.709 125.242 -11.221 1.00 22.82 ? 319  ARG B CZ    1 
ATOM   4943  N  NH1   . ARG B  1 291 ? 117.353 126.025 -12.228 1.00 22.23 ? 319  ARG B NH1   1 
ATOM   4944  N  NH2   . ARG B  1 291 ? 118.915 125.386 -10.685 1.00 22.88 ? 319  ARG B NH2   1 
ATOM   4945  N  N     . ILE B  1 292 ? 113.695 123.508 -13.888 1.00 24.59 ? 320  ILE B N     1 
ATOM   4946  C  CA    . ILE B  1 292 ? 114.101 122.412 -14.763 1.00 24.99 ? 320  ILE B CA    1 
ATOM   4947  C  C     . ILE B  1 292 ? 115.590 122.085 -14.562 1.00 24.76 ? 320  ILE B C     1 
ATOM   4948  O  O     . ILE B  1 292 ? 116.428 122.990 -14.566 1.00 23.90 ? 320  ILE B O     1 
ATOM   4949  C  CB    . ILE B  1 292 ? 113.892 122.783 -16.255 1.00 25.33 ? 320  ILE B CB    1 
ATOM   4950  C  CG1   . ILE B  1 292 ? 112.455 123.263 -16.526 1.00 25.92 ? 320  ILE B CG1   1 
ATOM   4951  C  CG2   . ILE B  1 292 ? 114.269 121.602 -17.209 1.00 26.43 ? 320  ILE B CG2   1 
ATOM   4952  C  CD1   . ILE B  1 292 ? 111.408 122.272 -16.199 1.00 25.70 ? 320  ILE B CD1   1 
ATOM   4953  N  N     . GLN B  1 293 ? 115.881 120.793 -14.368 1.00 24.53 ? 321  GLN B N     1 
ATOM   4954  C  CA    . GLN B  1 293 ? 117.238 120.236 -14.340 1.00 24.57 ? 321  GLN B CA    1 
ATOM   4955  C  C     . GLN B  1 293 ? 117.186 118.899 -15.059 1.00 24.84 ? 321  GLN B C     1 
ATOM   4956  O  O     . GLN B  1 293 ? 116.178 118.174 -14.950 1.00 24.64 ? 321  GLN B O     1 
ATOM   4957  C  CB    . GLN B  1 293 ? 117.728 120.013 -12.892 1.00 24.80 ? 321  GLN B CB    1 
ATOM   4958  C  CG    . GLN B  1 293 ? 118.105 121.267 -12.101 1.00 25.10 ? 321  GLN B CG    1 
ATOM   4959  C  CD    . GLN B  1 293 ? 119.290 122.038 -12.705 1.00 25.21 ? 321  GLN B CD    1 
ATOM   4960  O  OE1   . GLN B  1 293 ? 120.444 121.825 -12.325 1.00 23.30 ? 321  GLN B OE1   1 
ATOM   4961  N  NE2   . GLN B  1 293 ? 119.001 122.940 -13.635 1.00 24.19 ? 321  GLN B NE2   1 
ATOM   4962  N  N     . PHE B  1 294 ? 118.252 118.559 -15.786 1.00 25.03 ? 322  PHE B N     1 
ATOM   4963  C  CA    . PHE B  1 294 ? 118.321 117.302 -16.560 1.00 25.54 ? 322  PHE B CA    1 
ATOM   4964  C  C     . PHE B  1 294 ? 117.137 117.130 -17.525 1.00 26.91 ? 322  PHE B C     1 
ATOM   4965  O  O     . PHE B  1 294 ? 116.662 116.008 -17.760 1.00 27.71 ? 322  PHE B O     1 
ATOM   4966  C  CB    . PHE B  1 294 ? 118.393 116.082 -15.636 1.00 25.06 ? 322  PHE B CB    1 
ATOM   4967  C  CG    . PHE B  1 294 ? 119.488 116.145 -14.622 1.00 25.16 ? 322  PHE B CG    1 
ATOM   4968  C  CD1   . PHE B  1 294 ? 120.775 115.744 -14.954 1.00 26.20 ? 322  PHE B CD1   1 
ATOM   4969  C  CD2   . PHE B  1 294 ? 119.240 116.586 -13.330 1.00 24.79 ? 322  PHE B CD2   1 
ATOM   4970  C  CE1   . PHE B  1 294 ? 121.806 115.806 -14.002 1.00 25.30 ? 322  PHE B CE1   1 
ATOM   4971  C  CE2   . PHE B  1 294 ? 120.256 116.642 -12.392 1.00 25.65 ? 322  PHE B CE2   1 
ATOM   4972  C  CZ    . PHE B  1 294 ? 121.542 116.240 -12.731 1.00 25.09 ? 322  PHE B CZ    1 
ATOM   4973  N  N     . GLY B  1 295 ? 116.652 118.245 -18.058 1.00 27.78 ? 323  GLY B N     1 
ATOM   4974  C  CA    . GLY B  1 295 ? 115.502 118.260 -18.947 1.00 28.39 ? 323  GLY B CA    1 
ATOM   4975  C  C     . GLY B  1 295 ? 114.135 117.937 -18.351 1.00 28.80 ? 323  GLY B C     1 
ATOM   4976  O  O     . GLY B  1 295 ? 113.192 117.738 -19.102 1.00 28.18 ? 323  GLY B O     1 
ATOM   4977  N  N     . LYS B  1 296 ? 114.036 117.882 -17.020 1.00 28.99 ? 324  LYS B N     1 
ATOM   4978  C  CA    . LYS B  1 296 ? 112.804 117.534 -16.318 1.00 29.41 ? 324  LYS B CA    1 
ATOM   4979  C  C     . LYS B  1 296 ? 112.471 118.619 -15.299 1.00 28.08 ? 324  LYS B C     1 
ATOM   4980  O  O     . LYS B  1 296 ? 113.365 119.281 -14.773 1.00 26.67 ? 324  LYS B O     1 
ATOM   4981  C  CB    . LYS B  1 296 ? 112.960 116.216 -15.538 1.00 29.64 ? 324  LYS B CB    1 
ATOM   4982  C  CG    A LYS B  1 296 ? 113.313 114.957 -16.334 0.50 30.69 ? 324  LYS B CG    1 
ATOM   4983  C  CG    B LYS B  1 296 ? 113.322 115.014 -16.411 0.50 30.88 ? 324  LYS B CG    1 
ATOM   4984  C  CD    A LYS B  1 296 ? 113.302 113.746 -15.384 0.50 30.63 ? 324  LYS B CD    1 
ATOM   4985  C  CD    B LYS B  1 296 ? 113.502 113.749 -15.585 0.50 31.02 ? 324  LYS B CD    1 
ATOM   4986  C  CE    A LYS B  1 296 ? 113.928 112.480 -15.980 0.50 31.08 ? 324  LYS B CE    1 
ATOM   4987  C  CE    B LYS B  1 296 ? 112.159 113.119 -15.218 0.50 32.42 ? 324  LYS B CE    1 
ATOM   4988  N  NZ    A LYS B  1 296 ? 114.100 111.410 -14.940 0.50 30.91 ? 324  LYS B NZ    1 
ATOM   4989  N  NZ    B LYS B  1 296 ? 112.283 112.027 -14.217 0.50 32.73 ? 324  LYS B NZ    1 
ATOM   4990  N  N     . ARG B  1 297 ? 111.184 118.761 -14.993 1.00 27.27 ? 325  ARG B N     1 
ATOM   4991  C  CA    . ARG B  1 297 ? 110.753 119.511 -13.813 1.00 26.70 ? 325  ARG B CA    1 
ATOM   4992  C  C     . ARG B  1 297 ? 111.328 118.810 -12.590 1.00 26.46 ? 325  ARG B C     1 
ATOM   4993  O  O     . ARG B  1 297 ? 111.387 117.584 -12.555 1.00 25.80 ? 325  ARG B O     1 
ATOM   4994  C  CB    . ARG B  1 297 ? 109.229 119.532 -13.686 1.00 26.55 ? 325  ARG B CB    1 
ATOM   4995  C  CG    . ARG B  1 297 ? 108.473 120.063 -14.907 1.00 26.69 ? 325  ARG B CG    1 
ATOM   4996  C  CD    . ARG B  1 297 ? 106.978 120.075 -14.641 1.00 26.91 ? 325  ARG B CD    1 
ATOM   4997  N  NE    . ARG B  1 297 ? 106.501 118.779 -14.161 1.00 27.53 ? 325  ARG B NE    1 
ATOM   4998  C  CZ    . ARG B  1 297 ? 105.354 118.568 -13.521 1.00 27.46 ? 325  ARG B CZ    1 
ATOM   4999  N  NH1   . ARG B  1 297 ? 104.508 119.553 -13.272 1.00 26.15 ? 325  ARG B NH1   1 
ATOM   5000  N  NH2   . ARG B  1 297 ? 105.044 117.348 -13.132 1.00 29.19 ? 325  ARG B NH2   1 
ATOM   5001  N  N     . LEU B  1 298 ? 111.738 119.571 -11.581 1.00 26.28 ? 326  LEU B N     1 
ATOM   5002  C  CA    . LEU B  1 298 ? 112.223 118.948 -10.346 1.00 26.23 ? 326  LEU B CA    1 
ATOM   5003  C  C     . LEU B  1 298 ? 111.150 118.016 -9.798  1.00 26.96 ? 326  LEU B C     1 
ATOM   5004  O  O     . LEU B  1 298 ? 111.471 116.938 -9.275  1.00 26.56 ? 326  LEU B O     1 
ATOM   5005  C  CB    . LEU B  1 298 ? 112.604 119.988 -9.284  1.00 26.21 ? 326  LEU B CB    1 
ATOM   5006  C  CG    . LEU B  1 298 ? 113.808 120.878 -9.585  1.00 25.19 ? 326  LEU B CG    1 
ATOM   5007  C  CD1   . LEU B  1 298 ? 113.966 121.923 -8.489  1.00 22.30 ? 326  LEU B CD1   1 
ATOM   5008  C  CD2   . LEU B  1 298 ? 115.104 120.038 -9.783  1.00 23.51 ? 326  LEU B CD2   1 
ATOM   5009  N  N     . PHE B  1 299 ? 109.879 118.420 -9.958  1.00 27.26 ? 327  PHE B N     1 
ATOM   5010  C  CA    . PHE B  1 299 ? 108.733 117.635 -9.500  1.00 28.18 ? 327  PHE B CA    1 
ATOM   5011  C  C     . PHE B  1 299 ? 108.694 116.235 -10.122 1.00 28.14 ? 327  PHE B C     1 
ATOM   5012  O  O     . PHE B  1 299 ? 108.102 115.313 -9.545  1.00 28.12 ? 327  PHE B O     1 
ATOM   5013  C  CB    . PHE B  1 299 ? 107.404 118.367 -9.799  1.00 28.58 ? 327  PHE B CB    1 
ATOM   5014  C  CG    . PHE B  1 299 ? 106.212 117.816 -9.052  1.00 29.03 ? 327  PHE B CG    1 
ATOM   5015  C  CD1   . PHE B  1 299 ? 105.819 118.370 -7.844  1.00 30.61 ? 327  PHE B CD1   1 
ATOM   5016  C  CD2   . PHE B  1 299 ? 105.473 116.752 -9.561  1.00 29.10 ? 327  PHE B CD2   1 
ATOM   5017  C  CE1   . PHE B  1 299 ? 104.705 117.873 -7.141  1.00 31.10 ? 327  PHE B CE1   1 
ATOM   5018  C  CE2   . PHE B  1 299 ? 104.374 116.240 -8.862  1.00 30.23 ? 327  PHE B CE2   1 
ATOM   5019  C  CZ    . PHE B  1 299 ? 103.989 116.813 -7.651  1.00 30.06 ? 327  PHE B CZ    1 
ATOM   5020  N  N     . ASP B  1 300 ? 109.295 116.074 -11.293 1.00 28.26 ? 328  ASP B N     1 
ATOM   5021  C  CA    . ASP B  1 300 ? 109.241 114.779 -11.977 1.00 28.20 ? 328  ASP B CA    1 
ATOM   5022  C  C     . ASP B  1 300 ? 110.306 113.741 -11.571 1.00 28.13 ? 328  ASP B C     1 
ATOM   5023  O  O     . ASP B  1 300 ? 110.294 112.611 -12.082 1.00 27.86 ? 328  ASP B O     1 
ATOM   5024  C  CB    . ASP B  1 300 ? 109.260 114.996 -13.473 1.00 28.49 ? 328  ASP B CB    1 
ATOM   5025  C  CG    . ASP B  1 300 ? 107.948 115.572 -13.990 1.00 29.14 ? 328  ASP B CG    1 
ATOM   5026  O  OD1   . ASP B  1 300 ? 106.882 115.284 -13.425 1.00 32.12 ? 328  ASP B OD1   1 
ATOM   5027  O  OD2   . ASP B  1 300 ? 107.989 116.315 -14.964 1.00 30.10 ? 328  ASP B OD2   1 
ATOM   5028  N  N     . PHE B  1 301 ? 111.221 114.108 -10.680 1.00 27.66 ? 329  PHE B N     1 
ATOM   5029  C  CA    . PHE B  1 301 ? 112.146 113.128 -10.111 1.00 27.57 ? 329  PHE B CA    1 
ATOM   5030  C  C     . PHE B  1 301 ? 111.409 112.396 -9.006  1.00 27.32 ? 329  PHE B C     1 
ATOM   5031  O  O     . PHE B  1 301 ? 110.945 113.017 -8.044  1.00 26.56 ? 329  PHE B O     1 
ATOM   5032  C  CB    . PHE B  1 301 ? 113.398 113.793 -9.582  1.00 27.26 ? 329  PHE B CB    1 
ATOM   5033  C  CG    . PHE B  1 301 ? 114.210 114.413 -10.649 1.00 28.12 ? 329  PHE B CG    1 
ATOM   5034  C  CD1   . PHE B  1 301 ? 114.848 113.619 -11.587 1.00 28.08 ? 329  PHE B CD1   1 
ATOM   5035  C  CD2   . PHE B  1 301 ? 114.315 115.799 -10.752 1.00 29.42 ? 329  PHE B CD2   1 
ATOM   5036  C  CE1   . PHE B  1 301 ? 115.590 114.201 -12.631 1.00 30.45 ? 329  PHE B CE1   1 
ATOM   5037  C  CE2   . PHE B  1 301 ? 115.061 116.380 -11.783 1.00 29.52 ? 329  PHE B CE2   1 
ATOM   5038  C  CZ    . PHE B  1 301 ? 115.695 115.587 -12.715 1.00 28.53 ? 329  PHE B CZ    1 
ATOM   5039  N  N     . GLN B  1 302 ? 111.286 111.083 -9.157  1.00 27.05 ? 330  GLN B N     1 
ATOM   5040  C  CA    . GLN B  1 302 ? 110.432 110.311 -8.270  1.00 26.54 ? 330  GLN B CA    1 
ATOM   5041  C  C     . GLN B  1 302 ? 110.841 110.367 -6.789  1.00 26.58 ? 330  GLN B C     1 
ATOM   5042  O  O     . GLN B  1 302 ? 109.967 110.392 -5.918  1.00 26.39 ? 330  GLN B O     1 
ATOM   5043  C  CB    . GLN B  1 302 ? 110.325 108.871 -8.731  1.00 27.09 ? 330  GLN B CB    1 
ATOM   5044  C  CG    . GLN B  1 302 ? 109.296 108.084 -7.974  1.00 25.62 ? 330  GLN B CG    1 
ATOM   5045  C  CD    . GLN B  1 302 ? 109.264 106.636 -8.387  1.00 26.33 ? 330  GLN B CD    1 
ATOM   5046  O  OE1   . GLN B  1 302 ? 110.153 105.867 -8.030  1.00 24.93 ? 330  GLN B OE1   1 
ATOM   5047  N  NE2   . GLN B  1 302 ? 108.234 106.249 -9.129  1.00 25.00 ? 330  GLN B NE2   1 
ATOM   5048  N  N     . GLY B  1 303 ? 112.137 110.396 -6.500  1.00 26.67 ? 331  GLY B N     1 
ATOM   5049  C  CA    . GLY B  1 303 ? 112.619 110.541 -5.121  1.00 27.35 ? 331  GLY B CA    1 
ATOM   5050  C  C     . GLY B  1 303 ? 112.057 111.792 -4.480  1.00 27.82 ? 331  GLY B C     1 
ATOM   5051  O  O     . GLY B  1 303 ? 111.518 111.770 -3.389  1.00 27.34 ? 331  GLY B O     1 
ATOM   5052  N  N     . LEU B  1 304 ? 112.142 112.892 -5.203  1.00 28.78 ? 332  LEU B N     1 
ATOM   5053  C  CA    . LEU B  1 304 ? 111.555 114.133 -4.765  1.00 29.57 ? 332  LEU B CA    1 
ATOM   5054  C  C     . LEU B  1 304 ? 110.019 114.053 -4.656  1.00 29.65 ? 332  LEU B C     1 
ATOM   5055  O  O     . LEU B  1 304 ? 109.453 114.505 -3.656  1.00 30.56 ? 332  LEU B O     1 
ATOM   5056  C  CB    . LEU B  1 304 ? 111.992 115.247 -5.716  1.00 30.28 ? 332  LEU B CB    1 
ATOM   5057  C  CG    . LEU B  1 304 ? 111.975 116.652 -5.163  1.00 32.41 ? 332  LEU B CG    1 
ATOM   5058  C  CD1   . LEU B  1 304 ? 113.058 117.512 -5.822  1.00 34.97 ? 332  LEU B CD1   1 
ATOM   5059  C  CD2   . LEU B  1 304 ? 110.564 117.212 -5.428  1.00 34.69 ? 332  LEU B CD2   1 
ATOM   5060  N  N     . GLN B  1 305 ? 109.354 113.465 -5.648  1.00 28.63 ? 333  GLN B N     1 
ATOM   5061  C  CA    . GLN B  1 305 ? 107.911 113.250 -5.584  1.00 28.96 ? 333  GLN B CA    1 
ATOM   5062  C  C     . GLN B  1 305 ? 107.479 112.525 -4.313  1.00 27.39 ? 333  GLN B C     1 
ATOM   5063  O  O     . GLN B  1 305 ? 106.471 112.882 -3.687  1.00 25.79 ? 333  GLN B O     1 
ATOM   5064  C  CB    . GLN B  1 305 ? 107.407 112.386 -6.738  1.00 29.96 ? 333  GLN B CB    1 
ATOM   5065  C  CG    . GLN B  1 305 ? 107.012 113.116 -7.919  1.00 33.58 ? 333  GLN B CG    1 
ATOM   5066  C  CD    . GLN B  1 305 ? 106.477 112.215 -8.990  1.00 35.50 ? 333  GLN B CD    1 
ATOM   5067  O  OE1   . GLN B  1 305 ? 105.842 111.184 -8.716  1.00 35.97 ? 333  GLN B OE1   1 
ATOM   5068  N  NE2   . GLN B  1 305 ? 106.723 112.598 -10.228 1.00 38.53 ? 333  GLN B NE2   1 
ATOM   5069  N  N     . HIS B  1 306 ? 108.228 111.480 -3.970  1.00 26.21 ? 334  HIS B N     1 
ATOM   5070  C  CA    . HIS B  1 306 ? 107.907 110.650 -2.803  1.00 25.98 ? 334  HIS B CA    1 
ATOM   5071  C  C     . HIS B  1 306 ? 108.055 111.435 -1.499  1.00 25.65 ? 334  HIS B C     1 
ATOM   5072  O  O     . HIS B  1 306 ? 107.228 111.301 -0.610  1.00 24.49 ? 334  HIS B O     1 
ATOM   5073  C  CB    . HIS B  1 306 ? 108.760 109.374 -2.803  1.00 25.85 ? 334  HIS B CB    1 
ATOM   5074  C  CG    . HIS B  1 306 ? 108.292 108.344 -3.782  1.00 25.31 ? 334  HIS B CG    1 
ATOM   5075  N  ND1   . HIS B  1 306 ? 108.813 107.068 -3.834  1.00 26.03 ? 334  HIS B ND1   1 
ATOM   5076  C  CD2   . HIS B  1 306 ? 107.322 108.393 -4.728  1.00 25.68 ? 334  HIS B CD2   1 
ATOM   5077  C  CE1   . HIS B  1 306 ? 108.187 106.378 -4.771  1.00 25.07 ? 334  HIS B CE1   1 
ATOM   5078  N  NE2   . HIS B  1 306 ? 107.282 107.163 -5.335  1.00 25.22 ? 334  HIS B NE2   1 
ATOM   5079  N  N     . GLN B  1 307 ? 109.100 112.251 -1.411  1.00 25.98 ? 335  GLN B N     1 
ATOM   5080  C  CA    . GLN B  1 307 ? 109.294 113.161 -0.281  1.00 26.59 ? 335  GLN B CA    1 
ATOM   5081  C  C     . GLN B  1 307 ? 108.137 114.159 -0.170  1.00 26.41 ? 335  GLN B C     1 
ATOM   5082  O  O     . GLN B  1 307 ? 107.616 114.390 0.928   1.00 26.34 ? 335  GLN B O     1 
ATOM   5083  C  CB    . GLN B  1 307 ? 110.623 113.902 -0.387  1.00 26.93 ? 335  GLN B CB    1 
ATOM   5084  C  CG    . GLN B  1 307 ? 111.863 112.993 -0.315  1.00 27.22 ? 335  GLN B CG    1 
ATOM   5085  C  CD    . GLN B  1 307 ? 113.139 113.729 -0.679  1.00 28.86 ? 335  GLN B CD    1 
ATOM   5086  O  OE1   . GLN B  1 307 ? 113.263 114.919 -0.418  1.00 31.04 ? 335  GLN B OE1   1 
ATOM   5087  N  NE2   . GLN B  1 307 ? 114.099 113.018 -1.280  1.00 29.11 ? 335  GLN B NE2   1 
ATOM   5088  N  N     . VAL B  1 308 ? 107.736 114.729 -1.303  1.00 26.05 ? 336  VAL B N     1 
ATOM   5089  C  CA    . VAL B  1 308 ? 106.609 115.653 -1.353  1.00 25.76 ? 336  VAL B CA    1 
ATOM   5090  C  C     . VAL B  1 308 ? 105.312 114.993 -0.893  1.00 25.34 ? 336  VAL B C     1 
ATOM   5091  O  O     . VAL B  1 308 ? 104.602 115.550 -0.068  1.00 25.20 ? 336  VAL B O     1 
ATOM   5092  C  CB    . VAL B  1 308 ? 106.426 116.248 -2.765  1.00 26.09 ? 336  VAL B CB    1 
ATOM   5093  C  CG1   . VAL B  1 308 ? 105.049 116.981 -2.893  1.00 26.58 ? 336  VAL B CG1   1 
ATOM   5094  C  CG2   . VAL B  1 308 ? 107.597 117.156 -3.086  1.00 26.20 ? 336  VAL B CG2   1 
ATOM   5095  N  N     . ALA B  1 309 ? 105.018 113.806 -1.422  1.00 24.93 ? 337  ALA B N     1 
ATOM   5096  C  CA    . ALA B  1 309 ? 103.827 113.068 -1.047  1.00 25.42 ? 337  ALA B CA    1 
ATOM   5097  C  C     . ALA B  1 309 ? 103.824 112.646 0.435   1.00 25.54 ? 337  ALA B C     1 
ATOM   5098  O  O     . ALA B  1 309 ? 102.774 112.668 1.079   1.00 25.24 ? 337  ALA B O     1 
ATOM   5099  C  CB    . ALA B  1 309 ? 103.640 111.843 -1.977  1.00 25.35 ? 337  ALA B CB    1 
ATOM   5100  N  N     . HIS B  1 310 ? 104.994 112.266 0.956   1.00 25.86 ? 338  HIS B N     1 
ATOM   5101  C  CA    . HIS B  1 310 ? 105.143 111.921 2.366   1.00 26.47 ? 338  HIS B CA    1 
ATOM   5102  C  C     . HIS B  1 310 ? 104.809 113.133 3.254   1.00 25.80 ? 338  HIS B C     1 
ATOM   5103  O  O     . HIS B  1 310 ? 103.942 113.039 4.128   1.00 24.77 ? 338  HIS B O     1 
ATOM   5104  C  CB    . HIS B  1 310 ? 106.546 111.352 2.632   1.00 27.20 ? 338  HIS B CB    1 
ATOM   5105  C  CG    . HIS B  1 310 ? 106.814 111.020 4.068   1.00 29.43 ? 338  HIS B CG    1 
ATOM   5106  N  ND1   . HIS B  1 310 ? 106.324 109.887 4.676   1.00 34.89 ? 338  HIS B ND1   1 
ATOM   5107  C  CD2   . HIS B  1 310 ? 107.508 111.688 5.027   1.00 33.09 ? 338  HIS B CD2   1 
ATOM   5108  C  CE1   . HIS B  1 310 ? 106.714 109.857 5.939   1.00 33.99 ? 338  HIS B CE1   1 
ATOM   5109  N  NE2   . HIS B  1 310 ? 107.431 110.940 6.179   1.00 34.54 ? 338  HIS B NE2   1 
ATOM   5110  N  N     . VAL B  1 311 ? 105.444 114.279 2.976   1.00 25.51 ? 339  VAL B N     1 
ATOM   5111  C  CA    . VAL B  1 311 ? 105.159 115.524 3.675   1.00 26.08 ? 339  VAL B CA    1 
ATOM   5112  C  C     . VAL B  1 311 ? 103.670 115.945 3.555   1.00 25.97 ? 339  VAL B C     1 
ATOM   5113  O  O     . VAL B  1 311 ? 103.070 116.353 4.541   1.00 26.74 ? 339  VAL B O     1 
ATOM   5114  C  CB    . VAL B  1 311 ? 106.103 116.656 3.196   1.00 26.40 ? 339  VAL B CB    1 
ATOM   5115  C  CG1   . VAL B  1 311 ? 105.639 118.056 3.679   1.00 26.22 ? 339  VAL B CG1   1 
ATOM   5116  C  CG2   . VAL B  1 311 ? 107.561 116.354 3.620   1.00 26.81 ? 339  VAL B CG2   1 
ATOM   5117  N  N     . ALA B  1 312 ? 103.084 115.830 2.366   1.00 25.34 ? 340  ALA B N     1 
ATOM   5118  C  CA    . ALA B  1 312 ? 101.667 116.159 2.173   1.00 24.97 ? 340  ALA B CA    1 
ATOM   5119  C  C     . ALA B  1 312 ? 100.764 115.331 3.088   1.00 24.57 ? 340  ALA B C     1 
ATOM   5120  O  O     . ALA B  1 312 ? 99.780  115.838 3.622   1.00 23.69 ? 340  ALA B O     1 
ATOM   5121  C  CB    . ALA B  1 312 ? 101.262 115.962 0.728   1.00 24.46 ? 340  ALA B CB    1 
ATOM   5122  N  N     . THR B  1 313 ? 101.114 114.056 3.261   1.00 24.51 ? 341  THR B N     1 
ATOM   5123  C  CA    . THR B  1 313 ? 100.349 113.140 4.100   1.00 24.65 ? 341  THR B CA    1 
ATOM   5124  C  C     . THR B  1 313 ? 100.413 113.559 5.578   1.00 24.89 ? 341  THR B C     1 
ATOM   5125  O  O     . THR B  1 313 ? 99.403  113.556 6.288   1.00 24.01 ? 341  THR B O     1 
ATOM   5126  C  CB    . THR B  1 313 ? 100.867 111.694 3.910   1.00 24.74 ? 341  THR B CB    1 
ATOM   5127  O  OG1   . THR B  1 313 ? 100.788 111.339 2.520   1.00 23.94 ? 341  THR B OG1   1 
ATOM   5128  C  CG2   . THR B  1 313 ? 100.070 110.722 4.766   1.00 24.42 ? 341  THR B CG2   1 
ATOM   5129  N  N     . GLN B  1 314 ? 101.608 113.942 6.015   1.00 25.42 ? 342  GLN B N     1 
ATOM   5130  C  CA    . GLN B  1 314 ? 101.816 114.475 7.357   1.00 26.59 ? 342  GLN B CA    1 
ATOM   5131  C  C     . GLN B  1 314 ? 101.075 115.799 7.593   1.00 26.77 ? 342  GLN B C     1 
ATOM   5132  O  O     . GLN B  1 314 ? 100.531 116.004 8.669   1.00 25.65 ? 342  GLN B O     1 
ATOM   5133  C  CB    . GLN B  1 314 ? 103.302 114.665 7.613   1.00 27.19 ? 342  GLN B CB    1 
ATOM   5134  C  CG    . GLN B  1 314 ? 104.086 113.351 7.603   1.00 29.51 ? 342  GLN B CG    1 
ATOM   5135  C  CD    . GLN B  1 314 ? 105.558 113.577 7.780   1.00 33.88 ? 342  GLN B CD    1 
ATOM   5136  O  OE1   . GLN B  1 314 ? 106.136 114.466 7.151   1.00 38.05 ? 342  GLN B OE1   1 
ATOM   5137  N  NE2   . GLN B  1 314 ? 106.181 112.776 8.634   1.00 35.41 ? 342  GLN B NE2   1 
ATOM   5138  N  N     . LEU B  1 315 ? 101.078 116.691 6.593   1.00 26.82 ? 343  LEU B N     1 
ATOM   5139  C  CA    . LEU B  1 315 ? 100.320 117.939 6.670   1.00 27.09 ? 343  LEU B CA    1 
ATOM   5140  C  C     . LEU B  1 315 ? 98.834  117.672 6.850   1.00 26.56 ? 343  LEU B C     1 
ATOM   5141  O  O     . LEU B  1 315 ? 98.186  118.333 7.652   1.00 26.52 ? 343  LEU B O     1 
ATOM   5142  C  CB    . LEU B  1 315 ? 100.542 118.814 5.427   1.00 26.90 ? 343  LEU B CB    1 
ATOM   5143  C  CG    . LEU B  1 315 ? 101.857 119.590 5.333   1.00 28.72 ? 343  LEU B CG    1 
ATOM   5144  C  CD1   . LEU B  1 315 ? 101.965 120.253 3.946   1.00 27.06 ? 343  LEU B CD1   1 
ATOM   5145  C  CD2   . LEU B  1 315 ? 101.994 120.622 6.454   1.00 31.02 ? 343  LEU B CD2   1 
ATOM   5146  N  N     . GLU B  1 316 ? 98.312  116.716 6.082   1.00 26.02 ? 344  GLU B N     1 
ATOM   5147  C  CA    . GLU B  1 316 ? 96.913  116.278 6.157   1.00 26.19 ? 344  GLU B CA    1 
ATOM   5148  C  C     . GLU B  1 316 ? 96.585  115.710 7.536   1.00 25.45 ? 344  GLU B C     1 
ATOM   5149  O  O     . GLU B  1 316 ? 95.558  116.044 8.108   1.00 24.53 ? 344  GLU B O     1 
ATOM   5150  C  CB    . GLU B  1 316 ? 96.636  115.215 5.086   1.00 26.42 ? 344  GLU B CB    1 
ATOM   5151  C  CG    . GLU B  1 316 ? 95.178  114.816 4.923   1.00 29.08 ? 344  GLU B CG    1 
ATOM   5152  C  CD    . GLU B  1 316 ? 94.351  115.868 4.191   1.00 33.71 ? 344  GLU B CD    1 
ATOM   5153  O  OE1   . GLU B  1 316 ? 94.950  116.791 3.591   1.00 36.37 ? 344  GLU B OE1   1 
ATOM   5154  O  OE2   . GLU B  1 316 ? 93.110  115.754 4.217   1.00 35.57 ? 344  GLU B OE2   1 
ATOM   5155  N  N     . ALA B  1 317 ? 97.481  114.871 8.064   1.00 24.24 ? 345  ALA B N     1 
ATOM   5156  C  CA    . ALA B  1 317 ? 97.292  114.287 9.387   1.00 24.01 ? 345  ALA B CA    1 
ATOM   5157  C  C     . ALA B  1 317 ? 97.335  115.372 10.473  1.00 23.72 ? 345  ALA B C     1 
ATOM   5158  O  O     . ALA B  1 317 ? 96.518  115.363 11.395  1.00 22.84 ? 345  ALA B O     1 
ATOM   5159  C  CB    . ALA B  1 317 ? 98.335  113.208 9.652   1.00 23.30 ? 345  ALA B CB    1 
ATOM   5160  N  N     . ALA B  1 318 ? 98.275  116.312 10.351  1.00 23.80 ? 346  ALA B N     1 
ATOM   5161  C  CA    . ALA B  1 318 ? 98.361  117.438 11.297  1.00 24.29 ? 346  ALA B CA    1 
ATOM   5162  C  C     . ALA B  1 318 ? 97.096  118.328 11.302  1.00 24.36 ? 346  ALA B C     1 
ATOM   5163  O  O     . ALA B  1 318 ? 96.637  118.750 12.365  1.00 24.04 ? 346  ALA B O     1 
ATOM   5164  C  CB    . ALA B  1 318 ? 99.601  118.270 11.033  1.00 23.77 ? 346  ALA B CB    1 
ATOM   5165  N  N     . ARG B  1 319 ? 96.561  118.627 10.122  1.00 24.76 ? 347  ARG B N     1 
ATOM   5166  C  CA    . ARG B  1 319 ? 95.315  119.373 9.990   1.00 25.40 ? 347  ARG B CA    1 
ATOM   5167  C  C     . ARG B  1 319 ? 94.158  118.647 10.671  1.00 24.53 ? 347  ARG B C     1 
ATOM   5168  O  O     . ARG B  1 319 ? 93.426  119.244 11.463  1.00 24.09 ? 347  ARG B O     1 
ATOM   5169  C  CB    . ARG B  1 319 ? 95.004  119.645 8.505   1.00 25.57 ? 347  ARG B CB    1 
ATOM   5170  C  CG    . ARG B  1 319 ? 93.708  120.455 8.278   1.00 28.32 ? 347  ARG B CG    1 
ATOM   5171  C  CD    . ARG B  1 319 ? 93.662  121.162 6.918   1.00 28.59 ? 347  ARG B CD    1 
ATOM   5172  N  NE    . ARG B  1 319 ? 94.640  122.254 6.844   1.00 31.97 ? 347  ARG B NE    1 
ATOM   5173  C  CZ    . ARG B  1 319 ? 95.814  122.194 6.213   1.00 33.19 ? 347  ARG B CZ    1 
ATOM   5174  N  NH1   . ARG B  1 319 ? 96.191  121.080 5.569   1.00 36.38 ? 347  ARG B NH1   1 
ATOM   5175  N  NH2   . ARG B  1 319 ? 96.618  123.255 6.217   1.00 32.66 ? 347  ARG B NH2   1 
ATOM   5176  N  N     . LEU B  1 320 ? 94.009  117.352 10.392  1.00 24.03 ? 348  LEU B N     1 
ATOM   5177  C  CA    . LEU B  1 320 ? 92.915  116.584 10.977  1.00 24.13 ? 348  LEU B CA    1 
ATOM   5178  C  C     . LEU B  1 320 ? 93.057  116.503 12.492  1.00 23.68 ? 348  LEU B C     1 
ATOM   5179  O  O     . LEU B  1 320 ? 92.076  116.670 13.200  1.00 22.66 ? 348  LEU B O     1 
ATOM   5180  C  CB    . LEU B  1 320 ? 92.783  115.190 10.340  1.00 24.42 ? 348  LEU B CB    1 
ATOM   5181  C  CG    . LEU B  1 320 ? 92.394  115.136 8.852   1.00 25.31 ? 348  LEU B CG    1 
ATOM   5182  C  CD1   . LEU B  1 320 ? 92.476  113.714 8.314   1.00 23.90 ? 348  LEU B CD1   1 
ATOM   5183  C  CD2   . LEU B  1 320 ? 91.001  115.705 8.618   1.00 26.12 ? 348  LEU B CD2   1 
ATOM   5184  N  N     . LEU B  1 321 ? 94.277  116.299 12.998  1.00 24.09 ? 349  LEU B N     1 
ATOM   5185  C  CA    . LEU B  1 321 ? 94.478  116.307 14.465  1.00 23.95 ? 349  LEU B CA    1 
ATOM   5186  C  C     . LEU B  1 321 ? 94.066  117.645 15.092  1.00 23.50 ? 349  LEU B C     1 
ATOM   5187  O  O     . LEU B  1 321 ? 93.376  117.663 16.103  1.00 23.57 ? 349  LEU B O     1 
ATOM   5188  C  CB    . LEU B  1 321 ? 95.927  115.982 14.849  1.00 23.37 ? 349  LEU B CB    1 
ATOM   5189  C  CG    . LEU B  1 321 ? 96.363  114.530 14.651  1.00 23.59 ? 349  LEU B CG    1 
ATOM   5190  C  CD1   . LEU B  1 321 ? 97.907  114.455 14.656  1.00 21.49 ? 349  LEU B CD1   1 
ATOM   5191  C  CD2   . LEU B  1 321 ? 95.732  113.599 15.681  1.00 21.20 ? 349  LEU B CD2   1 
ATOM   5192  N  N     . THR B  1 322 ? 94.484  118.743 14.468  1.00 23.63 ? 350  THR B N     1 
ATOM   5193  C  CA    . THR B  1 322 ? 94.244  120.092 14.980  1.00 23.35 ? 350  THR B CA    1 
ATOM   5194  C  C     . THR B  1 322 ? 92.745  120.413 14.995  1.00 23.80 ? 350  THR B C     1 
ATOM   5195  O  O     . THR B  1 322 ? 92.207  120.810 16.028  1.00 23.08 ? 350  THR B O     1 
ATOM   5196  C  CB    . THR B  1 322 ? 95.060  121.154 14.184  1.00 24.18 ? 350  THR B CB    1 
ATOM   5197  O  OG1   . THR B  1 322 ? 96.455  120.819 14.242  1.00 21.88 ? 350  THR B OG1   1 
ATOM   5198  C  CG2   . THR B  1 322 ? 94.855  122.597 14.763  1.00 23.38 ? 350  THR B CG2   1 
ATOM   5199  N  N     . TYR B  1 323 ? 92.064  120.178 13.874  1.00 23.64 ? 351  TYR B N     1 
ATOM   5200  C  CA    . TYR B  1 323 ? 90.640  120.482 13.779  1.00 24.60 ? 351  TYR B CA    1 
ATOM   5201  C  C     . TYR B  1 323 ? 89.790  119.575 14.678  1.00 24.32 ? 351  TYR B C     1 
ATOM   5202  O  O     . TYR B  1 323 ? 88.826  120.033 15.262  1.00 23.50 ? 351  TYR B O     1 
ATOM   5203  C  CB    . TYR B  1 323 ? 90.134  120.376 12.337  1.00 25.47 ? 351  TYR B CB    1 
ATOM   5204  C  CG    . TYR B  1 323 ? 90.713  121.365 11.349  1.00 25.77 ? 351  TYR B CG    1 
ATOM   5205  C  CD1   . TYR B  1 323 ? 91.596  122.374 11.740  1.00 28.08 ? 351  TYR B CD1   1 
ATOM   5206  C  CD2   . TYR B  1 323 ? 90.325  121.313 10.004  1.00 27.83 ? 351  TYR B CD2   1 
ATOM   5207  C  CE1   . TYR B  1 323 ? 92.121  123.281 10.804  1.00 28.41 ? 351  TYR B CE1   1 
ATOM   5208  C  CE2   . TYR B  1 323 ? 90.823  122.208 9.071   1.00 27.85 ? 351  TYR B CE2   1 
ATOM   5209  C  CZ    . TYR B  1 323 ? 91.717  123.192 9.472   1.00 29.04 ? 351  TYR B CZ    1 
ATOM   5210  O  OH    . TYR B  1 323 ? 92.198  124.066 8.525   1.00 28.19 ? 351  TYR B OH    1 
ATOM   5211  N  N     . ASN B  1 324 ? 90.166  118.301 14.800  1.00 23.96 ? 352  ASN B N     1 
ATOM   5212  C  CA    . ASN B  1 324 ? 89.415  117.377 15.637  1.00 23.93 ? 352  ASN B CA    1 
ATOM   5213  C  C     . ASN B  1 324 ? 89.506  117.749 17.106  1.00 23.55 ? 352  ASN B C     1 
ATOM   5214  O  O     . ASN B  1 324 ? 88.506  117.674 17.825  1.00 23.44 ? 352  ASN B O     1 
ATOM   5215  C  CB    . ASN B  1 324 ? 89.880  115.931 15.430  1.00 24.29 ? 352  ASN B CB    1 
ATOM   5216  C  CG    . ASN B  1 324 ? 88.835  114.916 15.858  1.00 24.68 ? 352  ASN B CG    1 
ATOM   5217  O  OD1   . ASN B  1 324 ? 87.695  114.945 15.396  1.00 28.05 ? 352  ASN B OD1   1 
ATOM   5218  N  ND2   . ASN B  1 324 ? 89.225  114.009 16.728  1.00 25.26 ? 352  ASN B ND2   1 
ATOM   5219  N  N     . ALA B  1 325 ? 90.703  118.154 17.535  1.00 23.49 ? 353  ALA B N     1 
ATOM   5220  C  CA    . ALA B  1 325 ? 90.936  118.618 18.898  1.00 23.60 ? 353  ALA B CA    1 
ATOM   5221  C  C     . ALA B  1 325 ? 90.027  119.814 19.179  1.00 23.77 ? 353  ALA B C     1 
ATOM   5222  O  O     . ALA B  1 325 ? 89.387  119.871 20.235  1.00 22.63 ? 353  ALA B O     1 
ATOM   5223  C  CB    . ALA B  1 325 ? 92.397  119.001 19.101  1.00 23.11 ? 353  ALA B CB    1 
ATOM   5224  N  N     . ALA B  1 326 ? 89.982  120.743 18.217  1.00 24.00 ? 354  ALA B N     1 
ATOM   5225  C  CA    . ALA B  1 326 ? 89.120  121.946 18.298  1.00 25.00 ? 354  ALA B CA    1 
ATOM   5226  C  C     . ALA B  1 326 ? 87.621  121.622 18.409  1.00 25.54 ? 354  ALA B C     1 
ATOM   5227  O  O     . ALA B  1 326 ? 86.900  122.240 19.208  1.00 25.33 ? 354  ALA B O     1 
ATOM   5228  C  CB    . ALA B  1 326 ? 89.392  122.887 17.093  1.00 24.39 ? 354  ALA B CB    1 
ATOM   5229  N  N     . ARG B  1 327 ? 87.162  120.652 17.614  1.00 26.36 ? 355  ARG B N     1 
ATOM   5230  C  CA    . ARG B  1 327 ? 85.774  120.211 17.646  1.00 27.25 ? 355  ARG B CA    1 
ATOM   5231  C  C     . ARG B  1 327 ? 85.420  119.476 18.942  1.00 27.58 ? 355  ARG B C     1 
ATOM   5232  O  O     . ARG B  1 327 ? 84.319  119.660 19.474  1.00 26.79 ? 355  ARG B O     1 
ATOM   5233  C  CB    . ARG B  1 327 ? 85.442  119.346 16.426  1.00 27.43 ? 355  ARG B CB    1 
ATOM   5234  C  CG    . ARG B  1 327 ? 85.510  120.118 15.125  1.00 29.62 ? 355  ARG B CG    1 
ATOM   5235  C  CD    . ARG B  1 327 ? 85.016  119.286 13.960  1.00 34.68 ? 355  ARG B CD    1 
ATOM   5236  N  NE    . ARG B  1 327 ? 85.356  119.885 12.668  1.00 37.13 ? 355  ARG B NE    1 
ATOM   5237  C  CZ    . ARG B  1 327 ? 84.642  120.817 12.040  1.00 39.17 ? 355  ARG B CZ    1 
ATOM   5238  N  NH1   . ARG B  1 327 ? 83.518  121.298 12.570  1.00 41.32 ? 355  ARG B NH1   1 
ATOM   5239  N  NH2   . ARG B  1 327 ? 85.062  121.282 10.866  1.00 39.59 ? 355  ARG B NH2   1 
ATOM   5240  N  N     . LEU B  1 328 ? 86.351  118.660 19.448  1.00 27.74 ? 356  LEU B N     1 
ATOM   5241  C  CA    . LEU B  1 328 ? 86.163  117.985 20.734  1.00 27.77 ? 356  LEU B CA    1 
ATOM   5242  C  C     . LEU B  1 328 ? 85.989  119.001 21.870  1.00 28.13 ? 356  LEU B C     1 
ATOM   5243  O  O     . LEU B  1 328 ? 85.115  118.834 22.732  1.00 27.91 ? 356  LEU B O     1 
ATOM   5244  C  CB    . LEU B  1 328 ? 87.335  117.038 21.021  1.00 27.58 ? 356  LEU B CB    1 
ATOM   5245  C  CG    . LEU B  1 328 ? 87.324  115.732 20.210  1.00 27.23 ? 356  LEU B CG    1 
ATOM   5246  C  CD1   . LEU B  1 328 ? 88.692  115.034 20.241  1.00 27.10 ? 356  LEU B CD1   1 
ATOM   5247  C  CD2   . LEU B  1 328 ? 86.228  114.795 20.699  1.00 26.11 ? 356  LEU B CD2   1 
ATOM   5248  N  N     . LEU B  1 329 ? 86.814  120.048 21.862  1.00 28.37 ? 357  LEU B N     1 
ATOM   5249  C  CA    . LEU B  1 329 ? 86.668  121.149 22.817  1.00 29.11 ? 357  LEU B CA    1 
ATOM   5250  C  C     . LEU B  1 329 ? 85.281  121.784 22.696  1.00 29.72 ? 357  LEU B C     1 
ATOM   5251  O  O     . LEU B  1 329 ? 84.580  121.937 23.693  1.00 29.76 ? 357  LEU B O     1 
ATOM   5252  C  CB    . LEU B  1 329 ? 87.767  122.195 22.609  1.00 29.31 ? 357  LEU B CB    1 
ATOM   5253  C  CG    . LEU B  1 329 ? 87.789  123.431 23.512  1.00 28.34 ? 357  LEU B CG    1 
ATOM   5254  C  CD1   . LEU B  1 329 ? 89.184  123.988 23.585  1.00 27.16 ? 357  LEU B CD1   1 
ATOM   5255  C  CD2   . LEU B  1 329 ? 86.809  124.509 23.025  1.00 28.35 ? 357  LEU B CD2   1 
ATOM   5256  N  N     . GLU B  1 330 ? 84.884  122.130 21.474  1.00 30.53 ? 358  GLU B N     1 
ATOM   5257  C  CA    . GLU B  1 330 ? 83.590  122.772 21.233  1.00 31.25 ? 358  GLU B CA    1 
ATOM   5258  C  C     . GLU B  1 330 ? 82.399  121.892 21.606  1.00 31.26 ? 358  GLU B C     1 
ATOM   5259  O  O     . GLU B  1 330 ? 81.389  122.395 22.092  1.00 30.64 ? 358  GLU B O     1 
ATOM   5260  C  CB    . GLU B  1 330 ? 83.453  123.184 19.766  1.00 31.66 ? 358  GLU B CB    1 
ATOM   5261  C  CG    . GLU B  1 330 ? 84.303  124.372 19.355  1.00 32.20 ? 358  GLU B CG    1 
ATOM   5262  C  CD    . GLU B  1 330 ? 84.049  124.809 17.918  1.00 32.99 ? 358  GLU B CD    1 
ATOM   5263  O  OE1   . GLU B  1 330 ? 83.544  123.993 17.106  1.00 37.42 ? 358  GLU B OE1   1 
ATOM   5264  O  OE2   . GLU B  1 330 ? 84.357  125.972 17.593  1.00 34.50 ? 358  GLU B OE2   1 
ATOM   5265  N  N     . ALA B  1 331 ? 82.515  120.587 21.371  1.00 31.25 ? 359  ALA B N     1 
ATOM   5266  C  CA    . ALA B  1 331 ? 81.460  119.639 21.730  1.00 31.51 ? 359  ALA B CA    1 
ATOM   5267  C  C     . ALA B  1 331 ? 81.383  119.363 23.236  1.00 31.44 ? 359  ALA B C     1 
ATOM   5268  O  O     . ALA B  1 331 ? 80.481  118.655 23.689  1.00 31.88 ? 359  ALA B O     1 
ATOM   5269  C  CB    . ALA B  1 331 ? 81.645  118.325 20.961  1.00 31.66 ? 359  ALA B CB    1 
ATOM   5270  N  N     . GLY B  1 332 ? 82.322  119.905 24.009  1.00 31.33 ? 360  GLY B N     1 
ATOM   5271  C  CA    . GLY B  1 332 ? 82.341  119.695 25.456  1.00 31.18 ? 360  GLY B CA    1 
ATOM   5272  C  C     . GLY B  1 332 ? 82.836  118.308 25.835  1.00 31.09 ? 360  GLY B C     1 
ATOM   5273  O  O     . GLY B  1 332 ? 82.525  117.806 26.923  1.00 30.45 ? 360  GLY B O     1 
ATOM   5274  N  N     . LYS B  1 333 ? 83.620  117.705 24.939  1.00 30.82 ? 361  LYS B N     1 
ATOM   5275  C  CA    . LYS B  1 333 ? 84.160  116.361 25.125  1.00 30.89 ? 361  LYS B CA    1 
ATOM   5276  C  C     . LYS B  1 333 ? 85.603  116.448 25.605  1.00 30.88 ? 361  LYS B C     1 
ATOM   5277  O  O     . LYS B  1 333 ? 86.235  117.510 25.509  1.00 30.82 ? 361  LYS B O     1 
ATOM   5278  C  CB    . LYS B  1 333 ? 84.097  115.566 23.811  1.00 30.98 ? 361  LYS B CB    1 
ATOM   5279  C  CG    . LYS B  1 333 ? 82.715  115.508 23.168  1.00 31.16 ? 361  LYS B CG    1 
ATOM   5280  N  N     . PRO B  1 334 ? 86.132  115.341 26.156  1.00 30.78 ? 362  PRO B N     1 
ATOM   5281  C  CA    . PRO B  1 334 ? 87.542  115.349 26.537  1.00 30.47 ? 362  PRO B CA    1 
ATOM   5282  C  C     . PRO B  1 334 ? 88.430  115.677 25.329  1.00 29.65 ? 362  PRO B C     1 
ATOM   5283  O  O     . PRO B  1 334 ? 88.209  115.139 24.241  1.00 29.21 ? 362  PRO B O     1 
ATOM   5284  C  CB    . PRO B  1 334 ? 87.776  113.915 27.046  1.00 30.68 ? 362  PRO B CB    1 
ATOM   5285  C  CG    . PRO B  1 334 ? 86.438  113.451 27.485  1.00 31.17 ? 362  PRO B CG    1 
ATOM   5286  C  CD    . PRO B  1 334 ? 85.484  114.057 26.489  1.00 31.06 ? 362  PRO B CD    1 
ATOM   5287  N  N     . PHE B  1 335 ? 89.377  116.594 25.516  1.00 28.76 ? 363  PHE B N     1 
ATOM   5288  C  CA    . PHE B  1 335 ? 90.228  117.058 24.428  1.00 28.40 ? 363  PHE B CA    1 
ATOM   5289  C  C     . PHE B  1 335 ? 91.718  117.203 24.781  1.00 28.11 ? 363  PHE B C     1 
ATOM   5290  O  O     . PHE B  1 335 ? 92.513  117.480 23.900  1.00 27.95 ? 363  PHE B O     1 
ATOM   5291  C  CB    . PHE B  1 335 ? 89.712  118.404 23.894  1.00 28.63 ? 363  PHE B CB    1 
ATOM   5292  C  CG    . PHE B  1 335 ? 89.984  119.564 24.812  1.00 28.51 ? 363  PHE B CG    1 
ATOM   5293  C  CD1   . PHE B  1 335 ? 91.181  120.276 24.727  1.00 28.11 ? 363  PHE B CD1   1 
ATOM   5294  C  CD2   . PHE B  1 335 ? 89.049  119.939 25.764  1.00 29.28 ? 363  PHE B CD2   1 
ATOM   5295  C  CE1   . PHE B  1 335 ? 91.433  121.340 25.587  1.00 29.73 ? 363  PHE B CE1   1 
ATOM   5296  C  CE2   . PHE B  1 335 ? 89.294  121.011 26.619  1.00 30.20 ? 363  PHE B CE2   1 
ATOM   5297  C  CZ    . PHE B  1 335 ? 90.484  121.712 26.526  1.00 28.49 ? 363  PHE B CZ    1 
ATOM   5298  N  N     . ILE B  1 336 ? 92.096  117.045 26.049  1.00 27.69 ? 364  ILE B N     1 
ATOM   5299  C  CA    . ILE B  1 336 ? 93.485  117.271 26.449  1.00 27.43 ? 364  ILE B CA    1 
ATOM   5300  C  C     . ILE B  1 336 ? 94.486  116.350 25.714  1.00 27.22 ? 364  ILE B C     1 
ATOM   5301  O  O     . ILE B  1 336 ? 95.489  116.830 25.193  1.00 26.60 ? 364  ILE B O     1 
ATOM   5302  C  CB    . ILE B  1 336 ? 93.686  117.139 27.958  1.00 27.18 ? 364  ILE B CB    1 
ATOM   5303  C  CG1   . ILE B  1 336 ? 92.874  118.207 28.701  1.00 27.51 ? 364  ILE B CG1   1 
ATOM   5304  C  CG2   . ILE B  1 336 ? 95.184  117.282 28.307  1.00 26.48 ? 364  ILE B CG2   1 
ATOM   5305  C  CD1   . ILE B  1 336 ? 92.982  118.109 30.206  1.00 27.78 ? 364  ILE B CD1   1 
ATOM   5306  N  N     . LYS B  1 337 ? 94.225  115.045 25.682  1.00 27.11 ? 365  LYS B N     1 
ATOM   5307  C  CA    . LYS B  1 337 ? 95.136  114.109 24.984  1.00 27.51 ? 365  LYS B CA    1 
ATOM   5308  C  C     . LYS B  1 337 ? 95.272  114.517 23.509  1.00 26.86 ? 365  LYS B C     1 
ATOM   5309  O  O     . LYS B  1 337 ? 96.375  114.625 22.962  1.00 26.28 ? 365  LYS B O     1 
ATOM   5310  C  CB    . LYS B  1 337 ? 94.647  112.659 25.123  1.00 27.47 ? 365  LYS B CB    1 
ATOM   5311  C  CG    . LYS B  1 337 ? 95.566  111.622 24.436  1.00 27.78 ? 365  LYS B CG    1 
ATOM   5312  C  CD    . LYS B  1 337 ? 94.960  110.226 24.416  1.00 28.20 ? 365  LYS B CD    1 
ATOM   5313  C  CE    . LYS B  1 337 ? 93.873  110.084 23.364  1.00 30.20 ? 365  LYS B CE    1 
ATOM   5314  N  NZ    . LYS B  1 337 ? 93.227  108.742 23.371  1.00 30.83 ? 365  LYS B NZ    1 
ATOM   5315  N  N     . GLU B  1 338 ? 94.127  114.788 22.897  1.00 26.51 ? 366  GLU B N     1 
ATOM   5316  C  CA    . GLU B  1 338 ? 94.042  115.183 21.502  1.00 26.56 ? 366  GLU B CA    1 
ATOM   5317  C  C     . GLU B  1 338 ? 94.709  116.550 21.201  1.00 25.91 ? 366  GLU B C     1 
ATOM   5318  O  O     . GLU B  1 338 ? 95.333  116.717 20.155  1.00 25.84 ? 366  GLU B O     1 
ATOM   5319  C  CB    . GLU B  1 338 ? 92.569  115.166 21.077  1.00 27.13 ? 366  GLU B CB    1 
ATOM   5320  C  CG    . GLU B  1 338 ? 91.901  113.752 21.186  1.00 29.08 ? 366  GLU B CG    1 
ATOM   5321  C  CD    . GLU B  1 338 ? 91.292  113.395 22.571  1.00 31.52 ? 366  GLU B CD    1 
ATOM   5322  O  OE1   . GLU B  1 338 ? 91.446  114.153 23.568  1.00 30.67 ? 366  GLU B OE1   1 
ATOM   5323  O  OE2   . GLU B  1 338 ? 90.640  112.321 22.654  1.00 32.81 ? 366  GLU B OE2   1 
ATOM   5324  N  N     . ALA B  1 339 ? 94.603  117.515 22.119  1.00 25.36 ? 367  ALA B N     1 
ATOM   5325  C  CA    . ALA B  1 339 ? 95.320  118.790 21.969  1.00 25.00 ? 367  ALA B CA    1 
ATOM   5326  C  C     . ALA B  1 339 ? 96.832  118.556 22.019  1.00 24.89 ? 367  ALA B C     1 
ATOM   5327  O  O     . ALA B  1 339 ? 97.582  119.142 21.239  1.00 24.08 ? 367  ALA B O     1 
ATOM   5328  C  CB    . ALA B  1 339 ? 94.888  119.812 23.055  1.00 24.87 ? 367  ALA B CB    1 
ATOM   5329  N  N     . SER B  1 340 ? 97.283  117.704 22.944  1.00 24.75 ? 368  SER B N     1 
ATOM   5330  C  CA    . SER B  1 340 ? 98.709  117.397 23.054  1.00 24.91 ? 368  SER B CA    1 
ATOM   5331  C  C     . SER B  1 340 ? 99.218  116.676 21.821  1.00 24.15 ? 368  SER B C     1 
ATOM   5332  O  O     . SER B  1 340 ? 100.282 116.981 21.316  1.00 24.18 ? 368  SER B O     1 
ATOM   5333  C  CB    . SER B  1 340 ? 98.999  116.554 24.297  1.00 25.02 ? 368  SER B CB    1 
ATOM   5334  O  OG    . SER B  1 340 ? 98.700  117.293 25.457  1.00 28.01 ? 368  SER B OG    1 
ATOM   5335  N  N     . MET B  1 341 ? 98.441  115.718 21.332  1.00 23.95 ? 369  MET B N     1 
ATOM   5336  C  CA    . MET B  1 341 ? 98.791  115.014 20.113  1.00 23.41 ? 369  MET B CA    1 
ATOM   5337  C  C     . MET B  1 341 ? 98.911  115.992 18.944  1.00 23.47 ? 369  MET B C     1 
ATOM   5338  O  O     . MET B  1 341 ? 99.843  115.903 18.163  1.00 22.78 ? 369  MET B O     1 
ATOM   5339  C  CB    . MET B  1 341 ? 97.748  113.947 19.804  1.00 23.55 ? 369  MET B CB    1 
ATOM   5340  C  CG    . MET B  1 341 ? 97.853  112.716 20.641  1.00 22.76 ? 369  MET B CG    1 
ATOM   5341  S  SD    . MET B  1 341 ? 96.517  111.576 20.209  1.00 23.12 ? 369  MET B SD    1 
ATOM   5342  C  CE    . MET B  1 341 ? 96.984  110.116 21.133  1.00 24.33 ? 369  MET B CE    1 
ATOM   5343  N  N     . ALA B  1 342 ? 97.976  116.943 18.851  1.00 23.46 ? 370  ALA B N     1 
ATOM   5344  C  CA    . ALA B  1 342 ? 97.970  117.904 17.746  1.00 23.05 ? 370  ALA B CA    1 
ATOM   5345  C  C     . ALA B  1 342 ? 99.188  118.806 17.802  1.00 23.27 ? 370  ALA B C     1 
ATOM   5346  O  O     . ALA B  1 342 ? 99.837  119.032 16.787  1.00 23.18 ? 370  ALA B O     1 
ATOM   5347  C  CB    . ALA B  1 342 ? 96.721  118.747 17.745  1.00 22.01 ? 370  ALA B CB    1 
ATOM   5348  N  N     . LYS B  1 343 ? 99.474  119.341 18.984  1.00 23.27 ? 371  LYS B N     1 
ATOM   5349  C  CA    . LYS B  1 343 ? 100.606 120.263 19.143  1.00 23.31 ? 371  LYS B CA    1 
ATOM   5350  C  C     . LYS B  1 343 ? 101.931 119.547 18.879  1.00 23.15 ? 371  LYS B C     1 
ATOM   5351  O  O     . LYS B  1 343 ? 102.798 120.063 18.164  1.00 22.84 ? 371  LYS B O     1 
ATOM   5352  C  CB    . LYS B  1 343 ? 100.588 120.886 20.534  1.00 22.78 ? 371  LYS B CB    1 
ATOM   5353  C  CG    . LYS B  1 343 ? 101.520 122.092 20.725  1.00 24.09 ? 371  LYS B CG    1 
ATOM   5354  C  CD    . LYS B  1 343 ? 102.889 121.669 21.223  1.00 25.39 ? 371  LYS B CD    1 
ATOM   5355  C  CE    . LYS B  1 343 ? 103.797 122.852 21.404  1.00 26.16 ? 371  LYS B CE    1 
ATOM   5356  N  NZ    . LYS B  1 343 ? 105.140 122.428 21.806  1.00 27.73 ? 371  LYS B NZ    1 
ATOM   5357  N  N     . TYR B  1 344 ? 102.079 118.366 19.468  1.00 23.72 ? 372  TYR B N     1 
ATOM   5358  C  CA    . TYR B  1 344 ? 103.258 117.532 19.244  1.00 24.81 ? 372  TYR B CA    1 
ATOM   5359  C  C     . TYR B  1 344 ? 103.455 117.220 17.771  1.00 25.11 ? 372  TYR B C     1 
ATOM   5360  O  O     . TYR B  1 344 ? 104.526 117.482 17.215  1.00 24.67 ? 372  TYR B O     1 
ATOM   5361  C  CB    . TYR B  1 344 ? 103.175 116.235 20.043  1.00 25.60 ? 372  TYR B CB    1 
ATOM   5362  C  CG    . TYR B  1 344 ? 104.221 115.218 19.666  1.00 26.45 ? 372  TYR B CG    1 
ATOM   5363  C  CD1   . TYR B  1 344 ? 105.557 115.393 20.022  1.00 27.41 ? 372  TYR B CD1   1 
ATOM   5364  C  CD2   . TYR B  1 344 ? 103.874 114.076 18.955  1.00 28.58 ? 372  TYR B CD2   1 
ATOM   5365  C  CE1   . TYR B  1 344 ? 106.532 114.465 19.658  1.00 27.70 ? 372  TYR B CE1   1 
ATOM   5366  C  CE2   . TYR B  1 344 ? 104.838 113.131 18.591  1.00 30.55 ? 372  TYR B CE2   1 
ATOM   5367  C  CZ    . TYR B  1 344 ? 106.160 113.333 18.947  1.00 28.29 ? 372  TYR B CZ    1 
ATOM   5368  O  OH    . TYR B  1 344 ? 107.089 112.387 18.592  1.00 30.61 ? 372  TYR B OH    1 
ATOM   5369  N  N     . TYR B  1 345 ? 102.421 116.661 17.145  1.00 25.43 ? 373  TYR B N     1 
ATOM   5370  C  CA    . TYR B  1 345 ? 102.530 116.215 15.770  1.00 25.83 ? 373  TYR B CA    1 
ATOM   5371  C  C     . TYR B  1 345 ? 102.747 117.381 14.793  1.00 25.76 ? 373  TYR B C     1 
ATOM   5372  O  O     . TYR B  1 345 ? 103.642 117.312 13.948  1.00 24.49 ? 373  TYR B O     1 
ATOM   5373  C  CB    . TYR B  1 345 ? 101.314 115.377 15.378  1.00 26.59 ? 373  TYR B CB    1 
ATOM   5374  C  CG    . TYR B  1 345 ? 101.498 114.653 14.089  1.00 27.42 ? 373  TYR B CG    1 
ATOM   5375  C  CD1   . TYR B  1 345 ? 102.073 113.385 14.051  1.00 30.53 ? 373  TYR B CD1   1 
ATOM   5376  C  CD2   . TYR B  1 345 ? 101.108 115.234 12.894  1.00 29.84 ? 373  TYR B CD2   1 
ATOM   5377  C  CE1   . TYR B  1 345 ? 102.251 112.720 12.844  1.00 29.59 ? 373  TYR B CE1   1 
ATOM   5378  C  CE2   . TYR B  1 345 ? 101.291 114.581 11.689  1.00 29.73 ? 373  TYR B CE2   1 
ATOM   5379  C  CZ    . TYR B  1 345 ? 101.856 113.334 11.669  1.00 29.29 ? 373  TYR B CZ    1 
ATOM   5380  O  OH    . TYR B  1 345 ? 102.016 112.705 10.450  1.00 30.41 ? 373  TYR B OH    1 
ATOM   5381  N  N     . ALA B  1 346 ? 101.949 118.447 14.939  1.00 25.60 ? 374  ALA B N     1 
ATOM   5382  C  CA    . ALA B  1 346 ? 102.029 119.596 14.048  1.00 25.89 ? 374  ALA B CA    1 
ATOM   5383  C  C     . ALA B  1 346 ? 103.386 120.305 14.148  1.00 26.05 ? 374  ALA B C     1 
ATOM   5384  O  O     . ALA B  1 346 ? 103.956 120.696 13.123  1.00 25.62 ? 374  ALA B O     1 
ATOM   5385  C  CB    . ALA B  1 346 ? 100.853 120.596 14.308  1.00 25.40 ? 374  ALA B CB    1 
ATOM   5386  N  N     . SER B  1 347 ? 103.901 120.443 15.372  1.00 25.89 ? 375  SER B N     1 
ATOM   5387  C  CA    . SER B  1 347 ? 105.217 121.065 15.583  1.00 26.06 ? 375  SER B CA    1 
ATOM   5388  C  C     . SER B  1 347 ? 106.336 120.229 14.980  1.00 25.87 ? 375  SER B C     1 
ATOM   5389  O  O     . SER B  1 347 ? 107.202 120.772 14.302  1.00 25.99 ? 375  SER B O     1 
ATOM   5390  C  CB    . SER B  1 347 ? 105.490 121.325 17.071  1.00 25.49 ? 375  SER B CB    1 
ATOM   5391  O  OG    . SER B  1 347 ? 105.464 120.126 17.838  1.00 26.67 ? 375  SER B OG    1 
ATOM   5392  N  N     . GLU B  1 348 ? 106.309 118.920 15.223  1.00 26.70 ? 376  GLU B N     1 
ATOM   5393  C  CA    . GLU B  1 348 ? 107.332 118.017 14.695  1.00 27.18 ? 376  GLU B CA    1 
ATOM   5394  C  C     . GLU B  1 348 ? 107.301 117.995 13.164  1.00 26.91 ? 376  GLU B C     1 
ATOM   5395  O  O     . GLU B  1 348 ? 108.342 118.115 12.541  1.00 27.22 ? 376  GLU B O     1 
ATOM   5396  C  CB    . GLU B  1 348 ? 107.195 116.593 15.249  1.00 27.78 ? 376  GLU B CB    1 
ATOM   5397  C  CG    . GLU B  1 348 ? 107.465 116.441 16.775  1.00 28.88 ? 376  GLU B CG    1 
ATOM   5398  C  CD    . GLU B  1 348 ? 108.931 116.629 17.184  1.00 31.83 ? 376  GLU B CD    1 
ATOM   5399  O  OE1   . GLU B  1 348 ? 109.824 116.518 16.314  1.00 32.29 ? 376  GLU B OE1   1 
ATOM   5400  O  OE2   . GLU B  1 348 ? 109.191 116.891 18.384  1.00 31.89 ? 376  GLU B OE2   1 
ATOM   5401  N  N     . ILE B  1 349 ? 106.108 117.881 12.565  1.00 26.71 ? 377  ILE B N     1 
ATOM   5402  C  CA    A ILE B  1 349 ? 106.036 117.851 11.107  0.50 26.08 ? 377  ILE B CA    1 
ATOM   5403  C  CA    B ILE B  1 349 ? 105.920 117.891 11.105  0.50 26.32 ? 377  ILE B CA    1 
ATOM   5404  C  C     . ILE B  1 349 ? 106.270 119.234 10.466  1.00 26.26 ? 377  ILE B C     1 
ATOM   5405  O  O     . ILE B  1 349 ? 106.761 119.301 9.328   1.00 25.80 ? 377  ILE B O     1 
ATOM   5406  C  CB    A ILE B  1 349 ? 104.771 117.092 10.573  0.50 25.84 ? 377  ILE B CB    1 
ATOM   5407  C  CB    B ILE B  1 349 ? 104.447 117.531 10.738  0.50 26.25 ? 377  ILE B CB    1 
ATOM   5408  C  CG1   A ILE B  1 349 ? 103.480 117.894 10.780  0.50 24.91 ? 377  ILE B CG1   1 
ATOM   5409  C  CG1   B ILE B  1 349 ? 104.150 116.053 11.050  0.50 26.16 ? 377  ILE B CG1   1 
ATOM   5410  C  CG2   A ILE B  1 349 ? 104.689 115.696 11.222  0.50 25.65 ? 377  ILE B CG2   1 
ATOM   5411  C  CG2   B ILE B  1 349 ? 104.104 117.906 9.271   0.50 26.68 ? 377  ILE B CG2   1 
ATOM   5412  C  CD1   A ILE B  1 349 ? 103.116 118.767 9.591   0.50 23.01 ? 377  ILE B CD1   1 
ATOM   5413  C  CD1   B ILE B  1 349 ? 105.367 115.151 11.204  0.50 24.21 ? 377  ILE B CD1   1 
ATOM   5414  N  N     . ALA B  1 350 ? 105.984 120.323 11.184  1.00 26.00 ? 378  ALA B N     1 
ATOM   5415  C  CA    . ALA B  1 350 ? 106.356 121.654 10.689  1.00 26.53 ? 378  ALA B CA    1 
ATOM   5416  C  C     . ALA B  1 350 ? 107.891 121.765 10.531  1.00 26.10 ? 378  ALA B C     1 
ATOM   5417  O  O     . ALA B  1 350 ? 108.374 122.315 9.559   1.00 26.27 ? 378  ALA B O     1 
ATOM   5418  C  CB    . ALA B  1 350 ? 105.818 122.754 11.603  1.00 26.70 ? 378  ALA B CB    1 
ATOM   5419  N  N     . GLY B  1 351 ? 108.649 121.229 11.480  1.00 26.17 ? 379  GLY B N     1 
ATOM   5420  C  CA    . GLY B  1 351 ? 110.103 121.199 11.372  1.00 26.72 ? 379  GLY B CA    1 
ATOM   5421  C  C     . GLY B  1 351 ? 110.550 120.366 10.171  1.00 27.11 ? 379  GLY B C     1 
ATOM   5422  O  O     . GLY B  1 351 ? 111.422 120.782 9.400   1.00 26.96 ? 379  GLY B O     1 
ATOM   5423  N  N     . GLN B  1 352 ? 109.940 119.191 10.008  1.00 27.31 ? 380  GLN B N     1 
ATOM   5424  C  CA    . GLN B  1 352 ? 110.296 118.293 8.902   1.00 28.30 ? 380  GLN B CA    1 
ATOM   5425  C  C     . GLN B  1 352 ? 109.952 118.905 7.547   1.00 27.77 ? 380  GLN B C     1 
ATOM   5426  O  O     . GLN B  1 352 ? 110.753 118.846 6.614   1.00 27.67 ? 380  GLN B O     1 
ATOM   5427  C  CB    . GLN B  1 352 ? 109.617 116.930 9.070   1.00 28.18 ? 380  GLN B CB    1 
ATOM   5428  C  CG    . GLN B  1 352 ? 110.111 116.161 10.278  1.00 29.92 ? 380  GLN B CG    1 
ATOM   5429  C  CD    . GLN B  1 352 ? 109.424 114.821 10.470  1.00 31.12 ? 380  GLN B CD    1 
ATOM   5430  O  OE1   . GLN B  1 352 ? 109.144 114.108 9.505   1.00 35.90 ? 380  GLN B OE1   1 
ATOM   5431  N  NE2   . GLN B  1 352 ? 109.151 114.469 11.726  1.00 33.56 ? 380  GLN B NE2   1 
ATOM   5432  N  N     . THR B  1 353 ? 108.759 119.486 7.443   1.00 28.30 ? 381  THR B N     1 
ATOM   5433  C  CA    . THR B  1 353 ? 108.267 120.113 6.212   1.00 27.64 ? 381  THR B CA    1 
ATOM   5434  C  C     . THR B  1 353 ? 109.188 121.250 5.762   1.00 27.54 ? 381  THR B C     1 
ATOM   5435  O  O     . THR B  1 353 ? 109.602 121.295 4.608   1.00 27.00 ? 381  THR B O     1 
ATOM   5436  C  CB    . THR B  1 353 ? 106.821 120.679 6.382   1.00 28.00 ? 381  THR B CB    1 
ATOM   5437  O  OG1   . THR B  1 353 ? 105.918 119.628 6.740   1.00 27.82 ? 381  THR B OG1   1 
ATOM   5438  C  CG2   . THR B  1 353 ? 106.297 121.340 5.092   1.00 27.97 ? 381  THR B CG2   1 
ATOM   5439  N  N     . THR B  1 354 ? 109.518 122.156 6.672   1.00 27.32 ? 382  THR B N     1 
ATOM   5440  C  CA    . THR B  1 354 ? 110.317 123.323 6.334   1.00 27.20 ? 382  THR B CA    1 
ATOM   5441  C  C     . THR B  1 354 ? 111.775 122.943 5.994   1.00 27.51 ? 382  THR B C     1 
ATOM   5442  O  O     . THR B  1 354 ? 112.398 123.539 5.108   1.00 26.47 ? 382  THR B O     1 
ATOM   5443  C  CB    . THR B  1 354 ? 110.254 124.390 7.465   1.00 27.54 ? 382  THR B CB    1 
ATOM   5444  O  OG1   . THR B  1 354 ? 110.715 123.830 8.709   1.00 25.92 ? 382  THR B OG1   1 
ATOM   5445  C  CG2   . THR B  1 354 ? 108.808 124.904 7.629   1.00 26.86 ? 382  THR B CG2   1 
ATOM   5446  N  N     . SER B  1 355 ? 112.309 121.964 6.710   1.00 27.79 ? 383  SER B N     1 
ATOM   5447  C  CA    . SER B  1 355 ? 113.632 121.395 6.418   1.00 28.44 ? 383  SER B CA    1 
ATOM   5448  C  C     . SER B  1 355 ? 113.676 120.798 5.000   1.00 28.46 ? 383  SER B C     1 
ATOM   5449  O  O     . SER B  1 355 ? 114.594 121.087 4.227   1.00 28.99 ? 383  SER B O     1 
ATOM   5450  C  CB    . SER B  1 355 ? 113.973 120.323 7.467   1.00 28.38 ? 383  SER B CB    1 
ATOM   5451  O  OG    . SER B  1 355 ? 115.258 119.760 7.254   1.00 29.95 ? 383  SER B OG    1 
ATOM   5452  N  N     . LYS B  1 356 ? 112.666 120.002 4.659   1.00 28.66 ? 384  LYS B N     1 
ATOM   5453  C  CA    . LYS B  1 356 ? 112.574 119.415 3.318   1.00 29.27 ? 384  LYS B CA    1 
ATOM   5454  C  C     . LYS B  1 356 ? 112.372 120.475 2.236   1.00 28.93 ? 384  LYS B C     1 
ATOM   5455  O  O     . LYS B  1 356 ? 112.969 120.388 1.183   1.00 27.89 ? 384  LYS B O     1 
ATOM   5456  C  CB    . LYS B  1 356 ? 111.456 118.374 3.229   1.00 29.15 ? 384  LYS B CB    1 
ATOM   5457  C  CG    . LYS B  1 356 ? 111.774 117.039 3.867   1.00 32.54 ? 384  LYS B CG    1 
ATOM   5458  C  CD    . LYS B  1 356 ? 113.084 116.489 3.347   1.00 34.25 ? 384  LYS B CD    1 
ATOM   5459  C  CE    . LYS B  1 356 ? 113.242 115.008 3.557   1.00 36.33 ? 384  LYS B CE    1 
ATOM   5460  N  NZ    . LYS B  1 356 ? 114.671 114.740 3.795   1.00 38.11 ? 384  LYS B NZ    1 
ATOM   5461  N  N     . CYS B  1 357 ? 111.529 121.466 2.501   1.00 28.54 ? 385  CYS B N     1 
ATOM   5462  C  CA    . CYS B  1 357 ? 111.246 122.509 1.517   1.00 28.65 ? 385  CYS B CA    1 
ATOM   5463  C  C     . CYS B  1 357 ? 112.510 123.263 1.117   1.00 28.40 ? 385  CYS B C     1 
ATOM   5464  O  O     . CYS B  1 357 ? 112.696 123.572 -0.070  1.00 27.25 ? 385  CYS B O     1 
ATOM   5465  C  CB    . CYS B  1 357 ? 110.158 123.475 2.014   1.00 28.61 ? 385  CYS B CB    1 
ATOM   5466  S  SG    . CYS B  1 357 ? 108.452 122.810 1.847   1.00 30.66 ? 385  CYS B SG    1 
ATOM   5467  N  N     . ILE B  1 358 ? 113.384 123.541 2.092   1.00 27.53 ? 386  ILE B N     1 
ATOM   5468  C  CA    . ILE B  1 358 ? 114.675 124.158 1.797   1.00 28.17 ? 386  ILE B CA    1 
ATOM   5469  C  C     . ILE B  1 358 ? 115.465 123.286 0.806   1.00 27.75 ? 386  ILE B C     1 
ATOM   5470  O  O     . ILE B  1 358 ? 115.968 123.789 -0.198  1.00 27.75 ? 386  ILE B O     1 
ATOM   5471  C  CB    . ILE B  1 358 ? 115.536 124.425 3.084   1.00 27.84 ? 386  ILE B CB    1 
ATOM   5472  C  CG1   . ILE B  1 358 ? 114.906 125.529 3.939   1.00 28.65 ? 386  ILE B CG1   1 
ATOM   5473  C  CG2   . ILE B  1 358 ? 116.959 124.850 2.690   1.00 28.59 ? 386  ILE B CG2   1 
ATOM   5474  C  CD1   . ILE B  1 358 ? 115.704 125.883 5.246   1.00 28.16 ? 386  ILE B CD1   1 
ATOM   5475  N  N     . GLU B  1 359 ? 115.541 121.984 1.088   1.00 28.06 ? 387  GLU B N     1 
ATOM   5476  C  CA    . GLU B  1 359 ? 116.217 121.024 0.213   1.00 28.38 ? 387  GLU B CA    1 
ATOM   5477  C  C     . GLU B  1 359 ? 115.610 120.949 -1.197  1.00 27.72 ? 387  GLU B C     1 
ATOM   5478  O  O     . GLU B  1 359 ? 116.345 120.863 -2.176  1.00 26.98 ? 387  GLU B O     1 
ATOM   5479  C  CB    . GLU B  1 359 ? 116.223 119.626 0.842   1.00 28.68 ? 387  GLU B CB    1 
ATOM   5480  C  CG    . GLU B  1 359 ? 117.026 119.572 2.116   1.00 29.32 ? 387  GLU B CG    1 
ATOM   5481  C  CD    . GLU B  1 359 ? 116.998 118.216 2.799   1.00 30.97 ? 387  GLU B CD    1 
ATOM   5482  O  OE1   . GLU B  1 359 ? 116.477 117.238 2.213   1.00 36.82 ? 387  GLU B OE1   1 
ATOM   5483  O  OE2   . GLU B  1 359 ? 117.524 118.138 3.929   1.00 33.09 ? 387  GLU B OE2   1 
ATOM   5484  N  N     . TRP B  1 360 ? 114.282 120.999 -1.290  1.00 26.97 ? 388  TRP B N     1 
ATOM   5485  C  CA    . TRP B  1 360 ? 113.598 120.951 -2.579  1.00 27.20 ? 388  TRP B CA    1 
ATOM   5486  C  C     . TRP B  1 360 ? 113.890 122.200 -3.410  1.00 27.03 ? 388  TRP B C     1 
ATOM   5487  O  O     . TRP B  1 360 ? 114.021 122.095 -4.627  1.00 26.66 ? 388  TRP B O     1 
ATOM   5488  C  CB    . TRP B  1 360 ? 112.072 120.768 -2.437  1.00 27.60 ? 388  TRP B CB    1 
ATOM   5489  C  CG    . TRP B  1 360 ? 111.653 119.545 -1.680  1.00 27.72 ? 388  TRP B CG    1 
ATOM   5490  C  CD1   . TRP B  1 360 ? 112.384 118.412 -1.488  1.00 28.17 ? 388  TRP B CD1   1 
ATOM   5491  C  CD2   . TRP B  1 360 ? 110.403 119.337 -1.002  1.00 27.46 ? 388  TRP B CD2   1 
ATOM   5492  N  NE1   . TRP B  1 360 ? 111.681 117.516 -0.728  1.00 28.38 ? 388  TRP B NE1   1 
ATOM   5493  C  CE2   . TRP B  1 360 ? 110.455 118.051 -0.424  1.00 28.19 ? 388  TRP B CE2   1 
ATOM   5494  C  CE3   . TRP B  1 360 ? 109.243 120.108 -0.839  1.00 28.82 ? 388  TRP B CE3   1 
ATOM   5495  C  CZ2   . TRP B  1 360 ? 109.410 117.527 0.339   1.00 27.93 ? 388  TRP B CZ2   1 
ATOM   5496  C  CZ3   . TRP B  1 360 ? 108.188 119.579 -0.089  1.00 28.36 ? 388  TRP B CZ3   1 
ATOM   5497  C  CH2   . TRP B  1 360 ? 108.283 118.302 0.491   1.00 28.40 ? 388  TRP B CH2   1 
ATOM   5498  N  N     . MET B  1 361 ? 114.005 123.358 -2.754  1.00 26.53 ? 389  MET B N     1 
ATOM   5499  C  CA    . MET B  1 361 ? 114.351 124.614 -3.433  1.00 27.11 ? 389  MET B CA    1 
ATOM   5500  C  C     . MET B  1 361 ? 115.815 124.663 -3.867  1.00 26.39 ? 389  MET B C     1 
ATOM   5501  O  O     . MET B  1 361 ? 116.169 125.399 -4.786  1.00 26.52 ? 389  MET B O     1 
ATOM   5502  C  CB    . MET B  1 361 ? 114.109 125.827 -2.520  1.00 27.48 ? 389  MET B CB    1 
ATOM   5503  C  CG    . MET B  1 361 ? 112.701 126.006 -2.004  1.00 30.14 ? 389  MET B CG    1 
ATOM   5504  S  SD    . MET B  1 361 ? 111.524 126.635 -3.159  1.00 34.44 ? 389  MET B SD    1 
ATOM   5505  C  CE    . MET B  1 361 ? 112.321 128.139 -3.746  1.00 30.12 ? 389  MET B CE    1 
ATOM   5506  N  N     . GLY B  1 362 ? 116.671 123.914 -3.175  1.00 26.05 ? 390  GLY B N     1 
ATOM   5507  C  CA    . GLY B  1 362 ? 118.110 123.992 -3.384  1.00 25.55 ? 390  GLY B CA    1 
ATOM   5508  C  C     . GLY B  1 362 ? 118.711 125.282 -2.850  1.00 25.04 ? 390  GLY B C     1 
ATOM   5509  O  O     . GLY B  1 362 ? 118.247 125.832 -1.837  1.00 26.01 ? 390  GLY B O     1 
ATOM   5510  N  N     . GLY B  1 363 ? 119.758 125.759 -3.528  1.00 24.43 ? 391  GLY B N     1 
ATOM   5511  C  CA    . GLY B  1 363 ? 120.490 126.963 -3.142  1.00 23.84 ? 391  GLY B CA    1 
ATOM   5512  C  C     . GLY B  1 363 ? 119.636 128.161 -2.761  1.00 23.40 ? 391  GLY B C     1 
ATOM   5513  O  O     . GLY B  1 363 ? 119.852 128.786 -1.729  1.00 22.56 ? 391  GLY B O     1 
ATOM   5514  N  N     . VAL B  1 364 ? 118.646 128.469 -3.588  1.00 23.23 ? 392  VAL B N     1 
ATOM   5515  C  CA    . VAL B  1 364 ? 117.776 129.624 -3.326  1.00 23.09 ? 392  VAL B CA    1 
ATOM   5516  C  C     . VAL B  1 364 ? 117.017 129.509 -1.996  1.00 23.41 ? 392  VAL B C     1 
ATOM   5517  O  O     . VAL B  1 364 ? 116.774 130.515 -1.342  1.00 23.52 ? 392  VAL B O     1 
ATOM   5518  C  CB    . VAL B  1 364 ? 116.796 129.895 -4.507  1.00 23.44 ? 392  VAL B CB    1 
ATOM   5519  C  CG1   . VAL B  1 364 ? 117.585 130.253 -5.772  1.00 23.44 ? 392  VAL B CG1   1 
ATOM   5520  C  CG2   . VAL B  1 364 ? 115.824 128.724 -4.721  1.00 21.51 ? 392  VAL B CG2   1 
ATOM   5521  N  N     . GLY B  1 365 ? 116.655 128.282 -1.606  1.00 23.82 ? 393  GLY B N     1 
ATOM   5522  C  CA    . GLY B  1 365 ? 116.052 128.012 -0.300  1.00 24.36 ? 393  GLY B CA    1 
ATOM   5523  C  C     . GLY B  1 365 ? 116.920 128.411 0.883   1.00 24.79 ? 393  GLY B C     1 
ATOM   5524  O  O     . GLY B  1 365 ? 116.401 128.703 1.960   1.00 25.61 ? 393  GLY B O     1 
ATOM   5525  N  N     . TYR B  1 366 ? 118.239 128.470 0.679   1.00 25.17 ? 394  TYR B N     1 
ATOM   5526  C  CA    . TYR B  1 366 ? 119.172 128.840 1.748   1.00 25.24 ? 394  TYR B CA    1 
ATOM   5527  C  C     . TYR B  1 366 ? 119.375 130.360 1.844   1.00 25.15 ? 394  TYR B C     1 
ATOM   5528  O  O     . TYR B  1 366 ? 120.139 130.836 2.695   1.00 25.79 ? 394  TYR B O     1 
ATOM   5529  C  CB    . TYR B  1 366 ? 120.505 128.109 1.539   1.00 25.68 ? 394  TYR B CB    1 
ATOM   5530  C  CG    . TYR B  1 366 ? 121.339 127.920 2.800   1.00 25.39 ? 394  TYR B CG    1 
ATOM   5531  C  CD1   . TYR B  1 366 ? 120.923 127.061 3.816   1.00 26.18 ? 394  TYR B CD1   1 
ATOM   5532  C  CD2   . TYR B  1 366 ? 122.534 128.596 2.968   1.00 26.14 ? 394  TYR B CD2   1 
ATOM   5533  C  CE1   . TYR B  1 366 ? 121.699 126.887 4.975   1.00 25.88 ? 394  TYR B CE1   1 
ATOM   5534  C  CE2   . TYR B  1 366 ? 123.309 128.424 4.110   1.00 27.44 ? 394  TYR B CE2   1 
ATOM   5535  C  CZ    . TYR B  1 366 ? 122.880 127.557 5.116   1.00 25.56 ? 394  TYR B CZ    1 
ATOM   5536  O  OH    . TYR B  1 366 ? 123.669 127.387 6.255   1.00 25.29 ? 394  TYR B OH    1 
ATOM   5537  N  N     . THR B  1 367 ? 118.718 131.141 0.976   1.00 24.42 ? 395  THR B N     1 
ATOM   5538  C  CA    . THR B  1 367 ? 118.901 132.588 0.982   1.00 24.50 ? 395  THR B CA    1 
ATOM   5539  C  C     . THR B  1 367 ? 117.657 133.301 1.515   1.00 24.51 ? 395  THR B C     1 
ATOM   5540  O  O     . THR B  1 367 ? 116.547 132.791 1.421   1.00 23.16 ? 395  THR B O     1 
ATOM   5541  C  CB    . THR B  1 367 ? 119.249 133.167 -0.441  1.00 24.16 ? 395  THR B CB    1 
ATOM   5542  O  OG1   . THR B  1 367 ? 118.089 133.096 -1.290  1.00 24.43 ? 395  THR B OG1   1 
ATOM   5543  C  CG2   . THR B  1 367 ? 120.412 132.384 -1.079  1.00 22.81 ? 395  THR B CG2   1 
ATOM   5544  N  N     . LYS B  1 368 ? 117.869 134.510 2.018   1.00 25.38 ? 396  LYS B N     1 
ATOM   5545  C  CA    . LYS B  1 368 ? 116.810 135.312 2.628   1.00 26.89 ? 396  LYS B CA    1 
ATOM   5546  C  C     . LYS B  1 368 ? 115.995 136.058 1.564   1.00 27.86 ? 396  LYS B C     1 
ATOM   5547  O  O     . LYS B  1 368 ? 115.010 136.702 1.883   1.00 28.08 ? 396  LYS B O     1 
ATOM   5548  C  CB    . LYS B  1 368 ? 117.406 136.280 3.652   1.00 26.91 ? 396  LYS B CB    1 
ATOM   5549  C  CG    . LYS B  1 368 ? 118.031 135.542 4.851   1.00 27.83 ? 396  LYS B CG    1 
ATOM   5550  C  CD    . LYS B  1 368 ? 118.359 136.448 5.994   1.00 28.90 ? 396  LYS B CD    1 
ATOM   5551  C  CE    . LYS B  1 368 ? 118.991 135.683 7.156   1.00 27.79 ? 396  LYS B CE    1 
ATOM   5552  N  NZ    . LYS B  1 368 ? 118.016 134.774 7.840   1.00 26.29 ? 396  LYS B NZ    1 
ATOM   5553  N  N     . ASP B  1 369 ? 116.394 135.924 0.301   1.00 28.47 ? 397  ASP B N     1 
ATOM   5554  C  CA    . ASP B  1 369 ? 115.627 136.443 -0.832  1.00 29.67 ? 397  ASP B CA    1 
ATOM   5555  C  C     . ASP B  1 369 ? 114.361 135.609 -1.087  1.00 28.82 ? 397  ASP B C     1 
ATOM   5556  O  O     . ASP B  1 369 ? 113.455 136.036 -1.815  1.00 29.36 ? 397  ASP B O     1 
ATOM   5557  C  CB    . ASP B  1 369 ? 116.478 136.420 -2.093  1.00 30.25 ? 397  ASP B CB    1 
ATOM   5558  C  CG    . ASP B  1 369 ? 117.609 137.408 -2.062  1.00 33.25 ? 397  ASP B CG    1 
ATOM   5559  O  OD1   . ASP B  1 369 ? 117.497 138.486 -1.441  1.00 39.17 ? 397  ASP B OD1   1 
ATOM   5560  O  OD2   . ASP B  1 369 ? 118.627 137.118 -2.708  1.00 40.81 ? 397  ASP B OD2   1 
ATOM   5561  N  N     . TYR B  1 370 ? 114.328 134.419 -0.512  1.00 27.70 ? 398  TYR B N     1 
ATOM   5562  C  CA    . TYR B  1 370 ? 113.202 133.513 -0.609  1.00 27.53 ? 398  TYR B CA    1 
ATOM   5563  C  C     . TYR B  1 370 ? 112.654 133.286 0.804   1.00 27.41 ? 398  TYR B C     1 
ATOM   5564  O  O     . TYR B  1 370 ? 113.368 133.511 1.778   1.00 26.87 ? 398  TYR B O     1 
ATOM   5565  C  CB    . TYR B  1 370 ? 113.661 132.218 -1.257  1.00 27.52 ? 398  TYR B CB    1 
ATOM   5566  C  CG    . TYR B  1 370 ? 113.983 132.384 -2.732  1.00 27.15 ? 398  TYR B CG    1 
ATOM   5567  C  CD1   . TYR B  1 370 ? 113.126 131.891 -3.703  1.00 27.69 ? 398  TYR B CD1   1 
ATOM   5568  C  CD2   . TYR B  1 370 ? 115.120 133.077 -3.153  1.00 27.21 ? 398  TYR B CD2   1 
ATOM   5569  C  CE1   . TYR B  1 370 ? 113.409 132.042 -5.060  1.00 27.71 ? 398  TYR B CE1   1 
ATOM   5570  C  CE2   . TYR B  1 370 ? 115.407 133.235 -4.497  1.00 25.76 ? 398  TYR B CE2   1 
ATOM   5571  C  CZ    . TYR B  1 370 ? 114.543 132.705 -5.445  1.00 27.56 ? 398  TYR B CZ    1 
ATOM   5572  O  OH    . TYR B  1 370 ? 114.805 132.851 -6.791  1.00 29.01 ? 398  TYR B OH    1 
ATOM   5573  N  N     . PRO B  1 371 ? 111.372 132.897 0.925   1.00 28.06 ? 399  PRO B N     1 
ATOM   5574  C  CA    . PRO B  1 371 ? 110.705 132.821 2.245   1.00 27.75 ? 399  PRO B CA    1 
ATOM   5575  C  C     . PRO B  1 371 ? 110.882 131.542 3.047   1.00 27.80 ? 399  PRO B C     1 
ATOM   5576  O  O     . PRO B  1 371 ? 110.520 131.501 4.230   1.00 27.45 ? 399  PRO B O     1 
ATOM   5577  C  CB    . PRO B  1 371 ? 109.223 132.991 1.874   1.00 28.56 ? 399  PRO B CB    1 
ATOM   5578  C  CG    . PRO B  1 371 ? 109.104 132.357 0.536   1.00 28.36 ? 399  PRO B CG    1 
ATOM   5579  C  CD    . PRO B  1 371 ? 110.429 132.601 -0.175  1.00 28.41 ? 399  PRO B CD    1 
ATOM   5580  N  N     . VAL B  1 372 ? 111.429 130.501 2.429   1.00 27.54 ? 400  VAL B N     1 
ATOM   5581  C  CA    . VAL B  1 372 ? 111.420 129.175 3.042   1.00 27.37 ? 400  VAL B CA    1 
ATOM   5582  C  C     . VAL B  1 372 ? 112.391 129.087 4.235   1.00 26.95 ? 400  VAL B C     1 
ATOM   5583  O  O     . VAL B  1 372 ? 112.065 128.439 5.216   1.00 27.05 ? 400  VAL B O     1 
ATOM   5584  C  CB    A VAL B  1 372 ? 111.707 128.063 1.979   0.50 27.53 ? 400  VAL B CB    1 
ATOM   5585  C  CB    B VAL B  1 372 ? 111.608 128.010 2.012   0.50 27.37 ? 400  VAL B CB    1 
ATOM   5586  C  CG1   A VAL B  1 372 ? 112.105 126.746 2.630   0.50 28.08 ? 400  VAL B CG1   1 
ATOM   5587  C  CG1   B VAL B  1 372 ? 110.637 128.180 0.824   0.50 27.37 ? 400  VAL B CG1   1 
ATOM   5588  C  CG2   A VAL B  1 372 ? 110.486 127.867 1.060   0.50 27.70 ? 400  VAL B CG2   1 
ATOM   5589  C  CG2   B VAL B  1 372 ? 113.039 127.900 1.528   0.50 26.56 ? 400  VAL B CG2   1 
ATOM   5590  N  N     . GLU B  1 373 ? 113.523 129.792 4.202   1.00 25.86 ? 401  GLU B N     1 
ATOM   5591  C  CA    . GLU B  1 373 ? 114.442 129.750 5.346   1.00 25.77 ? 401  GLU B CA    1 
ATOM   5592  C  C     . GLU B  1 373 ? 113.848 130.369 6.642   1.00 25.29 ? 401  GLU B C     1 
ATOM   5593  O  O     . GLU B  1 373 ? 114.125 129.881 7.740   1.00 23.84 ? 401  GLU B O     1 
ATOM   5594  C  CB    . GLU B  1 373 ? 115.815 130.329 5.005   1.00 25.68 ? 401  GLU B CB    1 
ATOM   5595  C  CG    . GLU B  1 373 ? 115.871 131.825 4.657   1.00 26.91 ? 401  GLU B CG    1 
ATOM   5596  C  CD    . GLU B  1 373 ? 115.959 132.732 5.872   1.00 26.84 ? 401  GLU B CD    1 
ATOM   5597  O  OE1   . GLU B  1 373 ? 115.233 133.756 5.923   1.00 25.19 ? 401  GLU B OE1   1 
ATOM   5598  O  OE2   . GLU B  1 373 ? 116.771 132.422 6.769   1.00 27.60 ? 401  GLU B OE2   1 
ATOM   5599  N  N     . LYS B  1 374 ? 113.033 131.417 6.500   1.00 24.89 ? 402  LYS B N     1 
ATOM   5600  C  CA    . LYS B  1 374 ? 112.290 131.984 7.641   1.00 24.46 ? 402  LYS B CA    1 
ATOM   5601  C  C     . LYS B  1 374 ? 111.291 130.985 8.243   1.00 24.73 ? 402  LYS B C     1 
ATOM   5602  O  O     . LYS B  1 374 ? 111.258 130.811 9.463   1.00 23.68 ? 402  LYS B O     1 
ATOM   5603  C  CB    . LYS B  1 374 ? 111.592 133.298 7.275   1.00 24.35 ? 402  LYS B CB    1 
ATOM   5604  C  CG    . LYS B  1 374 ? 110.943 134.024 8.479   1.00 24.80 ? 402  LYS B CG    1 
ATOM   5605  C  CD    . LYS B  1 374 ? 110.157 135.243 8.059   1.00 24.80 ? 402  LYS B CD    1 
ATOM   5606  C  CE    . LYS B  1 374 ? 109.335 135.826 9.206   1.00 25.43 ? 402  LYS B CE    1 
ATOM   5607  N  NZ    . LYS B  1 374 ? 108.143 135.004 9.634   1.00 25.57 ? 402  LYS B NZ    1 
ATOM   5608  N  N     . TYR B  1 375 ? 110.500 130.322 7.392   1.00 24.25 ? 403  TYR B N     1 
ATOM   5609  C  CA    . TYR B  1 375 ? 109.562 129.298 7.857   1.00 25.08 ? 403  TYR B CA    1 
ATOM   5610  C  C     . TYR B  1 375 ? 110.322 128.241 8.684   1.00 24.99 ? 403  TYR B C     1 
ATOM   5611  O  O     . TYR B  1 375 ? 109.851 127.824 9.732   1.00 24.82 ? 403  TYR B O     1 
ATOM   5612  C  CB    . TYR B  1 375 ? 108.833 128.626 6.682   1.00 24.96 ? 403  TYR B CB    1 
ATOM   5613  C  CG    . TYR B  1 375 ? 107.731 129.432 5.997   1.00 25.77 ? 403  TYR B CG    1 
ATOM   5614  C  CD1   . TYR B  1 375 ? 106.626 129.899 6.708   1.00 25.32 ? 403  TYR B CD1   1 
ATOM   5615  C  CD2   . TYR B  1 375 ? 107.761 129.669 4.615   1.00 24.91 ? 403  TYR B CD2   1 
ATOM   5616  C  CE1   . TYR B  1 375 ? 105.596 130.618 6.061   1.00 25.46 ? 403  TYR B CE1   1 
ATOM   5617  C  CE2   . TYR B  1 375 ? 106.755 130.359 3.973   1.00 25.95 ? 403  TYR B CE2   1 
ATOM   5618  C  CZ    . TYR B  1 375 ? 105.672 130.835 4.694   1.00 26.27 ? 403  TYR B CZ    1 
ATOM   5619  O  OH    . TYR B  1 375 ? 104.680 131.513 4.045   1.00 25.44 ? 403  TYR B OH    1 
ATOM   5620  N  N     . PHE B  1 376 ? 111.499 127.835 8.196   1.00 25.05 ? 404  PHE B N     1 
ATOM   5621  C  CA    . PHE B  1 376 ? 112.373 126.841 8.853   1.00 25.44 ? 404  PHE B CA    1 
ATOM   5622  C  C     . PHE B  1 376 ? 112.862 127.322 10.230  1.00 25.49 ? 404  PHE B C     1 
ATOM   5623  O  O     . PHE B  1 376 ? 112.817 126.571 11.197  1.00 24.89 ? 404  PHE B O     1 
ATOM   5624  C  CB    . PHE B  1 376 ? 113.548 126.510 7.909   1.00 25.20 ? 404  PHE B CB    1 
ATOM   5625  C  CG    . PHE B  1 376 ? 114.668 125.680 8.514   1.00 25.24 ? 404  PHE B CG    1 
ATOM   5626  C  CD1   . PHE B  1 376 ? 114.559 124.303 8.621   1.00 25.85 ? 404  PHE B CD1   1 
ATOM   5627  C  CD2   . PHE B  1 376 ? 115.868 126.276 8.885   1.00 24.95 ? 404  PHE B CD2   1 
ATOM   5628  C  CE1   . PHE B  1 376 ? 115.617 123.520 9.132   1.00 26.21 ? 404  PHE B CE1   1 
ATOM   5629  C  CE2   . PHE B  1 376 ? 116.924 125.516 9.415   1.00 25.39 ? 404  PHE B CE2   1 
ATOM   5630  C  CZ    . PHE B  1 376 ? 116.808 124.138 9.533   1.00 25.40 ? 404  PHE B CZ    1 
ATOM   5631  N  N     . ARG B  1 377 ? 113.291 128.579 10.318  1.00 25.03 ? 405  ARG B N     1 
ATOM   5632  C  CA    . ARG B  1 377 ? 113.738 129.139 11.595  1.00 24.87 ? 405  ARG B CA    1 
ATOM   5633  C  C     . ARG B  1 377 ? 112.563 129.312 12.559  1.00 25.43 ? 405  ARG B C     1 
ATOM   5634  O  O     . ARG B  1 377 ? 112.714 129.050 13.755  1.00 25.13 ? 405  ARG B O     1 
ATOM   5635  C  CB    . ARG B  1 377 ? 114.462 130.468 11.399  1.00 24.38 ? 405  ARG B CB    1 
ATOM   5636  C  CG    . ARG B  1 377 ? 115.807 130.348 10.670  1.00 23.93 ? 405  ARG B CG    1 
ATOM   5637  C  CD    . ARG B  1 377 ? 116.505 131.692 10.604  1.00 24.23 ? 405  ARG B CD    1 
ATOM   5638  N  NE    . ARG B  1 377 ? 115.920 132.561 9.587   1.00 22.20 ? 405  ARG B NE    1 
ATOM   5639  C  CZ    . ARG B  1 377 ? 115.185 133.658 9.813   1.00 24.61 ? 405  ARG B CZ    1 
ATOM   5640  N  NH1   . ARG B  1 377 ? 114.878 134.081 11.044  1.00 24.23 ? 405  ARG B NH1   1 
ATOM   5641  N  NH2   . ARG B  1 377 ? 114.750 134.357 8.775   1.00 23.52 ? 405  ARG B NH2   1 
ATOM   5642  N  N     . ASP B  1 378 ? 111.414 129.761 12.034  1.00 25.79 ? 406  ASP B N     1 
ATOM   5643  C  CA    . ASP B  1 378 ? 110.198 129.932 12.845  1.00 26.45 ? 406  ASP B CA    1 
ATOM   5644  C  C     . ASP B  1 378 ? 109.646 128.602 13.367  1.00 26.62 ? 406  ASP B C     1 
ATOM   5645  O  O     . ASP B  1 378 ? 109.207 128.532 14.524  1.00 26.93 ? 406  ASP B O     1 
ATOM   5646  C  CB    . ASP B  1 378 ? 109.081 130.621 12.063  1.00 26.12 ? 406  ASP B CB    1 
ATOM   5647  C  CG    . ASP B  1 378 ? 109.389 132.061 11.697  1.00 27.16 ? 406  ASP B CG    1 
ATOM   5648  O  OD1   . ASP B  1 378 ? 110.374 132.668 12.209  1.00 27.25 ? 406  ASP B OD1   1 
ATOM   5649  O  OD2   . ASP B  1 378 ? 108.598 132.606 10.880  1.00 27.33 ? 406  ASP B OD2   1 
ATOM   5650  N  N     . ALA B  1 379 ? 109.636 127.562 12.521  1.00 26.72 ? 407  ALA B N     1 
ATOM   5651  C  CA    . ALA B  1 379 ? 109.052 126.252 12.900  1.00 27.03 ? 407  ALA B CA    1 
ATOM   5652  C  C     . ALA B  1 379 ? 109.742 125.618 14.099  1.00 27.32 ? 407  ALA B C     1 
ATOM   5653  O  O     . ALA B  1 379 ? 109.098 124.935 14.908  1.00 27.86 ? 407  ALA B O     1 
ATOM   5654  C  CB    . ALA B  1 379 ? 109.067 125.276 11.715  1.00 26.44 ? 407  ALA B CB    1 
ATOM   5655  N  N     . LYS B  1 380 ? 111.045 125.844 14.219  1.00 27.50 ? 408  LYS B N     1 
ATOM   5656  C  CA    . LYS B  1 380 ? 111.857 125.199 15.254  1.00 27.99 ? 408  LYS B CA    1 
ATOM   5657  C  C     . LYS B  1 380 ? 111.366 125.518 16.692  1.00 27.89 ? 408  LYS B C     1 
ATOM   5658  O  O     . LYS B  1 380 ? 111.447 124.677 17.570  1.00 28.17 ? 408  LYS B O     1 
ATOM   5659  C  CB    . LYS B  1 380 ? 113.343 125.560 15.060  1.00 27.54 ? 408  LYS B CB    1 
ATOM   5660  C  CG    . LYS B  1 380 ? 114.323 124.862 16.005  1.00 29.00 ? 408  LYS B CG    1 
ATOM   5661  C  CD    . LYS B  1 380 ? 114.420 123.370 15.742  1.00 29.79 ? 408  LYS B CD    1 
ATOM   5662  C  CE    . LYS B  1 380 ? 114.054 122.552 16.943  1.00 30.60 ? 408  LYS B CE    1 
ATOM   5663  N  NZ    . LYS B  1 380 ? 113.789 121.122 16.599  1.00 29.95 ? 408  LYS B NZ    1 
ATOM   5664  N  N     . ILE B  1 381 ? 110.807 126.698 16.919  1.00 28.23 ? 409  ILE B N     1 
ATOM   5665  C  CA    . ILE B  1 381 ? 110.266 127.037 18.254  1.00 28.66 ? 409  ILE B CA    1 
ATOM   5666  C  C     . ILE B  1 381 ? 109.074 126.162 18.680  1.00 28.56 ? 409  ILE B C     1 
ATOM   5667  O  O     . ILE B  1 381 ? 108.832 126.004 19.870  1.00 28.04 ? 409  ILE B O     1 
ATOM   5668  C  CB    . ILE B  1 381 ? 109.850 128.529 18.344  1.00 28.61 ? 409  ILE B CB    1 
ATOM   5669  C  CG1   . ILE B  1 381 ? 109.652 128.973 19.804  1.00 29.89 ? 409  ILE B CG1   1 
ATOM   5670  C  CG2   . ILE B  1 381 ? 108.592 128.782 17.524  1.00 29.99 ? 409  ILE B CG2   1 
ATOM   5671  C  CD1   . ILE B  1 381 ? 110.802 128.661 20.754  1.00 30.63 ? 409  ILE B CD1   1 
ATOM   5672  N  N     . GLY B  1 382 ? 108.345 125.608 17.709  1.00 28.91 ? 410  GLY B N     1 
ATOM   5673  C  CA    . GLY B  1 382 ? 107.153 124.796 17.954  1.00 29.18 ? 410  GLY B CA    1 
ATOM   5674  C  C     . GLY B  1 382 ? 107.302 123.600 18.884  1.00 29.46 ? 410  GLY B C     1 
ATOM   5675  O  O     . GLY B  1 382 ? 106.375 123.281 19.633  1.00 29.31 ? 410  GLY B O     1 
ATOM   5676  N  N     . THR B  1 383 ? 108.457 122.934 18.823  1.00 29.57 ? 411  THR B N     1 
ATOM   5677  C  CA    . THR B  1 383 ? 108.738 121.803 19.688  1.00 29.89 ? 411  THR B CA    1 
ATOM   5678  C  C     . THR B  1 383 ? 109.262 122.203 21.081  1.00 29.82 ? 411  THR B C     1 
ATOM   5679  O  O     . THR B  1 383 ? 109.490 121.329 21.914  1.00 29.61 ? 411  THR B O     1 
ATOM   5680  C  CB    . THR B  1 383 ? 109.735 120.839 19.038  1.00 30.20 ? 411  THR B CB    1 
ATOM   5681  O  OG1   . THR B  1 383 ? 110.998 121.504 18.890  1.00 30.00 ? 411  THR B OG1   1 
ATOM   5682  C  CG2   . THR B  1 383 ? 109.182 120.345 17.693  1.00 29.92 ? 411  THR B CG2   1 
ATOM   5683  N  N     . ILE B  1 384 ? 109.428 123.506 21.322  1.00 30.11 ? 412  ILE B N     1 
ATOM   5684  C  CA    . ILE B  1 384 ? 109.945 124.037 22.597  1.00 30.80 ? 412  ILE B CA    1 
ATOM   5685  C  C     . ILE B  1 384 ? 108.880 124.726 23.465  1.00 30.27 ? 412  ILE B C     1 
ATOM   5686  O  O     . ILE B  1 384 ? 108.635 124.310 24.606  1.00 30.20 ? 412  ILE B O     1 
ATOM   5687  C  CB    . ILE B  1 384 ? 111.149 125.007 22.368  1.00 31.14 ? 412  ILE B CB    1 
ATOM   5688  C  CG1   . ILE B  1 384 ? 112.277 124.295 21.596  1.00 31.89 ? 412  ILE B CG1   1 
ATOM   5689  C  CG2   . ILE B  1 384 ? 111.674 125.539 23.707  1.00 31.32 ? 412  ILE B CG2   1 
ATOM   5690  C  CD1   . ILE B  1 384 ? 113.311 125.246 20.963  1.00 32.26 ? 412  ILE B CD1   1 
ATOM   5691  N  N     . TYR B  1 385 ? 108.233 125.763 22.939  1.00 29.74 ? 413  TYR B N     1 
ATOM   5692  C  CA    . TYR B  1 385 ? 107.317 126.540 23.749  1.00 28.97 ? 413  TYR B CA    1 
ATOM   5693  C  C     . TYR B  1 385 ? 105.922 125.911 23.812  1.00 29.17 ? 413  TYR B C     1 
ATOM   5694  O  O     . TYR B  1 385 ? 105.640 124.939 23.105  1.00 27.43 ? 413  TYR B O     1 
ATOM   5695  C  CB    . TYR B  1 385 ? 107.308 128.022 23.330  1.00 29.21 ? 413  TYR B CB    1 
ATOM   5696  C  CG    . TYR B  1 385 ? 106.625 128.436 22.036  1.00 28.19 ? 413  TYR B CG    1 
ATOM   5697  C  CD1   . TYR B  1 385 ? 106.527 129.787 21.736  1.00 29.11 ? 413  TYR B CD1   1 
ATOM   5698  C  CD2   . TYR B  1 385 ? 106.092 127.516 21.119  1.00 28.60 ? 413  TYR B CD2   1 
ATOM   5699  C  CE1   . TYR B  1 385 ? 105.930 130.236 20.588  1.00 28.64 ? 413  TYR B CE1   1 
ATOM   5700  C  CE2   . TYR B  1 385 ? 105.466 127.961 19.938  1.00 27.34 ? 413  TYR B CE2   1 
ATOM   5701  C  CZ    . TYR B  1 385 ? 105.397 129.337 19.694  1.00 28.57 ? 413  TYR B CZ    1 
ATOM   5702  O  OH    . TYR B  1 385 ? 104.829 129.864 18.571  1.00 29.42 ? 413  TYR B OH    1 
ATOM   5703  N  N     . GLU B  1 386 ? 105.081 126.443 24.696  1.00 29.48 ? 414  GLU B N     1 
ATOM   5704  C  CA    . GLU B  1 386 ? 103.773 125.855 24.999  1.00 30.29 ? 414  GLU B CA    1 
ATOM   5705  C  C     . GLU B  1 386 ? 103.871 124.372 25.421  1.00 29.65 ? 414  GLU B C     1 
ATOM   5706  O  O     . GLU B  1 386 ? 102.981 123.568 25.145  1.00 30.02 ? 414  GLU B O     1 
ATOM   5707  C  CB    . GLU B  1 386 ? 102.808 126.079 23.824  1.00 31.42 ? 414  GLU B CB    1 
ATOM   5708  C  CG    . GLU B  1 386 ? 102.181 127.517 23.836  1.00 34.99 ? 414  GLU B CG    1 
ATOM   5709  C  CD    . GLU B  1 386 ? 100.753 127.524 24.335  1.00 39.55 ? 414  GLU B CD    1 
ATOM   5710  O  OE1   . GLU B  1 386 ? 100.319 126.469 24.873  1.00 43.38 ? 414  GLU B OE1   1 
ATOM   5711  O  OE2   . GLU B  1 386 ? 100.060 128.576 24.186  1.00 40.97 ? 414  GLU B OE2   1 
ATOM   5712  N  N     . GLY B  1 387 ? 104.936 124.037 26.141  1.00 28.37 ? 415  GLY B N     1 
ATOM   5713  C  CA    . GLY B  1 387 ? 105.172 122.662 26.579  1.00 27.60 ? 415  GLY B CA    1 
ATOM   5714  C  C     . GLY B  1 387 ? 105.965 121.938 25.515  1.00 26.98 ? 415  GLY B C     1 
ATOM   5715  O  O     . GLY B  1 387 ? 105.446 121.626 24.437  1.00 27.61 ? 415  GLY B O     1 
ATOM   5716  N  N     . ALA B  1 388 ? 107.235 121.696 25.799  1.00 26.63 ? 416  ALA B N     1 
ATOM   5717  C  CA    . ALA B  1 388 ? 108.134 121.067 24.825  1.00 25.98 ? 416  ALA B CA    1 
ATOM   5718  C  C     . ALA B  1 388 ? 107.628 119.660 24.463  1.00 26.17 ? 416  ALA B C     1 
ATOM   5719  O  O     . ALA B  1 388 ? 106.838 119.071 25.199  1.00 25.71 ? 416  ALA B O     1 
ATOM   5720  C  CB    . ALA B  1 388 ? 109.566 121.019 25.377  1.00 25.10 ? 416  ALA B CB    1 
ATOM   5721  N  N     . SER B  1 389 ? 108.081 119.132 23.327  1.00 25.81 ? 417  SER B N     1 
ATOM   5722  C  CA    . SER B  1 389 ? 107.617 117.820 22.850  1.00 25.90 ? 417  SER B CA    1 
ATOM   5723  C  C     . SER B  1 389 ? 107.605 116.718 23.906  1.00 25.58 ? 417  SER B C     1 
ATOM   5724  O  O     . SER B  1 389 ? 106.597 116.009 24.037  1.00 25.22 ? 417  SER B O     1 
ATOM   5725  C  CB    . SER B  1 389 ? 108.418 117.390 21.621  1.00 25.64 ? 417  SER B CB    1 
ATOM   5726  O  OG    . SER B  1 389 ? 108.027 118.164 20.496  1.00 26.41 ? 417  SER B OG    1 
ATOM   5727  N  N     . ASN B  1 390 ? 108.692 116.582 24.671  1.00 25.66 ? 418  ASN B N     1 
ATOM   5728  C  CA    . ASN B  1 390 ? 108.759 115.545 25.721  1.00 25.56 ? 418  ASN B CA    1 
ATOM   5729  C  C     . ASN B  1 390 ? 107.616 115.708 26.731  1.00 25.64 ? 418  ASN B C     1 
ATOM   5730  O  O     . ASN B  1 390 ? 107.109 114.720 27.242  1.00 24.96 ? 418  ASN B O     1 
ATOM   5731  C  CB    . ASN B  1 390 ? 110.092 115.560 26.482  1.00 25.45 ? 418  ASN B CB    1 
ATOM   5732  C  CG    . ASN B  1 390 ? 111.278 115.003 25.672  1.00 26.07 ? 418  ASN B CG    1 
ATOM   5733  O  OD1   . ASN B  1 390 ? 111.164 114.659 24.486  1.00 27.07 ? 418  ASN B OD1   1 
ATOM   5734  N  ND2   . ASN B  1 390 ? 112.430 114.899 26.341  1.00 25.31 ? 418  ASN B ND2   1 
ATOM   5735  N  N     . ILE B  1 391 ? 107.228 116.957 27.011  1.00 25.73 ? 419  ILE B N     1 
ATOM   5736  C  CA    . ILE B  1 391 ? 106.131 117.257 27.932  1.00 25.95 ? 419  ILE B CA    1 
ATOM   5737  C  C     . ILE B  1 391 ? 104.787 116.870 27.306  1.00 25.60 ? 419  ILE B C     1 
ATOM   5738  O  O     . ILE B  1 391 ? 103.903 116.364 28.002  1.00 25.55 ? 419  ILE B O     1 
ATOM   5739  C  CB    . ILE B  1 391 ? 106.124 118.755 28.380  1.00 26.21 ? 419  ILE B CB    1 
ATOM   5740  C  CG1   . ILE B  1 391 ? 107.453 119.147 29.054  1.00 27.65 ? 419  ILE B CG1   1 
ATOM   5741  C  CG2   . ILE B  1 391 ? 104.937 119.079 29.293  1.00 27.19 ? 419  ILE B CG2   1 
ATOM   5742  C  CD1   . ILE B  1 391 ? 107.987 118.179 30.134  1.00 29.09 ? 419  ILE B CD1   1 
ATOM   5743  N  N     . GLN B  1 392 ? 104.651 117.087 25.999  1.00 25.20 ? 420  GLN B N     1 
ATOM   5744  C  CA    . GLN B  1 392 ? 103.464 116.670 25.286  1.00 24.95 ? 420  GLN B CA    1 
ATOM   5745  C  C     . GLN B  1 392 ? 103.323 115.140 25.378  1.00 24.51 ? 420  GLN B C     1 
ATOM   5746  O  O     . GLN B  1 392 ? 102.251 114.639 25.680  1.00 24.10 ? 420  GLN B O     1 
ATOM   5747  C  CB    . GLN B  1 392 ? 103.481 117.154 23.834  1.00 25.37 ? 420  GLN B CB    1 
ATOM   5748  C  CG    . GLN B  1 392 ? 103.575 118.683 23.629  1.00 25.51 ? 420  GLN B CG    1 
ATOM   5749  C  CD    . GLN B  1 392 ? 102.467 119.461 24.327  1.00 26.09 ? 420  GLN B CD    1 
ATOM   5750  O  OE1   . GLN B  1 392 ? 101.348 118.970 24.478  1.00 27.99 ? 420  GLN B OE1   1 
ATOM   5751  N  NE2   . GLN B  1 392 ? 102.776 120.683 24.751  1.00 25.14 ? 420  GLN B NE2   1 
ATOM   5752  N  N     . LEU B  1 393 ? 104.421 114.420 25.164  1.00 24.52 ? 421  LEU B N     1 
ATOM   5753  C  CA    . LEU B  1 393 ? 104.421 112.965 25.242  1.00 24.58 ? 421  LEU B CA    1 
ATOM   5754  C  C     . LEU B  1 393 ? 104.144 112.450 26.658  1.00 24.14 ? 421  LEU B C     1 
ATOM   5755  O  O     . LEU B  1 393 ? 103.434 111.452 26.819  1.00 24.50 ? 421  LEU B O     1 
ATOM   5756  C  CB    . LEU B  1 393 ? 105.729 112.396 24.705  1.00 24.23 ? 421  LEU B CB    1 
ATOM   5757  C  CG    . LEU B  1 393 ? 106.026 112.689 23.228  1.00 26.53 ? 421  LEU B CG    1 
ATOM   5758  C  CD1   . LEU B  1 393 ? 107.472 112.283 22.897  1.00 26.07 ? 421  LEU B CD1   1 
ATOM   5759  C  CD2   . LEU B  1 393 ? 105.001 111.953 22.315  1.00 26.47 ? 421  LEU B CD2   1 
ATOM   5760  N  N     . ASN B  1 394 ? 104.674 113.123 27.680  1.00 23.46 ? 422  ASN B N     1 
ATOM   5761  C  CA    . ASN B  1 394 ? 104.342 112.771 29.062  1.00 23.56 ? 422  ASN B CA    1 
ATOM   5762  C  C     . ASN B  1 394 ? 102.839 112.892 29.327  1.00 23.27 ? 422  ASN B C     1 
ATOM   5763  O  O     . ASN B  1 394 ? 102.252 112.031 29.967  1.00 21.79 ? 422  ASN B O     1 
ATOM   5764  C  CB    . ASN B  1 394 ? 105.107 113.623 30.095  1.00 23.37 ? 422  ASN B CB    1 
ATOM   5765  C  CG    . ASN B  1 394 ? 106.612 113.363 30.087  1.00 24.46 ? 422  ASN B CG    1 
ATOM   5766  O  OD1   . ASN B  1 394 ? 107.089 112.346 29.564  1.00 25.36 ? 422  ASN B OD1   1 
ATOM   5767  N  ND2   . ASN B  1 394 ? 107.368 114.289 30.678  1.00 25.10 ? 422  ASN B ND2   1 
ATOM   5768  N  N     . THR B  1 395 ? 102.235 113.969 28.843  1.00 23.79 ? 423  THR B N     1 
ATOM   5769  C  CA    . THR B  1 395 ? 100.797 114.179 28.987  1.00 24.42 ? 423  THR B CA    1 
ATOM   5770  C  C     . THR B  1 395 ? 99.980  113.111 28.266  1.00 23.92 ? 423  THR B C     1 
ATOM   5771  O  O     . THR B  1 395 ? 99.001  112.588 28.810  1.00 24.42 ? 423  THR B O     1 
ATOM   5772  C  CB    . THR B  1 395 ? 100.380 115.562 28.444  1.00 24.67 ? 423  THR B CB    1 
ATOM   5773  O  OG1   . THR B  1 395 ? 101.051 116.577 29.195  1.00 27.11 ? 423  THR B OG1   1 
ATOM   5774  C  CG2   . THR B  1 395 ? 98.856  115.749 28.542  1.00 24.94 ? 423  THR B CG2   1 
ATOM   5775  N  N     . ILE B  1 396 ? 100.382 112.781 27.045  1.00 23.72 ? 424  ILE B N     1 
ATOM   5776  C  CA    . ILE B  1 396 ? 99.668  111.765 26.254  1.00 23.05 ? 424  ILE B CA    1 
ATOM   5777  C  C     . ILE B  1 396 ? 99.767  110.410 26.951  1.00 23.45 ? 424  ILE B C     1 
ATOM   5778  O  O     . ILE B  1 396 ? 98.785  109.675 27.024  1.00 23.12 ? 424  ILE B O     1 
ATOM   5779  C  CB    . ILE B  1 396 ? 100.208 111.690 24.803  1.00 22.36 ? 424  ILE B CB    1 
ATOM   5780  C  CG1   . ILE B  1 396 ? 99.954  113.010 24.070  1.00 21.56 ? 424  ILE B CG1   1 
ATOM   5781  C  CG2   . ILE B  1 396 ? 99.561  110.514 24.028  1.00 21.61 ? 424  ILE B CG2   1 
ATOM   5782  C  CD1   . ILE B  1 396 ? 100.856 113.245 22.861  1.00 21.50 ? 424  ILE B CD1   1 
ATOM   5783  N  N     . ALA B  1 397 ? 100.952 110.099 27.480  1.00 24.00 ? 425  ALA B N     1 
ATOM   5784  C  CA    . ALA B  1 397 ? 101.171 108.851 28.229  1.00 24.70 ? 425  ALA B CA    1 
ATOM   5785  C  C     . ALA B  1 397 ? 100.288 108.769 29.467  1.00 25.11 ? 425  ALA B C     1 
ATOM   5786  O  O     . ALA B  1 397 ? 99.733  107.721 29.737  1.00 24.86 ? 425  ALA B O     1 
ATOM   5787  C  CB    . ALA B  1 397 ? 102.657 108.676 28.617  1.00 24.28 ? 425  ALA B CB    1 
ATOM   5788  N  N     . LYS B  1 398 ? 100.159 109.867 30.213  1.00 26.35 ? 426  LYS B N     1 
ATOM   5789  C  CA    . LYS B  1 398 ? 99.281  109.887 31.384  1.00 27.82 ? 426  LYS B CA    1 
ATOM   5790  C  C     . LYS B  1 398 ? 97.839  109.529 31.000  1.00 27.06 ? 426  LYS B C     1 
ATOM   5791  O  O     . LYS B  1 398 ? 97.177  108.774 31.701  1.00 26.84 ? 426  LYS B O     1 
ATOM   5792  C  CB    . LYS B  1 398 ? 99.327  111.234 32.116  1.00 28.42 ? 426  LYS B CB    1 
ATOM   5793  C  CG    . LYS B  1 398 ? 100.715 111.568 32.696  1.00 30.66 ? 426  LYS B CG    1 
ATOM   5794  C  CD    . LYS B  1 398 ? 100.692 112.675 33.766  1.00 31.31 ? 426  LYS B CD    1 
ATOM   5795  C  CE    . LYS B  1 398 ? 102.053 113.421 33.823  1.00 34.57 ? 426  LYS B CE    1 
ATOM   5796  N  NZ    . LYS B  1 398 ? 103.272 112.505 33.868  1.00 37.79 ? 426  LYS B NZ    1 
ATOM   5797  N  N     . HIS B  1 399 ? 97.372  110.054 29.874  1.00 26.37 ? 427  HIS B N     1 
ATOM   5798  C  CA    . HIS B  1 399 ? 96.022  109.754 29.403  1.00 26.28 ? 427  HIS B CA    1 
ATOM   5799  C  C     . HIS B  1 399 ? 95.860  108.302 28.915  1.00 25.85 ? 427  HIS B C     1 
ATOM   5800  O  O     . HIS B  1 399 ? 94.873  107.627 29.237  1.00 25.77 ? 427  HIS B O     1 
ATOM   5801  C  CB    . HIS B  1 399 ? 95.609  110.790 28.355  1.00 26.47 ? 427  HIS B CB    1 
ATOM   5802  C  CG    . HIS B  1 399 ? 95.240  112.107 28.964  1.00 27.83 ? 427  HIS B CG    1 
ATOM   5803  N  ND1   . HIS B  1 399 ? 93.941  112.435 29.280  1.00 29.56 ? 427  HIS B ND1   1 
ATOM   5804  C  CD2   . HIS B  1 399 ? 96.005  113.137 29.401  1.00 29.43 ? 427  HIS B CD2   1 
ATOM   5805  C  CE1   . HIS B  1 399 ? 93.917  113.625 29.854  1.00 30.18 ? 427  HIS B CE1   1 
ATOM   5806  N  NE2   . HIS B  1 399 ? 95.158  114.070 29.946  1.00 30.92 ? 427  HIS B NE2   1 
ATOM   5807  N  N     . ILE B  1 400 ? 96.846  107.805 28.177  1.00 25.44 ? 428  ILE B N     1 
ATOM   5808  C  CA    . ILE B  1 400 ? 96.822  106.408 27.729  1.00 25.10 ? 428  ILE B CA    1 
ATOM   5809  C  C     . ILE B  1 400 ? 96.775  105.497 28.936  1.00 24.92 ? 428  ILE B C     1 
ATOM   5810  O  O     . ILE B  1 400 ? 95.996  104.553 28.955  1.00 25.03 ? 428  ILE B O     1 
ATOM   5811  C  CB    A ILE B  1 400 ? 98.041  106.051 26.837  0.50 24.75 ? 428  ILE B CB    1 
ATOM   5812  C  CB    B ILE B  1 400 ? 98.060  106.047 26.887  0.50 24.78 ? 428  ILE B CB    1 
ATOM   5813  C  CG1   A ILE B  1 400 ? 98.047  106.882 25.540  0.50 24.74 ? 428  ILE B CG1   1 
ATOM   5814  C  CG1   B ILE B  1 400 ? 98.037  106.781 25.546  0.50 24.81 ? 428  ILE B CG1   1 
ATOM   5815  C  CG2   A ILE B  1 400 ? 98.056  104.563 26.511  0.50 24.18 ? 428  ILE B CG2   1 
ATOM   5816  C  CG2   B ILE B  1 400 ? 98.142  104.544 26.655  0.50 24.20 ? 428  ILE B CG2   1 
ATOM   5817  C  CD1   A ILE B  1 400 ? 96.888  106.615 24.587  0.50 23.21 ? 428  ILE B CD1   1 
ATOM   5818  C  CD1   B ILE B  1 400 ? 99.379  106.798 24.866  0.50 23.38 ? 428  ILE B CD1   1 
ATOM   5819  N  N     . ASP B  1 401 ? 97.596  105.793 29.943  1.00 25.50 ? 429  ASP B N     1 
ATOM   5820  C  CA    . ASP B  1 401 ? 97.615  105.042 31.211  1.00 25.91 ? 429  ASP B CA    1 
ATOM   5821  C  C     . ASP B  1 401 ? 96.207  104.936 31.833  1.00 26.68 ? 429  ASP B C     1 
ATOM   5822  O  O     . ASP B  1 401 ? 95.807  103.869 32.315  1.00 25.51 ? 429  ASP B O     1 
ATOM   5823  C  CB    . ASP B  1 401 ? 98.588  105.716 32.195  1.00 25.97 ? 429  ASP B CB    1 
ATOM   5824  C  CG    . ASP B  1 401 ? 98.944  104.847 33.409  1.00 27.22 ? 429  ASP B CG    1 
ATOM   5825  O  OD1   . ASP B  1 401 ? 98.602  103.647 33.463  1.00 27.18 ? 429  ASP B OD1   1 
ATOM   5826  O  OD2   . ASP B  1 401 ? 99.598  105.392 34.330  1.00 28.79 ? 429  ASP B OD2   1 
ATOM   5827  N  N     . ALA B  1 402 ? 95.464  106.043 31.792  1.00 27.23 ? 430  ALA B N     1 
ATOM   5828  C  CA    . ALA B  1 402 ? 94.113  106.103 32.343  1.00 27.99 ? 430  ALA B CA    1 
ATOM   5829  C  C     . ALA B  1 402 ? 93.044  105.432 31.458  1.00 28.81 ? 430  ALA B C     1 
ATOM   5830  O  O     . ALA B  1 402 ? 91.966  105.092 31.950  1.00 29.63 ? 430  ALA B O     1 
ATOM   5831  C  CB    . ALA B  1 402 ? 93.734  107.554 32.630  1.00 27.84 ? 430  ALA B CB    1 
ATOM   5832  N  N     . GLU B  1 403 ? 93.333  105.214 30.179  1.00 30.04 ? 431  GLU B N     1 
ATOM   5833  C  CA    . GLU B  1 403 ? 92.374  104.543 29.272  1.00 31.12 ? 431  GLU B CA    1 
ATOM   5834  C  C     . GLU B  1 403 ? 92.310  103.021 29.423  1.00 31.36 ? 431  GLU B C     1 
ATOM   5835  O  O     . GLU B  1 403 ? 91.352  102.397 28.974  1.00 31.97 ? 431  GLU B O     1 
ATOM   5836  C  CB    . GLU B  1 403 ? 92.666  104.880 27.809  1.00 31.48 ? 431  GLU B CB    1 
ATOM   5837  C  CG    . GLU B  1 403 ? 92.246  106.263 27.407  1.00 33.47 ? 431  GLU B CG    1 
ATOM   5838  C  CD    . GLU B  1 403 ? 92.800  106.662 26.058  1.00 35.28 ? 431  GLU B CD    1 
ATOM   5839  O  OE1   . GLU B  1 403 ? 93.032  105.771 25.212  1.00 38.65 ? 431  GLU B OE1   1 
ATOM   5840  O  OE2   . GLU B  1 403 ? 93.000  107.872 25.845  1.00 37.20 ? 431  GLU B OE2   1 
ATOM   5841  N  N     . TYR B  1 404 ? 93.312  102.422 30.058  1.00 31.50 ? 432  TYR B N     1 
ATOM   5842  C  CA    . TYR B  1 404 ? 93.334  100.974 30.240  1.00 31.13 ? 432  TYR B CA    1 
ATOM   5843  C  C     . TYR B  1 404 ? 93.193  100.614 31.717  1.00 31.79 ? 432  TYR B C     1 
ATOM   5844  O  O     . TYR B  1 404 ? 93.698  101.314 32.593  1.00 32.27 ? 432  TYR B O     1 
ATOM   5845  C  CB    . TYR B  1 404 ? 94.600  100.391 29.599  1.00 30.62 ? 432  TYR B CB    1 
ATOM   5846  C  CG    . TYR B  1 404 ? 94.620  100.634 28.097  1.00 29.81 ? 432  TYR B CG    1 
ATOM   5847  C  CD1   . TYR B  1 404 ? 94.062  99.710  27.210  1.00 29.62 ? 432  TYR B CD1   1 
ATOM   5848  C  CD2   . TYR B  1 404 ? 95.134  101.805 27.575  1.00 28.99 ? 432  TYR B CD2   1 
ATOM   5849  C  CE1   . TYR B  1 404 ? 94.055  99.941  25.842  1.00 28.48 ? 432  TYR B CE1   1 
ATOM   5850  C  CE2   . TYR B  1 404 ? 95.128  102.050 26.210  1.00 29.17 ? 432  TYR B CE2   1 
ATOM   5851  C  CZ    . TYR B  1 404 ? 94.582  101.102 25.350  1.00 28.64 ? 432  TYR B CZ    1 
ATOM   5852  O  OH    . TYR B  1 404 ? 94.565  101.342 24.004  1.00 28.66 ? 432  TYR B OH    1 
ATOM   5853  O  OXT   . TYR B  1 404 ? 92.522  99.638  32.075  1.00 32.30 ? 432  TYR B OXT   1 
ATOM   5854  N  N     . THR C  1 28  ? 140.301 95.604  6.250   1.00 45.86 ? 56   THR C N     1 
ATOM   5855  C  CA    . THR C  1 28  ? 141.675 95.037  6.021   1.00 45.77 ? 56   THR C CA    1 
ATOM   5856  C  C     . THR C  1 28  ? 142.079 94.015  7.090   1.00 44.83 ? 56   THR C C     1 
ATOM   5857  O  O     . THR C  1 28  ? 142.624 94.356  8.148   1.00 45.57 ? 56   THR C O     1 
ATOM   5858  C  CB    . THR C  1 28  ? 142.728 96.142  5.926   1.00 45.89 ? 56   THR C CB    1 
ATOM   5859  O  OG1   . THR C  1 28  ? 142.351 97.048  4.875   1.00 47.13 ? 56   THR C OG1   1 
ATOM   5860  C  CG2   . THR C  1 28  ? 144.102 95.537  5.626   1.00 46.34 ? 56   THR C CG2   1 
ATOM   5861  N  N     . PHE C  1 29  ? 141.833 92.751  6.773   1.00 43.37 ? 57   PHE C N     1 
ATOM   5862  C  CA    . PHE C  1 29  ? 141.979 91.666  7.720   1.00 41.82 ? 57   PHE C CA    1 
ATOM   5863  C  C     . PHE C  1 29  ? 143.332 90.985  7.557   1.00 40.63 ? 57   PHE C C     1 
ATOM   5864  O  O     . PHE C  1 29  ? 143.969 91.098  6.508   1.00 40.39 ? 57   PHE C O     1 
ATOM   5865  C  CB    . PHE C  1 29  ? 140.859 90.648  7.497   1.00 42.00 ? 57   PHE C CB    1 
ATOM   5866  C  CG    . PHE C  1 29  ? 139.484 91.256  7.402   1.00 41.90 ? 57   PHE C CG    1 
ATOM   5867  C  CD1   . PHE C  1 29  ? 139.055 92.199  8.335   1.00 42.18 ? 57   PHE C CD1   1 
ATOM   5868  C  CD2   . PHE C  1 29  ? 138.601 90.854  6.397   1.00 42.56 ? 57   PHE C CD2   1 
ATOM   5869  C  CE1   . PHE C  1 29  ? 137.783 92.756  8.249   1.00 42.02 ? 57   PHE C CE1   1 
ATOM   5870  C  CE2   . PHE C  1 29  ? 137.318 91.399  6.304   1.00 42.76 ? 57   PHE C CE2   1 
ATOM   5871  C  CZ    . PHE C  1 29  ? 136.906 92.347  7.233   1.00 42.59 ? 57   PHE C CZ    1 
ATOM   5872  N  N     . THR C  1 30  ? 143.752 90.264  8.590   1.00 38.82 ? 58   THR C N     1 
ATOM   5873  C  CA    . THR C  1 30  ? 144.935 89.422  8.501   1.00 37.84 ? 58   THR C CA    1 
ATOM   5874  C  C     . THR C  1 30  ? 144.671 88.242  7.557   1.00 37.37 ? 58   THR C C     1 
ATOM   5875  O  O     . THR C  1 30  ? 143.526 87.944  7.228   1.00 36.38 ? 58   THR C O     1 
ATOM   5876  C  CB    . THR C  1 30  ? 145.359 88.891  9.889   1.00 37.92 ? 58   THR C CB    1 
ATOM   5877  O  OG1   . THR C  1 30  ? 144.400 87.930  10.365  1.00 37.84 ? 58   THR C OG1   1 
ATOM   5878  C  CG2   . THR C  1 30  ? 145.495 90.033  10.885  1.00 36.74 ? 58   THR C CG2   1 
ATOM   5879  N  N     . ASP C  1 31  ? 145.734 87.573  7.126   1.00 37.24 ? 59   ASP C N     1 
ATOM   5880  C  CA    . ASP C  1 31  ? 145.608 86.396  6.257   1.00 37.46 ? 59   ASP C CA    1 
ATOM   5881  C  C     . ASP C  1 31  ? 144.668 85.356  6.876   1.00 36.78 ? 59   ASP C C     1 
ATOM   5882  O  O     . ASP C  1 31  ? 143.792 84.831  6.198   1.00 36.45 ? 59   ASP C O     1 
ATOM   5883  C  CB    . ASP C  1 31  ? 146.985 85.754  5.978   1.00 37.81 ? 59   ASP C CB    1 
ATOM   5884  C  CG    . ASP C  1 31  ? 147.801 86.508  4.916   1.00 39.61 ? 59   ASP C CG    1 
ATOM   5885  O  OD1   . ASP C  1 31  ? 147.333 87.551  4.387   1.00 41.14 ? 59   ASP C OD1   1 
ATOM   5886  O  OD2   . ASP C  1 31  ? 148.929 86.043  4.610   1.00 42.47 ? 59   ASP C OD2   1 
ATOM   5887  N  N     . GLU C  1 32  ? 144.860 85.087  8.165   1.00 36.39 ? 60   GLU C N     1 
ATOM   5888  C  CA    . GLU C  1 32  ? 144.066 84.111  8.914   1.00 36.44 ? 60   GLU C CA    1 
ATOM   5889  C  C     . GLU C  1 32  ? 142.580 84.499  8.961   1.00 35.31 ? 60   GLU C C     1 
ATOM   5890  O  O     . GLU C  1 32  ? 141.712 83.657  8.797   1.00 34.65 ? 60   GLU C O     1 
ATOM   5891  C  CB    . GLU C  1 32  ? 144.629 83.977  10.335  1.00 36.57 ? 60   GLU C CB    1 
ATOM   5892  C  CG    . GLU C  1 32  ? 143.820 83.085  11.290  1.00 37.73 ? 60   GLU C CG    1 
ATOM   5893  C  CD    . GLU C  1 32  ? 143.963 83.493  12.761  1.00 38.81 ? 60   GLU C CD    1 
ATOM   5894  O  OE1   . GLU C  1 32  ? 143.228 84.432  13.237  1.00 40.80 ? 60   GLU C OE1   1 
ATOM   5895  O  OE2   . GLU C  1 32  ? 144.796 82.850  13.439  1.00 39.52 ? 60   GLU C OE2   1 
ATOM   5896  N  N     . GLU C  1 33  ? 142.306 85.777  9.200   1.00 34.50 ? 61   GLU C N     1 
ATOM   5897  C  CA    . GLU C  1 33  ? 140.940 86.289  9.222   1.00 34.09 ? 61   GLU C CA    1 
ATOM   5898  C  C     . GLU C  1 33  ? 140.275 86.148  7.855   1.00 34.40 ? 61   GLU C C     1 
ATOM   5899  O  O     . GLU C  1 33  ? 139.105 85.771  7.762   1.00 34.02 ? 61   GLU C O     1 
ATOM   5900  C  CB    . GLU C  1 33  ? 140.927 87.743  9.712   1.00 33.55 ? 61   GLU C CB    1 
ATOM   5901  C  CG    . GLU C  1 33  ? 141.219 87.859  11.210  1.00 33.39 ? 61   GLU C CG    1 
ATOM   5902  C  CD    . GLU C  1 33  ? 141.620 89.264  11.674  1.00 33.67 ? 61   GLU C CD    1 
ATOM   5903  O  OE1   . GLU C  1 33  ? 141.761 90.174  10.831  1.00 29.77 ? 61   GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C  1 33  ? 141.777 89.450  12.904  1.00 32.52 ? 61   GLU C OE2   1 
ATOM   5905  N  N     . MET C  1 34  ? 141.030 86.418  6.794   1.00 35.37 ? 62   MET C N     1 
ATOM   5906  C  CA    . MET C  1 34  ? 140.523 86.258  5.426   1.00 36.85 ? 62   MET C CA    1 
ATOM   5907  C  C     . MET C  1 34  ? 140.235 84.793  5.067   1.00 35.62 ? 62   MET C C     1 
ATOM   5908  O  O     . MET C  1 34  ? 139.186 84.503  4.477   1.00 35.01 ? 62   MET C O     1 
ATOM   5909  C  CB    . MET C  1 34  ? 141.495 86.866  4.413   1.00 36.96 ? 62   MET C CB    1 
ATOM   5910  C  CG    . MET C  1 34  ? 141.658 88.383  4.521   1.00 39.27 ? 62   MET C CG    1 
ATOM   5911  S  SD    . MET C  1 34  ? 142.879 89.044  3.351   1.00 41.89 ? 62   MET C SD    1 
ATOM   5912  C  CE    . MET C  1 34  ? 142.042 88.659  1.805   1.00 44.15 ? 62   MET C CE    1 
ATOM   5913  N  N     . MET C  1 35  ? 141.158 83.895  5.431   1.00 35.46 ? 63   MET C N     1 
ATOM   5914  C  CA    . MET C  1 35  ? 141.014 82.441  5.207   1.00 35.57 ? 63   MET C CA    1 
ATOM   5915  C  C     . MET C  1 35  ? 139.786 81.863  5.940   1.00 34.59 ? 63   MET C C     1 
ATOM   5916  O  O     . MET C  1 35  ? 139.010 81.101  5.364   1.00 33.84 ? 63   MET C O     1 
ATOM   5917  C  CB    . MET C  1 35  ? 142.293 81.681  5.626   1.00 35.70 ? 63   MET C CB    1 
ATOM   5918  C  CG    A MET C  1 35  ? 143.456 81.837  4.613   0.50 36.38 ? 63   MET C CG    1 
ATOM   5919  C  CG    B MET C  1 35  ? 143.503 81.852  4.695   0.50 36.35 ? 63   MET C CG    1 
ATOM   5920  S  SD    A MET C  1 35  ? 144.725 80.532  4.616   0.50 37.18 ? 63   MET C SD    1 
ATOM   5921  S  SD    B MET C  1 35  ? 145.112 81.688  5.544   0.50 37.10 ? 63   MET C SD    1 
ATOM   5922  C  CE    A MET C  1 35  ? 145.769 81.092  3.273   0.50 37.03 ? 63   MET C CE    1 
ATOM   5923  C  CE    B MET C  1 35  ? 144.870 80.191  6.506   0.50 36.69 ? 63   MET C CE    1 
ATOM   5924  N  N     . ILE C  1 36  ? 139.611 82.244  7.201   1.00 33.81 ? 64   ILE C N     1 
ATOM   5925  C  CA    . ILE C  1 36  ? 138.497 81.744  8.012   1.00 33.55 ? 64   ILE C CA    1 
ATOM   5926  C  C     . ILE C  1 36  ? 137.157 82.226  7.425   1.00 32.66 ? 64   ILE C C     1 
ATOM   5927  O  O     . ILE C  1 36  ? 136.193 81.456  7.331   1.00 31.87 ? 64   ILE C O     1 
ATOM   5928  C  CB    . ILE C  1 36  ? 138.662 82.148  9.519   1.00 33.74 ? 64   ILE C CB    1 
ATOM   5929  C  CG1   . ILE C  1 36  ? 139.909 81.469  10.109  1.00 34.89 ? 64   ILE C CG1   1 
ATOM   5930  C  CG2   . ILE C  1 36  ? 137.469 81.699  10.343  1.00 34.21 ? 64   ILE C CG2   1 
ATOM   5931  C  CD1   . ILE C  1 36  ? 140.406 82.069  11.423  1.00 34.47 ? 64   ILE C CD1   1 
ATOM   5932  N  N     . LYS C  1 37  ? 137.118 83.486  7.005   1.00 31.59 ? 65   LYS C N     1 
ATOM   5933  C  CA    . LYS C  1 37  ? 135.929 84.051  6.380   1.00 32.18 ? 65   LYS C CA    1 
ATOM   5934  C  C     . LYS C  1 37  ? 135.542 83.296  5.106   1.00 31.51 ? 65   LYS C C     1 
ATOM   5935  O  O     . LYS C  1 37  ? 134.372 82.960  4.904   1.00 31.32 ? 65   LYS C O     1 
ATOM   5936  C  CB    . LYS C  1 37  ? 136.134 85.541  6.068   1.00 32.21 ? 65   LYS C CB    1 
ATOM   5937  C  CG    . LYS C  1 37  ? 134.885 86.244  5.542   1.00 33.29 ? 65   LYS C CG    1 
ATOM   5938  C  CD    . LYS C  1 37  ? 135.167 87.674  5.109   1.00 33.67 ? 65   LYS C CD    1 
ATOM   5939  C  CE    . LYS C  1 37  ? 133.968 88.244  4.356   1.00 35.72 ? 65   LYS C CE    1 
ATOM   5940  N  NZ    . LYS C  1 37  ? 134.189 89.616  3.848   1.00 37.22 ? 65   LYS C NZ    1 
ATOM   5941  N  N     . SER C  1 38  ? 136.529 83.032  4.254   1.00 31.14 ? 66   SER C N     1 
ATOM   5942  C  CA    . SER C  1 38  ? 136.285 82.322  2.995   1.00 30.83 ? 66   SER C CA    1 
ATOM   5943  C  C     . SER C  1 38  ? 135.841 80.874  3.263   1.00 30.04 ? 66   SER C C     1 
ATOM   5944  O  O     . SER C  1 38  ? 134.897 80.398  2.656   1.00 29.79 ? 66   SER C O     1 
ATOM   5945  C  CB    A SER C  1 38  ? 137.521 82.374  2.089   0.50 30.84 ? 66   SER C CB    1 
ATOM   5946  C  CB    B SER C  1 38  ? 137.537 82.349  2.105   0.50 30.80 ? 66   SER C CB    1 
ATOM   5947  O  OG    A SER C  1 38  ? 138.687 82.008  2.800   0.50 31.41 ? 66   SER C OG    1 
ATOM   5948  O  OG    B SER C  1 38  ? 137.450 81.389  1.064   0.50 30.92 ? 66   SER C OG    1 
ATOM   5949  N  N     . SER C  1 39  ? 136.498 80.203  4.202   1.00 29.29 ? 67   SER C N     1 
ATOM   5950  C  CA    . SER C  1 39  ? 136.091 78.857  4.629   1.00 29.20 ? 67   SER C CA    1 
ATOM   5951  C  C     . SER C  1 39  ? 134.619 78.801  5.129   1.00 28.57 ? 67   SER C C     1 
ATOM   5952  O  O     . SER C  1 39  ? 133.862 77.899  4.754   1.00 28.22 ? 67   SER C O     1 
ATOM   5953  C  CB    A SER C  1 39  ? 137.032 78.326  5.715   0.50 28.99 ? 67   SER C CB    1 
ATOM   5954  C  CB    B SER C  1 39  ? 137.040 78.322  5.705   0.50 29.04 ? 67   SER C CB    1 
ATOM   5955  O  OG    A SER C  1 39  ? 138.298 77.994  5.179   0.50 28.92 ? 67   SER C OG    1 
ATOM   5956  O  OG    B SER C  1 39  ? 136.866 76.927  5.881   0.50 29.45 ? 67   SER C OG    1 
ATOM   5957  N  N     . VAL C  1 40  ? 134.211 79.768  5.941   1.00 28.36 ? 68   VAL C N     1 
ATOM   5958  C  CA    . VAL C  1 40  ? 132.855 79.775  6.494   1.00 28.09 ? 68   VAL C CA    1 
ATOM   5959  C  C     . VAL C  1 40  ? 131.828 80.047  5.402   1.00 28.60 ? 68   VAL C C     1 
ATOM   5960  O  O     . VAL C  1 40  ? 130.759 79.441  5.394   1.00 27.57 ? 68   VAL C O     1 
ATOM   5961  C  CB    . VAL C  1 40  ? 132.711 80.774  7.671   1.00 28.21 ? 68   VAL C CB    1 
ATOM   5962  C  CG1   . VAL C  1 40  ? 131.260 80.896  8.130   1.00 26.88 ? 68   VAL C CG1   1 
ATOM   5963  C  CG2   . VAL C  1 40  ? 133.574 80.330  8.826   1.00 27.53 ? 68   VAL C CG2   1 
ATOM   5964  N  N     . LYS C  1 41  ? 132.160 80.942  4.473   1.00 29.61 ? 69   LYS C N     1 
ATOM   5965  C  CA    . LYS C  1 41  ? 131.288 81.238  3.341   1.00 30.67 ? 69   LYS C CA    1 
ATOM   5966  C  C     . LYS C  1 41  ? 130.964 79.967  2.537   1.00 30.37 ? 69   LYS C C     1 
ATOM   5967  O  O     . LYS C  1 41  ? 129.816 79.741  2.176   1.00 29.81 ? 69   LYS C O     1 
ATOM   5968  C  CB    . LYS C  1 41  ? 131.917 82.306  2.431   1.00 31.07 ? 69   LYS C CB    1 
ATOM   5969  C  CG    . LYS C  1 41  ? 131.080 82.662  1.201   1.00 32.46 ? 69   LYS C CG    1 
ATOM   5970  C  CD    . LYS C  1 41  ? 131.839 83.588  0.246   1.00 33.55 ? 69   LYS C CD    1 
ATOM   5971  C  CE    . LYS C  1 41  ? 130.909 84.145  -0.827  1.00 37.34 ? 69   LYS C CE    1 
ATOM   5972  N  NZ    . LYS C  1 41  ? 131.642 84.926  -1.878  1.00 40.19 ? 69   LYS C NZ    1 
ATOM   5973  N  N     . LYS C  1 42  ? 131.980 79.143  2.281   1.00 30.65 ? 70   LYS C N     1 
ATOM   5974  C  CA    . LYS C  1 42  ? 131.819 77.902  1.513   1.00 30.81 ? 70   LYS C CA    1 
ATOM   5975  C  C     . LYS C  1 42  ? 130.981 76.889  2.299   1.00 30.36 ? 70   LYS C C     1 
ATOM   5976  O  O     . LYS C  1 42  ? 130.066 76.258  1.759   1.00 29.32 ? 70   LYS C O     1 
ATOM   5977  C  CB    . LYS C  1 42  ? 133.191 77.303  1.201   1.00 30.87 ? 70   LYS C CB    1 
ATOM   5978  C  CG    . LYS C  1 42  ? 133.162 76.049  0.313   1.00 32.49 ? 70   LYS C CG    1 
ATOM   5979  C  CD    . LYS C  1 42  ? 134.538 75.405  0.174   1.00 32.14 ? 70   LYS C CD    1 
ATOM   5980  C  CE    . LYS C  1 42  ? 134.460 74.013  -0.472  1.00 34.75 ? 70   LYS C CE    1 
ATOM   5981  N  NZ    . LYS C  1 42  ? 134.045 74.117  -1.913  1.00 38.09 ? 70   LYS C NZ    1 
ATOM   5982  N  N     . PHE C  1 43  ? 131.311 76.740  3.579   1.00 29.99 ? 71   PHE C N     1 
ATOM   5983  C  CA    . PHE C  1 43  ? 130.579 75.853  4.466   1.00 30.01 ? 71   PHE C CA    1 
ATOM   5984  C  C     . PHE C  1 43  ? 129.100 76.265  4.536   1.00 29.62 ? 71   PHE C C     1 
ATOM   5985  O  O     . PHE C  1 43  ? 128.217 75.429  4.427   1.00 29.12 ? 71   PHE C O     1 
ATOM   5986  C  CB    . PHE C  1 43  ? 131.236 75.830  5.859   1.00 29.84 ? 71   PHE C CB    1 
ATOM   5987  C  CG    . PHE C  1 43  ? 130.403 75.162  6.918   1.00 29.86 ? 71   PHE C CG    1 
ATOM   5988  C  CD1   . PHE C  1 43  ? 130.318 73.777  6.987   1.00 30.31 ? 71   PHE C CD1   1 
ATOM   5989  C  CD2   . PHE C  1 43  ? 129.703 75.921  7.850   1.00 29.70 ? 71   PHE C CD2   1 
ATOM   5990  C  CE1   . PHE C  1 43  ? 129.539 73.157  7.968   1.00 29.48 ? 71   PHE C CE1   1 
ATOM   5991  C  CE2   . PHE C  1 43  ? 128.932 75.315  8.829   1.00 30.50 ? 71   PHE C CE2   1 
ATOM   5992  C  CZ    . PHE C  1 43  ? 128.846 73.929  8.890   1.00 29.42 ? 71   PHE C CZ    1 
ATOM   5993  N  N     . ALA C  1 44  ? 128.838 77.555  4.688   1.00 29.95 ? 72   ALA C N     1 
ATOM   5994  C  CA    . ALA C  1 44  ? 127.476 78.050  4.826   1.00 30.50 ? 72   ALA C CA    1 
ATOM   5995  C  C     . ALA C  1 44  ? 126.669 77.776  3.546   1.00 31.63 ? 72   ALA C C     1 
ATOM   5996  O  O     . ALA C  1 44  ? 125.562 77.244  3.606   1.00 30.82 ? 72   ALA C O     1 
ATOM   5997  C  CB    . ALA C  1 44  ? 127.472 79.545  5.189   1.00 29.90 ? 72   ALA C CB    1 
ATOM   5998  N  N     . GLN C  1 45  ? 127.251 78.097  2.390   1.00 33.07 ? 73   GLN C N     1 
ATOM   5999  C  CA    . GLN C  1 45  ? 126.603 77.834  1.095   1.00 34.26 ? 73   GLN C CA    1 
ATOM   6000  C  C     . GLN C  1 45  ? 126.315 76.359  0.847   1.00 33.85 ? 73   GLN C C     1 
ATOM   6001  O  O     . GLN C  1 45  ? 125.232 76.003  0.391   1.00 34.58 ? 73   GLN C O     1 
ATOM   6002  C  CB    . GLN C  1 45  ? 127.426 78.436  -0.054  1.00 34.32 ? 73   GLN C CB    1 
ATOM   6003  C  CG    . GLN C  1 45  ? 127.205 79.944  -0.179  1.00 36.57 ? 73   GLN C CG    1 
ATOM   6004  C  CD    . GLN C  1 45  ? 128.128 80.648  -1.182  1.00 37.58 ? 73   GLN C CD    1 
ATOM   6005  O  OE1   . GLN C  1 45  ? 128.177 81.888  -1.216  1.00 45.00 ? 73   GLN C OE1   1 
ATOM   6006  N  NE2   . GLN C  1 45  ? 128.868 79.875  -1.975  1.00 41.54 ? 73   GLN C NE2   1 
ATOM   6007  N  N     . GLU C  1 46  ? 127.256 75.497  1.189   1.00 33.51 ? 74   GLU C N     1 
ATOM   6008  C  CA    . GLU C  1 46  ? 127.152 74.084  0.871   1.00 33.58 ? 74   GLU C CA    1 
ATOM   6009  C  C     . GLU C  1 46  ? 126.381 73.262  1.911   1.00 32.37 ? 74   GLU C C     1 
ATOM   6010  O  O     . GLU C  1 46  ? 125.648 72.351  1.557   1.00 31.60 ? 74   GLU C O     1 
ATOM   6011  C  CB    . GLU C  1 46  ? 128.553 73.495  0.697   1.00 33.58 ? 74   GLU C CB    1 
ATOM   6012  C  CG    . GLU C  1 46  ? 129.332 74.109  -0.469  1.00 34.76 ? 74   GLU C CG    1 
ATOM   6013  C  CD    . GLU C  1 46  ? 130.721 73.503  -0.637  1.00 36.23 ? 74   GLU C CD    1 
ATOM   6014  O  OE1   . GLU C  1 46  ? 131.115 72.634  0.196   1.00 38.87 ? 74   GLU C OE1   1 
ATOM   6015  O  OE2   . GLU C  1 46  ? 131.416 73.900  -1.611  1.00 40.03 ? 74   GLU C OE2   1 
ATOM   6016  N  N     . GLN C  1 47  ? 126.566 73.576  3.186   1.00 30.99 ? 75   GLN C N     1 
ATOM   6017  C  CA    . GLN C  1 47  ? 126.031 72.748  4.264   1.00 30.56 ? 75   GLN C CA    1 
ATOM   6018  C  C     . GLN C  1 47  ? 124.799 73.327  4.962   1.00 29.63 ? 75   GLN C C     1 
ATOM   6019  O  O     . GLN C  1 47  ? 124.046 72.584  5.591   1.00 29.74 ? 75   GLN C O     1 
ATOM   6020  C  CB    . GLN C  1 47  ? 127.118 72.482  5.312   1.00 30.50 ? 75   GLN C CB    1 
ATOM   6021  C  CG    . GLN C  1 47  ? 128.202 71.527  4.850   1.00 31.87 ? 75   GLN C CG    1 
ATOM   6022  C  CD    . GLN C  1 47  ? 127.657 70.157  4.485   1.00 32.83 ? 75   GLN C CD    1 
ATOM   6023  O  OE1   . GLN C  1 47  ? 126.962 69.502  5.282   1.00 34.61 ? 75   GLN C OE1   1 
ATOM   6024  N  NE2   . GLN C  1 47  ? 127.964 69.716  3.276   1.00 32.57 ? 75   GLN C NE2   1 
ATOM   6025  N  N     . ILE C  1 48  ? 124.599 74.637  4.878   1.00 28.13 ? 76   ILE C N     1 
ATOM   6026  C  CA    . ILE C  1 48  ? 123.529 75.271  5.644   1.00 27.22 ? 76   ILE C CA    1 
ATOM   6027  C  C     . ILE C  1 48  ? 122.407 75.747  4.732   1.00 26.96 ? 76   ILE C C     1 
ATOM   6028  O  O     . ILE C  1 48  ? 121.233 75.450  4.993   1.00 26.56 ? 76   ILE C O     1 
ATOM   6029  C  CB    . ILE C  1 48  ? 124.033 76.476  6.465   1.00 27.32 ? 76   ILE C CB    1 
ATOM   6030  C  CG1   . ILE C  1 48  ? 125.235 76.091  7.335   1.00 27.20 ? 76   ILE C CG1   1 
ATOM   6031  C  CG2   . ILE C  1 48  ? 122.893 77.047  7.331   1.00 26.92 ? 76   ILE C CG2   1 
ATOM   6032  C  CD1   . ILE C  1 48  ? 125.705 77.235  8.233   1.00 26.75 ? 76   ILE C CD1   1 
ATOM   6033  N  N     . ALA C  1 49  ? 122.763 76.471  3.665   1.00 25.90 ? 77   ALA C N     1 
ATOM   6034  C  CA    . ALA C  1 49  ? 121.763 77.083  2.782   1.00 26.03 ? 77   ALA C CA    1 
ATOM   6035  C  C     . ALA C  1 49  ? 120.620 76.143  2.325   1.00 26.25 ? 77   ALA C C     1 
ATOM   6036  O  O     . ALA C  1 49  ? 119.463 76.551  2.342   1.00 26.57 ? 77   ALA C O     1 
ATOM   6037  C  CB    . ALA C  1 49  ? 122.424 77.758  1.572   1.00 26.28 ? 77   ALA C CB    1 
ATOM   6038  N  N     . PRO C  1 50  ? 120.929 74.892  1.929   1.00 26.71 ? 78   PRO C N     1 
ATOM   6039  C  CA    . PRO C  1 50  ? 119.855 73.959  1.536   1.00 26.82 ? 78   PRO C CA    1 
ATOM   6040  C  C     . PRO C  1 50  ? 118.829 73.645  2.638   1.00 26.83 ? 78   PRO C C     1 
ATOM   6041  O  O     . PRO C  1 50  ? 117.694 73.254  2.339   1.00 27.49 ? 78   PRO C O     1 
ATOM   6042  C  CB    . PRO C  1 50  ? 120.629 72.688  1.161   1.00 27.67 ? 78   PRO C CB    1 
ATOM   6043  C  CG    . PRO C  1 50  ? 121.984 73.201  0.742   1.00 27.44 ? 78   PRO C CG    1 
ATOM   6044  C  CD    . PRO C  1 50  ? 122.254 74.278  1.750   1.00 26.46 ? 78   PRO C CD    1 
ATOM   6045  N  N     . LEU C  1 51  ? 119.230 73.803  3.898   1.00 26.31 ? 79   LEU C N     1 
ATOM   6046  C  CA    . LEU C  1 51  ? 118.424 73.398  5.043   1.00 26.13 ? 79   LEU C CA    1 
ATOM   6047  C  C     . LEU C  1 51  ? 117.731 74.536  5.768   1.00 25.73 ? 79   LEU C C     1 
ATOM   6048  O  O     . LEU C  1 51  ? 116.909 74.292  6.647   1.00 26.06 ? 79   LEU C O     1 
ATOM   6049  C  CB    . LEU C  1 51  ? 119.305 72.649  6.050   1.00 26.13 ? 79   LEU C CB    1 
ATOM   6050  C  CG    . LEU C  1 51  ? 119.909 71.352  5.535   1.00 26.04 ? 79   LEU C CG    1 
ATOM   6051  C  CD1   . LEU C  1 51  ? 121.048 70.921  6.471   1.00 26.26 ? 79   LEU C CD1   1 
ATOM   6052  C  CD2   . LEU C  1 51  ? 118.838 70.286  5.404   1.00 25.85 ? 79   LEU C CD2   1 
ATOM   6053  N  N     . VAL C  1 52  ? 118.041 75.771  5.397   1.00 25.01 ? 80   VAL C N     1 
ATOM   6054  C  CA    . VAL C  1 52  ? 117.518 76.938  6.113   1.00 25.01 ? 80   VAL C CA    1 
ATOM   6055  C  C     . VAL C  1 52  ? 115.980 76.923  6.268   1.00 25.17 ? 80   VAL C C     1 
ATOM   6056  O  O     . VAL C  1 52  ? 115.469 77.088  7.393   1.00 24.11 ? 80   VAL C O     1 
ATOM   6057  C  CB    . VAL C  1 52  ? 117.987 78.275  5.483   1.00 25.62 ? 80   VAL C CB    1 
ATOM   6058  C  CG1   . VAL C  1 52  ? 117.367 79.482  6.219   1.00 22.15 ? 80   VAL C CG1   1 
ATOM   6059  C  CG2   . VAL C  1 52  ? 119.513 78.382  5.523   1.00 25.86 ? 80   VAL C CG2   1 
ATOM   6060  N  N     . SER C  1 53  ? 115.256 76.690  5.169   1.00 25.17 ? 81   SER C N     1 
ATOM   6061  C  CA    . SER C  1 53  ? 113.788 76.666  5.203   1.00 26.47 ? 81   SER C CA    1 
ATOM   6062  C  C     . SER C  1 53  ? 113.190 75.603  6.129   1.00 25.75 ? 81   SER C C     1 
ATOM   6063  O  O     . SER C  1 53  ? 112.304 75.895  6.928   1.00 26.04 ? 81   SER C O     1 
ATOM   6064  C  CB    . SER C  1 53  ? 113.207 76.470  3.788   1.00 26.48 ? 81   SER C CB    1 
ATOM   6065  O  OG    . SER C  1 53  ? 113.343 77.685  3.080   1.00 31.71 ? 81   SER C OG    1 
ATOM   6066  N  N     . THR C  1 54  ? 113.667 74.375  6.002   1.00 25.95 ? 82   THR C N     1 
ATOM   6067  C  CA    . THR C  1 54  ? 113.127 73.253  6.783   1.00 25.66 ? 82   THR C CA    1 
ATOM   6068  C  C     . THR C  1 54  ? 113.501 73.384  8.268   1.00 25.36 ? 82   THR C C     1 
ATOM   6069  O  O     . THR C  1 54  ? 112.713 73.064  9.149   1.00 25.46 ? 82   THR C O     1 
ATOM   6070  C  CB    . THR C  1 54  ? 113.534 71.886  6.197   1.00 25.89 ? 82   THR C CB    1 
ATOM   6071  O  OG1   . THR C  1 54  ? 112.594 70.871  6.619   1.00 26.34 ? 82   THR C OG1   1 
ATOM   6072  C  CG2   . THR C  1 54  ? 114.956 71.482  6.611   1.00 25.53 ? 82   THR C CG2   1 
ATOM   6073  N  N     . MET C  1 55  ? 114.688 73.900  8.556   1.00 25.61 ? 83   MET C N     1 
ATOM   6074  C  CA    . MET C  1 55  ? 115.063 74.145  9.962   1.00 25.43 ? 83   MET C CA    1 
ATOM   6075  C  C     . MET C  1 55  ? 114.157 75.209  10.603  1.00 25.07 ? 83   MET C C     1 
ATOM   6076  O  O     . MET C  1 55  ? 113.715 75.052  11.742  1.00 25.82 ? 83   MET C O     1 
ATOM   6077  C  CB    . MET C  1 55  ? 116.543 74.511  10.081  1.00 24.82 ? 83   MET C CB    1 
ATOM   6078  C  CG    . MET C  1 55  ? 117.487 73.365  9.665   1.00 24.97 ? 83   MET C CG    1 
ATOM   6079  S  SD    . MET C  1 55  ? 119.224 73.672  10.042  1.00 27.35 ? 83   MET C SD    1 
ATOM   6080  C  CE    . MET C  1 55  ? 119.526 75.229  9.214   1.00 25.11 ? 83   MET C CE    1 
ATOM   6081  N  N     . ASP C  1 56  ? 113.855 76.259  9.848   1.00 25.06 ? 84   ASP C N     1 
ATOM   6082  C  CA    . ASP C  1 56  ? 112.956 77.321  10.279  1.00 24.83 ? 84   ASP C CA    1 
ATOM   6083  C  C     . ASP C  1 56  ? 111.531 76.804  10.475  1.00 24.57 ? 84   ASP C C     1 
ATOM   6084  O  O     . ASP C  1 56  ? 110.929 77.002  11.530  1.00 24.20 ? 84   ASP C O     1 
ATOM   6085  C  CB    . ASP C  1 56  ? 112.981 78.470  9.245   1.00 24.70 ? 84   ASP C CB    1 
ATOM   6086  C  CG    . ASP C  1 56  ? 111.888 79.500  9.476   1.00 24.44 ? 84   ASP C CG    1 
ATOM   6087  O  OD1   . ASP C  1 56  ? 111.938 80.234  10.468  1.00 23.88 ? 84   ASP C OD1   1 
ATOM   6088  O  OD2   . ASP C  1 56  ? 110.962 79.573  8.668   1.00 28.41 ? 84   ASP C OD2   1 
ATOM   6089  N  N     . GLU C  1 57  ? 110.994 76.138  9.457   1.00 24.84 ? 85   GLU C N     1 
ATOM   6090  C  CA    . GLU C  1 57  ? 109.638 75.598  9.521   1.00 24.58 ? 85   GLU C CA    1 
ATOM   6091  C  C     . GLU C  1 57  ? 109.419 74.718  10.755  1.00 25.06 ? 85   GLU C C     1 
ATOM   6092  O  O     . GLU C  1 57  ? 108.388 74.808  11.423  1.00 25.30 ? 85   GLU C O     1 
ATOM   6093  C  CB    . GLU C  1 57  ? 109.316 74.776  8.254   1.00 24.78 ? 85   GLU C CB    1 
ATOM   6094  N  N     . ASN C  1 58  ? 110.390 73.863  11.059  1.00 25.08 ? 86   ASN C N     1 
ATOM   6095  C  CA    . ASN C  1 58  ? 110.229 72.881  12.109  1.00 25.01 ? 86   ASN C CA    1 
ATOM   6096  C  C     . ASN C  1 58  ? 110.927 73.188  13.426  1.00 24.61 ? 86   ASN C C     1 
ATOM   6097  O  O     . ASN C  1 58  ? 110.948 72.346  14.336  1.00 24.61 ? 86   ASN C O     1 
ATOM   6098  C  CB    . ASN C  1 58  ? 110.625 71.525  11.550  1.00 25.27 ? 86   ASN C CB    1 
ATOM   6099  C  CG    . ASN C  1 58  ? 109.706 71.111  10.395  1.00 26.16 ? 86   ASN C CG    1 
ATOM   6100  O  OD1   . ASN C  1 58  ? 110.111 71.119  9.233   1.00 28.13 ? 86   ASN C OD1   1 
ATOM   6101  N  ND2   . ASN C  1 58  ? 108.442 70.853  10.714  1.00 23.46 ? 86   ASN C ND2   1 
ATOM   6102  N  N     . SER C  1 59  ? 111.458 74.399  13.537  1.00 24.56 ? 87   SER C N     1 
ATOM   6103  C  CA    . SER C  1 59  ? 112.192 74.854  14.730  1.00 24.40 ? 87   SER C CA    1 
ATOM   6104  C  C     . SER C  1 59  ? 113.205 73.802  15.184  1.00 24.32 ? 87   SER C C     1 
ATOM   6105  O  O     . SER C  1 59  ? 113.189 73.382  16.343  1.00 23.47 ? 87   SER C O     1 
ATOM   6106  C  CB    . SER C  1 59  ? 111.238 75.194  15.895  1.00 24.54 ? 87   SER C CB    1 
ATOM   6107  O  OG    . SER C  1 59  ? 110.329 76.229  15.570  1.00 26.12 ? 87   SER C OG    1 
ATOM   6108  N  N     . LYS C  1 60  ? 114.049 73.346  14.256  1.00 24.32 ? 88   LYS C N     1 
ATOM   6109  C  CA    . LYS C  1 60  ? 114.990 72.261  14.530  1.00 24.77 ? 88   LYS C CA    1 
ATOM   6110  C  C     . LYS C  1 60  ? 116.266 72.446  13.710  1.00 24.50 ? 88   LYS C C     1 
ATOM   6111  O  O     . LYS C  1 60  ? 116.234 72.370  12.485  1.00 23.73 ? 88   LYS C O     1 
ATOM   6112  C  CB    . LYS C  1 60  ? 114.356 70.895  14.221  1.00 24.80 ? 88   LYS C CB    1 
ATOM   6113  C  CG    . LYS C  1 60  ? 115.191 69.716  14.689  1.00 26.81 ? 88   LYS C CG    1 
ATOM   6114  C  CD    . LYS C  1 60  ? 114.704 68.397  14.158  1.00 26.41 ? 88   LYS C CD    1 
ATOM   6115  C  CE    . LYS C  1 60  ? 115.618 67.262  14.628  1.00 27.24 ? 88   LYS C CE    1 
ATOM   6116  N  NZ    . LYS C  1 60  ? 115.221 65.948  14.089  1.00 26.18 ? 88   LYS C NZ    1 
ATOM   6117  N  N     . MET C  1 61  ? 117.381 72.711  14.385  1.00 24.01 ? 89   MET C N     1 
ATOM   6118  C  CA    . MET C  1 61  ? 118.662 72.758  13.720  1.00 24.92 ? 89   MET C CA    1 
ATOM   6119  C  C     . MET C  1 61  ? 119.108 71.331  13.419  1.00 24.51 ? 89   MET C C     1 
ATOM   6120  O  O     . MET C  1 61  ? 118.983 70.435  14.255  1.00 24.67 ? 89   MET C O     1 
ATOM   6121  C  CB    . MET C  1 61  ? 119.703 73.512  14.568  1.00 24.97 ? 89   MET C CB    1 
ATOM   6122  C  CG    . MET C  1 61  ? 120.944 73.932  13.791  1.00 25.04 ? 89   MET C CG    1 
ATOM   6123  S  SD    . MET C  1 61  ? 122.050 74.958  14.785  1.00 27.95 ? 89   MET C SD    1 
ATOM   6124  C  CE    . MET C  1 61  ? 121.043 76.440  14.999  1.00 25.00 ? 89   MET C CE    1 
ATOM   6125  N  N     . GLU C  1 62  ? 119.602 71.110  12.210  1.00 24.69 ? 90   GLU C N     1 
ATOM   6126  C  CA    . GLU C  1 62  ? 120.037 69.785  11.808  1.00 24.94 ? 90   GLU C CA    1 
ATOM   6127  C  C     . GLU C  1 62  ? 121.376 69.439  12.439  1.00 25.14 ? 90   GLU C C     1 
ATOM   6128  O  O     . GLU C  1 62  ? 122.268 70.290  12.536  1.00 24.18 ? 90   GLU C O     1 
ATOM   6129  C  CB    . GLU C  1 62  ? 120.110 69.671  10.283  1.00 25.69 ? 90   GLU C CB    1 
ATOM   6130  C  CG    . GLU C  1 62  ? 118.745 69.488  9.607   1.00 26.48 ? 90   GLU C CG    1 
ATOM   6131  C  CD    . GLU C  1 62  ? 118.021 68.237  10.060  1.00 26.50 ? 90   GLU C CD    1 
ATOM   6132  O  OE1   . GLU C  1 62  ? 118.682 67.168  10.175  1.00 27.32 ? 90   GLU C OE1   1 
ATOM   6133  O  OE2   . GLU C  1 62  ? 116.786 68.321  10.310  1.00 25.64 ? 90   GLU C OE2   1 
ATOM   6134  N  N     . LYS C  1 63  ? 121.492 68.179  12.860  1.00 24.64 ? 91   LYS C N     1 
ATOM   6135  C  CA    . LYS C  1 63  ? 122.724 67.617  13.387  1.00 25.14 ? 91   LYS C CA    1 
ATOM   6136  C  C     . LYS C  1 63  ? 123.906 67.797  12.418  1.00 24.39 ? 91   LYS C C     1 
ATOM   6137  O  O     . LYS C  1 63  ? 125.032 68.091  12.871  1.00 23.74 ? 91   LYS C O     1 
ATOM   6138  C  CB    . LYS C  1 63  ? 122.534 66.124  13.747  1.00 24.87 ? 91   LYS C CB    1 
ATOM   6139  C  CG    . LYS C  1 63  ? 123.675 65.495  14.513  1.00 27.33 ? 91   LYS C CG    1 
ATOM   6140  C  CD    . LYS C  1 63  ? 124.022 66.247  15.810  1.00 28.80 ? 91   LYS C CD    1 
ATOM   6141  C  CE    . LYS C  1 63  ? 124.950 65.401  16.674  1.00 31.11 ? 91   LYS C CE    1 
ATOM   6142  N  NZ    . LYS C  1 63  ? 125.172 65.897  18.077  1.00 31.18 ? 91   LYS C NZ    1 
ATOM   6143  N  N     . SER C  1 64  ? 123.637 67.649  11.111  1.00 23.43 ? 92   SER C N     1 
ATOM   6144  C  CA    . SER C  1 64  ? 124.639 67.862  10.053  1.00 22.87 ? 92   SER C CA    1 
ATOM   6145  C  C     . SER C  1 64  ? 125.318 69.246  10.151  1.00 23.23 ? 92   SER C C     1 
ATOM   6146  O  O     . SER C  1 64  ? 126.537 69.348  10.009  1.00 21.92 ? 92   SER C O     1 
ATOM   6147  C  CB    . SER C  1 64  ? 124.042 67.644  8.652   1.00 22.98 ? 92   SER C CB    1 
ATOM   6148  O  OG    . SER C  1 64  ? 123.084 68.635  8.295   1.00 21.54 ? 92   SER C OG    1 
ATOM   6149  N  N     . VAL C  1 65  ? 124.516 70.274  10.433  1.00 23.35 ? 93   VAL C N     1 
ATOM   6150  C  CA    . VAL C  1 65  ? 124.975 71.654  10.588  1.00 24.38 ? 93   VAL C CA    1 
ATOM   6151  C  C     . VAL C  1 65  ? 125.755 71.808  11.896  1.00 25.02 ? 93   VAL C C     1 
ATOM   6152  O  O     . VAL C  1 65  ? 126.859 72.354  11.894  1.00 25.68 ? 93   VAL C O     1 
ATOM   6153  C  CB    . VAL C  1 65  ? 123.776 72.675  10.536  1.00 23.78 ? 93   VAL C CB    1 
ATOM   6154  C  CG1   . VAL C  1 65  ? 124.219 74.140  10.875  1.00 24.15 ? 93   VAL C CG1   1 
ATOM   6155  C  CG2   . VAL C  1 65  ? 123.072 72.614  9.170   1.00 24.10 ? 93   VAL C CG2   1 
ATOM   6156  N  N     . ILE C  1 66  ? 125.187 71.317  12.994  1.00 25.39 ? 94   ILE C N     1 
ATOM   6157  C  CA    . ILE C  1 66  ? 125.816 71.416  14.323  1.00 25.98 ? 94   ILE C CA    1 
ATOM   6158  C  C     . ILE C  1 66  ? 127.185 70.735  14.310  1.00 25.84 ? 94   ILE C C     1 
ATOM   6159  O  O     . ILE C  1 66  ? 128.222 71.339  14.669  1.00 24.42 ? 94   ILE C O     1 
ATOM   6160  C  CB    . ILE C  1 66  ? 124.911 70.802  15.450  1.00 26.08 ? 94   ILE C CB    1 
ATOM   6161  C  CG1   . ILE C  1 66  ? 123.629 71.617  15.626  1.00 26.52 ? 94   ILE C CG1   1 
ATOM   6162  C  CG2   . ILE C  1 66  ? 125.652 70.717  16.780  1.00 26.36 ? 94   ILE C CG2   1 
ATOM   6163  C  CD1   . ILE C  1 66  ? 122.455 70.789  16.171  1.00 26.59 ? 94   ILE C CD1   1 
ATOM   6164  N  N     . GLN C  1 67  ? 127.202 69.488  13.862  1.00 25.32 ? 95   GLN C N     1 
ATOM   6165  C  CA    . GLN C  1 67  ? 128.444 68.752  13.813  1.00 26.23 ? 95   GLN C CA    1 
ATOM   6166  C  C     . GLN C  1 67  ? 129.434 69.328  12.789  1.00 25.82 ? 95   GLN C C     1 
ATOM   6167  O  O     . GLN C  1 67  ? 130.645 69.246  12.996  1.00 24.86 ? 95   GLN C O     1 
ATOM   6168  C  CB    . GLN C  1 67  ? 128.183 67.264  13.567  1.00 26.64 ? 95   GLN C CB    1 
ATOM   6169  C  CG    . GLN C  1 67  ? 129.190 66.375  14.226  1.00 30.59 ? 95   GLN C CG    1 
ATOM   6170  C  CD    . GLN C  1 67  ? 129.409 66.702  15.716  1.00 31.42 ? 95   GLN C CD    1 
ATOM   6171  O  OE1   . GLN C  1 67  ? 128.466 67.024  16.479  1.00 35.83 ? 95   GLN C OE1   1 
ATOM   6172  N  NE2   . GLN C  1 67  ? 130.654 66.646  16.121  1.00 32.25 ? 95   GLN C NE2   1 
ATOM   6173  N  N     . GLY C  1 68  ? 128.908 69.903  11.706  1.00 25.73 ? 96   GLY C N     1 
ATOM   6174  C  CA    . GLY C  1 68  ? 129.703 70.634  10.733  1.00 26.12 ? 96   GLY C CA    1 
ATOM   6175  C  C     . GLY C  1 68  ? 130.438 71.824  11.358  1.00 26.24 ? 96   GLY C C     1 
ATOM   6176  O  O     . GLY C  1 68  ? 131.619 72.027  11.089  1.00 25.92 ? 96   GLY C O     1 
ATOM   6177  N  N     . LEU C  1 69  ? 129.750 72.590  12.202  1.00 26.36 ? 97   LEU C N     1 
ATOM   6178  C  CA    . LEU C  1 69  ? 130.382 73.716  12.935  1.00 26.56 ? 97   LEU C CA    1 
ATOM   6179  C  C     . LEU C  1 69  ? 131.546 73.251  13.817  1.00 26.55 ? 97   LEU C C     1 
ATOM   6180  O  O     . LEU C  1 69  ? 132.622 73.862  13.802  1.00 26.07 ? 97   LEU C O     1 
ATOM   6181  C  CB    . LEU C  1 69  ? 129.377 74.469  13.803  1.00 25.93 ? 97   LEU C CB    1 
ATOM   6182  C  CG    . LEU C  1 69  ? 128.333 75.351  13.115  1.00 28.04 ? 97   LEU C CG    1 
ATOM   6183  C  CD1   . LEU C  1 69  ? 127.287 75.793  14.102  1.00 26.01 ? 97   LEU C CD1   1 
ATOM   6184  C  CD2   . LEU C  1 69  ? 128.968 76.558  12.438  1.00 27.28 ? 97   LEU C CD2   1 
ATOM   6185  N  N     . PHE C  1 70  ? 131.331 72.178  14.583  1.00 25.82 ? 98   PHE C N     1 
ATOM   6186  C  CA    . PHE C  1 70  ? 132.398 71.618  15.403  1.00 25.92 ? 98   PHE C CA    1 
ATOM   6187  C  C     . PHE C  1 70  ? 133.575 71.132  14.553  1.00 26.11 ? 98   PHE C C     1 
ATOM   6188  O  O     . PHE C  1 70  ? 134.735 71.460  14.814  1.00 25.23 ? 98   PHE C O     1 
ATOM   6189  C  CB    . PHE C  1 70  ? 131.881 70.456  16.254  1.00 26.10 ? 98   PHE C CB    1 
ATOM   6190  C  CG    . PHE C  1 70  ? 131.126 70.887  17.470  1.00 26.30 ? 98   PHE C CG    1 
ATOM   6191  C  CD1   . PHE C  1 70  ? 131.799 71.377  18.583  1.00 25.81 ? 98   PHE C CD1   1 
ATOM   6192  C  CD2   . PHE C  1 70  ? 129.737 70.793  17.513  1.00 25.96 ? 98   PHE C CD2   1 
ATOM   6193  C  CE1   . PHE C  1 70  ? 131.105 71.773  19.717  1.00 25.81 ? 98   PHE C CE1   1 
ATOM   6194  C  CE2   . PHE C  1 70  ? 129.035 71.181  18.643  1.00 27.11 ? 98   PHE C CE2   1 
ATOM   6195  C  CZ    . PHE C  1 70  ? 129.724 71.669  19.758  1.00 26.81 ? 98   PHE C CZ    1 
ATOM   6196  N  N     . GLN C  1 71  ? 133.250 70.351  13.526  1.00 26.51 ? 99   GLN C N     1 
ATOM   6197  C  CA    . GLN C  1 71  ? 134.220 69.782  12.580  1.00 27.42 ? 99   GLN C CA    1 
ATOM   6198  C  C     . GLN C  1 71  ? 135.096 70.865  11.947  1.00 26.94 ? 99   GLN C C     1 
ATOM   6199  O  O     . GLN C  1 71  ? 136.300 70.685  11.773  1.00 26.95 ? 99   GLN C O     1 
ATOM   6200  C  CB    . GLN C  1 71  ? 133.415 69.098  11.471  1.00 27.76 ? 99   GLN C CB    1 
ATOM   6201  C  CG    A GLN C  1 71  ? 133.962 67.940  10.753  0.50 29.21 ? 99   GLN C CG    1 
ATOM   6202  C  CG    B GLN C  1 71  ? 134.242 68.123  10.631  0.50 29.08 ? 99   GLN C CG    1 
ATOM   6203  C  CD    A GLN C  1 71  ? 132.798 67.029  10.339  0.50 29.99 ? 99   GLN C CD    1 
ATOM   6204  C  CD    B GLN C  1 71  ? 134.974 68.771  9.445   0.50 30.03 ? 99   GLN C CD    1 
ATOM   6205  O  OE1   A GLN C  1 71  ? 131.995 67.392  9.465   0.50 29.53 ? 99   GLN C OE1   1 
ATOM   6206  O  OE1   B GLN C  1 71  ? 136.057 68.325  9.043   0.50 30.88 ? 99   GLN C OE1   1 
ATOM   6207  N  NE2   A GLN C  1 71  ? 132.655 65.887  11.021  0.50 29.07 ? 99   GLN C NE2   1 
ATOM   6208  N  NE2   B GLN C  1 71  ? 134.378 69.806  8.875   0.50 30.02 ? 99   GLN C NE2   1 
ATOM   6209  N  N     . GLN C  1 72  ? 134.469 71.964  11.559  1.00 27.16 ? 100  GLN C N     1 
ATOM   6210  C  CA    . GLN C  1 72  ? 135.169 73.079  10.897  1.00 27.82 ? 100  GLN C CA    1 
ATOM   6211  C  C     . GLN C  1 72  ? 135.999 73.955  11.864  1.00 27.94 ? 100  GLN C C     1 
ATOM   6212  O  O     . GLN C  1 72  ? 136.649 74.913  11.429  1.00 28.31 ? 100  GLN C O     1 
ATOM   6213  C  CB    . GLN C  1 72  ? 134.154 73.958  10.154  1.00 28.15 ? 100  GLN C CB    1 
ATOM   6214  C  CG    . GLN C  1 72  ? 133.498 73.292  8.927   1.00 29.85 ? 100  GLN C CG    1 
ATOM   6215  C  CD    . GLN C  1 72  ? 134.434 73.215  7.724   1.00 32.31 ? 100  GLN C CD    1 
ATOM   6216  O  OE1   . GLN C  1 72  ? 134.801 72.122  7.276   1.00 36.46 ? 100  GLN C OE1   1 
ATOM   6217  N  NE2   . GLN C  1 72  ? 134.841 74.365  7.216   1.00 32.47 ? 100  GLN C NE2   1 
ATOM   6218  N  N     . GLY C  1 73  ? 135.977 73.630  13.158  1.00 27.54 ? 101  GLY C N     1 
ATOM   6219  C  CA    . GLY C  1 73  ? 136.676 74.412  14.182  1.00 27.37 ? 101  GLY C CA    1 
ATOM   6220  C  C     . GLY C  1 73  ? 135.963 75.704  14.553  1.00 26.96 ? 101  GLY C C     1 
ATOM   6221  O  O     . GLY C  1 73  ? 136.557 76.603  15.139  1.00 27.94 ? 101  GLY C O     1 
ATOM   6222  N  N     . LEU C  1 74  ? 134.678 75.807  14.230  1.00 26.46 ? 102  LEU C N     1 
ATOM   6223  C  CA    . LEU C  1 74  ? 133.964 77.064  14.417  1.00 26.25 ? 102  LEU C CA    1 
ATOM   6224  C  C     . LEU C  1 74  ? 133.339 77.206  15.807  1.00 26.22 ? 102  LEU C C     1 
ATOM   6225  O  O     . LEU C  1 74  ? 132.790 78.251  16.127  1.00 26.19 ? 102  LEU C O     1 
ATOM   6226  C  CB    . LEU C  1 74  ? 132.922 77.247  13.305  1.00 26.21 ? 102  LEU C CB    1 
ATOM   6227  C  CG    . LEU C  1 74  ? 133.532 77.257  11.890  1.00 26.10 ? 102  LEU C CG    1 
ATOM   6228  C  CD1   . LEU C  1 74  ? 132.437 77.405  10.824  1.00 26.11 ? 102  LEU C CD1   1 
ATOM   6229  C  CD2   . LEU C  1 74  ? 134.574 78.381  11.758  1.00 25.89 ? 102  LEU C CD2   1 
ATOM   6230  N  N     . MET C  1 75  ? 133.449 76.169  16.637  1.00 26.23 ? 103  MET C N     1 
ATOM   6231  C  CA    . MET C  1 75  ? 132.945 76.233  18.017  1.00 26.38 ? 103  MET C CA    1 
ATOM   6232  C  C     . MET C  1 75  ? 134.035 76.513  19.072  1.00 26.59 ? 103  MET C C     1 
ATOM   6233  O  O     . MET C  1 75  ? 133.719 76.650  20.253  1.00 28.13 ? 103  MET C O     1 
ATOM   6234  C  CB    . MET C  1 75  ? 132.187 74.954  18.355  1.00 26.40 ? 103  MET C CB    1 
ATOM   6235  C  CG    . MET C  1 75  ? 130.952 74.734  17.466  1.00 25.74 ? 103  MET C CG    1 
ATOM   6236  S  SD    . MET C  1 75  ? 129.682 76.011  17.598  1.00 27.50 ? 103  MET C SD    1 
ATOM   6237  C  CE    . MET C  1 75  ? 128.714 75.319  18.949  1.00 27.18 ? 103  MET C CE    1 
ATOM   6238  N  N     . GLY C  1 76  ? 135.290 76.630  18.644  1.00 26.11 ? 104  GLY C N     1 
ATOM   6239  C  CA    . GLY C  1 76  ? 136.396 77.004  19.530  1.00 25.91 ? 104  GLY C CA    1 
ATOM   6240  C  C     . GLY C  1 76  ? 137.381 77.901  18.815  1.00 25.63 ? 104  GLY C C     1 
ATOM   6241  O  O     . GLY C  1 76  ? 138.589 77.663  18.836  1.00 25.99 ? 104  GLY C O     1 
ATOM   6242  N  N     . ILE C  1 77  ? 136.846 78.943  18.188  1.00 25.52 ? 105  ILE C N     1 
ATOM   6243  C  CA    . ILE C  1 77  ? 137.603 79.803  17.281  1.00 25.45 ? 105  ILE C CA    1 
ATOM   6244  C  C     . ILE C  1 77  ? 138.843 80.411  17.959  1.00 25.10 ? 105  ILE C C     1 
ATOM   6245  O  O     . ILE C  1 77  ? 139.927 80.415  17.387  1.00 23.96 ? 105  ILE C O     1 
ATOM   6246  C  CB    . ILE C  1 77  ? 136.689 80.919  16.719  1.00 25.50 ? 105  ILE C CB    1 
ATOM   6247  C  CG1   . ILE C  1 77  ? 135.603 80.302  15.811  1.00 25.23 ? 105  ILE C CG1   1 
ATOM   6248  C  CG2   . ILE C  1 77  ? 137.507 81.975  15.962  1.00 25.83 ? 105  ILE C CG2   1 
ATOM   6249  C  CD1   . ILE C  1 77  ? 134.432 81.221  15.523  1.00 25.84 ? 105  ILE C CD1   1 
ATOM   6250  N  N     . GLU C  1 78  ? 138.664 80.892  19.189  1.00 25.38 ? 106  GLU C N     1 
ATOM   6251  C  CA    . GLU C  1 78  ? 139.725 81.588  19.947  1.00 25.88 ? 106  GLU C CA    1 
ATOM   6252  C  C     . GLU C  1 78  ? 140.400 80.717  20.987  1.00 26.00 ? 106  GLU C C     1 
ATOM   6253  O  O     . GLU C  1 78  ? 141.372 81.142  21.616  1.00 26.40 ? 106  GLU C O     1 
ATOM   6254  C  CB    . GLU C  1 78  ? 139.129 82.804  20.656  1.00 26.05 ? 106  GLU C CB    1 
ATOM   6255  C  CG    . GLU C  1 78  ? 138.530 83.810  19.714  1.00 26.61 ? 106  GLU C CG    1 
ATOM   6256  C  CD    . GLU C  1 78  ? 137.693 84.840  20.432  1.00 29.20 ? 106  GLU C CD    1 
ATOM   6257  O  OE1   . GLU C  1 78  ? 138.286 85.697  21.118  1.00 31.46 ? 106  GLU C OE1   1 
ATOM   6258  O  OE2   . GLU C  1 78  ? 136.447 84.795  20.288  1.00 30.79 ? 106  GLU C OE2   1 
ATOM   6259  N  N     . VAL C  1 79  ? 139.854 79.523  21.203  1.00 25.82 ? 107  VAL C N     1 
ATOM   6260  C  CA    . VAL C  1 79  ? 140.398 78.576  22.154  1.00 25.55 ? 107  VAL C CA    1 
ATOM   6261  C  C     . VAL C  1 79  ? 141.787 78.111  21.685  1.00 26.07 ? 107  VAL C C     1 
ATOM   6262  O  O     . VAL C  1 79  ? 142.049 78.017  20.491  1.00 24.55 ? 107  VAL C O     1 
ATOM   6263  C  CB    . VAL C  1 79  ? 139.418 77.375  22.363  1.00 25.58 ? 107  VAL C CB    1 
ATOM   6264  C  CG1   . VAL C  1 79  ? 140.018 76.307  23.269  1.00 25.73 ? 107  VAL C CG1   1 
ATOM   6265  C  CG2   . VAL C  1 79  ? 138.073 77.862  22.931  1.00 23.89 ? 107  VAL C CG2   1 
ATOM   6266  N  N     . ASP C  1 80  ? 142.676 77.845  22.640  1.00 26.80 ? 108  ASP C N     1 
ATOM   6267  C  CA    . ASP C  1 80  ? 144.021 77.390  22.322  1.00 28.20 ? 108  ASP C CA    1 
ATOM   6268  C  C     . ASP C  1 80  ? 143.970 76.007  21.653  1.00 28.69 ? 108  ASP C C     1 
ATOM   6269  O  O     . ASP C  1 80  ? 143.158 75.175  22.036  1.00 27.50 ? 108  ASP C O     1 
ATOM   6270  C  CB    . ASP C  1 80  ? 144.886 77.324  23.595  1.00 28.52 ? 108  ASP C CB    1 
ATOM   6271  C  CG    . ASP C  1 80  ? 146.372 77.182  23.293  1.00 30.49 ? 108  ASP C CG    1 
ATOM   6272  O  OD1   . ASP C  1 80  ? 147.059 78.231  23.251  1.00 33.77 ? 108  ASP C OD1   1 
ATOM   6273  O  OD2   . ASP C  1 80  ? 146.852 76.044  23.070  1.00 31.49 ? 108  ASP C OD2   1 
ATOM   6274  N  N     . PRO C  1 81  ? 144.840 75.768  20.634  1.00 30.24 ? 109  PRO C N     1 
ATOM   6275  C  CA    . PRO C  1 81  ? 145.004 74.438  20.033  1.00 30.95 ? 109  PRO C CA    1 
ATOM   6276  C  C     . PRO C  1 81  ? 145.212 73.281  21.026  1.00 31.79 ? 109  PRO C C     1 
ATOM   6277  O  O     . PRO C  1 81  ? 144.783 72.158  20.736  1.00 32.41 ? 109  PRO C O     1 
ATOM   6278  C  CB    . PRO C  1 81  ? 146.236 74.613  19.139  1.00 31.24 ? 109  PRO C CB    1 
ATOM   6279  C  CG    . PRO C  1 81  ? 146.177 76.028  18.729  1.00 31.14 ? 109  PRO C CG    1 
ATOM   6280  C  CD    . PRO C  1 81  ? 145.670 76.771  19.937  1.00 30.21 ? 109  PRO C CD    1 
ATOM   6281  N  N     . GLU C  1 82  ? 145.846 73.540  22.170  1.00 32.29 ? 110  GLU C N     1 
ATOM   6282  C  CA    . GLU C  1 82  ? 146.030 72.506  23.201  1.00 33.14 ? 110  GLU C CA    1 
ATOM   6283  C  C     . GLU C  1 82  ? 144.719 71.893  23.708  1.00 32.79 ? 110  GLU C C     1 
ATOM   6284  O  O     . GLU C  1 82  ? 144.726 70.761  24.219  1.00 32.68 ? 110  GLU C O     1 
ATOM   6285  C  CB    . GLU C  1 82  ? 146.859 73.035  24.385  1.00 33.42 ? 110  GLU C CB    1 
ATOM   6286  C  CG    . GLU C  1 82  ? 146.120 73.935  25.399  1.00 35.07 ? 110  GLU C CG    1 
ATOM   6287  C  CD    . GLU C  1 82  ? 146.993 74.277  26.609  1.00 35.63 ? 110  GLU C CD    1 
ATOM   6288  O  OE1   . GLU C  1 82  ? 147.554 73.341  27.222  1.00 38.94 ? 110  GLU C OE1   1 
ATOM   6289  O  OE2   . GLU C  1 82  ? 147.124 75.479  26.945  1.00 39.75 ? 110  GLU C OE2   1 
ATOM   6290  N  N     . TYR C  1 83  ? 143.617 72.652  23.598  1.00 32.17 ? 111  TYR C N     1 
ATOM   6291  C  CA    . TYR C  1 83  ? 142.277 72.148  23.901  1.00 31.99 ? 111  TYR C CA    1 
ATOM   6292  C  C     . TYR C  1 83  ? 141.441 71.900  22.641  1.00 31.36 ? 111  TYR C C     1 
ATOM   6293  O  O     . TYR C  1 83  ? 140.212 71.891  22.705  1.00 31.43 ? 111  TYR C O     1 
ATOM   6294  C  CB    . TYR C  1 83  ? 141.522 73.126  24.801  1.00 32.18 ? 111  TYR C CB    1 
ATOM   6295  C  CG    . TYR C  1 83  ? 142.272 73.603  26.025  1.00 32.37 ? 111  TYR C CG    1 
ATOM   6296  C  CD1   . TYR C  1 83  ? 142.518 72.754  27.103  1.00 32.94 ? 111  TYR C CD1   1 
ATOM   6297  C  CD2   . TYR C  1 83  ? 142.702 74.923  26.122  1.00 33.05 ? 111  TYR C CD2   1 
ATOM   6298  C  CE1   . TYR C  1 83  ? 143.201 73.211  28.244  1.00 33.30 ? 111  TYR C CE1   1 
ATOM   6299  C  CE2   . TYR C  1 83  ? 143.370 75.384  27.246  1.00 32.71 ? 111  TYR C CE2   1 
ATOM   6300  C  CZ    . TYR C  1 83  ? 143.615 74.534  28.300  1.00 32.95 ? 111  TYR C CZ    1 
ATOM   6301  O  OH    . TYR C  1 83  ? 144.279 75.031  29.398  1.00 32.89 ? 111  TYR C OH    1 
ATOM   6302  N  N     . GLY C  1 84  ? 142.099 71.693  21.501  1.00 30.95 ? 112  GLY C N     1 
ATOM   6303  C  CA    . GLY C  1 84  ? 141.394 71.502  20.223  1.00 31.00 ? 112  GLY C CA    1 
ATOM   6304  C  C     . GLY C  1 84  ? 140.782 72.746  19.587  1.00 30.60 ? 112  GLY C C     1 
ATOM   6305  O  O     . GLY C  1 84  ? 139.951 72.646  18.677  1.00 30.33 ? 112  GLY C O     1 
ATOM   6306  N  N     . GLY C  1 85  ? 141.201 73.923  20.039  1.00 30.43 ? 113  GLY C N     1 
ATOM   6307  C  CA    . GLY C  1 85  ? 140.686 75.179  19.495  1.00 30.19 ? 113  GLY C CA    1 
ATOM   6308  C  C     . GLY C  1 85  ? 141.448 75.664  18.277  1.00 30.43 ? 113  GLY C C     1 
ATOM   6309  O  O     . GLY C  1 85  ? 142.505 75.135  17.933  1.00 29.79 ? 113  GLY C O     1 
ATOM   6310  N  N     . THR C  1 86  ? 140.914 76.686  17.623  1.00 30.64 ? 114  THR C N     1 
ATOM   6311  C  CA    . THR C  1 86  ? 141.531 77.195  16.399  1.00 31.36 ? 114  THR C CA    1 
ATOM   6312  C  C     . THR C  1 86  ? 142.653 78.196  16.689  1.00 30.73 ? 114  THR C C     1 
ATOM   6313  O  O     . THR C  1 86  ? 143.535 78.365  15.864  1.00 31.68 ? 114  THR C O     1 
ATOM   6314  C  CB    . THR C  1 86  ? 140.461 77.766  15.435  1.00 31.65 ? 114  THR C CB    1 
ATOM   6315  O  OG1   . THR C  1 86  ? 139.461 76.760  15.207  1.00 32.69 ? 114  THR C OG1   1 
ATOM   6316  C  CG2   . THR C  1 86  ? 141.081 78.180  14.097  1.00 32.47 ? 114  THR C CG2   1 
ATOM   6317  N  N     . GLY C  1 87  ? 142.633 78.832  17.862  1.00 29.97 ? 115  GLY C N     1 
ATOM   6318  C  CA    . GLY C  1 87  ? 143.663 79.794  18.264  1.00 29.26 ? 115  GLY C CA    1 
ATOM   6319  C  C     . GLY C  1 87  ? 143.626 81.154  17.555  1.00 28.89 ? 115  GLY C C     1 
ATOM   6320  O  O     . GLY C  1 87  ? 144.643 81.861  17.509  1.00 28.49 ? 115  GLY C O     1 
ATOM   6321  N  N     . ALA C  1 88  ? 142.461 81.537  17.035  1.00 27.87 ? 116  ALA C N     1 
ATOM   6322  C  CA    . ALA C  1 88  ? 142.330 82.730  16.184  1.00 27.32 ? 116  ALA C CA    1 
ATOM   6323  C  C     . ALA C  1 88  ? 141.886 83.963  16.973  1.00 27.14 ? 116  ALA C C     1 
ATOM   6324  O  O     . ALA C  1 88  ? 141.640 83.896  18.173  1.00 26.83 ? 116  ALA C O     1 
ATOM   6325  C  CB    . ALA C  1 88  ? 141.363 82.457  15.024  1.00 26.45 ? 116  ALA C CB    1 
ATOM   6326  N  N     . SER C  1 89  ? 141.800 85.087  16.273  1.00 27.24 ? 117  SER C N     1 
ATOM   6327  C  CA    . SER C  1 89  ? 141.510 86.390  16.875  1.00 27.58 ? 117  SER C CA    1 
ATOM   6328  C  C     . SER C  1 89  ? 140.035 86.583  17.185  1.00 26.98 ? 117  SER C C     1 
ATOM   6329  O  O     . SER C  1 89  ? 139.177 85.898  16.633  1.00 26.86 ? 117  SER C O     1 
ATOM   6330  C  CB    . SER C  1 89  ? 141.978 87.509  15.927  1.00 27.48 ? 117  SER C CB    1 
ATOM   6331  O  OG    . SER C  1 89  ? 141.222 87.483  14.731  1.00 28.68 ? 117  SER C OG    1 
ATOM   6332  N  N     . PHE C  1 90  ? 139.729 87.551  18.047  1.00 27.10 ? 118  PHE C N     1 
ATOM   6333  C  CA    . PHE C  1 90  ? 138.340 87.914  18.286  1.00 26.75 ? 118  PHE C CA    1 
ATOM   6334  C  C     . PHE C  1 90  ? 137.645 88.408  17.006  1.00 26.70 ? 118  PHE C C     1 
ATOM   6335  O  O     . PHE C  1 90  ? 136.478 88.101  16.789  1.00 25.24 ? 118  PHE C O     1 
ATOM   6336  C  CB    . PHE C  1 90  ? 138.206 88.953  19.400  1.00 27.26 ? 118  PHE C CB    1 
ATOM   6337  C  CG    . PHE C  1 90  ? 136.802 89.401  19.626  1.00 27.59 ? 118  PHE C CG    1 
ATOM   6338  C  CD1   . PHE C  1 90  ? 135.877 88.542  20.184  1.00 27.71 ? 118  PHE C CD1   1 
ATOM   6339  C  CD2   . PHE C  1 90  ? 136.389 90.670  19.241  1.00 28.20 ? 118  PHE C CD2   1 
ATOM   6340  C  CE1   . PHE C  1 90  ? 134.560 88.937  20.364  1.00 29.51 ? 118  PHE C CE1   1 
ATOM   6341  C  CE2   . PHE C  1 90  ? 135.075 91.072  19.420  1.00 29.03 ? 118  PHE C CE2   1 
ATOM   6342  C  CZ    . PHE C  1 90  ? 134.153 90.205  19.990  1.00 27.57 ? 118  PHE C CZ    1 
ATOM   6343  N  N     . LEU C  1 91  ? 138.347 89.162  16.160  1.00 26.59 ? 119  LEU C N     1 
ATOM   6344  C  CA    . LEU C  1 91  ? 137.756 89.600  14.897  1.00 26.85 ? 119  LEU C CA    1 
ATOM   6345  C  C     . LEU C  1 91  ? 137.399 88.402  13.978  1.00 26.34 ? 119  LEU C C     1 
ATOM   6346  O  O     . LEU C  1 91  ? 136.400 88.444  13.292  1.00 25.63 ? 119  LEU C O     1 
ATOM   6347  C  CB    . LEU C  1 91  ? 138.639 90.634  14.185  1.00 26.79 ? 119  LEU C CB    1 
ATOM   6348  C  CG    . LEU C  1 91  ? 138.023 91.329  12.956  1.00 27.68 ? 119  LEU C CG    1 
ATOM   6349  C  CD1   . LEU C  1 91  ? 136.734 92.075  13.286  1.00 29.80 ? 119  LEU C CD1   1 
ATOM   6350  C  CD2   . LEU C  1 91  ? 139.042 92.270  12.292  1.00 28.32 ? 119  LEU C CD2   1 
ATOM   6351  N  N     . SER C  1 92  ? 138.170 87.316  14.024  1.00 26.35 ? 120  SER C N     1 
ATOM   6352  C  CA    . SER C  1 92  ? 137.781 86.080  13.341  1.00 26.14 ? 120  SER C CA    1 
ATOM   6353  C  C     . SER C  1 92  ? 136.408 85.591  13.800  1.00 25.58 ? 120  SER C C     1 
ATOM   6354  O  O     . SER C  1 92  ? 135.590 85.220  12.982  1.00 25.39 ? 120  SER C O     1 
ATOM   6355  C  CB    . SER C  1 92  ? 138.802 84.951  13.555  1.00 25.95 ? 120  SER C CB    1 
ATOM   6356  O  OG    . SER C  1 92  ? 140.020 85.216  12.894  1.00 26.61 ? 120  SER C OG    1 
ATOM   6357  N  N     . THR C  1 93  ? 136.163 85.584  15.107  1.00 25.18 ? 121  THR C N     1 
ATOM   6358  C  CA    . THR C  1 93  ? 134.875 85.132  15.638  1.00 25.10 ? 121  THR C CA    1 
ATOM   6359  C  C     . THR C  1 93  ? 133.763 86.029  15.082  1.00 24.43 ? 121  THR C C     1 
ATOM   6360  O  O     . THR C  1 93  ? 132.707 85.570  14.652  1.00 23.74 ? 121  THR C O     1 
ATOM   6361  C  CB    . THR C  1 93  ? 134.870 85.183  17.175  1.00 24.86 ? 121  THR C CB    1 
ATOM   6362  O  OG1   . THR C  1 93  ? 135.833 84.264  17.678  1.00 26.89 ? 121  THR C OG1   1 
ATOM   6363  C  CG2   . THR C  1 93  ? 133.512 84.857  17.726  1.00 24.30 ? 121  THR C CG2   1 
ATOM   6364  N  N     . VAL C  1 94  ? 134.027 87.325  15.064  1.00 24.10 ? 122  VAL C N     1 
ATOM   6365  C  CA    . VAL C  1 94  ? 133.078 88.300  14.534  1.00 24.11 ? 122  VAL C CA    1 
ATOM   6366  C  C     . VAL C  1 94  ? 132.751 88.035  13.053  1.00 24.57 ? 122  VAL C C     1 
ATOM   6367  O  O     . VAL C  1 94  ? 131.583 88.014  12.677  1.00 24.42 ? 122  VAL C O     1 
ATOM   6368  C  CB    . VAL C  1 94  ? 133.595 89.755  14.762  1.00 24.12 ? 122  VAL C CB    1 
ATOM   6369  C  CG1   . VAL C  1 94  ? 132.761 90.803  13.981  1.00 24.16 ? 122  VAL C CG1   1 
ATOM   6370  C  CG2   . VAL C  1 94  ? 133.623 90.068  16.236  1.00 24.06 ? 122  VAL C CG2   1 
ATOM   6371  N  N     . LEU C  1 95  ? 133.778 87.831  12.234  1.00 24.71 ? 123  LEU C N     1 
ATOM   6372  C  CA    . LEU C  1 95  ? 133.595 87.541  10.811  1.00 24.88 ? 123  LEU C CA    1 
ATOM   6373  C  C     . LEU C  1 95  ? 132.883 86.201  10.549  1.00 24.68 ? 123  LEU C C     1 
ATOM   6374  O  O     . LEU C  1 95  ? 132.074 86.101  9.626   1.00 24.55 ? 123  LEU C O     1 
ATOM   6375  C  CB    . LEU C  1 95  ? 134.934 87.570  10.076  1.00 25.41 ? 123  LEU C CB    1 
ATOM   6376  C  CG    . LEU C  1 95  ? 135.649 88.933  10.045  1.00 26.82 ? 123  LEU C CG    1 
ATOM   6377  C  CD1   . LEU C  1 95  ? 137.062 88.775  9.524   1.00 26.43 ? 123  LEU C CD1   1 
ATOM   6378  C  CD2   . LEU C  1 95  ? 134.869 89.994  9.243   1.00 25.28 ? 123  LEU C CD2   1 
ATOM   6379  N  N     . VAL C  1 96  ? 133.171 85.194  11.370  1.00 24.20 ? 124  VAL C N     1 
ATOM   6380  C  CA    . VAL C  1 96  ? 132.442 83.931  11.317  1.00 23.31 ? 124  VAL C CA    1 
ATOM   6381  C  C     . VAL C  1 96  ? 130.958 84.143  11.630  1.00 23.50 ? 124  VAL C C     1 
ATOM   6382  O  O     . VAL C  1 96  ? 130.113 83.651  10.904  1.00 23.53 ? 124  VAL C O     1 
ATOM   6383  C  CB    . VAL C  1 96  ? 133.027 82.878  12.289  1.00 23.57 ? 124  VAL C CB    1 
ATOM   6384  C  CG1   . VAL C  1 96  ? 132.160 81.600  12.317  1.00 21.95 ? 124  VAL C CG1   1 
ATOM   6385  C  CG2   . VAL C  1 96  ? 134.448 82.544  11.899  1.00 21.33 ? 124  VAL C CG2   1 
ATOM   6386  N  N     . ILE C  1 97  ? 130.648 84.889  12.683  1.00 23.40 ? 125  ILE C N     1 
ATOM   6387  C  CA    . ILE C  1 97  ? 129.259 85.123  13.049  1.00 24.31 ? 125  ILE C CA    1 
ATOM   6388  C  C     . ILE C  1 97  ? 128.536 85.840  11.895  1.00 24.45 ? 125  ILE C C     1 
ATOM   6389  O  O     . ILE C  1 97  ? 127.442 85.442  11.493  1.00 23.93 ? 125  ILE C O     1 
ATOM   6390  C  CB    . ILE C  1 97  ? 129.107 85.887  14.372  1.00 23.77 ? 125  ILE C CB    1 
ATOM   6391  C  CG1   . ILE C  1 97  ? 129.635 85.046  15.541  1.00 26.19 ? 125  ILE C CG1   1 
ATOM   6392  C  CG2   . ILE C  1 97  ? 127.626 86.217  14.646  1.00 24.28 ? 125  ILE C CG2   1 
ATOM   6393  C  CD1   . ILE C  1 97  ? 129.951 85.877  16.780  1.00 27.55 ? 125  ILE C CD1   1 
ATOM   6394  N  N     . GLU C  1 98  ? 129.189 86.853  11.343  1.00 24.67 ? 126  GLU C N     1 
ATOM   6395  C  CA    . GLU C  1 98  ? 128.609 87.635  10.266  1.00 25.48 ? 126  GLU C CA    1 
ATOM   6396  C  C     . GLU C  1 98  ? 128.361 86.777  9.039   1.00 24.93 ? 126  GLU C C     1 
ATOM   6397  O  O     . GLU C  1 98  ? 127.284 86.820  8.457   1.00 24.59 ? 126  GLU C O     1 
ATOM   6398  C  CB    . GLU C  1 98  ? 129.534 88.796  9.893   1.00 25.18 ? 126  GLU C CB    1 
ATOM   6399  C  CG    . GLU C  1 98  ? 128.939 89.717  8.857   1.00 26.01 ? 126  GLU C CG    1 
ATOM   6400  C  CD    . GLU C  1 98  ? 129.937 90.697  8.283   1.00 26.84 ? 126  GLU C CD    1 
ATOM   6401  O  OE1   . GLU C  1 98  ? 131.063 90.821  8.814   1.00 28.54 ? 126  GLU C OE1   1 
ATOM   6402  O  OE2   . GLU C  1 98  ? 129.575 91.354  7.298   1.00 30.29 ? 126  GLU C OE2   1 
ATOM   6403  N  N     . GLU C  1 99  ? 129.373 86.009  8.654   1.00 25.23 ? 127  GLU C N     1 
ATOM   6404  C  CA    . GLU C  1 99  ? 129.298 85.168  7.472   1.00 26.07 ? 127  GLU C CA    1 
ATOM   6405  C  C     . GLU C  1 99  ? 128.216 84.068  7.621   1.00 25.75 ? 127  GLU C C     1 
ATOM   6406  O  O     . GLU C  1 99  ? 127.462 83.816  6.682   1.00 24.97 ? 127  GLU C O     1 
ATOM   6407  C  CB    . GLU C  1 99  ? 130.658 84.553  7.192   1.00 26.30 ? 127  GLU C CB    1 
ATOM   6408  C  CG    . GLU C  1 99  ? 130.848 84.087  5.777   1.00 29.85 ? 127  GLU C CG    1 
ATOM   6409  C  CD    . GLU C  1 99  ? 130.718 85.214  4.764   1.00 31.04 ? 127  GLU C CD    1 
ATOM   6410  O  OE1   . GLU C  1 99  ? 131.111 86.365  5.056   1.00 31.36 ? 127  GLU C OE1   1 
ATOM   6411  O  OE2   . GLU C  1 99  ? 130.192 84.930  3.684   1.00 32.44 ? 127  GLU C OE2   1 
ATOM   6412  N  N     . LEU C  1 100 ? 128.135 83.437  8.793   1.00 24.98 ? 128  LEU C N     1 
ATOM   6413  C  CA    . LEU C  1 100 ? 127.045 82.491  9.061   1.00 25.10 ? 128  LEU C CA    1 
ATOM   6414  C  C     . LEU C  1 100 ? 125.660 83.146  8.949   1.00 24.77 ? 128  LEU C C     1 
ATOM   6415  O  O     . LEU C  1 100 ? 124.736 82.562  8.378   1.00 24.03 ? 128  LEU C O     1 
ATOM   6416  C  CB    . LEU C  1 100 ? 127.187 81.848  10.443  1.00 24.85 ? 128  LEU C CB    1 
ATOM   6417  C  CG    . LEU C  1 100 ? 128.353 80.881  10.661  1.00 26.03 ? 128  LEU C CG    1 
ATOM   6418  C  CD1   . LEU C  1 100 ? 128.487 80.471  12.146  1.00 22.01 ? 128  LEU C CD1   1 
ATOM   6419  C  CD2   . LEU C  1 100 ? 128.230 79.650  9.732   1.00 25.24 ? 128  LEU C CD2   1 
ATOM   6420  N  N     . ALA C  1 101 ? 125.521 84.357  9.495   1.00 24.43 ? 129  ALA C N     1 
ATOM   6421  C  CA    . ALA C  1 101 ? 124.227 85.002  9.560   1.00 24.86 ? 129  ALA C CA    1 
ATOM   6422  C  C     . ALA C  1 101 ? 123.707 85.455  8.190   1.00 25.33 ? 129  ALA C C     1 
ATOM   6423  O  O     . ALA C  1 101 ? 122.494 85.619  8.034   1.00 24.92 ? 129  ALA C O     1 
ATOM   6424  C  CB    . ALA C  1 101 ? 124.250 86.188  10.561  1.00 24.70 ? 129  ALA C CB    1 
ATOM   6425  N  N     . LYS C  1 102 ? 124.614 85.665  7.223   1.00 25.22 ? 130  LYS C N     1 
ATOM   6426  C  CA    . LYS C  1 102 ? 124.219 85.947  5.838   1.00 25.47 ? 130  LYS C CA    1 
ATOM   6427  C  C     . LYS C  1 102 ? 123.364 84.805  5.267   1.00 24.94 ? 130  LYS C C     1 
ATOM   6428  O  O     . LYS C  1 102 ? 122.536 85.036  4.416   1.00 25.72 ? 130  LYS C O     1 
ATOM   6429  C  CB    . LYS C  1 102 ? 125.434 86.171  4.928   1.00 25.54 ? 130  LYS C CB    1 
ATOM   6430  C  CG    . LYS C  1 102 ? 126.235 87.430  5.197   1.00 25.04 ? 130  LYS C CG    1 
ATOM   6431  C  CD    . LYS C  1 102 ? 127.450 87.516  4.253   1.00 25.24 ? 130  LYS C CD    1 
ATOM   6432  C  CE    . LYS C  1 102 ? 128.368 88.716  4.576   1.00 27.02 ? 130  LYS C CE    1 
ATOM   6433  N  NZ    . LYS C  1 102 ? 129.523 88.806  3.649   1.00 25.75 ? 130  LYS C NZ    1 
ATOM   6434  N  N     . VAL C  1 103 ? 123.573 83.580  5.740   1.00 25.82 ? 131  VAL C N     1 
ATOM   6435  C  CA    . VAL C  1 103 ? 122.771 82.435  5.338   1.00 25.32 ? 131  VAL C CA    1 
ATOM   6436  C  C     . VAL C  1 103 ? 121.657 82.142  6.368   1.00 26.07 ? 131  VAL C C     1 
ATOM   6437  O  O     . VAL C  1 103 ? 120.479 82.018  5.991   1.00 25.87 ? 131  VAL C O     1 
ATOM   6438  C  CB    . VAL C  1 103 ? 123.670 81.198  5.049   1.00 25.86 ? 131  VAL C CB    1 
ATOM   6439  C  CG1   . VAL C  1 103 ? 122.827 79.958  4.716   1.00 24.36 ? 131  VAL C CG1   1 
ATOM   6440  C  CG2   . VAL C  1 103 ? 124.627 81.510  3.915   1.00 24.98 ? 131  VAL C CG2   1 
ATOM   6441  N  N     . ASP C  1 104 ? 122.010 82.069  7.656   1.00 26.24 ? 132  ASP C N     1 
ATOM   6442  C  CA    . ASP C  1 104 ? 121.034 81.727  8.711   1.00 26.33 ? 132  ASP C CA    1 
ATOM   6443  C  C     . ASP C  1 104 ? 121.437 82.296  10.064  1.00 26.23 ? 132  ASP C C     1 
ATOM   6444  O  O     . ASP C  1 104 ? 122.387 81.819  10.711  1.00 25.75 ? 132  ASP C O     1 
ATOM   6445  C  CB    . ASP C  1 104 ? 120.859 80.204  8.821   1.00 26.29 ? 132  ASP C CB    1 
ATOM   6446  C  CG    . ASP C  1 104 ? 119.607 79.793  9.602   1.00 28.19 ? 132  ASP C CG    1 
ATOM   6447  O  OD1   . ASP C  1 104 ? 119.069 80.602  10.398  1.00 27.57 ? 132  ASP C OD1   1 
ATOM   6448  O  OD2   . ASP C  1 104 ? 119.173 78.630  9.438   1.00 31.96 ? 132  ASP C OD2   1 
ATOM   6449  N  N     . ALA C  1 105 ? 120.682 83.305  10.491  1.00 26.18 ? 133  ALA C N     1 
ATOM   6450  C  CA    . ALA C  1 105 ? 120.911 83.975  11.755  1.00 25.74 ? 133  ALA C CA    1 
ATOM   6451  C  C     . ALA C  1 105 ? 120.835 83.002  12.963  1.00 25.40 ? 133  ALA C C     1 
ATOM   6452  O  O     . ALA C  1 105 ? 121.508 83.235  13.962  1.00 25.82 ? 133  ALA C O     1 
ATOM   6453  C  CB    . ALA C  1 105 ? 119.943 85.120  11.922  1.00 25.24 ? 133  ALA C CB    1 
ATOM   6454  N  N     . SER C  1 106 ? 120.025 81.947  12.856  1.00 25.35 ? 134  SER C N     1 
ATOM   6455  C  CA    . SER C  1 106 ? 119.903 80.932  13.911  1.00 25.01 ? 134  SER C CA    1 
ATOM   6456  C  C     . SER C  1 106 ? 121.215 80.181  14.129  1.00 24.77 ? 134  SER C C     1 
ATOM   6457  O  O     . SER C  1 106 ? 121.632 79.942  15.263  1.00 24.94 ? 134  SER C O     1 
ATOM   6458  C  CB    . SER C  1 106 ? 118.781 79.932  13.620  1.00 25.69 ? 134  SER C CB    1 
ATOM   6459  O  OG    . SER C  1 106 ? 117.514 80.552  13.630  1.00 26.30 ? 134  SER C OG    1 
ATOM   6460  N  N     . VAL C  1 107 ? 121.871 79.813  13.049  1.00 24.89 ? 135  VAL C N     1 
ATOM   6461  C  CA    . VAL C  1 107 ? 123.152 79.104  13.157  1.00 25.08 ? 135  VAL C CA    1 
ATOM   6462  C  C     . VAL C  1 107 ? 124.212 80.063  13.681  1.00 24.86 ? 135  VAL C C     1 
ATOM   6463  O  O     . VAL C  1 107 ? 125.073 79.673  14.469  1.00 23.85 ? 135  VAL C O     1 
ATOM   6464  C  CB    . VAL C  1 107 ? 123.564 78.466  11.809  1.00 25.36 ? 135  VAL C CB    1 
ATOM   6465  C  CG1   . VAL C  1 107 ? 124.922 77.736  11.916  1.00 25.38 ? 135  VAL C CG1   1 
ATOM   6466  C  CG2   . VAL C  1 107 ? 122.447 77.468  11.313  1.00 25.57 ? 135  VAL C CG2   1 
ATOM   6467  N  N     . ALA C  1 108 ? 124.147 81.317  13.232  1.00 24.66 ? 136  ALA C N     1 
ATOM   6468  C  CA    . ALA C  1 108 ? 125.066 82.355  13.711  1.00 25.58 ? 136  ALA C CA    1 
ATOM   6469  C  C     . ALA C  1 108 ? 125.013 82.578  15.228  1.00 25.73 ? 136  ALA C C     1 
ATOM   6470  O  O     . ALA C  1 108 ? 126.054 82.623  15.864  1.00 26.72 ? 136  ALA C O     1 
ATOM   6471  C  CB    . ALA C  1 108 ? 124.857 83.668  12.949  1.00 24.97 ? 136  ALA C CB    1 
ATOM   6472  N  N     . VAL C  1 109 ? 123.827 82.697  15.822  1.00 26.11 ? 137  VAL C N     1 
ATOM   6473  C  CA    . VAL C  1 109 ? 123.752 82.867  17.271  1.00 25.80 ? 137  VAL C CA    1 
ATOM   6474  C  C     . VAL C  1 109 ? 124.201 81.616  18.051  1.00 26.02 ? 137  VAL C C     1 
ATOM   6475  O  O     . VAL C  1 109 ? 124.847 81.731  19.093  1.00 25.43 ? 137  VAL C O     1 
ATOM   6476  C  CB    . VAL C  1 109 ? 122.354 83.386  17.744  1.00 26.63 ? 137  VAL C CB    1 
ATOM   6477  C  CG1   . VAL C  1 109 ? 121.270 82.346  17.549  1.00 25.95 ? 137  VAL C CG1   1 
ATOM   6478  C  CG2   . VAL C  1 109 ? 122.437 83.844  19.207  1.00 25.14 ? 137  VAL C CG2   1 
ATOM   6479  N  N     . PHE C  1 110 ? 123.911 80.430  17.516  1.00 26.35 ? 138  PHE C N     1 
ATOM   6480  C  CA    . PHE C  1 110 ? 124.390 79.181  18.086  1.00 26.08 ? 138  PHE C CA    1 
ATOM   6481  C  C     . PHE C  1 110 ? 125.932 79.190  18.218  1.00 26.35 ? 138  PHE C C     1 
ATOM   6482  O  O     . PHE C  1 110 ? 126.486 78.897  19.278  1.00 24.55 ? 138  PHE C O     1 
ATOM   6483  C  CB    . PHE C  1 110 ? 123.864 78.013  17.248  1.00 26.69 ? 138  PHE C CB    1 
ATOM   6484  C  CG    . PHE C  1 110 ? 124.364 76.663  17.664  1.00 26.54 ? 138  PHE C CG    1 
ATOM   6485  C  CD1   . PHE C  1 110 ? 123.870 76.038  18.798  1.00 27.58 ? 138  PHE C CD1   1 
ATOM   6486  C  CD2   . PHE C  1 110 ? 125.307 75.992  16.897  1.00 26.50 ? 138  PHE C CD2   1 
ATOM   6487  C  CE1   . PHE C  1 110 ? 124.335 74.793  19.171  1.00 26.49 ? 138  PHE C CE1   1 
ATOM   6488  C  CE2   . PHE C  1 110 ? 125.770 74.745  17.262  1.00 28.10 ? 138  PHE C CE2   1 
ATOM   6489  C  CZ    . PHE C  1 110 ? 125.288 74.140  18.400  1.00 28.08 ? 138  PHE C CZ    1 
ATOM   6490  N  N     . CYS C  1 111 ? 126.597 79.590  17.145  1.00 27.14 ? 139  CYS C N     1 
ATOM   6491  C  CA    . CYS C  1 111 ? 128.043 79.780  17.136  1.00 27.30 ? 139  CYS C CA    1 
ATOM   6492  C  C     . CYS C  1 111 ? 128.509 80.911  18.086  1.00 26.69 ? 139  CYS C C     1 
ATOM   6493  O  O     . CYS C  1 111 ? 129.503 80.764  18.802  1.00 26.06 ? 139  CYS C O     1 
ATOM   6494  C  CB    . CYS C  1 111 ? 128.481 80.070  15.707  1.00 27.28 ? 139  CYS C CB    1 
ATOM   6495  S  SG    . CYS C  1 111 ? 130.250 80.261  15.490  1.00 30.06 ? 139  CYS C SG    1 
ATOM   6496  N  N     . GLU C  1 112 ? 127.769 82.014  18.095  1.00 26.53 ? 140  GLU C N     1 
ATOM   6497  C  CA    . GLU C  1 112 ? 128.080 83.170  18.940  1.00 27.26 ? 140  GLU C CA    1 
ATOM   6498  C  C     . GLU C  1 112 ? 128.051 82.834  20.435  1.00 26.67 ? 140  GLU C C     1 
ATOM   6499  O  O     . GLU C  1 112 ? 128.960 83.203  21.184  1.00 26.13 ? 140  GLU C O     1 
ATOM   6500  C  CB    . GLU C  1 112 ? 127.114 84.306  18.632  1.00 27.31 ? 140  GLU C CB    1 
ATOM   6501  C  CG    . GLU C  1 112 ? 127.422 85.616  19.345  1.00 30.29 ? 140  GLU C CG    1 
ATOM   6502  C  CD    . GLU C  1 112 ? 126.704 85.804  20.675  1.00 31.91 ? 140  GLU C CD    1 
ATOM   6503  O  OE1   . GLU C  1 112 ? 125.736 85.067  20.963  1.00 30.71 ? 140  GLU C OE1   1 
ATOM   6504  O  OE2   . GLU C  1 112 ? 127.108 86.724  21.434  1.00 36.51 ? 140  GLU C OE2   1 
ATOM   6505  N  N     . ILE C  1 113 ? 127.016 82.128  20.866  1.00 26.79 ? 141  ILE C N     1 
ATOM   6506  C  CA    . ILE C  1 113 ? 126.890 81.786  22.279  1.00 27.20 ? 141  ILE C CA    1 
ATOM   6507  C  C     . ILE C  1 113 ? 128.096 80.948  22.727  1.00 26.96 ? 141  ILE C C     1 
ATOM   6508  O  O     . ILE C  1 113 ? 128.730 81.282  23.726  1.00 26.69 ? 141  ILE C O     1 
ATOM   6509  C  CB    . ILE C  1 113 ? 125.589 81.031  22.576  1.00 27.56 ? 141  ILE C CB    1 
ATOM   6510  C  CG1   . ILE C  1 113 ? 124.370 81.926  22.298  1.00 29.80 ? 141  ILE C CG1   1 
ATOM   6511  C  CG2   . ILE C  1 113 ? 125.587 80.520  24.036  1.00 27.48 ? 141  ILE C CG2   1 
ATOM   6512  C  CD1   . ILE C  1 113 ? 123.087 81.151  21.971  1.00 28.86 ? 141  ILE C CD1   1 
ATOM   6513  N  N     . GLN C  1 114 ? 128.401 79.874  21.990  1.00 26.81 ? 142  GLN C N     1 
ATOM   6514  C  CA    . GLN C  1 114 ? 129.512 78.973  22.334  1.00 27.04 ? 142  GLN C CA    1 
ATOM   6515  C  C     . GLN C  1 114 ? 130.829 79.728  22.454  1.00 27.43 ? 142  GLN C C     1 
ATOM   6516  O  O     . GLN C  1 114 ? 131.528 79.622  23.463  1.00 26.76 ? 142  GLN C O     1 
ATOM   6517  C  CB    . GLN C  1 114 ? 129.660 77.858  21.292  1.00 27.29 ? 142  GLN C CB    1 
ATOM   6518  C  CG    . GLN C  1 114 ? 130.604 76.714  21.705  1.00 27.58 ? 142  GLN C CG    1 
ATOM   6519  C  CD    . GLN C  1 114 ? 129.906 75.586  22.453  1.00 27.28 ? 142  GLN C CD    1 
ATOM   6520  O  OE1   . GLN C  1 114 ? 128.797 75.744  22.959  1.00 27.18 ? 142  GLN C OE1   1 
ATOM   6521  N  NE2   . GLN C  1 114 ? 130.556 74.438  22.510  1.00 27.62 ? 142  GLN C NE2   1 
ATOM   6522  N  N     . ASN C  1 115 ? 131.147 80.514  21.433  1.00 27.36 ? 143  ASN C N     1 
ATOM   6523  C  CA    . ASN C  1 115 ? 132.425 81.216  21.381  1.00 27.88 ? 143  ASN C CA    1 
ATOM   6524  C  C     . ASN C  1 115 ? 132.527 82.396  22.342  1.00 28.89 ? 143  ASN C C     1 
ATOM   6525  O  O     . ASN C  1 115 ? 133.471 82.470  23.128  1.00 28.71 ? 143  ASN C O     1 
ATOM   6526  C  CB    . ASN C  1 115 ? 132.716 81.681  19.949  1.00 27.26 ? 143  ASN C CB    1 
ATOM   6527  C  CG    . ASN C  1 115 ? 133.190 80.549  19.071  1.00 25.75 ? 143  ASN C CG    1 
ATOM   6528  O  OD1   . ASN C  1 115 ? 134.335 80.128  19.179  1.00 24.36 ? 143  ASN C OD1   1 
ATOM   6529  N  ND2   . ASN C  1 115 ? 132.303 80.033  18.209  1.00 23.01 ? 143  ASN C ND2   1 
ATOM   6530  N  N     . THR C  1 116 ? 131.540 83.289  22.305  1.00 29.89 ? 144  THR C N     1 
ATOM   6531  C  CA    . THR C  1 116 ? 131.661 84.586  22.985  1.00 30.92 ? 144  THR C CA    1 
ATOM   6532  C  C     . THR C  1 116 ? 131.180 84.555  24.427  1.00 31.34 ? 144  THR C C     1 
ATOM   6533  O  O     . THR C  1 116 ? 131.677 85.325  25.258  1.00 32.30 ? 144  THR C O     1 
ATOM   6534  C  CB    . THR C  1 116 ? 130.934 85.721  22.233  1.00 31.45 ? 144  THR C CB    1 
ATOM   6535  O  OG1   . THR C  1 116 ? 129.501 85.565  22.373  1.00 35.36 ? 144  THR C OG1   1 
ATOM   6536  C  CG2   . THR C  1 116 ? 131.302 85.709  20.750  1.00 29.75 ? 144  THR C CG2   1 
ATOM   6537  N  N     . LEU C  1 117 ? 130.217 83.691  24.743  1.00 31.08 ? 145  LEU C N     1 
ATOM   6538  C  CA    . LEU C  1 117 ? 129.759 83.593  26.123  1.00 31.06 ? 145  LEU C CA    1 
ATOM   6539  C  C     . LEU C  1 117 ? 130.466 82.435  26.817  1.00 31.31 ? 145  LEU C C     1 
ATOM   6540  O  O     . LEU C  1 117 ? 131.302 82.668  27.701  1.00 32.43 ? 145  LEU C O     1 
ATOM   6541  C  CB    . LEU C  1 117 ? 128.233 83.501  26.223  1.00 31.07 ? 145  LEU C CB    1 
ATOM   6542  C  CG    . LEU C  1 117 ? 127.483 84.645  25.522  1.00 30.56 ? 145  LEU C CG    1 
ATOM   6543  C  CD1   . LEU C  1 117 ? 125.959 84.480  25.664  1.00 30.77 ? 145  LEU C CD1   1 
ATOM   6544  C  CD2   . LEU C  1 117 ? 127.947 86.024  26.018  1.00 30.99 ? 145  LEU C CD2   1 
ATOM   6545  N  N     . ILE C  1 118 ? 130.207 81.214  26.365  1.00 30.16 ? 146  ILE C N     1 
ATOM   6546  C  CA    . ILE C  1 118 ? 130.658 80.007  27.072  1.00 29.76 ? 146  ILE C CA    1 
ATOM   6547  C  C     . ILE C  1 118 ? 132.187 79.855  27.089  1.00 29.49 ? 146  ILE C C     1 
ATOM   6548  O  O     . ILE C  1 118 ? 132.797 79.850  28.150  1.00 28.89 ? 146  ILE C O     1 
ATOM   6549  C  CB    . ILE C  1 118 ? 130.014 78.723  26.487  1.00 29.47 ? 146  ILE C CB    1 
ATOM   6550  C  CG1   . ILE C  1 118 ? 128.480 78.815  26.499  1.00 30.19 ? 146  ILE C CG1   1 
ATOM   6551  C  CG2   . ILE C  1 118 ? 130.493 77.475  27.269  1.00 29.87 ? 146  ILE C CG2   1 
ATOM   6552  C  CD1   . ILE C  1 118 ? 127.878 78.910  27.887  1.00 30.23 ? 146  ILE C CD1   1 
ATOM   6553  N  N     . ASN C  1 119 ? 132.801 79.742  25.913  1.00 29.97 ? 147  ASN C N     1 
ATOM   6554  C  CA    . ASN C  1 119 ? 134.249 79.557  25.825  1.00 30.20 ? 147  ASN C CA    1 
ATOM   6555  C  C     . ASN C  1 119 ? 135.044 80.676  26.491  1.00 30.14 ? 147  ASN C C     1 
ATOM   6556  O  O     . ASN C  1 119 ? 136.007 80.414  27.200  1.00 29.97 ? 147  ASN C O     1 
ATOM   6557  C  CB    . ASN C  1 119 ? 134.708 79.425  24.376  1.00 30.61 ? 147  ASN C CB    1 
ATOM   6558  C  CG    . ASN C  1 119 ? 134.300 78.114  23.737  1.00 30.77 ? 147  ASN C CG    1 
ATOM   6559  O  OD1   . ASN C  1 119 ? 133.763 77.210  24.385  1.00 33.04 ? 147  ASN C OD1   1 
ATOM   6560  N  ND2   . ASN C  1 119 ? 134.565 78.005  22.441  1.00 31.47 ? 147  ASN C ND2   1 
ATOM   6561  N  N     . THR C  1 120 ? 134.640 81.919  26.271  1.00 30.39 ? 148  THR C N     1 
ATOM   6562  C  CA    . THR C  1 120 ? 135.392 83.050  26.811  1.00 30.78 ? 148  THR C CA    1 
ATOM   6563  C  C     . THR C  1 120 ? 135.380 83.046  28.345  1.00 30.27 ? 148  THR C C     1 
ATOM   6564  O  O     . THR C  1 120 ? 136.394 83.330  28.980  1.00 29.61 ? 148  THR C O     1 
ATOM   6565  C  CB    . THR C  1 120 ? 134.841 84.386  26.270  1.00 31.26 ? 148  THR C CB    1 
ATOM   6566  O  OG1   . THR C  1 120 ? 135.016 84.421  24.850  1.00 32.92 ? 148  THR C OG1   1 
ATOM   6567  C  CG2   . THR C  1 120 ? 135.573 85.565  26.877  1.00 31.65 ? 148  THR C CG2   1 
ATOM   6568  N  N     . LEU C  1 121 ? 134.232 82.716  28.933  1.00 29.94 ? 149  LEU C N     1 
ATOM   6569  C  CA    . LEU C  1 121 ? 134.109 82.684  30.390  1.00 29.86 ? 149  LEU C CA    1 
ATOM   6570  C  C     . LEU C  1 121 ? 135.015 81.627  30.994  1.00 29.06 ? 149  LEU C C     1 
ATOM   6571  O  O     . LEU C  1 121 ? 135.708 81.883  31.985  1.00 28.71 ? 149  LEU C O     1 
ATOM   6572  C  CB    . LEU C  1 121 ? 132.661 82.440  30.820  1.00 29.98 ? 149  LEU C CB    1 
ATOM   6573  C  CG    . LEU C  1 121 ? 131.791 83.688  30.867  1.00 32.00 ? 149  LEU C CG    1 
ATOM   6574  C  CD1   . LEU C  1 121 ? 130.334 83.314  31.182  1.00 32.24 ? 149  LEU C CD1   1 
ATOM   6575  C  CD2   . LEU C  1 121 ? 132.349 84.693  31.878  1.00 33.35 ? 149  LEU C CD2   1 
ATOM   6576  N  N     . ILE C  1 122 ? 135.032 80.454  30.376  1.00 29.00 ? 150  ILE C N     1 
ATOM   6577  C  CA    . ILE C  1 122 ? 135.889 79.361  30.838  1.00 29.18 ? 150  ILE C CA    1 
ATOM   6578  C  C     . ILE C  1 122 ? 137.378 79.661  30.592  1.00 29.60 ? 150  ILE C C     1 
ATOM   6579  O  O     . ILE C  1 122 ? 138.211 79.357  31.460  1.00 29.50 ? 150  ILE C O     1 
ATOM   6580  C  CB    . ILE C  1 122 ? 135.443 78.002  30.249  1.00 29.34 ? 150  ILE C CB    1 
ATOM   6581  C  CG1   . ILE C  1 122 ? 134.044 77.651  30.797  1.00 29.40 ? 150  ILE C CG1   1 
ATOM   6582  C  CG2   . ILE C  1 122 ? 136.430 76.883  30.630  1.00 29.34 ? 150  ILE C CG2   1 
ATOM   6583  C  CD1   . ILE C  1 122 ? 133.313 76.548  30.042  1.00 29.02 ? 150  ILE C CD1   1 
ATOM   6584  N  N     . ARG C  1 123 ? 137.705 80.275  29.450  1.00 29.97 ? 151  ARG C N     1 
ATOM   6585  C  CA    . ARG C  1 123 ? 139.097 80.717  29.166  1.00 30.73 ? 151  ARG C CA    1 
ATOM   6586  C  C     . ARG C  1 123 ? 139.597 81.739  30.180  1.00 30.40 ? 151  ARG C C     1 
ATOM   6587  O  O     . ARG C  1 123 ? 140.736 81.656  30.629  1.00 30.87 ? 151  ARG C O     1 
ATOM   6588  C  CB    . ARG C  1 123 ? 139.259 81.331  27.753  1.00 30.67 ? 151  ARG C CB    1 
ATOM   6589  C  CG    A ARG C  1 123 ? 139.106 80.332  26.622  0.33 31.08 ? 151  ARG C CG    1 
ATOM   6590  C  CG    B ARG C  1 123 ? 139.163 80.341  26.603  0.33 30.89 ? 151  ARG C CG    1 
ATOM   6591  C  CG    C ARG C  1 123 ? 139.102 80.307  26.626  0.33 31.45 ? 151  ARG C CG    1 
ATOM   6592  C  CD    A ARG C  1 123 ? 139.197 80.998  25.255  0.33 30.90 ? 151  ARG C CD    1 
ATOM   6593  C  CD    B ARG C  1 123 ? 139.593 80.997  25.295  0.33 30.42 ? 151  ARG C CD    1 
ATOM   6594  C  CD    C ARG C  1 123 ? 139.466 80.791  25.203  0.33 31.70 ? 151  ARG C CD    1 
ATOM   6595  N  NE    A ARG C  1 123 ? 140.582 81.355  24.931  0.33 30.58 ? 151  ARG C NE    1 
ATOM   6596  N  NE    B ARG C  1 123 ? 138.741 82.139  24.969  0.33 29.82 ? 151  ARG C NE    1 
ATOM   6597  N  NE    C ARG C  1 123 ? 139.808 82.210  25.066  0.33 32.34 ? 151  ARG C NE    1 
ATOM   6598  C  CZ    A ARG C  1 123 ? 141.059 82.596  24.819  0.33 31.24 ? 151  ARG C CZ    1 
ATOM   6599  C  CZ    B ARG C  1 123 ? 139.131 83.236  24.318  0.33 28.86 ? 151  ARG C CZ    1 
ATOM   6600  C  CZ    C ARG C  1 123 ? 141.034 82.697  24.849  0.33 32.78 ? 151  ARG C CZ    1 
ATOM   6601  N  NH1   A ARG C  1 123 ? 140.276 83.663  24.975  0.33 30.75 ? 151  ARG C NH1   1 
ATOM   6602  N  NH1   B ARG C  1 123 ? 138.256 84.205  24.100  0.33 28.09 ? 151  ARG C NH1   1 
ATOM   6603  N  NH1   C ARG C  1 123 ? 142.100 81.899  24.751  0.33 32.77 ? 151  ARG C NH1   1 
ATOM   6604  N  NH2   A ARG C  1 123 ? 142.346 82.770  24.526  0.33 30.95 ? 151  ARG C NH2   1 
ATOM   6605  N  NH2   B ARG C  1 123 ? 140.383 83.384  23.893  0.33 28.58 ? 151  ARG C NH2   1 
ATOM   6606  N  NH2   C ARG C  1 123 ? 141.202 84.008  24.729  0.33 32.39 ? 151  ARG C NH2   1 
ATOM   6607  N  N     . LYS C  1 124 ? 138.761 82.717  30.516  1.00 30.58 ? 152  LYS C N     1 
ATOM   6608  C  CA    . LYS C  1 124 ? 139.180 83.829  31.367  1.00 31.48 ? 152  LYS C CA    1 
ATOM   6609  C  C     . LYS C  1 124 ? 139.156 83.516  32.858  1.00 31.37 ? 152  LYS C C     1 
ATOM   6610  O  O     . LYS C  1 124 ? 139.994 84.024  33.594  1.00 30.92 ? 152  LYS C O     1 
ATOM   6611  C  CB    . LYS C  1 124 ? 138.325 85.083  31.123  1.00 32.40 ? 152  LYS C CB    1 
ATOM   6612  C  CG    . LYS C  1 124 ? 138.366 85.660  29.706  1.00 34.62 ? 152  LYS C CG    1 
ATOM   6613  C  CD    . LYS C  1 124 ? 139.780 85.906  29.180  1.00 37.35 ? 152  LYS C CD    1 
ATOM   6614  C  CE    . LYS C  1 124 ? 139.779 86.255  27.684  1.00 37.53 ? 152  LYS C CE    1 
ATOM   6615  N  NZ    . LYS C  1 124 ? 141.118 85.930  27.106  1.00 40.72 ? 152  LYS C NZ    1 
ATOM   6616  N  N     . HIS C  1 125 ? 138.196 82.710  33.305  1.00 30.86 ? 153  HIS C N     1 
ATOM   6617  C  CA    . HIS C  1 125 ? 137.981 82.502  34.742  1.00 31.36 ? 153  HIS C CA    1 
ATOM   6618  C  C     . HIS C  1 125 ? 138.123 81.066  35.223  1.00 30.77 ? 153  HIS C C     1 
ATOM   6619  O  O     . HIS C  1 125 ? 138.146 80.821  36.422  1.00 31.05 ? 153  HIS C O     1 
ATOM   6620  C  CB    . HIS C  1 125 ? 136.622 83.078  35.120  1.00 31.86 ? 153  HIS C CB    1 
ATOM   6621  C  CG    . HIS C  1 125 ? 136.489 84.518  34.755  1.00 32.71 ? 153  HIS C CG    1 
ATOM   6622  N  ND1   . HIS C  1 125 ? 137.319 85.488  35.279  1.00 34.27 ? 153  HIS C ND1   1 
ATOM   6623  C  CD2   . HIS C  1 125 ? 135.670 85.151  33.885  1.00 33.53 ? 153  HIS C CD2   1 
ATOM   6624  C  CE1   . HIS C  1 125 ? 136.995 86.661  34.767  1.00 33.49 ? 153  HIS C CE1   1 
ATOM   6625  N  NE2   . HIS C  1 125 ? 136.000 86.483  33.917  1.00 34.06 ? 153  HIS C NE2   1 
ATOM   6626  N  N     . GLY C  1 126 ? 138.258 80.126  34.297  1.00 30.54 ? 154  GLY C N     1 
ATOM   6627  C  CA    . GLY C  1 126 ? 138.417 78.729  34.639  1.00 30.86 ? 154  GLY C CA    1 
ATOM   6628  C  C     . GLY C  1 126 ? 139.771 78.415  35.241  1.00 31.18 ? 154  GLY C C     1 
ATOM   6629  O  O     . GLY C  1 126 ? 140.770 79.077  34.938  1.00 30.86 ? 154  GLY C O     1 
ATOM   6630  N  N     . THR C  1 127 ? 139.796 77.416  36.122  1.00 31.48 ? 155  THR C N     1 
ATOM   6631  C  CA    . THR C  1 127 ? 141.052 76.875  36.645  1.00 31.83 ? 155  THR C CA    1 
ATOM   6632  C  C     . THR C  1 127 ? 141.671 76.044  35.529  1.00 32.50 ? 155  THR C C     1 
ATOM   6633  O  O     . THR C  1 127 ? 141.013 75.743  34.542  1.00 31.61 ? 155  THR C O     1 
ATOM   6634  C  CB    . THR C  1 127 ? 140.815 75.963  37.869  1.00 31.46 ? 155  THR C CB    1 
ATOM   6635  O  OG1   . THR C  1 127 ? 139.921 74.912  37.502  1.00 30.74 ? 155  THR C OG1   1 
ATOM   6636  C  CG2   . THR C  1 127 ? 140.215 76.745  39.039  1.00 31.20 ? 155  THR C CG2   1 
ATOM   6637  N  N     . GLU C  1 128 ? 142.925 75.649  35.695  1.00 33.65 ? 156  GLU C N     1 
ATOM   6638  C  CA    . GLU C  1 128 ? 143.592 74.814  34.698  1.00 34.73 ? 156  GLU C CA    1 
ATOM   6639  C  C     . GLU C  1 128 ? 142.863 73.483  34.577  1.00 34.78 ? 156  GLU C C     1 
ATOM   6640  O  O     . GLU C  1 128 ? 142.759 72.918  33.496  1.00 34.64 ? 156  GLU C O     1 
ATOM   6641  C  CB    . GLU C  1 128 ? 145.056 74.589  35.080  1.00 35.56 ? 156  GLU C CB    1 
ATOM   6642  C  CG    . GLU C  1 128 ? 145.869 75.872  35.152  1.00 38.25 ? 156  GLU C CG    1 
ATOM   6643  C  CD    . GLU C  1 128 ? 146.467 76.266  33.817  1.00 41.64 ? 156  GLU C CD    1 
ATOM   6644  O  OE1   . GLU C  1 128 ? 147.599 75.803  33.523  1.00 44.17 ? 156  GLU C OE1   1 
ATOM   6645  O  OE2   . GLU C  1 128 ? 145.825 77.052  33.080  1.00 42.83 ? 156  GLU C OE2   1 
ATOM   6646  N  N     . GLU C  1 129 ? 142.341 73.020  35.710  1.00 35.28 ? 157  GLU C N     1 
ATOM   6647  C  CA    . GLU C  1 129 ? 141.553 71.801  35.808  1.00 35.47 ? 157  GLU C CA    1 
ATOM   6648  C  C     . GLU C  1 129 ? 140.245 71.897  35.009  1.00 34.90 ? 157  GLU C C     1 
ATOM   6649  O  O     . GLU C  1 129 ? 139.901 70.998  34.229  1.00 34.37 ? 157  GLU C O     1 
ATOM   6650  C  CB    . GLU C  1 129 ? 141.239 71.501  37.293  1.00 36.12 ? 157  GLU C CB    1 
ATOM   6651  C  CG    . GLU C  1 129 ? 142.469 71.522  38.254  1.00 38.92 ? 157  GLU C CG    1 
ATOM   6652  C  CD    . GLU C  1 129 ? 142.647 72.848  39.049  1.00 41.97 ? 157  GLU C CD    1 
ATOM   6653  O  OE1   . GLU C  1 129 ? 142.003 73.010  40.129  1.00 42.66 ? 157  GLU C OE1   1 
ATOM   6654  O  OE2   . GLU C  1 129 ? 143.461 73.704  38.615  1.00 41.51 ? 157  GLU C OE2   1 
ATOM   6655  N  N     . GLN C  1 130 ? 139.510 72.982  35.224  1.00 34.35 ? 158  GLN C N     1 
ATOM   6656  C  CA    . GLN C  1 130 ? 138.251 73.231  34.506  1.00 34.08 ? 158  GLN C CA    1 
ATOM   6657  C  C     . GLN C  1 130 ? 138.453 73.406  32.993  1.00 33.89 ? 158  GLN C C     1 
ATOM   6658  O  O     . GLN C  1 130 ? 137.681 72.879  32.197  1.00 33.47 ? 158  GLN C O     1 
ATOM   6659  C  CB    . GLN C  1 130 ? 137.543 74.455  35.090  1.00 33.81 ? 158  GLN C CB    1 
ATOM   6660  C  CG    . GLN C  1 130 ? 136.996 74.199  36.499  1.00 34.31 ? 158  GLN C CG    1 
ATOM   6661  C  CD    . GLN C  1 130 ? 136.491 75.446  37.197  1.00 33.03 ? 158  GLN C CD    1 
ATOM   6662  O  OE1   . GLN C  1 130 ? 136.975 76.551  36.961  1.00 32.34 ? 158  GLN C OE1   1 
ATOM   6663  N  NE2   . GLN C  1 130 ? 135.525 75.266  38.091  1.00 32.11 ? 158  GLN C NE2   1 
ATOM   6664  N  N     . LYS C  1 131 ? 139.492 74.144  32.618  1.00 33.91 ? 159  LYS C N     1 
ATOM   6665  C  CA    . LYS C  1 131 ? 139.855 74.332  31.211  1.00 34.37 ? 159  LYS C CA    1 
ATOM   6666  C  C     . LYS C  1 131 ? 140.236 73.011  30.546  1.00 33.91 ? 159  LYS C C     1 
ATOM   6667  O  O     . LYS C  1 131 ? 139.782 72.713  29.445  1.00 33.64 ? 159  LYS C O     1 
ATOM   6668  C  CB    . LYS C  1 131 ? 141.002 75.338  31.091  1.00 34.22 ? 159  LYS C CB    1 
ATOM   6669  C  CG    . LYS C  1 131 ? 140.605 76.747  31.510  1.00 35.61 ? 159  LYS C CG    1 
ATOM   6670  C  CD    . LYS C  1 131 ? 141.554 77.828  30.998  1.00 36.09 ? 159  LYS C CD    1 
ATOM   6671  C  CE    . LYS C  1 131 ? 142.575 78.258  32.019  1.00 39.59 ? 159  LYS C CE    1 
ATOM   6672  N  NZ    . LYS C  1 131 ? 142.984 79.675  31.772  1.00 40.86 ? 159  LYS C NZ    1 
ATOM   6673  N  N     . ALA C  1 132 ? 141.055 72.216  31.231  1.00 33.68 ? 160  ALA C N     1 
ATOM   6674  C  CA    . ALA C  1 132 ? 141.482 70.902  30.728  1.00 33.45 ? 160  ALA C CA    1 
ATOM   6675  C  C     . ALA C  1 132 ? 140.302 69.948  30.554  1.00 33.05 ? 160  ALA C C     1 
ATOM   6676  O  O     . ALA C  1 132 ? 140.300 69.114  29.656  1.00 33.11 ? 160  ALA C O     1 
ATOM   6677  C  CB    . ALA C  1 132 ? 142.529 70.279  31.671  1.00 33.28 ? 160  ALA C CB    1 
ATOM   6678  N  N     . THR C  1 133 ? 139.310 70.073  31.430  1.00 32.53 ? 161  THR C N     1 
ATOM   6679  C  CA    . THR C  1 133 ? 138.108 69.249  31.378  1.00 32.12 ? 161  THR C CA    1 
ATOM   6680  C  C     . THR C  1 133 ? 137.127 69.696  30.278  1.00 31.57 ? 161  THR C C     1 
ATOM   6681  O  O     . THR C  1 133 ? 136.724 68.903  29.423  1.00 30.62 ? 161  THR C O     1 
ATOM   6682  C  CB    . THR C  1 133 ? 137.377 69.282  32.742  1.00 31.90 ? 161  THR C CB    1 
ATOM   6683  O  OG1   . THR C  1 133 ? 138.289 68.894  33.780  1.00 33.20 ? 161  THR C OG1   1 
ATOM   6684  C  CG2   . THR C  1 133 ? 136.170 68.347  32.742  1.00 32.53 ? 161  THR C CG2   1 
ATOM   6685  N  N     . TYR C  1 134 ? 136.743 70.968  30.303  1.00 31.51 ? 162  TYR C N     1 
ATOM   6686  C  CA    . TYR C  1 134 ? 135.605 71.424  29.505  1.00 31.49 ? 162  TYR C CA    1 
ATOM   6687  C  C     . TYR C  1 134 ? 135.960 71.912  28.097  1.00 30.52 ? 162  TYR C C     1 
ATOM   6688  O  O     . TYR C  1 134 ? 135.226 71.645  27.152  1.00 29.95 ? 162  TYR C O     1 
ATOM   6689  C  CB    . TYR C  1 134 ? 134.826 72.505  30.262  1.00 32.52 ? 162  TYR C CB    1 
ATOM   6690  C  CG    . TYR C  1 134 ? 134.018 71.944  31.415  1.00 33.28 ? 162  TYR C CG    1 
ATOM   6691  C  CD1   . TYR C  1 134 ? 132.933 71.119  31.171  1.00 34.29 ? 162  TYR C CD1   1 
ATOM   6692  C  CD2   . TYR C  1 134 ? 134.348 72.223  32.741  1.00 34.75 ? 162  TYR C CD2   1 
ATOM   6693  C  CE1   . TYR C  1 134 ? 132.178 70.587  32.207  1.00 35.65 ? 162  TYR C CE1   1 
ATOM   6694  C  CE2   . TYR C  1 134 ? 133.589 71.678  33.811  1.00 35.06 ? 162  TYR C CE2   1 
ATOM   6695  C  CZ    . TYR C  1 134 ? 132.505 70.869  33.525  1.00 35.16 ? 162  TYR C CZ    1 
ATOM   6696  O  OH    . TYR C  1 134 ? 131.712 70.320  34.526  1.00 36.26 ? 162  TYR C OH    1 
ATOM   6697  N  N     . LEU C  1 135 ? 137.071 72.622  27.954  1.00 29.75 ? 163  LEU C N     1 
ATOM   6698  C  CA    . LEU C  1 135 ? 137.398 73.214  26.657  1.00 28.97 ? 163  LEU C CA    1 
ATOM   6699  C  C     . LEU C  1 135 ? 137.578 72.186  25.533  1.00 28.63 ? 163  LEU C C     1 
ATOM   6700  O  O     . LEU C  1 135 ? 137.036 72.386  24.447  1.00 28.44 ? 163  LEU C O     1 
ATOM   6701  C  CB    . LEU C  1 135 ? 138.579 74.163  26.760  1.00 28.79 ? 163  LEU C CB    1 
ATOM   6702  C  CG    . LEU C  1 135 ? 138.326 75.466  27.516  1.00 28.46 ? 163  LEU C CG    1 
ATOM   6703  C  CD1   . LEU C  1 135 ? 139.618 76.261  27.619  1.00 27.56 ? 163  LEU C CD1   1 
ATOM   6704  C  CD2   . LEU C  1 135 ? 137.232 76.322  26.878  1.00 28.65 ? 163  LEU C CD2   1 
ATOM   6705  N  N     . PRO C  1 136 ? 138.310 71.086  25.781  1.00 28.93 ? 164  PRO C N     1 
ATOM   6706  C  CA    . PRO C  1 136 ? 138.354 70.008  24.786  1.00 28.73 ? 164  PRO C CA    1 
ATOM   6707  C  C     . PRO C  1 136 ? 136.995 69.482  24.346  1.00 28.61 ? 164  PRO C C     1 
ATOM   6708  O  O     . PRO C  1 136 ? 136.836 69.150  23.169  1.00 29.29 ? 164  PRO C O     1 
ATOM   6709  C  CB    . PRO C  1 136 ? 139.158 68.918  25.490  1.00 29.01 ? 164  PRO C CB    1 
ATOM   6710  C  CG    . PRO C  1 136 ? 140.061 69.672  26.383  1.00 29.30 ? 164  PRO C CG    1 
ATOM   6711  C  CD    . PRO C  1 136 ? 139.212 70.797  26.912  1.00 28.62 ? 164  PRO C CD    1 
ATOM   6712  N  N     . GLN C  1 137 ? 136.027 69.414  25.259  1.00 27.70 ? 165  GLN C N     1 
ATOM   6713  C  CA    . GLN C  1 137 ? 134.668 68.974  24.916  1.00 27.68 ? 165  GLN C CA    1 
ATOM   6714  C  C     . GLN C  1 137 ? 133.924 70.062  24.140  1.00 26.86 ? 165  GLN C C     1 
ATOM   6715  O  O     . GLN C  1 137 ? 133.214 69.786  23.188  1.00 26.68 ? 165  GLN C O     1 
ATOM   6716  C  CB    . GLN C  1 137 ? 133.858 68.648  26.179  1.00 27.33 ? 165  GLN C CB    1 
ATOM   6717  C  CG    . GLN C  1 137 ? 134.394 67.485  27.043  1.00 28.71 ? 165  GLN C CG    1 
ATOM   6718  C  CD    . GLN C  1 137 ? 133.638 67.347  28.372  1.00 29.60 ? 165  GLN C CD    1 
ATOM   6719  O  OE1   . GLN C  1 137 ? 132.877 68.242  28.775  1.00 33.38 ? 165  GLN C OE1   1 
ATOM   6720  N  NE2   . GLN C  1 137 ? 133.838 66.220  29.052  1.00 32.13 ? 165  GLN C NE2   1 
ATOM   6721  N  N     . LEU C  1 138 ? 134.072 71.298  24.594  1.00 26.33 ? 166  LEU C N     1 
ATOM   6722  C  CA    . LEU C  1 138 ? 133.400 72.441  23.982  1.00 26.07 ? 166  LEU C CA    1 
ATOM   6723  C  C     . LEU C  1 138 ? 133.902 72.759  22.563  1.00 26.25 ? 166  LEU C C     1 
ATOM   6724  O  O     . LEU C  1 138 ? 133.187 73.334  21.763  1.00 25.59 ? 166  LEU C O     1 
ATOM   6725  C  CB    . LEU C  1 138 ? 133.568 73.664  24.877  1.00 25.70 ? 166  LEU C CB    1 
ATOM   6726  C  CG    . LEU C  1 138 ? 132.794 73.630  26.197  1.00 25.58 ? 166  LEU C CG    1 
ATOM   6727  C  CD1   . LEU C  1 138 ? 133.279 74.751  27.113  1.00 24.87 ? 166  LEU C CD1   1 
ATOM   6728  C  CD2   . LEU C  1 138 ? 131.299 73.731  25.988  1.00 26.72 ? 166  LEU C CD2   1 
ATOM   6729  N  N     . THR C  1 139 ? 135.137 72.392  22.257  1.00 27.59 ? 167  THR C N     1 
ATOM   6730  C  CA    . THR C  1 139 ? 135.664 72.602  20.905  1.00 28.22 ? 167  THR C CA    1 
ATOM   6731  C  C     . THR C  1 139 ? 135.337 71.455  19.952  1.00 28.75 ? 167  THR C C     1 
ATOM   6732  O  O     . THR C  1 139 ? 135.488 71.604  18.739  1.00 29.34 ? 167  THR C O     1 
ATOM   6733  C  CB    . THR C  1 139 ? 137.175 72.821  20.925  1.00 27.93 ? 167  THR C CB    1 
ATOM   6734  O  OG1   . THR C  1 139 ? 137.837 71.641  21.406  1.00 28.28 ? 167  THR C OG1   1 
ATOM   6735  C  CG2   . THR C  1 139 ? 137.513 74.014  21.811  1.00 28.19 ? 167  THR C CG2   1 
ATOM   6736  N  N     . THR C  1 140 ? 134.877 70.325  20.489  1.00 29.61 ? 168  THR C N     1 
ATOM   6737  C  CA    . THR C  1 140 ? 134.692 69.106  19.688  1.00 30.11 ? 168  THR C CA    1 
ATOM   6738  C  C     . THR C  1 140 ? 133.251 68.611  19.533  1.00 29.88 ? 168  THR C C     1 
ATOM   6739  O  O     . THR C  1 140 ? 132.877 68.184  18.445  1.00 28.80 ? 168  THR C O     1 
ATOM   6740  C  CB    . THR C  1 140 ? 135.562 67.949  20.235  1.00 30.43 ? 168  THR C CB    1 
ATOM   6741  O  OG1   . THR C  1 140 ? 135.353 67.802  21.648  1.00 31.94 ? 168  THR C OG1   1 
ATOM   6742  C  CG2   . THR C  1 140 ? 137.023 68.237  19.971  1.00 31.57 ? 168  THR C CG2   1 
ATOM   6743  N  N     . GLU C  1 141 ? 132.460 68.612  20.609  1.00 30.19 ? 169  GLU C N     1 
ATOM   6744  C  CA    . GLU C  1 141 ? 131.084 68.065  20.543  1.00 30.79 ? 169  GLU C CA    1 
ATOM   6745  C  C     . GLU C  1 141 ? 130.069 68.548  21.586  1.00 29.81 ? 169  GLU C C     1 
ATOM   6746  O  O     . GLU C  1 141 ? 128.886 68.448  21.324  1.00 29.94 ? 169  GLU C O     1 
ATOM   6747  C  CB    . GLU C  1 141 ? 131.069 66.517  20.517  1.00 31.21 ? 169  GLU C CB    1 
ATOM   6748  C  CG    . GLU C  1 141 ? 131.493 65.810  21.797  1.00 33.37 ? 169  GLU C CG    1 
ATOM   6749  C  CD    . GLU C  1 141 ? 131.278 64.270  21.759  1.00 33.69 ? 169  GLU C CD    1 
ATOM   6750  O  OE1   . GLU C  1 141 ? 130.139 63.798  22.022  1.00 36.97 ? 169  GLU C OE1   1 
ATOM   6751  O  OE2   . GLU C  1 141 ? 132.260 63.527  21.505  1.00 38.83 ? 169  GLU C OE2   1 
ATOM   6752  N  N     . LYS C  1 142 ? 130.509 69.041  22.745  1.00 28.69 ? 170  LYS C N     1 
ATOM   6753  C  CA    . LYS C  1 142 ? 129.580 69.528  23.777  1.00 27.68 ? 170  LYS C CA    1 
ATOM   6754  C  C     . LYS C  1 142 ? 129.119 70.977  23.555  1.00 27.30 ? 170  LYS C C     1 
ATOM   6755  O  O     . LYS C  1 142 ? 129.932 71.880  23.361  1.00 26.38 ? 170  LYS C O     1 
ATOM   6756  C  CB    . LYS C  1 142 ? 130.220 69.421  25.153  1.00 27.88 ? 170  LYS C CB    1 
ATOM   6757  C  CG    . LYS C  1 142 ? 129.289 69.768  26.308  1.00 27.28 ? 170  LYS C CG    1 
ATOM   6758  C  CD    . LYS C  1 142 ? 129.890 69.378  27.633  1.00 26.82 ? 170  LYS C CD    1 
ATOM   6759  C  CE    . LYS C  1 142 ? 129.747 67.889  27.924  1.00 26.86 ? 170  LYS C CE    1 
ATOM   6760  N  NZ    . LYS C  1 142 ? 130.228 67.553  29.301  1.00 26.71 ? 170  LYS C NZ    1 
ATOM   6761  N  N     . VAL C  1 143 ? 127.806 71.176  23.633  1.00 27.24 ? 171  VAL C N     1 
ATOM   6762  C  CA    . VAL C  1 143 ? 127.187 72.493  23.555  1.00 27.07 ? 171  VAL C CA    1 
ATOM   6763  C  C     . VAL C  1 143 ? 126.943 73.068  24.951  1.00 26.94 ? 171  VAL C C     1 
ATOM   6764  O  O     . VAL C  1 143 ? 126.485 72.372  25.845  1.00 26.62 ? 171  VAL C O     1 
ATOM   6765  C  CB    . VAL C  1 143 ? 125.848 72.418  22.772  1.00 27.20 ? 171  VAL C CB    1 
ATOM   6766  C  CG1   . VAL C  1 143 ? 125.017 73.730  22.905  1.00 26.03 ? 171  VAL C CG1   1 
ATOM   6767  C  CG2   . VAL C  1 143 ? 126.110 72.072  21.314  1.00 26.94 ? 171  VAL C CG2   1 
ATOM   6768  N  N     . GLY C  1 144 ? 127.249 74.349  25.123  1.00 27.03 ? 172  GLY C N     1 
ATOM   6769  C  CA    . GLY C  1 144 ? 126.966 75.038  26.360  1.00 26.85 ? 172  GLY C CA    1 
ATOM   6770  C  C     . GLY C  1 144 ? 125.832 76.044  26.255  1.00 26.90 ? 172  GLY C C     1 
ATOM   6771  O  O     . GLY C  1 144 ? 125.575 76.619  25.189  1.00 27.46 ? 172  GLY C O     1 
ATOM   6772  N  N     . SER C  1 145 ? 125.152 76.254  27.379  1.00 26.43 ? 173  SER C N     1 
ATOM   6773  C  CA    . SER C  1 145 ? 124.101 77.252  27.499  1.00 26.27 ? 173  SER C CA    1 
ATOM   6774  C  C     . SER C  1 145 ? 124.484 78.242  28.604  1.00 26.17 ? 173  SER C C     1 
ATOM   6775  O  O     . SER C  1 145 ? 124.982 77.852  29.656  1.00 25.29 ? 173  SER C O     1 
ATOM   6776  C  CB    . SER C  1 145 ? 122.763 76.593  27.835  1.00 26.12 ? 173  SER C CB    1 
ATOM   6777  O  OG    . SER C  1 145 ? 122.148 76.010  26.708  1.00 25.99 ? 173  SER C OG    1 
ATOM   6778  N  N     . PHE C  1 146 ? 124.239 79.516  28.326  1.00 26.78 ? 174  PHE C N     1 
ATOM   6779  C  CA    . PHE C  1 146 ? 124.463 80.629  29.229  1.00 26.79 ? 174  PHE C CA    1 
ATOM   6780  C  C     . PHE C  1 146 ? 123.136 80.936  29.939  1.00 26.95 ? 174  PHE C C     1 
ATOM   6781  O  O     . PHE C  1 146 ? 122.172 81.349  29.309  1.00 25.29 ? 174  PHE C O     1 
ATOM   6782  C  CB    . PHE C  1 146 ? 124.930 81.829  28.396  1.00 27.88 ? 174  PHE C CB    1 
ATOM   6783  C  CG    . PHE C  1 146 ? 125.206 83.074  29.189  1.00 28.06 ? 174  PHE C CG    1 
ATOM   6784  C  CD1   . PHE C  1 146 ? 126.393 83.225  29.862  1.00 30.52 ? 174  PHE C CD1   1 
ATOM   6785  C  CD2   . PHE C  1 146 ? 124.293 84.117  29.204  1.00 29.58 ? 174  PHE C CD2   1 
ATOM   6786  C  CE1   . PHE C  1 146 ? 126.677 84.396  30.567  1.00 31.17 ? 174  PHE C CE1   1 
ATOM   6787  C  CE2   . PHE C  1 146 ? 124.553 85.280  29.909  1.00 31.46 ? 174  PHE C CE2   1 
ATOM   6788  C  CZ    . PHE C  1 146 ? 125.764 85.425  30.586  1.00 30.67 ? 174  PHE C CZ    1 
ATOM   6789  N  N     . CYS C  1 147 ? 123.097 80.736  31.258  1.00 27.14 ? 175  CYS C N     1 
ATOM   6790  C  CA    . CYS C  1 147 ? 121.842 80.785  32.003  1.00 27.51 ? 175  CYS C CA    1 
ATOM   6791  C  C     . CYS C  1 147 ? 121.809 81.933  32.991  1.00 27.54 ? 175  CYS C C     1 
ATOM   6792  O  O     . CYS C  1 147 ? 122.228 81.799  34.152  1.00 28.01 ? 175  CYS C O     1 
ATOM   6793  C  CB    . CYS C  1 147 ? 121.587 79.443  32.711  1.00 27.36 ? 175  CYS C CB    1 
ATOM   6794  S  SG    . CYS C  1 147 ? 121.806 77.981  31.659  1.00 27.98 ? 175  CYS C SG    1 
ATOM   6795  N  N     . LEU C  1 148 ? 121.310 83.073  32.518  1.00 28.37 ? 176  LEU C N     1 
ATOM   6796  C  CA    . LEU C  1 148 ? 121.156 84.265  33.347  1.00 28.38 ? 176  LEU C CA    1 
ATOM   6797  C  C     . LEU C  1 148 ? 119.676 84.629  33.624  1.00 28.86 ? 176  LEU C C     1 
ATOM   6798  O  O     . LEU C  1 148 ? 119.246 84.752  34.796  1.00 28.37 ? 176  LEU C O     1 
ATOM   6799  C  CB    . LEU C  1 148 ? 121.871 85.439  32.667  1.00 28.34 ? 176  LEU C CB    1 
ATOM   6800  C  CG    . LEU C  1 148 ? 121.879 86.779  33.384  1.00 27.84 ? 176  LEU C CG    1 
ATOM   6801  C  CD1   . LEU C  1 148 ? 122.446 86.643  34.773  1.00 25.69 ? 176  LEU C CD1   1 
ATOM   6802  C  CD2   . LEU C  1 148 ? 122.660 87.819  32.542  1.00 28.25 ? 176  LEU C CD2   1 
ATOM   6803  N  N     . SER C  1 149 ? 118.919 84.799  32.544  1.00 29.02 ? 177  SER C N     1 
ATOM   6804  C  CA    . SER C  1 149 ? 117.571 85.386  32.596  1.00 28.98 ? 177  SER C CA    1 
ATOM   6805  C  C     . SER C  1 149 ? 116.531 84.485  33.256  1.00 29.30 ? 177  SER C C     1 
ATOM   6806  O  O     . SER C  1 149 ? 116.591 83.241  33.156  1.00 28.64 ? 177  SER C O     1 
ATOM   6807  C  CB    . SER C  1 149 ? 117.071 85.729  31.186  1.00 29.06 ? 177  SER C CB    1 
ATOM   6808  O  OG    . SER C  1 149 ? 117.957 86.596  30.495  1.00 28.31 ? 177  SER C OG    1 
ATOM   6809  N  N     . GLU C  1 150 ? 115.597 85.148  33.933  1.00 29.42 ? 178  GLU C N     1 
ATOM   6810  C  CA    . GLU C  1 150 ? 114.431 84.535  34.557  1.00 30.04 ? 178  GLU C CA    1 
ATOM   6811  C  C     . GLU C  1 150 ? 113.174 85.328  34.188  1.00 30.52 ? 178  GLU C C     1 
ATOM   6812  O  O     . GLU C  1 150 ? 113.253 86.465  33.711  1.00 30.80 ? 178  GLU C O     1 
ATOM   6813  C  CB    . GLU C  1 150 ? 114.601 84.501  36.077  1.00 29.63 ? 178  GLU C CB    1 
ATOM   6814  C  CG    . GLU C  1 150 ? 115.966 83.936  36.493  1.00 30.25 ? 178  GLU C CG    1 
ATOM   6815  C  CD    . GLU C  1 150 ? 116.126 83.749  37.977  1.00 29.80 ? 178  GLU C CD    1 
ATOM   6816  O  OE1   . GLU C  1 150 ? 115.264 84.237  38.739  1.00 29.69 ? 178  GLU C OE1   1 
ATOM   6817  O  OE2   . GLU C  1 150 ? 117.128 83.120  38.387  1.00 29.97 ? 178  GLU C OE2   1 
ATOM   6818  N  N     . ALA C  1 151 ? 112.022 84.714  34.411  1.00 30.99 ? 179  ALA C N     1 
ATOM   6819  C  CA    . ALA C  1 151 ? 110.730 85.353  34.175  1.00 31.55 ? 179  ALA C CA    1 
ATOM   6820  C  C     . ALA C  1 151 ? 110.631 86.712  34.866  1.00 31.36 ? 179  ALA C C     1 
ATOM   6821  O  O     . ALA C  1 151 ? 110.102 87.650  34.290  1.00 31.76 ? 179  ALA C O     1 
ATOM   6822  C  CB    . ALA C  1 151 ? 109.579 84.431  34.619  1.00 31.36 ? 179  ALA C CB    1 
ATOM   6823  N  N     . GLY C  1 152 ? 111.152 86.815  36.085  1.00 31.31 ? 180  GLY C N     1 
ATOM   6824  C  CA    . GLY C  1 152 ? 111.150 88.074  36.819  1.00 31.41 ? 180  GLY C CA    1 
ATOM   6825  C  C     . GLY C  1 152 ? 112.444 88.876  36.718  1.00 31.25 ? 180  GLY C C     1 
ATOM   6826  O  O     . GLY C  1 152 ? 112.608 89.865  37.424  1.00 31.77 ? 180  GLY C O     1 
ATOM   6827  N  N     . ALA C  1 153 ? 113.363 88.442  35.854  1.00 31.05 ? 181  ALA C N     1 
ATOM   6828  C  CA    . ALA C  1 153 ? 114.691 89.048  35.714  1.00 30.61 ? 181  ALA C CA    1 
ATOM   6829  C  C     . ALA C  1 153 ? 115.143 88.955  34.258  1.00 30.73 ? 181  ALA C C     1 
ATOM   6830  O  O     . ALA C  1 153 ? 115.916 88.057  33.881  1.00 30.10 ? 181  ALA C O     1 
ATOM   6831  C  CB    . ALA C  1 153 ? 115.697 88.355  36.646  1.00 30.14 ? 181  ALA C CB    1 
ATOM   6832  N  N     . GLY C  1 154 ? 114.602 89.869  33.442  1.00 30.77 ? 182  GLY C N     1 
ATOM   6833  C  CA    . GLY C  1 154 ? 114.958 90.005  32.038  1.00 30.58 ? 182  GLY C CA    1 
ATOM   6834  C  C     . GLY C  1 154 ? 115.994 91.104  31.875  1.00 30.72 ? 182  GLY C C     1 
ATOM   6835  O  O     . GLY C  1 154 ? 117.203 90.854  32.009  1.00 30.56 ? 182  GLY C O     1 
ATOM   6836  N  N     . SER C  1 155 ? 115.533 92.323  31.604  1.00 30.28 ? 183  SER C N     1 
ATOM   6837  C  CA    . SER C  1 155 ? 116.431 93.489  31.557  1.00 30.12 ? 183  SER C CA    1 
ATOM   6838  C  C     . SER C  1 155 ? 117.102 93.674  32.926  1.00 29.75 ? 183  SER C C     1 
ATOM   6839  O  O     . SER C  1 155 ? 118.265 94.028  33.007  1.00 29.73 ? 183  SER C O     1 
ATOM   6840  C  CB    . SER C  1 155 ? 115.665 94.761  31.163  1.00 30.13 ? 183  SER C CB    1 
ATOM   6841  O  OG    . SER C  1 155 ? 115.032 94.609  29.908  1.00 30.17 ? 183  SER C OG    1 
ATOM   6842  N  N     . ASP C  1 156 ? 116.353 93.392  33.990  1.00 29.41 ? 184  ASP C N     1 
ATOM   6843  C  CA    . ASP C  1 156 ? 116.832 93.450  35.371  1.00 29.61 ? 184  ASP C CA    1 
ATOM   6844  C  C     . ASP C  1 156 ? 117.434 92.084  35.756  1.00 29.50 ? 184  ASP C C     1 
ATOM   6845  O  O     . ASP C  1 156 ? 116.951 91.406  36.671  1.00 29.23 ? 184  ASP C O     1 
ATOM   6846  C  CB    . ASP C  1 156 ? 115.658 93.843  36.284  1.00 29.55 ? 184  ASP C CB    1 
ATOM   6847  C  CG    . ASP C  1 156 ? 116.076 94.161  37.714  1.00 30.51 ? 184  ASP C CG    1 
ATOM   6848  O  OD1   . ASP C  1 156 ? 117.296 94.261  38.001  1.00 29.29 ? 184  ASP C OD1   1 
ATOM   6849  O  OD2   . ASP C  1 156 ? 115.158 94.331  38.553  1.00 31.36 ? 184  ASP C OD2   1 
ATOM   6850  N  N     . SER C  1 157 ? 118.492 91.698  35.038  1.00 29.84 ? 185  SER C N     1 
ATOM   6851  C  CA    . SER C  1 157 ? 119.189 90.410  35.242  1.00 30.10 ? 185  SER C CA    1 
ATOM   6852  C  C     . SER C  1 157 ? 119.574 90.138  36.692  1.00 29.93 ? 185  SER C C     1 
ATOM   6853  O  O     . SER C  1 157 ? 119.441 89.004  37.176  1.00 29.86 ? 185  SER C O     1 
ATOM   6854  C  CB    . SER C  1 157 ? 120.495 90.374  34.438  1.00 30.16 ? 185  SER C CB    1 
ATOM   6855  O  OG    . SER C  1 157 ? 120.263 90.642  33.083  1.00 31.68 ? 185  SER C OG    1 
ATOM   6856  N  N     . PHE C  1 158 ? 120.092 91.162  37.370  1.00 29.38 ? 186  PHE C N     1 
ATOM   6857  C  CA    . PHE C  1 158 ? 120.619 90.983  38.725  1.00 29.88 ? 186  PHE C CA    1 
ATOM   6858  C  C     . PHE C  1 158 ? 119.539 90.850  39.807  1.00 29.55 ? 186  PHE C C     1 
ATOM   6859  O  O     . PHE C  1 158 ? 119.859 90.650  40.982  1.00 28.96 ? 186  PHE C O     1 
ATOM   6860  C  CB    . PHE C  1 158 ? 121.613 92.101  39.092  1.00 30.50 ? 186  PHE C CB    1 
ATOM   6861  C  CG    . PHE C  1 158 ? 122.823 92.185  38.179  1.00 30.85 ? 186  PHE C CG    1 
ATOM   6862  C  CD1   . PHE C  1 158 ? 123.164 91.149  37.315  1.00 31.48 ? 186  PHE C CD1   1 
ATOM   6863  C  CD2   . PHE C  1 158 ? 123.639 93.311  38.215  1.00 33.27 ? 186  PHE C CD2   1 
ATOM   6864  C  CE1   . PHE C  1 158 ? 124.284 91.245  36.492  1.00 32.98 ? 186  PHE C CE1   1 
ATOM   6865  C  CE2   . PHE C  1 158 ? 124.775 93.405  37.393  1.00 33.49 ? 186  PHE C CE2   1 
ATOM   6866  C  CZ    . PHE C  1 158 ? 125.086 92.383  36.531  1.00 32.02 ? 186  PHE C CZ    1 
ATOM   6867  N  N     . ALA C  1 159 ? 118.275 90.934  39.401  1.00 29.29 ? 187  ALA C N     1 
ATOM   6868  C  CA    . ALA C  1 159 ? 117.150 90.583  40.267  1.00 29.24 ? 187  ALA C CA    1 
ATOM   6869  C  C     . ALA C  1 159 ? 116.868 89.076  40.236  1.00 29.04 ? 187  ALA C C     1 
ATOM   6870  O  O     . ALA C  1 159 ? 115.873 88.634  40.792  1.00 28.83 ? 187  ALA C O     1 
ATOM   6871  C  CB    . ALA C  1 159 ? 115.889 91.359  39.851  1.00 29.06 ? 187  ALA C CB    1 
ATOM   6872  N  N     . LEU C  1 160 ? 117.738 88.288  39.599  1.00 29.24 ? 188  LEU C N     1 
ATOM   6873  C  CA    . LEU C  1 160 ? 117.533 86.842  39.502  1.00 28.95 ? 188  LEU C CA    1 
ATOM   6874  C  C     . LEU C  1 160 ? 117.335 86.221  40.900  1.00 28.60 ? 188  LEU C C     1 
ATOM   6875  O  O     . LEU C  1 160 ? 117.951 86.650  41.885  1.00 28.48 ? 188  LEU C O     1 
ATOM   6876  C  CB    . LEU C  1 160 ? 118.678 86.170  38.721  1.00 29.07 ? 188  LEU C CB    1 
ATOM   6877  C  CG    . LEU C  1 160 ? 120.101 86.194  39.298  1.00 28.15 ? 188  LEU C CG    1 
ATOM   6878  C  CD1   . LEU C  1 160 ? 120.304 85.052  40.296  1.00 25.21 ? 188  LEU C CD1   1 
ATOM   6879  C  CD2   . LEU C  1 160 ? 121.120 86.103  38.169  1.00 28.77 ? 188  LEU C CD2   1 
ATOM   6880  N  N     . LYS C  1 161 ? 116.408 85.267  40.978  1.00 28.48 ? 189  LYS C N     1 
ATOM   6881  C  CA    . LYS C  1 161 ? 115.992 84.674  42.239  1.00 29.23 ? 189  LYS C CA    1 
ATOM   6882  C  C     . LYS C  1 161 ? 116.505 83.238  42.396  1.00 28.88 ? 189  LYS C C     1 
ATOM   6883  O  O     . LYS C  1 161 ? 116.336 82.640  43.461  1.00 28.94 ? 189  LYS C O     1 
ATOM   6884  C  CB    . LYS C  1 161 ? 114.453 84.719  42.378  1.00 30.11 ? 189  LYS C CB    1 
ATOM   6885  C  CG    . LYS C  1 161 ? 113.821 86.133  42.419  1.00 31.82 ? 189  LYS C CG    1 
ATOM   6886  C  CD    A LYS C  1 161 ? 114.162 86.859  43.722  0.50 33.14 ? 189  LYS C CD    1 
ATOM   6887  C  CD    B LYS C  1 161 ? 114.189 86.933  43.673  0.50 32.94 ? 189  LYS C CD    1 
ATOM   6888  C  CE    A LYS C  1 161 ? 113.353 88.160  43.923  0.50 33.15 ? 189  LYS C CE    1 
ATOM   6889  C  CE    B LYS C  1 161 ? 113.898 88.450  43.517  0.50 33.08 ? 189  LYS C CE    1 
ATOM   6890  N  NZ    A LYS C  1 161 ? 112.136 88.000  44.767  0.50 33.57 ? 189  LYS C NZ    1 
ATOM   6891  N  NZ    B LYS C  1 161 ? 115.106 89.314  43.229  0.50 31.93 ? 189  LYS C NZ    1 
ATOM   6892  N  N     . THR C  1 162 ? 117.123 82.678  41.356  1.00 28.44 ? 190  THR C N     1 
ATOM   6893  C  CA    . THR C  1 162 ? 117.775 81.375  41.505  1.00 28.40 ? 190  THR C CA    1 
ATOM   6894  C  C     . THR C  1 162 ? 118.866 81.513  42.568  1.00 28.24 ? 190  THR C C     1 
ATOM   6895  O  O     . THR C  1 162 ? 119.738 82.392  42.479  1.00 27.64 ? 190  THR C O     1 
ATOM   6896  C  CB    . THR C  1 162 ? 118.388 80.824  40.183  1.00 28.17 ? 190  THR C CB    1 
ATOM   6897  O  OG1   . THR C  1 162 ? 117.351 80.679  39.194  1.00 28.68 ? 190  THR C OG1   1 
ATOM   6898  C  CG2   . THR C  1 162 ? 119.072 79.450  40.434  1.00 27.94 ? 190  THR C CG2   1 
ATOM   6899  N  N     . ARG C  1 163 ? 118.798 80.646  43.568  1.00 27.98 ? 191  ARG C N     1 
ATOM   6900  C  CA    . ARG C  1 163 ? 119.641 80.762  44.743  1.00 28.63 ? 191  ARG C CA    1 
ATOM   6901  C  C     . ARG C  1 163 ? 120.549 79.535  44.840  1.00 26.96 ? 191  ARG C C     1 
ATOM   6902  O  O     . ARG C  1 163 ? 120.213 78.469  44.327  1.00 26.18 ? 191  ARG C O     1 
ATOM   6903  C  CB    . ARG C  1 163 ? 118.785 80.934  46.013  1.00 28.50 ? 191  ARG C CB    1 
ATOM   6904  C  CG    . ARG C  1 163 ? 117.843 79.790  46.305  1.00 31.23 ? 191  ARG C CG    1 
ATOM   6905  C  CD    . ARG C  1 163 ? 116.947 80.040  47.531  1.00 33.44 ? 191  ARG C CD    1 
ATOM   6906  N  NE    . ARG C  1 163 ? 116.149 78.853  47.891  1.00 37.62 ? 191  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C  1 163 ? 114.989 78.507  47.320  1.00 39.62 ? 191  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C  1 163 ? 114.477 79.222  46.327  1.00 40.55 ? 191  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C  1 163 ? 114.341 77.415  47.730  1.00 40.10 ? 191  ARG C NH2   1 
ATOM   6910  N  N     . ALA C  1 164 ? 121.694 79.709  45.496  1.00 26.41 ? 192  ALA C N     1 
ATOM   6911  C  CA    . ALA C  1 164 ? 122.670 78.633  45.713  1.00 25.78 ? 192  ALA C CA    1 
ATOM   6912  C  C     . ALA C  1 164 ? 123.059 78.565  47.178  1.00 25.45 ? 192  ALA C C     1 
ATOM   6913  O  O     . ALA C  1 164 ? 123.681 79.501  47.683  1.00 25.33 ? 192  ALA C O     1 
ATOM   6914  C  CB    . ALA C  1 164 ? 123.905 78.872  44.851  1.00 25.77 ? 192  ALA C CB    1 
ATOM   6915  N  N     . ASP C  1 165 ? 122.683 77.478  47.861  1.00 24.63 ? 193  ASP C N     1 
ATOM   6916  C  CA    . ASP C  1 165 ? 123.025 77.254  49.263  1.00 24.72 ? 193  ASP C CA    1 
ATOM   6917  C  C     . ASP C  1 165 ? 124.236 76.332  49.403  1.00 24.38 ? 193  ASP C C     1 
ATOM   6918  O  O     . ASP C  1 165 ? 124.212 75.199  48.931  1.00 23.80 ? 193  ASP C O     1 
ATOM   6919  C  CB    . ASP C  1 165 ? 121.860 76.591  50.018  1.00 24.95 ? 193  ASP C CB    1 
ATOM   6920  C  CG    . ASP C  1 165 ? 120.586 77.420  49.996  1.00 26.37 ? 193  ASP C CG    1 
ATOM   6921  O  OD1   . ASP C  1 165 ? 120.654 78.636  50.242  1.00 30.76 ? 193  ASP C OD1   1 
ATOM   6922  O  OD2   . ASP C  1 165 ? 119.507 76.851  49.753  1.00 27.48 ? 193  ASP C OD2   1 
ATOM   6923  N  N     . LYS C  1 166 ? 125.268 76.794  50.103  1.00 24.28 ? 194  LYS C N     1 
ATOM   6924  C  CA    . LYS C  1 166 ? 126.435 75.954  50.398  1.00 24.10 ? 194  LYS C CA    1 
ATOM   6925  C  C     . LYS C  1 166 ? 126.069 74.926  51.467  1.00 23.74 ? 194  LYS C C     1 
ATOM   6926  O  O     . LYS C  1 166 ? 125.591 75.280  52.535  1.00 22.98 ? 194  LYS C O     1 
ATOM   6927  C  CB    . LYS C  1 166 ? 127.634 76.798  50.860  1.00 24.63 ? 194  LYS C CB    1 
ATOM   6928  C  CG    . LYS C  1 166 ? 128.901 75.957  51.100  1.00 24.43 ? 194  LYS C CG    1 
ATOM   6929  C  CD    . LYS C  1 166 ? 130.137 76.788  51.447  1.00 25.55 ? 194  LYS C CD    1 
ATOM   6930  C  CE    . LYS C  1 166 ? 131.179 75.957  52.200  1.00 27.29 ? 194  LYS C CE    1 
ATOM   6931  N  NZ    . LYS C  1 166 ? 131.485 74.654  51.537  1.00 28.44 ? 194  LYS C NZ    1 
ATOM   6932  N  N     . GLU C  1 167 ? 126.262 73.650  51.154  1.00 23.69 ? 195  GLU C N     1 
ATOM   6933  C  CA    . GLU C  1 167 ? 126.070 72.573  52.119  1.00 24.30 ? 195  GLU C CA    1 
ATOM   6934  C  C     . GLU C  1 167 ? 127.315 71.672  52.112  1.00 24.53 ? 195  GLU C C     1 
ATOM   6935  O  O     . GLU C  1 167 ? 127.346 70.622  51.454  1.00 25.42 ? 195  GLU C O     1 
ATOM   6936  C  CB    . GLU C  1 167 ? 124.805 71.762  51.796  1.00 24.13 ? 195  GLU C CB    1 
ATOM   6937  C  CG    . GLU C  1 167 ? 123.571 72.592  51.444  1.00 24.20 ? 195  GLU C CG    1 
ATOM   6938  C  CD    . GLU C  1 167 ? 122.916 73.285  52.636  1.00 23.41 ? 195  GLU C CD    1 
ATOM   6939  O  OE1   . GLU C  1 167 ? 123.403 73.160  53.778  1.00 23.53 ? 195  GLU C OE1   1 
ATOM   6940  O  OE2   . GLU C  1 167 ? 121.886 73.943  52.421  1.00 25.50 ? 195  GLU C OE2   1 
ATOM   6941  N  N     . GLY C  1 168 ? 128.335 72.092  52.842  1.00 24.46 ? 196  GLY C N     1 
ATOM   6942  C  CA    . GLY C  1 168 ? 129.606 71.371  52.877  1.00 24.59 ? 196  GLY C CA    1 
ATOM   6943  C  C     . GLY C  1 168 ? 130.268 71.407  51.511  1.00 24.51 ? 196  GLY C C     1 
ATOM   6944  O  O     . GLY C  1 168 ? 130.549 72.485  50.997  1.00 24.95 ? 196  GLY C O     1 
ATOM   6945  N  N     . ASP C  1 169 ? 130.447 70.235  50.892  1.00 24.39 ? 197  ASP C N     1 
ATOM   6946  C  CA    . ASP C  1 169 ? 131.264 70.125  49.673  1.00 24.35 ? 197  ASP C CA    1 
ATOM   6947  C  C     . ASP C  1 169 ? 130.516 70.422  48.350  1.00 23.98 ? 197  ASP C C     1 
ATOM   6948  O  O     . ASP C  1 169 ? 131.062 70.242  47.252  1.00 24.03 ? 197  ASP C O     1 
ATOM   6949  C  CB    . ASP C  1 169 ? 132.050 68.788  49.660  1.00 24.51 ? 197  ASP C CB    1 
ATOM   6950  C  CG    . ASP C  1 169 ? 131.195 67.547  49.329  1.00 25.02 ? 197  ASP C CG    1 
ATOM   6951  O  OD1   . ASP C  1 169 ? 129.947 67.577  49.315  1.00 24.43 ? 197  ASP C OD1   1 
ATOM   6952  O  OD2   . ASP C  1 169 ? 131.818 66.486  49.108  1.00 27.42 ? 197  ASP C OD2   1 
ATOM   6953  N  N     . TYR C  1 170 ? 129.272 70.895  48.450  1.00 23.11 ? 198  TYR C N     1 
ATOM   6954  C  CA    . TYR C  1 170 ? 128.486 71.219  47.262  1.00 21.94 ? 198  TYR C CA    1 
ATOM   6955  C  C     . TYR C  1 170 ? 127.506 72.370  47.526  1.00 21.86 ? 198  TYR C C     1 
ATOM   6956  O  O     . TYR C  1 170 ? 127.284 72.767  48.676  1.00 20.52 ? 198  TYR C O     1 
ATOM   6957  C  CB    . TYR C  1 170 ? 127.735 69.975  46.764  1.00 21.42 ? 198  TYR C CB    1 
ATOM   6958  C  CG    . TYR C  1 170 ? 126.531 69.611  47.609  1.00 20.90 ? 198  TYR C CG    1 
ATOM   6959  C  CD1   . TYR C  1 170 ? 125.243 69.941  47.195  1.00 20.39 ? 198  TYR C CD1   1 
ATOM   6960  C  CD2   . TYR C  1 170 ? 126.681 68.982  48.828  1.00 19.30 ? 198  TYR C CD2   1 
ATOM   6961  C  CE1   . TYR C  1 170 ? 124.146 69.646  47.976  1.00 20.55 ? 198  TYR C CE1   1 
ATOM   6962  C  CE2   . TYR C  1 170 ? 125.583 68.682  49.615  1.00 20.32 ? 198  TYR C CE2   1 
ATOM   6963  C  CZ    . TYR C  1 170 ? 124.317 69.017  49.178  1.00 19.33 ? 198  TYR C CZ    1 
ATOM   6964  O  OH    . TYR C  1 170 ? 123.219 68.721  49.939  1.00 20.72 ? 198  TYR C OH    1 
ATOM   6965  N  N     . TYR C  1 171 ? 126.945 72.896  46.437  1.00 21.88 ? 199  TYR C N     1 
ATOM   6966  C  CA    . TYR C  1 171 ? 125.898 73.937  46.468  1.00 22.72 ? 199  TYR C CA    1 
ATOM   6967  C  C     . TYR C  1 171 ? 124.565 73.395  45.975  1.00 22.75 ? 199  TYR C C     1 
ATOM   6968  O  O     . TYR C  1 171 ? 124.535 72.654  44.991  1.00 23.05 ? 199  TYR C O     1 
ATOM   6969  C  CB    . TYR C  1 171 ? 126.304 75.143  45.611  1.00 22.37 ? 199  TYR C CB    1 
ATOM   6970  C  CG    . TYR C  1 171 ? 127.361 75.981  46.291  1.00 23.72 ? 199  TYR C CG    1 
ATOM   6971  C  CD1   . TYR C  1 171 ? 127.044 77.204  46.875  1.00 23.77 ? 199  TYR C CD1   1 
ATOM   6972  C  CD2   . TYR C  1 171 ? 128.678 75.535  46.373  1.00 23.83 ? 199  TYR C CD2   1 
ATOM   6973  C  CE1   . TYR C  1 171 ? 128.021 77.973  47.513  1.00 24.72 ? 199  TYR C CE1   1 
ATOM   6974  C  CE2   . TYR C  1 171 ? 129.667 76.297  47.004  1.00 24.72 ? 199  TYR C CE2   1 
ATOM   6975  C  CZ    . TYR C  1 171 ? 129.333 77.512  47.576  1.00 24.23 ? 199  TYR C CZ    1 
ATOM   6976  O  OH    . TYR C  1 171 ? 130.309 78.254  48.225  1.00 25.31 ? 199  TYR C OH    1 
ATOM   6977  N  N     . VAL C  1 172 ? 123.478 73.761  46.659  1.00 22.46 ? 200  VAL C N     1 
ATOM   6978  C  CA    . VAL C  1 172 ? 122.128 73.410  46.215  1.00 22.77 ? 200  VAL C CA    1 
ATOM   6979  C  C     . VAL C  1 172 ? 121.524 74.597  45.479  1.00 23.00 ? 200  VAL C C     1 
ATOM   6980  O  O     . VAL C  1 172 ? 121.362 75.676  46.077  1.00 22.66 ? 200  VAL C O     1 
ATOM   6981  C  CB    . VAL C  1 172 ? 121.173 73.075  47.390  1.00 22.69 ? 200  VAL C CB    1 
ATOM   6982  C  CG1   . VAL C  1 172 ? 119.837 72.546  46.834  1.00 22.70 ? 200  VAL C CG1   1 
ATOM   6983  C  CG2   . VAL C  1 172 ? 121.806 72.091  48.350  1.00 22.83 ? 200  VAL C CG2   1 
ATOM   6984  N  N     . LEU C  1 173 ? 121.208 74.401  44.193  1.00 23.06 ? 201  LEU C N     1 
ATOM   6985  C  CA    . LEU C  1 173 ? 120.564 75.429  43.362  1.00 23.46 ? 201  LEU C CA    1 
ATOM   6986  C  C     . LEU C  1 173 ? 119.039 75.225  43.261  1.00 23.46 ? 201  LEU C C     1 
ATOM   6987  O  O     . LEU C  1 173 ? 118.561 74.119  42.960  1.00 22.88 ? 201  LEU C O     1 
ATOM   6988  C  CB    . LEU C  1 173 ? 121.170 75.473  41.948  1.00 23.36 ? 201  LEU C CB    1 
ATOM   6989  C  CG    . LEU C  1 173 ? 122.465 76.287  41.769  1.00 23.97 ? 201  LEU C CG    1 
ATOM   6990  C  CD1   . LEU C  1 173 ? 123.517 75.845  42.753  1.00 23.43 ? 201  LEU C CD1   1 
ATOM   6991  C  CD2   . LEU C  1 173 ? 122.968 76.202  40.311  1.00 24.62 ? 201  LEU C CD2   1 
ATOM   6992  N  N     . ASN C  1 174 ? 118.298 76.310  43.500  1.00 23.29 ? 202  ASN C N     1 
ATOM   6993  C  CA    . ASN C  1 174 ? 116.839 76.308  43.439  1.00 23.70 ? 202  ASN C CA    1 
ATOM   6994  C  C     . ASN C  1 174 ? 116.350 77.543  42.707  1.00 24.48 ? 202  ASN C C     1 
ATOM   6995  O  O     . ASN C  1 174 ? 116.716 78.675  43.043  1.00 23.94 ? 202  ASN C O     1 
ATOM   6996  C  CB    . ASN C  1 174 ? 116.208 76.230  44.836  1.00 23.75 ? 202  ASN C CB    1 
ATOM   6997  C  CG    . ASN C  1 174 ? 116.072 74.809  45.328  1.00 23.47 ? 202  ASN C CG    1 
ATOM   6998  O  OD1   . ASN C  1 174 ? 115.260 74.038  44.799  1.00 22.85 ? 202  ASN C OD1   1 
ATOM   6999  N  ND2   . ASN C  1 174 ? 116.874 74.437  46.329  1.00 22.16 ? 202  ASN C ND2   1 
ATOM   7000  N  N     . GLY C  1 175 ? 115.521 77.305  41.698  1.00 25.48 ? 203  GLY C N     1 
ATOM   7001  C  CA    . GLY C  1 175 ? 114.900 78.369  40.947  1.00 26.29 ? 203  GLY C CA    1 
ATOM   7002  C  C     . GLY C  1 175 ? 114.527 77.945  39.543  1.00 26.92 ? 203  GLY C C     1 
ATOM   7003  O  O     . GLY C  1 175 ? 114.219 76.784  39.275  1.00 27.02 ? 203  GLY C O     1 
ATOM   7004  N  N     . SER C  1 176 ? 114.541 78.915  38.649  1.00 27.76 ? 204  SER C N     1 
ATOM   7005  C  CA    . SER C  1 176 ? 114.149 78.692  37.279  1.00 28.53 ? 204  SER C CA    1 
ATOM   7006  C  C     . SER C  1 176 ? 114.868 79.709  36.405  1.00 28.31 ? 204  SER C C     1 
ATOM   7007  O  O     . SER C  1 176 ? 115.254 80.769  36.881  1.00 28.88 ? 204  SER C O     1 
ATOM   7008  C  CB    . SER C  1 176 ? 112.628 78.853  37.155  1.00 28.60 ? 204  SER C CB    1 
ATOM   7009  O  OG    . SER C  1 176 ? 112.273 80.194  37.420  1.00 30.52 ? 204  SER C OG    1 
ATOM   7010  N  N     . LYS C  1 177 ? 115.078 79.359  35.143  1.00 28.21 ? 205  LYS C N     1 
ATOM   7011  C  CA    . LYS C  1 177 ? 115.583 80.296  34.146  1.00 28.51 ? 205  LYS C CA    1 
ATOM   7012  C  C     . LYS C  1 177 ? 114.612 80.303  32.976  1.00 29.14 ? 205  LYS C C     1 
ATOM   7013  O  O     . LYS C  1 177 ? 113.773 79.421  32.835  1.00 29.04 ? 205  LYS C O     1 
ATOM   7014  C  CB    . LYS C  1 177 ? 116.996 79.906  33.697  1.00 28.04 ? 205  LYS C CB    1 
ATOM   7015  C  CG    . LYS C  1 177 ? 118.031 79.960  34.823  1.00 27.88 ? 205  LYS C CG    1 
ATOM   7016  C  CD    . LYS C  1 177 ? 118.394 81.382  35.191  1.00 27.35 ? 205  LYS C CD    1 
ATOM   7017  C  CE    . LYS C  1 177 ? 119.378 81.460  36.342  1.00 26.67 ? 205  LYS C CE    1 
ATOM   7018  N  NZ    . LYS C  1 177 ? 119.498 82.872  36.886  1.00 27.10 ? 205  LYS C NZ    1 
ATOM   7019  N  N     . MET C  1 178 ? 114.728 81.315  32.144  1.00 29.83 ? 206  MET C N     1 
ATOM   7020  C  CA    . MET C  1 178 ? 113.828 81.482  31.023  1.00 30.38 ? 206  MET C CA    1 
ATOM   7021  C  C     . MET C  1 178 ? 114.651 81.945  29.825  1.00 30.03 ? 206  MET C C     1 
ATOM   7022  O  O     . MET C  1 178 ? 115.667 82.638  29.987  1.00 28.44 ? 206  MET C O     1 
ATOM   7023  C  CB    . MET C  1 178 ? 112.759 82.520  31.389  1.00 30.88 ? 206  MET C CB    1 
ATOM   7024  C  CG    . MET C  1 178 ? 111.617 82.647  30.387  1.00 33.75 ? 206  MET C CG    1 
ATOM   7025  S  SD    . MET C  1 178 ? 110.580 81.182  30.282  1.00 38.75 ? 206  MET C SD    1 
ATOM   7026  C  CE    . MET C  1 178 ? 109.469 81.527  31.644  1.00 41.12 ? 206  MET C CE    1 
ATOM   7027  N  N     . TRP C  1 179 ? 114.185 81.573  28.634  1.00 29.68 ? 207  TRP C N     1 
ATOM   7028  C  CA    . TRP C  1 179 ? 114.788 82.006  27.365  1.00 30.34 ? 207  TRP C CA    1 
ATOM   7029  C  C     . TRP C  1 179 ? 116.171 81.433  27.114  1.00 29.79 ? 207  TRP C C     1 
ATOM   7030  O  O     . TRP C  1 179 ? 116.966 82.060  26.396  1.00 31.15 ? 207  TRP C O     1 
ATOM   7031  C  CB    . TRP C  1 179 ? 114.868 83.549  27.241  1.00 30.69 ? 207  TRP C CB    1 
ATOM   7032  C  CG    . TRP C  1 179 ? 113.658 84.273  27.725  1.00 31.41 ? 207  TRP C CG    1 
ATOM   7033  C  CD1   . TRP C  1 179 ? 113.558 85.086  28.823  1.00 32.27 ? 207  TRP C CD1   1 
ATOM   7034  C  CD2   . TRP C  1 179 ? 112.350 84.213  27.152  1.00 32.86 ? 207  TRP C CD2   1 
ATOM   7035  N  NE1   . TRP C  1 179 ? 112.267 85.545  28.957  1.00 31.71 ? 207  TRP C NE1   1 
ATOM   7036  C  CE2   . TRP C  1 179 ? 111.506 85.026  27.946  1.00 32.11 ? 207  TRP C CE2   1 
ATOM   7037  C  CE3   . TRP C  1 179 ? 111.810 83.556  26.043  1.00 32.23 ? 207  TRP C CE3   1 
ATOM   7038  C  CZ2   . TRP C  1 179 ? 110.158 85.181  27.672  1.00 32.61 ? 207  TRP C CZ2   1 
ATOM   7039  C  CZ3   . TRP C  1 179 ? 110.459 83.722  25.766  1.00 31.76 ? 207  TRP C CZ3   1 
ATOM   7040  C  CH2   . TRP C  1 179 ? 109.653 84.525  26.580  1.00 32.22 ? 207  TRP C CH2   1 
ATOM   7041  N  N     . ILE C  1 180 ? 116.480 80.255  27.657  1.00 28.39 ? 208  ILE C N     1 
ATOM   7042  C  CA    . ILE C  1 180 ? 117.849 79.762  27.545  1.00 26.81 ? 208  ILE C CA    1 
ATOM   7043  C  C     . ILE C  1 180 ? 118.152 79.205  26.154  1.00 26.60 ? 208  ILE C C     1 
ATOM   7044  O  O     . ILE C  1 180 ? 117.603 78.177  25.736  1.00 26.32 ? 208  ILE C O     1 
ATOM   7045  C  CB    . ILE C  1 180 ? 118.228 78.777  28.677  1.00 26.86 ? 208  ILE C CB    1 
ATOM   7046  C  CG1   . ILE C  1 180 ? 117.928 79.405  30.043  1.00 26.35 ? 208  ILE C CG1   1 
ATOM   7047  C  CG2   . ILE C  1 180 ? 119.712 78.368  28.558  1.00 25.46 ? 208  ILE C CG2   1 
ATOM   7048  C  CD1   . ILE C  1 180 ? 118.480 80.843  30.252  1.00 26.85 ? 208  ILE C CD1   1 
ATOM   7049  N  N     . SER C  1 181 ? 119.029 79.908  25.434  1.00 26.24 ? 209  SER C N     1 
ATOM   7050  C  CA    . SER C  1 181 ? 119.391 79.503  24.085  1.00 26.39 ? 209  SER C CA    1 
ATOM   7051  C  C     . SER C  1 181 ? 120.253 78.247  24.100  1.00 26.18 ? 209  SER C C     1 
ATOM   7052  O  O     . SER C  1 181 ? 121.118 78.083  24.955  1.00 25.19 ? 209  SER C O     1 
ATOM   7053  C  CB    . SER C  1 181 ? 120.124 80.618  23.333  1.00 26.72 ? 209  SER C CB    1 
ATOM   7054  O  OG    . SER C  1 181 ? 119.255 81.703  23.071  1.00 27.48 ? 209  SER C OG    1 
ATOM   7055  N  N     . SER C  1 182 ? 120.007 77.391  23.114  1.00 26.29 ? 210  SER C N     1 
ATOM   7056  C  CA    . SER C  1 182 ? 120.777 76.179  22.883  1.00 26.64 ? 210  SER C CA    1 
ATOM   7057  C  C     . SER C  1 182 ? 120.581 75.087  23.946  1.00 25.95 ? 210  SER C C     1 
ATOM   7058  O  O     . SER C  1 182 ? 121.312 74.098  23.934  1.00 25.98 ? 210  SER C O     1 
ATOM   7059  C  CB    . SER C  1 182 ? 122.274 76.496  22.737  1.00 27.04 ? 210  SER C CB    1 
ATOM   7060  O  OG    . SER C  1 182 ? 122.506 77.623  21.917  1.00 28.16 ? 210  SER C OG    1 
ATOM   7061  N  N     . ALA C  1 183 ? 119.590 75.242  24.831  1.00 25.66 ? 211  ALA C N     1 
ATOM   7062  C  CA    . ALA C  1 183 ? 119.426 74.344  25.975  1.00 26.24 ? 211  ALA C CA    1 
ATOM   7063  C  C     . ALA C  1 183 ? 118.935 72.962  25.589  1.00 26.75 ? 211  ALA C C     1 
ATOM   7064  O  O     . ALA C  1 183 ? 119.132 72.006  26.339  1.00 26.45 ? 211  ALA C O     1 
ATOM   7065  C  CB    . ALA C  1 183 ? 118.475 74.949  27.019  1.00 25.75 ? 211  ALA C CB    1 
ATOM   7066  N  N     . GLU C  1 184 ? 118.273 72.856  24.444  1.00 27.59 ? 212  GLU C N     1 
ATOM   7067  C  CA    . GLU C  1 184 ? 117.569 71.633  24.113  1.00 29.07 ? 212  GLU C CA    1 
ATOM   7068  C  C     . GLU C  1 184 ? 118.496 70.420  24.172  1.00 29.10 ? 212  GLU C C     1 
ATOM   7069  O  O     . GLU C  1 184 ? 118.127 69.405  24.754  1.00 29.27 ? 212  GLU C O     1 
ATOM   7070  C  CB    . GLU C  1 184 ? 116.880 71.730  22.759  1.00 28.82 ? 212  GLU C CB    1 
ATOM   7071  C  CG    . GLU C  1 184 ? 116.000 70.522  22.463  1.00 30.06 ? 212  GLU C CG    1 
ATOM   7072  C  CD    . GLU C  1 184 ? 115.229 70.653  21.172  1.00 31.54 ? 212  GLU C CD    1 
ATOM   7073  O  OE1   . GLU C  1 184 ? 115.628 71.492  20.338  1.00 34.34 ? 212  GLU C OE1   1 
ATOM   7074  O  OE2   . GLU C  1 184 ? 114.226 69.905  21.007  1.00 35.62 ? 212  GLU C OE2   1 
ATOM   7075  N  N     . HIS C  1 185 ? 119.706 70.550  23.632  1.00 30.03 ? 213  HIS C N     1 
ATOM   7076  C  CA    . HIS C  1 185 ? 120.673 69.452  23.641  1.00 31.07 ? 213  HIS C CA    1 
ATOM   7077  C  C     . HIS C  1 185 ? 122.020 69.833  24.266  1.00 30.61 ? 213  HIS C C     1 
ATOM   7078  O  O     . HIS C  1 185 ? 123.015 69.121  24.077  1.00 30.92 ? 213  HIS C O     1 
ATOM   7079  C  CB    . HIS C  1 185 ? 120.894 68.930  22.213  1.00 32.72 ? 213  HIS C CB    1 
ATOM   7080  C  CG    . HIS C  1 185 ? 119.636 68.473  21.542  1.00 33.94 ? 213  HIS C CG    1 
ATOM   7081  N  ND1   . HIS C  1 185 ? 118.857 67.453  22.042  1.00 36.14 ? 213  HIS C ND1   1 
ATOM   7082  C  CD2   . HIS C  1 185 ? 119.011 68.917  20.427  1.00 36.25 ? 213  HIS C CD2   1 
ATOM   7083  C  CE1   . HIS C  1 185 ? 117.811 67.277  21.256  1.00 36.26 ? 213  HIS C CE1   1 
ATOM   7084  N  NE2   . HIS C  1 185 ? 117.884 68.150  20.263  1.00 36.91 ? 213  HIS C NE2   1 
ATOM   7085  N  N     . ALA C  1 186 ? 122.047 70.929  25.032  1.00 29.08 ? 214  ALA C N     1 
ATOM   7086  C  CA    . ALA C  1 186 ? 123.260 71.361  25.715  1.00 28.24 ? 214  ALA C CA    1 
ATOM   7087  C  C     . ALA C  1 186 ? 123.686 70.339  26.770  1.00 27.48 ? 214  ALA C C     1 
ATOM   7088  O  O     . ALA C  1 186 ? 122.845 69.778  27.475  1.00 27.74 ? 214  ALA C O     1 
ATOM   7089  C  CB    . ALA C  1 186 ? 123.066 72.753  26.372  1.00 27.11 ? 214  ALA C CB    1 
ATOM   7090  N  N     . GLY C  1 187 ? 124.991 70.112  26.884  1.00 26.85 ? 215  GLY C N     1 
ATOM   7091  C  CA    . GLY C  1 187 ? 125.536 69.252  27.926  1.00 26.70 ? 215  GLY C CA    1 
ATOM   7092  C  C     . GLY C  1 187 ? 126.050 70.030  29.129  1.00 26.81 ? 215  GLY C C     1 
ATOM   7093  O  O     . GLY C  1 187 ? 126.213 69.465  30.197  1.00 27.40 ? 215  GLY C O     1 
ATOM   7094  N  N     . LEU C  1 188 ? 126.321 71.322  28.944  1.00 27.01 ? 216  LEU C N     1 
ATOM   7095  C  CA    . LEU C  1 188 ? 126.883 72.171  29.990  1.00 26.89 ? 216  LEU C CA    1 
ATOM   7096  C  C     . LEU C  1 188 ? 126.050 73.442  30.128  1.00 26.53 ? 216  LEU C C     1 
ATOM   7097  O  O     . LEU C  1 188 ? 125.719 74.096  29.142  1.00 26.26 ? 216  LEU C O     1 
ATOM   7098  C  CB    . LEU C  1 188 ? 128.355 72.499  29.698  1.00 26.52 ? 216  LEU C CB    1 
ATOM   7099  C  CG    . LEU C  1 188 ? 129.071 73.495  30.624  1.00 27.05 ? 216  LEU C CG    1 
ATOM   7100  C  CD1   . LEU C  1 188 ? 129.208 72.970  32.070  1.00 27.23 ? 216  LEU C CD1   1 
ATOM   7101  C  CD2   . LEU C  1 188 ? 130.440 73.868  30.068  1.00 27.49 ? 216  LEU C CD2   1 
ATOM   7102  N  N     . PHE C  1 189 ? 125.700 73.761  31.371  1.00 26.66 ? 217  PHE C N     1 
ATOM   7103  C  CA    . PHE C  1 189 ? 124.942 74.961  31.691  1.00 26.51 ? 217  PHE C CA    1 
ATOM   7104  C  C     . PHE C  1 189 ? 125.792 75.843  32.598  1.00 26.29 ? 217  PHE C C     1 
ATOM   7105  O  O     . PHE C  1 189 ? 126.217 75.420  33.670  1.00 26.00 ? 217  PHE C O     1 
ATOM   7106  C  CB    . PHE C  1 189 ? 123.605 74.588  32.339  1.00 26.16 ? 217  PHE C CB    1 
ATOM   7107  C  CG    . PHE C  1 189 ? 122.709 73.831  31.431  1.00 26.06 ? 217  PHE C CG    1 
ATOM   7108  C  CD1   . PHE C  1 189 ? 121.729 74.485  30.693  1.00 27.46 ? 217  PHE C CD1   1 
ATOM   7109  C  CD2   . PHE C  1 189 ? 122.880 72.465  31.258  1.00 26.74 ? 217  PHE C CD2   1 
ATOM   7110  C  CE1   . PHE C  1 189 ? 120.918 73.783  29.815  1.00 26.44 ? 217  PHE C CE1   1 
ATOM   7111  C  CE2   . PHE C  1 189 ? 122.092 71.769  30.369  1.00 26.51 ? 217  PHE C CE2   1 
ATOM   7112  C  CZ    . PHE C  1 189 ? 121.110 72.423  29.649  1.00 27.30 ? 217  PHE C CZ    1 
ATOM   7113  N  N     . LEU C  1 190 ? 126.062 77.057  32.133  1.00 26.22 ? 218  LEU C N     1 
ATOM   7114  C  CA    . LEU C  1 190 ? 126.774 78.045  32.908  1.00 26.37 ? 218  LEU C CA    1 
ATOM   7115  C  C     . LEU C  1 190 ? 125.721 78.904  33.598  1.00 26.32 ? 218  LEU C C     1 
ATOM   7116  O  O     . LEU C  1 190 ? 125.074 79.733  32.964  1.00 26.09 ? 218  LEU C O     1 
ATOM   7117  C  CB    . LEU C  1 190 ? 127.677 78.851  31.978  1.00 26.42 ? 218  LEU C CB    1 
ATOM   7118  C  CG    . LEU C  1 190 ? 128.821 79.630  32.591  1.00 28.16 ? 218  LEU C CG    1 
ATOM   7119  C  CD1   . LEU C  1 190 ? 129.854 79.943  31.474  1.00 30.08 ? 218  LEU C CD1   1 
ATOM   7120  C  CD2   . LEU C  1 190 ? 128.338 80.921  33.286  1.00 28.83 ? 218  LEU C CD2   1 
ATOM   7121  N  N     . VAL C  1 191 ? 125.534 78.667  34.895  1.00 26.48 ? 219  VAL C N     1 
ATOM   7122  C  CA    . VAL C  1 191 ? 124.366 79.156  35.627  1.00 26.02 ? 219  VAL C CA    1 
ATOM   7123  C  C     . VAL C  1 191 ? 124.751 80.238  36.633  1.00 26.60 ? 219  VAL C C     1 
ATOM   7124  O  O     . VAL C  1 191 ? 125.620 80.034  37.480  1.00 26.23 ? 219  VAL C O     1 
ATOM   7125  C  CB    . VAL C  1 191 ? 123.650 77.983  36.375  1.00 25.87 ? 219  VAL C CB    1 
ATOM   7126  C  CG1   . VAL C  1 191 ? 122.374 78.455  37.095  1.00 24.63 ? 219  VAL C CG1   1 
ATOM   7127  C  CG2   . VAL C  1 191 ? 123.327 76.843  35.393  1.00 25.49 ? 219  VAL C CG2   1 
ATOM   7128  N  N     . MET C  1 192 ? 124.079 81.382  36.531  1.00 27.27 ? 220  MET C N     1 
ATOM   7129  C  CA    . MET C  1 192 ? 124.201 82.465  37.507  1.00 27.80 ? 220  MET C CA    1 
ATOM   7130  C  C     . MET C  1 192 ? 123.157 82.279  38.601  1.00 26.93 ? 220  MET C C     1 
ATOM   7131  O  O     . MET C  1 192 ? 121.954 82.163  38.333  1.00 27.64 ? 220  MET C O     1 
ATOM   7132  C  CB    . MET C  1 192 ? 124.076 83.840  36.833  1.00 28.44 ? 220  MET C CB    1 
ATOM   7133  C  CG    . MET C  1 192 ? 125.437 84.502  36.514  1.00 30.21 ? 220  MET C CG    1 
ATOM   7134  S  SD    . MET C  1 192 ? 126.433 83.511  35.408  1.00 35.83 ? 220  MET C SD    1 
ATOM   7135  C  CE    . MET C  1 192 ? 125.292 83.304  34.031  1.00 36.61 ? 220  MET C CE    1 
ATOM   7136  N  N     . ALA C  1 193 ? 123.632 82.203  39.838  1.00 27.20 ? 221  ALA C N     1 
ATOM   7137  C  CA    . ALA C  1 193 ? 122.760 81.958  40.986  1.00 27.04 ? 221  ALA C CA    1 
ATOM   7138  C  C     . ALA C  1 193 ? 123.292 82.737  42.178  1.00 27.25 ? 221  ALA C C     1 
ATOM   7139  O  O     . ALA C  1 193 ? 124.489 82.962  42.300  1.00 26.91 ? 221  ALA C O     1 
ATOM   7140  C  CB    . ALA C  1 193 ? 122.664 80.432  41.296  1.00 26.76 ? 221  ALA C CB    1 
ATOM   7141  N  N     . ASN C  1 194 ? 122.386 83.166  43.048  1.00 27.67 ? 222  ASN C N     1 
ATOM   7142  C  CA    . ASN C  1 194 ? 122.750 84.018  44.166  1.00 28.02 ? 222  ASN C CA    1 
ATOM   7143  C  C     . ASN C  1 194 ? 123.003 83.210  45.429  1.00 27.98 ? 222  ASN C C     1 
ATOM   7144  O  O     . ASN C  1 194 ? 122.082 82.599  45.974  1.00 27.20 ? 222  ASN C O     1 
ATOM   7145  C  CB    . ASN C  1 194 ? 121.653 85.072  44.391  1.00 28.21 ? 222  ASN C CB    1 
ATOM   7146  C  CG    . ASN C  1 194 ? 122.172 86.304  45.108  1.00 28.43 ? 222  ASN C CG    1 
ATOM   7147  O  OD1   . ASN C  1 194 ? 122.925 86.189  46.070  1.00 26.36 ? 222  ASN C OD1   1 
ATOM   7148  N  ND2   . ASN C  1 194 ? 121.763 87.488  44.645  1.00 27.49 ? 222  ASN C ND2   1 
ATOM   7149  N  N     . VAL C  1 195 ? 124.245 83.241  45.914  1.00 28.18 ? 223  VAL C N     1 
ATOM   7150  C  CA    . VAL C  1 195 ? 124.617 82.528  47.157  1.00 28.68 ? 223  VAL C CA    1 
ATOM   7151  C  C     . VAL C  1 195 ? 124.205 83.261  48.444  1.00 29.37 ? 223  VAL C C     1 
ATOM   7152  O  O     . VAL C  1 195 ? 124.160 82.660  49.525  1.00 28.63 ? 223  VAL C O     1 
ATOM   7153  C  CB    . VAL C  1 195 ? 126.132 82.210  47.205  1.00 28.54 ? 223  VAL C CB    1 
ATOM   7154  C  CG1   . VAL C  1 195 ? 126.570 81.537  45.914  1.00 28.40 ? 223  VAL C CG1   1 
ATOM   7155  C  CG2   . VAL C  1 195 ? 126.958 83.475  47.484  1.00 27.68 ? 223  VAL C CG2   1 
ATOM   7156  N  N     . ASP C  1 196 ? 123.917 84.558  48.319  1.00 30.92 ? 224  ASP C N     1 
ATOM   7157  C  CA    . ASP C  1 196 ? 123.448 85.372  49.436  1.00 32.15 ? 224  ASP C CA    1 
ATOM   7158  C  C     . ASP C  1 196 ? 122.585 86.541  48.950  1.00 32.97 ? 224  ASP C C     1 
ATOM   7159  O  O     . ASP C  1 196 ? 123.093 87.649  48.720  1.00 33.02 ? 224  ASP C O     1 
ATOM   7160  C  CB    . ASP C  1 196 ? 124.618 85.902  50.255  1.00 32.55 ? 224  ASP C CB    1 
ATOM   7161  C  CG    . ASP C  1 196 ? 124.168 86.586  51.534  1.00 33.34 ? 224  ASP C CG    1 
ATOM   7162  O  OD1   . ASP C  1 196 ? 122.964 86.501  51.904  1.00 32.70 ? 224  ASP C OD1   1 
ATOM   7163  O  OD2   . ASP C  1 196 ? 125.028 87.215  52.169  1.00 36.44 ? 224  ASP C OD2   1 
ATOM   7164  N  N     . PRO C  1 197 ? 121.271 86.297  48.789  1.00 33.91 ? 225  PRO C N     1 
ATOM   7165  C  CA    . PRO C  1 197 ? 120.356 87.349  48.352  1.00 34.75 ? 225  PRO C CA    1 
ATOM   7166  C  C     . PRO C  1 197 ? 120.312 88.592  49.247  1.00 35.45 ? 225  PRO C C     1 
ATOM   7167  O  O     . PRO C  1 197 ? 119.847 89.631  48.785  1.00 36.46 ? 225  PRO C O     1 
ATOM   7168  C  CB    . PRO C  1 197 ? 118.991 86.634  48.318  1.00 34.89 ? 225  PRO C CB    1 
ATOM   7169  C  CG    . PRO C  1 197 ? 119.334 85.198  48.141  1.00 34.44 ? 225  PRO C CG    1 
ATOM   7170  C  CD    . PRO C  1 197 ? 120.571 85.013  48.958  1.00 34.12 ? 225  PRO C CD    1 
ATOM   7171  N  N     . THR C  1 198 ? 120.812 88.512  50.485  1.00 36.20 ? 226  THR C N     1 
ATOM   7172  C  CA    . THR C  1 198 ? 120.810 89.678  51.381  1.00 36.53 ? 226  THR C CA    1 
ATOM   7173  C  C     . THR C  1 198 ? 121.811 90.778  50.959  1.00 36.55 ? 226  THR C C     1 
ATOM   7174  O  O     . THR C  1 198 ? 121.686 91.927  51.398  1.00 36.64 ? 226  THR C O     1 
ATOM   7175  C  CB    . THR C  1 198 ? 120.995 89.271  52.875  1.00 36.84 ? 226  THR C CB    1 
ATOM   7176  O  OG1   . THR C  1 198 ? 122.343 88.842  53.125  1.00 37.59 ? 226  THR C OG1   1 
ATOM   7177  C  CG2   . THR C  1 198 ? 120.024 88.142  53.251  1.00 36.93 ? 226  THR C CG2   1 
ATOM   7178  N  N     . ILE C  1 199 ? 122.768 90.438  50.088  1.00 36.23 ? 227  ILE C N     1 
ATOM   7179  C  CA    . ILE C  1 199 ? 123.745 91.407  49.570  1.00 35.98 ? 227  ILE C CA    1 
ATOM   7180  C  C     . ILE C  1 199 ? 123.493 91.743  48.091  1.00 35.79 ? 227  ILE C C     1 
ATOM   7181  O  O     . ILE C  1 199 ? 124.343 92.339  47.422  1.00 36.09 ? 227  ILE C O     1 
ATOM   7182  C  CB    . ILE C  1 199 ? 125.226 90.946  49.810  1.00 36.18 ? 227  ILE C CB    1 
ATOM   7183  C  CG1   . ILE C  1 199 ? 125.533 89.595  49.149  1.00 36.03 ? 227  ILE C CG1   1 
ATOM   7184  C  CG2   . ILE C  1 199 ? 125.511 90.849  51.298  1.00 36.19 ? 227  ILE C CG2   1 
ATOM   7185  C  CD1   . ILE C  1 199 ? 126.999 89.183  49.266  1.00 35.77 ? 227  ILE C CD1   1 
ATOM   7186  N  N     . GLY C  1 200 ? 122.312 91.379  47.590  1.00 35.20 ? 228  GLY C N     1 
ATOM   7187  C  CA    . GLY C  1 200 ? 121.912 91.735  46.236  1.00 34.77 ? 228  GLY C CA    1 
ATOM   7188  C  C     . GLY C  1 200 ? 122.793 91.105  45.173  1.00 34.54 ? 228  GLY C C     1 
ATOM   7189  O  O     . GLY C  1 200 ? 123.200 89.946  45.300  1.00 33.71 ? 228  GLY C O     1 
ATOM   7190  N  N     . TYR C  1 201 ? 123.096 91.881  44.133  1.00 34.04 ? 229  TYR C N     1 
ATOM   7191  C  CA    . TYR C  1 201 ? 123.875 91.392  43.000  1.00 34.13 ? 229  TYR C CA    1 
ATOM   7192  C  C     . TYR C  1 201 ? 125.274 90.883  43.359  1.00 33.07 ? 229  TYR C C     1 
ATOM   7193  O  O     . TYR C  1 201 ? 125.834 90.081  42.622  1.00 32.32 ? 229  TYR C O     1 
ATOM   7194  C  CB    . TYR C  1 201 ? 123.951 92.436  41.874  1.00 35.07 ? 229  TYR C CB    1 
ATOM   7195  C  CG    . TYR C  1 201 ? 124.760 93.702  42.145  1.00 36.34 ? 229  TYR C CG    1 
ATOM   7196  C  CD1   . TYR C  1 201 ? 126.142 93.731  41.949  1.00 37.28 ? 229  TYR C CD1   1 
ATOM   7197  C  CD2   . TYR C  1 201 ? 124.124 94.886  42.528  1.00 38.18 ? 229  TYR C CD2   1 
ATOM   7198  C  CE1   . TYR C  1 201 ? 126.877 94.897  42.173  1.00 37.87 ? 229  TYR C CE1   1 
ATOM   7199  C  CE2   . TYR C  1 201 ? 124.841 96.062  42.752  1.00 38.71 ? 229  TYR C CE2   1 
ATOM   7200  C  CZ    . TYR C  1 201 ? 126.217 96.068  42.574  1.00 38.31 ? 229  TYR C CZ    1 
ATOM   7201  O  OH    . TYR C  1 201 ? 126.914 97.240  42.796  1.00 37.21 ? 229  TYR C OH    1 
ATOM   7202  N  N     . LYS C  1 202 ? 125.825 91.338  44.486  1.00 32.17 ? 230  LYS C N     1 
ATOM   7203  C  CA    . LYS C  1 202 ? 127.144 90.887  44.931  1.00 31.73 ? 230  LYS C CA    1 
ATOM   7204  C  C     . LYS C  1 202 ? 127.166 89.457  45.495  1.00 31.33 ? 230  LYS C C     1 
ATOM   7205  O  O     . LYS C  1 202 ? 128.233 88.950  45.825  1.00 31.07 ? 230  LYS C O     1 
ATOM   7206  C  CB    . LYS C  1 202 ? 127.757 91.893  45.924  1.00 32.21 ? 230  LYS C CB    1 
ATOM   7207  C  CG    . LYS C  1 202 ? 128.077 93.263  45.280  1.00 32.81 ? 230  LYS C CG    1 
ATOM   7208  C  CD    . LYS C  1 202 ? 129.285 93.958  45.930  1.00 34.89 ? 230  LYS C CD    1 
ATOM   7209  C  CE    . LYS C  1 202 ? 129.350 95.452  45.581  1.00 35.14 ? 230  LYS C CE    1 
ATOM   7210  N  NZ    . LYS C  1 202 ? 129.128 95.713  44.124  1.00 36.95 ? 230  LYS C NZ    1 
ATOM   7211  N  N     . GLY C  1 203 ? 126.000 88.812  45.591  1.00 30.67 ? 231  GLY C N     1 
ATOM   7212  C  CA    . GLY C  1 203 ? 125.917 87.375  45.860  1.00 30.04 ? 231  GLY C CA    1 
ATOM   7213  C  C     . GLY C  1 203 ? 125.878 86.499  44.608  1.00 29.52 ? 231  GLY C C     1 
ATOM   7214  O  O     . GLY C  1 203 ? 125.987 85.273  44.711  1.00 29.21 ? 231  GLY C O     1 
ATOM   7215  N  N     . ILE C  1 204 ? 125.746 87.115  43.430  1.00 28.83 ? 232  ILE C N     1 
ATOM   7216  C  CA    . ILE C  1 204 ? 125.613 86.372  42.176  1.00 28.07 ? 232  ILE C CA    1 
ATOM   7217  C  C     . ILE C  1 204 ? 126.926 85.662  41.815  1.00 27.61 ? 232  ILE C C     1 
ATOM   7218  O  O     . ILE C  1 204 ? 127.988 86.276  41.774  1.00 27.77 ? 232  ILE C O     1 
ATOM   7219  C  CB    . ILE C  1 204 ? 125.126 87.268  41.021  1.00 28.45 ? 232  ILE C CB    1 
ATOM   7220  C  CG1   . ILE C  1 204 ? 123.726 87.825  41.339  1.00 28.54 ? 232  ILE C CG1   1 
ATOM   7221  C  CG2   . ILE C  1 204 ? 125.080 86.471  39.711  1.00 26.61 ? 232  ILE C CG2   1 
ATOM   7222  C  CD1   . ILE C  1 204 ? 123.254 88.869  40.349  1.00 28.19 ? 232  ILE C CD1   1 
ATOM   7223  N  N     . THR C  1 205 ? 126.828 84.356  41.582  1.00 26.81 ? 233  THR C N     1 
ATOM   7224  C  CA    . THR C  1 205 ? 127.982 83.471  41.413  1.00 26.30 ? 233  THR C CA    1 
ATOM   7225  C  C     . THR C  1 205 ? 127.708 82.603  40.179  1.00 26.43 ? 233  THR C C     1 
ATOM   7226  O  O     . THR C  1 205 ? 126.550 82.310  39.882  1.00 26.77 ? 233  THR C O     1 
ATOM   7227  C  CB    . THR C  1 205 ? 128.169 82.590  42.684  1.00 26.02 ? 233  THR C CB    1 
ATOM   7228  O  OG1   . THR C  1 205 ? 128.408 83.434  43.823  1.00 24.41 ? 233  THR C OG1   1 
ATOM   7229  C  CG2   . THR C  1 205 ? 129.319 81.589  42.540  1.00 25.58 ? 233  THR C CG2   1 
ATOM   7230  N  N     . SER C  1 206 ? 128.774 82.236  39.468  1.00 26.15 ? 234  SER C N     1 
ATOM   7231  C  CA    . SER C  1 206 ? 128.721 81.428  38.254  1.00 26.71 ? 234  SER C CA    1 
ATOM   7232  C  C     . SER C  1 206 ? 129.053 79.971  38.557  1.00 26.12 ? 234  SER C C     1 
ATOM   7233  O  O     . SER C  1 206 ? 130.056 79.697  39.214  1.00 25.59 ? 234  SER C O     1 
ATOM   7234  C  CB    . SER C  1 206 ? 129.743 81.957  37.233  1.00 26.96 ? 234  SER C CB    1 
ATOM   7235  O  OG    . SER C  1 206 ? 129.378 83.247  36.750  1.00 29.69 ? 234  SER C OG    1 
ATOM   7236  N  N     . PHE C  1 207 ? 128.222 79.054  38.055  1.00 26.02 ? 235  PHE C N     1 
ATOM   7237  C  CA    . PHE C  1 207 ? 128.382 77.622  38.271  1.00 25.50 ? 235  PHE C CA    1 
ATOM   7238  C  C     . PHE C  1 207 ? 128.398 76.849  36.953  1.00 25.83 ? 235  PHE C C     1 
ATOM   7239  O  O     . PHE C  1 207 ? 127.616 77.115  36.050  1.00 25.63 ? 235  PHE C O     1 
ATOM   7240  C  CB    . PHE C  1 207 ? 127.225 77.082  39.123  1.00 25.45 ? 235  PHE C CB    1 
ATOM   7241  C  CG    . PHE C  1 207 ? 127.169 77.645  40.513  1.00 24.52 ? 235  PHE C CG    1 
ATOM   7242  C  CD1   . PHE C  1 207 ? 127.818 77.009  41.561  1.00 24.74 ? 235  PHE C CD1   1 
ATOM   7243  C  CD2   . PHE C  1 207 ? 126.463 78.803  40.776  1.00 24.54 ? 235  PHE C CD2   1 
ATOM   7244  C  CE1   . PHE C  1 207 ? 127.772 77.522  42.850  1.00 23.51 ? 235  PHE C CE1   1 
ATOM   7245  C  CE2   . PHE C  1 207 ? 126.408 79.319  42.070  1.00 23.71 ? 235  PHE C CE2   1 
ATOM   7246  C  CZ    . PHE C  1 207 ? 127.067 78.673  43.103  1.00 24.60 ? 235  PHE C CZ    1 
ATOM   7247  N  N     . LEU C  1 208 ? 129.267 75.849  36.876  1.00 25.89 ? 236  LEU C N     1 
ATOM   7248  C  CA    . LEU C  1 208 ? 129.264 74.894  35.773  1.00 25.71 ? 236  LEU C CA    1 
ATOM   7249  C  C     . LEU C  1 208 ? 128.394 73.686  36.147  1.00 25.48 ? 236  LEU C C     1 
ATOM   7250  O  O     . LEU C  1 208 ? 128.704 72.946  37.080  1.00 25.23 ? 236  LEU C O     1 
ATOM   7251  C  CB    . LEU C  1 208 ? 130.697 74.447  35.469  1.00 25.67 ? 236  LEU C CB    1 
ATOM   7252  C  CG    . LEU C  1 208 ? 131.614 75.620  35.100  1.00 26.59 ? 236  LEU C CG    1 
ATOM   7253  C  CD1   . LEU C  1 208 ? 133.070 75.187  35.121  1.00 26.91 ? 236  LEU C CD1   1 
ATOM   7254  C  CD2   . LEU C  1 208 ? 131.209 76.224  33.753  1.00 28.92 ? 236  LEU C CD2   1 
ATOM   7255  N  N     . VAL C  1 209 ? 127.305 73.494  35.418  1.00 25.86 ? 237  VAL C N     1 
ATOM   7256  C  CA    . VAL C  1 209 ? 126.346 72.435  35.740  1.00 25.70 ? 237  VAL C CA    1 
ATOM   7257  C  C     . VAL C  1 209 ? 126.195 71.461  34.571  1.00 25.98 ? 237  VAL C C     1 
ATOM   7258  O  O     . VAL C  1 209 ? 125.878 71.873  33.464  1.00 25.11 ? 237  VAL C O     1 
ATOM   7259  C  CB    . VAL C  1 209 ? 124.990 73.041  36.110  1.00 26.04 ? 237  VAL C CB    1 
ATOM   7260  C  CG1   . VAL C  1 209 ? 124.045 71.964  36.644  1.00 25.56 ? 237  VAL C CG1   1 
ATOM   7261  C  CG2   . VAL C  1 209 ? 125.198 74.179  37.135  1.00 25.15 ? 237  VAL C CG2   1 
ATOM   7262  N  N     . ASP C  1 210 ? 126.413 70.171  34.832  1.00 26.22 ? 238  ASP C N     1 
ATOM   7263  C  CA    . ASP C  1 210 ? 126.219 69.137  33.818  1.00 27.44 ? 238  ASP C CA    1 
ATOM   7264  C  C     . ASP C  1 210 ? 124.721 68.863  33.615  1.00 28.21 ? 238  ASP C C     1 
ATOM   7265  O  O     . ASP C  1 210 ? 123.927 68.944  34.558  1.00 28.09 ? 238  ASP C O     1 
ATOM   7266  C  CB    . ASP C  1 210 ? 126.944 67.841  34.198  1.00 27.48 ? 238  ASP C CB    1 
ATOM   7267  C  CG    . ASP C  1 210 ? 128.457 68.029  34.365  1.00 29.22 ? 238  ASP C CG    1 
ATOM   7268  O  OD1   . ASP C  1 210 ? 129.058 68.921  33.731  1.00 31.06 ? 238  ASP C OD1   1 
ATOM   7269  O  OD2   . ASP C  1 210 ? 129.059 67.262  35.139  1.00 33.47 ? 238  ASP C OD2   1 
ATOM   7270  N  N     . ARG C  1 211 ? 124.349 68.538  32.382  1.00 28.76 ? 239  ARG C N     1 
ATOM   7271  C  CA    . ARG C  1 211 ? 122.947 68.320  32.030  1.00 29.28 ? 239  ARG C CA    1 
ATOM   7272  C  C     . ARG C  1 211 ? 122.300 67.228  32.878  1.00 30.12 ? 239  ARG C C     1 
ATOM   7273  O  O     . ARG C  1 211 ? 121.175 67.386  33.349  1.00 29.91 ? 239  ARG C O     1 
ATOM   7274  C  CB    . ARG C  1 211 ? 122.833 67.943  30.555  1.00 29.81 ? 239  ARG C CB    1 
ATOM   7275  C  CG    . ARG C  1 211 ? 121.414 67.972  29.989  1.00 29.42 ? 239  ARG C CG    1 
ATOM   7276  C  CD    . ARG C  1 211 ? 121.271 67.178  28.684  1.00 29.34 ? 239  ARG C CD    1 
ATOM   7277  N  NE    . ARG C  1 211 ? 119.868 67.225  28.256  1.00 30.23 ? 239  ARG C NE    1 
ATOM   7278  C  CZ    . ARG C  1 211 ? 119.294 68.254  27.637  1.00 29.12 ? 239  ARG C CZ    1 
ATOM   7279  N  NH1   . ARG C  1 211 ? 119.983 69.339  27.318  1.00 30.55 ? 239  ARG C NH1   1 
ATOM   7280  N  NH2   . ARG C  1 211 ? 118.010 68.199  27.324  1.00 29.26 ? 239  ARG C NH2   1 
ATOM   7281  N  N     . ASP C  1 212 ? 123.024 66.127  33.050  1.00 30.30 ? 240  ASP C N     1 
ATOM   7282  C  CA    . ASP C  1 212 ? 122.487 64.922  33.646  1.00 31.41 ? 240  ASP C CA    1 
ATOM   7283  C  C     . ASP C  1 212 ? 122.616 64.978  35.165  1.00 30.66 ? 240  ASP C C     1 
ATOM   7284  O  O     . ASP C  1 212 ? 123.550 64.430  35.738  1.00 30.61 ? 240  ASP C O     1 
ATOM   7285  C  CB    . ASP C  1 212 ? 123.245 63.698  33.134  1.00 32.46 ? 240  ASP C CB    1 
ATOM   7286  C  CG    . ASP C  1 212 ? 123.207 63.564  31.628  1.00 35.18 ? 240  ASP C CG    1 
ATOM   7287  O  OD1   . ASP C  1 212 ? 122.601 64.418  30.947  1.00 40.80 ? 240  ASP C OD1   1 
ATOM   7288  O  OD2   . ASP C  1 212 ? 123.818 62.586  31.127  1.00 42.11 ? 240  ASP C OD2   1 
ATOM   7289  N  N     . THR C  1 213 ? 121.687 65.662  35.806  1.00 29.97 ? 241  THR C N     1 
ATOM   7290  C  CA    . THR C  1 213 ? 121.742 65.819  37.254  1.00 29.89 ? 241  THR C CA    1 
ATOM   7291  C  C     . THR C  1 213 ? 120.323 65.909  37.826  1.00 28.66 ? 241  THR C C     1 
ATOM   7292  O  O     . THR C  1 213 ? 119.475 66.580  37.242  1.00 28.59 ? 241  THR C O     1 
ATOM   7293  C  CB    . THR C  1 213 ? 122.654 67.026  37.646  1.00 29.86 ? 241  THR C CB    1 
ATOM   7294  O  OG1   . THR C  1 213 ? 123.122 66.854  38.985  1.00 31.26 ? 241  THR C OG1   1 
ATOM   7295  C  CG2   . THR C  1 213 ? 121.940 68.346  37.517  1.00 30.42 ? 241  THR C CG2   1 
ATOM   7296  N  N     . PRO C  1 214 ? 120.047 65.186  38.938  1.00 27.30 ? 242  PRO C N     1 
ATOM   7297  C  CA    . PRO C  1 214 ? 118.722 65.269  39.536  1.00 26.64 ? 242  PRO C CA    1 
ATOM   7298  C  C     . PRO C  1 214 ? 118.256 66.705  39.772  1.00 25.64 ? 242  PRO C C     1 
ATOM   7299  O  O     . PRO C  1 214 ? 119.032 67.565  40.181  1.00 24.60 ? 242  PRO C O     1 
ATOM   7300  C  CB    . PRO C  1 214 ? 118.890 64.518  40.863  1.00 26.70 ? 242  PRO C CB    1 
ATOM   7301  C  CG    . PRO C  1 214 ? 119.951 63.527  40.588  1.00 27.00 ? 242  PRO C CG    1 
ATOM   7302  C  CD    . PRO C  1 214 ? 120.911 64.246  39.679  1.00 27.55 ? 242  PRO C CD    1 
ATOM   7303  N  N     . GLY C  1 215 ? 116.999 66.962  39.461  1.00 24.88 ? 243  GLY C N     1 
ATOM   7304  C  CA    . GLY C  1 215 ? 116.399 68.249  39.733  1.00 24.78 ? 243  GLY C CA    1 
ATOM   7305  C  C     . GLY C  1 215 ? 116.498 69.284  38.631  1.00 23.97 ? 243  GLY C C     1 
ATOM   7306  O  O     . GLY C  1 215 ? 115.853 70.318  38.714  1.00 23.46 ? 243  GLY C O     1 
ATOM   7307  N  N     . LEU C  1 216 ? 117.311 69.026  37.608  1.00 24.06 ? 244  LEU C N     1 
ATOM   7308  C  CA    . LEU C  1 216 ? 117.454 69.953  36.496  1.00 24.23 ? 244  LEU C CA    1 
ATOM   7309  C  C     . LEU C  1 216 ? 116.514 69.497  35.379  1.00 24.53 ? 244  LEU C C     1 
ATOM   7310  O  O     . LEU C  1 216 ? 116.604 68.349  34.921  1.00 24.96 ? 244  LEU C O     1 
ATOM   7311  C  CB    . LEU C  1 216 ? 118.900 69.992  35.976  1.00 24.47 ? 244  LEU C CB    1 
ATOM   7312  C  CG    . LEU C  1 216 ? 119.193 70.842  34.721  1.00 24.90 ? 244  LEU C CG    1 
ATOM   7313  C  CD1   . LEU C  1 216 ? 118.557 72.233  34.819  1.00 24.57 ? 244  LEU C CD1   1 
ATOM   7314  C  CD2   . LEU C  1 216 ? 120.706 70.976  34.485  1.00 25.42 ? 244  LEU C CD2   1 
ATOM   7315  N  N     . HIS C  1 217 ? 115.587 70.359  34.991  1.00 23.99 ? 245  HIS C N     1 
ATOM   7316  C  CA    . HIS C  1 217 ? 114.684 70.054  33.866  1.00 24.58 ? 245  HIS C CA    1 
ATOM   7317  C  C     . HIS C  1 217 ? 114.795 71.131  32.796  1.00 24.49 ? 245  HIS C C     1 
ATOM   7318  O  O     . HIS C  1 217 ? 114.686 72.315  33.099  1.00 24.12 ? 245  HIS C O     1 
ATOM   7319  C  CB    . HIS C  1 217 ? 113.228 69.963  34.300  1.00 25.11 ? 245  HIS C CB    1 
ATOM   7320  C  CG    . HIS C  1 217 ? 112.294 69.590  33.190  1.00 24.73 ? 245  HIS C CG    1 
ATOM   7321  N  ND1   . HIS C  1 217 ? 112.293 68.335  32.617  1.00 26.50 ? 245  HIS C ND1   1 
ATOM   7322  C  CD2   . HIS C  1 217 ? 111.346 70.306  32.537  1.00 26.81 ? 245  HIS C CD2   1 
ATOM   7323  C  CE1   . HIS C  1 217 ? 111.394 68.302  31.648  1.00 26.35 ? 245  HIS C CE1   1 
ATOM   7324  N  NE2   . HIS C  1 217 ? 110.795 69.479  31.592  1.00 26.07 ? 245  HIS C NE2   1 
ATOM   7325  N  N     . ILE C  1 218 ? 114.983 70.684  31.554  1.00 24.51 ? 246  ILE C N     1 
ATOM   7326  C  CA    . ILE C  1 218 ? 114.955 71.523  30.363  1.00 25.27 ? 246  ILE C CA    1 
ATOM   7327  C  C     . ILE C  1 218 ? 113.593 71.324  29.713  1.00 25.72 ? 246  ILE C C     1 
ATOM   7328  O  O     . ILE C  1 218 ? 113.242 70.211  29.333  1.00 24.86 ? 246  ILE C O     1 
ATOM   7329  C  CB    . ILE C  1 218 ? 116.059 71.129  29.349  1.00 25.53 ? 246  ILE C CB    1 
ATOM   7330  C  CG1   . ILE C  1 218 ? 117.453 71.423  29.911  1.00 28.12 ? 246  ILE C CG1   1 
ATOM   7331  C  CG2   . ILE C  1 218 ? 115.883 71.910  28.016  1.00 24.68 ? 246  ILE C CG2   1 
ATOM   7332  C  CD1   . ILE C  1 218 ? 118.123 70.298  30.618  1.00 31.16 ? 246  ILE C CD1   1 
ATOM   7333  N  N     . GLY C  1 219 ? 112.823 72.400  29.614  1.00 26.30 ? 247  GLY C N     1 
ATOM   7334  C  CA    . GLY C  1 219 ? 111.484 72.334  29.051  1.00 27.31 ? 247  GLY C CA    1 
ATOM   7335  C  C     . GLY C  1 219 ? 111.489 72.372  27.534  1.00 28.42 ? 247  GLY C C     1 
ATOM   7336  O  O     . GLY C  1 219 ? 112.539 72.448  26.878  1.00 28.14 ? 247  GLY C O     1 
ATOM   7337  N  N     . LYS C  1 220 ? 110.292 72.283  26.984  1.00 29.57 ? 248  LYS C N     1 
ATOM   7338  C  CA    . LYS C  1 220 ? 110.051 72.372  25.548  1.00 30.74 ? 248  LYS C CA    1 
ATOM   7339  C  C     . LYS C  1 220 ? 110.586 73.686  24.948  1.00 29.77 ? 248  LYS C C     1 
ATOM   7340  O  O     . LYS C  1 220 ? 110.352 74.752  25.525  1.00 29.83 ? 248  LYS C O     1 
ATOM   7341  C  CB    . LYS C  1 220 ? 108.534 72.321  25.333  1.00 30.68 ? 248  LYS C CB    1 
ATOM   7342  C  CG    . LYS C  1 220 ? 108.121 72.079  23.924  1.00 32.69 ? 248  LYS C CG    1 
ATOM   7343  C  CD    . LYS C  1 220 ? 106.595 72.125  23.778  1.00 33.72 ? 248  LYS C CD    1 
ATOM   7344  C  CE    . LYS C  1 220 ? 106.196 72.183  22.309  1.00 36.70 ? 248  LYS C CE    1 
ATOM   7345  N  NZ    . LYS C  1 220 ? 104.817 71.678  22.088  1.00 38.61 ? 248  LYS C NZ    1 
ATOM   7346  N  N     . PRO C  1 221 ? 111.291 73.622  23.795  1.00 29.57 ? 249  PRO C N     1 
ATOM   7347  C  CA    . PRO C  1 221 ? 111.667 74.861  23.104  1.00 29.62 ? 249  PRO C CA    1 
ATOM   7348  C  C     . PRO C  1 221 ? 110.458 75.726  22.767  1.00 29.28 ? 249  PRO C C     1 
ATOM   7349  O  O     . PRO C  1 221 ? 109.422 75.215  22.365  1.00 29.44 ? 249  PRO C O     1 
ATOM   7350  C  CB    . PRO C  1 221 ? 112.337 74.371  21.810  1.00 29.34 ? 249  PRO C CB    1 
ATOM   7351  C  CG    . PRO C  1 221 ? 112.772 72.998  22.098  1.00 30.20 ? 249  PRO C CG    1 
ATOM   7352  C  CD    . PRO C  1 221 ? 111.815 72.436  23.093  1.00 30.06 ? 249  PRO C CD    1 
ATOM   7353  N  N     . GLU C  1 222 ? 110.607 77.028  22.933  1.00 29.00 ? 250  GLU C N     1 
ATOM   7354  C  CA    . GLU C  1 222 ? 109.561 77.971  22.599  1.00 29.39 ? 250  GLU C CA    1 
ATOM   7355  C  C     . GLU C  1 222 ? 109.257 77.937  21.097  1.00 28.13 ? 250  GLU C C     1 
ATOM   7356  O  O     . GLU C  1 222 ? 110.125 77.672  20.257  1.00 26.62 ? 250  GLU C O     1 
ATOM   7357  C  CB    . GLU C  1 222 ? 109.947 79.412  22.985  1.00 30.21 ? 250  GLU C CB    1 
ATOM   7358  C  CG    . GLU C  1 222 ? 110.296 79.671  24.459  1.00 33.85 ? 250  GLU C CG    1 
ATOM   7359  C  CD    . GLU C  1 222 ? 109.098 79.642  25.427  1.00 39.91 ? 250  GLU C CD    1 
ATOM   7360  O  OE1   . GLU C  1 222 ? 107.943 79.996  25.045  1.00 41.28 ? 250  GLU C OE1   1 
ATOM   7361  O  OE2   . GLU C  1 222 ? 109.327 79.246  26.608  1.00 44.76 ? 250  GLU C OE2   1 
ATOM   7362  N  N     . ASN C  1 223 ? 108.003 78.230  20.809  1.00 27.82 ? 251  ASN C N     1 
ATOM   7363  C  CA    . ASN C  1 223 ? 107.480 78.426  19.472  1.00 27.97 ? 251  ASN C CA    1 
ATOM   7364  C  C     . ASN C  1 223 ? 107.562 79.927  19.142  1.00 27.06 ? 251  ASN C C     1 
ATOM   7365  O  O     . ASN C  1 223 ? 106.777 80.740  19.630  1.00 27.25 ? 251  ASN C O     1 
ATOM   7366  C  CB    . ASN C  1 223 ? 106.033 77.902  19.448  1.00 28.71 ? 251  ASN C CB    1 
ATOM   7367  C  CG    . ASN C  1 223 ? 105.432 77.886  18.083  1.00 28.94 ? 251  ASN C CG    1 
ATOM   7368  O  OD1   . ASN C  1 223 ? 106.131 78.033  17.097  1.00 32.85 ? 251  ASN C OD1   1 
ATOM   7369  N  ND2   . ASN C  1 223 ? 104.111 77.718  18.012  1.00 30.68 ? 251  ASN C ND2   1 
ATOM   7370  N  N     . LYS C  1 224 ? 108.534 80.273  18.308  1.00 26.15 ? 252  LYS C N     1 
ATOM   7371  C  CA    . LYS C  1 224 ? 108.968 81.646  18.121  1.00 25.86 ? 252  LYS C CA    1 
ATOM   7372  C  C     . LYS C  1 224 ? 108.616 82.216  16.755  1.00 25.67 ? 252  LYS C C     1 
ATOM   7373  O  O     . LYS C  1 224 ? 108.449 81.488  15.771  1.00 25.39 ? 252  LYS C O     1 
ATOM   7374  C  CB    . LYS C  1 224 ? 110.491 81.727  18.336  1.00 26.10 ? 252  LYS C CB    1 
ATOM   7375  C  CG    . LYS C  1 224 ? 110.931 81.220  19.710  1.00 26.31 ? 252  LYS C CG    1 
ATOM   7376  C  CD    . LYS C  1 224 ? 112.345 81.635  20.103  1.00 26.99 ? 252  LYS C CD    1 
ATOM   7377  C  CE    . LYS C  1 224 ? 113.452 81.199  19.115  1.00 27.72 ? 252  LYS C CE    1 
ATOM   7378  N  NZ    . LYS C  1 224 ? 113.413 79.769  18.796  1.00 30.37 ? 252  LYS C NZ    1 
ATOM   7379  N  N     . LEU C  1 225 ? 108.526 83.542  16.701  1.00 25.64 ? 253  LEU C N     1 
ATOM   7380  C  CA    . LEU C  1 225 ? 108.390 84.291  15.450  1.00 24.97 ? 253  LEU C CA    1 
ATOM   7381  C  C     . LEU C  1 225 ? 109.508 83.990  14.445  1.00 24.85 ? 253  LEU C C     1 
ATOM   7382  O  O     . LEU C  1 225 ? 109.255 83.770  13.274  1.00 24.43 ? 253  LEU C O     1 
ATOM   7383  C  CB    . LEU C  1 225 ? 108.413 85.792  15.760  1.00 24.39 ? 253  LEU C CB    1 
ATOM   7384  C  CG    . LEU C  1 225 ? 108.520 86.793  14.612  1.00 25.44 ? 253  LEU C CG    1 
ATOM   7385  C  CD1   . LEU C  1 225 ? 107.374 86.608  13.583  1.00 22.17 ? 253  LEU C CD1   1 
ATOM   7386  C  CD2   . LEU C  1 225 ? 108.536 88.206  15.198  1.00 25.20 ? 253  LEU C CD2   1 
ATOM   7387  N  N     . GLY C  1 226 ? 110.744 84.032  14.917  1.00 25.08 ? 254  GLY C N     1 
ATOM   7388  C  CA    . GLY C  1 226 ? 111.903 83.747  14.103  1.00 24.93 ? 254  GLY C CA    1 
ATOM   7389  C  C     . GLY C  1 226 ? 113.000 83.166  14.970  1.00 25.49 ? 254  GLY C C     1 
ATOM   7390  O  O     . GLY C  1 226 ? 112.746 82.773  16.107  1.00 25.21 ? 254  GLY C O     1 
ATOM   7391  N  N     . LEU C  1 227 ? 114.218 83.096  14.429  1.00 25.41 ? 255  LEU C N     1 
ATOM   7392  C  CA    . LEU C  1 227 ? 115.317 82.394  15.088  1.00 26.09 ? 255  LEU C CA    1 
ATOM   7393  C  C     . LEU C  1 227 ? 114.862 80.994  15.532  1.00 25.27 ? 255  LEU C C     1 
ATOM   7394  O  O     . LEU C  1 227 ? 115.242 80.487  16.583  1.00 23.68 ? 255  LEU C O     1 
ATOM   7395  C  CB    . LEU C  1 227 ? 115.807 83.217  16.284  1.00 27.00 ? 255  LEU C CB    1 
ATOM   7396  C  CG    . LEU C  1 227 ? 117.311 83.257  16.395  1.00 31.39 ? 255  LEU C CG    1 
ATOM   7397  C  CD1   . LEU C  1 227 ? 117.850 84.134  15.217  1.00 31.61 ? 255  LEU C CD1   1 
ATOM   7398  C  CD2   . LEU C  1 227 ? 117.714 83.770  17.789  1.00 33.56 ? 255  LEU C CD2   1 
ATOM   7399  N  N     . ARG C  1 228 ? 114.054 80.357  14.694  1.00 25.36 ? 256  ARG C N     1 
ATOM   7400  C  CA    . ARG C  1 228 ? 113.319 79.170  15.117  1.00 25.38 ? 256  ARG C CA    1 
ATOM   7401  C  C     . ARG C  1 228 ? 114.192 77.927  15.325  1.00 24.95 ? 256  ARG C C     1 
ATOM   7402  O  O     . ARG C  1 228 ? 113.880 77.099  16.191  1.00 24.28 ? 256  ARG C O     1 
ATOM   7403  C  CB    . ARG C  1 228 ? 112.135 78.914  14.173  1.00 25.72 ? 256  ARG C CB    1 
ATOM   7404  C  CG    . ARG C  1 228 ? 111.048 79.947  14.352  1.00 26.20 ? 256  ARG C CG    1 
ATOM   7405  C  CD    . ARG C  1 228 ? 109.994 79.881  13.250  1.00 27.59 ? 256  ARG C CD    1 
ATOM   7406  N  NE    . ARG C  1 228 ? 109.331 78.581  13.141  1.00 27.62 ? 256  ARG C NE    1 
ATOM   7407  C  CZ    . ARG C  1 228 ? 108.346 78.146  13.918  1.00 28.67 ? 256  ARG C CZ    1 
ATOM   7408  N  NH1   . ARG C  1 228 ? 107.870 78.882  14.904  1.00 28.54 ? 256  ARG C NH1   1 
ATOM   7409  N  NH2   . ARG C  1 228 ? 107.834 76.944  13.708  1.00 29.58 ? 256  ARG C NH2   1 
ATOM   7410  N  N     . ALA C  1 229 ? 115.289 77.818  14.569  1.00 24.56 ? 257  ALA C N     1 
ATOM   7411  C  CA    . ALA C  1 229 ? 116.211 76.671  14.683  1.00 25.50 ? 257  ALA C CA    1 
ATOM   7412  C  C     . ALA C  1 229 ? 117.140 76.763  15.911  1.00 25.87 ? 257  ALA C C     1 
ATOM   7413  O  O     . ALA C  1 229 ? 117.754 75.773  16.306  1.00 26.39 ? 257  ALA C O     1 
ATOM   7414  C  CB    . ALA C  1 229 ? 117.041 76.502  13.367  1.00 24.05 ? 257  ALA C CB    1 
ATOM   7415  N  N     . SER C  1 230 ? 117.220 77.939  16.516  1.00 26.61 ? 258  SER C N     1 
ATOM   7416  C  CA    . SER C  1 230 ? 117.936 78.128  17.786  1.00 26.82 ? 258  SER C CA    1 
ATOM   7417  C  C     . SER C  1 230 ? 116.991 77.818  18.933  1.00 26.82 ? 258  SER C C     1 
ATOM   7418  O  O     . SER C  1 230 ? 116.077 78.590  19.217  1.00 26.43 ? 258  SER C O     1 
ATOM   7419  C  CB    . SER C  1 230 ? 118.474 79.554  17.921  1.00 27.00 ? 258  SER C CB    1 
ATOM   7420  O  OG    . SER C  1 230 ? 119.096 79.760  19.188  1.00 27.38 ? 258  SER C OG    1 
ATOM   7421  N  N     . SER C  1 231 ? 117.207 76.682  19.579  1.00 26.71 ? 259  SER C N     1 
ATOM   7422  C  CA    . SER C  1 231 ? 116.374 76.288  20.717  1.00 26.81 ? 259  SER C CA    1 
ATOM   7423  C  C     . SER C  1 231 ? 116.408 77.347  21.840  1.00 26.95 ? 259  SER C C     1 
ATOM   7424  O  O     . SER C  1 231 ? 117.450 77.945  22.156  1.00 26.60 ? 259  SER C O     1 
ATOM   7425  C  CB    . SER C  1 231 ? 116.756 74.892  21.232  1.00 26.76 ? 259  SER C CB    1 
ATOM   7426  O  OG    . SER C  1 231 ? 118.042 74.882  21.818  1.00 26.08 ? 259  SER C OG    1 
ATOM   7427  N  N     . THR C  1 232 ? 115.229 77.612  22.384  1.00 27.13 ? 260  THR C N     1 
ATOM   7428  C  CA    . THR C  1 232 ? 115.062 78.583  23.438  1.00 27.31 ? 260  THR C CA    1 
ATOM   7429  C  C     . THR C  1 232 ? 114.121 77.942  24.458  1.00 26.88 ? 260  THR C C     1 
ATOM   7430  O  O     . THR C  1 232 ? 112.928 77.794  24.200  1.00 26.52 ? 260  THR C O     1 
ATOM   7431  C  CB    . THR C  1 232 ? 114.506 79.901  22.880  1.00 27.42 ? 260  THR C CB    1 
ATOM   7432  O  OG1   . THR C  1 232 ? 115.289 80.311  21.744  1.00 28.24 ? 260  THR C OG1   1 
ATOM   7433  C  CG2   . THR C  1 232 ? 114.554 80.989  23.937  1.00 28.54 ? 260  THR C CG2   1 
ATOM   7434  N  N     . CYS C  1 233 ? 114.677 77.534  25.595  1.00 26.95 ? 261  CYS C N     1 
ATOM   7435  C  CA    . CYS C  1 233 ? 113.973 76.673  26.540  1.00 26.98 ? 261  CYS C CA    1 
ATOM   7436  C  C     . CYS C  1 233 ? 113.936 77.227  27.960  1.00 27.44 ? 261  CYS C C     1 
ATOM   7437  O  O     . CYS C  1 233 ? 114.907 77.827  28.420  1.00 27.33 ? 261  CYS C O     1 
ATOM   7438  C  CB    . CYS C  1 233 ? 114.657 75.308  26.624  1.00 26.79 ? 261  CYS C CB    1 
ATOM   7439  S  SG    . CYS C  1 233 ? 114.820 74.381  25.081  1.00 27.90 ? 261  CYS C SG    1 
ATOM   7440  N  N     . PRO C  1 234 ? 112.828 76.967  28.673  1.00 27.68 ? 262  PRO C N     1 
ATOM   7441  C  CA    . PRO C  1 234 ? 112.777 77.226  30.091  1.00 28.17 ? 262  PRO C CA    1 
ATOM   7442  C  C     . PRO C  1 234 ? 113.554 76.152  30.869  1.00 27.76 ? 262  PRO C C     1 
ATOM   7443  O  O     . PRO C  1 234 ? 113.586 74.983  30.471  1.00 27.53 ? 262  PRO C O     1 
ATOM   7444  C  CB    . PRO C  1 234 ? 111.275 77.164  30.395  1.00 28.15 ? 262  PRO C CB    1 
ATOM   7445  C  CG    . PRO C  1 234 ? 110.733 76.205  29.418  1.00 28.21 ? 262  PRO C CG    1 
ATOM   7446  C  CD    . PRO C  1 234 ? 111.571 76.368  28.175  1.00 27.63 ? 262  PRO C CD    1 
ATOM   7447  N  N     . LEU C  1 235 ? 114.193 76.549  31.961  1.00 27.83 ? 263  LEU C N     1 
ATOM   7448  C  CA    . LEU C  1 235 ? 114.850 75.590  32.856  1.00 27.78 ? 263  LEU C CA    1 
ATOM   7449  C  C     . LEU C  1 235 ? 114.282 75.706  34.250  1.00 27.57 ? 263  LEU C C     1 
ATOM   7450  O  O     . LEU C  1 235 ? 113.908 76.791  34.672  1.00 28.03 ? 263  LEU C O     1 
ATOM   7451  C  CB    . LEU C  1 235 ? 116.345 75.846  32.956  1.00 28.00 ? 263  LEU C CB    1 
ATOM   7452  C  CG    . LEU C  1 235 ? 117.190 76.012  31.712  1.00 29.84 ? 263  LEU C CG    1 
ATOM   7453  C  CD1   . LEU C  1 235 ? 118.665 76.189  32.156  1.00 29.35 ? 263  LEU C CD1   1 
ATOM   7454  C  CD2   . LEU C  1 235 ? 117.019 74.865  30.741  1.00 30.30 ? 263  LEU C CD2   1 
ATOM   7455  N  N     . THR C  1 236 ? 114.222 74.587  34.964  1.00 26.75 ? 264  THR C N     1 
ATOM   7456  C  CA    . THR C  1 236 ? 113.875 74.605  36.373  1.00 27.08 ? 264  THR C CA    1 
ATOM   7457  C  C     . THR C  1 236 ? 114.947 73.824  37.140  1.00 26.48 ? 264  THR C C     1 
ATOM   7458  O  O     . THR C  1 236 ? 115.489 72.828  36.652  1.00 25.29 ? 264  THR C O     1 
ATOM   7459  C  CB    . THR C  1 236 ? 112.432 74.075  36.658  1.00 26.91 ? 264  THR C CB    1 
ATOM   7460  O  OG1   . THR C  1 236 ? 112.313 72.749  36.166  1.00 29.42 ? 264  THR C OG1   1 
ATOM   7461  C  CG2   . THR C  1 236 ? 111.360 74.961  35.996  1.00 28.46 ? 264  THR C CG2   1 
ATOM   7462  N  N     . PHE C  1 237 ? 115.266 74.343  38.323  1.00 26.32 ? 265  PHE C N     1 
ATOM   7463  C  CA    . PHE C  1 237 ? 116.257 73.788  39.223  1.00 25.97 ? 265  PHE C CA    1 
ATOM   7464  C  C     . PHE C  1 237 ? 115.555 73.452  40.518  1.00 25.89 ? 265  PHE C C     1 
ATOM   7465  O  O     . PHE C  1 237 ? 115.189 74.340  41.284  1.00 26.10 ? 265  PHE C O     1 
ATOM   7466  C  CB    . PHE C  1 237 ? 117.376 74.796  39.497  1.00 26.33 ? 265  PHE C CB    1 
ATOM   7467  C  CG    . PHE C  1 237 ? 118.201 75.136  38.294  1.00 26.66 ? 265  PHE C CG    1 
ATOM   7468  C  CD1   . PHE C  1 237 ? 119.438 74.550  38.099  1.00 28.55 ? 265  PHE C CD1   1 
ATOM   7469  C  CD2   . PHE C  1 237 ? 117.762 76.074  37.380  1.00 28.38 ? 265  PHE C CD2   1 
ATOM   7470  C  CE1   . PHE C  1 237 ? 120.215 74.868  36.993  1.00 29.83 ? 265  PHE C CE1   1 
ATOM   7471  C  CE2   . PHE C  1 237 ? 118.523 76.392  36.262  1.00 28.11 ? 265  PHE C CE2   1 
ATOM   7472  C  CZ    . PHE C  1 237 ? 119.752 75.797  36.066  1.00 28.09 ? 265  PHE C CZ    1 
ATOM   7473  N  N     . GLU C  1 238 ? 115.346 72.164  40.741  1.00 25.34 ? 266  GLU C N     1 
ATOM   7474  C  CA    . GLU C  1 238 ? 114.774 71.654  41.981  1.00 25.55 ? 266  GLU C CA    1 
ATOM   7475  C  C     . GLU C  1 238 ? 115.876 70.956  42.739  1.00 24.05 ? 266  GLU C C     1 
ATOM   7476  O  O     . GLU C  1 238 ? 116.180 69.797  42.458  1.00 23.54 ? 266  GLU C O     1 
ATOM   7477  C  CB    . GLU C  1 238 ? 113.674 70.642  41.680  1.00 26.05 ? 266  GLU C CB    1 
ATOM   7478  C  CG    A GLU C  1 238 ? 112.271 70.968  42.157  0.50 28.21 ? 266  GLU C CG    1 
ATOM   7479  C  CG    B GLU C  1 238 ? 112.296 71.286  41.724  0.50 28.15 ? 266  GLU C CG    1 
ATOM   7480  C  CD    A GLU C  1 238 ? 111.432 69.692  42.367  0.50 26.59 ? 266  GLU C CD    1 
ATOM   7481  C  CD    B GLU C  1 238 ? 111.535 71.135  40.421  0.50 28.08 ? 266  GLU C CD    1 
ATOM   7482  O  OE1   A GLU C  1 238 ? 111.002 69.122  41.349  0.50 28.01 ? 266  GLU C OE1   1 
ATOM   7483  O  OE1   B GLU C  1 238 ? 111.189 69.983  40.067  0.50 26.86 ? 266  GLU C OE1   1 
ATOM   7484  O  OE2   A GLU C  1 238 ? 111.215 69.249  43.528  0.50 27.93 ? 266  GLU C OE2   1 
ATOM   7485  O  OE2   B GLU C  1 238 ? 111.274 72.171  39.762  0.50 29.86 ? 266  GLU C OE2   1 
ATOM   7486  N  N     . ASN C  1 239 ? 116.470 71.664  43.692  1.00 22.98 ? 267  ASN C N     1 
ATOM   7487  C  CA    . ASN C  1 239 ? 117.516 71.097  44.546  1.00 22.37 ? 267  ASN C CA    1 
ATOM   7488  C  C     . ASN C  1 239 ? 118.629 70.454  43.712  1.00 21.84 ? 267  ASN C C     1 
ATOM   7489  O  O     . ASN C  1 239 ? 119.015 69.300  43.915  1.00 21.87 ? 267  ASN C O     1 
ATOM   7490  C  CB    . ASN C  1 239 ? 116.909 70.124  45.560  1.00 22.03 ? 267  ASN C CB    1 
ATOM   7491  C  CG    . ASN C  1 239 ? 116.054 70.841  46.604  1.00 22.90 ? 267  ASN C CG    1 
ATOM   7492  O  OD1   . ASN C  1 239 ? 116.519 71.776  47.254  1.00 21.05 ? 267  ASN C OD1   1 
ATOM   7493  N  ND2   . ASN C  1 239 ? 114.796 70.412  46.752  1.00 21.05 ? 267  ASN C ND2   1 
ATOM   7494  N  N     . VAL C  1 240 ? 119.112 71.227  42.753  1.00 21.83 ? 268  VAL C N     1 
ATOM   7495  C  CA    . VAL C  1 240 ? 120.190 70.792  41.878  1.00 22.44 ? 268  VAL C CA    1 
ATOM   7496  C  C     . VAL C  1 240 ? 121.518 70.945  42.624  1.00 22.87 ? 268  VAL C C     1 
ATOM   7497  O  O     . VAL C  1 240 ? 121.841 72.012  43.146  1.00 23.22 ? 268  VAL C O     1 
ATOM   7498  C  CB    . VAL C  1 240 ? 120.178 71.584  40.548  1.00 22.90 ? 268  VAL C CB    1 
ATOM   7499  C  CG1   . VAL C  1 240 ? 121.480 71.327  39.739  1.00 21.90 ? 268  VAL C CG1   1 
ATOM   7500  C  CG2   . VAL C  1 240 ? 118.900 71.230  39.747  1.00 21.68 ? 268  VAL C CG2   1 
ATOM   7501  N  N     . LYS C  1 241 ? 122.273 69.857  42.690  1.00 23.45 ? 269  LYS C N     1 
ATOM   7502  C  CA    . LYS C  1 241 ? 123.494 69.814  43.499  1.00 23.85 ? 269  LYS C CA    1 
ATOM   7503  C  C     . LYS C  1 241 ? 124.734 69.967  42.637  1.00 23.90 ? 269  LYS C C     1 
ATOM   7504  O  O     . LYS C  1 241 ? 124.962 69.189  41.724  1.00 23.96 ? 269  LYS C O     1 
ATOM   7505  C  CB    . LYS C  1 241 ? 123.515 68.525  44.293  1.00 23.89 ? 269  LYS C CB    1 
ATOM   7506  C  CG    . LYS C  1 241 ? 122.285 68.413  45.161  1.00 24.58 ? 269  LYS C CG    1 
ATOM   7507  C  CD    . LYS C  1 241 ? 122.278 67.129  45.891  1.00 24.87 ? 269  LYS C CD    1 
ATOM   7508  C  CE    . LYS C  1 241 ? 120.973 66.880  46.581  1.00 22.90 ? 269  LYS C CE    1 
ATOM   7509  N  NZ    . LYS C  1 241 ? 121.019 65.480  47.088  1.00 24.03 ? 269  LYS C NZ    1 
ATOM   7510  N  N     . VAL C  1 242 ? 125.524 70.998  42.929  1.00 23.96 ? 270  VAL C N     1 
ATOM   7511  C  CA    . VAL C  1 242 ? 126.706 71.314  42.147  1.00 23.77 ? 270  VAL C CA    1 
ATOM   7512  C  C     . VAL C  1 242 ? 127.939 71.220  43.056  1.00 23.62 ? 270  VAL C C     1 
ATOM   7513  O  O     . VAL C  1 242 ? 127.975 71.880  44.084  1.00 22.81 ? 270  VAL C O     1 
ATOM   7514  C  CB    . VAL C  1 242 ? 126.596 72.746  41.561  1.00 23.83 ? 270  VAL C CB    1 
ATOM   7515  C  CG1   . VAL C  1 242 ? 127.817 73.088  40.713  1.00 23.82 ? 270  VAL C CG1   1 
ATOM   7516  C  CG2   . VAL C  1 242 ? 125.292 72.902  40.767  1.00 24.70 ? 270  VAL C CG2   1 
ATOM   7517  N  N     . PRO C  1 243 ? 128.952 70.402  42.679  1.00 23.52 ? 271  PRO C N     1 
ATOM   7518  C  CA    . PRO C  1 243 ? 130.166 70.352  43.496  1.00 24.33 ? 271  PRO C CA    1 
ATOM   7519  C  C     . PRO C  1 243 ? 130.760 71.739  43.654  1.00 24.11 ? 271  PRO C C     1 
ATOM   7520  O  O     . PRO C  1 243 ? 130.703 72.525  42.724  1.00 24.20 ? 271  PRO C O     1 
ATOM   7521  C  CB    . PRO C  1 243 ? 131.122 69.460  42.684  1.00 24.20 ? 271  PRO C CB    1 
ATOM   7522  C  CG    . PRO C  1 243 ? 130.278 68.725  41.729  1.00 24.28 ? 271  PRO C CG    1 
ATOM   7523  C  CD    . PRO C  1 243 ? 129.028 69.517  41.505  1.00 24.05 ? 271  PRO C CD    1 
ATOM   7524  N  N     . GLU C  1 244 ? 131.335 72.029  44.815  1.00 25.12 ? 272  GLU C N     1 
ATOM   7525  C  CA    . GLU C  1 244 ? 131.998 73.318  45.051  1.00 25.95 ? 272  GLU C CA    1 
ATOM   7526  C  C     . GLU C  1 244 ? 133.100 73.607  44.016  1.00 25.96 ? 272  GLU C C     1 
ATOM   7527  O  O     . GLU C  1 244 ? 133.351 74.767  43.674  1.00 25.60 ? 272  GLU C O     1 
ATOM   7528  C  CB    . GLU C  1 244 ? 132.572 73.376  46.480  1.00 26.30 ? 272  GLU C CB    1 
ATOM   7529  C  CG    . GLU C  1 244 ? 133.670 72.344  46.777  1.00 27.32 ? 272  GLU C CG    1 
ATOM   7530  C  CD    . GLU C  1 244 ? 134.128 72.343  48.233  1.00 28.40 ? 272  GLU C CD    1 
ATOM   7531  O  OE1   . GLU C  1 244 ? 133.895 73.349  48.945  1.00 30.81 ? 272  GLU C OE1   1 
ATOM   7532  O  OE2   . GLU C  1 244 ? 134.722 71.324  48.659  1.00 31.70 ? 272  GLU C OE2   1 
ATOM   7533  N  N     . ALA C  1 245 ? 133.736 72.553  43.504  1.00 26.20 ? 273  ALA C N     1 
ATOM   7534  C  CA    . ALA C  1 245 ? 134.803 72.707  42.512  1.00 26.57 ? 273  ALA C CA    1 
ATOM   7535  C  C     . ALA C  1 245 ? 134.277 73.217  41.173  1.00 26.68 ? 273  ALA C C     1 
ATOM   7536  O  O     . ALA C  1 245 ? 135.059 73.650  40.336  1.00 26.90 ? 273  ALA C O     1 
ATOM   7537  C  CB    . ALA C  1 245 ? 135.568 71.378  42.321  1.00 26.42 ? 273  ALA C CB    1 
ATOM   7538  N  N     . ASN C  1 246 ? 132.955 73.170  40.976  1.00 26.92 ? 274  ASN C N     1 
ATOM   7539  C  CA    . ASN C  1 246 ? 132.329 73.653  39.752  1.00 26.93 ? 274  ASN C CA    1 
ATOM   7540  C  C     . ASN C  1 246 ? 131.948 75.127  39.774  1.00 26.96 ? 274  ASN C C     1 
ATOM   7541  O  O     . ASN C  1 246 ? 131.356 75.614  38.830  1.00 26.90 ? 274  ASN C O     1 
ATOM   7542  C  CB    . ASN C  1 246 ? 131.103 72.801  39.398  1.00 26.90 ? 274  ASN C CB    1 
ATOM   7543  C  CG    . ASN C  1 246 ? 131.485 71.451  38.893  1.00 27.89 ? 274  ASN C CG    1 
ATOM   7544  O  OD1   . ASN C  1 246 ? 132.528 70.917  39.275  1.00 29.62 ? 274  ASN C OD1   1 
ATOM   7545  N  ND2   . ASN C  1 246 ? 130.642 70.867  38.051  1.00 29.75 ? 274  ASN C ND2   1 
ATOM   7546  N  N     . ILE C  1 247 ? 132.308 75.845  40.833  1.00 27.43 ? 275  ILE C N     1 
ATOM   7547  C  CA    . ILE C  1 247 ? 132.173 77.288  40.814  1.00 28.03 ? 275  ILE C CA    1 
ATOM   7548  C  C     . ILE C  1 247 ? 133.177 77.835  39.785  1.00 28.56 ? 275  ILE C C     1 
ATOM   7549  O  O     . ILE C  1 247 ? 134.350 77.474  39.807  1.00 27.84 ? 275  ILE C O     1 
ATOM   7550  C  CB    . ILE C  1 247 ? 132.429 77.918  42.188  1.00 28.20 ? 275  ILE C CB    1 
ATOM   7551  C  CG1   . ILE C  1 247 ? 131.311 77.531  43.168  1.00 28.31 ? 275  ILE C CG1   1 
ATOM   7552  C  CG2   . ILE C  1 247 ? 132.508 79.473  42.088  1.00 27.38 ? 275  ILE C CG2   1 
ATOM   7553  C  CD1   . ILE C  1 247 ? 131.645 77.898  44.611  1.00 28.42 ? 275  ILE C CD1   1 
ATOM   7554  N  N     . LEU C  1 248 ? 132.690 78.679  38.877  1.00 28.93 ? 276  LEU C N     1 
ATOM   7555  C  CA    . LEU C  1 248 ? 133.553 79.344  37.917  1.00 29.60 ? 276  LEU C CA    1 
ATOM   7556  C  C     . LEU C  1 248 ? 133.974 80.694  38.492  1.00 30.18 ? 276  LEU C C     1 
ATOM   7557  O  O     . LEU C  1 248 ? 133.134 81.582  38.709  1.00 30.58 ? 276  LEU C O     1 
ATOM   7558  C  CB    . LEU C  1 248 ? 132.828 79.523  36.588  1.00 29.62 ? 276  LEU C CB    1 
ATOM   7559  C  CG    . LEU C  1 248 ? 133.639 80.104  35.428  1.00 29.81 ? 276  LEU C CG    1 
ATOM   7560  C  CD1   . LEU C  1 248 ? 134.771 79.162  35.040  1.00 27.05 ? 276  LEU C CD1   1 
ATOM   7561  C  CD2   . LEU C  1 248 ? 132.719 80.385  34.218  1.00 29.74 ? 276  LEU C CD2   1 
ATOM   7562  N  N     . GLY C  1 249 ? 135.269 80.832  38.758  1.00 30.63 ? 277  GLY C N     1 
ATOM   7563  C  CA    . GLY C  1 249 ? 135.834 82.090  39.234  1.00 31.18 ? 277  GLY C CA    1 
ATOM   7564  C  C     . GLY C  1 249 ? 135.624 82.285  40.725  1.00 31.61 ? 277  GLY C C     1 
ATOM   7565  O  O     . GLY C  1 249 ? 135.627 81.312  41.482  1.00 31.58 ? 277  GLY C O     1 
ATOM   7566  N  N     . GLN C  1 250 ? 135.459 83.542  41.142  1.00 31.91 ? 278  GLN C N     1 
ATOM   7567  C  CA    . GLN C  1 250 ? 135.293 83.891  42.560  1.00 32.60 ? 278  GLN C CA    1 
ATOM   7568  C  C     . GLN C  1 250 ? 133.825 83.948  42.950  1.00 31.75 ? 278  GLN C C     1 
ATOM   7569  O  O     . GLN C  1 250 ? 133.008 84.451  42.186  1.00 31.39 ? 278  GLN C O     1 
ATOM   7570  C  CB    . GLN C  1 250 ? 135.888 85.271  42.866  1.00 32.55 ? 278  GLN C CB    1 
ATOM   7571  C  CG    . GLN C  1 250 ? 137.380 85.346  42.891  1.00 34.67 ? 278  GLN C CG    1 
ATOM   7572  C  CD    . GLN C  1 250 ? 137.865 86.754  43.239  1.00 34.90 ? 278  GLN C CD    1 
ATOM   7573  O  OE1   . GLN C  1 250 ? 137.719 87.219  44.381  1.00 37.63 ? 278  GLN C OE1   1 
ATOM   7574  N  NE2   . GLN C  1 250 ? 138.447 87.434  42.255  1.00 37.16 ? 278  GLN C NE2   1 
ATOM   7575  N  N     . ILE C  1 251 ? 133.509 83.500  44.169  1.00 31.21 ? 279  ILE C N     1 
ATOM   7576  C  CA    . ILE C  1 251 ? 132.151 83.650  44.717  1.00 30.55 ? 279  ILE C CA    1 
ATOM   7577  C  C     . ILE C  1 251 ? 131.764 85.138  44.772  1.00 30.00 ? 279  ILE C C     1 
ATOM   7578  O  O     . ILE C  1 251 ? 132.553 85.991  45.208  1.00 28.93 ? 279  ILE C O     1 
ATOM   7579  C  CB    . ILE C  1 251 ? 132.004 83.047  46.141  1.00 30.45 ? 279  ILE C CB    1 
ATOM   7580  C  CG1   . ILE C  1 251 ? 132.308 81.547  46.138  1.00 30.41 ? 279  ILE C CG1   1 
ATOM   7581  C  CG2   . ILE C  1 251 ? 130.574 83.259  46.665  1.00 30.66 ? 279  ILE C CG2   1 
ATOM   7582  C  CD1   . ILE C  1 251 ? 132.507 80.959  47.527  1.00 31.38 ? 279  ILE C CD1   1 
ATOM   7583  N  N     . GLY C  1 252 ? 130.559 85.448  44.307  1.00 29.39 ? 280  GLY C N     1 
ATOM   7584  C  CA    . GLY C  1 252 ? 130.069 86.822  44.324  1.00 29.70 ? 280  GLY C CA    1 
ATOM   7585  C  C     . GLY C  1 252 ? 130.492 87.679  43.136  1.00 29.80 ? 280  GLY C C     1 
ATOM   7586  O  O     . GLY C  1 252 ? 130.048 88.813  43.021  1.00 30.48 ? 280  GLY C O     1 
ATOM   7587  N  N     . HIS C  1 253 ? 131.314 87.136  42.238  1.00 29.77 ? 281  HIS C N     1 
ATOM   7588  C  CA    . HIS C  1 253 ? 131.773 87.872  41.052  1.00 30.06 ? 281  HIS C CA    1 
ATOM   7589  C  C     . HIS C  1 253 ? 131.050 87.459  39.767  1.00 29.52 ? 281  HIS C C     1 
ATOM   7590  O  O     . HIS C  1 253 ? 131.318 88.002  38.697  1.00 29.08 ? 281  HIS C O     1 
ATOM   7591  C  CB    . HIS C  1 253 ? 133.297 87.723  40.904  1.00 30.81 ? 281  HIS C CB    1 
ATOM   7592  C  CG    . HIS C  1 253 ? 134.072 88.439  41.970  1.00 31.87 ? 281  HIS C CG    1 
ATOM   7593  N  ND1   . HIS C  1 253 ? 133.926 88.162  43.313  1.00 34.70 ? 281  HIS C ND1   1 
ATOM   7594  C  CD2   . HIS C  1 253 ? 134.990 89.433  41.891  1.00 33.64 ? 281  HIS C CD2   1 
ATOM   7595  C  CE1   . HIS C  1 253 ? 134.724 88.948  44.016  1.00 34.98 ? 281  HIS C CE1   1 
ATOM   7596  N  NE2   . HIS C  1 253 ? 135.379 89.731  43.177  1.00 34.75 ? 281  HIS C NE2   1 
ATOM   7597  N  N     . GLY C  1 254 ? 130.106 86.527  39.882  1.00 28.66 ? 282  GLY C N     1 
ATOM   7598  C  CA    . GLY C  1 254 ? 129.347 86.049  38.741  1.00 28.84 ? 282  GLY C CA    1 
ATOM   7599  C  C     . GLY C  1 254 ? 128.600 87.134  37.984  1.00 28.79 ? 282  GLY C C     1 
ATOM   7600  O  O     . GLY C  1 254 ? 128.368 87.000  36.778  1.00 27.54 ? 282  GLY C O     1 
ATOM   7601  N  N     . TYR C  1 255 ? 128.206 88.202  38.685  1.00 29.27 ? 283  TYR C N     1 
ATOM   7602  C  CA    . TYR C  1 255 ? 127.538 89.319  38.031  1.00 29.88 ? 283  TYR C CA    1 
ATOM   7603  C  C     . TYR C  1 255 ? 128.535 90.029  37.121  1.00 29.99 ? 283  TYR C C     1 
ATOM   7604  O  O     . TYR C  1 255 ? 128.168 90.457  36.029  1.00 29.42 ? 283  TYR C O     1 
ATOM   7605  C  CB    . TYR C  1 255 ? 126.898 90.292  39.033  1.00 30.53 ? 283  TYR C CB    1 
ATOM   7606  C  CG    . TYR C  1 255 ? 127.847 91.207  39.758  1.00 30.85 ? 283  TYR C CG    1 
ATOM   7607  C  CD1   . TYR C  1 255 ? 128.083 92.504  39.299  1.00 31.64 ? 283  TYR C CD1   1 
ATOM   7608  C  CD2   . TYR C  1 255 ? 128.508 90.787  40.908  1.00 30.98 ? 283  TYR C CD2   1 
ATOM   7609  C  CE1   . TYR C  1 255 ? 128.965 93.351  39.960  1.00 32.06 ? 283  TYR C CE1   1 
ATOM   7610  C  CE2   . TYR C  1 255 ? 129.387 91.622  41.570  1.00 32.14 ? 283  TYR C CE2   1 
ATOM   7611  C  CZ    . TYR C  1 255 ? 129.608 92.909  41.096  1.00 31.92 ? 283  TYR C CZ    1 
ATOM   7612  O  OH    . TYR C  1 255 ? 130.479 93.737  41.770  1.00 31.87 ? 283  TYR C OH    1 
ATOM   7613  N  N     . LYS C  1 256 ? 129.788 90.111  37.560  1.00 30.21 ? 284  LYS C N     1 
ATOM   7614  C  CA    . LYS C  1 256 ? 130.850 90.719  36.756  1.00 30.82 ? 284  LYS C CA    1 
ATOM   7615  C  C     . LYS C  1 256 ? 131.142 89.912  35.505  1.00 30.62 ? 284  LYS C C     1 
ATOM   7616  O  O     . LYS C  1 256 ? 131.299 90.482  34.425  1.00 29.79 ? 284  LYS C O     1 
ATOM   7617  C  CB    . LYS C  1 256 ? 132.129 90.935  37.573  1.00 31.14 ? 284  LYS C CB    1 
ATOM   7618  C  CG    . LYS C  1 256 ? 131.964 91.964  38.687  1.00 31.75 ? 284  LYS C CG    1 
ATOM   7619  C  CD    . LYS C  1 256 ? 133.281 92.220  39.426  1.00 32.32 ? 284  LYS C CD    1 
ATOM   7620  N  N     . TYR C  1 257 ? 131.182 88.593  35.646  1.00 30.86 ? 285  TYR C N     1 
ATOM   7621  C  CA    . TYR C  1 257 ? 131.432 87.704  34.512  1.00 31.53 ? 285  TYR C CA    1 
ATOM   7622  C  C     . TYR C  1 257 ? 130.279 87.705  33.520  1.00 32.16 ? 285  TYR C C     1 
ATOM   7623  O  O     . TYR C  1 257 ? 130.506 87.642  32.319  1.00 32.36 ? 285  TYR C O     1 
ATOM   7624  C  CB    . TYR C  1 257 ? 131.713 86.271  34.976  1.00 31.67 ? 285  TYR C CB    1 
ATOM   7625  C  CG    . TYR C  1 257 ? 132.733 86.151  36.079  1.00 31.35 ? 285  TYR C CG    1 
ATOM   7626  C  CD1   . TYR C  1 257 ? 133.794 87.032  36.179  1.00 31.82 ? 285  TYR C CD1   1 
ATOM   7627  C  CD2   . TYR C  1 257 ? 132.627 85.140  37.035  1.00 32.88 ? 285  TYR C CD2   1 
ATOM   7628  C  CE1   . TYR C  1 257 ? 134.724 86.925  37.203  1.00 31.07 ? 285  TYR C CE1   1 
ATOM   7629  C  CE2   . TYR C  1 257 ? 133.547 85.022  38.051  1.00 31.91 ? 285  TYR C CE2   1 
ATOM   7630  C  CZ    . TYR C  1 257 ? 134.592 85.914  38.132  1.00 32.31 ? 285  TYR C CZ    1 
ATOM   7631  O  OH    . TYR C  1 257 ? 135.500 85.797  39.145  1.00 31.44 ? 285  TYR C OH    1 
ATOM   7632  N  N     . ALA C  1 258 ? 129.046 87.782  34.023  1.00 32.60 ? 286  ALA C N     1 
ATOM   7633  C  CA    . ALA C  1 258 ? 127.872 87.788  33.160  1.00 33.07 ? 286  ALA C CA    1 
ATOM   7634  C  C     . ALA C  1 258 ? 127.908 88.999  32.230  1.00 33.55 ? 286  ALA C C     1 
ATOM   7635  O  O     . ALA C  1 258 ? 127.829 88.847  31.006  1.00 34.13 ? 286  ALA C O     1 
ATOM   7636  C  CB    . ALA C  1 258 ? 126.583 87.786  33.981  1.00 32.78 ? 286  ALA C CB    1 
ATOM   7637  N  N     . ILE C  1 259 ? 128.022 90.188  32.807  1.00 33.63 ? 287  ILE C N     1 
ATOM   7638  C  CA    . ILE C  1 259 ? 127.965 91.412  32.016  1.00 34.11 ? 287  ILE C CA    1 
ATOM   7639  C  C     . ILE C  1 259 ? 129.246 91.636  31.205  1.00 33.16 ? 287  ILE C C     1 
ATOM   7640  O  O     . ILE C  1 259 ? 129.181 92.156  30.099  1.00 32.64 ? 287  ILE C O     1 
ATOM   7641  C  CB    . ILE C  1 259 ? 127.586 92.658  32.877  1.00 34.62 ? 287  ILE C CB    1 
ATOM   7642  C  CG1   . ILE C  1 259 ? 127.118 93.817  31.969  1.00 36.74 ? 287  ILE C CG1   1 
ATOM   7643  C  CG2   . ILE C  1 259 ? 128.732 93.090  33.786  1.00 34.04 ? 287  ILE C CG2   1 
ATOM   7644  C  CD1   . ILE C  1 259 ? 126.047 93.460  30.926  1.00 37.03 ? 287  ILE C CD1   1 
ATOM   7645  N  N     . GLY C  1 260 ? 130.396 91.237  31.740  1.00 32.40 ? 288  GLY C N     1 
ATOM   7646  C  CA    . GLY C  1 260 ? 131.626 91.191  30.950  1.00 32.36 ? 288  GLY C CA    1 
ATOM   7647  C  C     . GLY C  1 260 ? 131.481 90.384  29.668  1.00 32.38 ? 288  GLY C C     1 
ATOM   7648  O  O     . GLY C  1 260 ? 131.827 90.863  28.588  1.00 32.28 ? 288  GLY C O     1 
ATOM   7649  N  N     . SER C  1 261 ? 130.960 89.155  29.766  1.00 32.02 ? 289  SER C N     1 
ATOM   7650  C  CA    . SER C  1 261 ? 130.807 88.302  28.573  1.00 31.81 ? 289  SER C CA    1 
ATOM   7651  C  C     . SER C  1 261 ? 129.741 88.880  27.643  1.00 31.63 ? 289  SER C C     1 
ATOM   7652  O  O     . SER C  1 261 ? 129.909 88.860  26.415  1.00 31.36 ? 289  SER C O     1 
ATOM   7653  C  CB    . SER C  1 261 ? 130.541 86.822  28.939  1.00 31.97 ? 289  SER C CB    1 
ATOM   7654  O  OG    . SER C  1 261 ? 129.273 86.647  29.546  1.00 31.58 ? 289  SER C OG    1 
ATOM   7655  N  N     . LEU C  1 262 ? 128.690 89.461  28.225  1.00 31.06 ? 290  LEU C N     1 
ATOM   7656  C  CA    . LEU C  1 262 ? 127.656 90.136  27.440  1.00 30.78 ? 290  LEU C CA    1 
ATOM   7657  C  C     . LEU C  1 262 ? 128.120 91.424  26.743  1.00 30.18 ? 290  LEU C C     1 
ATOM   7658  O  O     . LEU C  1 262 ? 127.582 91.755  25.700  1.00 30.50 ? 290  LEU C O     1 
ATOM   7659  C  CB    . LEU C  1 262 ? 126.408 90.409  28.283  1.00 31.20 ? 290  LEU C CB    1 
ATOM   7660  C  CG    . LEU C  1 262 ? 125.647 89.148  28.741  1.00 31.79 ? 290  LEU C CG    1 
ATOM   7661  C  CD1   . LEU C  1 262 ? 124.679 89.510  29.863  1.00 32.87 ? 290  LEU C CD1   1 
ATOM   7662  C  CD2   . LEU C  1 262 ? 124.917 88.429  27.608  1.00 32.52 ? 290  LEU C CD2   1 
ATOM   7663  N  N     . ASN C  1 263 ? 129.098 92.140  27.300  1.00 29.11 ? 291  ASN C N     1 
ATOM   7664  C  CA    . ASN C  1 263 ? 129.744 93.265  26.577  1.00 28.90 ? 291  ASN C CA    1 
ATOM   7665  C  C     . ASN C  1 263 ? 130.403 92.821  25.261  1.00 28.83 ? 291  ASN C C     1 
ATOM   7666  O  O     . ASN C  1 263 ? 130.257 93.479  24.230  1.00 28.96 ? 291  ASN C O     1 
ATOM   7667  C  CB    . ASN C  1 263 ? 130.746 94.020  27.475  1.00 28.80 ? 291  ASN C CB    1 
ATOM   7668  C  CG    . ASN C  1 263 ? 130.044 94.910  28.502  1.00 29.16 ? 291  ASN C CG    1 
ATOM   7669  O  OD1   . ASN C  1 263 ? 128.904 95.289  28.293  1.00 31.64 ? 291  ASN C OD1   1 
ATOM   7670  N  ND2   . ASN C  1 263 ? 130.702 95.209  29.626  1.00 26.10 ? 291  ASN C ND2   1 
ATOM   7671  N  N     . GLU C  1 264 ? 131.083 91.680  25.301  1.00 28.15 ? 292  GLU C N     1 
ATOM   7672  C  CA    . GLU C  1 264 ? 131.657 91.055  24.108  1.00 28.57 ? 292  GLU C CA    1 
ATOM   7673  C  C     . GLU C  1 264 ? 130.567 90.427  23.224  1.00 27.71 ? 292  GLU C C     1 
ATOM   7674  O  O     . GLU C  1 264 ? 130.634 90.497  21.993  1.00 28.08 ? 292  GLU C O     1 
ATOM   7675  C  CB    A GLU C  1 264 ? 132.689 89.992  24.520  0.50 28.40 ? 292  GLU C CB    1 
ATOM   7676  C  CB    B GLU C  1 264 ? 132.688 89.994  24.498  0.50 28.33 ? 292  GLU C CB    1 
ATOM   7677  C  CG    A GLU C  1 264 ? 133.569 89.513  23.388  0.50 29.18 ? 292  GLU C CG    1 
ATOM   7678  C  CG    B GLU C  1 264 ? 133.798 90.534  25.384  0.50 28.37 ? 292  GLU C CG    1 
ATOM   7679  C  CD    A GLU C  1 264 ? 134.661 88.549  23.842  0.50 29.05 ? 292  GLU C CD    1 
ATOM   7680  C  CD    B GLU C  1 264 ? 134.936 89.554  25.570  0.50 29.65 ? 292  GLU C CD    1 
ATOM   7681  O  OE1   A GLU C  1 264 ? 135.514 88.937  24.665  0.50 29.92 ? 292  GLU C OE1   1 
ATOM   7682  O  OE1   B GLU C  1 264 ? 134.938 88.497  24.903  0.50 30.77 ? 292  GLU C OE1   1 
ATOM   7683  O  OE2   A GLU C  1 264 ? 134.670 87.402  23.364  0.50 29.79 ? 292  GLU C OE2   1 
ATOM   7684  O  OE2   B GLU C  1 264 ? 135.841 89.853  26.386  0.50 33.22 ? 292  GLU C OE2   1 
ATOM   7685  N  N     . GLY C  1 265 ? 129.570 89.825  23.863  1.00 27.05 ? 293  GLY C N     1 
ATOM   7686  C  CA    . GLY C  1 265 ? 128.407 89.273  23.180  1.00 27.23 ? 293  GLY C CA    1 
ATOM   7687  C  C     . GLY C  1 265 ? 127.630 90.288  22.343  1.00 27.53 ? 293  GLY C C     1 
ATOM   7688  O  O     . GLY C  1 265 ? 127.089 89.947  21.291  1.00 28.58 ? 293  GLY C O     1 
ATOM   7689  N  N     . ARG C  1 266 ? 127.582 91.531  22.795  1.00 27.32 ? 294  ARG C N     1 
ATOM   7690  C  CA    . ARG C  1 266 ? 126.931 92.594  22.021  1.00 28.11 ? 294  ARG C CA    1 
ATOM   7691  C  C     . ARG C  1 266 ? 127.590 92.858  20.682  1.00 27.03 ? 294  ARG C C     1 
ATOM   7692  O  O     . ARG C  1 266 ? 126.902 93.140  19.718  1.00 28.11 ? 294  ARG C O     1 
ATOM   7693  C  CB    . ARG C  1 266 ? 126.889 93.868  22.824  1.00 28.47 ? 294  ARG C CB    1 
ATOM   7694  C  CG    A ARG C  1 266 ? 125.709 93.731  23.837  0.50 28.62 ? 294  ARG C CG    1 
ATOM   7695  C  CG    B ARG C  1 266 ? 125.922 93.954  23.939  0.50 31.20 ? 294  ARG C CG    1 
ATOM   7696  C  CD    A ARG C  1 266 ? 125.861 94.470  25.142  0.50 27.54 ? 294  ARG C CD    1 
ATOM   7697  C  CD    B ARG C  1 266 ? 126.567 94.925  24.869  0.50 33.59 ? 294  ARG C CD    1 
ATOM   7698  N  NE    A ARG C  1 266 ? 124.781 94.140  26.084  0.50 25.55 ? 294  ARG C NE    1 
ATOM   7699  N  NE    B ARG C  1 266 ? 125.661 95.641  25.735  0.50 35.37 ? 294  ARG C NE    1 
ATOM   7700  C  CZ    A ARG C  1 266 ? 124.541 94.818  27.208  0.50 25.40 ? 294  ARG C CZ    1 
ATOM   7701  C  CZ    B ARG C  1 266 ? 126.075 96.571  26.581  0.50 35.53 ? 294  ARG C CZ    1 
ATOM   7702  N  NH1   A ARG C  1 266 ? 125.300 95.841  27.557  0.50 24.39 ? 294  ARG C NH1   1 
ATOM   7703  N  NH1   B ARG C  1 266 ? 125.201 97.201  27.345  0.50 35.81 ? 294  ARG C NH1   1 
ATOM   7704  N  NH2   A ARG C  1 266 ? 123.541 94.466  27.999  0.50 26.21 ? 294  ARG C NH2   1 
ATOM   7705  N  NH2   B ARG C  1 266 ? 127.371 96.877  26.648  0.50 34.75 ? 294  ARG C NH2   1 
ATOM   7706  N  N     . ILE C  1 267 ? 128.913 92.754  20.636  1.00 25.78 ? 295  ILE C N     1 
ATOM   7707  C  CA    . ILE C  1 267 ? 129.628 92.806  19.371  1.00 25.54 ? 295  ILE C CA    1 
ATOM   7708  C  C     . ILE C  1 267 ? 129.245 91.623  18.488  1.00 25.41 ? 295  ILE C C     1 
ATOM   7709  O  O     . ILE C  1 267 ? 129.073 91.783  17.269  1.00 26.04 ? 295  ILE C O     1 
ATOM   7710  C  CB    . ILE C  1 267 ? 131.166 92.848  19.561  1.00 25.15 ? 295  ILE C CB    1 
ATOM   7711  C  CG1   . ILE C  1 267 ? 131.555 94.022  20.464  1.00 25.15 ? 295  ILE C CG1   1 
ATOM   7712  C  CG2   . ILE C  1 267 ? 131.868 92.962  18.171  1.00 24.42 ? 295  ILE C CG2   1 
ATOM   7713  C  CD1   . ILE C  1 267 ? 133.040 94.110  20.795  1.00 24.51 ? 295  ILE C CD1   1 
ATOM   7714  N  N     . GLY C  1 268 ? 129.108 90.442  19.099  1.00 25.29 ? 296  GLY C N     1 
ATOM   7715  C  CA    . GLY C  1 268 ? 128.700 89.233  18.387  1.00 25.42 ? 296  GLY C CA    1 
ATOM   7716  C  C     . GLY C  1 268 ? 127.304 89.322  17.786  1.00 25.16 ? 296  GLY C C     1 
ATOM   7717  O  O     . GLY C  1 268 ? 127.090 88.905  16.647  1.00 24.61 ? 296  GLY C O     1 
ATOM   7718  N  N     . ILE C  1 269 ? 126.365 89.899  18.547  1.00 24.70 ? 297  ILE C N     1 
ATOM   7719  C  CA    . ILE C  1 269 ? 125.016 90.110  18.078  1.00 25.22 ? 297  ILE C CA    1 
ATOM   7720  C  C     . ILE C  1 269 ? 124.954 91.215  17.020  1.00 24.80 ? 297  ILE C C     1 
ATOM   7721  O  O     . ILE C  1 269 ? 124.208 91.086  16.062  1.00 24.39 ? 297  ILE C O     1 
ATOM   7722  C  CB    . ILE C  1 269 ? 124.023 90.353  19.247  1.00 25.58 ? 297  ILE C CB    1 
ATOM   7723  C  CG1   . ILE C  1 269 ? 123.992 89.124  20.177  1.00 26.35 ? 297  ILE C CG1   1 
ATOM   7724  C  CG2   . ILE C  1 269 ? 122.601 90.636  18.723  1.00 25.25 ? 297  ILE C CG2   1 
ATOM   7725  C  CD1   . ILE C  1 269 ? 123.703 87.775  19.457  1.00 26.03 ? 297  ILE C CD1   1 
ATOM   7726  N  N     . ALA C  1 270 ? 125.746 92.281  17.190  1.00 25.26 ? 298  ALA C N     1 
ATOM   7727  C  CA    . ALA C  1 270 ? 125.954 93.266  16.109  1.00 25.18 ? 298  ALA C CA    1 
ATOM   7728  C  C     . ALA C  1 270 ? 126.370 92.567  14.824  1.00 24.71 ? 298  ALA C C     1 
ATOM   7729  O  O     . ALA C  1 270 ? 125.805 92.834  13.775  1.00 25.44 ? 298  ALA C O     1 
ATOM   7730  C  CB    . ALA C  1 270 ? 126.986 94.336  16.504  1.00 23.76 ? 298  ALA C CB    1 
ATOM   7731  N  N     . ALA C  1 271 ? 127.312 91.634  14.919  1.00 24.56 ? 299  ALA C N     1 
ATOM   7732  C  CA    . ALA C  1 271 ? 127.809 90.875  13.753  1.00 25.27 ? 299  ALA C CA    1 
ATOM   7733  C  C     . ALA C  1 271 ? 126.734 89.977  13.118  1.00 24.80 ? 299  ALA C C     1 
ATOM   7734  O  O     . ALA C  1 271 ? 126.614 89.903  11.899  1.00 24.38 ? 299  ALA C O     1 
ATOM   7735  C  CB    . ALA C  1 271 ? 129.033 90.038  14.145  1.00 24.71 ? 299  ALA C CB    1 
ATOM   7736  N  N     . GLN C  1 272 ? 125.949 89.314  13.957  1.00 25.25 ? 300  GLN C N     1 
ATOM   7737  C  CA    . GLN C  1 272 ? 124.826 88.508  13.486  1.00 26.08 ? 300  GLN C CA    1 
ATOM   7738  C  C     . GLN C  1 272 ? 123.804 89.371  12.738  1.00 26.30 ? 300  GLN C C     1 
ATOM   7739  O  O     . GLN C  1 272 ? 123.357 89.011  11.649  1.00 26.01 ? 300  GLN C O     1 
ATOM   7740  C  CB    . GLN C  1 272 ? 124.128 87.841  14.657  1.00 26.12 ? 300  GLN C CB    1 
ATOM   7741  C  CG    . GLN C  1 272 ? 122.902 86.968  14.287  1.00 25.89 ? 300  GLN C CG    1 
ATOM   7742  C  CD    . GLN C  1 272 ? 121.917 86.871  15.419  1.00 25.66 ? 300  GLN C CD    1 
ATOM   7743  O  OE1   . GLN C  1 272 ? 121.812 87.788  16.234  1.00 28.12 ? 300  GLN C OE1   1 
ATOM   7744  N  NE2   . GLN C  1 272 ? 121.176 85.766  15.483  1.00 24.38 ? 300  GLN C NE2   1 
ATOM   7745  N  N     . MET C  1 273 ? 123.396 90.467  13.369  1.00 26.39 ? 301  MET C N     1 
ATOM   7746  C  CA    . MET C  1 273 ? 122.411 91.380  12.774  1.00 26.98 ? 301  MET C CA    1 
ATOM   7747  C  C     . MET C  1 273 ? 122.907 92.004  11.459  1.00 26.82 ? 301  MET C C     1 
ATOM   7748  O  O     . MET C  1 273 ? 122.158 92.093  10.483  1.00 26.72 ? 301  MET C O     1 
ATOM   7749  C  CB    . MET C  1 273 ? 122.023 92.474  13.774  1.00 26.87 ? 301  MET C CB    1 
ATOM   7750  C  CG    . MET C  1 273 ? 121.115 91.984  14.904  1.00 28.74 ? 301  MET C CG    1 
ATOM   7751  S  SD    . MET C  1 273 ? 119.454 91.495  14.357  1.00 29.27 ? 301  MET C SD    1 
ATOM   7752  C  CE    . MET C  1 273 ? 119.359 89.791  14.903  1.00 28.04 ? 301  MET C CE    1 
ATOM   7753  N  N     . LEU C  1 274 ? 124.166 92.419  11.457  1.00 26.59 ? 302  LEU C N     1 
ATOM   7754  C  CA    . LEU C  1 274 ? 124.861 92.861  10.250  1.00 26.91 ? 302  LEU C CA    1 
ATOM   7755  C  C     . LEU C  1 274 ? 124.823 91.813  9.132   1.00 26.40 ? 302  LEU C C     1 
ATOM   7756  O  O     . LEU C  1 274 ? 124.437 92.121  8.014   1.00 24.89 ? 302  LEU C O     1 
ATOM   7757  C  CB    . LEU C  1 274 ? 126.307 93.232  10.576  1.00 26.96 ? 302  LEU C CB    1 
ATOM   7758  C  CG    . LEU C  1 274 ? 127.253 93.591  9.422   1.00 27.62 ? 302  LEU C CG    1 
ATOM   7759  C  CD1   . LEU C  1 274 ? 126.739 94.859  8.699   1.00 27.05 ? 302  LEU C CD1   1 
ATOM   7760  C  CD2   . LEU C  1 274 ? 128.695 93.773  9.944   1.00 26.27 ? 302  LEU C CD2   1 
ATOM   7761  N  N     . GLY C  1 275 ? 125.216 90.578  9.448   1.00 26.34 ? 303  GLY C N     1 
ATOM   7762  C  CA    . GLY C  1 275 ? 125.305 89.521  8.450   1.00 26.15 ? 303  GLY C CA    1 
ATOM   7763  C  C     . GLY C  1 275 ? 123.940 89.166  7.908   1.00 26.21 ? 303  GLY C C     1 
ATOM   7764  O  O     . GLY C  1 275 ? 123.760 89.003  6.712   1.00 26.77 ? 303  GLY C O     1 
ATOM   7765  N  N     . LEU C  1 276 ? 122.963 89.078  8.800   1.00 26.46 ? 304  LEU C N     1 
ATOM   7766  C  CA    . LEU C  1 276 ? 121.574 88.820  8.428   1.00 27.28 ? 304  LEU C CA    1 
ATOM   7767  C  C     . LEU C  1 276 ? 121.061 89.878  7.438   1.00 27.04 ? 304  LEU C C     1 
ATOM   7768  O  O     . LEU C  1 276 ? 120.516 89.538  6.387   1.00 26.98 ? 304  LEU C O     1 
ATOM   7769  C  CB    . LEU C  1 276 ? 120.755 88.863  9.711   1.00 27.70 ? 304  LEU C CB    1 
ATOM   7770  C  CG    . LEU C  1 276 ? 119.264 88.705  9.833   1.00 30.46 ? 304  LEU C CG    1 
ATOM   7771  C  CD1   . LEU C  1 276 ? 119.015 88.684  11.367  1.00 29.88 ? 304  LEU C CD1   1 
ATOM   7772  C  CD2   . LEU C  1 276 ? 118.465 89.788  9.118   1.00 28.54 ? 304  LEU C CD2   1 
ATOM   7773  N  N     . ALA C  1 277 ? 121.218 91.149  7.822   1.00 27.43 ? 305  ALA C N     1 
ATOM   7774  C  CA    . ALA C  1 277 ? 120.810 92.294  6.986   1.00 27.19 ? 305  ALA C CA    1 
ATOM   7775  C  C     . ALA C  1 277 ? 121.544 92.294  5.639   1.00 26.98 ? 305  ALA C C     1 
ATOM   7776  O  O     . ALA C  1 277 ? 120.937 92.527  4.588   1.00 26.86 ? 305  ALA C O     1 
ATOM   7777  C  CB    . ALA C  1 277 ? 121.023 93.625  7.735   1.00 26.37 ? 305  ALA C CB    1 
ATOM   7778  N  N     . GLN C  1 278 ? 122.845 92.020  5.669   1.00 27.15 ? 306  GLN C N     1 
ATOM   7779  C  CA    . GLN C  1 278 ? 123.618 91.951  4.445   1.00 26.94 ? 306  GLN C CA    1 
ATOM   7780  C  C     . GLN C  1 278 ? 123.143 90.833  3.533   1.00 26.68 ? 306  GLN C C     1 
ATOM   7781  O  O     . GLN C  1 278 ? 123.061 91.028  2.319   1.00 25.20 ? 306  GLN C O     1 
ATOM   7782  C  CB    . GLN C  1 278 ? 125.109 91.776  4.717   1.00 27.51 ? 306  GLN C CB    1 
ATOM   7783  C  CG    . GLN C  1 278 ? 125.964 92.011  3.477   1.00 29.90 ? 306  GLN C CG    1 
ATOM   7784  C  CD    . GLN C  1 278 ? 125.939 93.475  3.003   1.00 32.95 ? 306  GLN C CD    1 
ATOM   7785  O  OE1   . GLN C  1 278 ? 126.271 94.390  3.771   1.00 36.38 ? 306  GLN C OE1   1 
ATOM   7786  N  NE2   . GLN C  1 278 ? 125.548 93.696  1.753   1.00 30.78 ? 306  GLN C NE2   1 
ATOM   7787  N  N     . GLY C  1 279 ? 122.904 89.649  4.103   1.00 26.46 ? 307  GLY C N     1 
ATOM   7788  C  CA    . GLY C  1 279 ? 122.429 88.513  3.316   1.00 26.05 ? 307  GLY C CA    1 
ATOM   7789  C  C     . GLY C  1 279 ? 121.093 88.816  2.645   1.00 26.19 ? 307  GLY C C     1 
ATOM   7790  O  O     . GLY C  1 279 ? 120.883 88.484  1.499   1.00 25.82 ? 307  GLY C O     1 
ATOM   7791  N  N     . CYS C  1 280 ? 120.198 89.458  3.381   1.00 26.21 ? 308  CYS C N     1 
ATOM   7792  C  CA    . CYS C  1 280 ? 118.908 89.856  2.857   1.00 26.65 ? 308  CYS C CA    1 
ATOM   7793  C  C     . CYS C  1 280 ? 119.055 90.844  1.694   1.00 25.88 ? 308  CYS C C     1 
ATOM   7794  O  O     . CYS C  1 280 ? 118.493 90.631  0.623   1.00 25.69 ? 308  CYS C O     1 
ATOM   7795  C  CB    . CYS C  1 280 ? 118.056 90.456  3.967   1.00 26.77 ? 308  CYS C CB    1 
ATOM   7796  S  SG    . CYS C  1 280 ? 116.323 90.640  3.543   1.00 28.80 ? 308  CYS C SG    1 
ATOM   7797  N  N     . PHE C  1 281 ? 119.849 91.880  1.918   1.00 25.84 ? 309  PHE C N     1 
ATOM   7798  C  CA    . PHE C  1 281 ? 120.157 92.892  0.912   1.00 26.25 ? 309  PHE C CA    1 
ATOM   7799  C  C     . PHE C  1 281 ? 120.788 92.287  -0.352  1.00 26.44 ? 309  PHE C C     1 
ATOM   7800  O  O     . PHE C  1 281 ? 120.338 92.547  -1.464  1.00 25.93 ? 309  PHE C O     1 
ATOM   7801  C  CB    . PHE C  1 281 ? 121.064 93.954  1.545   1.00 26.26 ? 309  PHE C CB    1 
ATOM   7802  C  CG    . PHE C  1 281 ? 121.325 95.160  0.670   1.00 25.49 ? 309  PHE C CG    1 
ATOM   7803  C  CD1   . PHE C  1 281 ? 120.486 96.260  0.719   1.00 24.67 ? 309  PHE C CD1   1 
ATOM   7804  C  CD2   . PHE C  1 281 ? 122.442 95.208  -0.147  1.00 25.10 ? 309  PHE C CD2   1 
ATOM   7805  C  CE1   . PHE C  1 281 ? 120.744 97.384  -0.058  1.00 25.99 ? 309  PHE C CE1   1 
ATOM   7806  C  CE2   . PHE C  1 281 ? 122.703 96.342  -0.947  1.00 26.01 ? 309  PHE C CE2   1 
ATOM   7807  C  CZ    . PHE C  1 281 ? 121.846 97.422  -0.893  1.00 25.76 ? 309  PHE C CZ    1 
ATOM   7808  N  N     . ASP C  1 282 ? 121.816 91.467  -0.167  1.00 27.14 ? 310  ASP C N     1 
ATOM   7809  C  CA    . ASP C  1 282 ? 122.535 90.825  -1.263  1.00 26.99 ? 310  ASP C CA    1 
ATOM   7810  C  C     . ASP C  1 282 ? 121.628 89.963  -2.144  1.00 26.93 ? 310  ASP C C     1 
ATOM   7811  O  O     . ASP C  1 282 ? 121.819 89.885  -3.356  1.00 25.83 ? 310  ASP C O     1 
ATOM   7812  C  CB    . ASP C  1 282 ? 123.679 89.945  -0.719  1.00 27.69 ? 310  ASP C CB    1 
ATOM   7813  C  CG    . ASP C  1 282 ? 124.853 90.764  -0.147  1.00 29.36 ? 310  ASP C CG    1 
ATOM   7814  O  OD1   . ASP C  1 282 ? 124.912 92.002  -0.344  1.00 26.45 ? 310  ASP C OD1   1 
ATOM   7815  O  OD2   . ASP C  1 282 ? 125.723 90.134  0.506   1.00 31.30 ? 310  ASP C OD2   1 
ATOM   7816  N  N     . TYR C  1 283 ? 120.657 89.301  -1.527  1.00 27.30 ? 311  TYR C N     1 
ATOM   7817  C  CA    . TYR C  1 283 ? 119.674 88.516  -2.258  1.00 27.11 ? 311  TYR C CA    1 
ATOM   7818  C  C     . TYR C  1 283 ? 118.695 89.410  -3.044  1.00 27.01 ? 311  TYR C C     1 
ATOM   7819  O  O     . TYR C  1 283 ? 118.292 89.088  -4.167  1.00 26.34 ? 311  TYR C O     1 
ATOM   7820  C  CB    . TYR C  1 283 ? 118.878 87.634  -1.297  1.00 27.70 ? 311  TYR C CB    1 
ATOM   7821  C  CG    . TYR C  1 283 ? 117.791 86.868  -2.003  1.00 28.40 ? 311  TYR C CG    1 
ATOM   7822  C  CD1   . TYR C  1 283 ? 118.054 85.624  -2.571  1.00 28.62 ? 311  TYR C CD1   1 
ATOM   7823  C  CD2   . TYR C  1 283 ? 116.509 87.406  -2.136  1.00 26.56 ? 311  TYR C CD2   1 
ATOM   7824  C  CE1   . TYR C  1 283 ? 117.075 84.937  -3.254  1.00 29.58 ? 311  TYR C CE1   1 
ATOM   7825  C  CE2   . TYR C  1 283 ? 115.533 86.739  -2.808  1.00 27.93 ? 311  TYR C CE2   1 
ATOM   7826  C  CZ    . TYR C  1 283 ? 115.813 85.503  -3.372  1.00 28.89 ? 311  TYR C CZ    1 
ATOM   7827  O  OH    . TYR C  1 283 ? 114.837 84.806  -4.033  1.00 29.35 ? 311  TYR C OH    1 
ATOM   7828  N  N     . THR C  1 284 ? 118.299 90.516  -2.435  1.00 26.73 ? 312  THR C N     1 
ATOM   7829  C  CA    . THR C  1 284 ? 117.231 91.339  -2.972  1.00 26.76 ? 312  THR C CA    1 
ATOM   7830  C  C     . THR C  1 284 ? 117.665 92.199  -4.181  1.00 26.91 ? 312  THR C C     1 
ATOM   7831  O  O     . THR C  1 284 ? 116.878 92.389  -5.109  1.00 26.98 ? 312  THR C O     1 
ATOM   7832  C  CB    . THR C  1 284 ? 116.607 92.196  -1.845  1.00 26.99 ? 312  THR C CB    1 
ATOM   7833  O  OG1   . THR C  1 284 ? 116.164 91.332  -0.786  1.00 27.00 ? 312  THR C OG1   1 
ATOM   7834  C  CG2   . THR C  1 284 ? 115.433 93.018  -2.357  1.00 26.55 ? 312  THR C CG2   1 
ATOM   7835  N  N     . ILE C  1 285 ? 118.903 92.688  -4.208  1.00 27.44 ? 313  ILE C N     1 
ATOM   7836  C  CA    . ILE C  1 285 ? 119.313 93.586  -5.295  1.00 27.41 ? 313  ILE C CA    1 
ATOM   7837  C  C     . ILE C  1 285 ? 119.231 92.921  -6.696  1.00 27.43 ? 313  ILE C C     1 
ATOM   7838  O  O     . ILE C  1 285 ? 118.677 93.519  -7.621  1.00 27.78 ? 313  ILE C O     1 
ATOM   7839  C  CB    . ILE C  1 285 ? 120.702 94.255  -5.055  1.00 27.89 ? 313  ILE C CB    1 
ATOM   7840  C  CG1   . ILE C  1 285 ? 120.757 95.015  -3.727  1.00 28.93 ? 313  ILE C CG1   1 
ATOM   7841  C  CG2   . ILE C  1 285 ? 121.037 95.229  -6.193  1.00 26.76 ? 313  ILE C CG2   1 
ATOM   7842  C  CD1   . ILE C  1 285 ? 119.595 96.000  -3.462  1.00 27.89 ? 313  ILE C CD1   1 
ATOM   7843  N  N     . PRO C  1 286 ? 119.781 91.699  -6.871  1.00 27.33 ? 314  PRO C N     1 
ATOM   7844  C  CA    . PRO C  1 286 ? 119.593 91.013  -8.159  1.00 27.42 ? 314  PRO C CA    1 
ATOM   7845  C  C     . PRO C  1 286 ? 118.117 90.850  -8.588  1.00 26.81 ? 314  PRO C C     1 
ATOM   7846  O  O     . PRO C  1 286 ? 117.808 90.981  -9.752  1.00 26.71 ? 314  PRO C O     1 
ATOM   7847  C  CB    . PRO C  1 286 ? 120.261 89.646  -7.937  1.00 27.44 ? 314  PRO C CB    1 
ATOM   7848  C  CG    . PRO C  1 286 ? 121.291 89.907  -6.869  1.00 27.99 ? 314  PRO C CG    1 
ATOM   7849  C  CD    . PRO C  1 286 ? 120.642 90.917  -5.958  1.00 27.73 ? 314  PRO C CD    1 
ATOM   7850  N  N     . TYR C  1 287 ? 117.221 90.597  -7.646  1.00 27.09 ? 315  TYR C N     1 
ATOM   7851  C  CA    . TYR C  1 287 ? 115.799 90.501  -7.963  1.00 26.81 ? 315  TYR C CA    1 
ATOM   7852  C  C     . TYR C  1 287 ? 115.263 91.810  -8.563  1.00 27.10 ? 315  TYR C C     1 
ATOM   7853  O  O     . TYR C  1 287 ? 114.639 91.805  -9.626  1.00 25.70 ? 315  TYR C O     1 
ATOM   7854  C  CB    . TYR C  1 287 ? 114.977 90.126  -6.722  1.00 27.43 ? 315  TYR C CB    1 
ATOM   7855  C  CG    . TYR C  1 287 ? 113.531 89.960  -7.078  1.00 27.53 ? 315  TYR C CG    1 
ATOM   7856  C  CD1   . TYR C  1 287 ? 113.066 88.753  -7.605  1.00 27.47 ? 315  TYR C CD1   1 
ATOM   7857  C  CD2   . TYR C  1 287 ? 112.631 91.029  -6.953  1.00 26.31 ? 315  TYR C CD2   1 
ATOM   7858  C  CE1   . TYR C  1 287 ? 111.720 88.596  -7.981  1.00 29.80 ? 315  TYR C CE1   1 
ATOM   7859  C  CE2   . TYR C  1 287 ? 111.283 90.879  -7.318  1.00 28.28 ? 315  TYR C CE2   1 
ATOM   7860  C  CZ    . TYR C  1 287 ? 110.834 89.671  -7.829  1.00 28.67 ? 315  TYR C CZ    1 
ATOM   7861  O  OH    . TYR C  1 287 ? 109.507 89.520  -8.216  1.00 28.64 ? 315  TYR C OH    1 
ATOM   7862  N  N     . ILE C  1 288 ? 115.502 92.928  -7.877  1.00 26.70 ? 316  ILE C N     1 
ATOM   7863  C  CA    . ILE C  1 288 ? 115.005 94.224  -8.350  1.00 27.24 ? 316  ILE C CA    1 
ATOM   7864  C  C     . ILE C  1 288 ? 115.713 94.703  -9.639  1.00 26.94 ? 316  ILE C C     1 
ATOM   7865  O  O     . ILE C  1 288 ? 115.175 95.515  -10.388 1.00 26.84 ? 316  ILE C O     1 
ATOM   7866  C  CB    . ILE C  1 288 ? 114.947 95.304  -7.211  1.00 27.36 ? 316  ILE C CB    1 
ATOM   7867  C  CG1   . ILE C  1 288 ? 116.326 95.659  -6.668  1.00 28.56 ? 316  ILE C CG1   1 
ATOM   7868  C  CG2   . ILE C  1 288 ? 114.014 94.833  -6.098  1.00 26.97 ? 316  ILE C CG2   1 
ATOM   7869  C  CD1   . ILE C  1 288 ? 116.322 96.867  -5.716  1.00 28.64 ? 316  ILE C CD1   1 
ATOM   7870  N  N     . LYS C  1 289 ? 116.909 94.183  -9.905  1.00 26.77 ? 317  LYS C N     1 
ATOM   7871  C  CA    . LYS C  1 289 ? 117.555 94.388  -11.196 1.00 27.04 ? 317  LYS C CA    1 
ATOM   7872  C  C     . LYS C  1 289 ? 116.867 93.619  -12.334 1.00 27.46 ? 317  LYS C C     1 
ATOM   7873  O  O     . LYS C  1 289 ? 116.819 94.100  -13.455 1.00 27.59 ? 317  LYS C O     1 
ATOM   7874  C  CB    . LYS C  1 289 ? 119.040 94.020  -11.137 1.00 26.80 ? 317  LYS C CB    1 
ATOM   7875  C  CG    . LYS C  1 289 ? 119.864 95.039  -10.364 1.00 26.46 ? 317  LYS C CG    1 
ATOM   7876  C  CD    . LYS C  1 289 ? 121.358 94.736  -10.394 1.00 26.97 ? 317  LYS C CD    1 
ATOM   7877  C  CE    . LYS C  1 289 ? 121.902 94.747  -11.797 1.00 26.97 ? 317  LYS C CE    1 
ATOM   7878  N  NZ    . LYS C  1 289 ? 123.357 94.975  -11.855 1.00 26.54 ? 317  LYS C NZ    1 
ATOM   7879  N  N     . GLU C  1 290 ? 116.353 92.428  -12.034 1.00 28.37 ? 318  GLU C N     1 
ATOM   7880  C  CA    . GLU C  1 290 ? 115.783 91.518  -13.027 1.00 29.44 ? 318  GLU C CA    1 
ATOM   7881  C  C     . GLU C  1 290 ? 114.275 91.757  -13.244 1.00 27.79 ? 318  GLU C C     1 
ATOM   7882  O  O     . GLU C  1 290 ? 113.788 91.635  -14.370 1.00 26.82 ? 318  GLU C O     1 
ATOM   7883  C  CB    . GLU C  1 290 ? 116.036 90.052  -12.612 1.00 29.68 ? 318  GLU C CB    1 
ATOM   7884  C  CG    . GLU C  1 290 ? 117.545 89.656  -12.585 1.00 34.24 ? 318  GLU C CG    1 
ATOM   7885  C  CD    . GLU C  1 290 ? 117.908 88.410  -11.697 1.00 35.76 ? 318  GLU C CD    1 
ATOM   7886  O  OE1   . GLU C  1 290 ? 117.077 87.940  -10.867 1.00 44.38 ? 318  GLU C OE1   1 
ATOM   7887  O  OE2   . GLU C  1 290 ? 119.060 87.905  -11.829 1.00 43.90 ? 318  GLU C OE2   1 
ATOM   7888  N  N     . ARG C  1 291 ? 113.546 92.106  -12.182 1.00 26.41 ? 319  ARG C N     1 
ATOM   7889  C  CA    . ARG C  1 291 ? 112.083 92.244  -12.260 1.00 26.41 ? 319  ARG C CA    1 
ATOM   7890  C  C     . ARG C  1 291 ? 111.723 93.520  -13.031 1.00 25.81 ? 319  ARG C C     1 
ATOM   7891  O  O     . ARG C  1 291 ? 112.253 94.584  -12.754 1.00 25.16 ? 319  ARG C O     1 
ATOM   7892  C  CB    . ARG C  1 291 ? 111.440 92.246  -10.859 1.00 26.50 ? 319  ARG C CB    1 
ATOM   7893  C  CG    . ARG C  1 291 ? 109.967 91.822  -10.826 1.00 26.95 ? 319  ARG C CG    1 
ATOM   7894  C  CD    . ARG C  1 291 ? 109.006 92.849  -11.437 1.00 26.80 ? 319  ARG C CD    1 
ATOM   7895  N  NE    . ARG C  1 291 ? 107.633 92.596  -10.998 1.00 27.30 ? 319  ARG C NE    1 
ATOM   7896  C  CZ    . ARG C  1 291 ? 106.819 91.656  -11.488 1.00 27.65 ? 319  ARG C CZ    1 
ATOM   7897  N  NH1   . ARG C  1 291 ? 107.178 90.864  -12.502 1.00 27.43 ? 319  ARG C NH1   1 
ATOM   7898  N  NH2   . ARG C  1 291 ? 105.608 91.528  -10.960 1.00 27.38 ? 319  ARG C NH2   1 
ATOM   7899  N  N     . ILE C  1 292 ? 110.851 93.377  -14.028 1.00 25.53 ? 320  ILE C N     1 
ATOM   7900  C  CA    . ILE C  1 292 ? 110.439 94.476  -14.898 1.00 25.88 ? 320  ILE C CA    1 
ATOM   7901  C  C     . ILE C  1 292 ? 108.971 94.827  -14.659 1.00 25.63 ? 320  ILE C C     1 
ATOM   7902  O  O     . ILE C  1 292 ? 108.113 93.948  -14.696 1.00 24.97 ? 320  ILE C O     1 
ATOM   7903  C  CB    . ILE C  1 292 ? 110.626 94.083  -16.374 1.00 26.68 ? 320  ILE C CB    1 
ATOM   7904  C  CG1   . ILE C  1 292 ? 112.088 93.674  -16.634 1.00 27.36 ? 320  ILE C CG1   1 
ATOM   7905  C  CG2   . ILE C  1 292 ? 110.182 95.205  -17.356 1.00 25.63 ? 320  ILE C CG2   1 
ATOM   7906  C  CD1   . ILE C  1 292 ? 113.089 94.744  -16.384 1.00 27.41 ? 320  ILE C CD1   1 
ATOM   7907  N  N     . GLN C  1 293 ? 108.706 96.109  -14.396 1.00 26.19 ? 321  GLN C N     1 
ATOM   7908  C  CA    . GLN C  1 293 ? 107.346 96.672  -14.390 1.00 26.36 ? 321  GLN C CA    1 
ATOM   7909  C  C     . GLN C  1 293 ? 107.381 98.013  -15.097 1.00 26.52 ? 321  GLN C C     1 
ATOM   7910  O  O     . GLN C  1 293 ? 108.397 98.710  -15.056 1.00 26.46 ? 321  GLN C O     1 
ATOM   7911  C  CB    . GLN C  1 293 ? 106.792 96.836  -12.953 1.00 26.23 ? 321  GLN C CB    1 
ATOM   7912  C  CG    . GLN C  1 293 ? 106.463 95.534  -12.245 1.00 26.25 ? 321  GLN C CG    1 
ATOM   7913  C  CD    . GLN C  1 293 ? 105.227 94.821  -12.808 1.00 28.17 ? 321  GLN C CD    1 
ATOM   7914  O  OE1   . GLN C  1 293 ? 104.100 95.057  -12.366 1.00 28.76 ? 321  GLN C OE1   1 
ATOM   7915  N  NE2   . GLN C  1 293 ? 105.445 93.931  -13.770 1.00 25.84 ? 321  GLN C NE2   1 
ATOM   7916  N  N     . PHE C  1 294 ? 106.277 98.362  -15.769 1.00 26.76 ? 322  PHE C N     1 
ATOM   7917  C  CA    . PHE C  1 294 ? 106.176 99.615  -16.543 1.00 27.34 ? 322  PHE C CA    1 
ATOM   7918  C  C     . PHE C  1 294 ? 107.340 99.787  -17.519 1.00 27.83 ? 322  PHE C C     1 
ATOM   7919  O  O     . PHE C  1 294 ? 107.791 100.900 -17.779 1.00 27.78 ? 322  PHE C O     1 
ATOM   7920  C  CB    . PHE C  1 294 ? 106.081 100.848 -15.638 1.00 27.07 ? 322  PHE C CB    1 
ATOM   7921  C  CG    . PHE C  1 294 ? 105.028 100.757 -14.583 1.00 26.92 ? 322  PHE C CG    1 
ATOM   7922  C  CD1   . PHE C  1 294 ? 103.708 101.127 -14.858 1.00 27.55 ? 322  PHE C CD1   1 
ATOM   7923  C  CD2   . PHE C  1 294 ? 105.347 100.327 -13.303 1.00 26.41 ? 322  PHE C CD2   1 
ATOM   7924  C  CE1   . PHE C  1 294 ? 102.719 101.047 -13.863 1.00 27.68 ? 322  PHE C CE1   1 
ATOM   7925  C  CE2   . PHE C  1 294 ? 104.367 100.238 -12.318 1.00 27.40 ? 322  PHE C CE2   1 
ATOM   7926  C  CZ    . PHE C  1 294 ? 103.053 100.599 -12.598 1.00 26.59 ? 322  PHE C CZ    1 
ATOM   7927  N  N     . GLY C  1 295 ? 107.832 98.675  -18.052 1.00 28.84 ? 323  GLY C N     1 
ATOM   7928  C  CA    . GLY C  1 295 ? 108.916 98.716  -19.018 1.00 30.05 ? 323  GLY C CA    1 
ATOM   7929  C  C     . GLY C  1 295 ? 110.298 99.005  -18.453 1.00 30.71 ? 323  GLY C C     1 
ATOM   7930  O  O     . GLY C  1 295 ? 111.226 99.276  -19.206 1.00 31.18 ? 323  GLY C O     1 
ATOM   7931  N  N     . LYS C  1 296 ? 110.462 98.965  -17.138 1.00 31.23 ? 324  LYS C N     1 
ATOM   7932  C  CA    . LYS C  1 296 ? 111.799 99.143  -16.598 1.00 31.92 ? 324  LYS C CA    1 
ATOM   7933  C  C     . LYS C  1 296 ? 112.083 98.224  -15.442 1.00 30.63 ? 324  LYS C C     1 
ATOM   7934  O  O     . LYS C  1 296 ? 111.168 97.613  -14.857 1.00 29.28 ? 324  LYS C O     1 
ATOM   7935  C  CB    . LYS C  1 296 ? 112.060 100.604 -16.215 1.00 32.52 ? 324  LYS C CB    1 
ATOM   7936  C  CG    . LYS C  1 296 ? 111.081 101.236 -15.267 1.00 34.42 ? 324  LYS C CG    1 
ATOM   7937  C  CD    . LYS C  1 296 ? 111.742 102.411 -14.493 1.00 35.48 ? 324  LYS C CD    1 
ATOM   7938  C  CE    . LYS C  1 296 ? 111.632 103.748 -15.197 1.00 38.08 ? 324  LYS C CE    1 
ATOM   7939  N  NZ    . LYS C  1 296 ? 112.372 104.788 -14.389 1.00 38.31 ? 324  LYS C NZ    1 
ATOM   7940  N  N     . ARG C  1 297 ? 113.371 98.138  -15.115 1.00 29.79 ? 325  ARG C N     1 
ATOM   7941  C  CA    . ARG C  1 297 ? 113.813 97.401  -13.943 1.00 28.92 ? 325  ARG C CA    1 
ATOM   7942  C  C     . ARG C  1 297 ? 113.232 98.094  -12.725 1.00 28.08 ? 325  ARG C C     1 
ATOM   7943  O  O     . ARG C  1 297 ? 113.163 99.313  -12.681 1.00 27.62 ? 325  ARG C O     1 
ATOM   7944  C  CB    . ARG C  1 297 ? 115.339 97.384  -13.847 1.00 28.98 ? 325  ARG C CB    1 
ATOM   7945  C  CG    . ARG C  1 297 ? 116.078 96.874  -15.098 1.00 29.75 ? 325  ARG C CG    1 
ATOM   7946  C  CD    . ARG C  1 297 ? 117.595 96.871  -14.895 1.00 29.88 ? 325  ARG C CD    1 
ATOM   7947  N  NE    . ARG C  1 297 ? 118.110 98.162  -14.435 1.00 30.53 ? 325  ARG C NE    1 
ATOM   7948  C  CZ    . ARG C  1 297 ? 119.270 98.328  -13.795 1.00 30.79 ? 325  ARG C CZ    1 
ATOM   7949  N  NH1   . ARG C  1 297 ? 120.058 97.301  -13.542 1.00 28.77 ? 325  ARG C NH1   1 
ATOM   7950  N  NH2   . ARG C  1 297 ? 119.653 99.541  -13.418 1.00 31.69 ? 325  ARG C NH2   1 
ATOM   7951  N  N     . LEU C  1 298 ? 112.827 97.324  -11.724 1.00 27.28 ? 326  LEU C N     1 
ATOM   7952  C  CA    . LEU C  1 298 ? 112.412 97.917  -10.456 1.00 27.28 ? 326  LEU C CA    1 
ATOM   7953  C  C     . LEU C  1 298 ? 113.509 98.859  -9.933  1.00 27.84 ? 326  LEU C C     1 
ATOM   7954  O  O     . LEU C  1 298 ? 113.215 99.944  -9.423  1.00 26.64 ? 326  LEU C O     1 
ATOM   7955  C  CB    . LEU C  1 298 ? 112.065 96.850  -9.424  1.00 26.59 ? 326  LEU C CB    1 
ATOM   7956  C  CG    . LEU C  1 298 ? 110.857 95.965  -9.730  1.00 27.42 ? 326  LEU C CG    1 
ATOM   7957  C  CD1   . LEU C  1 298 ? 110.701 94.955  -8.606  1.00 25.40 ? 326  LEU C CD1   1 
ATOM   7958  C  CD2   . LEU C  1 298 ? 109.582 96.793  -9.937  1.00 25.72 ? 326  LEU C CD2   1 
ATOM   7959  N  N     . PHE C  1 299 ? 114.770 98.444  -10.111 1.00 28.08 ? 327  PHE C N     1 
ATOM   7960  C  CA    . PHE C  1 299 ? 115.919 99.216  -9.675  1.00 28.04 ? 327  PHE C CA    1 
ATOM   7961  C  C     . PHE C  1 299 ? 115.974 100.604 -10.321 1.00 27.86 ? 327  PHE C C     1 
ATOM   7962  O  O     . PHE C  1 299 ? 116.582 101.516 -9.778  1.00 28.62 ? 327  PHE C O     1 
ATOM   7963  C  CB    . PHE C  1 299 ? 117.208 98.445  -9.978  1.00 29.06 ? 327  PHE C CB    1 
ATOM   7964  C  CG    . PHE C  1 299 ? 118.418 98.956  -9.245  1.00 29.26 ? 327  PHE C CG    1 
ATOM   7965  C  CD1   . PHE C  1 299 ? 118.822 98.364  -8.057  1.00 31.08 ? 327  PHE C CD1   1 
ATOM   7966  C  CD2   . PHE C  1 299 ? 119.163 100.009 -9.749  1.00 31.65 ? 327  PHE C CD2   1 
ATOM   7967  C  CE1   . PHE C  1 299 ? 119.942 98.823  -7.372  1.00 32.56 ? 327  PHE C CE1   1 
ATOM   7968  C  CE2   . PHE C  1 299 ? 120.283 100.486 -9.063  1.00 32.43 ? 327  PHE C CE2   1 
ATOM   7969  C  CZ    . PHE C  1 299 ? 120.669 99.875  -7.872  1.00 31.82 ? 327  PHE C CZ    1 
ATOM   7970  N  N     . ASP C  1 300 ? 115.326 100.785 -11.460 1.00 27.77 ? 328  ASP C N     1 
ATOM   7971  C  CA    . ASP C  1 300 ? 115.353 102.081 -12.122 1.00 27.75 ? 328  ASP C CA    1 
ATOM   7972  C  C     . ASP C  1 300 ? 114.293 103.091 -11.655 1.00 27.02 ? 328  ASP C C     1 
ATOM   7973  O  O     . ASP C  1 300 ? 114.283 104.204 -12.144 1.00 26.43 ? 328  ASP C O     1 
ATOM   7974  C  CB    . ASP C  1 300 ? 115.304 101.897 -13.635 1.00 28.09 ? 328  ASP C CB    1 
ATOM   7975  C  CG    . ASP C  1 300 ? 116.613 101.346 -14.188 1.00 29.98 ? 328  ASP C CG    1 
ATOM   7976  O  OD1   . ASP C  1 300 ? 117.681 101.663 -13.615 1.00 34.23 ? 328  ASP C OD1   1 
ATOM   7977  O  OD2   . ASP C  1 300 ? 116.569 100.603 -15.170 1.00 28.06 ? 328  ASP C OD2   1 
ATOM   7978  N  N     . PHE C  1 301 ? 113.424 102.719 -10.722 1.00 26.33 ? 329  PHE C N     1 
ATOM   7979  C  CA    . PHE C  1 301 ? 112.512 103.700 -10.124 1.00 25.77 ? 329  PHE C CA    1 
ATOM   7980  C  C     . PHE C  1 301 ? 113.278 104.414 -9.038  1.00 25.49 ? 329  PHE C C     1 
ATOM   7981  O  O     . PHE C  1 301 ? 113.798 103.762 -8.132  1.00 25.12 ? 329  PHE C O     1 
ATOM   7982  C  CB    . PHE C  1 301 ? 111.251 103.025 -9.587  1.00 25.79 ? 329  PHE C CB    1 
ATOM   7983  C  CG    . PHE C  1 301 ? 110.402 102.438 -10.681 1.00 26.37 ? 329  PHE C CG    1 
ATOM   7984  C  CD1   . PHE C  1 301 ? 109.751 103.275 -11.583 1.00 26.17 ? 329  PHE C CD1   1 
ATOM   7985  C  CD2   . PHE C  1 301 ? 110.301 101.068 -10.848 1.00 26.32 ? 329  PHE C CD2   1 
ATOM   7986  C  CE1   . PHE C  1 301 ? 108.982 102.741 -12.626 1.00 28.03 ? 329  PHE C CE1   1 
ATOM   7987  C  CE2   . PHE C  1 301 ? 109.526 100.531 -11.882 1.00 27.39 ? 329  PHE C CE2   1 
ATOM   7988  C  CZ    . PHE C  1 301 ? 108.884 101.367 -12.770 1.00 26.94 ? 329  PHE C CZ    1 
ATOM   7989  N  N     . GLN C  1 302 ? 113.383 105.738 -9.156  1.00 25.19 ? 330  GLN C N     1 
ATOM   7990  C  CA    . GLN C  1 302 ? 114.255 106.511 -8.281  1.00 25.28 ? 330  GLN C CA    1 
ATOM   7991  C  C     . GLN C  1 302 ? 113.837 106.424 -6.811  1.00 25.50 ? 330  GLN C C     1 
ATOM   7992  O  O     . GLN C  1 302 ? 114.685 106.425 -5.949  1.00 25.44 ? 330  GLN C O     1 
ATOM   7993  C  CB    . GLN C  1 302 ? 114.361 107.965 -8.726  1.00 25.11 ? 330  GLN C CB    1 
ATOM   7994  C  CG    . GLN C  1 302 ? 115.415 108.762 -7.973  1.00 24.37 ? 330  GLN C CG    1 
ATOM   7995  C  CD    . GLN C  1 302 ? 115.464 110.193 -8.392  1.00 24.60 ? 330  GLN C CD    1 
ATOM   7996  O  OE1   . GLN C  1 302 ? 114.587 110.978 -8.041  1.00 26.68 ? 330  GLN C OE1   1 
ATOM   7997  N  NE2   . GLN C  1 302 ? 116.487 110.555 -9.152  1.00 24.07 ? 330  GLN C NE2   1 
ATOM   7998  N  N     . GLY C  1 303 ? 112.538 106.343 -6.537  1.00 26.36 ? 331  GLY C N     1 
ATOM   7999  C  CA    . GLY C  1 303 ? 112.047 106.182 -5.171  1.00 26.55 ? 331  GLY C CA    1 
ATOM   8000  C  C     . GLY C  1 303 ? 112.618 104.919 -4.575  1.00 27.14 ? 331  GLY C C     1 
ATOM   8001  O  O     . GLY C  1 303 ? 113.105 104.903 -3.441  1.00 27.03 ? 331  GLY C O     1 
ATOM   8002  N  N     . LEU C  1 304 ? 112.610 103.851 -5.360  1.00 27.34 ? 332  LEU C N     1 
ATOM   8003  C  CA    . LEU C  1 304 ? 113.186 102.612 -4.905  1.00 28.00 ? 332  LEU C CA    1 
ATOM   8004  C  C     . LEU C  1 304 ? 114.725 102.693 -4.801  1.00 27.39 ? 332  LEU C C     1 
ATOM   8005  O  O     . LEU C  1 304 ? 115.277 102.231 -3.808  1.00 27.17 ? 332  LEU C O     1 
ATOM   8006  C  CB    . LEU C  1 304 ? 112.692 101.468 -5.798  1.00 28.92 ? 332  LEU C CB    1 
ATOM   8007  C  CG    . LEU C  1 304 ? 112.813 100.045 -5.303  1.00 31.62 ? 332  LEU C CG    1 
ATOM   8008  C  CD1   . LEU C  1 304 ? 111.751 99.185  -5.993  1.00 32.60 ? 332  LEU C CD1   1 
ATOM   8009  C  CD2   . LEU C  1 304 ? 114.243 99.529  -5.595  1.00 32.73 ? 332  LEU C CD2   1 
ATOM   8010  N  N     . GLN C  1 305 ? 115.394 103.318 -5.776  1.00 26.53 ? 333  GLN C N     1 
ATOM   8011  C  CA    . GLN C  1 305 ? 116.852 103.505 -5.732  1.00 27.14 ? 333  GLN C CA    1 
ATOM   8012  C  C     . GLN C  1 305 ? 117.317 104.240 -4.486  1.00 25.82 ? 333  GLN C C     1 
ATOM   8013  O  O     . GLN C  1 305 ? 118.369 103.940 -3.954  1.00 24.96 ? 333  GLN C O     1 
ATOM   8014  C  CB    . GLN C  1 305 ? 117.369 104.364 -6.889  1.00 27.59 ? 333  GLN C CB    1 
ATOM   8015  C  CG    . GLN C  1 305 ? 117.545 103.666 -8.146  1.00 31.45 ? 333  GLN C CG    1 
ATOM   8016  C  CD    . GLN C  1 305 ? 118.128 104.529 -9.222  1.00 33.28 ? 333  GLN C CD    1 
ATOM   8017  O  OE1   . GLN C  1 305 ? 118.730 105.590 -8.964  1.00 37.94 ? 333  GLN C OE1   1 
ATOM   8018  N  NE2   . GLN C  1 305 ? 117.946 104.093 -10.447 1.00 36.17 ? 333  GLN C NE2   1 
ATOM   8019  N  N     . HIS C  1 306 ? 116.562 105.259 -4.091  1.00 25.27 ? 334  HIS C N     1 
ATOM   8020  C  CA    . HIS C  1 306 ? 116.893 106.074 -2.911  1.00 24.60 ? 334  HIS C CA    1 
ATOM   8021  C  C     . HIS C  1 306 ? 116.761 105.288 -1.620  1.00 25.35 ? 334  HIS C C     1 
ATOM   8022  O  O     . HIS C  1 306 ? 117.600 105.437 -0.725  1.00 24.20 ? 334  HIS C O     1 
ATOM   8023  C  CB    . HIS C  1 306 ? 116.012 107.332 -2.865  1.00 24.29 ? 334  HIS C CB    1 
ATOM   8024  C  CG    . HIS C  1 306 ? 116.433 108.386 -3.840  1.00 22.09 ? 334  HIS C CG    1 
ATOM   8025  N  ND1   . HIS C  1 306 ? 115.880 109.650 -3.864  1.00 21.97 ? 334  HIS C ND1   1 
ATOM   8026  C  CD2   . HIS C  1 306 ? 117.388 108.375 -4.800  1.00 21.50 ? 334  HIS C CD2   1 
ATOM   8027  C  CE1   . HIS C  1 306 ? 116.455 110.360 -4.816  1.00 21.81 ? 334  HIS C CE1   1 
ATOM   8028  N  NE2   . HIS C  1 306 ? 117.372 109.608 -5.401  1.00 21.62 ? 334  HIS C NE2   1 
ATOM   8029  N  N     . GLN C  1 307 ? 115.727 104.447 -1.539  1.00 25.22 ? 335  GLN C N     1 
ATOM   8030  C  CA    . GLN C  1 307 ? 115.530 103.548 -0.384  1.00 26.06 ? 335  GLN C CA    1 
ATOM   8031  C  C     . GLN C  1 307 ? 116.675 102.534 -0.303  1.00 25.46 ? 335  GLN C C     1 
ATOM   8032  O  O     . GLN C  1 307 ? 117.226 102.290 0.767   1.00 24.85 ? 335  GLN C O     1 
ATOM   8033  C  CB    . GLN C  1 307 ? 114.202 102.807 -0.486  1.00 25.79 ? 335  GLN C CB    1 
ATOM   8034  C  CG    . GLN C  1 307 ? 112.969 103.704 -0.397  1.00 27.94 ? 335  GLN C CG    1 
ATOM   8035  C  CD    . GLN C  1 307 ? 111.677 102.947 -0.700  1.00 28.16 ? 335  GLN C CD    1 
ATOM   8036  O  OE1   . GLN C  1 307 ? 111.589 101.725 -0.488  1.00 29.64 ? 335  GLN C OE1   1 
ATOM   8037  N  NE2   . GLN C  1 307 ? 110.671 103.668 -1.184  1.00 28.91 ? 335  GLN C NE2   1 
ATOM   8038  N  N     . VAL C  1 308 ? 117.050 101.983 -1.451  1.00 25.00 ? 336  VAL C N     1 
ATOM   8039  C  CA    . VAL C  1 308 ? 118.187 101.064 -1.526  1.00 25.29 ? 336  VAL C CA    1 
ATOM   8040  C  C     . VAL C  1 308 ? 119.498 101.733 -1.060  1.00 25.23 ? 336  VAL C C     1 
ATOM   8041  O  O     . VAL C  1 308 ? 120.249 101.154 -0.259  1.00 24.91 ? 336  VAL C O     1 
ATOM   8042  C  CB    . VAL C  1 308 ? 118.330 100.477 -2.958  1.00 25.38 ? 336  VAL C CB    1 
ATOM   8043  C  CG1   . VAL C  1 308 ? 119.722 99.799  -3.165  1.00 25.24 ? 336  VAL C CG1   1 
ATOM   8044  C  CG2   . VAL C  1 308 ? 117.139 99.535  -3.297  1.00 24.73 ? 336  VAL C CG2   1 
ATOM   8045  N  N     . ALA C  1 309 ? 119.763 102.940 -1.562  1.00 24.32 ? 337  ALA C N     1 
ATOM   8046  C  CA    . ALA C  1 309 ? 120.990 103.678 -1.217  1.00 24.78 ? 337  ALA C CA    1 
ATOM   8047  C  C     . ALA C  1 309 ? 121.042 104.066 0.263   1.00 24.52 ? 337  ALA C C     1 
ATOM   8048  O  O     . ALA C  1 309 ? 122.106 104.032 0.883   1.00 24.48 ? 337  ALA C O     1 
ATOM   8049  C  CB    . ALA C  1 309 ? 121.138 104.938 -2.101  1.00 23.56 ? 337  ALA C CB    1 
ATOM   8050  N  N     . HIS C  1 310 ? 119.896 104.481 0.803   1.00 25.01 ? 338  HIS C N     1 
ATOM   8051  C  CA    . HIS C  1 310 ? 119.776 104.811 2.216   1.00 25.85 ? 338  HIS C CA    1 
ATOM   8052  C  C     . HIS C  1 310 ? 120.106 103.574 3.076   1.00 25.60 ? 338  HIS C C     1 
ATOM   8053  O  O     . HIS C  1 310 ? 120.914 103.638 4.018   1.00 24.63 ? 338  HIS C O     1 
ATOM   8054  C  CB    . HIS C  1 310 ? 118.355 105.346 2.509   1.00 27.11 ? 338  HIS C CB    1 
ATOM   8055  C  CG    . HIS C  1 310 ? 118.098 105.618 3.963   1.00 29.52 ? 338  HIS C CG    1 
ATOM   8056  N  ND1   . HIS C  1 310 ? 118.453 106.799 4.573   1.00 33.76 ? 338  HIS C ND1   1 
ATOM   8057  C  CD2   . HIS C  1 310 ? 117.553 104.846 4.936   1.00 35.06 ? 338  HIS C CD2   1 
ATOM   8058  C  CE1   . HIS C  1 310 ? 118.137 106.750 5.856   1.00 32.30 ? 338  HIS C CE1   1 
ATOM   8059  N  NE2   . HIS C  1 310 ? 117.582 105.580 6.102   1.00 33.91 ? 338  HIS C NE2   1 
ATOM   8060  N  N     . VAL C  1 311 ? 119.496 102.452 2.720   1.00 25.03 ? 339  VAL C N     1 
ATOM   8061  C  CA    . VAL C  1 311 ? 119.732 101.189 3.425   1.00 25.72 ? 339  VAL C CA    1 
ATOM   8062  C  C     . VAL C  1 311 ? 121.205 100.753 3.326   1.00 25.40 ? 339  VAL C C     1 
ATOM   8063  O  O     . VAL C  1 311 ? 121.798 100.367 4.325   1.00 25.95 ? 339  VAL C O     1 
ATOM   8064  C  CB    . VAL C  1 311 ? 118.787 100.071 2.924   1.00 25.14 ? 339  VAL C CB    1 
ATOM   8065  C  CG1   . VAL C  1 311 ? 119.333 98.680  3.281   1.00 24.43 ? 339  VAL C CG1   1 
ATOM   8066  C  CG2   . VAL C  1 311 ? 117.370 100.265 3.511   1.00 27.20 ? 339  VAL C CG2   1 
ATOM   8067  N  N     . ALA C  1 312 ? 121.781 100.823 2.123   1.00 25.62 ? 340  ALA C N     1 
ATOM   8068  C  CA    . ALA C  1 312 ? 123.194 100.492 1.901   1.00 25.45 ? 340  ALA C CA    1 
ATOM   8069  C  C     . ALA C  1 312 ? 124.120 101.322 2.794   1.00 24.58 ? 340  ALA C C     1 
ATOM   8070  O  O     . ALA C  1 312 ? 125.135 100.826 3.281   1.00 24.83 ? 340  ALA C O     1 
ATOM   8071  C  CB    . ALA C  1 312 ? 123.573 100.704 0.416   1.00 24.52 ? 340  ALA C CB    1 
ATOM   8072  N  N     . THR C  1 313 ? 123.776 102.590 2.987   1.00 24.70 ? 341  THR C N     1 
ATOM   8073  C  CA    . THR C  1 313 ? 124.575 103.499 3.820   1.00 24.14 ? 341  THR C CA    1 
ATOM   8074  C  C     . THR C  1 313 ? 124.529 103.023 5.274   1.00 25.21 ? 341  THR C C     1 
ATOM   8075  O  O     . THR C  1 313 ? 125.563 103.007 5.975   1.00 24.26 ? 341  THR C O     1 
ATOM   8076  C  CB    . THR C  1 313 ? 124.089 104.979 3.693   1.00 24.38 ? 341  THR C CB    1 
ATOM   8077  O  OG1   . THR C  1 313 ? 124.182 105.414 2.327   1.00 22.81 ? 341  THR C OG1   1 
ATOM   8078  C  CG2   . THR C  1 313 ? 124.906 105.945 4.597   1.00 24.13 ? 341  THR C CG2   1 
ATOM   8079  N  N     . GLN C  1 314 ? 123.327 102.646 5.723   1.00 25.79 ? 342  GLN C N     1 
ATOM   8080  C  CA    . GLN C  1 314 ? 123.124 102.133 7.078   1.00 27.33 ? 342  GLN C CA    1 
ATOM   8081  C  C     . GLN C  1 314 ? 123.870 100.819 7.313   1.00 26.81 ? 342  GLN C C     1 
ATOM   8082  O  O     . GLN C  1 314 ? 124.435 100.609 8.386   1.00 26.58 ? 342  GLN C O     1 
ATOM   8083  C  CB    . GLN C  1 314 ? 121.627 101.942 7.366   1.00 27.49 ? 342  GLN C CB    1 
ATOM   8084  C  CG    . GLN C  1 314 ? 120.832 103.221 7.414   1.00 29.02 ? 342  GLN C CG    1 
ATOM   8085  C  CD    . GLN C  1 314 ? 119.346 102.949 7.604   1.00 30.99 ? 342  GLN C CD    1 
ATOM   8086  O  OE1   . GLN C  1 314 ? 118.729 102.193 6.836   1.00 36.28 ? 342  GLN C OE1   1 
ATOM   8087  N  NE2   . GLN C  1 314 ? 118.772 103.543 8.635   1.00 33.81 ? 342  GLN C NE2   1 
ATOM   8088  N  N     . LEU C  1 315 ? 123.886 99.947  6.304   1.00 27.12 ? 343  LEU C N     1 
ATOM   8089  C  CA    . LEU C  1 315 ? 124.638 98.690  6.372   1.00 26.96 ? 343  LEU C CA    1 
ATOM   8090  C  C     . LEU C  1 315 ? 126.128 98.967  6.522   1.00 26.31 ? 343  LEU C C     1 
ATOM   8091  O  O     . LEU C  1 315 ? 126.809 98.324  7.324   1.00 25.14 ? 343  LEU C O     1 
ATOM   8092  C  CB    . LEU C  1 315 ? 124.411 97.820  5.127   1.00 27.59 ? 343  LEU C CB    1 
ATOM   8093  C  CG    . LEU C  1 315 ? 123.077 97.080  5.051   1.00 29.36 ? 343  LEU C CG    1 
ATOM   8094  C  CD1   . LEU C  1 315 ? 122.793 96.539  3.635   1.00 28.43 ? 343  LEU C CD1   1 
ATOM   8095  C  CD2   . LEU C  1 315 ? 123.076 95.949  6.047   1.00 31.48 ? 343  LEU C CD2   1 
ATOM   8096  N  N     . GLU C  1 316 ? 126.614 99.925  5.732   1.00 25.37 ? 344  GLU C N     1 
ATOM   8097  C  CA    . GLU C  1 316 ? 127.992 100.384 5.799   1.00 26.05 ? 344  GLU C CA    1 
ATOM   8098  C  C     . GLU C  1 316 ? 128.359 100.892 7.193   1.00 25.23 ? 344  GLU C C     1 
ATOM   8099  O  O     . GLU C  1 316 ? 129.378 100.472 7.754   1.00 24.96 ? 344  GLU C O     1 
ATOM   8100  C  CB    . GLU C  1 316 ? 128.255 101.466 4.746   1.00 26.10 ? 344  GLU C CB    1 
ATOM   8101  C  CG    . GLU C  1 316 ? 129.716 101.842 4.568   1.00 28.49 ? 344  GLU C CG    1 
ATOM   8102  C  CD    . GLU C  1 316 ? 130.482 100.860 3.693   1.00 34.78 ? 344  GLU C CD    1 
ATOM   8103  O  OE1   . GLU C  1 316 ? 129.854 99.957  3.092   1.00 36.96 ? 344  GLU C OE1   1 
ATOM   8104  O  OE2   . GLU C  1 316 ? 131.714 100.998 3.616   1.00 36.81 ? 344  GLU C OE2   1 
ATOM   8105  N  N     . ALA C  1 317 ? 127.534 101.782 7.740   1.00 24.78 ? 345  ALA C N     1 
ATOM   8106  C  CA    . ALA C  1 317 ? 127.734 102.313 9.085   1.00 25.18 ? 345  ALA C CA    1 
ATOM   8107  C  C     . ALA C  1 317 ? 127.745 101.168 10.131  1.00 25.05 ? 345  ALA C C     1 
ATOM   8108  O  O     . ALA C  1 317 ? 128.629 101.116 10.993  1.00 24.87 ? 345  ALA C O     1 
ATOM   8109  C  CB    . ALA C  1 317 ? 126.637 103.355 9.434   1.00 24.75 ? 345  ALA C CB    1 
ATOM   8110  N  N     . ALA C  1 318 ? 126.765 100.271 10.035  1.00 24.88 ? 346  ALA C N     1 
ATOM   8111  C  CA    . ALA C  1 318 ? 126.671 99.094  10.927  1.00 25.04 ? 346  ALA C CA    1 
ATOM   8112  C  C     . ALA C  1 318 ? 127.941 98.235  10.919  1.00 25.30 ? 346  ALA C C     1 
ATOM   8113  O  O     . ALA C  1 318 ? 128.389 97.784  11.980  1.00 24.84 ? 346  ALA C O     1 
ATOM   8114  C  CB    . ALA C  1 318 ? 125.500 98.236  10.557  1.00 24.36 ? 346  ALA C CB    1 
ATOM   8115  N  N     . ARG C  1 319 ? 128.477 97.981  9.718   1.00 25.27 ? 347  ARG C N     1 
ATOM   8116  C  CA    . ARG C  1 319 ? 129.717 97.213  9.555   1.00 24.79 ? 347  ARG C CA    1 
ATOM   8117  C  C     . ARG C  1 319 ? 130.881 97.930  10.215  1.00 24.45 ? 347  ARG C C     1 
ATOM   8118  O  O     . ARG C  1 319 ? 131.640 97.318  10.964  1.00 23.78 ? 347  ARG C O     1 
ATOM   8119  C  CB    . ARG C  1 319 ? 130.018 96.919  8.072   1.00 24.91 ? 347  ARG C CB    1 
ATOM   8120  C  CG    A ARG C  1 319 ? 131.344 96.159  7.812   0.50 25.56 ? 347  ARG C CG    1 
ATOM   8121  C  CG    B ARG C  1 319 ? 131.287 96.096  7.845   0.50 24.75 ? 347  ARG C CG    1 
ATOM   8122  C  CD    A ARG C  1 319 ? 131.654 95.990  6.315   0.50 26.14 ? 347  ARG C CD    1 
ATOM   8123  C  CD    B ARG C  1 319 ? 131.271 95.379  6.503   0.50 23.89 ? 347  ARG C CD    1 
ATOM   8124  N  NE    A ARG C  1 319 ? 132.025 97.240  5.625   0.50 27.46 ? 347  ARG C NE    1 
ATOM   8125  N  NE    B ARG C  1 319 ? 130.222 94.359  6.432   0.50 23.50 ? 347  ARG C NE    1 
ATOM   8126  C  CZ    A ARG C  1 319 ? 133.272 97.662  5.389   0.50 28.10 ? 347  ARG C CZ    1 
ATOM   8127  C  CZ    B ARG C  1 319 ? 129.061 94.485  5.790   0.50 20.92 ? 347  ARG C CZ    1 
ATOM   8128  N  NH1   A ARG C  1 319 ? 134.336 96.968  5.787   0.50 29.47 ? 347  ARG C NH1   1 
ATOM   8129  N  NH1   B ARG C  1 319 ? 128.202 93.482  5.811   0.50 20.47 ? 347  ARG C NH1   1 
ATOM   8130  N  NH2   A ARG C  1 319 ? 133.465 98.800  4.741   0.50 27.48 ? 347  ARG C NH2   1 
ATOM   8131  N  NH2   B ARG C  1 319 ? 128.744 95.607  5.144   0.50 23.79 ? 347  ARG C NH2   1 
ATOM   8132  N  N     . LEU C  1 320 ? 130.998 99.234  9.983   1.00 23.13 ? 348  LEU C N     1 
ATOM   8133  C  CA    . LEU C  1 320 ? 132.095 99.981  10.595  1.00 22.78 ? 348  LEU C CA    1 
ATOM   8134  C  C     . LEU C  1 320 ? 132.028 100.003 12.119  1.00 22.29 ? 348  LEU C C     1 
ATOM   8135  O  O     . LEU C  1 320 ? 133.030 99.822  12.763  1.00 21.15 ? 348  LEU C O     1 
ATOM   8136  C  CB    . LEU C  1 320 ? 132.189 101.396 10.025  1.00 22.65 ? 348  LEU C CB    1 
ATOM   8137  C  CG    . LEU C  1 320 ? 132.469 101.489 8.509   1.00 24.13 ? 348  LEU C CG    1 
ATOM   8138  C  CD1   . LEU C  1 320 ? 132.420 102.905 8.046   1.00 22.06 ? 348  LEU C CD1   1 
ATOM   8139  C  CD2   . LEU C  1 320 ? 133.817 100.816 8.116   1.00 25.34 ? 348  LEU C CD2   1 
ATOM   8140  N  N     . LEU C  1 321 ? 130.838 100.228 12.686  1.00 22.36 ? 349  LEU C N     1 
ATOM   8141  C  CA    . LEU C  1 321 ? 130.660 100.223 14.137  1.00 22.57 ? 349  LEU C CA    1 
ATOM   8142  C  C     . LEU C  1 321 ? 131.033 98.866  14.742  1.00 23.02 ? 349  LEU C C     1 
ATOM   8143  O  O     . LEU C  1 321 ? 131.670 98.808  15.774  1.00 22.77 ? 349  LEU C O     1 
ATOM   8144  C  CB    . LEU C  1 321 ? 129.205 100.555 14.497  1.00 22.26 ? 349  LEU C CB    1 
ATOM   8145  C  CG    . LEU C  1 321 ? 128.756 102.013 14.328  1.00 22.14 ? 349  LEU C CG    1 
ATOM   8146  C  CD1   . LEU C  1 321 ? 127.197 102.084 14.352  1.00 24.56 ? 349  LEU C CD1   1 
ATOM   8147  C  CD2   . LEU C  1 321 ? 129.353 102.931 15.356  1.00 23.07 ? 349  LEU C CD2   1 
ATOM   8148  N  N     . THR C  1 322 ? 130.607 97.793  14.084  1.00 22.98 ? 350  THR C N     1 
ATOM   8149  C  CA    . THR C  1 322 ? 130.834 96.426  14.580  1.00 24.06 ? 350  THR C CA    1 
ATOM   8150  C  C     . THR C  1 322 ? 132.333 96.108  14.593  1.00 24.32 ? 350  THR C C     1 
ATOM   8151  O  O     . THR C  1 322 ? 132.887 95.719  15.633  1.00 23.94 ? 350  THR C O     1 
ATOM   8152  C  CB    . THR C  1 322 ? 130.057 95.398  13.739  1.00 23.66 ? 350  THR C CB    1 
ATOM   8153  O  OG1   . THR C  1 322 ? 128.665 95.714  13.816  1.00 25.05 ? 350  THR C OG1   1 
ATOM   8154  C  CG2   . THR C  1 322 ? 130.270 93.946  14.262  1.00 24.53 ? 350  THR C CG2   1 
ATOM   8155  N  N     . TYR C  1 323 ? 132.990 96.319  13.454  1.00 24.09 ? 351  TYR C N     1 
ATOM   8156  C  CA    . TYR C  1 323 ? 134.406 96.011  13.349  1.00 25.03 ? 351  TYR C CA    1 
ATOM   8157  C  C     . TYR C  1 323 ? 135.251 96.930  14.220  1.00 24.77 ? 351  TYR C C     1 
ATOM   8158  O  O     . TYR C  1 323 ? 136.256 96.501  14.770  1.00 23.91 ? 351  TYR C O     1 
ATOM   8159  C  CB    . TYR C  1 323 ? 134.897 96.103  11.895  1.00 26.13 ? 351  TYR C CB    1 
ATOM   8160  C  CG    . TYR C  1 323 ? 134.288 95.111  10.890  1.00 27.42 ? 351  TYR C CG    1 
ATOM   8161  C  CD1   . TYR C  1 323 ? 133.373 94.136  11.265  1.00 27.97 ? 351  TYR C CD1   1 
ATOM   8162  C  CD2   . TYR C  1 323 ? 134.661 95.173  9.537   1.00 29.45 ? 351  TYR C CD2   1 
ATOM   8163  C  CE1   . TYR C  1 323 ? 132.829 93.248  10.323  1.00 27.81 ? 351  TYR C CE1   1 
ATOM   8164  C  CE2   . TYR C  1 323 ? 134.144 94.300  8.598   1.00 29.59 ? 351  TYR C CE2   1 
ATOM   8165  C  CZ    . TYR C  1 323 ? 133.225 93.338  8.985   1.00 29.87 ? 351  TYR C CZ    1 
ATOM   8166  O  OH    . TYR C  1 323 ? 132.719 92.489  8.022   1.00 28.60 ? 351  TYR C OH    1 
ATOM   8167  N  N     . ASN C  1 324 ? 134.850 98.196  14.358  1.00 24.12 ? 352  ASN C N     1 
ATOM   8168  C  CA    . ASN C  1 324 ? 135.604 99.101  15.213  1.00 24.11 ? 352  ASN C CA    1 
ATOM   8169  C  C     . ASN C  1 324 ? 135.531 98.717  16.692  1.00 23.26 ? 352  ASN C C     1 
ATOM   8170  O  O     . ASN C  1 324 ? 136.534 98.813  17.398  1.00 22.35 ? 352  ASN C O     1 
ATOM   8171  C  CB    . ASN C  1 324 ? 135.191 100.568 15.020  1.00 24.11 ? 352  ASN C CB    1 
ATOM   8172  C  CG    . ASN C  1 324 ? 136.167 101.533 15.688  1.00 25.58 ? 352  ASN C CG    1 
ATOM   8173  O  OD1   . ASN C  1 324 ? 137.340 101.534 15.376  1.00 26.36 ? 352  ASN C OD1   1 
ATOM   8174  N  ND2   . ASN C  1 324 ? 135.681 102.330 16.631  1.00 26.47 ? 352  ASN C ND2   1 
ATOM   8175  N  N     . ALA C  1 325 ? 134.354 98.287  17.147  1.00 23.17 ? 353  ALA C N     1 
ATOM   8176  C  CA    . ALA C  1 325 ? 134.188 97.797  18.510  1.00 23.01 ? 353  ALA C CA    1 
ATOM   8177  C  C     . ALA C  1 325 ? 135.113 96.590  18.755  1.00 23.53 ? 353  ALA C C     1 
ATOM   8178  O  O     . ALA C  1 325 ? 135.815 96.530  19.780  1.00 23.34 ? 353  ALA C O     1 
ATOM   8179  C  CB    . ALA C  1 325 ? 132.723 97.435  18.785  1.00 22.61 ? 353  ALA C CB    1 
ATOM   8180  N  N     . ALA C  1 326 ? 135.138 95.675  17.786  1.00 24.09 ? 354  ALA C N     1 
ATOM   8181  C  CA    . ALA C  1 326 ? 135.990 94.480  17.838  1.00 25.26 ? 354  ALA C CA    1 
ATOM   8182  C  C     . ALA C  1 326 ? 137.465 94.824  17.927  1.00 25.54 ? 354  ALA C C     1 
ATOM   8183  O  O     . ALA C  1 326 ? 138.193 94.219  18.709  1.00 25.53 ? 354  ALA C O     1 
ATOM   8184  C  CB    . ALA C  1 326 ? 135.721 93.556  16.615  1.00 24.20 ? 354  ALA C CB    1 
ATOM   8185  N  N     . ARG C  1 327 ? 137.895 95.808  17.131  1.00 26.86 ? 355  ARG C N     1 
ATOM   8186  C  CA    . ARG C  1 327 ? 139.273 96.219  17.098  1.00 28.37 ? 355  ARG C CA    1 
ATOM   8187  C  C     . ARG C  1 327 ? 139.672 96.946  18.378  1.00 27.48 ? 355  ARG C C     1 
ATOM   8188  O  O     . ARG C  1 327 ? 140.785 96.797  18.833  1.00 26.77 ? 355  ARG C O     1 
ATOM   8189  C  CB    . ARG C  1 327 ? 139.564 97.074  15.863  1.00 28.53 ? 355  ARG C CB    1 
ATOM   8190  C  CG    . ARG C  1 327 ? 139.586 96.251  14.574  1.00 30.80 ? 355  ARG C CG    1 
ATOM   8191  C  CD    . ARG C  1 327 ? 140.020 97.095  13.390  1.00 33.41 ? 355  ARG C CD    1 
ATOM   8192  N  NE    . ARG C  1 327 ? 139.397 96.679  12.124  1.00 39.67 ? 355  ARG C NE    1 
ATOM   8193  C  CZ    . ARG C  1 327 ? 139.907 95.800  11.260  1.00 40.48 ? 355  ARG C CZ    1 
ATOM   8194  N  NH1   . ARG C  1 327 ? 141.062 95.196  11.499  1.00 43.09 ? 355  ARG C NH1   1 
ATOM   8195  N  NH2   . ARG C  1 327 ? 139.243 95.513  10.148  1.00 40.04 ? 355  ARG C NH2   1 
ATOM   8196  N  N     . LEU C  1 328 ? 138.756 97.716  18.961  1.00 27.25 ? 356  LEU C N     1 
ATOM   8197  C  CA    . LEU C  1 328 ? 139.009 98.342  20.253  1.00 26.77 ? 356  LEU C CA    1 
ATOM   8198  C  C     . LEU C  1 328 ? 139.245 97.285  21.344  1.00 26.88 ? 356  LEU C C     1 
ATOM   8199  O  O     . LEU C  1 328 ? 140.213 97.378  22.101  1.00 26.37 ? 356  LEU C O     1 
ATOM   8200  C  CB    . LEU C  1 328 ? 137.854 99.283  20.645  1.00 26.79 ? 356  LEU C CB    1 
ATOM   8201  C  CG    . LEU C  1 328 ? 137.771 100.608 19.859  1.00 25.36 ? 356  LEU C CG    1 
ATOM   8202  C  CD1   . LEU C  1 328 ? 136.388 101.290 20.104  1.00 24.58 ? 356  LEU C CD1   1 
ATOM   8203  C  CD2   . LEU C  1 328 ? 138.921 101.523 20.206  1.00 25.44 ? 356  LEU C CD2   1 
ATOM   8204  N  N     . LEU C  1 329 ? 138.352 96.303  21.414  1.00 27.46 ? 357  LEU C N     1 
ATOM   8205  C  CA    . LEU C  1 329 ? 138.488 95.160  22.330  1.00 27.92 ? 357  LEU C CA    1 
ATOM   8206  C  C     . LEU C  1 329 ? 139.846 94.492  22.145  1.00 28.47 ? 357  LEU C C     1 
ATOM   8207  O  O     . LEU C  1 329 ? 140.596 94.333  23.113  1.00 28.82 ? 357  LEU C O     1 
ATOM   8208  C  CB    . LEU C  1 329 ? 137.363 94.142  22.103  1.00 28.02 ? 357  LEU C CB    1 
ATOM   8209  C  CG    . LEU C  1 329 ? 137.346 92.901  23.015  1.00 27.71 ? 357  LEU C CG    1 
ATOM   8210  C  CD1   . LEU C  1 329 ? 135.926 92.325  23.089  1.00 27.16 ? 357  LEU C CD1   1 
ATOM   8211  C  CD2   . LEU C  1 329 ? 138.354 91.844  22.527  1.00 29.24 ? 357  LEU C CD2   1 
ATOM   8212  N  N     . GLU C  1 330 ? 140.180 94.134  20.907  1.00 28.76 ? 358  GLU C N     1 
ATOM   8213  C  CA    . GLU C  1 330 ? 141.493 93.534  20.625  1.00 29.70 ? 358  GLU C CA    1 
ATOM   8214  C  C     . GLU C  1 330 ? 142.663 94.402  21.070  1.00 30.05 ? 358  GLU C C     1 
ATOM   8215  O  O     . GLU C  1 330 ? 143.660 93.886  21.579  1.00 30.34 ? 358  GLU C O     1 
ATOM   8216  C  CB    . GLU C  1 330 ? 141.649 93.221  19.138  1.00 29.76 ? 358  GLU C CB    1 
ATOM   8217  C  CG    . GLU C  1 330 ? 140.793 92.066  18.703  1.00 31.07 ? 358  GLU C CG    1 
ATOM   8218  C  CD    . GLU C  1 330 ? 141.070 91.625  17.290  1.00 32.84 ? 358  GLU C CD    1 
ATOM   8219  O  OE1   . GLU C  1 330 ? 141.525 92.450  16.457  1.00 35.92 ? 358  GLU C OE1   1 
ATOM   8220  O  OE2   . GLU C  1 330 ? 140.808 90.451  17.005  1.00 34.09 ? 358  GLU C OE2   1 
ATOM   8221  N  N     . ALA C  1 331 ? 142.553 95.717  20.876  1.00 29.94 ? 359  ALA C N     1 
ATOM   8222  C  CA    . ALA C  1 331 ? 143.646 96.615  21.233  1.00 29.84 ? 359  ALA C CA    1 
ATOM   8223  C  C     . ALA C  1 331 ? 143.741 96.861  22.740  1.00 29.56 ? 359  ALA C C     1 
ATOM   8224  O  O     . ALA C  1 331 ? 144.658 97.527  23.191  1.00 29.28 ? 359  ALA C O     1 
ATOM   8225  C  CB    . ALA C  1 331 ? 143.533 97.938  20.474  1.00 29.80 ? 359  ALA C CB    1 
ATOM   8226  N  N     . GLY C  1 332 ? 142.798 96.335  23.512  1.00 29.69 ? 360  GLY C N     1 
ATOM   8227  C  CA    . GLY C  1 332 ? 142.775 96.561  24.961  1.00 29.54 ? 360  GLY C CA    1 
ATOM   8228  C  C     . GLY C  1 332 ? 142.339 97.977  25.298  1.00 29.32 ? 360  GLY C C     1 
ATOM   8229  O  O     . GLY C  1 332 ? 142.717 98.512  26.329  1.00 28.99 ? 360  GLY C O     1 
ATOM   8230  N  N     . LYS C  1 333 ? 141.550 98.588  24.416  1.00 28.89 ? 361  LYS C N     1 
ATOM   8231  C  CA    . LYS C  1 333 ? 141.018 99.934  24.650  1.00 29.06 ? 361  LYS C CA    1 
ATOM   8232  C  C     . LYS C  1 333 ? 139.600 99.835  25.200  1.00 28.48 ? 361  LYS C C     1 
ATOM   8233  O  O     . LYS C  1 333 ? 138.978 98.766  25.130  1.00 27.83 ? 361  LYS C O     1 
ATOM   8234  C  CB    . LYS C  1 333 ? 141.034 100.755 23.357  1.00 29.05 ? 361  LYS C CB    1 
ATOM   8235  C  CG    . LYS C  1 333 ? 142.423 101.029 22.827  1.00 31.07 ? 361  LYS C CG    1 
ATOM   8236  C  CD    . LYS C  1 333 ? 142.368 101.597 21.417  1.00 33.41 ? 361  LYS C CD    1 
ATOM   8237  N  N     . PRO C  1 334 ? 139.083 100.941 25.774  1.00 28.31 ? 362  PRO C N     1 
ATOM   8238  C  CA    . PRO C  1 334 ? 137.660 100.934 26.141  1.00 28.10 ? 362  PRO C CA    1 
ATOM   8239  C  C     . PRO C  1 334 ? 136.769 100.617 24.927  1.00 27.47 ? 362  PRO C C     1 
ATOM   8240  O  O     . PRO C  1 334 ? 136.971 101.178 23.851  1.00 27.04 ? 362  PRO C O     1 
ATOM   8241  C  CB    . PRO C  1 334 ? 137.417 102.360 26.672  1.00 28.39 ? 362  PRO C CB    1 
ATOM   8242  C  CG    . PRO C  1 334 ? 138.776 102.859 27.091  1.00 28.71 ? 362  PRO C CG    1 
ATOM   8243  C  CD    . PRO C  1 334 ? 139.750 102.209 26.141  1.00 28.59 ? 362  PRO C CD    1 
ATOM   8244  N  N     . PHE C  1 335 ? 135.839 99.682  25.092  1.00 27.19 ? 363  PHE C N     1 
ATOM   8245  C  CA    . PHE C  1 335 ? 134.968 99.244  23.994  1.00 27.10 ? 363  PHE C CA    1 
ATOM   8246  C  C     . PHE C  1 335 ? 133.484 99.095  24.355  1.00 26.45 ? 363  PHE C C     1 
ATOM   8247  O  O     . PHE C  1 335 ? 132.683 98.805  23.477  1.00 26.59 ? 363  PHE C O     1 
ATOM   8248  C  CB    . PHE C  1 335 ? 135.462 97.904  23.415  1.00 27.23 ? 363  PHE C CB    1 
ATOM   8249  C  CG    . PHE C  1 335 ? 135.201 96.731  24.310  1.00 27.08 ? 363  PHE C CG    1 
ATOM   8250  C  CD1   . PHE C  1 335 ? 133.993 96.032  24.235  1.00 26.52 ? 363  PHE C CD1   1 
ATOM   8251  C  CD2   . PHE C  1 335 ? 136.141 96.347  25.255  1.00 28.00 ? 363  PHE C CD2   1 
ATOM   8252  C  CE1   . PHE C  1 335 ? 133.738 94.969  25.068  1.00 27.79 ? 363  PHE C CE1   1 
ATOM   8253  C  CE2   . PHE C  1 335 ? 135.891 95.276  26.098  1.00 27.58 ? 363  PHE C CE2   1 
ATOM   8254  C  CZ    . PHE C  1 335 ? 134.689 94.583  26.000  1.00 29.19 ? 363  PHE C CZ    1 
ATOM   8255  N  N     . ILE C  1 336 ? 133.119 99.259  25.622  1.00 26.17 ? 364  ILE C N     1 
ATOM   8256  C  CA    . ILE C  1 336 ? 131.737 99.002  26.059  1.00 26.05 ? 364  ILE C CA    1 
ATOM   8257  C  C     . ILE C  1 336 ? 130.710 99.930  25.386  1.00 26.06 ? 364  ILE C C     1 
ATOM   8258  O  O     . ILE C  1 336 ? 129.695 99.456  24.861  1.00 25.29 ? 364  ILE C O     1 
ATOM   8259  C  CB    . ILE C  1 336 ? 131.580 99.078  27.581  1.00 26.27 ? 364  ILE C CB    1 
ATOM   8260  C  CG1   . ILE C  1 336 ? 132.391 97.961  28.264  1.00 26.24 ? 364  ILE C CG1   1 
ATOM   8261  C  CG2   . ILE C  1 336 ? 130.092 98.971  27.982  1.00 24.82 ? 364  ILE C CG2   1 
ATOM   8262  C  CD1   . ILE C  1 336 ? 132.450 98.101  29.789  1.00 26.27 ? 364  ILE C CD1   1 
ATOM   8263  N  N     . LYS C  1 337 ? 130.980 101.228 25.383  1.00 26.30 ? 365  LYS C N     1 
ATOM   8264  C  CA    . LYS C  1 337 ? 130.107 102.170 24.686  1.00 26.47 ? 365  LYS C CA    1 
ATOM   8265  C  C     . LYS C  1 337 ? 129.978 101.818 23.200  1.00 25.81 ? 365  LYS C C     1 
ATOM   8266  O  O     . LYS C  1 337 ? 128.889 101.829 22.636  1.00 25.45 ? 365  LYS C O     1 
ATOM   8267  C  CB    . LYS C  1 337 ? 130.607 103.600 24.848  1.00 26.88 ? 365  LYS C CB    1 
ATOM   8268  C  CG    . LYS C  1 337 ? 129.657 104.643 24.283  1.00 27.68 ? 365  LYS C CG    1 
ATOM   8269  C  CD    . LYS C  1 337 ? 130.293 106.009 24.272  1.00 31.23 ? 365  LYS C CD    1 
ATOM   8270  C  CE    . LYS C  1 337 ? 131.318 106.146 23.151  1.00 31.45 ? 365  LYS C CE    1 
ATOM   8271  N  NZ    . LYS C  1 337 ? 131.867 107.520 23.097  1.00 33.03 ? 365  LYS C NZ    1 
ATOM   8272  N  N     . GLU C  1 338 ? 131.105 101.491 22.577  1.00 25.41 ? 366  GLU C N     1 
ATOM   8273  C  CA    . GLU C  1 338 ? 131.143 101.177 21.170  1.00 24.65 ? 366  GLU C CA    1 
ATOM   8274  C  C     . GLU C  1 338 ? 130.452 99.859  20.858  1.00 24.11 ? 366  GLU C C     1 
ATOM   8275  O  O     . GLU C  1 338 ? 129.744 99.747  19.858  1.00 22.67 ? 366  GLU C O     1 
ATOM   8276  C  CB    . GLU C  1 338 ? 132.606 101.192 20.680  1.00 25.27 ? 366  GLU C CB    1 
ATOM   8277  C  CG    . GLU C  1 338 ? 133.268 102.588 20.762  1.00 26.75 ? 366  GLU C CG    1 
ATOM   8278  C  CD    . GLU C  1 338 ? 133.822 103.011 22.150  1.00 28.58 ? 366  GLU C CD    1 
ATOM   8279  O  OE1   . GLU C  1 338 ? 133.761 102.262 23.157  1.00 27.55 ? 366  GLU C OE1   1 
ATOM   8280  O  OE2   . GLU C  1 338 ? 134.333 104.152 22.233  1.00 30.84 ? 366  GLU C OE2   1 
ATOM   8281  N  N     . ALA C  1 339 ? 130.599 98.866  21.741  1.00 23.99 ? 367  ALA C N     1 
ATOM   8282  C  CA    . ALA C  1 339 ? 129.856 97.612  21.594  1.00 23.61 ? 367  ALA C CA    1 
ATOM   8283  C  C     . ALA C  1 339 ? 128.341 97.810  21.646  1.00 23.74 ? 367  ALA C C     1 
ATOM   8284  O  O     . ALA C  1 339 ? 127.614 97.223  20.847  1.00 21.88 ? 367  ALA C O     1 
ATOM   8285  C  CB    . ALA C  1 339 ? 130.303 96.565  22.660  1.00 23.94 ? 367  ALA C CB    1 
ATOM   8286  N  N     . SER C  1 340 ? 127.877 98.607  22.607  1.00 24.03 ? 368  SER C N     1 
ATOM   8287  C  CA    . SER C  1 340 ? 126.453 98.946  22.726  1.00 24.06 ? 368  SER C CA    1 
ATOM   8288  C  C     . SER C  1 340 ? 125.929 99.721  21.520  1.00 24.16 ? 368  SER C C     1 
ATOM   8289  O  O     . SER C  1 340 ? 124.845 99.434  21.006  1.00 23.51 ? 368  SER C O     1 
ATOM   8290  C  CB    . SER C  1 340 ? 126.219 99.757  23.990  1.00 24.23 ? 368  SER C CB    1 
ATOM   8291  O  OG    . SER C  1 340 ? 126.518 99.004  25.140  1.00 24.36 ? 368  SER C OG    1 
ATOM   8292  N  N     . MET C  1 341 ? 126.716 100.699 21.077  1.00 24.83 ? 369  MET C N     1 
ATOM   8293  C  CA    . MET C  1 341 ? 126.428 101.402 19.830  1.00 24.97 ? 369  MET C CA    1 
ATOM   8294  C  C     . MET C  1 341 ? 126.301 100.450 18.639  1.00 24.79 ? 369  MET C C     1 
ATOM   8295  O  O     . MET C  1 341 ? 125.316 100.528 17.923  1.00 24.77 ? 369  MET C O     1 
ATOM   8296  C  CB    . MET C  1 341 ? 127.487 102.450 19.549  1.00 25.09 ? 369  MET C CB    1 
ATOM   8297  C  CG    . MET C  1 341 ? 127.347 103.685 20.386  1.00 24.99 ? 369  MET C CG    1 
ATOM   8298  S  SD    . MET C  1 341 ? 128.620 104.875 19.968  1.00 25.18 ? 369  MET C SD    1 
ATOM   8299  C  CE    . MET C  1 341 ? 128.134 106.290 20.970  1.00 23.21 ? 369  MET C CE    1 
ATOM   8300  N  N     . ALA C  1 342 ? 127.266 99.533  18.443  1.00 24.59 ? 370  ALA C N     1 
ATOM   8301  C  CA    . ALA C  1 342 ? 127.170 98.555  17.343  1.00 24.56 ? 370  ALA C CA    1 
ATOM   8302  C  C     . ALA C  1 342 ? 125.922 97.673  17.437  1.00 24.57 ? 370  ALA C C     1 
ATOM   8303  O  O     . ALA C  1 342 ? 125.253 97.440  16.440  1.00 23.19 ? 370  ALA C O     1 
ATOM   8304  C  CB    . ALA C  1 342 ? 128.429 97.668  17.233  1.00 22.97 ? 370  ALA C CB    1 
ATOM   8305  N  N     . LYS C  1 343 ? 125.612 97.173  18.635  1.00 25.20 ? 371  LYS C N     1 
ATOM   8306  C  CA    . LYS C  1 343 ? 124.503 96.229  18.776  1.00 25.77 ? 371  LYS C CA    1 
ATOM   8307  C  C     . LYS C  1 343 ? 123.177 96.942  18.542  1.00 25.28 ? 371  LYS C C     1 
ATOM   8308  O  O     . LYS C  1 343 ? 122.301 96.420  17.832  1.00 25.73 ? 371  LYS C O     1 
ATOM   8309  C  CB    . LYS C  1 343 ? 124.523 95.544  20.153  1.00 25.61 ? 371  LYS C CB    1 
ATOM   8310  C  CG    . LYS C  1 343 ? 123.581 94.348  20.293  1.00 26.46 ? 371  LYS C CG    1 
ATOM   8311  C  CD    . LYS C  1 343 ? 122.198 94.760  20.790  1.00 26.36 ? 371  LYS C CD    1 
ATOM   8312  C  CE    . LYS C  1 343 ? 121.310 93.566  21.034  1.00 27.42 ? 371  LYS C CE    1 
ATOM   8313  N  NZ    . LYS C  1 343 ? 119.984 93.997  21.573  1.00 24.97 ? 371  LYS C NZ    1 
ATOM   8314  N  N     . TYR C  1 344 ? 123.029 98.109  19.167  1.00 25.15 ? 372  TYR C N     1 
ATOM   8315  C  CA    . TYR C  1 344 ? 121.841 98.946  19.003  1.00 25.63 ? 372  TYR C CA    1 
ATOM   8316  C  C     . TYR C  1 344 ? 121.613 99.268  17.526  1.00 25.62 ? 372  TYR C C     1 
ATOM   8317  O  O     . TYR C  1 344 ? 120.531 98.974  16.979  1.00 24.91 ? 372  TYR C O     1 
ATOM   8318  C  CB    . TYR C  1 344 ? 121.932 100.225 19.838  1.00 25.55 ? 372  TYR C CB    1 
ATOM   8319  C  CG    . TYR C  1 344 ? 120.886 101.281 19.473  1.00 26.27 ? 372  TYR C CG    1 
ATOM   8320  C  CD1   . TYR C  1 344 ? 119.542 101.126 19.828  1.00 25.73 ? 372  TYR C CD1   1 
ATOM   8321  C  CD2   . TYR C  1 344 ? 121.240 102.403 18.750  1.00 26.39 ? 372  TYR C CD2   1 
ATOM   8322  C  CE1   . TYR C  1 344 ? 118.583 102.087 19.486  1.00 27.09 ? 372  TYR C CE1   1 
ATOM   8323  C  CE2   . TYR C  1 344 ? 120.287 103.348 18.383  1.00 28.71 ? 372  TYR C CE2   1 
ATOM   8324  C  CZ    . TYR C  1 344 ? 118.965 103.187 18.758  1.00 28.46 ? 372  TYR C CZ    1 
ATOM   8325  O  OH    . TYR C  1 344 ? 118.051 104.156 18.407  1.00 28.24 ? 372  TYR C OH    1 
ATOM   8326  N  N     . TYR C  1 345 ? 122.632 99.854  16.889  1.00 26.42 ? 373  TYR C N     1 
ATOM   8327  C  CA    . TYR C  1 345 ? 122.509 100.330 15.496  1.00 26.19 ? 373  TYR C CA    1 
ATOM   8328  C  C     . TYR C  1 345 ? 122.267 99.183  14.497  1.00 26.12 ? 373  TYR C C     1 
ATOM   8329  O  O     . TYR C  1 345 ? 121.334 99.235  13.684  1.00 25.33 ? 373  TYR C O     1 
ATOM   8330  C  CB    . TYR C  1 345 ? 123.755 101.132 15.107  1.00 26.69 ? 373  TYR C CB    1 
ATOM   8331  C  CG    . TYR C  1 345 ? 123.600 101.856 13.800  1.00 27.59 ? 373  TYR C CG    1 
ATOM   8332  C  CD1   . TYR C  1 345 ? 123.040 103.118 13.750  1.00 29.46 ? 373  TYR C CD1   1 
ATOM   8333  C  CD2   . TYR C  1 345 ? 123.958 101.247 12.595  1.00 27.63 ? 373  TYR C CD2   1 
ATOM   8334  C  CE1   . TYR C  1 345 ? 122.875 103.771 12.540  1.00 29.69 ? 373  TYR C CE1   1 
ATOM   8335  C  CE2   . TYR C  1 345 ? 123.787 101.888 11.399  1.00 27.45 ? 373  TYR C CE2   1 
ATOM   8336  C  CZ    . TYR C  1 345 ? 123.242 103.149 11.373  1.00 28.77 ? 373  TYR C CZ    1 
ATOM   8337  O  OH    . TYR C  1 345 ? 123.068 103.787 10.148  1.00 30.59 ? 373  TYR C OH    1 
ATOM   8338  N  N     . ALA C  1 346 ? 123.108 98.148  14.578  1.00 25.75 ? 374  ALA C N     1 
ATOM   8339  C  CA    . ALA C  1 346 ? 123.013 96.979  13.701  1.00 25.66 ? 374  ALA C CA    1 
ATOM   8340  C  C     . ALA C  1 346 ? 121.667 96.262  13.828  1.00 25.51 ? 374  ALA C C     1 
ATOM   8341  O  O     . ALA C  1 346 ? 121.071 95.878  12.818  1.00 25.25 ? 374  ALA C O     1 
ATOM   8342  C  CB    . ALA C  1 346 ? 124.181 96.000  13.963  1.00 25.11 ? 374  ALA C CB    1 
ATOM   8343  N  N     . SER C  1 347 ? 121.191 96.087  15.056  1.00 25.70 ? 375  SER C N     1 
ATOM   8344  C  CA    . SER C  1 347 ? 119.898 95.421  15.279  1.00 25.45 ? 375  SER C CA    1 
ATOM   8345  C  C     . SER C  1 347 ? 118.749 96.270  14.733  1.00 25.52 ? 375  SER C C     1 
ATOM   8346  O  O     . SER C  1 347 ? 117.888 95.739  14.040  1.00 25.12 ? 375  SER C O     1 
ATOM   8347  C  CB    . SER C  1 347 ? 119.665 95.088  16.751  1.00 25.08 ? 375  SER C CB    1 
ATOM   8348  O  OG    . SER C  1 347 ? 119.552 96.262  17.554  1.00 26.15 ? 375  SER C OG    1 
ATOM   8349  N  N     . GLU C  1 348 ? 118.780 97.574  14.997  1.00 26.40 ? 376  GLU C N     1 
ATOM   8350  C  CA    . GLU C  1 348 ? 117.749 98.495  14.492  1.00 26.88 ? 376  GLU C CA    1 
ATOM   8351  C  C     . GLU C  1 348 ? 117.766 98.566  12.969  1.00 26.84 ? 376  GLU C C     1 
ATOM   8352  O  O     . GLU C  1 348 ? 116.722 98.450  12.332  1.00 26.51 ? 376  GLU C O     1 
ATOM   8353  C  CB    . GLU C  1 348 ? 117.866 99.902  15.084  1.00 27.48 ? 376  GLU C CB    1 
ATOM   8354  C  CG    . GLU C  1 348 ? 117.611 100.030 16.599  1.00 29.00 ? 376  GLU C CG    1 
ATOM   8355  C  CD    . GLU C  1 348 ? 116.153 99.875  17.051  1.00 32.77 ? 376  GLU C CD    1 
ATOM   8356  O  OE1   . GLU C  1 348 ? 115.218 100.050 16.233  1.00 32.57 ? 376  GLU C OE1   1 
ATOM   8357  O  OE2   . GLU C  1 348 ? 115.956 99.530  18.251  1.00 32.07 ? 376  GLU C OE2   1 
ATOM   8358  N  N     . ILE C  1 349 ? 118.939 98.735  12.360  1.00 27.00 ? 377  ILE C N     1 
ATOM   8359  C  CA    . ILE C  1 349 ? 118.970 98.747  10.900  1.00 27.54 ? 377  ILE C CA    1 
ATOM   8360  C  C     . ILE C  1 349 ? 118.710 97.387  10.220  1.00 26.93 ? 377  ILE C C     1 
ATOM   8361  O  O     . ILE C  1 349 ? 118.180 97.348  9.105   1.00 27.26 ? 377  ILE C O     1 
ATOM   8362  C  CB    . ILE C  1 349 ? 120.181 99.526  10.311  1.00 28.19 ? 377  ILE C CB    1 
ATOM   8363  C  CG1   . ILE C  1 349 ? 121.455 98.730  10.439  1.00 29.51 ? 377  ILE C CG1   1 
ATOM   8364  C  CG2   . ILE C  1 349 ? 120.245 100.962 10.902  1.00 26.02 ? 377  ILE C CG2   1 
ATOM   8365  C  CD1   . ILE C  1 349 ? 121.729 97.873  9.212   1.00 30.51 ? 377  ILE C CD1   1 
ATOM   8366  N  N     . ALA C  1 350 ? 119.012 96.271  10.878  1.00 26.66 ? 378  ALA C N     1 
ATOM   8367  C  CA    . ALA C  1 350 ? 118.608 94.972  10.357  1.00 26.67 ? 378  ALA C CA    1 
ATOM   8368  C  C     . ALA C  1 350 ? 117.074 94.842  10.250  1.00 26.93 ? 378  ALA C C     1 
ATOM   8369  O  O     . ALA C  1 350 ? 116.577 94.248  9.296   1.00 26.98 ? 378  ALA C O     1 
ATOM   8370  C  CB    . ALA C  1 350 ? 119.183 93.822  11.180  1.00 27.09 ? 378  ALA C CB    1 
ATOM   8371  N  N     . GLY C  1 351 ? 116.345 95.376  11.227  1.00 26.80 ? 379  GLY C N     1 
ATOM   8372  C  CA    . GLY C  1 351 ? 114.866 95.412  11.177  1.00 27.16 ? 379  GLY C CA    1 
ATOM   8373  C  C     . GLY C  1 351 ? 114.393 96.228  9.982   1.00 27.13 ? 379  GLY C C     1 
ATOM   8374  O  O     . GLY C  1 351 ? 113.521 95.811  9.205   1.00 26.61 ? 379  GLY C O     1 
ATOM   8375  N  N     . GLN C  1 352 ? 115.015 97.384  9.810   1.00 27.00 ? 380  GLN C N     1 
ATOM   8376  C  CA    . GLN C  1 352 ? 114.655 98.293  8.727   1.00 27.62 ? 380  GLN C CA    1 
ATOM   8377  C  C     . GLN C  1 352 ? 114.982 97.713  7.353   1.00 26.83 ? 380  GLN C C     1 
ATOM   8378  O  O     . GLN C  1 352 ? 114.143 97.750  6.449   1.00 26.84 ? 380  GLN C O     1 
ATOM   8379  C  CB    . GLN C  1 352 ? 115.346 99.655  8.931   1.00 27.35 ? 380  GLN C CB    1 
ATOM   8380  C  CG    . GLN C  1 352 ? 114.849 100.388 10.175  1.00 29.00 ? 380  GLN C CG    1 
ATOM   8381  C  CD    . GLN C  1 352 ? 115.508 101.754 10.371  1.00 31.20 ? 380  GLN C CD    1 
ATOM   8382  O  OE1   . GLN C  1 352 ? 115.846 102.424 9.403   1.00 34.78 ? 380  GLN C OE1   1 
ATOM   8383  N  NE2   . GLN C  1 352 ? 115.677 102.170 11.639  1.00 35.58 ? 380  GLN C NE2   1 
ATOM   8384  N  N     . THR C  1 353 ? 116.189 97.160  7.222   1.00 27.01 ? 381  THR C N     1 
ATOM   8385  C  CA    . THR C  1 353 ? 116.688 96.572  5.984   1.00 26.53 ? 381  THR C CA    1 
ATOM   8386  C  C     . THR C  1 353 ? 115.763 95.445  5.526   1.00 27.36 ? 381  THR C C     1 
ATOM   8387  O  O     . THR C  1 353 ? 115.289 95.463  4.404   1.00 27.06 ? 381  THR C O     1 
ATOM   8388  C  CB    . THR C  1 353 ? 118.124 96.030  6.152   1.00 26.64 ? 381  THR C CB    1 
ATOM   8389  O  OG1   . THR C  1 353 ? 119.010 97.109  6.495   1.00 25.79 ? 381  THR C OG1   1 
ATOM   8390  C  CG2   . THR C  1 353 ? 118.614 95.303  4.879   1.00 26.51 ? 381  THR C CG2   1 
ATOM   8391  N  N     . THR C  1 354 ? 115.490 94.493  6.421   1.00 27.48 ? 382  THR C N     1 
ATOM   8392  C  CA    . THR C  1 354 ? 114.647 93.356  6.107   1.00 27.07 ? 382  THR C CA    1 
ATOM   8393  C  C     . THR C  1 354 ? 113.191 93.735  5.784   1.00 27.54 ? 382  THR C C     1 
ATOM   8394  O  O     . THR C  1 354 ? 112.597 93.176  4.849   1.00 27.02 ? 382  THR C O     1 
ATOM   8395  C  CB    . THR C  1 354 ? 114.718 92.255  7.210   1.00 27.67 ? 382  THR C CB    1 
ATOM   8396  O  OG1   . THR C  1 354 ? 114.280 92.775  8.487   1.00 26.72 ? 382  THR C OG1   1 
ATOM   8397  C  CG2   . THR C  1 354 ? 116.142 91.678  7.321   1.00 24.21 ? 382  THR C CG2   1 
ATOM   8398  N  N     . SER C  1 355 ? 112.618 94.647  6.561   1.00 27.63 ? 383  SER C N     1 
ATOM   8399  C  CA    . SER C  1 355 ? 111.300 95.206  6.279   1.00 28.51 ? 383  SER C CA    1 
ATOM   8400  C  C     . SER C  1 355 ? 111.224 95.837  4.869   1.00 29.00 ? 383  SER C C     1 
ATOM   8401  O  O     . SER C  1 355 ? 110.271 95.581  4.110   1.00 28.90 ? 383  SER C O     1 
ATOM   8402  C  CB    . SER C  1 355 ? 110.933 96.240  7.352   1.00 28.89 ? 383  SER C CB    1 
ATOM   8403  O  OG    . SER C  1 355 ? 109.665 96.820  7.118   1.00 29.35 ? 383  SER C OG    1 
ATOM   8404  N  N     . LYS C  1 356 ? 112.232 96.630  4.518   1.00 29.10 ? 384  LYS C N     1 
ATOM   8405  C  CA    . LYS C  1 356 ? 112.278 97.252  3.200   1.00 30.18 ? 384  LYS C CA    1 
ATOM   8406  C  C     . LYS C  1 356 ? 112.473 96.244  2.088   1.00 29.25 ? 384  LYS C C     1 
ATOM   8407  O  O     . LYS C  1 356 ? 111.881 96.396  1.041   1.00 28.26 ? 384  LYS C O     1 
ATOM   8408  C  CB    . LYS C  1 356 ? 113.367 98.330  3.103   1.00 30.63 ? 384  LYS C CB    1 
ATOM   8409  C  CG    . LYS C  1 356 ? 112.999 99.633  3.773   1.00 33.91 ? 384  LYS C CG    1 
ATOM   8410  C  CD    . LYS C  1 356 ? 112.001 100.433 2.961   1.00 38.46 ? 384  LYS C CD    1 
ATOM   8411  C  CE    . LYS C  1 356 ? 111.121 101.286 3.859   1.00 40.01 ? 384  LYS C CE    1 
ATOM   8412  N  NZ    . LYS C  1 356 ? 110.335 102.295 3.108   1.00 42.85 ? 384  LYS C NZ    1 
ATOM   8413  N  N     . CYS C  1 357 ? 113.317 95.227  2.309   1.00 28.91 ? 385  CYS C N     1 
ATOM   8414  C  CA    . CYS C  1 357 ? 113.555 94.215  1.272   1.00 28.62 ? 385  CYS C CA    1 
ATOM   8415  C  C     . CYS C  1 357 ? 112.283 93.452  0.903   1.00 28.06 ? 385  CYS C C     1 
ATOM   8416  O  O     . CYS C  1 357 ? 112.084 93.163  -0.270  1.00 27.41 ? 385  CYS C O     1 
ATOM   8417  C  CB    . CYS C  1 357 ? 114.664 93.223  1.661   1.00 28.69 ? 385  CYS C CB    1 
ATOM   8418  S  SG    . CYS C  1 357 ? 116.338 93.892  1.558   1.00 30.71 ? 385  CYS C SG    1 
ATOM   8419  N  N     . ILE C  1 358 ? 111.437 93.127  1.886   1.00 27.55 ? 386  ILE C N     1 
ATOM   8420  C  CA    . ILE C  1 358 ? 110.137 92.492  1.604   1.00 28.47 ? 386  ILE C CA    1 
ATOM   8421  C  C     . ILE C  1 358 ? 109.329 93.379  0.639   1.00 27.83 ? 386  ILE C C     1 
ATOM   8422  O  O     . ILE C  1 358 ? 108.764 92.899  -0.332  1.00 27.90 ? 386  ILE C O     1 
ATOM   8423  C  CB    . ILE C  1 358 ? 109.307 92.224  2.882   1.00 28.28 ? 386  ILE C CB    1 
ATOM   8424  C  CG1   . ILE C  1 358 ? 109.992 91.183  3.767   1.00 30.08 ? 386  ILE C CG1   1 
ATOM   8425  C  CG2   . ILE C  1 358 ? 107.892 91.714  2.516   1.00 30.99 ? 386  ILE C CG2   1 
ATOM   8426  C  CD1   . ILE C  1 358 ? 109.178 90.760  5.006   1.00 28.61 ? 386  ILE C CD1   1 
ATOM   8427  N  N     . GLU C  1 359 ? 109.309 94.678  0.912   1.00 27.77 ? 387  GLU C N     1 
ATOM   8428  C  CA    . GLU C  1 359 ? 108.591 95.643  0.059   1.00 28.07 ? 387  GLU C CA    1 
ATOM   8429  C  C     . GLU C  1 359 ? 109.146 95.727  -1.367  1.00 27.58 ? 387  GLU C C     1 
ATOM   8430  O  O     . GLU C  1 359 ? 108.377 95.736  -2.334  1.00 27.54 ? 387  GLU C O     1 
ATOM   8431  C  CB    . GLU C  1 359 ? 108.604 97.021  0.709   1.00 28.06 ? 387  GLU C CB    1 
ATOM   8432  C  CG    . GLU C  1 359 ? 107.752 97.057  1.971   1.00 30.42 ? 387  GLU C CG    1 
ATOM   8433  C  CD    . GLU C  1 359 ? 107.807 98.382  2.693   1.00 31.31 ? 387  GLU C CD    1 
ATOM   8434  O  OE1   . GLU C  1 359 ? 108.351 99.355  2.137   1.00 37.07 ? 387  GLU C OE1   1 
ATOM   8435  O  OE2   . GLU C  1 359 ? 107.296 98.446  3.827   1.00 34.98 ? 387  GLU C OE2   1 
ATOM   8436  N  N     . TRP C  1 360 ? 110.470 95.763  -1.489  1.00 27.20 ? 388  TRP C N     1 
ATOM   8437  C  CA    . TRP C  1 360 ? 111.132 95.830  -2.798  1.00 27.38 ? 388  TRP C CA    1 
ATOM   8438  C  C     . TRP C  1 360 ? 110.840 94.568  -3.616  1.00 27.46 ? 388  TRP C C     1 
ATOM   8439  O  O     . TRP C  1 360 ? 110.680 94.643  -4.818  1.00 26.83 ? 388  TRP C O     1 
ATOM   8440  C  CB    . TRP C  1 360 ? 112.658 96.028  -2.672  1.00 27.21 ? 388  TRP C CB    1 
ATOM   8441  C  CG    . TRP C  1 360 ? 113.112 97.237  -1.879  1.00 27.61 ? 388  TRP C CG    1 
ATOM   8442  C  CD1   . TRP C  1 360 ? 112.406 98.388  -1.643  1.00 28.01 ? 388  TRP C CD1   1 
ATOM   8443  C  CD2   . TRP C  1 360 ? 114.375 97.403  -1.213  1.00 27.20 ? 388  TRP C CD2   1 
ATOM   8444  N  NE1   . TRP C  1 360 ? 113.146 99.247  -0.882  1.00 28.20 ? 388  TRP C NE1   1 
ATOM   8445  C  CE2   . TRP C  1 360 ? 114.355 98.668  -0.595  1.00 28.14 ? 388  TRP C CE2   1 
ATOM   8446  C  CE3   . TRP C  1 360 ? 115.514 96.595  -1.071  1.00 27.86 ? 388  TRP C CE3   1 
ATOM   8447  C  CZ2   . TRP C  1 360 ? 115.428 99.148  0.169   1.00 27.26 ? 388  TRP C CZ2   1 
ATOM   8448  C  CZ3   . TRP C  1 360 ? 116.592 97.074  -0.321  1.00 27.72 ? 388  TRP C CZ3   1 
ATOM   8449  C  CH2   . TRP C  1 360 ? 116.534 98.342  0.291   1.00 27.39 ? 388  TRP C CH2   1 
ATOM   8450  N  N     . MET C  1 361 ? 110.761 93.414  -2.944  1.00 28.03 ? 389  MET C N     1 
ATOM   8451  C  CA    . MET C  1 361 ? 110.414 92.151  -3.587  1.00 28.45 ? 389  MET C CA    1 
ATOM   8452  C  C     . MET C  1 361 ? 108.950 92.121  -4.029  1.00 27.76 ? 389  MET C C     1 
ATOM   8453  O  O     . MET C  1 361 ? 108.605 91.415  -4.976  1.00 28.14 ? 389  MET C O     1 
ATOM   8454  C  CB    . MET C  1 361 ? 110.626 90.968  -2.638  1.00 28.39 ? 389  MET C CB    1 
ATOM   8455  C  CG    . MET C  1 361 ? 112.047 90.713  -2.189  1.00 31.16 ? 389  MET C CG    1 
ATOM   8456  S  SD    . MET C  1 361 ? 113.169 90.104  -3.439  1.00 33.87 ? 389  MET C SD    1 
ATOM   8457  C  CE    . MET C  1 361 ? 112.348 88.627  -4.077  1.00 31.07 ? 389  MET C CE    1 
ATOM   8458  N  N     . GLY C  1 362 ? 108.100 92.844  -3.302  1.00 27.33 ? 390  GLY C N     1 
ATOM   8459  C  CA    . GLY C  1 362 ? 106.646 92.810  -3.493  1.00 26.54 ? 390  GLY C CA    1 
ATOM   8460  C  C     . GLY C  1 362 ? 106.033 91.510  -3.014  1.00 25.75 ? 390  GLY C C     1 
ATOM   8461  O  O     . GLY C  1 362 ? 106.488 90.922  -2.041  1.00 25.42 ? 390  GLY C O     1 
ATOM   8462  N  N     . GLY C  1 363 ? 104.991 91.057  -3.711  1.00 25.35 ? 391  GLY C N     1 
ATOM   8463  C  CA    . GLY C  1 363 ? 104.250 89.849  -3.344  1.00 25.09 ? 391  GLY C CA    1 
ATOM   8464  C  C     . GLY C  1 363 ? 105.088 88.628  -2.985  1.00 25.28 ? 391  GLY C C     1 
ATOM   8465  O  O     . GLY C  1 363 ? 104.860 87.993  -1.941  1.00 23.98 ? 391  GLY C O     1 
ATOM   8466  N  N     . VAL C  1 364 ? 106.048 88.289  -3.845  1.00 25.61 ? 392  VAL C N     1 
ATOM   8467  C  CA    . VAL C  1 364 ? 106.910 87.118  -3.603  1.00 25.95 ? 392  VAL C CA    1 
ATOM   8468  C  C     . VAL C  1 364 ? 107.669 87.228  -2.275  1.00 26.39 ? 392  VAL C C     1 
ATOM   8469  O  O     . VAL C  1 364 ? 107.887 86.215  -1.602  1.00 26.66 ? 392  VAL C O     1 
ATOM   8470  C  CB    . VAL C  1 364 ? 107.918 86.832  -4.780  1.00 26.10 ? 392  VAL C CB    1 
ATOM   8471  C  CG1   . VAL C  1 364 ? 107.182 86.370  -6.039  1.00 26.57 ? 392  VAL C CG1   1 
ATOM   8472  C  CG2   . VAL C  1 364 ? 108.817 88.020  -5.056  1.00 26.23 ? 392  VAL C CG2   1 
ATOM   8473  N  N     . GLY C  1 365 ? 108.050 88.451  -1.893  1.00 26.31 ? 393  GLY C N     1 
ATOM   8474  C  CA    . GLY C  1 365 ? 108.692 88.694  -0.599  1.00 26.53 ? 393  GLY C CA    1 
ATOM   8475  C  C     . GLY C  1 365 ? 107.855 88.319  0.621   1.00 26.26 ? 393  GLY C C     1 
ATOM   8476  O  O     . GLY C  1 365 ? 108.406 88.045  1.695   1.00 27.09 ? 393  GLY C O     1 
ATOM   8477  N  N     . TYR C  1 366 ? 106.533 88.285  0.455   1.00 25.55 ? 394  TYR C N     1 
ATOM   8478  C  CA    . TYR C  1 366 ? 105.617 87.881  1.523   1.00 25.49 ? 394  TYR C CA    1 
ATOM   8479  C  C     . TYR C  1 366 ? 105.441 86.354  1.620   1.00 25.68 ? 394  TYR C C     1 
ATOM   8480  O  O     . TYR C  1 366 ? 104.709 85.873  2.474   1.00 26.05 ? 394  TYR C O     1 
ATOM   8481  C  CB    . TYR C  1 366 ? 104.256 88.589  1.337   1.00 24.93 ? 394  TYR C CB    1 
ATOM   8482  C  CG    . TYR C  1 366 ? 103.428 88.734  2.620   1.00 24.58 ? 394  TYR C CG    1 
ATOM   8483  C  CD1   . TYR C  1 366 ? 103.847 89.571  3.651   1.00 26.27 ? 394  TYR C CD1   1 
ATOM   8484  C  CD2   . TYR C  1 366 ? 102.225 88.036  2.791   1.00 25.08 ? 394  TYR C CD2   1 
ATOM   8485  C  CE1   . TYR C  1 366 ? 103.098 89.705  4.822   1.00 24.60 ? 394  TYR C CE1   1 
ATOM   8486  C  CE2   . TYR C  1 366 ? 101.467 88.176  3.941   1.00 24.38 ? 394  TYR C CE2   1 
ATOM   8487  C  CZ    . TYR C  1 366 ? 101.923 89.005  4.964   1.00 24.99 ? 394  TYR C CZ    1 
ATOM   8488  O  OH    . TYR C  1 366 ? 101.201 89.144  6.113   1.00 24.09 ? 394  TYR C OH    1 
ATOM   8489  N  N     . THR C  1 367 ? 106.091 85.591  0.738   1.00 25.82 ? 395  THR C N     1 
ATOM   8490  C  CA    . THR C  1 367 ? 105.901 84.141  0.697   1.00 26.15 ? 395  THR C CA    1 
ATOM   8491  C  C     . THR C  1 367 ? 107.132 83.407  1.226   1.00 26.50 ? 395  THR C C     1 
ATOM   8492  O  O     . THR C  1 367 ? 108.257 83.891  1.114   1.00 26.04 ? 395  THR C O     1 
ATOM   8493  C  CB    . THR C  1 367 ? 105.537 83.603  -0.726  1.00 25.90 ? 395  THR C CB    1 
ATOM   8494  O  OG1   . THR C  1 367 ? 106.665 83.706  -1.609  1.00 27.51 ? 395  THR C OG1   1 
ATOM   8495  C  CG2   . THR C  1 367 ? 104.357 84.370  -1.325  1.00 25.66 ? 395  THR C CG2   1 
ATOM   8496  N  N     . LYS C  1 368 ? 106.898 82.228  1.791   1.00 27.30 ? 396  LYS C N     1 
ATOM   8497  C  CA    . LYS C  1 368 ? 107.971 81.408  2.342   1.00 28.58 ? 396  LYS C CA    1 
ATOM   8498  C  C     . LYS C  1 368 ? 108.760 80.650  1.268   1.00 28.82 ? 396  LYS C C     1 
ATOM   8499  O  O     . LYS C  1 368 ? 109.718 79.966  1.584   1.00 29.17 ? 396  LYS C O     1 
ATOM   8500  C  CB    . LYS C  1 368 ? 107.406 80.446  3.388   1.00 28.65 ? 396  LYS C CB    1 
ATOM   8501  C  CG    . LYS C  1 368 ? 106.696 81.160  4.558   1.00 29.34 ? 396  LYS C CG    1 
ATOM   8502  C  CD    . LYS C  1 368 ? 106.527 80.246  5.756   1.00 30.18 ? 396  LYS C CD    1 
ATOM   8503  C  CE    . LYS C  1 368 ? 105.906 80.982  6.943   1.00 30.44 ? 396  LYS C CE    1 
ATOM   8504  N  NZ    . LYS C  1 368 ? 106.825 81.952  7.631   1.00 28.81 ? 396  LYS C NZ    1 
ATOM   8505  N  N     . ASP C  1 369 ? 108.363 80.781  0.009   1.00 29.44 ? 397  ASP C N     1 
ATOM   8506  C  CA    . ASP C  1 369 ? 109.139 80.257  -1.119  1.00 30.32 ? 397  ASP C CA    1 
ATOM   8507  C  C     . ASP C  1 369 ? 110.366 81.113  -1.415  1.00 29.97 ? 397  ASP C C     1 
ATOM   8508  O  O     . ASP C  1 369 ? 111.237 80.699  -2.169  1.00 30.63 ? 397  ASP C O     1 
ATOM   8509  C  CB    . ASP C  1 369 ? 108.262 80.179  -2.371  1.00 30.69 ? 397  ASP C CB    1 
ATOM   8510  C  CG    . ASP C  1 369 ? 107.231 79.061  -2.303  1.00 33.36 ? 397  ASP C CG    1 
ATOM   8511  O  OD1   . ASP C  1 369 ? 107.413 78.073  -1.577  1.00 39.02 ? 397  ASP C OD1   1 
ATOM   8512  O  OD2   . ASP C  1 369 ? 106.229 79.138  -3.012  1.00 39.20 ? 397  ASP C OD2   1 
ATOM   8513  N  N     . TYR C  1 370 ? 110.398 82.324  -0.863  1.00 29.01 ? 398  TYR C N     1 
ATOM   8514  C  CA    . TYR C  1 370 ? 111.525 83.222  -0.968  1.00 28.31 ? 398  TYR C CA    1 
ATOM   8515  C  C     . TYR C  1 370 ? 112.086 83.409  0.441   1.00 27.85 ? 398  TYR C C     1 
ATOM   8516  O  O     . TYR C  1 370 ? 111.371 83.190  1.417   1.00 26.91 ? 398  TYR C O     1 
ATOM   8517  C  CB    . TYR C  1 370 ? 111.080 84.558  -1.603  1.00 28.62 ? 398  TYR C CB    1 
ATOM   8518  C  CG    . TYR C  1 370 ? 110.716 84.411  -3.074  1.00 29.16 ? 398  TYR C CG    1 
ATOM   8519  C  CD1   . TYR C  1 370 ? 111.538 84.918  -4.075  1.00 28.59 ? 398  TYR C CD1   1 
ATOM   8520  C  CD2   . TYR C  1 370 ? 109.564 83.731  -3.456  1.00 28.87 ? 398  TYR C CD2   1 
ATOM   8521  C  CE1   . TYR C  1 370 ? 111.205 84.766  -5.435  1.00 29.91 ? 398  TYR C CE1   1 
ATOM   8522  C  CE2   . TYR C  1 370 ? 109.234 83.558  -4.800  1.00 30.35 ? 398  TYR C CE2   1 
ATOM   8523  C  CZ    . TYR C  1 370 ? 110.054 84.078  -5.774  1.00 29.39 ? 398  TYR C CZ    1 
ATOM   8524  O  OH    . TYR C  1 370 ? 109.701 83.900  -7.070  1.00 31.02 ? 398  TYR C OH    1 
ATOM   8525  N  N     . PRO C  1 371 ? 113.368 83.791  0.551   1.00 27.75 ? 399  PRO C N     1 
ATOM   8526  C  CA    . PRO C  1 371 ? 114.049 83.851  1.861   1.00 27.60 ? 399  PRO C CA    1 
ATOM   8527  C  C     . PRO C  1 371 ? 113.887 85.127  2.671   1.00 26.82 ? 399  PRO C C     1 
ATOM   8528  O  O     . PRO C  1 371 ? 114.323 85.170  3.837   1.00 26.97 ? 399  PRO C O     1 
ATOM   8529  C  CB    . PRO C  1 371 ? 115.518 83.684  1.475   1.00 27.75 ? 399  PRO C CB    1 
ATOM   8530  C  CG    . PRO C  1 371 ? 115.625 84.370  0.127   1.00 29.05 ? 399  PRO C CG    1 
ATOM   8531  C  CD    . PRO C  1 371 ? 114.287 84.124  -0.558  1.00 28.33 ? 399  PRO C CD    1 
ATOM   8532  N  N     . VAL C  1 372 ? 113.309 86.176  2.072   1.00 26.30 ? 400  VAL C N     1 
ATOM   8533  C  CA    . VAL C  1 372 ? 113.349 87.485  2.702   1.00 26.09 ? 400  VAL C CA    1 
ATOM   8534  C  C     . VAL C  1 372 ? 112.432 87.591  3.916   1.00 25.91 ? 400  VAL C C     1 
ATOM   8535  O  O     . VAL C  1 372 ? 112.795 88.258  4.872   1.00 26.11 ? 400  VAL C O     1 
ATOM   8536  C  CB    A VAL C  1 372 ? 112.987 88.590  1.678   0.50 26.15 ? 400  VAL C CB    1 
ATOM   8537  C  CB    B VAL C  1 372 ? 113.102 88.685  1.729   0.50 26.15 ? 400  VAL C CB    1 
ATOM   8538  C  CG1   A VAL C  1 372 ? 112.918 89.939  2.350   0.50 25.34 ? 400  VAL C CG1   1 
ATOM   8539  C  CG1   B VAL C  1 372 ? 114.327 88.904  0.821   0.50 26.24 ? 400  VAL C CG1   1 
ATOM   8540  C  CG2   A VAL C  1 372 ? 113.996 88.590  0.505   0.50 25.94 ? 400  VAL C CG2   1 
ATOM   8541  C  CG2   B VAL C  1 372 ? 111.846 88.494  0.916   0.50 25.51 ? 400  VAL C CG2   1 
ATOM   8542  N  N     . GLU C  1 373 ? 111.279 86.913  3.899   1.00 26.12 ? 401  GLU C N     1 
ATOM   8543  C  CA    . GLU C  1 373 ? 110.375 86.930  5.058   1.00 26.08 ? 401  GLU C CA    1 
ATOM   8544  C  C     . GLU C  1 373 ? 110.996 86.293  6.321   1.00 26.15 ? 401  GLU C C     1 
ATOM   8545  O  O     . GLU C  1 373 ? 110.718 86.736  7.441   1.00 26.50 ? 401  GLU C O     1 
ATOM   8546  C  CB    . GLU C  1 373 ? 109.009 86.330  4.735   1.00 26.31 ? 401  GLU C CB    1 
ATOM   8547  C  CG    . GLU C  1 373 ? 108.985 84.854  4.370   1.00 26.39 ? 401  GLU C CG    1 
ATOM   8548  C  CD    . GLU C  1 373 ? 108.938 83.920  5.560   1.00 26.38 ? 401  GLU C CD    1 
ATOM   8549  O  OE1   . GLU C  1 373 ? 109.690 82.923  5.553   1.00 25.91 ? 401  GLU C OE1   1 
ATOM   8550  O  OE2   . GLU C  1 373 ? 108.142 84.166  6.495   1.00 27.79 ? 401  GLU C OE2   1 
ATOM   8551  N  N     . LYS C  1 374 ? 111.862 85.291  6.148   1.00 25.96 ? 402  LYS C N     1 
ATOM   8552  C  CA    . LYS C  1 374 ? 112.594 84.714  7.279   1.00 25.46 ? 402  LYS C CA    1 
ATOM   8553  C  C     . LYS C  1 374 ? 113.637 85.686  7.855   1.00 25.72 ? 402  LYS C C     1 
ATOM   8554  O  O     . LYS C  1 374 ? 113.750 85.839  9.077   1.00 25.62 ? 402  LYS C O     1 
ATOM   8555  C  CB    . LYS C  1 374 ? 113.263 83.392  6.885   1.00 25.60 ? 402  LYS C CB    1 
ATOM   8556  C  CG    . LYS C  1 374 ? 114.051 82.753  8.041   1.00 25.47 ? 402  LYS C CG    1 
ATOM   8557  C  CD    . LYS C  1 374 ? 114.751 81.452  7.627   1.00 25.22 ? 402  LYS C CD    1 
ATOM   8558  C  CE    . LYS C  1 374 ? 115.632 80.926  8.773   1.00 26.25 ? 402  LYS C CE    1 
ATOM   8559  N  NZ    . LYS C  1 374 ? 116.805 81.785  9.113   1.00 25.79 ? 402  LYS C NZ    1 
ATOM   8560  N  N     . TYR C  1 375 ? 114.406 86.338  6.985   1.00 25.31 ? 403  TYR C N     1 
ATOM   8561  C  CA    . TYR C  1 375 ? 115.340 87.363  7.446   1.00 25.97 ? 403  TYR C CA    1 
ATOM   8562  C  C     . TYR C  1 375 ? 114.627 88.401  8.334   1.00 25.50 ? 403  TYR C C     1 
ATOM   8563  O  O     . TYR C  1 375 ? 115.113 88.741  9.407   1.00 25.11 ? 403  TYR C O     1 
ATOM   8564  C  CB    . TYR C  1 375 ? 116.023 88.053  6.280   1.00 26.33 ? 403  TYR C CB    1 
ATOM   8565  C  CG    . TYR C  1 375 ? 117.102 87.256  5.590   1.00 26.18 ? 403  TYR C CG    1 
ATOM   8566  C  CD1   . TYR C  1 375 ? 118.246 86.822  6.280   1.00 26.37 ? 403  TYR C CD1   1 
ATOM   8567  C  CD2   . TYR C  1 375 ? 117.032 87.021  4.214   1.00 27.26 ? 403  TYR C CD2   1 
ATOM   8568  C  CE1   . TYR C  1 375 ? 119.266 86.130  5.590   1.00 26.17 ? 403  TYR C CE1   1 
ATOM   8569  C  CE2   . TYR C  1 375 ? 118.023 86.346  3.529   1.00 27.00 ? 403  TYR C CE2   1 
ATOM   8570  C  CZ    . TYR C  1 375 ? 119.139 85.895  4.217   1.00 27.97 ? 403  TYR C CZ    1 
ATOM   8571  O  OH    . TYR C  1 375 ? 120.106 85.208  3.496   1.00 27.19 ? 403  TYR C OH    1 
ATOM   8572  N  N     . PHE C  1 376 ? 113.468 88.866  7.866   1.00 25.33 ? 404  PHE C N     1 
ATOM   8573  C  CA    . PHE C  1 376 ? 112.565 89.780  8.588   1.00 25.20 ? 404  PHE C CA    1 
ATOM   8574  C  C     . PHE C  1 376 ? 112.101 89.273  9.968   1.00 25.02 ? 404  PHE C C     1 
ATOM   8575  O  O     . PHE C  1 376 ? 112.162 89.997  10.977  1.00 24.95 ? 404  PHE C O     1 
ATOM   8576  C  CB    . PHE C  1 376 ? 111.375 90.070  7.660   1.00 25.61 ? 404  PHE C CB    1 
ATOM   8577  C  CG    . PHE C  1 376 ? 110.289 90.934  8.249   1.00 25.38 ? 404  PHE C CG    1 
ATOM   8578  C  CD1   . PHE C  1 376 ? 110.447 92.312  8.341   1.00 25.48 ? 404  PHE C CD1   1 
ATOM   8579  C  CD2   . PHE C  1 376 ? 109.074 90.375  8.623   1.00 26.10 ? 404  PHE C CD2   1 
ATOM   8580  C  CE1   . PHE C  1 376 ? 109.423 93.111  8.853   1.00 26.27 ? 404  PHE C CE1   1 
ATOM   8581  C  CE2   . PHE C  1 376 ? 108.045 91.173  9.140   1.00 27.57 ? 404  PHE C CE2   1 
ATOM   8582  C  CZ    . PHE C  1 376 ? 108.225 92.537  9.245   1.00 27.37 ? 404  PHE C CZ    1 
ATOM   8583  N  N     . ARG C  1 377 ? 111.600 88.050  10.005  1.00 24.62 ? 405  ARG C N     1 
ATOM   8584  C  CA    . ARG C  1 377 ? 111.225 87.420  11.262  1.00 24.99 ? 405  ARG C CA    1 
ATOM   8585  C  C     . ARG C  1 377 ? 112.423 87.278  12.227  1.00 25.37 ? 405  ARG C C     1 
ATOM   8586  O  O     . ARG C  1 377 ? 112.299 87.589  13.415  1.00 25.93 ? 405  ARG C O     1 
ATOM   8587  C  CB    . ARG C  1 377 ? 110.558 86.082  10.987  1.00 24.92 ? 405  ARG C CB    1 
ATOM   8588  C  CG    . ARG C  1 377 ? 109.180 86.247  10.377  1.00 23.87 ? 405  ARG C CG    1 
ATOM   8589  C  CD    . ARG C  1 377 ? 108.451 84.923  10.225  1.00 24.97 ? 405  ARG C CD    1 
ATOM   8590  N  NE    . ARG C  1 377 ? 109.014 84.078  9.180   1.00 23.29 ? 405  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C  1 377 ? 109.757 82.984  9.370   1.00 26.73 ? 405  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C  1 377 ? 110.118 82.569  10.587  1.00 27.38 ? 405  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C  1 377 ? 110.156 82.285  8.307   1.00 26.95 ? 405  ARG C NH2   1 
ATOM   8594  N  N     . ASP C  1 378 ? 113.573 86.847  11.695  1.00 25.31 ? 406  ASP C N     1 
ATOM   8595  C  CA    . ASP C  1 378 ? 114.807 86.677  12.459  1.00 25.28 ? 406  ASP C CA    1 
ATOM   8596  C  C     . ASP C  1 378 ? 115.336 88.006  13.007  1.00 25.84 ? 406  ASP C C     1 
ATOM   8597  O  O     . ASP C  1 378 ? 115.750 88.072  14.156  1.00 25.73 ? 406  ASP C O     1 
ATOM   8598  C  CB    . ASP C  1 378 ? 115.913 86.050  11.595  1.00 24.83 ? 406  ASP C CB    1 
ATOM   8599  C  CG    . ASP C  1 378 ? 115.668 84.582  11.260  1.00 26.38 ? 406  ASP C CG    1 
ATOM   8600  O  OD1   . ASP C  1 378 ? 114.692 83.959  11.764  1.00 27.43 ? 406  ASP C OD1   1 
ATOM   8601  O  OD2   . ASP C  1 378 ? 116.483 84.035  10.465  1.00 26.67 ? 406  ASP C OD2   1 
ATOM   8602  N  N     . ALA C  1 379 ? 115.292 89.071  12.197  1.00 25.93 ? 407  ALA C N     1 
ATOM   8603  C  CA    . ALA C  1 379 ? 115.888 90.352  12.600  1.00 25.93 ? 407  ALA C CA    1 
ATOM   8604  C  C     . ALA C  1 379 ? 115.220 90.944  13.834  1.00 26.59 ? 407  ALA C C     1 
ATOM   8605  O  O     . ALA C  1 379 ? 115.880 91.548  14.656  1.00 26.57 ? 407  ALA C O     1 
ATOM   8606  C  CB    . ALA C  1 379 ? 115.924 91.369  11.412  1.00 24.22 ? 407  ALA C CB    1 
ATOM   8607  N  N     . LYS C  1 380 ? 113.920 90.711  13.983  1.00 27.34 ? 408  LYS C N     1 
ATOM   8608  C  CA    . LYS C  1 380 ? 113.143 91.321  15.033  1.00 28.56 ? 408  LYS C CA    1 
ATOM   8609  C  C     . LYS C  1 380 ? 113.681 90.991  16.429  1.00 29.64 ? 408  LYS C C     1 
ATOM   8610  O  O     . LYS C  1 380 ? 113.560 91.822  17.311  1.00 30.08 ? 408  LYS C O     1 
ATOM   8611  C  CB    . LYS C  1 380 ? 111.660 90.937  14.904  1.00 28.38 ? 408  LYS C CB    1 
ATOM   8612  C  CG    . LYS C  1 380 ? 110.679 91.661  15.826  1.00 29.37 ? 408  LYS C CG    1 
ATOM   8613  C  CD    . LYS C  1 380 ? 110.524 93.155  15.526  1.00 29.52 ? 408  LYS C CD    1 
ATOM   8614  C  CE    . LYS C  1 380 ? 111.091 94.022  16.640  1.00 29.46 ? 408  LYS C CE    1 
ATOM   8615  N  NZ    . LYS C  1 380 ? 111.209 95.483  16.294  1.00 29.98 ? 408  LYS C NZ    1 
ATOM   8616  N  N     . ILE C  1 381 ? 114.262 89.798  16.616  1.00 29.94 ? 409  ILE C N     1 
ATOM   8617  C  CA    . ILE C  1 381 ? 114.895 89.425  17.895  1.00 30.44 ? 409  ILE C CA    1 
ATOM   8618  C  C     . ILE C  1 381 ? 116.032 90.348  18.349  1.00 30.08 ? 409  ILE C C     1 
ATOM   8619  O  O     . ILE C  1 381 ? 116.224 90.540  19.556  1.00 29.95 ? 409  ILE C O     1 
ATOM   8620  C  CB    . ILE C  1 381 ? 115.441 87.966  17.887  1.00 30.18 ? 409  ILE C CB    1 
ATOM   8621  C  CG1   . ILE C  1 381 ? 115.676 87.457  19.319  1.00 31.63 ? 409  ILE C CG1   1 
ATOM   8622  C  CG2   . ILE C  1 381 ? 116.744 87.869  17.079  1.00 30.45 ? 409  ILE C CG2   1 
ATOM   8623  C  CD1   . ILE C  1 381 ? 114.537 87.705  20.310  1.00 30.47 ? 409  ILE C CD1   1 
ATOM   8624  N  N     . GLY C  1 382 ? 116.758 90.920  17.392  1.00 29.92 ? 410  GLY C N     1 
ATOM   8625  C  CA    . GLY C  1 382 ? 117.957 91.704  17.664  1.00 29.94 ? 410  GLY C CA    1 
ATOM   8626  C  C     . GLY C  1 382 ? 117.805 92.901  18.589  1.00 29.80 ? 410  GLY C C     1 
ATOM   8627  O  O     . GLY C  1 382 ? 118.721 93.243  19.317  1.00 29.77 ? 410  GLY C O     1 
ATOM   8628  N  N     . THR C  1 383 ? 116.654 93.550  18.549  1.00 29.81 ? 411  THR C N     1 
ATOM   8629  C  CA    . THR C  1 383 ? 116.399 94.677  19.440  1.00 30.15 ? 411  THR C CA    1 
ATOM   8630  C  C     . THR C  1 383 ? 115.920 94.251  20.830  1.00 30.05 ? 411  THR C C     1 
ATOM   8631  O  O     . THR C  1 383 ? 115.657 95.111  21.658  1.00 29.48 ? 411  THR C O     1 
ATOM   8632  C  CB    . THR C  1 383 ? 115.367 95.669  18.815  1.00 29.94 ? 411  THR C CB    1 
ATOM   8633  O  OG1   . THR C  1 383 ? 114.117 95.001  18.650  1.00 31.91 ? 411  THR C OG1   1 
ATOM   8634  C  CG2   . THR C  1 383 ? 115.871 96.206  17.465  1.00 29.05 ? 411  THR C CG2   1 
ATOM   8635  N  N     . ILE C  1 384 ? 115.795 92.938  21.061  1.00 31.20 ? 412  ILE C N     1 
ATOM   8636  C  CA    . ILE C  1 384 ? 115.269 92.384  22.326  1.00 32.18 ? 412  ILE C CA    1 
ATOM   8637  C  C     . ILE C  1 384 ? 116.338 91.691  23.178  1.00 31.46 ? 412  ILE C C     1 
ATOM   8638  O  O     . ILE C  1 384 ? 116.565 92.074  24.338  1.00 31.94 ? 412  ILE C O     1 
ATOM   8639  C  CB    . ILE C  1 384 ? 114.098 91.395  22.054  1.00 32.45 ? 412  ILE C CB    1 
ATOM   8640  C  CG1   . ILE C  1 384 ? 112.899 92.153  21.461  1.00 33.77 ? 412  ILE C CG1   1 
ATOM   8641  C  CG2   . ILE C  1 384 ? 113.698 90.660  23.341  1.00 33.16 ? 412  ILE C CG2   1 
ATOM   8642  C  CD1   . ILE C  1 384 ? 111.768 91.238  20.953  1.00 33.36 ? 412  ILE C CD1   1 
ATOM   8643  N  N     . TYR C  1 385 ? 117.007 90.683  22.623  1.00 31.57 ? 413  TYR C N     1 
ATOM   8644  C  CA    . TYR C  1 385 ? 118.000 89.918  23.393  1.00 30.93 ? 413  TYR C CA    1 
ATOM   8645  C  C     . TYR C  1 385 ? 119.396 90.547  23.420  1.00 31.59 ? 413  TYR C C     1 
ATOM   8646  O  O     . TYR C  1 385 ? 119.644 91.537  22.729  1.00 30.03 ? 413  TYR C O     1 
ATOM   8647  C  CB    . TYR C  1 385 ? 118.021 88.432  22.984  1.00 31.55 ? 413  TYR C CB    1 
ATOM   8648  C  CG    . TYR C  1 385 ? 118.618 88.014  21.646  1.00 30.75 ? 413  TYR C CG    1 
ATOM   8649  C  CD1   . TYR C  1 385 ? 118.665 86.652  21.318  1.00 31.42 ? 413  TYR C CD1   1 
ATOM   8650  C  CD2   . TYR C  1 385 ? 119.138 88.929  20.726  1.00 30.71 ? 413  TYR C CD2   1 
ATOM   8651  C  CE1   . TYR C  1 385 ? 119.185 86.207  20.128  1.00 30.09 ? 413  TYR C CE1   1 
ATOM   8652  C  CE2   . TYR C  1 385 ? 119.676 88.489  19.499  1.00 29.24 ? 413  TYR C CE2   1 
ATOM   8653  C  CZ    . TYR C  1 385 ? 119.692 87.120  19.216  1.00 29.84 ? 413  TYR C CZ    1 
ATOM   8654  O  OH    . TYR C  1 385 ? 120.195 86.629  18.042  1.00 30.76 ? 413  TYR C OH    1 
ATOM   8655  N  N     . GLU C  1 386 ? 120.277 89.962  24.248  1.00 31.88 ? 414  GLU C N     1 
ATOM   8656  C  CA    . GLU C  1 386 ? 121.582 90.534  24.629  1.00 32.56 ? 414  GLU C CA    1 
ATOM   8657  C  C     . GLU C  1 386 ? 121.478 91.993  25.056  1.00 31.61 ? 414  GLU C C     1 
ATOM   8658  O  O     . GLU C  1 386 ? 122.394 92.784  24.829  1.00 31.72 ? 414  GLU C O     1 
ATOM   8659  C  CB    . GLU C  1 386 ? 122.634 90.323  23.524  1.00 33.43 ? 414  GLU C CB    1 
ATOM   8660  C  CG    . GLU C  1 386 ? 123.160 88.864  23.488  1.00 38.17 ? 414  GLU C CG    1 
ATOM   8661  C  CD    . GLU C  1 386 ? 124.627 88.755  23.828  1.00 42.50 ? 414  GLU C CD    1 
ATOM   8662  O  OE1   . GLU C  1 386 ? 125.147 89.682  24.498  1.00 48.47 ? 414  GLU C OE1   1 
ATOM   8663  O  OE2   . GLU C  1 386 ? 125.250 87.737  23.439  1.00 43.44 ? 414  GLU C OE2   1 
ATOM   8664  N  N     . GLY C  1 387 ? 120.372 92.321  25.726  1.00 30.58 ? 415  GLY C N     1 
ATOM   8665  C  CA    . GLY C  1 387 ? 120.114 93.682  26.184  1.00 30.09 ? 415  GLY C CA    1 
ATOM   8666  C  C     . GLY C  1 387 ? 119.295 94.428  25.153  1.00 29.16 ? 415  GLY C C     1 
ATOM   8667  O  O     . GLY C  1 387 ? 119.797 94.786  24.074  1.00 28.87 ? 415  GLY C O     1 
ATOM   8668  N  N     . ALA C  1 388 ? 118.019 94.635  25.478  1.00 28.93 ? 416  ALA C N     1 
ATOM   8669  C  CA    . ALA C  1 388 ? 117.080 95.336  24.598  1.00 27.79 ? 416  ALA C CA    1 
ATOM   8670  C  C     . ALA C  1 388 ? 117.631 96.702  24.208  1.00 27.44 ? 416  ALA C C     1 
ATOM   8671  O  O     . ALA C  1 388 ? 118.527 97.234  24.867  1.00 26.29 ? 416  ALA C O     1 
ATOM   8672  C  CB    . ALA C  1 388 ? 115.716 95.494  25.283  1.00 28.10 ? 416  ALA C CB    1 
ATOM   8673  N  N     . SER C  1 389 ? 117.082 97.273  23.140  1.00 26.17 ? 417  SER C N     1 
ATOM   8674  C  CA    . SER C  1 389 ? 117.526 98.582  22.668  1.00 25.89 ? 417  SER C CA    1 
ATOM   8675  C  C     . SER C  1 389 ? 117.576 99.663  23.746  1.00 25.60 ? 417  SER C C     1 
ATOM   8676  O  O     . SER C  1 389 ? 118.576 100.373 23.840  1.00 24.98 ? 417  SER C O     1 
ATOM   8677  C  CB    . SER C  1 389 ? 116.676 99.033  21.502  1.00 25.62 ? 417  SER C CB    1 
ATOM   8678  O  OG    . SER C  1 389 ? 116.990 98.276  20.364  1.00 25.75 ? 417  SER C OG    1 
ATOM   8679  N  N     . ASN C  1 390 ? 116.504 99.796  24.546  1.00 25.20 ? 418  ASN C N     1 
ATOM   8680  C  CA    . ASN C  1 390 ? 116.469 100.782 25.621  1.00 25.29 ? 418  ASN C CA    1 
ATOM   8681  C  C     . ASN C  1 390 ? 117.650 100.610 26.593  1.00 25.36 ? 418  ASN C C     1 
ATOM   8682  O  O     . ASN C  1 390 ? 118.198 101.583 27.089  1.00 24.17 ? 418  ASN C O     1 
ATOM   8683  C  CB    . ASN C  1 390 ? 115.137 100.714 26.390  1.00 25.35 ? 418  ASN C CB    1 
ATOM   8684  C  CG    . ASN C  1 390 ? 113.927 101.304 25.599  1.00 27.00 ? 418  ASN C CG    1 
ATOM   8685  O  OD1   . ASN C  1 390 ? 114.047 101.724 24.440  1.00 28.05 ? 418  ASN C OD1   1 
ATOM   8686  N  ND2   . ASN C  1 390 ? 112.758 101.346 26.258  1.00 27.04 ? 418  ASN C ND2   1 
ATOM   8687  N  N     . ILE C  1 391 ? 118.025 99.357  26.850  1.00 26.42 ? 419  ILE C N     1 
ATOM   8688  C  CA    . ILE C  1 391 ? 119.137 99.016  27.737  1.00 26.81 ? 419  ILE C CA    1 
ATOM   8689  C  C     . ILE C  1 391 ? 120.471 99.434  27.118  1.00 26.26 ? 419  ILE C C     1 
ATOM   8690  O  O     . ILE C  1 391 ? 121.345 99.921  27.806  1.00 26.43 ? 419  ILE C O     1 
ATOM   8691  C  CB    . ILE C  1 391 ? 119.143 97.486  28.066  1.00 27.16 ? 419  ILE C CB    1 
ATOM   8692  C  CG1   . ILE C  1 391 ? 117.828 97.058  28.756  1.00 28.55 ? 419  ILE C CG1   1 
ATOM   8693  C  CG2   . ILE C  1 391 ? 120.368 97.102  28.857  1.00 29.15 ? 419  ILE C CG2   1 
ATOM   8694  C  CD1   . ILE C  1 391 ? 117.274 97.976  29.806  1.00 31.04 ? 419  ILE C CD1   1 
ATOM   8695  N  N     . GLN C  1 392 ? 120.629 99.227  25.819  1.00 26.49 ? 420  GLN C N     1 
ATOM   8696  C  CA    . GLN C  1 392 ? 121.823 99.701  25.102  1.00 25.74 ? 420  GLN C CA    1 
ATOM   8697  C  C     . GLN C  1 392 ? 121.958 101.216 25.193  1.00 25.22 ? 420  GLN C C     1 
ATOM   8698  O  O     . GLN C  1 392 ? 123.016 101.742 25.510  1.00 23.85 ? 420  GLN C O     1 
ATOM   8699  C  CB    . GLN C  1 392 ? 121.774 99.271  23.630  1.00 26.21 ? 420  GLN C CB    1 
ATOM   8700  C  CG    . GLN C  1 392 ? 121.630 97.759  23.381  1.00 26.33 ? 420  GLN C CG    1 
ATOM   8701  C  CD    . GLN C  1 392 ? 122.740 96.952  24.010  1.00 26.11 ? 420  GLN C CD    1 
ATOM   8702  O  OE1   . GLN C  1 392 ? 123.824 97.447  24.200  1.00 26.34 ? 420  GLN C OE1   1 
ATOM   8703  N  NE2   . GLN C  1 392 ? 122.455 95.699  24.354  1.00 26.69 ? 420  GLN C NE2   1 
ATOM   8704  N  N     . LEU C  1 393 ? 120.859 101.922 24.941  1.00 25.45 ? 421  LEU C N     1 
ATOM   8705  C  CA    . LEU C  1 393 ? 120.854 103.381 25.050  1.00 24.89 ? 421  LEU C CA    1 
ATOM   8706  C  C     . LEU C  1 393 ? 121.160 103.845 26.478  1.00 24.22 ? 421  LEU C C     1 
ATOM   8707  O  O     . LEU C  1 393 ? 121.866 104.817 26.651  1.00 23.22 ? 421  LEU C O     1 
ATOM   8708  C  CB    . LEU C  1 393 ? 119.517 103.982 24.553  1.00 24.74 ? 421  LEU C CB    1 
ATOM   8709  C  CG    . LEU C  1 393 ? 119.122 103.724 23.087  1.00 25.59 ? 421  LEU C CG    1 
ATOM   8710  C  CD1   . LEU C  1 393 ? 117.711 104.244 22.793  1.00 26.29 ? 421  LEU C CD1   1 
ATOM   8711  C  CD2   . LEU C  1 393 ? 120.153 104.319 22.096  1.00 25.62 ? 421  LEU C CD2   1 
ATOM   8712  N  N     . ASN C  1 394 ? 120.651 103.142 27.494  1.00 24.32 ? 422  ASN C N     1 
ATOM   8713  C  CA    . ASN C  1 394 ? 120.957 103.472 28.877  1.00 24.52 ? 422  ASN C CA    1 
ATOM   8714  C  C     . ASN C  1 394 ? 122.470 103.360 29.121  1.00 24.54 ? 422  ASN C C     1 
ATOM   8715  O  O     . ASN C  1 394 ? 123.052 104.228 29.748  1.00 24.25 ? 422  ASN C O     1 
ATOM   8716  C  CB    . ASN C  1 394 ? 120.211 102.564 29.877  1.00 24.93 ? 422  ASN C CB    1 
ATOM   8717  C  CG    . ASN C  1 394 ? 118.698 102.803 29.902  1.00 25.71 ? 422  ASN C CG    1 
ATOM   8718  O  OD1   . ASN C  1 394 ? 118.208 103.820 29.412  1.00 25.99 ? 422  ASN C OD1   1 
ATOM   8719  N  ND2   . ASN C  1 394 ? 117.954 101.857 30.502  1.00 25.58 ? 422  ASN C ND2   1 
ATOM   8720  N  N     . THR C  1 395 ? 123.082 102.288 28.622  1.00 24.93 ? 423  THR C N     1 
ATOM   8721  C  CA    . THR C  1 395 ? 124.520 102.054 28.796  1.00 25.00 ? 423  THR C CA    1 
ATOM   8722  C  C     . THR C  1 395 ? 125.337 103.142 28.098  1.00 24.52 ? 423  THR C C     1 
ATOM   8723  O  O     . THR C  1 395 ? 126.274 103.711 28.681  1.00 23.92 ? 423  THR C O     1 
ATOM   8724  C  CB    . THR C  1 395 ? 124.908 100.670 28.237  1.00 25.54 ? 423  THR C CB    1 
ATOM   8725  O  OG1   . THR C  1 395 ? 124.165 99.657  28.926  1.00 26.61 ? 423  THR C OG1   1 
ATOM   8726  C  CG2   . THR C  1 395 ? 126.410 100.414 28.378  1.00 25.83 ? 423  THR C CG2   1 
ATOM   8727  N  N     . ILE C  1 396 ? 124.960 103.431 26.854  1.00 24.56 ? 424  ILE C N     1 
ATOM   8728  C  CA    . ILE C  1 396 ? 125.587 104.497 26.064  1.00 24.13 ? 424  ILE C CA    1 
ATOM   8729  C  C     . ILE C  1 396 ? 125.507 105.833 26.791  1.00 24.79 ? 424  ILE C C     1 
ATOM   8730  O  O     . ILE C  1 396 ? 126.519 106.561 26.879  1.00 24.97 ? 424  ILE C O     1 
ATOM   8731  C  CB    . ILE C  1 396 ? 124.982 104.625 24.627  1.00 23.60 ? 424  ILE C CB    1 
ATOM   8732  C  CG1   . ILE C  1 396 ? 125.300 103.393 23.774  1.00 24.14 ? 424  ILE C CG1   1 
ATOM   8733  C  CG2   . ILE C  1 396 ? 125.515 105.906 23.930  1.00 21.17 ? 424  ILE C CG2   1 
ATOM   8734  C  CD1   . ILE C  1 396 ? 124.332 103.124 22.573  1.00 22.12 ? 424  ILE C CD1   1 
ATOM   8735  N  N     . ALA C  1 397 ? 124.329 106.168 27.330  1.00 24.76 ? 425  ALA C N     1 
ATOM   8736  C  CA    . ALA C  1 397 ? 124.162 107.428 28.059  1.00 25.03 ? 425  ALA C CA    1 
ATOM   8737  C  C     . ALA C  1 397 ? 125.041 107.489 29.303  1.00 25.64 ? 425  ALA C C     1 
ATOM   8738  O  O     . ALA C  1 397 ? 125.600 108.530 29.593  1.00 24.79 ? 425  ALA C O     1 
ATOM   8739  C  CB    . ALA C  1 397 ? 122.705 107.662 28.443  1.00 24.99 ? 425  ALA C CB    1 
ATOM   8740  N  N     . LYS C  1 398 ? 125.140 106.381 30.043  1.00 26.70 ? 426  LYS C N     1 
ATOM   8741  C  CA    . LYS C  1 398 ? 126.035 106.319 31.198  1.00 28.02 ? 426  LYS C CA    1 
ATOM   8742  C  C     . LYS C  1 398 ? 127.461 106.689 30.809  1.00 26.65 ? 426  LYS C C     1 
ATOM   8743  O  O     . LYS C  1 398 ? 128.131 107.439 31.520  1.00 26.21 ? 426  LYS C O     1 
ATOM   8744  C  CB    . LYS C  1 398 ? 126.035 104.920 31.835  1.00 28.80 ? 426  LYS C CB    1 
ATOM   8745  C  CG    . LYS C  1 398 ? 124.788 104.553 32.625  1.00 31.85 ? 426  LYS C CG    1 
ATOM   8746  C  CD    . LYS C  1 398 ? 124.948 103.171 33.310  1.00 32.20 ? 426  LYS C CD    1 
ATOM   8747  C  CE    . LYS C  1 398 ? 123.610 102.439 33.527  1.00 36.10 ? 426  LYS C CE    1 
ATOM   8748  N  NZ    . LYS C  1 398 ? 123.261 101.461 32.402  1.00 38.31 ? 426  LYS C NZ    1 
ATOM   8749  N  N     . HIS C  1 399 ? 127.928 106.135 29.692  1.00 25.85 ? 427  HIS C N     1 
ATOM   8750  C  CA    . HIS C  1 399 ? 129.276 106.423 29.197  1.00 25.92 ? 427  HIS C CA    1 
ATOM   8751  C  C     . HIS C  1 399 ? 129.416 107.889 28.765  1.00 25.21 ? 427  HIS C C     1 
ATOM   8752  O  O     . HIS C  1 399 ? 130.392 108.545 29.117  1.00 24.13 ? 427  HIS C O     1 
ATOM   8753  C  CB    . HIS C  1 399 ? 129.692 105.406 28.107  1.00 26.54 ? 427  HIS C CB    1 
ATOM   8754  C  CG    . HIS C  1 399 ? 130.124 104.088 28.684  1.00 28.80 ? 427  HIS C CG    1 
ATOM   8755  N  ND1   . HIS C  1 399 ? 131.436 103.818 29.021  1.00 30.80 ? 427  HIS C ND1   1 
ATOM   8756  C  CD2   . HIS C  1 399 ? 129.407 103.014 29.085  1.00 30.34 ? 427  HIS C CD2   1 
ATOM   8757  C  CE1   . HIS C  1 399 ? 131.513 102.612 29.552  1.00 31.15 ? 427  HIS C CE1   1 
ATOM   8758  N  NE2   . HIS C  1 399 ? 130.295 102.107 29.616  1.00 33.01 ? 427  HIS C NE2   1 
ATOM   8759  N  N     . ILE C  1 400 ? 128.413 108.418 28.065  1.00 24.72 ? 428  ILE C N     1 
ATOM   8760  C  CA    . ILE C  1 400 ? 128.396 109.841 27.693  1.00 24.71 ? 428  ILE C CA    1 
ATOM   8761  C  C     . ILE C  1 400 ? 128.461 110.755 28.925  1.00 24.67 ? 428  ILE C C     1 
ATOM   8762  O  O     . ILE C  1 400 ? 129.192 111.736 28.930  1.00 24.90 ? 428  ILE C O     1 
ATOM   8763  C  CB    A ILE C  1 400 ? 127.150 110.194 26.839  0.50 24.77 ? 428  ILE C CB    1 
ATOM   8764  C  CB    B ILE C  1 400 ? 127.146 110.205 26.836  0.50 24.69 ? 428  ILE C CB    1 
ATOM   8765  C  CG1   A ILE C  1 400 ? 127.243 109.541 25.462  0.50 25.18 ? 428  ILE C CG1   1 
ATOM   8766  C  CG1   B ILE C  1 400 ? 127.148 109.458 25.498  0.50 24.88 ? 428  ILE C CG1   1 
ATOM   8767  C  CG2   A ILE C  1 400 ? 126.992 111.714 26.691  0.50 23.99 ? 428  ILE C CG2   1 
ATOM   8768  C  CG2   B ILE C  1 400 ? 127.060 111.714 26.595  0.50 24.02 ? 428  ILE C CG2   1 
ATOM   8769  C  CD1   A ILE C  1 400 ? 125.912 109.441 24.748  0.50 25.23 ? 428  ILE C CD1   1 
ATOM   8770  C  CD1   B ILE C  1 400 ? 128.356 109.716 24.626  0.50 24.03 ? 428  ILE C CD1   1 
ATOM   8771  N  N     . ASP C  1 401 ? 127.707 110.424 29.967  1.00 24.94 ? 429  ASP C N     1 
ATOM   8772  C  CA    . ASP C  1 401 ? 127.716 111.177 31.231  1.00 25.49 ? 429  ASP C CA    1 
ATOM   8773  C  C     . ASP C  1 401 ? 129.129 111.239 31.837  1.00 25.95 ? 429  ASP C C     1 
ATOM   8774  O  O     . ASP C  1 401 ? 129.554 112.278 32.346  1.00 25.20 ? 429  ASP C O     1 
ATOM   8775  C  CB    . ASP C  1 401 ? 126.742 110.510 32.212  1.00 25.37 ? 429  ASP C CB    1 
ATOM   8776  C  CG    . ASP C  1 401 ? 126.369 111.386 33.407  1.00 26.22 ? 429  ASP C CG    1 
ATOM   8777  O  OD1   . ASP C  1 401 ? 126.605 112.617 33.431  1.00 24.93 ? 429  ASP C OD1   1 
ATOM   8778  O  OD2   . ASP C  1 401 ? 125.785 110.818 34.347  1.00 28.53 ? 429  ASP C OD2   1 
ATOM   8779  N  N     . ALA C  1 402 ? 129.859 110.125 31.749  1.00 26.62 ? 430  ALA C N     1 
ATOM   8780  C  CA    . ALA C  1 402 ? 131.210 110.039 32.300  1.00 27.53 ? 430  ALA C CA    1 
ATOM   8781  C  C     . ALA C  1 402 ? 132.255 110.764 31.435  1.00 28.38 ? 430  ALA C C     1 
ATOM   8782  O  O     . ALA C  1 402 ? 133.345 111.054 31.917  1.00 28.22 ? 430  ALA C O     1 
ATOM   8783  C  CB    . ALA C  1 402 ? 131.603 108.582 32.517  1.00 27.43 ? 430  ALA C CB    1 
ATOM   8784  N  N     . GLU C  1 403 ? 131.915 111.072 30.180  1.00 29.62 ? 431  GLU C N     1 
ATOM   8785  C  CA    . GLU C  1 403 ? 132.822 111.786 29.252  1.00 30.90 ? 431  GLU C CA    1 
ATOM   8786  C  C     . GLU C  1 403 ? 132.763 113.314 29.285  1.00 30.92 ? 431  GLU C C     1 
ATOM   8787  O  O     . GLU C  1 403 ? 133.614 113.971 28.676  1.00 30.21 ? 431  GLU C O     1 
ATOM   8788  C  CB    . GLU C  1 403 ? 132.537 111.365 27.811  1.00 30.92 ? 431  GLU C CB    1 
ATOM   8789  C  CG    . GLU C  1 403 ? 132.910 109.945 27.490  1.00 32.59 ? 431  GLU C CG    1 
ATOM   8790  C  CD    . GLU C  1 403 ? 132.597 109.584 26.044  1.00 33.37 ? 431  GLU C CD    1 
ATOM   8791  O  OE1   . GLU C  1 403 ? 132.503 110.504 25.190  1.00 39.60 ? 431  GLU C OE1   1 
ATOM   8792  O  OE2   . GLU C  1 403 ? 132.467 108.386 25.753  1.00 36.73 ? 431  GLU C OE2   1 
ATOM   8793  N  N     . TYR C  1 404 ? 131.754 113.877 29.951  1.00 31.62 ? 432  TYR C N     1 
ATOM   8794  C  CA    . TYR C  1 404 ? 131.556 115.334 29.995  1.00 31.96 ? 432  TYR C CA    1 
ATOM   8795  C  C     . TYR C  1 404 ? 131.438 115.862 31.418  1.00 32.66 ? 432  TYR C C     1 
ATOM   8796  O  O     . TYR C  1 404 ? 131.344 115.129 32.387  1.00 32.80 ? 432  TYR C O     1 
ATOM   8797  C  CB    . TYR C  1 404 ? 130.308 115.710 29.180  1.00 32.22 ? 432  TYR C CB    1 
ATOM   8798  C  CG    . TYR C  1 404 ? 130.448 115.422 27.697  1.00 31.17 ? 432  TYR C CG    1 
ATOM   8799  C  CD1   . TYR C  1 404 ? 130.133 114.180 27.180  1.00 31.46 ? 432  TYR C CD1   1 
ATOM   8800  C  CD2   . TYR C  1 404 ? 130.929 116.392 26.821  1.00 32.46 ? 432  TYR C CD2   1 
ATOM   8801  C  CE1   . TYR C  1 404 ? 130.278 113.900 25.824  1.00 32.12 ? 432  TYR C CE1   1 
ATOM   8802  C  CE2   . TYR C  1 404 ? 131.071 116.129 25.465  1.00 30.86 ? 432  TYR C CE2   1 
ATOM   8803  C  CZ    . TYR C  1 404 ? 130.747 114.901 24.971  1.00 31.57 ? 432  TYR C CZ    1 
ATOM   8804  O  OH    . TYR C  1 404 ? 130.904 114.627 23.630  1.00 31.39 ? 432  TYR C OH    1 
ATOM   8805  O  OXT   . TYR C  1 404 ? 131.457 117.070 31.660  1.00 34.54 ? 432  TYR C OXT   1 
ATOM   8806  N  N     . ALA D  1 24  ? 144.173 98.437  12.762  1.00 52.41 ? 52   ALA D N     1 
ATOM   8807  C  CA    . ALA D  1 24  ? 143.863 99.248  13.984  1.00 52.59 ? 52   ALA D CA    1 
ATOM   8808  C  C     . ALA D  1 24  ? 142.541 100.024 13.835  1.00 52.50 ? 52   ALA D C     1 
ATOM   8809  O  O     . ALA D  1 24  ? 142.066 100.230 12.711  1.00 52.81 ? 52   ALA D O     1 
ATOM   8810  C  CB    . ALA D  1 24  ? 145.018 100.209 14.292  1.00 52.47 ? 52   ALA D CB    1 
ATOM   8811  N  N     . PRO D  1 25  ? 141.936 100.447 14.969  1.00 52.23 ? 53   PRO D N     1 
ATOM   8812  C  CA    . PRO D  1 25  ? 140.728 101.286 14.959  1.00 51.88 ? 53   PRO D CA    1 
ATOM   8813  C  C     . PRO D  1 25  ? 140.838 102.537 14.053  1.00 51.58 ? 53   PRO D C     1 
ATOM   8814  O  O     . PRO D  1 25  ? 141.932 103.112 13.923  1.00 51.27 ? 53   PRO D O     1 
ATOM   8815  C  CB    . PRO D  1 25  ? 140.582 101.700 16.428  1.00 51.97 ? 53   PRO D CB    1 
ATOM   8816  C  CG    . PRO D  1 25  ? 141.260 100.635 17.200  1.00 51.88 ? 53   PRO D CG    1 
ATOM   8817  C  CD    . PRO D  1 25  ? 142.370 100.124 16.345  1.00 52.28 ? 53   PRO D CD    1 
ATOM   8818  N  N     . LEU D  1 26  ? 139.708 102.942 13.452  1.00 51.01 ? 54   LEU D N     1 
ATOM   8819  C  CA    . LEU D  1 26  ? 139.648 104.098 12.524  1.00 50.61 ? 54   LEU D CA    1 
ATOM   8820  C  C     . LEU D  1 26  ? 140.061 105.419 13.180  1.00 50.06 ? 54   LEU D C     1 
ATOM   8821  O  O     . LEU D  1 26  ? 140.439 106.362 12.481  1.00 50.37 ? 54   LEU D O     1 
ATOM   8822  C  CB    . LEU D  1 26  ? 138.238 104.267 11.911  1.00 50.51 ? 54   LEU D CB    1 
ATOM   8823  C  CG    . LEU D  1 26  ? 137.926 104.128 10.399  1.00 50.90 ? 54   LEU D CG    1 
ATOM   8824  C  CD1   . LEU D  1 26  ? 139.007 103.461 9.515   1.00 49.86 ? 54   LEU D CD1   1 
ATOM   8825  C  CD2   . LEU D  1 26  ? 136.571 103.429 10.205  1.00 49.91 ? 54   LEU D CD2   1 
ATOM   8826  N  N     . GLN D  1 27  ? 139.961 105.495 14.508  1.00 49.09 ? 55   GLN D N     1 
ATOM   8827  C  CA    . GLN D  1 27  ? 140.368 106.694 15.252  1.00 47.99 ? 55   GLN D CA    1 
ATOM   8828  C  C     . GLN D  1 27  ? 141.852 106.660 15.710  1.00 46.64 ? 55   GLN D C     1 
ATOM   8829  O  O     . GLN D  1 27  ? 142.255 107.473 16.548  1.00 46.52 ? 55   GLN D O     1 
ATOM   8830  C  CB    . GLN D  1 27  ? 139.437 106.898 16.460  1.00 48.09 ? 55   GLN D CB    1 
ATOM   8831  N  N     . THR D  1 28  ? 142.642 105.723 15.169  1.00 44.83 ? 56   THR D N     1 
ATOM   8832  C  CA    . THR D  1 28  ? 144.094 105.643 15.428  1.00 43.32 ? 56   THR D CA    1 
ATOM   8833  C  C     . THR D  1 28  ? 144.886 106.351 14.320  1.00 41.57 ? 56   THR D C     1 
ATOM   8834  O  O     . THR D  1 28  ? 144.903 105.906 13.171  1.00 42.13 ? 56   THR D O     1 
ATOM   8835  C  CB    . THR D  1 28  ? 144.585 104.189 15.516  1.00 43.37 ? 56   THR D CB    1 
ATOM   8836  O  OG1   . THR D  1 28  ? 143.853 103.504 16.545  1.00 43.85 ? 56   THR D OG1   1 
ATOM   8837  C  CG2   . THR D  1 28  ? 146.104 104.140 15.814  1.00 43.21 ? 56   THR D CG2   1 
ATOM   8838  N  N     . PHE D  1 29  ? 145.550 107.438 14.692  1.00 39.03 ? 57   PHE D N     1 
ATOM   8839  C  CA    . PHE D  1 29  ? 146.180 108.348 13.748  1.00 37.17 ? 57   PHE D CA    1 
ATOM   8840  C  C     . PHE D  1 29  ? 147.707 108.251 13.807  1.00 35.83 ? 57   PHE D C     1 
ATOM   8841  O  O     . PHE D  1 29  ? 148.274 107.826 14.811  1.00 34.45 ? 57   PHE D O     1 
ATOM   8842  C  CB    . PHE D  1 29  ? 145.754 109.786 14.066  1.00 36.95 ? 57   PHE D CB    1 
ATOM   8843  C  CG    . PHE D  1 29  ? 144.257 110.002 14.110  1.00 36.92 ? 57   PHE D CG    1 
ATOM   8844  C  CD1   . PHE D  1 29  ? 143.422 109.497 13.107  1.00 36.67 ? 57   PHE D CD1   1 
ATOM   8845  C  CD2   . PHE D  1 29  ? 143.684 110.755 15.142  1.00 37.23 ? 57   PHE D CD2   1 
ATOM   8846  C  CE1   . PHE D  1 29  ? 142.050 109.711 13.142  1.00 35.32 ? 57   PHE D CE1   1 
ATOM   8847  C  CE2   . PHE D  1 29  ? 142.310 110.984 15.186  1.00 38.15 ? 57   PHE D CE2   1 
ATOM   8848  C  CZ    . PHE D  1 29  ? 141.484 110.454 14.183  1.00 37.00 ? 57   PHE D CZ    1 
ATOM   8849  N  N     . THR D  1 30  ? 148.372 108.656 12.725  1.00 34.27 ? 58   THR D N     1 
ATOM   8850  C  CA    . THR D  1 30  ? 149.822 108.806 12.758  1.00 33.15 ? 58   THR D CA    1 
ATOM   8851  C  C     . THR D  1 30  ? 150.175 109.942 13.725  1.00 32.72 ? 58   THR D C     1 
ATOM   8852  O  O     . THR D  1 30  ? 149.324 110.743 14.109  1.00 31.67 ? 58   THR D O     1 
ATOM   8853  C  CB    . THR D  1 30  ? 150.419 109.118 11.361  1.00 33.19 ? 58   THR D CB    1 
ATOM   8854  O  OG1   . THR D  1 30  ? 150.036 110.435 10.958  1.00 31.02 ? 58   THR D OG1   1 
ATOM   8855  C  CG2   . THR D  1 30  ? 149.940 108.112 10.322  1.00 32.79 ? 58   THR D CG2   1 
ATOM   8856  N  N     . ASP D  1 31  ? 151.435 109.997 14.118  1.00 32.76 ? 59   ASP D N     1 
ATOM   8857  C  CA    . ASP D  1 31  ? 151.949 111.107 14.922  1.00 33.09 ? 59   ASP D CA    1 
ATOM   8858  C  C     . ASP D  1 31  ? 151.698 112.482 14.291  1.00 32.22 ? 59   ASP D C     1 
ATOM   8859  O  O     . ASP D  1 31  ? 151.288 113.402 14.989  1.00 31.21 ? 59   ASP D O     1 
ATOM   8860  C  CB    . ASP D  1 31  ? 153.447 110.924 15.192  1.00 33.47 ? 59   ASP D CB    1 
ATOM   8861  C  CG    . ASP D  1 31  ? 153.733 109.769 16.129  1.00 35.54 ? 59   ASP D CG    1 
ATOM   8862  O  OD1   . ASP D  1 31  ? 152.790 109.264 16.786  1.00 38.05 ? 59   ASP D OD1   1 
ATOM   8863  O  OD2   . ASP D  1 31  ? 154.910 109.368 16.205  1.00 38.04 ? 59   ASP D OD2   1 
ATOM   8864  N  N     . GLU D  1 32  ? 151.923 112.617 12.985  1.00 32.17 ? 60   GLU D N     1 
ATOM   8865  C  CA    . GLU D  1 32  ? 151.691 113.900 12.299  1.00 32.56 ? 60   GLU D CA    1 
ATOM   8866  C  C     . GLU D  1 32  ? 150.213 114.293 12.344  1.00 31.68 ? 60   GLU D C     1 
ATOM   8867  O  O     . GLU D  1 32  ? 149.878 115.448 12.635  1.00 30.81 ? 60   GLU D O     1 
ATOM   8868  C  CB    . GLU D  1 32  ? 152.183 113.867 10.842  1.00 32.71 ? 60   GLU D CB    1 
ATOM   8869  C  CG    . GLU D  1 32  ? 152.225 115.267 10.170  1.00 35.45 ? 60   GLU D CG    1 
ATOM   8870  C  CD    . GLU D  1 32  ? 152.597 115.258 8.670   1.00 36.37 ? 60   GLU D CD    1 
ATOM   8871  O  OE1   . GLU D  1 32  ? 152.211 114.317 7.941   1.00 40.54 ? 60   GLU D OE1   1 
ATOM   8872  O  OE2   . GLU D  1 32  ? 153.255 116.228 8.205   1.00 42.81 ? 60   GLU D OE2   1 
ATOM   8873  N  N     . GLU D  1 33  ? 149.332 113.333 12.056  1.00 30.46 ? 61   GLU D N     1 
ATOM   8874  C  CA    . GLU D  1 33  ? 147.883 113.568 12.114  1.00 30.30 ? 61   GLU D CA    1 
ATOM   8875  C  C     . GLU D  1 33  ? 147.433 114.042 13.500  1.00 30.66 ? 61   GLU D C     1 
ATOM   8876  O  O     . GLU D  1 33  ? 146.666 114.991 13.601  1.00 29.75 ? 61   GLU D O     1 
ATOM   8877  C  CB    . GLU D  1 33  ? 147.125 112.306 11.689  1.00 29.71 ? 61   GLU D CB    1 
ATOM   8878  C  CG    . GLU D  1 33  ? 147.265 112.037 10.183  1.00 29.41 ? 61   GLU D CG    1 
ATOM   8879  C  CD    . GLU D  1 33  ? 146.905 110.609 9.728   1.00 30.14 ? 61   GLU D CD    1 
ATOM   8880  O  OE1   . GLU D  1 33  ? 146.665 109.688 10.562  1.00 25.78 ? 61   GLU D OE1   1 
ATOM   8881  O  OE2   . GLU D  1 33  ? 146.853 110.431 8.492   1.00 26.63 ? 61   GLU D OE2   1 
ATOM   8882  N  N     . MET D  1 34  ? 147.932 113.385 14.548  1.00 31.77 ? 62   MET D N     1 
ATOM   8883  C  CA    . MET D  1 34  ? 147.618 113.733 15.935  1.00 33.10 ? 62   MET D CA    1 
ATOM   8884  C  C     . MET D  1 34  ? 148.123 115.141 16.262  1.00 32.18 ? 62   MET D C     1 
ATOM   8885  O  O     . MET D  1 34  ? 147.410 115.926 16.866  1.00 31.43 ? 62   MET D O     1 
ATOM   8886  C  CB    . MET D  1 34  ? 148.246 112.730 16.925  1.00 33.56 ? 62   MET D CB    1 
ATOM   8887  C  CG    . MET D  1 34  ? 147.637 111.326 16.933  1.00 34.60 ? 62   MET D CG    1 
ATOM   8888  S  SD    . MET D  1 34  ? 148.285 110.273 18.276  1.00 38.96 ? 62   MET D SD    1 
ATOM   8889  C  CE    . MET D  1 34  ? 149.952 109.938 17.739  1.00 38.25 ? 62   MET D CE    1 
ATOM   8890  N  N     . MET D  1 35  ? 149.351 115.449 15.853  1.00 32.28 ? 63   MET D N     1 
ATOM   8891  C  CA    . MET D  1 35  ? 149.938 116.769 16.097  1.00 33.17 ? 63   MET D CA    1 
ATOM   8892  C  C     . MET D  1 35  ? 149.185 117.892 15.364  1.00 31.60 ? 63   MET D C     1 
ATOM   8893  O  O     . MET D  1 35  ? 148.979 118.967 15.919  1.00 30.38 ? 63   MET D O     1 
ATOM   8894  C  CB    . MET D  1 35  ? 151.413 116.790 15.701  1.00 32.73 ? 63   MET D CB    1 
ATOM   8895  C  CG    . MET D  1 35  ? 152.317 115.909 16.586  1.00 35.49 ? 63   MET D CG    1 
ATOM   8896  S  SD    . MET D  1 35  ? 154.093 116.071 16.230  1.00 38.60 ? 63   MET D SD    1 
ATOM   8897  C  CE    . MET D  1 35  ? 154.153 116.142 14.424  1.00 39.08 ? 63   MET D CE    1 
ATOM   8898  N  N     . ILE D  1 36  ? 148.772 117.629 14.128  1.00 31.03 ? 64   ILE D N     1 
ATOM   8899  C  CA    . ILE D  1 36  ? 148.056 118.625 13.335  1.00 31.03 ? 64   ILE D CA    1 
ATOM   8900  C  C     . ILE D  1 36  ? 146.675 118.892 13.946  1.00 30.63 ? 64   ILE D C     1 
ATOM   8901  O  O     . ILE D  1 36  ? 146.279 120.047 14.105  1.00 30.38 ? 64   ILE D O     1 
ATOM   8902  C  CB    . ILE D  1 36  ? 147.972 118.216 11.839  1.00 30.94 ? 64   ILE D CB    1 
ATOM   8903  C  CG1   . ILE D  1 36  ? 149.366 118.263 11.209  1.00 31.86 ? 64   ILE D CG1   1 
ATOM   8904  C  CG2   . ILE D  1 36  ? 147.081 119.157 11.079  1.00 31.99 ? 64   ILE D CG2   1 
ATOM   8905  C  CD1   . ILE D  1 36  ? 149.431 117.864 9.723   1.00 31.48 ? 64   ILE D CD1   1 
ATOM   8906  N  N     . LYS D  1 37  ? 145.961 117.824 14.307  1.00 30.52 ? 65   LYS D N     1 
ATOM   8907  C  CA    . LYS D  1 37  ? 144.679 117.929 15.009  1.00 30.66 ? 65   LYS D CA    1 
ATOM   8908  C  C     . LYS D  1 37  ? 144.793 118.835 16.254  1.00 30.13 ? 65   LYS D C     1 
ATOM   8909  O  O     . LYS D  1 37  ? 143.971 119.732 16.468  1.00 29.34 ? 65   LYS D O     1 
ATOM   8910  C  CB    . LYS D  1 37  ? 144.188 116.532 15.417  1.00 30.68 ? 65   LYS D CB    1 
ATOM   8911  C  CG    . LYS D  1 37  ? 142.839 116.534 16.105  1.00 31.95 ? 65   LYS D CG    1 
ATOM   8912  C  CD    . LYS D  1 37  ? 142.295 115.127 16.358  1.00 32.76 ? 65   LYS D CD    1 
ATOM   8913  C  CE    . LYS D  1 37  ? 141.022 115.223 17.193  1.00 33.86 ? 65   LYS D CE    1 
ATOM   8914  N  NZ    . LYS D  1 37  ? 140.451 113.918 17.537  1.00 36.10 ? 65   LYS D NZ    1 
ATOM   8915  N  N     . SER D  1 38  ? 145.822 118.576 17.056  1.00 30.17 ? 66   SER D N     1 
ATOM   8916  C  CA    . SER D  1 38  ? 146.097 119.327 18.294  1.00 30.03 ? 66   SER D CA    1 
ATOM   8917  C  C     . SER D  1 38  ? 146.376 120.809 18.038  1.00 29.51 ? 66   SER D C     1 
ATOM   8918  O  O     . SER D  1 38  ? 145.839 121.664 18.742  1.00 29.27 ? 66   SER D O     1 
ATOM   8919  C  CB    A SER D  1 38  ? 147.257 118.698 19.067  0.50 30.04 ? 66   SER D CB    1 
ATOM   8920  C  CB    B SER D  1 38  ? 147.297 118.707 19.018  0.50 30.06 ? 66   SER D CB    1 
ATOM   8921  O  OG    A SER D  1 38  ? 146.825 117.501 19.688  0.50 29.94 ? 66   SER D OG    1 
ATOM   8922  O  OG    B SER D  1 38  ? 147.506 119.309 20.279  0.50 30.36 ? 66   SER D OG    1 
ATOM   8923  N  N     . SER D  1 39  ? 147.225 121.104 17.051  1.00 28.81 ? 67   SER D N     1 
ATOM   8924  C  CA    . SER D  1 39  ? 147.518 122.499 16.667  1.00 28.55 ? 67   SER D CA    1 
ATOM   8925  C  C     . SER D  1 39  ? 146.254 123.241 16.223  1.00 27.73 ? 67   SER D C     1 
ATOM   8926  O  O     . SER D  1 39  ? 146.029 124.385 16.618  1.00 27.10 ? 67   SER D O     1 
ATOM   8927  C  CB    A SER D  1 39  ? 148.575 122.569 15.565  0.50 28.33 ? 67   SER D CB    1 
ATOM   8928  C  CB    B SER D  1 39  ? 148.587 122.560 15.567  0.50 28.49 ? 67   SER D CB    1 
ATOM   8929  O  OG    A SER D  1 39  ? 149.812 122.094 16.032  0.50 28.71 ? 67   SER D OG    1 
ATOM   8930  O  OG    B SER D  1 39  ? 148.040 122.197 14.306  0.50 30.46 ? 67   SER D OG    1 
ATOM   8931  N  N     . VAL D  1 40  ? 145.421 122.589 15.423  1.00 26.88 ? 68   VAL D N     1 
ATOM   8932  C  CA    . VAL D  1 40  ? 144.204 123.226 14.927  1.00 26.35 ? 68   VAL D CA    1 
ATOM   8933  C  C     . VAL D  1 40  ? 143.203 123.486 16.045  1.00 26.77 ? 68   VAL D C     1 
ATOM   8934  O  O     . VAL D  1 40  ? 142.583 124.549 16.069  1.00 26.19 ? 68   VAL D O     1 
ATOM   8935  C  CB    . VAL D  1 40  ? 143.545 122.423 13.769  1.00 26.27 ? 68   VAL D CB    1 
ATOM   8936  C  CG1   . VAL D  1 40  ? 142.219 123.097 13.296  1.00 25.44 ? 68   VAL D CG1   1 
ATOM   8937  C  CG2   . VAL D  1 40  ? 144.528 122.336 12.620  1.00 25.94 ? 68   VAL D CG2   1 
ATOM   8938  N  N     . LYS D  1 41  ? 143.064 122.531 16.971  1.00 27.19 ? 69   LYS D N     1 
ATOM   8939  C  CA    . LYS D  1 41  ? 142.196 122.704 18.134  1.00 28.39 ? 69   LYS D CA    1 
ATOM   8940  C  C     . LYS D  1 41  ? 142.557 123.987 18.894  1.00 28.32 ? 69   LYS D C     1 
ATOM   8941  O  O     . LYS D  1 41  ? 141.684 124.795 19.209  1.00 28.11 ? 69   LYS D O     1 
ATOM   8942  C  CB    . LYS D  1 41  ? 142.296 121.492 19.074  1.00 28.49 ? 69   LYS D CB    1 
ATOM   8943  C  CG    . LYS D  1 41  ? 141.379 121.565 20.294  1.00 29.94 ? 69   LYS D CG    1 
ATOM   8944  C  CD    . LYS D  1 41  ? 141.567 120.350 21.199  1.00 31.23 ? 69   LYS D CD    1 
ATOM   8945  C  CE    . LYS D  1 41  ? 140.545 120.337 22.314  1.00 34.83 ? 69   LYS D CE    1 
ATOM   8946  N  NZ    . LYS D  1 41  ? 140.918 119.330 23.375  1.00 38.98 ? 69   LYS D NZ    1 
ATOM   8947  N  N     . LYS D  1 42  ? 143.846 124.156 19.161  1.00 28.41 ? 70   LYS D N     1 
ATOM   8948  C  CA    . LYS D  1 42  ? 144.376 125.319 19.887  1.00 29.37 ? 70   LYS D CA    1 
ATOM   8949  C  C     . LYS D  1 42  ? 144.138 126.612 19.109  1.00 29.15 ? 70   LYS D C     1 
ATOM   8950  O  O     . LYS D  1 42  ? 143.644 127.599 19.663  1.00 28.94 ? 70   LYS D O     1 
ATOM   8951  C  CB    . LYS D  1 42  ? 145.872 125.130 20.170  1.00 29.41 ? 70   LYS D CB    1 
ATOM   8952  C  CG    . LYS D  1 42  ? 146.500 126.175 21.097  1.00 30.77 ? 70   LYS D CG    1 
ATOM   8953  C  CD    . LYS D  1 42  ? 148.025 126.060 21.141  1.00 31.47 ? 70   LYS D CD    1 
ATOM   8954  C  CE    . LYS D  1 42  ? 148.678 127.160 22.013  1.00 33.26 ? 70   LYS D CE    1 
ATOM   8955  N  NZ    . LYS D  1 42  ? 148.990 128.407 21.230  1.00 35.69 ? 70   LYS D NZ    1 
ATOM   8956  N  N     . PHE D  1 43  ? 144.499 126.603 17.827  1.00 29.66 ? 71   PHE D N     1 
ATOM   8957  C  CA    . PHE D  1 43  ? 144.283 127.755 16.946  1.00 29.82 ? 71   PHE D CA    1 
ATOM   8958  C  C     . PHE D  1 43  ? 142.800 128.165 16.883  1.00 29.79 ? 71   PHE D C     1 
ATOM   8959  O  O     . PHE D  1 43  ? 142.488 129.337 17.039  1.00 29.59 ? 71   PHE D O     1 
ATOM   8960  C  CB    . PHE D  1 43  ? 144.825 127.473 15.530  1.00 30.40 ? 71   PHE D CB    1 
ATOM   8961  C  CG    . PHE D  1 43  ? 144.390 128.486 14.496  1.00 30.66 ? 71   PHE D CG    1 
ATOM   8962  C  CD1   . PHE D  1 43  ? 144.934 129.767 14.489  1.00 32.27 ? 71   PHE D CD1   1 
ATOM   8963  C  CD2   . PHE D  1 43  ? 143.441 128.158 13.535  1.00 31.55 ? 71   PHE D CD2   1 
ATOM   8964  C  CE1   . PHE D  1 43  ? 144.528 130.712 13.526  1.00 32.03 ? 71   PHE D CE1   1 
ATOM   8965  C  CE2   . PHE D  1 43  ? 143.033 129.089 12.574  1.00 31.40 ? 71   PHE D CE2   1 
ATOM   8966  C  CZ    . PHE D  1 43  ? 143.572 130.372 12.585  1.00 31.61 ? 71   PHE D CZ    1 
ATOM   8967  N  N     . ALA D  1 44  ? 141.899 127.207 16.666  1.00 29.17 ? 72   ALA D N     1 
ATOM   8968  C  CA    . ALA D  1 44  ? 140.467 127.498 16.598  1.00 30.12 ? 72   ALA D CA    1 
ATOM   8969  C  C     . ALA D  1 44  ? 139.956 128.101 17.912  1.00 31.04 ? 72   ALA D C     1 
ATOM   8970  O  O     . ALA D  1 44  ? 139.279 129.126 17.897  1.00 30.81 ? 72   ALA D O     1 
ATOM   8971  C  CB    . ALA D  1 44  ? 139.662 126.253 16.226  1.00 29.33 ? 72   ALA D CB    1 
ATOM   8972  N  N     . GLN D  1 45  ? 140.304 127.482 19.039  1.00 32.12 ? 73   GLN D N     1 
ATOM   8973  C  CA    . GLN D  1 45  ? 139.848 127.977 20.344  1.00 34.06 ? 73   GLN D CA    1 
ATOM   8974  C  C     . GLN D  1 45  ? 140.393 129.373 20.653  1.00 34.08 ? 73   GLN D C     1 
ATOM   8975  O  O     . GLN D  1 45  ? 139.647 130.230 21.129  1.00 34.64 ? 73   GLN D O     1 
ATOM   8976  C  CB    . GLN D  1 45  ? 140.101 126.944 21.481  1.00 33.98 ? 73   GLN D CB    1 
ATOM   8977  C  CG    . GLN D  1 45  ? 138.982 125.864 21.544  1.00 36.15 ? 73   GLN D CG    1 
ATOM   8978  C  CD    . GLN D  1 45  ? 139.299 124.619 22.420  1.00 36.38 ? 73   GLN D CD    1 
ATOM   8979  O  OE1   . GLN D  1 45  ? 140.054 124.697 23.391  1.00 40.74 ? 73   GLN D OE1   1 
ATOM   8980  N  NE2   . GLN D  1 45  ? 138.680 123.479 22.082  1.00 37.95 ? 73   GLN D NE2   1 
ATOM   8981  N  N     . GLU D  1 46  ? 141.654 129.638 20.316  1.00 34.53 ? 74   GLU D N     1 
ATOM   8982  C  CA    . GLU D  1 46  ? 142.281 130.932 20.618  1.00 34.76 ? 74   GLU D CA    1 
ATOM   8983  C  C     . GLU D  1 46  ? 141.964 132.043 19.592  1.00 34.05 ? 74   GLU D C     1 
ATOM   8984  O  O     . GLU D  1 46  ? 141.697 133.194 19.962  1.00 33.44 ? 74   GLU D O     1 
ATOM   8985  C  CB    . GLU D  1 46  ? 143.809 130.764 20.764  1.00 34.98 ? 74   GLU D CB    1 
ATOM   8986  C  CG    . GLU D  1 46  ? 144.196 129.860 21.957  1.00 36.39 ? 74   GLU D CG    1 
ATOM   8987  C  CD    . GLU D  1 46  ? 145.696 129.636 22.115  1.00 36.58 ? 74   GLU D CD    1 
ATOM   8988  O  OE1   . GLU D  1 46  ? 146.482 130.057 21.237  1.00 38.85 ? 74   GLU D OE1   1 
ATOM   8989  O  OE2   . GLU D  1 46  ? 146.082 129.024 23.139  1.00 40.63 ? 74   GLU D OE2   1 
ATOM   8990  N  N     . GLN D  1 47  ? 141.992 131.703 18.309  1.00 33.09 ? 75   GLN D N     1 
ATOM   8991  C  CA    . GLN D  1 47  ? 141.909 132.707 17.257  1.00 32.43 ? 75   GLN D CA    1 
ATOM   8992  C  C     . GLN D  1 47  ? 140.549 132.816 16.544  1.00 31.34 ? 75   GLN D C     1 
ATOM   8993  O  O     . GLN D  1 47  ? 140.256 133.837 15.911  1.00 31.55 ? 75   GLN D O     1 
ATOM   8994  C  CB    . GLN D  1 47  ? 143.009 132.447 16.233  1.00 32.97 ? 75   GLN D CB    1 
ATOM   8995  C  CG    . GLN D  1 47  ? 144.436 132.632 16.776  1.00 34.81 ? 75   GLN D CG    1 
ATOM   8996  C  CD    . GLN D  1 47  ? 144.724 134.057 17.238  1.00 38.40 ? 75   GLN D CD    1 
ATOM   8997  O  OE1   . GLN D  1 47  ? 144.349 135.036 16.577  1.00 40.89 ? 75   GLN D OE1   1 
ATOM   8998  N  NE2   . GLN D  1 47  ? 145.411 134.180 18.370  1.00 40.06 ? 75   GLN D NE2   1 
ATOM   8999  N  N     . ILE D  1 48  ? 139.727 131.778 16.616  1.00 29.87 ? 76   ILE D N     1 
ATOM   9000  C  CA    . ILE D  1 48  ? 138.465 131.784 15.884  1.00 28.44 ? 76   ILE D CA    1 
ATOM   9001  C  C     . ILE D  1 48  ? 137.265 131.976 16.806  1.00 28.09 ? 76   ILE D C     1 
ATOM   9002  O  O     . ILE D  1 48  ? 136.446 132.865 16.572  1.00 26.77 ? 76   ILE D O     1 
ATOM   9003  C  CB    . ILE D  1 48  ? 138.284 130.504 15.027  1.00 28.88 ? 76   ILE D CB    1 
ATOM   9004  C  CG1   . ILE D  1 48  ? 139.461 130.358 14.051  1.00 28.99 ? 76   ILE D CG1   1 
ATOM   9005  C  CG2   . ILE D  1 48  ? 136.955 130.574 14.271  1.00 25.83 ? 76   ILE D CG2   1 
ATOM   9006  C  CD1   . ILE D  1 48  ? 139.401 129.107 13.194  1.00 29.05 ? 76   ILE D CD1   1 
ATOM   9007  N  N     . ALA D  1 49  ? 137.183 131.157 17.854  1.00 27.41 ? 77   ALA D N     1 
ATOM   9008  C  CA    . ALA D  1 49  ? 136.029 131.149 18.766  1.00 27.67 ? 77   ALA D CA    1 
ATOM   9009  C  C     . ALA D  1 49  ? 135.527 132.540 19.239  1.00 27.64 ? 77   ALA D C     1 
ATOM   9010  O  O     . ALA D  1 49  ? 134.323 132.765 19.229  1.00 28.47 ? 77   ALA D O     1 
ATOM   9011  C  CB    . ALA D  1 49  ? 136.294 130.217 19.961  1.00 27.70 ? 77   ALA D CB    1 
ATOM   9012  N  N     . PRO D  1 50  ? 136.432 133.469 19.634  1.00 27.66 ? 78   PRO D N     1 
ATOM   9013  C  CA    . PRO D  1 50  ? 135.989 134.826 20.028  1.00 27.51 ? 78   PRO D CA    1 
ATOM   9014  C  C     . PRO D  1 50  ? 135.297 135.639 18.926  1.00 26.93 ? 78   PRO D C     1 
ATOM   9015  O  O     . PRO D  1 50  ? 134.544 136.562 19.229  1.00 26.68 ? 78   PRO D O     1 
ATOM   9016  C  CB    . PRO D  1 50  ? 137.292 135.520 20.463  1.00 28.20 ? 78   PRO D CB    1 
ATOM   9017  C  CG    . PRO D  1 50  ? 138.251 134.399 20.738  1.00 28.56 ? 78   PRO D CG    1 
ATOM   9018  C  CD    . PRO D  1 50  ? 137.893 133.324 19.777  1.00 27.63 ? 78   PRO D CD    1 
ATOM   9019  N  N     . LEU D  1 51  ? 135.535 135.287 17.662  1.00 25.99 ? 79   LEU D N     1 
ATOM   9020  C  CA    . LEU D  1 51  ? 134.975 136.020 16.541  1.00 25.92 ? 79   LEU D CA    1 
ATOM   9021  C  C     . LEU D  1 51  ? 133.768 135.353 15.889  1.00 25.60 ? 79   LEU D C     1 
ATOM   9022  O  O     . LEU D  1 51  ? 133.162 135.959 15.030  1.00 25.46 ? 79   LEU D O     1 
ATOM   9023  C  CB    . LEU D  1 51  ? 136.046 136.245 15.469  1.00 26.16 ? 79   LEU D CB    1 
ATOM   9024  C  CG    . LEU D  1 51  ? 137.297 136.988 15.918  1.00 26.51 ? 79   LEU D CG    1 
ATOM   9025  C  CD1   . LEU D  1 51  ? 138.409 136.795 14.893  1.00 29.17 ? 79   LEU D CD1   1 
ATOM   9026  C  CD2   . LEU D  1 51  ? 136.999 138.489 16.158  1.00 28.22 ? 79   LEU D CD2   1 
ATOM   9027  N  N     . VAL D  1 52  ? 133.446 134.116 16.259  1.00 25.61 ? 80   VAL D N     1 
ATOM   9028  C  CA    . VAL D  1 52  ? 132.370 133.365 15.579  1.00 25.76 ? 80   VAL D CA    1 
ATOM   9029  C  C     . VAL D  1 52  ? 131.059 134.164 15.474  1.00 26.26 ? 80   VAL D C     1 
ATOM   9030  O  O     . VAL D  1 52  ? 130.491 134.267 14.391  1.00 26.25 ? 80   VAL D O     1 
ATOM   9031  C  CB    . VAL D  1 52  ? 132.146 131.989 16.223  1.00 26.34 ? 80   VAL D CB    1 
ATOM   9032  C  CG1   . VAL D  1 52  ? 130.919 131.243 15.603  1.00 26.45 ? 80   VAL D CG1   1 
ATOM   9033  C  CG2   . VAL D  1 52  ? 133.414 131.132 16.053  1.00 25.21 ? 80   VAL D CG2   1 
ATOM   9034  N  N     . SER D  1 53  ? 130.623 134.777 16.574  1.00 26.73 ? 81   SER D N     1 
ATOM   9035  C  CA    . SER D  1 53  ? 129.330 135.478 16.620  1.00 27.19 ? 81   SER D CA    1 
ATOM   9036  C  C     . SER D  1 53  ? 129.284 136.723 15.754  1.00 26.82 ? 81   SER D C     1 
ATOM   9037  O  O     . SER D  1 53  ? 128.322 136.944 15.028  1.00 25.78 ? 81   SER D O     1 
ATOM   9038  C  CB    . SER D  1 53  ? 128.963 135.843 18.066  1.00 27.47 ? 81   SER D CB    1 
ATOM   9039  O  OG    . SER D  1 53  ? 128.542 134.671 18.717  1.00 31.42 ? 81   SER D OG    1 
ATOM   9040  N  N     . THR D  1 54  ? 130.339 137.524 15.822  1.00 27.09 ? 82   THR D N     1 
ATOM   9041  C  CA    . THR D  1 54  ? 130.433 138.734 15.029  1.00 27.71 ? 82   THR D CA    1 
ATOM   9042  C  C     . THR D  1 54  ? 130.473 138.459 13.544  1.00 27.06 ? 82   THR D C     1 
ATOM   9043  O  O     . THR D  1 54  ? 129.902 139.212 12.763  1.00 26.29 ? 82   THR D O     1 
ATOM   9044  C  CB    . THR D  1 54  ? 131.733 139.530 15.321  1.00 28.07 ? 82   THR D CB    1 
ATOM   9045  O  OG1   . THR D  1 54  ? 132.046 139.453 16.711  1.00 31.68 ? 82   THR D OG1   1 
ATOM   9046  C  CG2   . THR D  1 54  ? 131.547 140.951 14.892  1.00 29.08 ? 82   THR D CG2   1 
ATOM   9047  N  N     . MET D  1 55  ? 131.199 137.409 13.163  1.00 27.01 ? 83   MET D N     1 
ATOM   9048  C  CA    . MET D  1 55  ? 131.350 137.056 11.770  1.00 26.97 ? 83   MET D CA    1 
ATOM   9049  C  C     . MET D  1 55  ? 130.017 136.592 11.190  1.00 27.06 ? 83   MET D C     1 
ATOM   9050  O  O     . MET D  1 55  ? 129.679 136.928 10.056  1.00 26.28 ? 83   MET D O     1 
ATOM   9051  C  CB    . MET D  1 55  ? 132.436 135.984 11.594  1.00 27.08 ? 83   MET D CB    1 
ATOM   9052  C  CG    . MET D  1 55  ? 133.829 136.506 11.893  1.00 27.40 ? 83   MET D CG    1 
ATOM   9053  S  SD    . MET D  1 55  ? 135.182 135.433 11.378  1.00 28.72 ? 83   MET D SD    1 
ATOM   9054  C  CE    . MET D  1 55  ? 134.905 133.926 12.280  1.00 25.96 ? 83   MET D CE    1 
ATOM   9055  N  N     . ASP D  1 56  ? 129.269 135.840 11.987  1.00 26.68 ? 84   ASP D N     1 
ATOM   9056  C  CA    . ASP D  1 56  ? 127.939 135.386 11.617  1.00 27.38 ? 84   ASP D CA    1 
ATOM   9057  C  C     . ASP D  1 56  ? 126.979 136.563 11.505  1.00 27.60 ? 84   ASP D C     1 
ATOM   9058  O  O     . ASP D  1 56  ? 126.281 136.695 10.519  1.00 26.97 ? 84   ASP D O     1 
ATOM   9059  C  CB    . ASP D  1 56  ? 127.430 134.369 12.654  1.00 27.12 ? 84   ASP D CB    1 
ATOM   9060  C  CG    . ASP D  1 56  ? 125.979 133.978 12.447  1.00 28.12 ? 84   ASP D CG    1 
ATOM   9061  O  OD1   . ASP D  1 56  ? 125.700 133.243 11.485  1.00 26.63 ? 84   ASP D OD1   1 
ATOM   9062  O  OD2   . ASP D  1 56  ? 125.109 134.387 13.260  1.00 29.95 ? 84   ASP D OD2   1 
ATOM   9063  N  N     . GLU D  1 57  ? 126.943 137.403 12.531  1.00 29.03 ? 85   GLU D N     1 
ATOM   9064  C  CA    . GLU D  1 57  ? 126.082 138.577 12.542  1.00 30.88 ? 85   GLU D CA    1 
ATOM   9065  C  C     . GLU D  1 57  ? 126.321 139.479 11.316  1.00 30.55 ? 85   GLU D C     1 
ATOM   9066  O  O     . GLU D  1 57  ? 125.378 139.923 10.660  1.00 30.25 ? 85   GLU D O     1 
ATOM   9067  C  CB    . GLU D  1 57  ? 126.308 139.363 13.846  1.00 30.82 ? 85   GLU D CB    1 
ATOM   9068  C  CG    . GLU D  1 57  ? 125.522 140.666 13.958  1.00 33.36 ? 85   GLU D CG    1 
ATOM   9069  C  CD    . GLU D  1 57  ? 125.796 141.419 15.263  1.00 34.86 ? 85   GLU D CD    1 
ATOM   9070  O  OE1   . GLU D  1 57  ? 126.311 140.809 16.237  1.00 41.57 ? 85   GLU D OE1   1 
ATOM   9071  O  OE2   . GLU D  1 57  ? 125.479 142.625 15.326  1.00 40.47 ? 85   GLU D OE2   1 
ATOM   9072  N  N     . ASN D  1 58  ? 127.584 139.711 10.984  1.00 30.40 ? 86   ASN D N     1 
ATOM   9073  C  CA    . ASN D  1 58  ? 127.932 140.629 9.917   1.00 30.70 ? 86   ASN D CA    1 
ATOM   9074  C  C     . ASN D  1 58  ? 128.124 139.989 8.540   1.00 30.10 ? 86   ASN D C     1 
ATOM   9075  O  O     . ASN D  1 58  ? 128.356 140.703 7.568   1.00 29.14 ? 86   ASN D O     1 
ATOM   9076  C  CB    . ASN D  1 58  ? 129.178 141.412 10.321  1.00 31.49 ? 86   ASN D CB    1 
ATOM   9077  C  CG    . ASN D  1 58  ? 128.941 142.279 11.548  1.00 34.06 ? 86   ASN D CG    1 
ATOM   9078  O  OD1   . ASN D  1 58  ? 127.893 142.933 11.674  1.00 37.01 ? 86   ASN D OD1   1 
ATOM   9079  N  ND2   . ASN D  1 58  ? 129.917 142.299 12.459  1.00 38.51 ? 86   ASN D ND2   1 
ATOM   9080  N  N     . SER D  1 59  ? 127.977 138.665 8.459   1.00 29.66 ? 87   SER D N     1 
ATOM   9081  C  CA    . SER D  1 59  ? 128.260 137.892 7.246   1.00 29.84 ? 87   SER D CA    1 
ATOM   9082  C  C     . SER D  1 59  ? 129.607 138.250 6.646   1.00 30.04 ? 87   SER D C     1 
ATOM   9083  O  O     . SER D  1 59  ? 129.694 138.579 5.461   1.00 29.12 ? 87   SER D O     1 
ATOM   9084  C  CB    . SER D  1 59  ? 127.156 138.073 6.199   1.00 30.22 ? 87   SER D CB    1 
ATOM   9085  O  OG    . SER D  1 59  ? 125.957 137.491 6.653   1.00 30.25 ? 87   SER D OG    1 
ATOM   9086  N  N     . LYS D  1 60  ? 130.644 138.204 7.478   1.00 29.90 ? 88   LYS D N     1 
ATOM   9087  C  CA    . LYS D  1 60  ? 131.949 138.729 7.112   1.00 31.01 ? 88   LYS D CA    1 
ATOM   9088  C  C     . LYS D  1 60  ? 133.028 137.957 7.845   1.00 30.03 ? 88   LYS D C     1 
ATOM   9089  O  O     . LYS D  1 60  ? 133.118 137.998 9.082   1.00 29.87 ? 88   LYS D O     1 
ATOM   9090  C  CB    . LYS D  1 60  ? 132.062 140.211 7.478   1.00 30.90 ? 88   LYS D CB    1 
ATOM   9091  C  CG    . LYS D  1 60  ? 133.407 140.868 7.111   1.00 32.65 ? 88   LYS D CG    1 
ATOM   9092  C  CD    . LYS D  1 60  ? 133.561 142.260 7.760   1.00 34.16 ? 88   LYS D CD    1 
ATOM   9093  C  CE    . LYS D  1 60  ? 135.002 142.796 7.693   1.00 36.38 ? 88   LYS D CE    1 
ATOM   9094  N  NZ    . LYS D  1 60  ? 135.299 143.700 8.861   1.00 40.08 ? 88   LYS D NZ    1 
ATOM   9095  N  N     . MET D  1 61  ? 133.859 137.282 7.070   1.00 29.28 ? 89   MET D N     1 
ATOM   9096  C  CA    . MET D  1 61  ? 135.023 136.604 7.598   1.00 28.86 ? 89   MET D CA    1 
ATOM   9097  C  C     . MET D  1 61  ? 136.096 137.633 7.955   1.00 29.04 ? 89   MET D C     1 
ATOM   9098  O  O     . MET D  1 61  ? 136.336 138.570 7.203   1.00 28.86 ? 89   MET D O     1 
ATOM   9099  C  CB    . MET D  1 61  ? 135.559 135.604 6.565   1.00 28.93 ? 89   MET D CB    1 
ATOM   9100  C  CG    A MET D  1 61  ? 136.732 134.800 6.997   0.50 29.17 ? 89   MET D CG    1 
ATOM   9101  C  CG    B MET D  1 61  ? 136.659 134.701 7.195   0.50 29.50 ? 89   MET D CG    1 
ATOM   9102  S  SD    A MET D  1 61  ? 136.185 133.545 8.099   0.50 27.31 ? 89   MET D SD    1 
ATOM   9103  S  SD    B MET D  1 61  ? 136.880 133.012 6.562   0.50 28.95 ? 89   MET D SD    1 
ATOM   9104  C  CE    A MET D  1 61  ? 135.268 132.483 6.987   0.50 27.47 ? 89   MET D CE    1 
ATOM   9105  C  CE    B MET D  1 61  ? 135.228 132.340 6.737   0.50 28.78 ? 89   MET D CE    1 
ATOM   9106  N  N     . GLU D  1 62  ? 136.726 137.449 9.110   1.00 28.69 ? 90   GLU D N     1 
ATOM   9107  C  CA    . GLU D  1 62  ? 137.772 138.359 9.589   1.00 29.01 ? 90   GLU D CA    1 
ATOM   9108  C  C     . GLU D  1 62  ? 139.108 138.080 8.887   1.00 28.89 ? 90   GLU D C     1 
ATOM   9109  O  O     . GLU D  1 62  ? 139.502 136.925 8.716   1.00 27.27 ? 90   GLU D O     1 
ATOM   9110  C  CB    . GLU D  1 62  ? 137.931 138.218 11.110  1.00 29.15 ? 90   GLU D CB    1 
ATOM   9111  C  CG    . GLU D  1 62  ? 136.840 138.911 11.919  1.00 30.73 ? 90   GLU D CG    1 
ATOM   9112  C  CD    . GLU D  1 62  ? 136.864 140.424 11.728  1.00 33.97 ? 90   GLU D CD    1 
ATOM   9113  O  OE1   . GLU D  1 62  ? 137.957 141.024 11.822  1.00 35.38 ? 90   GLU D OE1   1 
ATOM   9114  O  OE2   . GLU D  1 62  ? 135.799 141.009 11.437  1.00 36.42 ? 90   GLU D OE2   1 
ATOM   9115  N  N     . LYS D  1 63  ? 139.793 139.147 8.481   1.00 29.15 ? 91   LYS D N     1 
ATOM   9116  C  CA    . LYS D  1 63  ? 141.113 139.041 7.862   1.00 30.00 ? 91   LYS D CA    1 
ATOM   9117  C  C     . LYS D  1 63  ? 142.094 138.305 8.778   1.00 29.20 ? 91   LYS D C     1 
ATOM   9118  O  O     . LYS D  1 63  ? 142.881 137.495 8.311   1.00 29.60 ? 91   LYS D O     1 
ATOM   9119  C  CB    . LYS D  1 63  ? 141.658 140.440 7.545   1.00 30.57 ? 91   LYS D CB    1 
ATOM   9120  C  CG    . LYS D  1 63  ? 142.962 140.463 6.792   1.00 31.62 ? 91   LYS D CG    1 
ATOM   9121  C  CD    . LYS D  1 63  ? 143.346 141.893 6.397   1.00 32.04 ? 91   LYS D CD    1 
ATOM   9122  N  N     . SER D  1 64  ? 142.027 138.569 10.075  1.00 28.58 ? 92   SER D N     1 
ATOM   9123  C  CA    . SER D  1 64  ? 142.879 137.875 11.049  1.00 28.33 ? 92   SER D CA    1 
ATOM   9124  C  C     . SER D  1 64  ? 142.742 136.343 10.978  1.00 27.78 ? 92   SER D C     1 
ATOM   9125  O  O     . SER D  1 64  ? 143.728 135.616 11.111  1.00 27.48 ? 92   SER D O     1 
ATOM   9126  C  CB    . SER D  1 64  ? 142.594 138.365 12.473  1.00 28.37 ? 92   SER D CB    1 
ATOM   9127  O  OG    . SER D  1 64  ? 141.301 137.971 12.915  1.00 28.32 ? 92   SER D OG    1 
ATOM   9128  N  N     . VAL D  1 65  ? 141.520 135.862 10.756  1.00 27.45 ? 93   VAL D N     1 
ATOM   9129  C  CA    . VAL D  1 65  ? 141.250 134.426 10.662  1.00 26.81 ? 93   VAL D CA    1 
ATOM   9130  C  C     . VAL D  1 65  ? 141.859 133.858 9.369   1.00 27.32 ? 93   VAL D C     1 
ATOM   9131  O  O     . VAL D  1 65  ? 142.537 132.829 9.403   1.00 25.39 ? 93   VAL D O     1 
ATOM   9132  C  CB    . VAL D  1 65  ? 139.725 134.153 10.732  1.00 27.06 ? 93   VAL D CB    1 
ATOM   9133  C  CG1   . VAL D  1 65  ? 139.390 132.668 10.455  1.00 26.54 ? 93   VAL D CG1   1 
ATOM   9134  C  CG2   . VAL D  1 65  ? 139.170 134.629 12.094  1.00 24.86 ? 93   VAL D CG2   1 
ATOM   9135  N  N     . ILE D  1 66  ? 141.622 134.546 8.245   1.00 27.48 ? 94   ILE D N     1 
ATOM   9136  C  CA    . ILE D  1 66  ? 142.174 134.134 6.952   1.00 28.38 ? 94   ILE D CA    1 
ATOM   9137  C  C     . ILE D  1 66  ? 143.712 134.100 7.005   1.00 28.05 ? 94   ILE D C     1 
ATOM   9138  O  O     . ILE D  1 66  ? 144.335 133.096 6.621   1.00 27.18 ? 94   ILE D O     1 
ATOM   9139  C  CB    . ILE D  1 66  ? 141.679 135.033 5.788   1.00 28.46 ? 94   ILE D CB    1 
ATOM   9140  C  CG1   . ILE D  1 66  ? 140.154 134.900 5.623   1.00 29.64 ? 94   ILE D CG1   1 
ATOM   9141  C  CG2   . ILE D  1 66  ? 142.379 134.631 4.467   1.00 29.38 ? 94   ILE D CG2   1 
ATOM   9142  C  CD1   . ILE D  1 66  ? 139.489 136.129 4.960   1.00 29.79 ? 94   ILE D CD1   1 
ATOM   9143  N  N     . GLN D  1 67  ? 144.299 135.184 7.504   1.00 28.27 ? 95   GLN D N     1 
ATOM   9144  C  CA    . GLN D  1 67  ? 145.746 135.282 7.728   1.00 29.58 ? 95   GLN D CA    1 
ATOM   9145  C  C     . GLN D  1 67  ? 146.269 134.130 8.608   1.00 28.99 ? 95   GLN D C     1 
ATOM   9146  O  O     . GLN D  1 67  ? 147.321 133.548 8.328   1.00 28.37 ? 95   GLN D O     1 
ATOM   9147  C  CB    . GLN D  1 67  ? 146.088 136.617 8.392   1.00 29.68 ? 95   GLN D CB    1 
ATOM   9148  C  CG    . GLN D  1 67  ? 145.972 137.828 7.493   1.00 32.41 ? 95   GLN D CG    1 
ATOM   9149  C  CD    . GLN D  1 67  ? 146.251 139.139 8.229   1.00 33.26 ? 95   GLN D CD    1 
ATOM   9150  O  OE1   . GLN D  1 67  ? 145.957 139.293 9.425   1.00 39.84 ? 95   GLN D OE1   1 
ATOM   9151  N  NE2   . GLN D  1 67  ? 146.817 140.088 7.514   1.00 37.68 ? 95   GLN D NE2   1 
ATOM   9152  N  N     . GLY D  1 68  ? 145.529 133.825 9.677   1.00 28.67 ? 96   GLY D N     1 
ATOM   9153  C  CA    . GLY D  1 68  ? 145.862 132.722 10.577  1.00 28.33 ? 96   GLY D CA    1 
ATOM   9154  C  C     . GLY D  1 68  ? 145.870 131.363 9.896   1.00 27.79 ? 96   GLY D C     1 
ATOM   9155  O  O     . GLY D  1 68  ? 146.817 130.608 10.063  1.00 27.63 ? 96   GLY D O     1 
ATOM   9156  N  N     . LEU D  1 69  ? 144.822 131.053 9.132   1.00 27.69 ? 97   LEU D N     1 
ATOM   9157  C  CA    . LEU D  1 69  ? 144.762 129.803 8.370   1.00 27.37 ? 97   LEU D CA    1 
ATOM   9158  C  C     . LEU D  1 69  ? 146.014 129.612 7.511   1.00 26.67 ? 97   LEU D C     1 
ATOM   9159  O  O     . LEU D  1 69  ? 146.622 128.544 7.508   1.00 25.76 ? 97   LEU D O     1 
ATOM   9160  C  CB    . LEU D  1 69  ? 143.491 129.722 7.514   1.00 27.62 ? 97   LEU D CB    1 
ATOM   9161  C  CG    . LEU D  1 69  ? 142.145 129.618 8.243   1.00 29.05 ? 97   LEU D CG    1 
ATOM   9162  C  CD1   . LEU D  1 69  ? 140.996 129.719 7.233   1.00 29.42 ? 97   LEU D CD1   1 
ATOM   9163  C  CD2   . LEU D  1 69  ? 142.019 128.317 9.070   1.00 27.31 ? 97   LEU D CD2   1 
ATOM   9164  N  N     . PHE D  1 70  ? 146.424 130.667 6.815   1.00 26.09 ? 98   PHE D N     1 
ATOM   9165  C  CA    . PHE D  1 70  ? 147.627 130.600 5.987   1.00 25.88 ? 98   PHE D CA    1 
ATOM   9166  C  C     . PHE D  1 70  ? 148.877 130.435 6.834   1.00 26.54 ? 98   PHE D C     1 
ATOM   9167  O  O     . PHE D  1 70  ? 149.710 129.575 6.543   1.00 26.59 ? 98   PHE D O     1 
ATOM   9168  C  CB    . PHE D  1 70  ? 147.751 131.847 5.104   1.00 25.56 ? 98   PHE D CB    1 
ATOM   9169  C  CG    . PHE D  1 70  ? 146.892 131.816 3.887   1.00 24.69 ? 98   PHE D CG    1 
ATOM   9170  C  CD1   . PHE D  1 70  ? 147.206 130.976 2.820   1.00 23.74 ? 98   PHE D CD1   1 
ATOM   9171  C  CD2   . PHE D  1 70  ? 145.780 132.648 3.775   1.00 24.47 ? 98   PHE D CD2   1 
ATOM   9172  C  CE1   . PHE D  1 70  ? 146.428 130.950 1.675   1.00 24.26 ? 98   PHE D CE1   1 
ATOM   9173  C  CE2   . PHE D  1 70  ? 144.975 132.606 2.628   1.00 25.72 ? 98   PHE D CE2   1 
ATOM   9174  C  CZ    . PHE D  1 70  ? 145.312 131.756 1.571   1.00 24.81 ? 98   PHE D CZ    1 
ATOM   9175  N  N     . GLN D  1 71  ? 148.992 131.252 7.884   1.00 27.19 ? 99   GLN D N     1 
ATOM   9176  C  CA    . GLN D  1 71  ? 150.168 131.279 8.745   1.00 28.46 ? 99   GLN D CA    1 
ATOM   9177  C  C     . GLN D  1 71  ? 150.352 129.928 9.443   1.00 27.69 ? 99   GLN D C     1 
ATOM   9178  O  O     . GLN D  1 71  ? 151.474 129.459 9.601   1.00 26.24 ? 99   GLN D O     1 
ATOM   9179  C  CB    . GLN D  1 71  ? 150.057 132.449 9.753   1.00 29.16 ? 99   GLN D CB    1 
ATOM   9180  C  CG    . GLN D  1 71  ? 150.971 132.407 10.989  1.00 34.02 ? 99   GLN D CG    1 
ATOM   9181  C  CD    . GLN D  1 71  ? 150.284 131.821 12.255  1.00 39.61 ? 99   GLN D CD    1 
ATOM   9182  O  OE1   . GLN D  1 71  ? 149.307 132.393 12.806  1.00 42.70 ? 99   GLN D OE1   1 
ATOM   9183  N  NE2   . GLN D  1 71  ? 150.796 130.683 12.715  1.00 40.50 ? 99   GLN D NE2   1 
ATOM   9184  N  N     . GLN D  1 72  ? 149.241 129.293 9.819   1.00 27.24 ? 100  GLN D N     1 
ATOM   9185  C  CA    . GLN D  1 72  ? 149.284 127.991 10.460  1.00 28.26 ? 100  GLN D CA    1 
ATOM   9186  C  C     . GLN D  1 72  ? 149.547 126.813 9.501   1.00 28.68 ? 100  GLN D C     1 
ATOM   9187  O  O     . GLN D  1 72  ? 149.633 125.667 9.949   1.00 29.30 ? 100  GLN D O     1 
ATOM   9188  C  CB    . GLN D  1 72  ? 147.983 127.746 11.234  1.00 28.21 ? 100  GLN D CB    1 
ATOM   9189  C  CG    . GLN D  1 72  ? 147.864 128.593 12.495  1.00 29.21 ? 100  GLN D CG    1 
ATOM   9190  C  CD    . GLN D  1 72  ? 148.771 128.090 13.610  1.00 30.29 ? 100  GLN D CD    1 
ATOM   9191  O  OE1   . GLN D  1 72  ? 149.722 128.766 14.000  1.00 32.18 ? 100  GLN D OE1   1 
ATOM   9192  N  NE2   . GLN D  1 72  ? 148.507 126.883 14.091  1.00 29.87 ? 100  GLN D NE2   1 
ATOM   9193  N  N     . GLY D  1 73  ? 149.656 127.078 8.200   1.00 28.88 ? 101  GLY D N     1 
ATOM   9194  C  CA    . GLY D  1 73  ? 149.883 126.014 7.213   1.00 28.74 ? 101  GLY D CA    1 
ATOM   9195  C  C     . GLY D  1 73  ? 148.629 125.257 6.803   1.00 28.69 ? 101  GLY D C     1 
ATOM   9196  O  O     . GLY D  1 73  ? 148.727 124.190 6.198   1.00 29.40 ? 101  GLY D O     1 
ATOM   9197  N  N     . LEU D  1 74  ? 147.452 125.807 7.090   1.00 27.76 ? 102  LEU D N     1 
ATOM   9198  C  CA    . LEU D  1 74  ? 146.203 125.059 6.933   1.00 27.73 ? 102  LEU D CA    1 
ATOM   9199  C  C     . LEU D  1 74  ? 145.561 125.236 5.550   1.00 27.77 ? 102  LEU D C     1 
ATOM   9200  O  O     . LEU D  1 74  ? 144.522 124.627 5.252   1.00 27.30 ? 102  LEU D O     1 
ATOM   9201  C  CB    . LEU D  1 74  ? 145.217 125.433 8.046   1.00 27.90 ? 102  LEU D CB    1 
ATOM   9202  C  CG    . LEU D  1 74  ? 145.770 125.131 9.452   1.00 27.81 ? 102  LEU D CG    1 
ATOM   9203  C  CD1   . LEU D  1 74  ? 144.818 125.634 10.520  1.00 25.84 ? 102  LEU D CD1   1 
ATOM   9204  C  CD2   . LEU D  1 74  ? 146.069 123.620 9.606   1.00 26.21 ? 102  LEU D CD2   1 
ATOM   9205  N  N     . MET D  1 75  ? 146.203 126.041 4.711   1.00 27.36 ? 103  MET D N     1 
ATOM   9206  C  CA    . MET D  1 75  ? 145.764 126.261 3.340   1.00 28.16 ? 103  MET D CA    1 
ATOM   9207  C  C     . MET D  1 75  ? 146.574 125.455 2.296   1.00 28.70 ? 103  MET D C     1 
ATOM   9208  O  O     . MET D  1 75  ? 146.281 125.517 1.095   1.00 30.34 ? 103  MET D O     1 
ATOM   9209  C  CB    . MET D  1 75  ? 145.804 127.760 3.046   1.00 27.49 ? 103  MET D CB    1 
ATOM   9210  C  CG    . MET D  1 75  ? 144.861 128.541 3.962   1.00 26.68 ? 103  MET D CG    1 
ATOM   9211  S  SD    . MET D  1 75  ? 143.124 128.095 3.736   1.00 28.37 ? 103  MET D SD    1 
ATOM   9212  C  CE    . MET D  1 75  ? 142.654 129.325 2.523   1.00 26.14 ? 103  MET D CE    1 
ATOM   9213  N  N     . GLY D  1 76  ? 147.588 124.722 2.757   1.00 28.16 ? 104  GLY D N     1 
ATOM   9214  C  CA    . GLY D  1 76  ? 148.399 123.861 1.890   1.00 27.64 ? 104  GLY D CA    1 
ATOM   9215  C  C     . GLY D  1 76  ? 148.774 122.554 2.564   1.00 27.14 ? 104  GLY D C     1 
ATOM   9216  O  O     . GLY D  1 76  ? 149.903 122.098 2.434   1.00 26.65 ? 104  GLY D O     1 
ATOM   9217  N  N     . ILE D  1 77  ? 147.787 121.928 3.221   1.00 27.10 ? 105  ILE D N     1 
ATOM   9218  C  CA    . ILE D  1 77  ? 148.000 120.765 4.096   1.00 26.53 ? 105  ILE D CA    1 
ATOM   9219  C  C     . ILE D  1 77  ? 148.715 119.600 3.388   1.00 26.55 ? 105  ILE D C     1 
ATOM   9220  O  O     . ILE D  1 77  ? 149.677 119.056 3.931   1.00 26.12 ? 105  ILE D O     1 
ATOM   9221  C  CB    . ILE D  1 77  ? 146.660 120.270 4.764   1.00 26.52 ? 105  ILE D CB    1 
ATOM   9222  C  CG1   . ILE D  1 77  ? 146.050 121.365 5.646   1.00 25.23 ? 105  ILE D CG1   1 
ATOM   9223  C  CG2   . ILE D  1 77  ? 146.898 119.014 5.606   1.00 24.93 ? 105  ILE D CG2   1 
ATOM   9224  C  CD1   . ILE D  1 77  ? 144.541 121.186 5.953   1.00 26.04 ? 105  ILE D CD1   1 
ATOM   9225  N  N     . GLU D  1 78  ? 148.258 119.252 2.189   1.00 26.54 ? 106  GLU D N     1 
ATOM   9226  C  CA    . GLU D  1 78  ? 148.828 118.146 1.403   1.00 26.90 ? 106  GLU D CA    1 
ATOM   9227  C  C     . GLU D  1 78  ? 149.818 118.579 0.330   1.00 26.80 ? 106  GLU D C     1 
ATOM   9228  O  O     . GLU D  1 78  ? 150.414 117.737 -0.326  1.00 27.27 ? 106  GLU D O     1 
ATOM   9229  C  CB    . GLU D  1 78  ? 147.715 117.365 0.708   1.00 27.39 ? 106  GLU D CB    1 
ATOM   9230  C  CG    . GLU D  1 78  ? 146.645 116.889 1.651   1.00 28.69 ? 106  GLU D CG    1 
ATOM   9231  C  CD    . GLU D  1 78  ? 145.462 116.290 0.929   1.00 32.99 ? 106  GLU D CD    1 
ATOM   9232  O  OE1   . GLU D  1 78  ? 145.620 115.206 0.335   1.00 34.63 ? 106  GLU D OE1   1 
ATOM   9233  O  OE2   . GLU D  1 78  ? 144.372 116.906 0.984   1.00 37.02 ? 106  GLU D OE2   1 
ATOM   9234  N  N     . VAL D  1 79  ? 149.971 119.881 0.131   1.00 26.52 ? 107  VAL D N     1 
ATOM   9235  C  CA    . VAL D  1 79  ? 150.898 120.390 -0.863  1.00 26.20 ? 107  VAL D CA    1 
ATOM   9236  C  C     . VAL D  1 79  ? 152.324 120.075 -0.416  1.00 25.98 ? 107  VAL D C     1 
ATOM   9237  O  O     . VAL D  1 79  ? 152.638 120.126 0.769   1.00 25.92 ? 107  VAL D O     1 
ATOM   9238  C  CB    . VAL D  1 79  ? 150.676 121.892 -1.081  1.00 25.99 ? 107  VAL D CB    1 
ATOM   9239  C  CG1   . VAL D  1 79  ? 151.743 122.486 -2.007  1.00 25.11 ? 107  VAL D CG1   1 
ATOM   9240  C  CG2   . VAL D  1 79  ? 149.242 122.124 -1.612  1.00 27.59 ? 107  VAL D CG2   1 
ATOM   9241  N  N     . ASP D  1 80  ? 153.168 119.719 -1.372  1.00 26.44 ? 108  ASP D N     1 
ATOM   9242  C  CA    . ASP D  1 80  ? 154.560 119.389 -1.104  1.00 27.30 ? 108  ASP D CA    1 
ATOM   9243  C  C     . ASP D  1 80  ? 155.254 120.601 -0.485  1.00 27.04 ? 108  ASP D C     1 
ATOM   9244  O  O     . ASP D  1 80  ? 154.940 121.739 -0.842  1.00 26.12 ? 108  ASP D O     1 
ATOM   9245  C  CB    . ASP D  1 80  ? 155.273 118.959 -2.399  1.00 27.79 ? 108  ASP D CB    1 
ATOM   9246  C  CG    . ASP D  1 80  ? 156.609 118.274 -2.131  1.00 29.42 ? 108  ASP D CG    1 
ATOM   9247  O  OD1   . ASP D  1 80  ? 156.639 117.022 -2.129  1.00 33.40 ? 108  ASP D OD1   1 
ATOM   9248  O  OD2   . ASP D  1 80  ? 157.608 118.975 -1.881  1.00 29.40 ? 108  ASP D OD2   1 
ATOM   9249  N  N     . PRO D  1 81  ? 156.160 120.368 0.478   1.00 28.25 ? 109  PRO D N     1 
ATOM   9250  C  CA    . PRO D  1 81  ? 157.000 121.441 1.018   1.00 28.42 ? 109  PRO D CA    1 
ATOM   9251  C  C     . PRO D  1 81  ? 157.804 122.261 -0.007  1.00 28.81 ? 109  PRO D C     1 
ATOM   9252  O  O     . PRO D  1 81  ? 158.165 123.395 0.301   1.00 28.34 ? 109  PRO D O     1 
ATOM   9253  C  CB    . PRO D  1 81  ? 157.935 120.695 1.970   1.00 28.75 ? 109  PRO D CB    1 
ATOM   9254  C  CG    . PRO D  1 81  ? 157.130 119.546 2.433   1.00 28.66 ? 109  PRO D CG    1 
ATOM   9255  C  CD    . PRO D  1 81  ? 156.382 119.102 1.210   1.00 28.56 ? 109  PRO D CD    1 
ATOM   9256  N  N     . GLU D  1 82  ? 158.062 121.727 -1.199  1.00 29.43 ? 110  GLU D N     1 
ATOM   9257  C  CA    . GLU D  1 82  ? 158.764 122.512 -2.238  1.00 30.50 ? 110  GLU D CA    1 
ATOM   9258  C  C     . GLU D  1 82  ? 157.928 123.708 -2.713  1.00 30.22 ? 110  GLU D C     1 
ATOM   9259  O  O     . GLU D  1 82  ? 158.476 124.688 -3.205  1.00 30.15 ? 110  GLU D O     1 
ATOM   9260  C  CB    . GLU D  1 82  ? 159.183 121.643 -3.439  1.00 30.57 ? 110  GLU D CB    1 
ATOM   9261  C  CG    . GLU D  1 82  ? 158.045 121.193 -4.378  1.00 32.10 ? 110  GLU D CG    1 
ATOM   9262  C  CD    . GLU D  1 82  ? 158.543 120.363 -5.565  1.00 32.85 ? 110  GLU D CD    1 
ATOM   9263  O  OE1   . GLU D  1 82  ? 159.680 120.585 -6.020  1.00 38.02 ? 110  GLU D OE1   1 
ATOM   9264  O  OE2   . GLU D  1 82  ? 157.795 119.489 -6.048  1.00 36.88 ? 110  GLU D OE2   1 
ATOM   9265  N  N     . TYR D  1 83  ? 156.607 123.621 -2.565  1.00 29.87 ? 111  TYR D N     1 
ATOM   9266  C  CA    . TYR D  1 83  ? 155.722 124.725 -2.913  1.00 30.01 ? 111  TYR D CA    1 
ATOM   9267  C  C     . TYR D  1 83  ? 155.190 125.443 -1.671  1.00 30.10 ? 111  TYR D C     1 
ATOM   9268  O  O     . TYR D  1 83  ? 154.157 126.120 -1.742  1.00 31.16 ? 111  TYR D O     1 
ATOM   9269  C  CB    . TYR D  1 83  ? 154.527 124.214 -3.724  1.00 29.81 ? 111  TYR D CB    1 
ATOM   9270  C  CG    . TYR D  1 83  ? 154.859 123.376 -4.938  1.00 30.02 ? 111  TYR D CG    1 
ATOM   9271  C  CD1   . TYR D  1 83  ? 155.628 123.889 -5.984  1.00 30.73 ? 111  TYR D CD1   1 
ATOM   9272  C  CD2   . TYR D  1 83  ? 154.349 122.091 -5.066  1.00 29.28 ? 111  TYR D CD2   1 
ATOM   9273  C  CE1   . TYR D  1 83  ? 155.917 123.111 -7.120  1.00 30.72 ? 111  TYR D CE1   1 
ATOM   9274  C  CE2   . TYR D  1 83  ? 154.623 121.318 -6.179  1.00 30.34 ? 111  TYR D CE2   1 
ATOM   9275  C  CZ    . TYR D  1 83  ? 155.395 121.826 -7.200  1.00 29.39 ? 111  TYR D CZ    1 
ATOM   9276  O  OH    . TYR D  1 83  ? 155.655 121.032 -8.293  1.00 30.86 ? 111  TYR D OH    1 
ATOM   9277  N  N     . GLY D  1 84  ? 155.855 125.259 -0.537  1.00 30.21 ? 112  GLY D N     1 
ATOM   9278  C  CA    . GLY D  1 84  ? 155.441 125.860 0.727   1.00 30.22 ? 112  GLY D CA    1 
ATOM   9279  C  C     . GLY D  1 84  ? 154.353 125.119 1.488   1.00 30.25 ? 112  GLY D C     1 
ATOM   9280  O  O     . GLY D  1 84  ? 153.777 125.664 2.431   1.00 31.22 ? 112  GLY D O     1 
ATOM   9281  N  N     . GLY D  1 85  ? 154.045 123.891 1.089   1.00 29.53 ? 113  GLY D N     1 
ATOM   9282  C  CA    . GLY D  1 85  ? 152.994 123.132 1.743   1.00 28.63 ? 113  GLY D CA    1 
ATOM   9283  C  C     . GLY D  1 85  ? 153.479 122.313 2.925   1.00 28.35 ? 113  GLY D C     1 
ATOM   9284  O  O     . GLY D  1 85  ? 154.676 122.209 3.183   1.00 27.12 ? 113  GLY D O     1 
ATOM   9285  N  N     . THR D  1 86  ? 152.543 121.677 3.628   1.00 28.70 ? 114  THR D N     1 
ATOM   9286  C  CA    . THR D  1 86  ? 152.906 120.843 4.778   1.00 29.60 ? 114  THR D CA    1 
ATOM   9287  C  C     . THR D  1 86  ? 153.240 119.384 4.416   1.00 28.92 ? 114  THR D C     1 
ATOM   9288  O  O     . THR D  1 86  ? 153.902 118.693 5.188   1.00 28.91 ? 114  THR D O     1 
ATOM   9289  C  CB    . THR D  1 86  ? 151.813 120.918 5.858   1.00 30.38 ? 114  THR D CB    1 
ATOM   9290  O  OG1   . THR D  1 86  ? 151.589 122.299 6.182   1.00 33.50 ? 114  THR D OG1   1 
ATOM   9291  C  CG2   . THR D  1 86  ? 152.241 120.164 7.108   1.00 32.61 ? 114  THR D CG2   1 
ATOM   9292  N  N     . GLY D  1 87  ? 152.803 118.914 3.249   1.00 27.99 ? 115  GLY D N     1 
ATOM   9293  C  CA    . GLY D  1 87  ? 153.100 117.546 2.827   1.00 27.53 ? 115  GLY D CA    1 
ATOM   9294  C  C     . GLY D  1 87  ? 152.439 116.460 3.685   1.00 27.36 ? 115  GLY D C     1 
ATOM   9295  O  O     . GLY D  1 87  ? 152.934 115.336 3.743   1.00 27.40 ? 115  GLY D O     1 
ATOM   9296  N  N     . ALA D  1 88  ? 151.317 116.786 4.326   1.00 26.17 ? 116  ALA D N     1 
ATOM   9297  C  CA    . ALA D  1 88  ? 150.609 115.832 5.185   1.00 26.54 ? 116  ALA D CA    1 
ATOM   9298  C  C     . ALA D  1 88  ? 149.603 114.984 4.386   1.00 26.13 ? 116  ALA D C     1 
ATOM   9299  O  O     . ALA D  1 88  ? 149.390 115.201 3.199   1.00 25.78 ? 116  ALA D O     1 
ATOM   9300  C  CB    . ALA D  1 88  ? 149.911 116.561 6.361   1.00 25.54 ? 116  ALA D CB    1 
ATOM   9301  N  N     . SER D  1 89  ? 149.026 113.999 5.063   1.00 26.18 ? 117  SER D N     1 
ATOM   9302  C  CA    . SER D  1 89  ? 148.054 113.069 4.485   1.00 26.00 ? 117  SER D CA    1 
ATOM   9303  C  C     . SER D  1 89  ? 146.705 113.697 4.210   1.00 25.80 ? 117  SER D C     1 
ATOM   9304  O  O     . SER D  1 89  ? 146.385 114.780 4.706   1.00 25.79 ? 117  SER D O     1 
ATOM   9305  C  CB    . SER D  1 89  ? 147.861 111.882 5.440   1.00 25.93 ? 117  SER D CB    1 
ATOM   9306  O  OG    . SER D  1 89  ? 147.356 112.329 6.694   1.00 26.57 ? 117  SER D OG    1 
ATOM   9307  N  N     . PHE D  1 90  ? 145.896 113.005 3.418   1.00 25.22 ? 118  PHE D N     1 
ATOM   9308  C  CA    . PHE D  1 90  ? 144.551 113.454 3.170   1.00 25.69 ? 118  PHE D CA    1 
ATOM   9309  C  C     . PHE D  1 90  ? 143.710 113.393 4.457   1.00 25.51 ? 118  PHE D C     1 
ATOM   9310  O  O     . PHE D  1 90  ? 142.844 114.251 4.698   1.00 24.85 ? 118  PHE D O     1 
ATOM   9311  C  CB    . PHE D  1 90  ? 143.906 112.611 2.073   1.00 26.10 ? 118  PHE D CB    1 
ATOM   9312  C  CG    . PHE D  1 90  ? 142.495 112.959 1.830   1.00 28.08 ? 118  PHE D CG    1 
ATOM   9313  C  CD1   . PHE D  1 90  ? 142.174 114.159 1.217   1.00 28.34 ? 118  PHE D CD1   1 
ATOM   9314  C  CD2   . PHE D  1 90  ? 141.469 112.113 2.242   1.00 28.22 ? 118  PHE D CD2   1 
ATOM   9315  C  CE1   . PHE D  1 90  ? 140.871 114.507 1.015   1.00 30.47 ? 118  PHE D CE1   1 
ATOM   9316  C  CE2   . PHE D  1 90  ? 140.158 112.459 2.041   1.00 28.13 ? 118  PHE D CE2   1 
ATOM   9317  C  CZ    . PHE D  1 90  ? 139.850 113.652 1.417   1.00 28.08 ? 118  PHE D CZ    1 
ATOM   9318  N  N     . LEU D  1 91  ? 143.974 112.380 5.283   1.00 24.97 ? 119  LEU D N     1 
ATOM   9319  C  CA    . LEU D  1 91  ? 143.307 112.270 6.561   1.00 25.94 ? 119  LEU D CA    1 
ATOM   9320  C  C     . LEU D  1 91  ? 143.584 113.467 7.460   1.00 25.20 ? 119  LEU D C     1 
ATOM   9321  O  O     . LEU D  1 91  ? 142.692 113.911 8.178   1.00 25.10 ? 119  LEU D O     1 
ATOM   9322  C  CB    . LEU D  1 91  ? 143.665 110.960 7.275   1.00 25.38 ? 119  LEU D CB    1 
ATOM   9323  C  CG    . LEU D  1 91  ? 142.898 110.681 8.575   1.00 28.18 ? 119  LEU D CG    1 
ATOM   9324  C  CD1   . LEU D  1 91  ? 141.374 110.797 8.401   1.00 28.28 ? 119  LEU D CD1   1 
ATOM   9325  C  CD2   . LEU D  1 91  ? 143.304 109.308 9.122   1.00 27.75 ? 119  LEU D CD2   1 
ATOM   9326  N  N     . SER D  1 92  ? 144.799 114.006 7.400   1.00 25.47 ? 120  SER D N     1 
ATOM   9327  C  CA    . SER D  1 92  ? 145.092 115.268 8.095   1.00 25.64 ? 120  SER D CA    1 
ATOM   9328  C  C     . SER D  1 92  ? 144.164 116.399 7.669   1.00 25.53 ? 120  SER D C     1 
ATOM   9329  O  O     . SER D  1 92  ? 143.689 117.159 8.503   1.00 25.94 ? 120  SER D O     1 
ATOM   9330  C  CB    . SER D  1 92  ? 146.555 115.691 7.887   1.00 24.91 ? 120  SER D CB    1 
ATOM   9331  O  OG    . SER D  1 92  ? 147.434 114.802 8.537   1.00 27.66 ? 120  SER D OG    1 
ATOM   9332  N  N     . THR D  1 93  ? 143.909 116.521 6.372   1.00 26.06 ? 121  THR D N     1 
ATOM   9333  C  CA    . THR D  1 93  ? 142.997 117.543 5.854   1.00 26.11 ? 121  THR D CA    1 
ATOM   9334  C  C     . THR D  1 93  ? 141.580 117.349 6.409   1.00 26.18 ? 121  THR D C     1 
ATOM   9335  O  O     . THR D  1 93  ? 140.919 118.308 6.809   1.00 24.64 ? 121  THR D O     1 
ATOM   9336  C  CB    . THR D  1 93  ? 142.962 117.524 4.309   1.00 26.26 ? 121  THR D CB    1 
ATOM   9337  O  OG1   . THR D  1 93  ? 144.255 117.850 3.805   1.00 27.99 ? 121  THR D OG1   1 
ATOM   9338  C  CG2   . THR D  1 93  ? 141.942 118.501 3.754   1.00 28.42 ? 121  THR D CG2   1 
ATOM   9339  N  N     . VAL D  1 94  ? 141.136 116.093 6.430   1.00 25.58 ? 122  VAL D N     1 
ATOM   9340  C  CA    . VAL D  1 94  ? 139.845 115.727 6.990   1.00 25.52 ? 122  VAL D CA    1 
ATOM   9341  C  C     . VAL D  1 94  ? 139.773 116.149 8.470   1.00 24.85 ? 122  VAL D C     1 
ATOM   9342  O  O     . VAL D  1 94  ? 138.823 116.799 8.869   1.00 24.97 ? 122  VAL D O     1 
ATOM   9343  C  CB    . VAL D  1 94  ? 139.561 114.223 6.810   1.00 25.41 ? 122  VAL D CB    1 
ATOM   9344  C  CG1   . VAL D  1 94  ? 138.355 113.770 7.648   1.00 26.39 ? 122  VAL D CG1   1 
ATOM   9345  C  CG2   . VAL D  1 94  ? 139.379 113.887 5.313   1.00 25.24 ? 122  VAL D CG2   1 
ATOM   9346  N  N     . LEU D  1 95  ? 140.798 115.813 9.246   1.00 24.93 ? 123  LEU D N     1 
ATOM   9347  C  CA    . LEU D  1 95  ? 140.846 116.160 10.674  1.00 25.01 ? 123  LEU D CA    1 
ATOM   9348  C  C     . LEU D  1 95  ? 140.890 117.658 10.938  1.00 24.77 ? 123  LEU D C     1 
ATOM   9349  O  O     . LEU D  1 95  ? 140.294 118.136 11.900  1.00 25.06 ? 123  LEU D O     1 
ATOM   9350  C  CB    . LEU D  1 95  ? 142.014 115.456 11.371  1.00 25.33 ? 123  LEU D CB    1 
ATOM   9351  C  CG    . LEU D  1 95  ? 141.958 113.920 11.411  1.00 26.02 ? 123  LEU D CG    1 
ATOM   9352  C  CD1   . LEU D  1 95  ? 143.275 113.374 11.906  1.00 27.58 ? 123  LEU D CD1   1 
ATOM   9353  C  CD2   . LEU D  1 95  ? 140.768 113.369 12.240  1.00 26.47 ? 123  LEU D CD2   1 
ATOM   9354  N  N     . VAL D  1 96  ? 141.594 118.400 10.087  1.00 25.18 ? 124  VAL D N     1 
ATOM   9355  C  CA    . VAL D  1 96  ? 141.653 119.865 10.186  1.00 25.10 ? 124  VAL D CA    1 
ATOM   9356  C  C     . VAL D  1 96  ? 140.275 120.475 9.952   1.00 24.91 ? 124  VAL D C     1 
ATOM   9357  O  O     . VAL D  1 96  ? 139.837 121.340 10.703  1.00 24.77 ? 124  VAL D O     1 
ATOM   9358  C  CB    . VAL D  1 96  ? 142.669 120.482 9.162   1.00 24.88 ? 124  VAL D CB    1 
ATOM   9359  C  CG1   . VAL D  1 96  ? 142.541 122.017 9.125   1.00 24.73 ? 124  VAL D CG1   1 
ATOM   9360  C  CG2   . VAL D  1 96  ? 144.123 120.062 9.499   1.00 23.23 ? 124  VAL D CG2   1 
ATOM   9361  N  N     . ILE D  1 97  ? 139.598 120.016 8.915   1.00 25.48 ? 125  ILE D N     1 
ATOM   9362  C  CA    . ILE D  1 97  ? 138.262 120.511 8.576   1.00 25.72 ? 125  ILE D CA    1 
ATOM   9363  C  C     . ILE D  1 97  ? 137.280 120.223 9.721   1.00 25.77 ? 125  ILE D C     1 
ATOM   9364  O  O     . ILE D  1 97  ? 136.523 121.092 10.144  1.00 24.98 ? 125  ILE D O     1 
ATOM   9365  C  CB    . ILE D  1 97  ? 137.738 119.870 7.258   1.00 25.38 ? 125  ILE D CB    1 
ATOM   9366  C  CG1   . ILE D  1 97  ? 138.619 120.297 6.064   1.00 27.28 ? 125  ILE D CG1   1 
ATOM   9367  C  CG2   . ILE D  1 97  ? 136.275 120.277 6.987   1.00 25.48 ? 125  ILE D CG2   1 
ATOM   9368  C  CD1   . ILE D  1 97  ? 138.409 119.429 4.860   1.00 29.34 ? 125  ILE D CD1   1 
ATOM   9369  N  N     . GLU D  1 98  ? 137.315 118.995 10.210  1.00 25.95 ? 126  GLU D N     1 
ATOM   9370  C  CA    . GLU D  1 98  ? 136.484 118.596 11.352  1.00 26.33 ? 126  GLU D CA    1 
ATOM   9371  C  C     . GLU D  1 98  ? 136.728 119.476 12.550  1.00 26.16 ? 126  GLU D C     1 
ATOM   9372  O  O     . GLU D  1 98  ? 135.796 120.010 13.133  1.00 26.47 ? 126  GLU D O     1 
ATOM   9373  C  CB    . GLU D  1 98  ? 136.762 117.142 11.721  1.00 26.08 ? 126  GLU D CB    1 
ATOM   9374  C  CG    . GLU D  1 98  ? 135.888 116.605 12.828  1.00 26.32 ? 126  GLU D CG    1 
ATOM   9375  C  CD    . GLU D  1 98  ? 136.279 115.202 13.284  1.00 27.63 ? 126  GLU D CD    1 
ATOM   9376  O  OE1   . GLU D  1 98  ? 137.201 114.581 12.705  1.00 28.62 ? 126  GLU D OE1   1 
ATOM   9377  O  OE2   . GLU D  1 98  ? 135.625 114.712 14.223  1.00 29.45 ? 126  GLU D OE2   1 
ATOM   9378  N  N     . GLU D  1 99  ? 138.004 119.649 12.887  1.00 26.58 ? 127  GLU D N     1 
ATOM   9379  C  CA    . GLU D  1 99  ? 138.401 120.401 14.041  1.00 26.89 ? 127  GLU D CA    1 
ATOM   9380  C  C     . GLU D  1 99  ? 138.003 121.878 13.942  1.00 26.43 ? 127  GLU D C     1 
ATOM   9381  O  O     . GLU D  1 99  ? 137.475 122.450 14.908  1.00 25.37 ? 127  GLU D O     1 
ATOM   9382  C  CB    . GLU D  1 99  ? 139.912 120.213 14.235  1.00 27.00 ? 127  GLU D CB    1 
ATOM   9383  C  CG    . GLU D  1 99  ? 140.427 120.221 15.615  1.00 30.33 ? 127  GLU D CG    1 
ATOM   9384  C  CD    . GLU D  1 99  ? 139.617 119.446 16.641  1.00 30.76 ? 127  GLU D CD    1 
ATOM   9385  O  OE1   . GLU D  1 99  ? 139.319 118.238 16.461  1.00 33.90 ? 127  GLU D OE1   1 
ATOM   9386  O  OE2   . GLU D  1 99  ? 139.327 120.074 17.666  1.00 29.88 ? 127  GLU D OE2   1 
ATOM   9387  N  N     . LEU D  1 100 ? 138.200 122.482 12.766  1.00 25.76 ? 128  LEU D N     1 
ATOM   9388  C  CA    . LEU D  1 100 ? 137.739 123.855 12.533  1.00 25.60 ? 128  LEU D CA    1 
ATOM   9389  C  C     . LEU D  1 100 ? 136.223 123.952 12.640  1.00 25.02 ? 128  LEU D C     1 
ATOM   9390  O  O     . LEU D  1 100 ? 135.704 124.915 13.211  1.00 25.06 ? 128  LEU D O     1 
ATOM   9391  C  CB    . LEU D  1 100 ? 138.176 124.380 11.148  1.00 25.34 ? 128  LEU D CB    1 
ATOM   9392  C  CG    . LEU D  1 100 ? 139.662 124.678 10.916  1.00 25.59 ? 128  LEU D CG    1 
ATOM   9393  C  CD1   . LEU D  1 100 ? 139.967 124.912 9.403   1.00 24.47 ? 128  LEU D CD1   1 
ATOM   9394  C  CD2   . LEU D  1 100 ? 140.127 125.847 11.780  1.00 24.86 ? 128  LEU D CD2   1 
ATOM   9395  N  N     . ALA D  1 101 ? 135.518 122.966 12.086  1.00 24.47 ? 129  ALA D N     1 
ATOM   9396  C  CA    . ALA D  1 101 ? 134.050 122.985 12.068  1.00 24.78 ? 129  ALA D CA    1 
ATOM   9397  C  C     . ALA D  1 101 ? 133.446 122.855 13.470  1.00 24.19 ? 129  ALA D C     1 
ATOM   9398  O  O     . ALA D  1 101 ? 132.349 123.358 13.702  1.00 24.91 ? 129  ALA D O     1 
ATOM   9399  C  CB    . ALA D  1 101 ? 133.484 121.922 11.126  1.00 24.54 ? 129  ALA D CB    1 
ATOM   9400  N  N     . LYS D  1 102 ? 134.156 122.217 14.403  1.00 24.77 ? 130  LYS D N     1 
ATOM   9401  C  CA    . LYS D  1 102 ? 133.705 122.173 15.802  1.00 25.26 ? 130  LYS D CA    1 
ATOM   9402  C  C     . LYS D  1 102 ? 133.530 123.585 16.375  1.00 25.22 ? 130  LYS D C     1 
ATOM   9403  O  O     . LYS D  1 102 ? 132.721 123.789 17.288  1.00 25.33 ? 130  LYS D O     1 
ATOM   9404  C  CB    . LYS D  1 102 ? 134.664 121.368 16.694  1.00 25.11 ? 130  LYS D CB    1 
ATOM   9405  C  CG    . LYS D  1 102 ? 134.680 119.884 16.403  1.00 24.95 ? 130  LYS D CG    1 
ATOM   9406  C  CD    . LYS D  1 102 ? 135.672 119.163 17.312  1.00 25.72 ? 130  LYS D CD    1 
ATOM   9407  C  CE    . LYS D  1 102 ? 135.895 117.721 16.887  1.00 26.96 ? 130  LYS D CE    1 
ATOM   9408  N  NZ    . LYS D  1 102 ? 136.809 116.988 17.830  1.00 27.10 ? 130  LYS D NZ    1 
ATOM   9409  N  N     . VAL D  1 103 ? 134.285 124.545 15.847  1.00 25.91 ? 131  VAL D N     1 
ATOM   9410  C  CA    . VAL D  1 103 ? 134.216 125.941 16.304  1.00 26.17 ? 131  VAL D CA    1 
ATOM   9411  C  C     . VAL D  1 103 ? 133.386 126.780 15.327  1.00 26.60 ? 131  VAL D C     1 
ATOM   9412  O  O     . VAL D  1 103 ? 132.486 127.497 15.755  1.00 26.43 ? 131  VAL D O     1 
ATOM   9413  C  CB    . VAL D  1 103 ? 135.617 126.549 16.511  1.00 26.83 ? 131  VAL D CB    1 
ATOM   9414  C  CG1   . VAL D  1 103 ? 135.526 128.045 16.788  1.00 26.64 ? 131  VAL D CG1   1 
ATOM   9415  C  CG2   . VAL D  1 103 ? 136.336 125.829 17.685  1.00 27.28 ? 131  VAL D CG2   1 
ATOM   9416  N  N     . ASP D  1 104 ? 133.675 126.680 14.029  1.00 26.35 ? 132  ASP D N     1 
ATOM   9417  C  CA    . ASP D  1 104 ? 132.964 127.471 13.008  1.00 26.40 ? 132  ASP D CA    1 
ATOM   9418  C  C     . ASP D  1 104 ? 132.943 126.800 11.635  1.00 26.69 ? 132  ASP D C     1 
ATOM   9419  O  O     . ASP D  1 104 ? 133.947 126.802 10.910  1.00 26.94 ? 132  ASP D O     1 
ATOM   9420  C  CB    . ASP D  1 104 ? 133.559 128.873 12.872  1.00 26.87 ? 132  ASP D CB    1 
ATOM   9421  C  CG    . ASP D  1 104 ? 132.624 129.846 12.146  1.00 26.27 ? 132  ASP D CG    1 
ATOM   9422  O  OD1   . ASP D  1 104 ? 131.693 129.402 11.419  1.00 25.91 ? 132  ASP D OD1   1 
ATOM   9423  O  OD2   . ASP D  1 104 ? 132.823 131.065 12.313  1.00 28.08 ? 132  ASP D OD2   1 
ATOM   9424  N  N     . ALA D  1 105 ? 131.779 126.267 11.280  1.00 26.20 ? 133  ALA D N     1 
ATOM   9425  C  CA    . ALA D  1 105 ? 131.567 125.624 9.972   1.00 26.94 ? 133  ALA D CA    1 
ATOM   9426  C  C     . ALA D  1 105 ? 131.947 126.511 8.763   1.00 26.58 ? 133  ALA D C     1 
ATOM   9427  O  O     . ALA D  1 105 ? 132.364 125.982 7.735   1.00 26.49 ? 133  ALA D O     1 
ATOM   9428  C  CB    . ALA D  1 105 ? 130.122 125.138 9.835   1.00 27.22 ? 133  ALA D CB    1 
ATOM   9429  N  N     . SER D  1 106 ? 131.801 127.832 8.891   1.00 26.84 ? 134  SER D N     1 
ATOM   9430  C  CA    . SER D  1 106 ? 132.170 128.758 7.815   1.00 26.81 ? 134  SER D CA    1 
ATOM   9431  C  C     . SER D  1 106 ? 133.683 128.815 7.561   1.00 26.99 ? 134  SER D C     1 
ATOM   9432  O  O     . SER D  1 106 ? 134.122 128.856 6.411   1.00 27.10 ? 134  SER D O     1 
ATOM   9433  C  CB    . SER D  1 106 ? 131.676 130.166 8.104   1.00 27.22 ? 134  SER D CB    1 
ATOM   9434  O  OG    . SER D  1 106 ? 130.273 130.195 8.218   1.00 28.38 ? 134  SER D OG    1 
ATOM   9435  N  N     . VAL D  1 107 ? 134.463 128.838 8.634   1.00 26.62 ? 135  VAL D N     1 
ATOM   9436  C  CA    . VAL D  1 107 ? 135.910 128.780 8.521   1.00 27.40 ? 135  VAL D CA    1 
ATOM   9437  C  C     . VAL D  1 107 ? 136.355 127.442 7.938   1.00 27.91 ? 135  VAL D C     1 
ATOM   9438  O  O     . VAL D  1 107 ? 137.234 127.406 7.063   1.00 28.47 ? 135  VAL D O     1 
ATOM   9439  C  CB    . VAL D  1 107 ? 136.593 129.084 9.869   1.00 27.30 ? 135  VAL D CB    1 
ATOM   9440  C  CG1   . VAL D  1 107 ? 138.118 129.083 9.720   1.00 27.37 ? 135  VAL D CG1   1 
ATOM   9441  C  CG2   . VAL D  1 107 ? 136.104 130.422 10.398  1.00 26.24 ? 135  VAL D CG2   1 
ATOM   9442  N  N     . ALA D  1 108 ? 135.723 126.361 8.391   1.00 27.74 ? 136  ALA D N     1 
ATOM   9443  C  CA    . ALA D  1 108 ? 135.984 125.008 7.882   1.00 28.06 ? 136  ALA D CA    1 
ATOM   9444  C  C     . ALA D  1 108 ? 135.796 124.865 6.355   1.00 28.25 ? 136  ALA D C     1 
ATOM   9445  O  O     . ALA D  1 108 ? 136.629 124.245 5.693   1.00 27.10 ? 136  ALA D O     1 
ATOM   9446  C  CB    . ALA D  1 108 ? 135.109 123.971 8.639   1.00 27.43 ? 136  ALA D CB    1 
ATOM   9447  N  N     . VAL D  1 109 ? 134.709 125.421 5.797   1.00 28.88 ? 137  VAL D N     1 
ATOM   9448  C  CA    . VAL D  1 109 ? 134.481 125.318 4.358   1.00 29.62 ? 137  VAL D CA    1 
ATOM   9449  C  C     . VAL D  1 109 ? 135.506 126.152 3.581   1.00 30.28 ? 137  VAL D C     1 
ATOM   9450  O  O     . VAL D  1 109 ? 135.973 125.730 2.531   1.00 30.27 ? 137  VAL D O     1 
ATOM   9451  C  CB    . VAL D  1 109 ? 133.004 125.647 3.939   1.00 29.69 ? 137  VAL D CB    1 
ATOM   9452  C  CG1   . VAL D  1 109 ? 132.717 127.143 3.998   1.00 28.99 ? 137  VAL D CG1   1 
ATOM   9453  C  CG2   . VAL D  1 109 ? 132.697 125.075 2.550   1.00 29.26 ? 137  VAL D CG2   1 
ATOM   9454  N  N     . PHE D  1 110 ? 135.857 127.318 4.115   1.00 31.04 ? 138  PHE D N     1 
ATOM   9455  C  CA    . PHE D  1 110 ? 136.930 128.129 3.568   1.00 31.22 ? 138  PHE D CA    1 
ATOM   9456  C  C     . PHE D  1 110 ? 138.229 127.308 3.404   1.00 30.73 ? 138  PHE D C     1 
ATOM   9457  O  O     . PHE D  1 110 ? 138.895 127.359 2.370   1.00 29.87 ? 138  PHE D O     1 
ATOM   9458  C  CB    . PHE D  1 110 ? 137.139 129.342 4.469   1.00 32.48 ? 138  PHE D CB    1 
ATOM   9459  C  CG    . PHE D  1 110 ? 138.035 130.385 3.900   1.00 32.99 ? 138  PHE D CG    1 
ATOM   9460  C  CD1   . PHE D  1 110 ? 137.529 131.394 3.088   1.00 34.45 ? 138  PHE D CD1   1 
ATOM   9461  C  CD2   . PHE D  1 110 ? 139.390 130.397 4.209   1.00 36.43 ? 138  PHE D CD2   1 
ATOM   9462  C  CE1   . PHE D  1 110 ? 138.364 132.377 2.563   1.00 36.55 ? 138  PHE D CE1   1 
ATOM   9463  C  CE2   . PHE D  1 110 ? 140.228 131.386 3.699   1.00 35.39 ? 138  PHE D CE2   1 
ATOM   9464  C  CZ    . PHE D  1 110 ? 139.712 132.370 2.865   1.00 34.66 ? 138  PHE D CZ    1 
ATOM   9465  N  N     . CYS D  1 111 ? 138.553 126.515 4.418   1.00 30.60 ? 139  CYS D N     1 
ATOM   9466  C  CA    . CYS D  1 111 ? 139.702 125.620 4.387   1.00 29.93 ? 139  CYS D CA    1 
ATOM   9467  C  C     . CYS D  1 111 ? 139.490 124.414 3.450   1.00 29.29 ? 139  CYS D C     1 
ATOM   9468  O  O     . CYS D  1 111 ? 140.385 124.013 2.698   1.00 27.89 ? 139  CYS D O     1 
ATOM   9469  C  CB    . CYS D  1 111 ? 139.979 125.137 5.818   1.00 30.62 ? 139  CYS D CB    1 
ATOM   9470  S  SG    . CYS D  1 111 ? 141.351 124.037 5.985   1.00 32.73 ? 139  CYS D SG    1 
ATOM   9471  N  N     . GLU D  1 112 ? 138.303 123.837 3.497   1.00 28.38 ? 140  GLU D N     1 
ATOM   9472  C  CA    . GLU D  1 112 ? 137.978 122.679 2.659   1.00 28.78 ? 140  GLU D CA    1 
ATOM   9473  C  C     . GLU D  1 112 ? 138.059 122.981 1.152   1.00 27.94 ? 140  GLU D C     1 
ATOM   9474  O  O     . GLU D  1 112 ? 138.569 122.186 0.389   1.00 27.81 ? 140  GLU D O     1 
ATOM   9475  C  CB    . GLU D  1 112 ? 136.590 122.143 3.010   1.00 29.05 ? 140  GLU D CB    1 
ATOM   9476  C  CG    . GLU D  1 112 ? 136.187 120.915 2.209   1.00 31.24 ? 140  GLU D CG    1 
ATOM   9477  C  CD    . GLU D  1 112 ? 135.386 121.198 0.952   1.00 33.89 ? 140  GLU D CD    1 
ATOM   9478  O  OE1   . GLU D  1 112 ? 134.945 122.342 0.718   1.00 35.44 ? 140  GLU D OE1   1 
ATOM   9479  O  OE2   . GLU D  1 112 ? 135.190 120.243 0.188   1.00 36.87 ? 140  GLU D OE2   1 
ATOM   9480  N  N     . ILE D  1 113 ? 137.548 124.130 0.736   1.00 27.55 ? 141  ILE D N     1 
ATOM   9481  C  CA    . ILE D  1 113 ? 137.578 124.516 -0.668  1.00 27.17 ? 141  ILE D CA    1 
ATOM   9482  C  C     . ILE D  1 113 ? 139.032 124.644 -1.138  1.00 26.42 ? 141  ILE D C     1 
ATOM   9483  O  O     . ILE D  1 113 ? 139.418 124.036 -2.142  1.00 25.36 ? 141  ILE D O     1 
ATOM   9484  C  CB    . ILE D  1 113 ? 136.776 125.827 -0.928  1.00 27.15 ? 141  ILE D CB    1 
ATOM   9485  C  CG1   . ILE D  1 113 ? 135.278 125.613 -0.685  1.00 28.63 ? 141  ILE D CG1   1 
ATOM   9486  C  CG2   . ILE D  1 113 ? 137.023 126.353 -2.370  1.00 26.42 ? 141  ILE D CG2   1 
ATOM   9487  C  CD1   . ILE D  1 113 ? 134.505 126.940 -0.390  1.00 27.88 ? 141  ILE D CD1   1 
ATOM   9488  N  N     . GLN D  1 114 ? 139.846 125.384 -0.391  1.00 26.09 ? 142  GLN D N     1 
ATOM   9489  C  CA    . GLN D  1 114 ? 141.247 125.581 -0.758  1.00 26.34 ? 142  GLN D CA    1 
ATOM   9490  C  C     . GLN D  1 114 ? 142.011 124.265 -0.893  1.00 27.40 ? 142  GLN D C     1 
ATOM   9491  O  O     . GLN D  1 114 ? 142.670 124.021 -1.902  1.00 26.87 ? 142  GLN D O     1 
ATOM   9492  C  CB    . GLN D  1 114 ? 141.962 126.496 0.234   1.00 26.70 ? 142  GLN D CB    1 
ATOM   9493  C  CG    . GLN D  1 114 ? 143.361 126.956 -0.237  1.00 25.52 ? 142  GLN D CG    1 
ATOM   9494  C  CD    . GLN D  1 114 ? 143.328 128.248 -1.014  1.00 25.51 ? 142  GLN D CD    1 
ATOM   9495  O  OE1   . GLN D  1 114 ? 142.262 128.697 -1.456  1.00 27.45 ? 142  GLN D OE1   1 
ATOM   9496  N  NE2   . GLN D  1 114 ? 144.484 128.889 -1.139  1.00 24.91 ? 142  GLN D NE2   1 
ATOM   9497  N  N     . ASN D  1 115 ? 141.910 123.411 0.117   1.00 27.93 ? 143  ASN D N     1 
ATOM   9498  C  CA    . ASN D  1 115 ? 142.671 122.169 0.122   1.00 28.95 ? 143  ASN D CA    1 
ATOM   9499  C  C     . ASN D  1 115 ? 142.106 121.104 -0.810  1.00 30.31 ? 143  ASN D C     1 
ATOM   9500  O  O     . ASN D  1 115 ? 142.833 120.498 -1.605  1.00 30.66 ? 143  ASN D O     1 
ATOM   9501  C  CB    . ASN D  1 115 ? 142.732 121.606 1.544   1.00 28.74 ? 143  ASN D CB    1 
ATOM   9502  C  CG    . ASN D  1 115 ? 143.667 122.396 2.419   1.00 28.44 ? 143  ASN D CG    1 
ATOM   9503  O  OD1   . ASN D  1 115 ? 144.882 122.267 2.278   1.00 26.52 ? 143  ASN D OD1   1 
ATOM   9504  N  ND2   . ASN D  1 115 ? 143.116 123.260 3.287   1.00 24.48 ? 143  ASN D ND2   1 
ATOM   9505  N  N     . THR D  1 116 ? 140.813 120.876 -0.710  1.00 31.02 ? 144  THR D N     1 
ATOM   9506  C  CA    . THR D  1 116 ? 140.236 119.671 -1.298  1.00 32.09 ? 144  THR D CA    1 
ATOM   9507  C  C     . THR D  1 116 ? 139.769 119.894 -2.735  1.00 31.25 ? 144  THR D C     1 
ATOM   9508  O  O     . THR D  1 116 ? 139.676 118.941 -3.491  1.00 31.91 ? 144  THR D O     1 
ATOM   9509  C  CB    . THR D  1 116 ? 139.068 119.088 -0.434  1.00 32.60 ? 144  THR D CB    1 
ATOM   9510  O  OG1   . THR D  1 116 ? 137.874 119.840 -0.674  1.00 37.79 ? 144  THR D OG1   1 
ATOM   9511  C  CG2   . THR D  1 116 ? 139.386 119.134 1.048   1.00 32.46 ? 144  THR D CG2   1 
ATOM   9512  N  N     . LEU D  1 117 ? 139.464 121.136 -3.111  1.00 30.28 ? 145  LEU D N     1 
ATOM   9513  C  CA    . LEU D  1 117 ? 139.030 121.420 -4.467  1.00 29.79 ? 145  LEU D CA    1 
ATOM   9514  C  C     . LEU D  1 117 ? 140.183 122.078 -5.223  1.00 29.79 ? 145  LEU D C     1 
ATOM   9515  O  O     . LEU D  1 117 ? 140.743 121.457 -6.139  1.00 31.28 ? 145  LEU D O     1 
ATOM   9516  C  CB    . LEU D  1 117 ? 137.742 122.270 -4.499  1.00 29.38 ? 145  LEU D CB    1 
ATOM   9517  C  CG    . LEU D  1 117 ? 136.467 121.653 -3.872  1.00 29.00 ? 145  LEU D CG    1 
ATOM   9518  C  CD1   . LEU D  1 117 ? 135.264 122.563 -3.964  1.00 28.15 ? 145  LEU D CD1   1 
ATOM   9519  C  CD2   . LEU D  1 117 ? 136.109 120.312 -4.496  1.00 25.15 ? 145  LEU D CD2   1 
ATOM   9520  N  N     . ILE D  1 118 ? 140.595 123.268 -4.786  1.00 28.90 ? 146  ILE D N     1 
ATOM   9521  C  CA    . ILE D  1 118 ? 141.576 124.104 -5.539  1.00 28.36 ? 146  ILE D CA    1 
ATOM   9522  C  C     . ILE D  1 118 ? 142.963 123.467 -5.609  1.00 28.73 ? 146  ILE D C     1 
ATOM   9523  O  O     . ILE D  1 118 ? 143.478 123.208 -6.711  1.00 27.72 ? 146  ILE D O     1 
ATOM   9524  C  CB    . ILE D  1 118 ? 141.697 125.559 -4.973  1.00 27.67 ? 146  ILE D CB    1 
ATOM   9525  C  CG1   . ILE D  1 118 ? 140.329 126.260 -4.909  1.00 26.51 ? 146  ILE D CG1   1 
ATOM   9526  C  CG2   . ILE D  1 118 ? 142.711 126.404 -5.792  1.00 28.18 ? 146  ILE D CG2   1 
ATOM   9527  C  CD1   . ILE D  1 118 ? 139.609 126.369 -6.219  1.00 25.50 ? 146  ILE D CD1   1 
ATOM   9528  N  N     . ASN D  1 119 ? 143.571 123.208 -4.448  1.00 29.15 ? 147  ASN D N     1 
ATOM   9529  C  CA    . ASN D  1 119 ? 144.929 122.656 -4.417  1.00 29.42 ? 147  ASN D CA    1 
ATOM   9530  C  C     . ASN D  1 119 ? 145.008 121.289 -5.073  1.00 29.22 ? 147  ASN D C     1 
ATOM   9531  O  O     . ASN D  1 119 ? 145.959 120.999 -5.789  1.00 29.00 ? 147  ASN D O     1 
ATOM   9532  C  CB    . ASN D  1 119 ? 145.470 122.537 -2.984  1.00 30.10 ? 147  ASN D CB    1 
ATOM   9533  C  CG    . ASN D  1 119 ? 145.767 123.868 -2.347  1.00 30.12 ? 147  ASN D CG    1 
ATOM   9534  O  OD1   . ASN D  1 119 ? 145.698 124.928 -2.981  1.00 31.93 ? 147  ASN D OD1   1 
ATOM   9535  N  ND2   . ASN D  1 119 ? 146.098 123.824 -1.066  1.00 32.37 ? 147  ASN D ND2   1 
ATOM   9536  N  N     . THR D  1 120 ? 144.010 120.451 -4.817  1.00 29.33 ? 148  THR D N     1 
ATOM   9537  C  CA    . THR D  1 120 ? 143.957 119.111 -5.399  1.00 29.80 ? 148  THR D CA    1 
ATOM   9538  C  C     . THR D  1 120 ? 143.823 119.150 -6.922  1.00 28.69 ? 148  THR D C     1 
ATOM   9539  O  O     . THR D  1 120 ? 144.523 118.420 -7.615  1.00 28.46 ? 148  THR D O     1 
ATOM   9540  C  CB    . THR D  1 120 ? 142.815 118.297 -4.785  1.00 30.19 ? 148  THR D CB    1 
ATOM   9541  O  OG1   . THR D  1 120 ? 143.100 118.088 -3.402  1.00 31.91 ? 148  THR D OG1   1 
ATOM   9542  C  CG2   . THR D  1 120 ? 142.664 116.960 -5.460  1.00 32.72 ? 148  THR D CG2   1 
ATOM   9543  N  N     . LEU D  1 121 ? 142.925 119.988 -7.435  1.00 27.85 ? 149  LEU D N     1 
ATOM   9544  C  CA    . LEU D  1 121 ? 142.800 120.165 -8.892  1.00 27.55 ? 149  LEU D CA    1 
ATOM   9545  C  C     . LEU D  1 121 ? 144.149 120.508 -9.541  1.00 25.83 ? 149  LEU D C     1 
ATOM   9546  O  O     . LEU D  1 121 ? 144.529 119.920 -10.546 1.00 25.62 ? 149  LEU D O     1 
ATOM   9547  C  CB    . LEU D  1 121 ? 141.751 121.230 -9.243  1.00 27.77 ? 149  LEU D CB    1 
ATOM   9548  C  CG    . LEU D  1 121 ? 140.299 120.732 -9.232  1.00 29.48 ? 149  LEU D CG    1 
ATOM   9549  C  CD1   . LEU D  1 121 ? 139.302 121.899 -9.138  1.00 30.23 ? 149  LEU D CD1   1 
ATOM   9550  C  CD2   . LEU D  1 121 ? 140.023 119.894 -10.459 1.00 30.29 ? 149  LEU D CD2   1 
ATOM   9551  N  N     . ILE D  1 122 ? 144.869 121.451 -8.959  1.00 26.11 ? 150  ILE D N     1 
ATOM   9552  C  CA    . ILE D  1 122 ? 146.163 121.885 -9.501  1.00 26.28 ? 150  ILE D CA    1 
ATOM   9553  C  C     . ILE D  1 122 ? 147.265 120.828 -9.294  1.00 26.20 ? 150  ILE D C     1 
ATOM   9554  O  O     . ILE D  1 122 ? 148.029 120.558 -10.220 1.00 24.90 ? 150  ILE D O     1 
ATOM   9555  C  CB    . ILE D  1 122 ? 146.575 123.294 -8.936  1.00 26.60 ? 150  ILE D CB    1 
ATOM   9556  C  CG1   . ILE D  1 122 ? 145.563 124.352 -9.430  1.00 28.31 ? 150  ILE D CG1   1 
ATOM   9557  C  CG2   . ILE D  1 122 ? 147.997 123.659 -9.366  1.00 25.74 ? 150  ILE D CG2   1 
ATOM   9558  C  CD1   . ILE D  1 122 ? 145.614 125.677 -8.713  1.00 27.24 ? 150  ILE D CD1   1 
ATOM   9559  N  N     . ARG D  1 123 ? 147.331 120.226 -8.099  1.00 26.73 ? 151  ARG D N     1 
ATOM   9560  C  CA    . ARG D  1 123 ? 148.274 119.117 -7.816  1.00 27.93 ? 151  ARG D CA    1 
ATOM   9561  C  C     . ARG D  1 123 ? 148.088 117.947 -8.764  1.00 27.35 ? 151  ARG D C     1 
ATOM   9562  O  O     . ARG D  1 123 ? 149.058 117.370 -9.217  1.00 27.30 ? 151  ARG D O     1 
ATOM   9563  C  CB    . ARG D  1 123 ? 148.125 118.558 -6.385  1.00 27.77 ? 151  ARG D CB    1 
ATOM   9564  C  CG    A ARG D  1 123 ? 148.559 119.474 -5.266  0.50 28.35 ? 151  ARG D CG    1 
ATOM   9565  C  CG    B ARG D  1 123 ? 148.738 119.409 -5.293  0.50 28.91 ? 151  ARG D CG    1 
ATOM   9566  C  CD    A ARG D  1 123 ? 148.242 118.854 -3.888  0.50 28.40 ? 151  ARG D CD    1 
ATOM   9567  C  CD    B ARG D  1 123 ? 148.869 118.569 -4.018  0.50 29.29 ? 151  ARG D CD    1 
ATOM   9568  N  NE    A ARG D  1 123 ? 149.333 117.972 -3.473  0.50 28.00 ? 151  ARG D NE    1 
ATOM   9569  N  NE    B ARG D  1 123 ? 147.559 118.060 -3.654  0.50 30.50 ? 151  ARG D NE    1 
ATOM   9570  C  CZ    A ARG D  1 123 ? 149.321 116.641 -3.467  0.50 29.44 ? 151  ARG D CZ    1 
ATOM   9571  C  CZ    B ARG D  1 123 ? 147.302 116.885 -3.088  0.50 30.09 ? 151  ARG D CZ    1 
ATOM   9572  N  NH1   A ARG D  1 123 ? 148.239 115.944 -3.810  0.50 30.46 ? 151  ARG D NH1   1 
ATOM   9573  N  NH1   B ARG D  1 123 ? 146.045 116.573 -2.838  0.50 30.25 ? 151  ARG D NH1   1 
ATOM   9574  N  NH2   A ARG D  1 123 ? 150.421 115.994 -3.083  0.50 29.35 ? 151  ARG D NH2   1 
ATOM   9575  N  NH2   B ARG D  1 123 ? 148.271 116.019 -2.788  0.50 30.98 ? 151  ARG D NH2   1 
ATOM   9576  N  N     . LYS D  1 124 ? 146.845 117.596 -9.055  1.00 28.13 ? 152  LYS D N     1 
ATOM   9577  C  CA    . LYS D  1 124 ? 146.539 116.452 -9.934  1.00 28.59 ? 152  LYS D CA    1 
ATOM   9578  C  C     . LYS D  1 124 ? 146.633 116.703 -11.434 1.00 27.45 ? 152  LYS D C     1 
ATOM   9579  O  O     . LYS D  1 124 ? 147.047 115.815 -12.174 1.00 27.25 ? 152  LYS D O     1 
ATOM   9580  C  CB    . LYS D  1 124 ? 145.145 115.911 -9.635  1.00 29.40 ? 152  LYS D CB    1 
ATOM   9581  C  CG    . LYS D  1 124 ? 145.114 115.052 -8.387  1.00 33.94 ? 152  LYS D CG    1 
ATOM   9582  C  CD    . LYS D  1 124 ? 143.748 115.049 -7.740  1.00 39.23 ? 152  LYS D CD    1 
ATOM   9583  C  CE    . LYS D  1 124 ? 142.818 113.972 -8.271  1.00 43.60 ? 152  LYS D CE    1 
ATOM   9584  N  NZ    . LYS D  1 124 ? 141.454 114.076 -7.613  1.00 46.01 ? 152  LYS D NZ    1 
ATOM   9585  N  N     . HIS D  1 125 ? 146.246 117.895 -11.882 1.00 26.37 ? 153  HIS D N     1 
ATOM   9586  C  CA    . HIS D  1 125 ? 146.041 118.140 -13.313 1.00 25.88 ? 153  HIS D CA    1 
ATOM   9587  C  C     . HIS D  1 125 ? 146.862 119.275 -13.906 1.00 25.01 ? 153  HIS D C     1 
ATOM   9588  O  O     . HIS D  1 125 ? 146.834 119.492 -15.111 1.00 25.44 ? 153  HIS D O     1 
ATOM   9589  C  CB    . HIS D  1 125 ? 144.560 118.385 -13.586 1.00 25.94 ? 153  HIS D CB    1 
ATOM   9590  C  CG    . HIS D  1 125 ? 143.664 117.373 -12.948 1.00 26.69 ? 153  HIS D CG    1 
ATOM   9591  N  ND1   . HIS D  1 125 ? 143.688 116.038 -13.286 1.00 26.92 ? 153  HIS D ND1   1 
ATOM   9592  C  CD2   . HIS D  1 125 ? 142.714 117.503 -11.993 1.00 27.60 ? 153  HIS D CD2   1 
ATOM   9593  C  CE1   . HIS D  1 125 ? 142.804 115.386 -12.554 1.00 28.42 ? 153  HIS D CE1   1 
ATOM   9594  N  NE2   . HIS D  1 125 ? 142.186 116.257 -11.775 1.00 27.21 ? 153  HIS D NE2   1 
ATOM   9595  N  N     . GLY D  1 126 ? 147.623 119.962 -13.069 1.00 24.52 ? 154  GLY D N     1 
ATOM   9596  C  CA    . GLY D  1 126 ? 148.471 121.042 -13.509 1.00 23.55 ? 154  GLY D CA    1 
ATOM   9597  C  C     . GLY D  1 126 ? 149.762 120.589 -14.156 1.00 22.72 ? 154  GLY D C     1 
ATOM   9598  O  O     . GLY D  1 126 ? 150.333 119.554 -13.808 1.00 22.39 ? 154  GLY D O     1 
ATOM   9599  N  N     . THR D  1 127 ? 150.263 121.422 -15.058 1.00 21.69 ? 155  THR D N     1 
ATOM   9600  C  CA    . THR D  1 127 ? 151.604 121.251 -15.606 1.00 21.59 ? 155  THR D CA    1 
ATOM   9601  C  C     . THR D  1 127 ? 152.581 121.543 -14.486 1.00 21.85 ? 155  THR D C     1 
ATOM   9602  O  O     . THR D  1 127 ? 152.188 122.091 -13.450 1.00 21.67 ? 155  THR D O     1 
ATOM   9603  C  CB    . THR D  1 127 ? 151.872 122.185 -16.810 1.00 21.42 ? 155  THR D CB    1 
ATOM   9604  O  OG1   . THR D  1 127 ? 151.924 123.551 -16.373 1.00 19.99 ? 155  THR D OG1   1 
ATOM   9605  C  CG2   . THR D  1 127 ? 150.802 122.024 -17.867 1.00 19.60 ? 155  THR D CG2   1 
ATOM   9606  N  N     . GLU D  1 128 ? 153.839 121.183 -14.681 1.00 22.63 ? 156  GLU D N     1 
ATOM   9607  C  CA    . GLU D  1 128 ? 154.872 121.509 -13.696 1.00 23.27 ? 156  GLU D CA    1 
ATOM   9608  C  C     . GLU D  1 128 ? 155.009 123.035 -13.526 1.00 23.31 ? 156  GLU D C     1 
ATOM   9609  O  O     . GLU D  1 128 ? 155.170 123.519 -12.416 1.00 22.73 ? 156  GLU D O     1 
ATOM   9610  C  CB    . GLU D  1 128 ? 156.214 120.877 -14.064 1.00 23.66 ? 156  GLU D CB    1 
ATOM   9611  C  CG    . GLU D  1 128 ? 156.196 119.340 -14.101 1.00 25.68 ? 156  GLU D CG    1 
ATOM   9612  C  CD    . GLU D  1 128 ? 155.756 118.738 -12.778 1.00 26.73 ? 156  GLU D CD    1 
ATOM   9613  O  OE1   . GLU D  1 128 ? 156.441 118.958 -11.775 1.00 30.45 ? 156  GLU D OE1   1 
ATOM   9614  O  OE2   . GLU D  1 128 ? 154.716 118.074 -12.732 1.00 28.80 ? 156  GLU D OE2   1 
ATOM   9615  N  N     . GLU D  1 129 ? 154.911 123.790 -14.613 1.00 23.92 ? 157  GLU D N     1 
ATOM   9616  C  CA    . GLU D  1 129 ? 154.898 125.263 -14.513 1.00 24.56 ? 157  GLU D CA    1 
ATOM   9617  C  C     . GLU D  1 129 ? 153.711 125.793 -13.713 1.00 23.02 ? 157  GLU D C     1 
ATOM   9618  O  O     . GLU D  1 129 ? 153.875 126.671 -12.865 1.00 22.92 ? 157  GLU D O     1 
ATOM   9619  C  CB    . GLU D  1 129 ? 154.922 125.930 -15.902 1.00 24.87 ? 157  GLU D CB    1 
ATOM   9620  C  CG    . GLU D  1 129 ? 156.290 125.983 -16.496 1.00 27.67 ? 157  GLU D CG    1 
ATOM   9621  C  CD    . GLU D  1 129 ? 156.304 126.450 -17.954 1.00 28.05 ? 157  GLU D CD    1 
ATOM   9622  O  OE1   . GLU D  1 129 ? 155.267 126.975 -18.430 1.00 29.60 ? 157  GLU D OE1   1 
ATOM   9623  O  OE2   . GLU D  1 129 ? 157.373 126.274 -18.603 1.00 35.27 ? 157  GLU D OE2   1 
ATOM   9624  N  N     . GLN D  1 130 ? 152.523 125.262 -13.959 1.00 23.07 ? 158  GLN D N     1 
ATOM   9625  C  CA    . GLN D  1 130 ? 151.353 125.698 -13.226 1.00 23.35 ? 158  GLN D CA    1 
ATOM   9626  C  C     . GLN D  1 130 ? 151.465 125.407 -11.733 1.00 23.08 ? 158  GLN D C     1 
ATOM   9627  O  O     . GLN D  1 130 ? 151.121 126.249 -10.910 1.00 22.55 ? 158  GLN D O     1 
ATOM   9628  C  CB    . GLN D  1 130 ? 150.066 125.084 -13.798 1.00 23.52 ? 158  GLN D CB    1 
ATOM   9629  C  CG    . GLN D  1 130 ? 149.654 125.720 -15.141 1.00 23.80 ? 158  GLN D CG    1 
ATOM   9630  C  CD    . GLN D  1 130 ? 148.500 124.996 -15.820 1.00 24.58 ? 158  GLN D CD    1 
ATOM   9631  O  OE1   . GLN D  1 130 ? 148.285 123.795 -15.605 1.00 25.77 ? 158  GLN D OE1   1 
ATOM   9632  N  NE2   . GLN D  1 130 ? 147.758 125.717 -16.652 1.00 25.41 ? 158  GLN D NE2   1 
ATOM   9633  N  N     . LYS D  1 131 ? 151.942 124.220 -11.378 1.00 23.12 ? 159  LYS D N     1 
ATOM   9634  C  CA    . LYS D  1 131 ? 152.154 123.891 -9.975  1.00 23.60 ? 159  LYS D CA    1 
ATOM   9635  C  C     . LYS D  1 131 ? 153.157 124.870 -9.313  1.00 23.71 ? 159  LYS D C     1 
ATOM   9636  O  O     . LYS D  1 131 ? 152.895 125.375 -8.220  1.00 23.21 ? 159  LYS D O     1 
ATOM   9637  C  CB    . LYS D  1 131 ? 152.645 122.463 -9.827  1.00 23.25 ? 159  LYS D CB    1 
ATOM   9638  C  CG    A LYS D  1 131 ? 151.694 121.348 -10.188 0.50 24.09 ? 159  LYS D CG    1 
ATOM   9639  C  CG    B LYS D  1 131 ? 151.556 121.435 -10.121 0.50 24.03 ? 159  LYS D CG    1 
ATOM   9640  C  CD    A LYS D  1 131 ? 152.511 120.051 -10.218 0.50 25.67 ? 159  LYS D CD    1 
ATOM   9641  C  CD    B LYS D  1 131 ? 151.992 120.016 -9.774  0.50 25.19 ? 159  LYS D CD    1 
ATOM   9642  C  CE    A LYS D  1 131 ? 151.713 118.833 -10.603 0.50 26.81 ? 159  LYS D CE    1 
ATOM   9643  C  CE    B LYS D  1 131 ? 152.214 119.149 -10.999 0.50 27.97 ? 159  LYS D CE    1 
ATOM   9644  N  NZ    A LYS D  1 131 ? 152.655 117.689 -10.862 0.50 25.98 ? 159  LYS D NZ    1 
ATOM   9645  N  NZ    B LYS D  1 131 ? 150.930 118.436 -11.335 0.50 29.85 ? 159  LYS D NZ    1 
ATOM   9646  N  N     . ALA D  1 132 ? 154.270 125.143 -9.991  1.00 23.97 ? 160  ALA D N     1 
ATOM   9647  C  CA    . ALA D  1 132 ? 155.331 126.014 -9.459  1.00 24.34 ? 160  ALA D CA    1 
ATOM   9648  C  C     . ALA D  1 132 ? 154.862 127.462 -9.277  1.00 24.84 ? 160  ALA D C     1 
ATOM   9649  O  O     . ALA D  1 132 ? 155.297 128.156 -8.366  1.00 24.53 ? 160  ALA D O     1 
ATOM   9650  C  CB    . ALA D  1 132 ? 156.584 125.973 -10.356 1.00 23.90 ? 160  ALA D CB    1 
ATOM   9651  N  N     . THR D  1 133 ? 153.982 127.891 -10.169 1.00 25.64 ? 161  THR D N     1 
ATOM   9652  C  CA    . THR D  1 133 ? 153.464 129.236 -10.203 1.00 26.85 ? 161  THR D CA    1 
ATOM   9653  C  C     . THR D  1 133 ? 152.336 129.430 -9.192  1.00 26.43 ? 161  THR D C     1 
ATOM   9654  O  O     . THR D  1 133 ? 152.369 130.364 -8.403  1.00 27.10 ? 161  THR D O     1 
ATOM   9655  C  CB    . THR D  1 133 ? 152.990 129.558 -11.642 1.00 27.37 ? 161  THR D CB    1 
ATOM   9656  O  OG1   . THR D  1 133 ? 154.110 129.405 -12.538 1.00 29.27 ? 161  THR D OG1   1 
ATOM   9657  C  CG2   . THR D  1 133 ? 152.447 130.964 -11.709 1.00 29.60 ? 161  THR D CG2   1 
ATOM   9658  N  N     . TYR D  1 134 ? 151.369 128.518 -9.178  1.00 25.80 ? 162  TYR D N     1 
ATOM   9659  C  CA    . TYR D  1 134 ? 150.174 128.671 -8.354  1.00 25.92 ? 162  TYR D CA    1 
ATOM   9660  C  C     . TYR D  1 134 ? 150.230 128.132 -6.926  1.00 25.16 ? 162  TYR D C     1 
ATOM   9661  O  O     . TYR D  1 134 ? 149.726 128.779 -6.009  1.00 24.43 ? 162  TYR D O     1 
ATOM   9662  C  CB    . TYR D  1 134 ? 148.969 128.038 -9.050  1.00 26.06 ? 162  TYR D CB    1 
ATOM   9663  C  CG    . TYR D  1 134 ? 148.555 128.759 -10.312 1.00 26.80 ? 162  TYR D CG    1 
ATOM   9664  C  CD1   . TYR D  1 134 ? 147.622 129.780 -10.274 1.00 28.82 ? 162  TYR D CD1   1 
ATOM   9665  C  CD2   . TYR D  1 134 ? 149.095 128.418 -11.541 1.00 28.14 ? 162  TYR D CD2   1 
ATOM   9666  C  CE1   . TYR D  1 134 ? 147.237 130.441 -11.437 1.00 29.08 ? 162  TYR D CE1   1 
ATOM   9667  C  CE2   . TYR D  1 134 ? 148.722 129.076 -12.701 1.00 28.48 ? 162  TYR D CE2   1 
ATOM   9668  C  CZ    . TYR D  1 134 ? 147.790 130.086 -12.646 1.00 26.93 ? 162  TYR D CZ    1 
ATOM   9669  O  OH    . TYR D  1 134 ? 147.397 130.722 -13.810 1.00 28.20 ? 162  TYR D OH    1 
ATOM   9670  N  N     . LEU D  1 135 ? 150.803 126.949 -6.734  1.00 24.55 ? 163  LEU D N     1 
ATOM   9671  C  CA    . LEU D  1 135 ? 150.815 126.336 -5.408  1.00 24.09 ? 163  LEU D CA    1 
ATOM   9672  C  C     . LEU D  1 135 ? 151.529 127.147 -4.297  1.00 24.41 ? 163  LEU D C     1 
ATOM   9673  O  O     . LEU D  1 135 ? 150.969 127.271 -3.207  1.00 24.99 ? 163  LEU D O     1 
ATOM   9674  C  CB    . LEU D  1 135 ? 151.314 124.887 -5.470  1.00 23.63 ? 163  LEU D CB    1 
ATOM   9675  C  CG    . LEU D  1 135 ? 150.402 123.914 -6.224  1.00 23.19 ? 163  LEU D CG    1 
ATOM   9676  C  CD1   . LEU D  1 135 ? 151.040 122.517 -6.351  1.00 23.15 ? 163  LEU D CD1   1 
ATOM   9677  C  CD2   . LEU D  1 135 ? 148.982 123.825 -5.588  1.00 21.54 ? 163  LEU D CD2   1 
ATOM   9678  N  N     . PRO D  1 136 ? 152.724 127.713 -4.555  1.00 25.11 ? 164  PRO D N     1 
ATOM   9679  C  CA    . PRO D  1 136 ? 153.308 128.599 -3.515  1.00 25.46 ? 164  PRO D CA    1 
ATOM   9680  C  C     . PRO D  1 136 ? 152.403 129.763 -3.092  1.00 25.68 ? 164  PRO D C     1 
ATOM   9681  O  O     . PRO D  1 136 ? 152.349 130.078 -1.908  1.00 26.28 ? 164  PRO D O     1 
ATOM   9682  C  CB    . PRO D  1 136 ? 154.594 129.101 -4.161  1.00 25.32 ? 164  PRO D CB    1 
ATOM   9683  C  CG    . PRO D  1 136 ? 154.958 128.014 -5.139  1.00 25.01 ? 164  PRO D CG    1 
ATOM   9684  C  CD    . PRO D  1 136 ? 153.630 127.591 -5.712  1.00 24.79 ? 164  PRO D CD    1 
ATOM   9685  N  N     . GLN D  1 137 ? 151.660 130.345 -4.035  1.00 25.18 ? 165  GLN D N     1 
ATOM   9686  C  CA    . GLN D  1 137 ? 150.698 131.395 -3.706  1.00 25.48 ? 165  GLN D CA    1 
ATOM   9687  C  C     . GLN D  1 137 ? 149.501 130.852 -2.924  1.00 25.18 ? 165  GLN D C     1 
ATOM   9688  O  O     . GLN D  1 137 ? 149.078 131.456 -1.952  1.00 24.39 ? 165  GLN D O     1 
ATOM   9689  C  CB    . GLN D  1 137 ? 150.221 132.107 -4.967  1.00 25.20 ? 165  GLN D CB    1 
ATOM   9690  C  CG    . GLN D  1 137 ? 151.351 132.795 -5.733  1.00 26.19 ? 165  GLN D CG    1 
ATOM   9691  C  CD    . GLN D  1 137 ? 150.845 133.713 -6.839  1.00 26.75 ? 165  GLN D CD    1 
ATOM   9692  O  OE1   . GLN D  1 137 ? 150.138 134.694 -6.577  1.00 28.04 ? 165  GLN D OE1   1 
ATOM   9693  N  NE2   . GLN D  1 137 ? 151.234 133.418 -8.071  1.00 26.85 ? 165  GLN D NE2   1 
ATOM   9694  N  N     . LEU D  1 138 ? 148.966 129.711 -3.352  1.00 25.55 ? 166  LEU D N     1 
ATOM   9695  C  CA    . LEU D  1 138 ? 147.810 129.097 -2.687  1.00 25.65 ? 166  LEU D CA    1 
ATOM   9696  C  C     . LEU D  1 138 ? 148.097 128.603 -1.255  1.00 26.09 ? 166  LEU D C     1 
ATOM   9697  O  O     . LEU D  1 138 ? 147.180 128.503 -0.425  1.00 25.88 ? 166  LEU D O     1 
ATOM   9698  C  CB    . LEU D  1 138 ? 147.259 127.948 -3.538  1.00 26.01 ? 166  LEU D CB    1 
ATOM   9699  C  CG    . LEU D  1 138 ? 146.595 128.371 -4.846  1.00 26.92 ? 166  LEU D CG    1 
ATOM   9700  C  CD1   . LEU D  1 138 ? 146.446 127.213 -5.824  1.00 27.83 ? 166  LEU D CD1   1 
ATOM   9701  C  CD2   . LEU D  1 138 ? 145.256 129.015 -4.571  1.00 26.60 ? 166  LEU D CD2   1 
ATOM   9702  N  N     . THR D  1 139 ? 149.358 128.311 -0.955  1.00 26.37 ? 167  THR D N     1 
ATOM   9703  C  CA    . THR D  1 139 ? 149.730 127.867 0.389   1.00 26.68 ? 167  THR D CA    1 
ATOM   9704  C  C     . THR D  1 139 ? 150.068 129.039 1.328   1.00 26.90 ? 167  THR D C     1 
ATOM   9705  O  O     . THR D  1 139 ? 150.128 128.861 2.546   1.00 27.34 ? 167  THR D O     1 
ATOM   9706  C  CB    . THR D  1 139 ? 150.906 126.859 0.353   1.00 26.68 ? 167  THR D CB    1 
ATOM   9707  O  OG1   . THR D  1 139 ? 152.088 127.503 -0.104  1.00 26.72 ? 167  THR D OG1   1 
ATOM   9708  C  CG2   . THR D  1 139 ? 150.606 125.692 -0.564  1.00 25.54 ? 167  THR D CG2   1 
ATOM   9709  N  N     . THR D  1 140 ? 150.249 130.233 0.770   1.00 26.50 ? 168  THR D N     1 
ATOM   9710  C  CA    . THR D  1 140 ? 150.794 131.371 1.524   1.00 26.76 ? 168  THR D CA    1 
ATOM   9711  C  C     . THR D  1 140 ? 149.844 132.575 1.676   1.00 26.40 ? 168  THR D C     1 
ATOM   9712  O  O     . THR D  1 140 ? 149.804 133.179 2.744   1.00 26.05 ? 168  THR D O     1 
ATOM   9713  C  CB    A THR D  1 140 ? 152.145 131.863 0.957   0.50 26.70 ? 168  THR D CB    1 
ATOM   9714  C  CB    B THR D  1 140 ? 152.110 131.819 0.876   0.50 26.79 ? 168  THR D CB    1 
ATOM   9715  O  OG1   A THR D  1 140 ? 151.988 132.304 -0.396  0.50 25.95 ? 168  THR D OG1   1 
ATOM   9716  O  OG1   B THR D  1 140 ? 152.957 130.672 0.717   0.50 27.75 ? 168  THR D OG1   1 
ATOM   9717  C  CG2   A THR D  1 140 ? 153.178 130.753 1.023   0.50 27.40 ? 168  THR D CG2   1 
ATOM   9718  C  CG2   B THR D  1 140 ? 152.818 132.867 1.725   0.50 26.96 ? 168  THR D CG2   1 
ATOM   9719  N  N     . GLU D  1 141 ? 149.087 132.925 0.638   1.00 26.19 ? 169  GLU D N     1 
ATOM   9720  C  CA    . GLU D  1 141 ? 148.225 134.109 0.727   1.00 26.96 ? 169  GLU D CA    1 
ATOM   9721  C  C     . GLU D  1 141 ? 147.030 134.181 -0.225  1.00 26.87 ? 169  GLU D C     1 
ATOM   9722  O  O     . GLU D  1 141 ? 146.099 134.953 0.040   1.00 27.05 ? 169  GLU D O     1 
ATOM   9723  C  CB    . GLU D  1 141 ? 149.069 135.390 0.572   1.00 28.09 ? 169  GLU D CB    1 
ATOM   9724  C  CG    . GLU D  1 141 ? 149.652 135.606 -0.823  1.00 31.64 ? 169  GLU D CG    1 
ATOM   9725  C  CD    . GLU D  1 141 ? 151.099 135.135 -0.999  1.00 37.87 ? 169  GLU D CD    1 
ATOM   9726  O  OE1   . GLU D  1 141 ? 151.441 134.658 -2.120  1.00 40.21 ? 169  GLU D OE1   1 
ATOM   9727  O  OE2   . GLU D  1 141 ? 151.909 135.293 -0.048  1.00 42.13 ? 169  GLU D OE2   1 
ATOM   9728  N  N     . LYS D  1 142 ? 147.036 133.397 -1.308  1.00 25.85 ? 170  LYS D N     1 
ATOM   9729  C  CA    . LYS D  1 142 ? 146.034 133.531 -2.362  1.00 25.92 ? 170  LYS D CA    1 
ATOM   9730  C  C     . LYS D  1 142 ? 144.914 132.505 -2.179  1.00 24.90 ? 170  LYS D C     1 
ATOM   9731  O  O     . LYS D  1 142 ? 145.162 131.300 -2.088  1.00 24.12 ? 170  LYS D O     1 
ATOM   9732  C  CB    . LYS D  1 142 ? 146.684 133.405 -3.750  1.00 25.75 ? 170  LYS D CB    1 
ATOM   9733  C  CG    . LYS D  1 142 ? 145.712 133.473 -4.930  1.00 26.96 ? 170  LYS D CG    1 
ATOM   9734  C  CD    . LYS D  1 142 ? 146.408 133.821 -6.265  1.00 27.59 ? 170  LYS D CD    1 
ATOM   9735  C  CE    . LYS D  1 142 ? 146.750 135.314 -6.395  1.00 28.34 ? 170  LYS D CE    1 
ATOM   9736  N  NZ    . LYS D  1 142 ? 147.614 135.652 -7.596  1.00 28.10 ? 170  LYS D NZ    1 
ATOM   9737  N  N     . VAL D  1 143 ? 143.686 133.016 -2.118  1.00 25.00 ? 171  VAL D N     1 
ATOM   9738  C  CA    . VAL D  1 143 ? 142.493 132.208 -1.981  1.00 24.99 ? 171  VAL D CA    1 
ATOM   9739  C  C     . VAL D  1 143 ? 141.945 131.875 -3.361  1.00 25.34 ? 171  VAL D C     1 
ATOM   9740  O  O     . VAL D  1 143 ? 141.912 132.729 -4.247  1.00 24.88 ? 171  VAL D O     1 
ATOM   9741  C  CB    . VAL D  1 143 ? 141.387 132.961 -1.163  1.00 25.39 ? 171  VAL D CB    1 
ATOM   9742  C  CG1   . VAL D  1 143 ? 140.086 132.153 -1.143  1.00 24.68 ? 171  VAL D CG1   1 
ATOM   9743  C  CG2   . VAL D  1 143 ? 141.892 133.271 0.247   1.00 25.22 ? 171  VAL D CG2   1 
ATOM   9744  N  N     . GLY D  1 144 ? 141.507 130.630 -3.522  1.00 25.33 ? 172  GLY D N     1 
ATOM   9745  C  CA    . GLY D  1 144 ? 140.881 130.168 -4.738  1.00 25.96 ? 172  GLY D CA    1 
ATOM   9746  C  C     . GLY D  1 144 ? 139.390 129.894 -4.565  1.00 25.78 ? 172  GLY D C     1 
ATOM   9747  O  O     . GLY D  1 144 ? 138.937 129.496 -3.472  1.00 26.12 ? 172  GLY D O     1 
ATOM   9748  N  N     . SER D  1 145 ? 138.643 130.133 -5.643  1.00 25.52 ? 173  SER D N     1 
ATOM   9749  C  CA    . SER D  1 145 ? 137.209 129.803 -5.759  1.00 25.71 ? 173  SER D CA    1 
ATOM   9750  C  C     . SER D  1 145 ? 137.009 128.779 -6.875  1.00 26.24 ? 173  SER D C     1 
ATOM   9751  O  O     . SER D  1 145 ? 137.662 128.843 -7.916  1.00 25.90 ? 173  SER D O     1 
ATOM   9752  C  CB    . SER D  1 145 ? 136.370 131.032 -6.071  1.00 25.26 ? 173  SER D CB    1 
ATOM   9753  O  OG    . SER D  1 145 ? 136.180 131.845 -4.931  1.00 25.46 ? 173  SER D OG    1 
ATOM   9754  N  N     . PHE D  1 146 ? 136.116 127.836 -6.613  1.00 26.37 ? 174  PHE D N     1 
ATOM   9755  C  CA    . PHE D  1 146 ? 135.750 126.747 -7.535  1.00 26.95 ? 174  PHE D CA    1 
ATOM   9756  C  C     . PHE D  1 146 ? 134.434 127.147 -8.187  1.00 26.60 ? 174  PHE D C     1 
ATOM   9757  O  O     . PHE D  1 146 ? 133.427 127.328 -7.497  1.00 26.71 ? 174  PHE D O     1 
ATOM   9758  C  CB    . PHE D  1 146 ? 135.628 125.455 -6.717  1.00 27.31 ? 174  PHE D CB    1 
ATOM   9759  C  CG    . PHE D  1 146 ? 135.126 124.255 -7.477  1.00 28.43 ? 174  PHE D CG    1 
ATOM   9760  C  CD1   . PHE D  1 146 ? 136.008 123.400 -8.126  1.00 29.94 ? 174  PHE D CD1   1 
ATOM   9761  C  CD2   . PHE D  1 146 ? 133.772 123.954 -7.492  1.00 27.06 ? 174  PHE D CD2   1 
ATOM   9762  C  CE1   . PHE D  1 146 ? 135.533 122.256 -8.791  1.00 30.95 ? 174  PHE D CE1   1 
ATOM   9763  C  CE2   . PHE D  1 146 ? 133.296 122.831 -8.154  1.00 29.42 ? 174  PHE D CE2   1 
ATOM   9764  C  CZ    . PHE D  1 146 ? 134.175 121.975 -8.800  1.00 28.99 ? 174  PHE D CZ    1 
ATOM   9765  N  N     . CYS D  1 147 ? 134.447 127.316 -9.510  1.00 26.22 ? 175  CYS D N     1 
ATOM   9766  C  CA    . CYS D  1 147 ? 133.334 127.921 -10.225 1.00 26.15 ? 175  CYS D CA    1 
ATOM   9767  C  C     . CYS D  1 147 ? 132.706 126.969 -11.252 1.00 26.24 ? 175  CYS D C     1 
ATOM   9768  O  O     . CYS D  1 147 ? 133.102 126.925 -12.411 1.00 26.24 ? 175  CYS D O     1 
ATOM   9769  C  CB    . CYS D  1 147 ? 133.773 129.221 -10.893 1.00 25.94 ? 175  CYS D CB    1 
ATOM   9770  S  SG    . CYS D  1 147 ? 134.757 130.276 -9.829  1.00 27.40 ? 175  CYS D SG    1 
ATOM   9771  N  N     . LEU D  1 148 ? 131.713 126.212 -10.799 1.00 26.48 ? 176  LEU D N     1 
ATOM   9772  C  CA    . LEU D  1 148 ? 131.025 125.219 -11.634 1.00 25.95 ? 176  LEU D CA    1 
ATOM   9773  C  C     . LEU D  1 148 ? 129.569 125.608 -11.888 1.00 25.69 ? 176  LEU D C     1 
ATOM   9774  O  O     . LEU D  1 148 ? 129.129 125.730 -13.040 1.00 25.58 ? 176  LEU D O     1 
ATOM   9775  C  CB    . LEU D  1 148 ? 131.094 123.845 -10.957 1.00 26.13 ? 176  LEU D CB    1 
ATOM   9776  C  CG    . LEU D  1 148 ? 130.349 122.680 -11.644 1.00 26.68 ? 176  LEU D CG    1 
ATOM   9777  C  CD1   . LEU D  1 148 ? 130.877 122.441 -13.089 1.00 25.47 ? 176  LEU D CD1   1 
ATOM   9778  C  CD2   . LEU D  1 148 ? 130.458 121.383 -10.794 1.00 26.01 ? 176  LEU D CD2   1 
ATOM   9779  N  N     . SER D  1 149 ? 128.848 125.821 -10.795 1.00 25.33 ? 177  SER D N     1 
ATOM   9780  C  CA    . SER D  1 149 ? 127.404 126.025 -10.803 1.00 25.87 ? 177  SER D CA    1 
ATOM   9781  C  C     . SER D  1 149 ? 126.954 127.329 -11.432 1.00 25.45 ? 177  SER D C     1 
ATOM   9782  O  O     . SER D  1 149 ? 127.644 128.346 -11.376 1.00 26.29 ? 177  SER D O     1 
ATOM   9783  C  CB    . SER D  1 149 ? 126.841 125.964 -9.363  1.00 25.30 ? 177  SER D CB    1 
ATOM   9784  O  OG    . SER D  1 149 ? 127.213 124.775 -8.687  1.00 26.32 ? 177  SER D OG    1 
ATOM   9785  N  N     . GLU D  1 150 ? 125.762 127.267 -12.012 1.00 25.67 ? 178  GLU D N     1 
ATOM   9786  C  CA    . GLU D  1 150 ? 125.080 128.391 -12.642 1.00 25.72 ? 178  GLU D CA    1 
ATOM   9787  C  C     . GLU D  1 150 ? 123.613 128.339 -12.236 1.00 26.03 ? 178  GLU D C     1 
ATOM   9788  O  O     . GLU D  1 150 ? 123.144 127.314 -11.721 1.00 25.95 ? 178  GLU D O     1 
ATOM   9789  C  CB    . GLU D  1 150 ? 125.200 128.315 -14.170 1.00 25.26 ? 178  GLU D CB    1 
ATOM   9790  C  CG    . GLU D  1 150 ? 126.658 128.185 -14.651 1.00 25.69 ? 178  GLU D CG    1 
ATOM   9791  C  CD    . GLU D  1 150 ? 126.856 128.318 -16.144 1.00 25.21 ? 178  GLU D CD    1 
ATOM   9792  O  OE1   . GLU D  1 150 ? 125.857 128.410 -16.906 1.00 25.78 ? 178  GLU D OE1   1 
ATOM   9793  O  OE2   . GLU D  1 150 ? 128.042 128.336 -16.569 1.00 26.61 ? 178  GLU D OE2   1 
ATOM   9794  N  N     . ALA D  1 151 ? 122.887 129.426 -12.505 1.00 26.19 ? 179  ALA D N     1 
ATOM   9795  C  CA    . ALA D  1 151 ? 121.446 129.495 -12.252 1.00 26.79 ? 179  ALA D CA    1 
ATOM   9796  C  C     . ALA D  1 151 ? 120.694 128.323 -12.882 1.00 26.54 ? 179  ALA D C     1 
ATOM   9797  O  O     . ALA D  1 151 ? 119.795 127.772 -12.267 1.00 26.93 ? 179  ALA D O     1 
ATOM   9798  C  CB    . ALA D  1 151 ? 120.865 130.835 -12.750 1.00 26.66 ? 179  ALA D CB    1 
ATOM   9799  N  N     . GLY D  1 152 ? 121.096 127.925 -14.085 1.00 26.86 ? 180  GLY D N     1 
ATOM   9800  C  CA    . GLY D  1 152 ? 120.454 126.834 -14.817 1.00 27.38 ? 180  GLY D CA    1 
ATOM   9801  C  C     . GLY D  1 152 ? 121.188 125.502 -14.772 1.00 27.46 ? 180  GLY D C     1 
ATOM   9802  O  O     . GLY D  1 152 ? 120.810 124.565 -15.469 1.00 28.42 ? 180  GLY D O     1 
ATOM   9803  N  N     . ALA D  1 153 ? 122.209 125.412 -13.932 1.00 27.37 ? 181  ALA D N     1 
ATOM   9804  C  CA    . ALA D  1 153 ? 123.066 124.234 -13.835 1.00 27.16 ? 181  ALA D CA    1 
ATOM   9805  C  C     . ALA D  1 153 ? 123.571 124.068 -12.406 1.00 27.15 ? 181  ALA D C     1 
ATOM   9806  O  O     . ALA D  1 153 ? 124.671 124.491 -12.061 1.00 27.30 ? 181  ALA D O     1 
ATOM   9807  C  CB    . ALA D  1 153 ? 124.248 124.344 -14.826 1.00 26.77 ? 181  ALA D CB    1 
ATOM   9808  N  N     . GLY D  1 154 ? 122.728 123.480 -11.568 1.00 27.19 ? 182  GLY D N     1 
ATOM   9809  C  CA    . GLY D  1 154 ? 123.063 123.187 -10.190 1.00 27.17 ? 182  GLY D CA    1 
ATOM   9810  C  C     . GLY D  1 154 ? 123.370 121.719 -10.018 1.00 26.59 ? 182  GLY D C     1 
ATOM   9811  O  O     . GLY D  1 154 ? 124.517 121.288 -10.151 1.00 26.42 ? 182  GLY D O     1 
ATOM   9812  N  N     . SER D  1 155 ? 122.348 120.925 -9.729  1.00 26.69 ? 183  SER D N     1 
ATOM   9813  C  CA    . SER D  1 155 ? 122.543 119.479 -9.727  1.00 25.85 ? 183  SER D CA    1 
ATOM   9814  C  C     . SER D  1 155 ? 123.018 119.029 -11.116 1.00 25.84 ? 183  SER D C     1 
ATOM   9815  O  O     . SER D  1 155 ? 123.881 118.172 -11.231 1.00 25.01 ? 183  SER D O     1 
ATOM   9816  C  CB    . SER D  1 155 ? 121.262 118.766 -9.325  1.00 26.04 ? 183  SER D CB    1 
ATOM   9817  O  OG    . SER D  1 155 ? 120.900 119.127 -8.000  1.00 25.89 ? 183  SER D OG    1 
ATOM   9818  N  N     . ASP D  1 156 ? 122.450 119.632 -12.161 1.00 25.72 ? 184  ASP D N     1 
ATOM   9819  C  CA    . ASP D  1 156 ? 122.809 119.351 -13.539 1.00 25.66 ? 184  ASP D CA    1 
ATOM   9820  C  C     . ASP D  1 156 ? 123.978 120.276 -13.920 1.00 25.94 ? 184  ASP D C     1 
ATOM   9821  O  O     . ASP D  1 156 ? 123.846 121.170 -14.761 1.00 25.06 ? 184  ASP D O     1 
ATOM   9822  C  CB    . ASP D  1 156 ? 121.574 119.547 -14.429 1.00 25.27 ? 184  ASP D CB    1 
ATOM   9823  C  CG    . ASP D  1 156 ? 121.790 119.110 -15.868 1.00 25.54 ? 184  ASP D CG    1 
ATOM   9824  O  OD1   . ASP D  1 156 ? 122.854 118.540 -16.222 1.00 26.06 ? 184  ASP D OD1   1 
ATOM   9825  O  OD2   . ASP D  1 156 ? 120.861 119.352 -16.648 1.00 23.98 ? 184  ASP D OD2   1 
ATOM   9826  N  N     . SER D  1 157 ? 125.118 120.035 -13.273 1.00 26.45 ? 185  SER D N     1 
ATOM   9827  C  CA    . SER D  1 157 ? 126.331 120.838 -13.466 1.00 27.74 ? 185  SER D CA    1 
ATOM   9828  C  C     . SER D  1 157 ? 126.761 120.916 -14.921 1.00 27.52 ? 185  SER D C     1 
ATOM   9829  O  O     . SER D  1 157 ? 127.194 121.964 -15.403 1.00 27.40 ? 185  SER D O     1 
ATOM   9830  C  CB    . SER D  1 157 ? 127.489 120.226 -12.691 1.00 27.52 ? 185  SER D CB    1 
ATOM   9831  O  OG    . SER D  1 157 ? 127.208 120.151 -11.320 1.00 31.10 ? 185  SER D OG    1 
ATOM   9832  N  N     . PHE D  1 158 ? 126.652 119.795 -15.629 1.00 27.81 ? 186  PHE D N     1 
ATOM   9833  C  CA    . PHE D  1 158 ? 127.214 119.732 -16.972 1.00 27.56 ? 186  PHE D CA    1 
ATOM   9834  C  C     . PHE D  1 158 ? 126.325 120.381 -18.041 1.00 26.87 ? 186  PHE D C     1 
ATOM   9835  O  O     . PHE D  1 158 ? 126.723 120.438 -19.211 1.00 26.66 ? 186  PHE D O     1 
ATOM   9836  C  CB    . PHE D  1 158 ? 127.630 118.306 -17.338 1.00 28.61 ? 186  PHE D CB    1 
ATOM   9837  C  CG    . PHE D  1 158 ? 128.619 117.682 -16.375 1.00 28.62 ? 186  PHE D CG    1 
ATOM   9838  C  CD1   . PHE D  1 158 ? 129.440 118.453 -15.561 1.00 30.08 ? 186  PHE D CD1   1 
ATOM   9839  C  CD2   . PHE D  1 158 ? 128.730 116.289 -16.303 1.00 31.91 ? 186  PHE D CD2   1 
ATOM   9840  C  CE1   . PHE D  1 158 ? 130.333 117.859 -14.691 1.00 32.28 ? 186  PHE D CE1   1 
ATOM   9841  C  CE2   . PHE D  1 158 ? 129.622 115.691 -15.435 1.00 31.64 ? 186  PHE D CE2   1 
ATOM   9842  C  CZ    . PHE D  1 158 ? 130.416 116.461 -14.629 1.00 32.29 ? 186  PHE D CZ    1 
ATOM   9843  N  N     . ALA D  1 159 ? 125.172 120.912 -17.632 1.00 25.52 ? 187  ALA D N     1 
ATOM   9844  C  CA    . ALA D  1 159 ? 124.361 121.794 -18.489 1.00 25.51 ? 187  ALA D CA    1 
ATOM   9845  C  C     . ALA D  1 159 ? 124.856 123.236 -18.445 1.00 24.85 ? 187  ALA D C     1 
ATOM   9846  O  O     . ALA D  1 159 ? 124.183 124.139 -18.947 1.00 24.35 ? 187  ALA D O     1 
ATOM   9847  C  CB    . ALA D  1 159 ? 122.898 121.764 -18.085 1.00 25.05 ? 187  ALA D CB    1 
ATOM   9848  N  N     . LEU D  1 160 ? 126.013 123.465 -17.838 1.00 25.22 ? 188  LEU D N     1 
ATOM   9849  C  CA    . LEU D  1 160 ? 126.506 124.832 -17.688 1.00 25.33 ? 188  LEU D CA    1 
ATOM   9850  C  C     . LEU D  1 160 ? 126.577 125.498 -19.076 1.00 25.44 ? 188  LEU D C     1 
ATOM   9851  O  O     . LEU D  1 160 ? 126.940 124.856 -20.067 1.00 25.21 ? 188  LEU D O     1 
ATOM   9852  C  CB    . LEU D  1 160 ? 127.863 124.859 -16.960 1.00 25.11 ? 188  LEU D CB    1 
ATOM   9853  C  CG    . LEU D  1 160 ? 129.080 124.178 -17.613 1.00 24.63 ? 188  LEU D CG    1 
ATOM   9854  C  CD1   . LEU D  1 160 ? 129.812 125.118 -18.601 1.00 21.11 ? 188  LEU D CD1   1 
ATOM   9855  C  CD2   . LEU D  1 160 ? 130.046 123.709 -16.555 1.00 24.11 ? 188  LEU D CD2   1 
ATOM   9856  N  N     . LYS D  1 161 ? 126.200 126.776 -19.126 1.00 26.14 ? 189  LYS D N     1 
ATOM   9857  C  CA    . LYS D  1 161 ? 126.172 127.567 -20.362 1.00 26.38 ? 189  LYS D CA    1 
ATOM   9858  C  C     . LYS D  1 161 ? 127.322 128.554 -20.566 1.00 26.06 ? 189  LYS D C     1 
ATOM   9859  O  O     . LYS D  1 161 ? 127.439 129.129 -21.656 1.00 25.62 ? 189  LYS D O     1 
ATOM   9860  C  CB    . LYS D  1 161 ? 124.848 128.331 -20.449 1.00 27.53 ? 189  LYS D CB    1 
ATOM   9861  C  CG    . LYS D  1 161 ? 123.669 127.437 -20.728 1.00 31.04 ? 189  LYS D CG    1 
ATOM   9862  C  CD    . LYS D  1 161 ? 122.380 128.253 -20.788 1.00 36.08 ? 189  LYS D CD    1 
ATOM   9863  C  CE    . LYS D  1 161 ? 121.216 127.420 -21.316 1.00 38.84 ? 189  LYS D CE    1 
ATOM   9864  N  NZ    . LYS D  1 161 ? 119.907 128.146 -21.148 1.00 41.55 ? 189  LYS D NZ    1 
ATOM   9865  N  N     . THR D  1 162 ? 128.167 128.764 -19.556 1.00 26.25 ? 190  THR D N     1 
ATOM   9866  C  CA    . THR D  1 162 ? 129.353 129.610 -19.726 1.00 26.57 ? 190  THR D CA    1 
ATOM   9867  C  C     . THR D  1 162 ? 130.220 128.985 -20.829 1.00 26.98 ? 190  THR D C     1 
ATOM   9868  O  O     . THR D  1 162 ? 130.526 127.788 -20.797 1.00 26.18 ? 190  THR D O     1 
ATOM   9869  C  CB    . THR D  1 162 ? 130.168 129.814 -18.415 1.00 27.00 ? 190  THR D CB    1 
ATOM   9870  O  OG1   . THR D  1 162 ? 129.365 130.489 -17.439 1.00 26.98 ? 190  THR D OG1   1 
ATOM   9871  C  CG2   . THR D  1 162 ? 131.444 130.651 -18.661 1.00 26.02 ? 190  THR D CG2   1 
ATOM   9872  N  N     . ARG D  1 163 ? 130.533 129.786 -21.840 1.00 27.60 ? 191  ARG D N     1 
ATOM   9873  C  CA    . ARG D  1 163 ? 131.245 129.287 -23.015 1.00 28.93 ? 191  ARG D CA    1 
ATOM   9874  C  C     . ARG D  1 163 ? 132.605 129.947 -23.166 1.00 28.14 ? 191  ARG D C     1 
ATOM   9875  O  O     . ARG D  1 163 ? 132.825 131.061 -22.697 1.00 27.12 ? 191  ARG D O     1 
ATOM   9876  C  CB    . ARG D  1 163 ? 130.420 129.467 -24.296 1.00 29.29 ? 191  ARG D CB    1 
ATOM   9877  C  CG    . ARG D  1 163 ? 130.022 130.884 -24.626 1.00 30.30 ? 191  ARG D CG    1 
ATOM   9878  C  CD    . ARG D  1 163 ? 129.121 130.893 -25.865 1.00 32.87 ? 191  ARG D CD    1 
ATOM   9879  N  NE    . ARG D  1 163 ? 129.826 130.332 -27.021 1.00 36.52 ? 191  ARG D NE    1 
ATOM   9880  C  CZ    . ARG D  1 163 ? 129.261 129.701 -28.048 1.00 36.86 ? 191  ARG D CZ    1 
ATOM   9881  N  NH1   . ARG D  1 163 ? 127.942 129.524 -28.119 1.00 37.49 ? 191  ARG D NH1   1 
ATOM   9882  N  NH2   . ARG D  1 163 ? 130.036 129.236 -29.019 1.00 38.24 ? 191  ARG D NH2   1 
ATOM   9883  N  N     . ALA D  1 164 ? 133.519 129.223 -23.804 1.00 28.34 ? 192  ALA D N     1 
ATOM   9884  C  CA    . ALA D  1 164 ? 134.875 129.695 -24.025 1.00 28.23 ? 192  ALA D CA    1 
ATOM   9885  C  C     . ALA D  1 164 ? 135.128 129.561 -25.519 1.00 28.44 ? 192  ALA D C     1 
ATOM   9886  O  O     . ALA D  1 164 ? 135.132 128.451 -26.036 1.00 27.82 ? 192  ALA D O     1 
ATOM   9887  C  CB    . ALA D  1 164 ? 135.871 128.865 -23.220 1.00 27.95 ? 192  ALA D CB    1 
ATOM   9888  N  N     . ASP D  1 165 ? 135.277 130.699 -26.196 1.00 28.79 ? 193  ASP D N     1 
ATOM   9889  C  CA    . ASP D  1 165 ? 135.498 130.762 -27.638 1.00 29.48 ? 193  ASP D CA    1 
ATOM   9890  C  C     . ASP D  1 165 ? 136.954 131.100 -27.936 1.00 29.95 ? 193  ASP D C     1 
ATOM   9891  O  O     . ASP D  1 165 ? 137.475 132.116 -27.468 1.00 29.01 ? 193  ASP D O     1 
ATOM   9892  C  CB    . ASP D  1 165 ? 134.576 131.810 -28.264 1.00 29.57 ? 193  ASP D CB    1 
ATOM   9893  C  CG    . ASP D  1 165 ? 133.124 131.417 -28.172 1.00 31.80 ? 193  ASP D CG    1 
ATOM   9894  O  OD1   . ASP D  1 165 ? 132.808 130.286 -28.583 1.00 34.12 ? 193  ASP D OD1   1 
ATOM   9895  O  OD2   . ASP D  1 165 ? 132.299 132.210 -27.670 1.00 34.20 ? 193  ASP D OD2   1 
ATOM   9896  N  N     . LYS D  1 166 ? 137.616 130.231 -28.691 1.00 30.50 ? 194  LYS D N     1 
ATOM   9897  C  CA    . LYS D  1 166 ? 139.020 130.435 -29.025 1.00 31.78 ? 194  LYS D CA    1 
ATOM   9898  C  C     . LYS D  1 166 ? 139.177 131.589 -29.990 1.00 31.53 ? 194  LYS D C     1 
ATOM   9899  O  O     . LYS D  1 166 ? 138.484 131.653 -30.999 1.00 31.05 ? 194  LYS D O     1 
ATOM   9900  C  CB    . LYS D  1 166 ? 139.640 129.180 -29.635 1.00 31.96 ? 194  LYS D CB    1 
ATOM   9901  C  CG    . LYS D  1 166 ? 141.151 129.190 -29.556 1.00 33.41 ? 194  LYS D CG    1 
ATOM   9902  C  CD    . LYS D  1 166 ? 141.757 127.882 -30.066 1.00 34.59 ? 194  LYS D CD    1 
ATOM   9903  C  CE    . LYS D  1 166 ? 143.290 127.923 -30.031 1.00 36.01 ? 194  LYS D CE    1 
ATOM   9904  N  NZ    . LYS D  1 166 ? 143.781 128.118 -28.629 1.00 38.43 ? 194  LYS D NZ    1 
ATOM   9905  N  N     . GLU D  1 167 ? 140.070 132.513 -29.646 1.00 31.92 ? 195  GLU D N     1 
ATOM   9906  C  CA    . GLU D  1 167 ? 140.468 133.601 -30.536 1.00 32.24 ? 195  GLU D CA    1 
ATOM   9907  C  C     . GLU D  1 167 ? 141.989 133.702 -30.461 1.00 31.65 ? 195  GLU D C     1 
ATOM   9908  O  O     . GLU D  1 167 ? 142.539 134.116 -29.439 1.00 30.76 ? 195  GLU D O     1 
ATOM   9909  C  CB    . GLU D  1 167 ? 139.821 134.930 -30.132 1.00 32.77 ? 195  GLU D CB    1 
ATOM   9910  C  CG    . GLU D  1 167 ? 138.342 134.876 -29.723 1.00 35.36 ? 195  GLU D CG    1 
ATOM   9911  C  CD    . GLU D  1 167 ? 137.366 134.531 -30.853 1.00 39.47 ? 195  GLU D CD    1 
ATOM   9912  O  OE1   . GLU D  1 167 ? 137.728 134.666 -32.044 1.00 42.70 ? 195  GLU D OE1   1 
ATOM   9913  O  OE2   . GLU D  1 167 ? 136.214 134.138 -30.535 1.00 43.52 ? 195  GLU D OE2   1 
ATOM   9914  N  N     . GLY D  1 168 ? 142.666 133.272 -31.524 1.00 31.19 ? 196  GLY D N     1 
ATOM   9915  C  CA    . GLY D  1 168 ? 144.123 133.213 -31.539 1.00 30.71 ? 196  GLY D CA    1 
ATOM   9916  C  C     . GLY D  1 168 ? 144.647 132.295 -30.460 1.00 30.53 ? 196  GLY D C     1 
ATOM   9917  O  O     . GLY D  1 168 ? 144.201 131.163 -30.334 1.00 30.76 ? 196  GLY D O     1 
ATOM   9918  N  N     . ASP D  1 169 ? 145.579 132.785 -29.651 1.00 30.08 ? 197  ASP D N     1 
ATOM   9919  C  CA    . ASP D  1 169 ? 146.129 131.977 -28.565 1.00 29.57 ? 197  ASP D CA    1 
ATOM   9920  C  C     . ASP D  1 169 ? 145.440 132.268 -27.216 1.00 28.69 ? 197  ASP D C     1 
ATOM   9921  O  O     . ASP D  1 169 ? 146.024 132.040 -26.160 1.00 28.40 ? 197  ASP D O     1 
ATOM   9922  C  CB    . ASP D  1 169 ? 147.666 132.117 -28.487 1.00 30.29 ? 197  ASP D CB    1 
ATOM   9923  C  CG    . ASP D  1 169 ? 148.139 133.563 -28.304 1.00 31.09 ? 197  ASP D CG    1 
ATOM   9924  O  OD1   . ASP D  1 169 ? 147.302 134.480 -28.195 1.00 33.19 ? 197  ASP D OD1   1 
ATOM   9925  O  OD2   . ASP D  1 169 ? 149.369 133.777 -28.292 1.00 33.52 ? 197  ASP D OD2   1 
ATOM   9926  N  N     . TYR D  1 170 ? 144.203 132.768 -27.263 1.00 27.86 ? 198  TYR D N     1 
ATOM   9927  C  CA    . TYR D  1 170 ? 143.383 132.929 -26.060 1.00 28.16 ? 198  TYR D CA    1 
ATOM   9928  C  C     . TYR D  1 170 ? 141.986 132.330 -26.206 1.00 28.02 ? 198  TYR D C     1 
ATOM   9929  O  O     . TYR D  1 170 ? 141.531 132.023 -27.317 1.00 27.64 ? 198  TYR D O     1 
ATOM   9930  C  CB    A TYR D  1 170 ? 143.391 134.359 -25.499 0.60 28.38 ? 198  TYR D CB    1 
ATOM   9931  C  CB    B TYR D  1 170 ? 143.134 134.433 -25.821 0.40 28.02 ? 198  TYR D CB    1 
ATOM   9932  C  CG    A TYR D  1 170 ? 142.957 135.452 -26.410 0.60 28.40 ? 198  TYR D CG    1 
ATOM   9933  C  CG    B TYR D  1 170 ? 144.251 135.246 -25.214 0.40 28.00 ? 198  TYR D CG    1 
ATOM   9934  C  CD1   A TYR D  1 170 ? 143.872 136.104 -27.226 0.60 29.13 ? 198  TYR D CD1   1 
ATOM   9935  C  CD1   B TYR D  1 170 ? 145.415 135.523 -25.927 0.40 28.19 ? 198  TYR D CD1   1 
ATOM   9936  C  CD2   A TYR D  1 170 ? 141.639 135.882 -26.423 0.60 28.84 ? 198  TYR D CD2   1 
ATOM   9937  C  CD2   B TYR D  1 170 ? 144.112 135.797 -23.941 0.40 27.61 ? 198  TYR D CD2   1 
ATOM   9938  C  CE1   A TYR D  1 170 ? 143.474 137.130 -28.056 0.60 29.13 ? 198  TYR D CE1   1 
ATOM   9939  C  CE1   B TYR D  1 170 ? 146.429 136.285 -25.366 0.40 28.01 ? 198  TYR D CE1   1 
ATOM   9940  C  CE2   A TYR D  1 170 ? 141.238 136.910 -27.251 0.60 29.02 ? 198  TYR D CE2   1 
ATOM   9941  C  CE2   B TYR D  1 170 ? 145.107 136.559 -23.383 0.40 27.53 ? 198  TYR D CE2   1 
ATOM   9942  C  CZ    A TYR D  1 170 ? 142.156 137.524 -28.058 0.60 28.27 ? 198  TYR D CZ    1 
ATOM   9943  C  CZ    B TYR D  1 170 ? 146.259 136.798 -24.091 0.40 27.75 ? 198  TYR D CZ    1 
ATOM   9944  O  OH    A TYR D  1 170 ? 141.758 138.543 -28.873 0.60 29.19 ? 198  TYR D OH    1 
ATOM   9945  O  OH    B TYR D  1 170 ? 147.235 137.556 -23.514 0.40 28.44 ? 198  TYR D OH    1 
ATOM   9946  N  N     . TYR D  1 171 ? 141.304 132.189 -25.071 1.00 27.89 ? 199  TYR D N     1 
ATOM   9947  C  CA    . TYR D  1 171 ? 139.877 131.900 -25.064 1.00 27.79 ? 199  TYR D CA    1 
ATOM   9948  C  C     . TYR D  1 171 ? 139.123 133.107 -24.525 1.00 27.60 ? 199  TYR D C     1 
ATOM   9949  O  O     . TYR D  1 171 ? 139.624 133.827 -23.659 1.00 28.36 ? 199  TYR D O     1 
ATOM   9950  C  CB    . TYR D  1 171 ? 139.574 130.655 -24.238 1.00 28.15 ? 199  TYR D CB    1 
ATOM   9951  C  CG    . TYR D  1 171 ? 139.963 129.388 -24.955 1.00 28.16 ? 199  TYR D CG    1 
ATOM   9952  C  CD1   . TYR D  1 171 ? 139.019 128.629 -25.636 1.00 27.62 ? 199  TYR D CD1   1 
ATOM   9953  C  CD2   . TYR D  1 171 ? 141.282 128.979 -24.984 1.00 27.92 ? 199  TYR D CD2   1 
ATOM   9954  C  CE1   . TYR D  1 171 ? 139.385 127.472 -26.305 1.00 28.19 ? 199  TYR D CE1   1 
ATOM   9955  C  CE2   . TYR D  1 171 ? 141.661 127.836 -25.660 1.00 29.49 ? 199  TYR D CE2   1 
ATOM   9956  C  CZ    . TYR D  1 171 ? 140.708 127.083 -26.308 1.00 28.64 ? 199  TYR D CZ    1 
ATOM   9957  O  OH    . TYR D  1 171 ? 141.121 125.950 -26.977 1.00 30.76 ? 199  TYR D OH    1 
ATOM   9958  N  N     . VAL D  1 172 ? 137.933 133.341 -25.058 1.00 26.91 ? 200  VAL D N     1 
ATOM   9959  C  CA    . VAL D  1 172 ? 137.080 134.429 -24.605 1.00 26.60 ? 200  VAL D CA    1 
ATOM   9960  C  C     . VAL D  1 172 ? 135.910 133.778 -23.896 1.00 26.25 ? 200  VAL D C     1 
ATOM   9961  O  O     . VAL D  1 172 ? 135.157 132.995 -24.492 1.00 25.62 ? 200  VAL D O     1 
ATOM   9962  C  CB    . VAL D  1 172 ? 136.581 135.321 -25.768 1.00 26.92 ? 200  VAL D CB    1 
ATOM   9963  C  CG1   . VAL D  1 172 ? 135.803 136.521 -25.235 1.00 26.05 ? 200  VAL D CG1   1 
ATOM   9964  C  CG2   . VAL D  1 172 ? 137.748 135.783 -26.612 1.00 27.06 ? 200  VAL D CG2   1 
ATOM   9965  N  N     . LEU D  1 173 ? 135.781 134.090 -22.613 1.00 25.85 ? 201  LEU D N     1 
ATOM   9966  C  CA    . LEU D  1 173 ? 134.748 133.510 -21.774 1.00 26.02 ? 201  LEU D CA    1 
ATOM   9967  C  C     . LEU D  1 173 ? 133.554 134.460 -21.653 1.00 25.50 ? 201  LEU D C     1 
ATOM   9968  O  O     . LEU D  1 173 ? 133.717 135.655 -21.410 1.00 25.20 ? 201  LEU D O     1 
ATOM   9969  C  CB    . LEU D  1 173 ? 135.309 133.154 -20.397 1.00 25.44 ? 201  LEU D CB    1 
ATOM   9970  C  CG    . LEU D  1 173 ? 135.919 131.751 -20.277 1.00 27.37 ? 201  LEU D CG    1 
ATOM   9971  C  CD1   . LEU D  1 173 ? 137.170 131.604 -21.174 1.00 26.04 ? 201  LEU D CD1   1 
ATOM   9972  C  CD2   . LEU D  1 173 ? 136.245 131.449 -18.812 1.00 26.42 ? 201  LEU D CD2   1 
ATOM   9973  N  N     . ASN D  1 174 ? 132.365 133.897 -21.845 1.00 25.37 ? 202  ASN D N     1 
ATOM   9974  C  CA    . ASN D  1 174 ? 131.108 134.615 -21.717 1.00 25.33 ? 202  ASN D CA    1 
ATOM   9975  C  C     . ASN D  1 174 ? 130.103 133.743 -20.983 1.00 26.09 ? 202  ASN D C     1 
ATOM   9976  O  O     . ASN D  1 174 ? 129.900 132.571 -21.318 1.00 25.79 ? 202  ASN D O     1 
ATOM   9977  C  CB    . ASN D  1 174 ? 130.559 135.021 -23.091 1.00 25.26 ? 202  ASN D CB    1 
ATOM   9978  C  CG    . ASN D  1 174 ? 131.160 136.299 -23.594 1.00 24.27 ? 202  ASN D CG    1 
ATOM   9979  O  OD1   . ASN D  1 174 ? 130.938 137.360 -23.016 1.00 24.41 ? 202  ASN D OD1   1 
ATOM   9980  N  ND2   . ASN D  1 174 ? 131.945 136.213 -24.664 1.00 23.85 ? 202  ASN D ND2   1 
ATOM   9981  N  N     . GLY D  1 175 ? 129.481 134.323 -19.965 1.00 26.87 ? 203  GLY D N     1 
ATOM   9982  C  CA    . GLY D  1 175 ? 128.468 133.635 -19.209 1.00 26.66 ? 203  GLY D CA    1 
ATOM   9983  C  C     . GLY D  1 175 ? 128.388 134.142 -17.789 1.00 27.16 ? 203  GLY D C     1 
ATOM   9984  O  O     . GLY D  1 175 ? 128.691 135.296 -17.498 1.00 26.94 ? 203  GLY D O     1 
ATOM   9985  N  N     . SER D  1 176 ? 127.958 133.255 -16.910 1.00 27.68 ? 204  SER D N     1 
ATOM   9986  C  CA    . SER D  1 176 ? 127.739 133.586 -15.519 1.00 28.11 ? 204  SER D CA    1 
ATOM   9987  C  C     . SER D  1 176 ? 127.882 132.338 -14.650 1.00 27.62 ? 204  SER D C     1 
ATOM   9988  O  O     . SER D  1 176 ? 127.659 131.215 -15.118 1.00 28.54 ? 204  SER D O     1 
ATOM   9989  C  CB    . SER D  1 176 ? 126.344 134.177 -15.353 1.00 28.04 ? 204  SER D CB    1 
ATOM   9990  O  OG    . SER D  1 176 ? 125.374 133.197 -15.674 1.00 30.85 ? 204  SER D OG    1 
ATOM   9991  N  N     . LYS D  1 177 ? 128.221 132.558 -13.390 1.00 26.70 ? 205  LYS D N     1 
ATOM   9992  C  CA    . LYS D  1 177 ? 128.238 131.533 -12.385 1.00 26.89 ? 205  LYS D CA    1 
ATOM   9993  C  C     . LYS D  1 177 ? 127.438 132.006 -11.176 1.00 26.89 ? 205  LYS D C     1 
ATOM   9994  O  O     . LYS D  1 177 ? 127.255 133.197 -10.955 1.00 26.26 ? 205  LYS D O     1 
ATOM   9995  C  CB    . LYS D  1 177 ? 129.670 131.202 -11.953 1.00 26.99 ? 205  LYS D CB    1 
ATOM   9996  C  CG    . LYS D  1 177 ? 130.536 130.630 -13.049 1.00 27.24 ? 205  LYS D CG    1 
ATOM   9997  C  CD    . LYS D  1 177 ? 130.105 129.212 -13.405 1.00 25.38 ? 205  LYS D CD    1 
ATOM   9998  C  CE    . LYS D  1 177 ? 130.939 128.618 -14.513 1.00 24.18 ? 205  LYS D CE    1 
ATOM   9999  N  NZ    . LYS D  1 177 ? 130.313 127.342 -14.974 1.00 23.72 ? 205  LYS D NZ    1 
ATOM   10000 N  N     . MET D  1 178 ? 126.995 131.036 -10.389 1.00 27.46 ? 206  MET D N     1 
ATOM   10001 C  CA    . MET D  1 178 ? 126.181 131.276 -9.218  1.00 28.06 ? 206  MET D CA    1 
ATOM   10002 C  C     . MET D  1 178 ? 126.717 130.457 -8.046  1.00 27.54 ? 206  MET D C     1 
ATOM   10003 O  O     . MET D  1 178 ? 127.278 129.373 -8.240  1.00 27.36 ? 206  MET D O     1 
ATOM   10004 C  CB    . MET D  1 178 ? 124.748 130.848 -9.522  1.00 29.04 ? 206  MET D CB    1 
ATOM   10005 C  CG    . MET D  1 178 ? 123.740 131.270 -8.473  1.00 31.37 ? 206  MET D CG    1 
ATOM   10006 S  SD    . MET D  1 178 ? 123.432 133.041 -8.584  1.00 38.04 ? 206  MET D SD    1 
ATOM   10007 C  CE    . MET D  1 178 ? 122.240 133.030 -9.931  1.00 38.00 ? 206  MET D CE    1 
ATOM   10008 N  N     . TRP D  1 179 ? 126.568 131.003 -6.840  1.00 27.06 ? 207  TRP D N     1 
ATOM   10009 C  CA    . TRP D  1 179 ? 126.878 130.309 -5.587  1.00 26.76 ? 207  TRP D CA    1 
ATOM   10010 C  C     . TRP D  1 179 ? 128.365 130.155 -5.326  1.00 26.11 ? 207  TRP D C     1 
ATOM   10011 O  O     . TRP D  1 179 ? 128.765 129.241 -4.633  1.00 25.95 ? 207  TRP D O     1 
ATOM   10012 C  CB    . TRP D  1 179 ? 126.210 128.917 -5.490  1.00 26.68 ? 207  TRP D CB    1 
ATOM   10013 C  CG    . TRP D  1 179 ? 124.783 128.893 -5.879  1.00 26.84 ? 207  TRP D CG    1 
ATOM   10014 C  CD1   . TRP D  1 179 ? 124.249 128.266 -6.953  1.00 27.20 ? 207  TRP D CD1   1 
ATOM   10015 C  CD2   . TRP D  1 179 ? 123.690 129.543 -5.207  1.00 27.33 ? 207  TRP D CD2   1 
ATOM   10016 N  NE1   . TRP D  1 179 ? 122.904 128.495 -7.016  1.00 27.37 ? 207  TRP D NE1   1 
ATOM   10017 C  CE2   . TRP D  1 179 ? 122.525 129.269 -5.955  1.00 27.83 ? 207  TRP D CE2   1 
ATOM   10018 C  CE3   . TRP D  1 179 ? 123.587 130.340 -4.067  1.00 27.20 ? 207  TRP D CE3   1 
ATOM   10019 C  CZ2   . TRP D  1 179 ? 121.264 129.762 -5.597  1.00 28.26 ? 207  TRP D CZ2   1 
ATOM   10020 C  CZ3   . TRP D  1 179 ? 122.328 130.836 -3.706  1.00 27.11 ? 207  TRP D CZ3   1 
ATOM   10021 C  CH2   . TRP D  1 179 ? 121.190 130.550 -4.479  1.00 27.81 ? 207  TRP D CH2   1 
ATOM   10022 N  N     . ILE D  1 180 ? 129.189 131.066 -5.836  1.00 25.84 ? 208  ILE D N     1 
ATOM   10023 C  CA    . ILE D  1 180 ? 130.636 130.896 -5.719  1.00 24.94 ? 208  ILE D CA    1 
ATOM   10024 C  C     . ILE D  1 180 ? 131.159 131.315 -4.340  1.00 25.36 ? 208  ILE D C     1 
ATOM   10025 O  O     . ILE D  1 180 ? 131.207 132.499 -3.987  1.00 25.04 ? 208  ILE D O     1 
ATOM   10026 C  CB    . ILE D  1 180 ? 131.396 131.594 -6.873  1.00 25.20 ? 208  ILE D CB    1 
ATOM   10027 C  CG1   . ILE D  1 180 ? 130.839 131.132 -8.222  1.00 23.91 ? 208  ILE D CG1   1 
ATOM   10028 C  CG2   . ILE D  1 180 ? 132.907 131.332 -6.802  1.00 23.47 ? 208  ILE D CG2   1 
ATOM   10029 C  CD1   . ILE D  1 180 ? 130.598 129.601 -8.356  1.00 23.76 ? 208  ILE D CD1   1 
ATOM   10030 N  N     . SER D  1 181 ? 131.551 130.298 -3.579  1.00 25.38 ? 209  SER D N     1 
ATOM   10031 C  CA    . SER D  1 181 ? 132.100 130.446 -2.249  1.00 25.53 ? 209  SER D CA    1 
ATOM   10032 C  C     . SER D  1 181 ? 133.477 131.086 -2.288  1.00 26.15 ? 209  SER D C     1 
ATOM   10033 O  O     . SER D  1 181 ? 134.296 130.796 -3.187  1.00 27.00 ? 209  SER D O     1 
ATOM   10034 C  CB    . SER D  1 181 ? 132.216 129.094 -1.542  1.00 25.00 ? 209  SER D CB    1 
ATOM   10035 O  OG    . SER D  1 181 ? 130.964 128.467 -1.391  1.00 25.07 ? 209  SER D OG    1 
ATOM   10036 N  N     . SER D  1 182 ? 133.721 131.917 -1.279  1.00 25.89 ? 210  SER D N     1 
ATOM   10037 C  CA    . SER D  1 182 ? 134.991 132.625 -1.076  1.00 26.64 ? 210  SER D CA    1 
ATOM   10038 C  C     . SER D  1 182 ? 135.315 133.674 -2.145  1.00 26.47 ? 210  SER D C     1 
ATOM   10039 O  O     . SER D  1 182 ? 136.423 134.197 -2.153  1.00 26.72 ? 210  SER D O     1 
ATOM   10040 C  CB    . SER D  1 182 ? 136.164 131.634 -0.967  1.00 26.51 ? 210  SER D CB    1 
ATOM   10041 O  OG    . SER D  1 182 ? 135.854 130.520 -0.142  1.00 27.55 ? 210  SER D OG    1 
ATOM   10042 N  N     . ALA D  1 183 ? 134.355 133.990 -3.011  1.00 26.81 ? 211  ALA D N     1 
ATOM   10043 C  CA    . ALA D  1 183 ? 134.564 134.872 -4.155  1.00 27.73 ? 211  ALA D CA    1 
ATOM   10044 C  C     . ALA D  1 183 ? 134.984 136.288 -3.759  1.00 28.79 ? 211  ALA D C     1 
ATOM   10045 O  O     . ALA D  1 183 ? 135.715 136.960 -4.499  1.00 28.30 ? 211  ALA D O     1 
ATOM   10046 C  CB    . ALA D  1 183 ? 133.304 134.932 -5.008  1.00 26.84 ? 211  ALA D CB    1 
ATOM   10047 N  N     . GLU D  1 184 ? 134.488 136.753 -2.612  1.00 29.74 ? 212  GLU D N     1 
ATOM   10048 C  CA    . GLU D  1 184 ? 134.754 138.114 -2.168  1.00 31.79 ? 212  GLU D CA    1 
ATOM   10049 C  C     . GLU D  1 184 ? 136.254 138.345 -1.924  1.00 31.47 ? 212  GLU D C     1 
ATOM   10050 O  O     . GLU D  1 184 ? 136.745 139.454 -2.108  1.00 31.07 ? 212  GLU D O     1 
ATOM   10051 C  CB    . GLU D  1 184 ? 133.926 138.431 -0.908  1.00 31.52 ? 212  GLU D CB    1 
ATOM   10052 C  CG    . GLU D  1 184 ? 133.848 139.903 -0.575  1.00 34.96 ? 212  GLU D CG    1 
ATOM   10053 C  CD    . GLU D  1 184 ? 132.836 140.215 0.542   1.00 35.69 ? 212  GLU D CD    1 
ATOM   10054 O  OE1   . GLU D  1 184 ? 132.398 139.287 1.251   1.00 40.91 ? 212  GLU D OE1   1 
ATOM   10055 O  OE2   . GLU D  1 184 ? 132.481 141.402 0.703   1.00 42.23 ? 212  GLU D OE2   1 
ATOM   10056 N  N     . HIS D  1 185 ? 136.973 137.284 -1.547  1.00 31.47 ? 213  HIS D N     1 
ATOM   10057 C  CA    . HIS D  1 185 ? 138.405 137.347 -1.228  1.00 32.24 ? 213  HIS D CA    1 
ATOM   10058 C  C     . HIS D  1 185 ? 139.324 136.655 -2.241  1.00 30.43 ? 213  HIS D C     1 
ATOM   10059 O  O     . HIS D  1 185 ? 140.536 136.854 -2.202  1.00 30.61 ? 213  HIS D O     1 
ATOM   10060 C  CB    . HIS D  1 185 ? 138.642 136.703 0.158   1.00 33.71 ? 213  HIS D CB    1 
ATOM   10061 C  CG    . HIS D  1 185 ? 138.286 137.605 1.306   1.00 36.97 ? 213  HIS D CG    1 
ATOM   10062 N  ND1   . HIS D  1 185 ? 137.181 137.398 2.108   1.00 40.29 ? 213  HIS D ND1   1 
ATOM   10063 C  CD2   . HIS D  1 185 ? 138.880 138.732 1.769   1.00 41.01 ? 213  HIS D CD2   1 
ATOM   10064 C  CE1   . HIS D  1 185 ? 137.116 138.350 3.020   1.00 41.39 ? 213  HIS D CE1   1 
ATOM   10065 N  NE2   . HIS D  1 185 ? 138.135 139.175 2.838   1.00 42.17 ? 213  HIS D NE2   1 
ATOM   10066 N  N     . ALA D  1 186 ? 138.759 135.855 -3.140  1.00 28.16 ? 214  ALA D N     1 
ATOM   10067 C  CA    . ALA D  1 186 ? 139.560 134.992 -4.023  1.00 27.22 ? 214  ALA D CA    1 
ATOM   10068 C  C     . ALA D  1 186 ? 140.406 135.766 -5.030  1.00 26.00 ? 214  ALA D C     1 
ATOM   10069 O  O     . ALA D  1 186 ? 139.936 136.723 -5.629  1.00 25.40 ? 214  ALA D O     1 
ATOM   10070 C  CB    . ALA D  1 186 ? 138.657 134.005 -4.768  1.00 26.10 ? 214  ALA D CB    1 
ATOM   10071 N  N     . GLY D  1 187 ? 141.655 135.335 -5.205  1.00 25.64 ? 215  GLY D N     1 
ATOM   10072 C  CA    . GLY D  1 187 ? 142.564 135.887 -6.219  1.00 25.77 ? 215  GLY D CA    1 
ATOM   10073 C  C     . GLY D  1 187 ? 142.550 135.033 -7.476  1.00 25.72 ? 215  GLY D C     1 
ATOM   10074 O  O     . GLY D  1 187 ? 142.952 135.484 -8.553  1.00 25.24 ? 215  GLY D O     1 
ATOM   10075 N  N     . LEU D  1 188 ? 142.068 133.802 -7.319  1.00 25.64 ? 216  LEU D N     1 
ATOM   10076 C  CA    . LEU D  1 188 ? 142.014 132.811 -8.376  1.00 26.24 ? 216  LEU D CA    1 
ATOM   10077 C  C     . LEU D  1 188 ? 140.646 132.140 -8.447  1.00 25.55 ? 216  LEU D C     1 
ATOM   10078 O  O     . LEU D  1 188 ? 140.112 131.651 -7.448  1.00 24.71 ? 216  LEU D O     1 
ATOM   10079 C  CB    . LEU D  1 188 ? 143.094 131.742 -8.160  1.00 26.23 ? 216  LEU D CB    1 
ATOM   10080 C  CG    . LEU D  1 188 ? 143.170 130.657 -9.234  1.00 28.30 ? 216  LEU D CG    1 
ATOM   10081 C  CD1   . LEU D  1 188 ? 143.688 131.228 -10.569 1.00 27.04 ? 216  LEU D CD1   1 
ATOM   10082 C  CD2   . LEU D  1 188 ? 144.006 129.456 -8.756  1.00 27.16 ? 216  LEU D CD2   1 
ATOM   10083 N  N     . PHE D  1 189 ? 140.123 132.098 -9.661  1.00 25.59 ? 217  PHE D N     1 
ATOM   10084 C  CA    . PHE D  1 189 ? 138.860 131.486 -9.982  1.00 26.47 ? 217  PHE D CA    1 
ATOM   10085 C  C     . PHE D  1 189 ? 139.111 130.316 -10.931 1.00 26.67 ? 217  PHE D C     1 
ATOM   10086 O  O     . PHE D  1 189 ? 139.633 130.511 -12.035 1.00 26.22 ? 217  PHE D O     1 
ATOM   10087 C  CB    . PHE D  1 189 ? 137.926 132.549 -10.593 1.00 26.28 ? 217  PHE D CB    1 
ATOM   10088 C  CG    . PHE D  1 189 ? 137.542 133.621 -9.609  1.00 26.56 ? 217  PHE D CG    1 
ATOM   10089 C  CD1   . PHE D  1 189 ? 136.385 133.498 -8.850  1.00 27.83 ? 217  PHE D CD1   1 
ATOM   10090 C  CD2   . PHE D  1 189 ? 138.381 134.702 -9.369  1.00 25.97 ? 217  PHE D CD2   1 
ATOM   10091 C  CE1   . PHE D  1 189 ? 136.059 134.452 -7.896  1.00 27.88 ? 217  PHE D CE1   1 
ATOM   10092 C  CE2   . PHE D  1 189 ? 138.055 135.658 -8.412  1.00 26.66 ? 217  PHE D CE2   1 
ATOM   10093 C  CZ    . PHE D  1 189 ? 136.885 135.527 -7.678  1.00 26.26 ? 217  PHE D CZ    1 
ATOM   10094 N  N     . LEU D  1 190 ? 138.757 129.107 -10.487 1.00 26.68 ? 218  LEU D N     1 
ATOM   10095 C  CA    . LEU D  1 190 ? 138.833 127.913 -11.326 1.00 27.42 ? 218  LEU D CA    1 
ATOM   10096 C  C     . LEU D  1 190 ? 137.495 127.731 -11.995 1.00 27.20 ? 218  LEU D C     1 
ATOM   10097 O  O     . LEU D  1 190 ? 136.534 127.265 -11.364 1.00 26.85 ? 218  LEU D O     1 
ATOM   10098 C  CB    . LEU D  1 190 ? 139.155 126.655 -10.513 1.00 27.61 ? 218  LEU D CB    1 
ATOM   10099 C  CG    . LEU D  1 190 ? 140.611 126.302 -10.424 1.00 29.97 ? 218  LEU D CG    1 
ATOM   10100 C  CD1   . LEU D  1 190 ? 141.309 127.379 -9.565  1.00 31.54 ? 218  LEU D CD1   1 
ATOM   10101 C  CD2   . LEU D  1 190 ? 140.838 124.903 -9.874  1.00 29.99 ? 218  LEU D CD2   1 
ATOM   10102 N  N     . VAL D  1 191 ? 137.435 128.115 -13.265 1.00 27.09 ? 219  VAL D N     1 
ATOM   10103 C  CA    . VAL D  1 191 ? 136.190 128.236 -13.972 1.00 26.46 ? 219  VAL D CA    1 
ATOM   10104 C  C     . VAL D  1 191 ? 135.990 127.108 -14.972 1.00 25.95 ? 219  VAL D C     1 
ATOM   10105 O  O     . VAL D  1 191 ? 136.847 126.845 -15.815 1.00 25.66 ? 219  VAL D O     1 
ATOM   10106 C  CB    . VAL D  1 191 ? 136.093 129.621 -14.670 1.00 26.81 ? 219  VAL D CB    1 
ATOM   10107 C  CG1   . VAL D  1 191 ? 134.710 129.807 -15.296 1.00 25.40 ? 219  VAL D CG1   1 
ATOM   10108 C  CG2   . VAL D  1 191 ? 136.387 130.760 -13.658 1.00 25.81 ? 219  VAL D CG2   1 
ATOM   10109 N  N     . MET D  1 192 ? 134.846 126.440 -14.858 1.00 25.27 ? 220  MET D N     1 
ATOM   10110 C  CA    . MET D  1 192 ? 134.423 125.438 -15.829 1.00 25.24 ? 220  MET D CA    1 
ATOM   10111 C  C     . MET D  1 192 ? 133.537 126.117 -16.888 1.00 24.91 ? 220  MET D C     1 
ATOM   10112 O  O     . MET D  1 192 ? 132.524 126.746 -16.558 1.00 24.70 ? 220  MET D O     1 
ATOM   10113 C  CB    . MET D  1 192 ? 133.689 124.276 -15.124 1.00 25.24 ? 220  MET D CB    1 
ATOM   10114 C  CG    . MET D  1 192 ? 134.601 123.101 -14.749 1.00 26.72 ? 220  MET D CG    1 
ATOM   10115 S  SD    . MET D  1 192 ? 135.992 123.496 -13.687 1.00 30.53 ? 220  MET D SD    1 
ATOM   10116 C  CE    . MET D  1 192 ? 135.148 123.997 -12.167 1.00 33.51 ? 220  MET D CE    1 
ATOM   10117 N  N     . ALA D  1 193 ? 133.973 126.030 -18.141 1.00 24.78 ? 221  ALA D N     1 
ATOM   10118 C  CA    . ALA D  1 193 ? 133.315 126.662 -19.277 1.00 25.47 ? 221  ALA D CA    1 
ATOM   10119 C  C     . ALA D  1 193 ? 133.356 125.692 -20.439 1.00 25.86 ? 221  ALA D C     1 
ATOM   10120 O  O     . ALA D  1 193 ? 134.263 124.858 -20.534 1.00 26.54 ? 221  ALA D O     1 
ATOM   10121 C  CB    . ALA D  1 193 ? 134.017 127.993 -19.673 1.00 24.70 ? 221  ALA D CB    1 
ATOM   10122 N  N     . ASN D  1 194 ? 132.386 125.808 -21.333 1.00 25.98 ? 222  ASN D N     1 
ATOM   10123 C  CA    . ASN D  1 194 ? 132.298 124.904 -22.460 1.00 26.49 ? 222  ASN D CA    1 
ATOM   10124 C  C     . ASN D  1 194 ? 132.904 125.495 -23.751 1.00 26.55 ? 222  ASN D C     1 
ATOM   10125 O  O     . ASN D  1 194 ? 132.474 126.543 -24.238 1.00 25.64 ? 222  ASN D O     1 
ATOM   10126 C  CB    . ASN D  1 194 ? 130.842 124.469 -22.655 1.00 26.72 ? 222  ASN D CB    1 
ATOM   10127 C  CG    . ASN D  1 194 ? 130.731 123.182 -23.438 1.00 26.50 ? 222  ASN D CG    1 
ATOM   10128 O  OD1   . ASN D  1 194 ? 131.468 122.982 -24.398 1.00 27.16 ? 222  ASN D OD1   1 
ATOM   10129 N  ND2   . ASN D  1 194 ? 129.822 122.296 -23.027 1.00 27.71 ? 222  ASN D ND2   1 
ATOM   10130 N  N     . VAL D  1 195 ? 133.902 124.806 -24.298 1.00 27.17 ? 223  VAL D N     1 
ATOM   10131 C  CA    . VAL D  1 195 ? 134.543 125.230 -25.545 1.00 28.00 ? 223  VAL D CA    1 
ATOM   10132 C  C     . VAL D  1 195 ? 133.759 124.842 -26.805 1.00 29.25 ? 223  VAL D C     1 
ATOM   10133 O  O     . VAL D  1 195 ? 133.996 125.405 -27.875 1.00 28.99 ? 223  VAL D O     1 
ATOM   10134 C  CB    . VAL D  1 195 ? 136.009 124.714 -25.663 1.00 27.85 ? 223  VAL D CB    1 
ATOM   10135 C  CG1   . VAL D  1 195 ? 136.818 125.145 -24.433 1.00 26.81 ? 223  VAL D CG1   1 
ATOM   10136 C  CG2   . VAL D  1 195 ? 136.044 123.193 -25.843 1.00 27.67 ? 223  VAL D CG2   1 
ATOM   10137 N  N     . ASP D  1 196 ? 132.843 123.890 -26.667 1.00 30.74 ? 224  ASP D N     1 
ATOM   10138 C  CA    . ASP D  1 196 ? 132.070 123.363 -27.796 1.00 32.28 ? 224  ASP D CA    1 
ATOM   10139 C  C     . ASP D  1 196 ? 130.724 122.816 -27.303 1.00 32.80 ? 224  ASP D C     1 
ATOM   10140 O  O     . ASP D  1 196 ? 130.543 121.602 -27.133 1.00 32.80 ? 224  ASP D O     1 
ATOM   10141 C  CB    . ASP D  1 196 ? 132.878 122.271 -28.506 1.00 32.89 ? 224  ASP D CB    1 
ATOM   10142 C  CG    . ASP D  1 196 ? 132.268 121.845 -29.845 1.00 34.28 ? 224  ASP D CG    1 
ATOM   10143 O  OD1   . ASP D  1 196 ? 132.943 121.066 -30.550 1.00 38.20 ? 224  ASP D OD1   1 
ATOM   10144 O  OD2   . ASP D  1 196 ? 131.141 122.269 -30.193 1.00 34.95 ? 224  ASP D OD2   1 
ATOM   10145 N  N     . PRO D  1 197 ? 129.770 123.719 -27.039 1.00 33.88 ? 225  PRO D N     1 
ATOM   10146 C  CA    . PRO D  1 197 ? 128.476 123.294 -26.498 1.00 34.66 ? 225  PRO D CA    1 
ATOM   10147 C  C     . PRO D  1 197 ? 127.735 122.199 -27.291 1.00 35.31 ? 225  PRO D C     1 
ATOM   10148 O  O     . PRO D  1 197 ? 126.924 121.483 -26.711 1.00 35.78 ? 225  PRO D O     1 
ATOM   10149 C  CB    . PRO D  1 197 ? 127.677 124.606 -26.466 1.00 34.94 ? 225  PRO D CB    1 
ATOM   10150 C  CG    . PRO D  1 197 ? 128.704 125.645 -26.282 1.00 34.03 ? 225  PRO D CG    1 
ATOM   10151 C  CD    . PRO D  1 197 ? 129.842 125.186 -27.160 1.00 33.93 ? 225  PRO D CD    1 
ATOM   10152 N  N     . THR D  1 198 ? 128.047 122.041 -28.580 1.00 36.05 ? 226  THR D N     1 
ATOM   10153 C  CA    . THR D  1 198 ? 127.409 121.021 -29.427 1.00 36.15 ? 226  THR D CA    1 
ATOM   10154 C  C     . THR D  1 198 ? 127.804 119.574 -29.073 1.00 36.33 ? 226  THR D C     1 
ATOM   10155 O  O     . THR D  1 198 ? 127.084 118.641 -29.446 1.00 36.53 ? 226  THR D O     1 
ATOM   10156 C  CB    . THR D  1 198 ? 127.649 121.290 -30.939 1.00 36.46 ? 226  THR D CB    1 
ATOM   10157 O  OG1   . THR D  1 198 ? 129.012 121.011 -31.298 1.00 36.45 ? 226  THR D OG1   1 
ATOM   10158 C  CG2   . THR D  1 198 ? 127.317 122.739 -31.290 1.00 36.63 ? 226  THR D CG2   1 
ATOM   10159 N  N     . ILE D  1 199 ? 128.913 119.375 -28.348 1.00 35.74 ? 227  ILE D N     1 
ATOM   10160 C  CA    . ILE D  1 199 ? 129.269 118.029 -27.854 1.00 35.73 ? 227  ILE D CA    1 
ATOM   10161 C  C     . ILE D  1 199 ? 128.931 117.799 -26.371 1.00 35.30 ? 227  ILE D C     1 
ATOM   10162 O  O     . ILE D  1 199 ? 129.375 116.819 -25.758 1.00 35.61 ? 227  ILE D O     1 
ATOM   10163 C  CB    . ILE D  1 199 ? 130.753 117.654 -28.160 1.00 36.09 ? 227  ILE D CB    1 
ATOM   10164 C  CG1   . ILE D  1 199 ? 131.748 118.567 -27.419 1.00 36.55 ? 227  ILE D CG1   1 
ATOM   10165 C  CG2   . ILE D  1 199 ? 130.987 117.681 -29.671 1.00 36.36 ? 227  ILE D CG2   1 
ATOM   10166 C  CD1   . ILE D  1 199 ? 133.198 118.111 -27.550 1.00 35.75 ? 227  ILE D CD1   1 
ATOM   10167 N  N     . GLY D  1 200 ? 128.126 118.694 -25.802 1.00 34.48 ? 228  GLY D N     1 
ATOM   10168 C  CA    . GLY D  1 200 ? 127.670 118.547 -24.430 1.00 33.85 ? 228  GLY D CA    1 
ATOM   10169 C  C     . GLY D  1 200 ? 128.784 118.628 -23.409 1.00 33.37 ? 228  GLY D C     1 
ATOM   10170 O  O     . GLY D  1 200 ? 129.680 119.467 -23.524 1.00 32.70 ? 228  GLY D O     1 
ATOM   10171 N  N     . TYR D  1 201 ? 128.726 117.741 -22.413 1.00 33.15 ? 229  TYR D N     1 
ATOM   10172 C  CA    . TYR D  1 201 ? 129.673 117.763 -21.299 1.00 33.22 ? 229  TYR D CA    1 
ATOM   10173 C  C     . TYR D  1 201 ? 131.134 117.559 -21.695 1.00 32.41 ? 229  TYR D C     1 
ATOM   10174 O  O     . TYR D  1 201 ? 132.043 118.050 -21.006 1.00 32.10 ? 229  TYR D O     1 
ATOM   10175 C  CB    . TYR D  1 201 ? 129.274 116.771 -20.196 1.00 33.76 ? 229  TYR D CB    1 
ATOM   10176 C  CG    . TYR D  1 201 ? 129.349 115.280 -20.498 1.00 34.27 ? 229  TYR D CG    1 
ATOM   10177 C  CD1   . TYR D  1 201 ? 130.534 114.565 -20.334 1.00 35.13 ? 229  TYR D CD1   1 
ATOM   10178 C  CD2   . TYR D  1 201 ? 128.200 114.568 -20.863 1.00 36.90 ? 229  TYR D CD2   1 
ATOM   10179 C  CE1   . TYR D  1 201 ? 130.592 113.182 -20.580 1.00 35.51 ? 229  TYR D CE1   1 
ATOM   10180 C  CE2   . TYR D  1 201 ? 128.239 113.181 -21.100 1.00 36.84 ? 229  TYR D CE2   1 
ATOM   10181 C  CZ    . TYR D  1 201 ? 129.437 112.497 -20.952 1.00 36.30 ? 229  TYR D CZ    1 
ATOM   10182 O  OH    . TYR D  1 201 ? 129.475 111.140 -21.176 1.00 35.84 ? 229  TYR D OH    1 
ATOM   10183 N  N     . LYS D  1 202 ? 131.356 116.850 -22.802 1.00 31.45 ? 230  LYS D N     1 
ATOM   10184 C  CA    . LYS D  1 202 ? 132.713 116.606 -23.290 1.00 30.59 ? 230  LYS D CA    1 
ATOM   10185 C  C     . LYS D  1 202 ? 133.414 117.865 -23.844 1.00 29.42 ? 230  LYS D C     1 
ATOM   10186 O  O     . LYS D  1 202 ? 134.599 117.819 -24.142 1.00 28.82 ? 230  LYS D O     1 
ATOM   10187 C  CB    . LYS D  1 202 ? 132.709 115.439 -24.287 1.00 31.10 ? 230  LYS D CB    1 
ATOM   10188 C  CG    . LYS D  1 202 ? 132.382 114.102 -23.574 1.00 30.97 ? 230  LYS D CG    1 
ATOM   10189 C  CD    . LYS D  1 202 ? 132.452 112.870 -24.477 1.00 31.35 ? 230  LYS D CD    1 
ATOM   10190 C  CE    . LYS D  1 202 ? 132.531 111.593 -23.635 1.00 32.18 ? 230  LYS D CE    1 
ATOM   10191 N  NZ    . LYS D  1 202 ? 132.390 110.312 -24.417 1.00 31.25 ? 230  LYS D NZ    1 
ATOM   10192 N  N     . GLY D  1 203 ? 132.706 118.993 -23.934 1.00 28.32 ? 231  GLY D N     1 
ATOM   10193 C  CA    . GLY D  1 203 ? 133.344 120.281 -24.231 1.00 27.31 ? 231  GLY D CA    1 
ATOM   10194 C  C     . GLY D  1 203 ? 133.811 121.092 -23.015 1.00 26.36 ? 231  GLY D C     1 
ATOM   10195 O  O     . GLY D  1 203 ? 134.511 122.114 -23.173 1.00 25.13 ? 231  GLY D O     1 
ATOM   10196 N  N     . ILE D  1 204 ? 133.428 120.641 -21.820 1.00 25.81 ? 232  ILE D N     1 
ATOM   10197 C  CA    . ILE D  1 204 ? 133.643 121.379 -20.585 1.00 25.65 ? 232  ILE D CA    1 
ATOM   10198 C  C     . ILE D  1 204 ? 135.124 121.346 -20.216 1.00 25.65 ? 232  ILE D C     1 
ATOM   10199 O  O     . ILE D  1 204 ? 135.762 120.278 -20.172 1.00 25.70 ? 232  ILE D O     1 
ATOM   10200 C  CB    . ILE D  1 204 ? 132.794 120.840 -19.397 1.00 26.13 ? 232  ILE D CB    1 
ATOM   10201 C  CG1   . ILE D  1 204 ? 131.291 121.094 -19.623 1.00 26.47 ? 232  ILE D CG1   1 
ATOM   10202 C  CG2   . ILE D  1 204 ? 133.201 121.519 -18.085 1.00 24.33 ? 232  ILE D CG2   1 
ATOM   10203 C  CD1   . ILE D  1 204 ? 130.401 120.356 -18.658 1.00 24.41 ? 232  ILE D CD1   1 
ATOM   10204 N  N     . THR D  1 205 ? 135.646 122.533 -19.943 1.00 25.44 ? 233  THR D N     1 
ATOM   10205 C  CA    . THR D  1 205 ? 137.072 122.746 -19.785 1.00 25.02 ? 233  THR D CA    1 
ATOM   10206 C  C     . THR D  1 205 ? 137.278 123.619 -18.549 1.00 25.46 ? 233  THR D C     1 
ATOM   10207 O  O     . THR D  1 205 ? 136.482 124.528 -18.269 1.00 25.49 ? 233  THR D O     1 
ATOM   10208 C  CB    . THR D  1 205 ? 137.665 123.386 -21.080 1.00 25.19 ? 233  THR D CB    1 
ATOM   10209 O  OG1   . THR D  1 205 ? 137.416 122.516 -22.195 1.00 23.63 ? 233  THR D OG1   1 
ATOM   10210 C  CG2   . THR D  1 205 ? 139.178 123.682 -20.985 1.00 22.51 ? 233  THR D CG2   1 
ATOM   10211 N  N     . SER D  1 206 ? 138.335 123.318 -17.809 1.00 25.10 ? 234  SER D N     1 
ATOM   10212 C  CA    . SER D  1 206 ? 138.721 124.075 -16.611 1.00 25.75 ? 234  SER D CA    1 
ATOM   10213 C  C     . SER D  1 206 ? 139.717 125.185 -16.943 1.00 25.04 ? 234  SER D C     1 
ATOM   10214 O  O     . SER D  1 206 ? 140.730 124.920 -17.599 1.00 24.80 ? 234  SER D O     1 
ATOM   10215 C  CB    . SER D  1 206 ? 139.365 123.126 -15.587 1.00 25.58 ? 234  SER D CB    1 
ATOM   10216 O  OG    . SER D  1 206 ? 138.480 122.067 -15.234 1.00 29.59 ? 234  SER D OG    1 
ATOM   10217 N  N     . PHE D  1 207 ? 139.422 126.409 -16.489 1.00 24.70 ? 235  PHE D N     1 
ATOM   10218 C  CA    . PHE D  1 207 ? 140.279 127.585 -16.692 1.00 24.76 ? 235  PHE D CA    1 
ATOM   10219 C  C     . PHE D  1 207 ? 140.725 128.234 -15.380 1.00 25.27 ? 235  PHE D C     1 
ATOM   10220 O  O     . PHE D  1 207 ? 139.936 128.391 -14.436 1.00 25.18 ? 235  PHE D O     1 
ATOM   10221 C  CB    . PHE D  1 207 ? 139.582 128.652 -17.555 1.00 25.06 ? 235  PHE D CB    1 
ATOM   10222 C  CG    . PHE D  1 207 ? 139.258 128.201 -18.956 1.00 25.27 ? 235  PHE D CG    1 
ATOM   10223 C  CD1   . PHE D  1 207 ? 140.122 128.487 -20.012 1.00 25.62 ? 235  PHE D CD1   1 
ATOM   10224 C  CD2   . PHE D  1 207 ? 138.071 127.529 -19.234 1.00 25.29 ? 235  PHE D CD2   1 
ATOM   10225 C  CE1   . PHE D  1 207 ? 139.813 128.085 -21.315 1.00 24.60 ? 235  PHE D CE1   1 
ATOM   10226 C  CE2   . PHE D  1 207 ? 137.763 127.136 -20.543 1.00 24.19 ? 235  PHE D CE2   1 
ATOM   10227 C  CZ    . PHE D  1 207 ? 138.649 127.406 -21.566 1.00 25.14 ? 235  PHE D CZ    1 
ATOM   10228 N  N     . LEU D  1 208 ? 141.996 128.623 -15.345 1.00 25.03 ? 236  LEU D N     1 
ATOM   10229 C  CA    . LEU D  1 208 ? 142.554 129.385 -14.239 1.00 25.39 ? 236  LEU D CA    1 
ATOM   10230 C  C     . LEU D  1 208 ? 142.447 130.882 -14.538 1.00 24.83 ? 236  LEU D C     1 
ATOM   10231 O  O     . LEU D  1 208 ? 143.216 131.439 -15.323 1.00 25.72 ? 236  LEU D O     1 
ATOM   10232 C  CB    . LEU D  1 208 ? 144.003 128.964 -14.007 1.00 25.37 ? 236  LEU D CB    1 
ATOM   10233 C  CG    . LEU D  1 208 ? 144.244 127.474 -13.718 1.00 26.24 ? 236  LEU D CG    1 
ATOM   10234 C  CD1   . LEU D  1 208 ? 145.640 127.094 -14.069 1.00 24.51 ? 236  LEU D CD1   1 
ATOM   10235 C  CD2   . LEU D  1 208 ? 143.962 127.127 -12.253 1.00 27.40 ? 236  LEU D CD2   1 
ATOM   10236 N  N     . VAL D  1 209 ? 141.451 131.515 -13.937 1.00 24.51 ? 237  VAL D N     1 
ATOM   10237 C  CA    . VAL D  1 209 ? 141.132 132.896 -14.205 1.00 24.56 ? 237  VAL D CA    1 
ATOM   10238 C  C     . VAL D  1 209 ? 141.533 133.742 -12.996 1.00 24.50 ? 237  VAL D C     1 
ATOM   10239 O  O     . VAL D  1 209 ? 141.121 133.456 -11.869 1.00 24.93 ? 237  VAL D O     1 
ATOM   10240 C  CB    . VAL D  1 209 ? 139.626 133.081 -14.488 1.00 24.25 ? 237  VAL D CB    1 
ATOM   10241 C  CG1   . VAL D  1 209 ? 139.326 134.542 -14.826 1.00 24.32 ? 237  VAL D CG1   1 
ATOM   10242 C  CG2   . VAL D  1 209 ? 139.184 132.145 -15.638 1.00 24.12 ? 237  VAL D CG2   1 
ATOM   10243 N  N     . ASP D  1 210 ? 142.347 134.764 -13.234 1.00 24.70 ? 238  ASP D N     1 
ATOM   10244 C  CA    . ASP D  1 210 ? 142.731 135.699 -12.181 1.00 24.81 ? 238  ASP D CA    1 
ATOM   10245 C  C     . ASP D  1 210 ? 141.600 136.674 -11.860 1.00 25.30 ? 238  ASP D C     1 
ATOM   10246 O  O     . ASP D  1 210 ? 140.913 137.156 -12.761 1.00 25.21 ? 238  ASP D O     1 
ATOM   10247 C  CB    . ASP D  1 210 ? 143.981 136.467 -12.597 1.00 25.37 ? 238  ASP D CB    1 
ATOM   10248 C  CG    . ASP D  1 210 ? 145.170 135.556 -12.871 1.00 26.39 ? 238  ASP D CG    1 
ATOM   10249 O  OD1   . ASP D  1 210 ? 145.389 134.596 -12.098 1.00 29.32 ? 238  ASP D OD1   1 
ATOM   10250 O  OD2   . ASP D  1 210 ? 145.893 135.801 -13.863 1.00 26.86 ? 238  ASP D OD2   1 
ATOM   10251 N  N     . ARG D  1 211 ? 141.430 136.987 -10.577 1.00 25.81 ? 239  ARG D N     1 
ATOM   10252 C  CA    . ARG D  1 211 ? 140.387 137.929 -10.113 1.00 26.67 ? 239  ARG D CA    1 
ATOM   10253 C  C     . ARG D  1 211 ? 140.234 139.207 -10.972 1.00 26.72 ? 239  ARG D C     1 
ATOM   10254 O  O     . ARG D  1 211 ? 139.127 139.575 -11.390 1.00 26.98 ? 239  ARG D O     1 
ATOM   10255 C  CB    . ARG D  1 211 ? 140.682 138.370 -8.675  1.00 26.55 ? 239  ARG D CB    1 
ATOM   10256 C  CG    . ARG D  1 211 ? 139.616 139.263 -8.066  1.00 26.26 ? 239  ARG D CG    1 
ATOM   10257 C  CD    . ARG D  1 211 ? 140.070 139.833 -6.736  1.00 27.06 ? 239  ARG D CD    1 
ATOM   10258 N  NE    . ARG D  1 211 ? 139.004 140.607 -6.107  1.00 27.98 ? 239  ARG D NE    1 
ATOM   10259 C  CZ    . ARG D  1 211 ? 137.973 140.083 -5.442  1.00 28.51 ? 239  ARG D CZ    1 
ATOM   10260 N  NH1   . ARG D  1 211 ? 137.867 138.788 -5.259  1.00 27.47 ? 239  ARG D NH1   1 
ATOM   10261 N  NH2   . ARG D  1 211 ? 137.054 140.883 -4.909  1.00 29.93 ? 239  ARG D NH2   1 
ATOM   10262 N  N     . ASP D  1 212 ? 141.351 139.876 -11.217 1.00 26.50 ? 240  ASP D N     1 
ATOM   10263 C  CA    . ASP D  1 212 ? 141.353 141.211 -11.815 1.00 26.63 ? 240  ASP D CA    1 
ATOM   10264 C  C     . ASP D  1 212 ? 141.462 141.191 -13.340 1.00 26.21 ? 240  ASP D C     1 
ATOM   10265 O  O     . ASP D  1 212 ? 142.114 142.037 -13.939 1.00 27.21 ? 240  ASP D O     1 
ATOM   10266 C  CB    . ASP D  1 212 ? 142.489 142.033 -11.213 1.00 26.46 ? 240  ASP D CB    1 
ATOM   10267 C  CG    . ASP D  1 212 ? 142.363 142.168 -9.713  1.00 28.49 ? 240  ASP D CG    1 
ATOM   10268 O  OD1   . ASP D  1 212 ? 141.294 142.635 -9.259  1.00 30.14 ? 240  ASP D OD1   1 
ATOM   10269 O  OD2   . ASP D  1 212 ? 143.301 141.767 -8.992  1.00 29.37 ? 240  ASP D OD2   1 
ATOM   10270 N  N     . THR D  1 213 ? 140.807 140.225 -13.958 1.00 25.76 ? 241  THR D N     1 
ATOM   10271 C  CA    . THR D  1 213 ? 140.750 140.118 -15.396 1.00 25.94 ? 241  THR D CA    1 
ATOM   10272 C  C     . THR D  1 213 ? 139.549 140.921 -15.875 1.00 25.39 ? 241  THR D C     1 
ATOM   10273 O  O     . THR D  1 213 ? 138.430 140.668 -15.434 1.00 25.34 ? 241  THR D O     1 
ATOM   10274 C  CB    . THR D  1 213 ? 140.628 138.653 -15.828 1.00 26.24 ? 241  THR D CB    1 
ATOM   10275 O  OG1   . THR D  1 213 ? 141.678 137.896 -15.205 1.00 26.19 ? 241  THR D OG1   1 
ATOM   10276 C  CG2   . THR D  1 213 ? 140.725 138.528 -17.341 1.00 26.25 ? 241  THR D CG2   1 
ATOM   10277 N  N     . PRO D  1 214 ? 139.779 141.926 -16.744 1.00 25.71 ? 242  PRO D N     1 
ATOM   10278 C  CA    . PRO D  1 214 ? 138.662 142.690 -17.314 1.00 25.39 ? 242  PRO D CA    1 
ATOM   10279 C  C     . PRO D  1 214 ? 137.518 141.819 -17.864 1.00 24.89 ? 242  PRO D C     1 
ATOM   10280 O  O     . PRO D  1 214 ? 137.754 140.828 -18.552 1.00 24.82 ? 242  PRO D O     1 
ATOM   10281 C  CB    . PRO D  1 214 ? 139.329 143.498 -18.428 1.00 25.91 ? 242  PRO D CB    1 
ATOM   10282 C  CG    . PRO D  1 214 ? 140.711 143.741 -17.915 1.00 25.79 ? 242  PRO D CG    1 
ATOM   10283 C  CD    . PRO D  1 214 ? 141.077 142.438 -17.216 1.00 26.00 ? 242  PRO D CD    1 
ATOM   10284 N  N     . GLY D  1 215 ? 136.290 142.207 -17.540 1.00 25.00 ? 243  GLY D N     1 
ATOM   10285 C  CA    . GLY D  1 215 ? 135.109 141.463 -17.936 1.00 24.99 ? 243  GLY D CA    1 
ATOM   10286 C  C     . GLY D  1 215 ? 134.569 140.530 -16.869 1.00 25.02 ? 243  GLY D C     1 
ATOM   10287 O  O     . GLY D  1 215 ? 133.421 140.100 -16.970 1.00 24.16 ? 243  GLY D O     1 
ATOM   10288 N  N     . LEU D  1 216 ? 135.384 140.214 -15.853 1.00 25.05 ? 244  LEU D N     1 
ATOM   10289 C  CA    . LEU D  1 216 ? 134.942 139.400 -14.718 1.00 25.45 ? 244  LEU D CA    1 
ATOM   10290 C  C     . LEU D  1 216 ? 134.364 140.290 -13.623 1.00 25.48 ? 244  LEU D C     1 
ATOM   10291 O  O     . LEU D  1 216 ? 135.070 141.142 -13.047 1.00 24.50 ? 244  LEU D O     1 
ATOM   10292 C  CB    . LEU D  1 216 ? 136.091 138.559 -14.150 1.00 25.76 ? 244  LEU D CB    1 
ATOM   10293 C  CG    . LEU D  1 216 ? 135.840 137.688 -12.906 1.00 26.03 ? 244  LEU D CG    1 
ATOM   10294 C  CD1   . LEU D  1 216 ? 134.619 136.815 -13.028 1.00 25.84 ? 244  LEU D CD1   1 
ATOM   10295 C  CD2   . LEU D  1 216 ? 137.096 136.856 -12.635 1.00 26.22 ? 244  LEU D CD2   1 
ATOM   10296 N  N     . HIS D  1 217 ? 133.075 140.120 -13.355 1.00 25.52 ? 245  HIS D N     1 
ATOM   10297 C  CA    . HIS D  1 217 ? 132.444 140.865 -12.285 1.00 26.17 ? 245  HIS D CA    1 
ATOM   10298 C  C     . HIS D  1 217 ? 131.980 139.922 -11.180 1.00 26.53 ? 245  HIS D C     1 
ATOM   10299 O  O     . HIS D  1 217 ? 131.389 138.865 -11.426 1.00 25.47 ? 245  HIS D O     1 
ATOM   10300 C  CB    . HIS D  1 217 ? 131.345 141.838 -12.788 1.00 26.94 ? 245  HIS D CB    1 
ATOM   10301 C  CG    A HIS D  1 217 ? 130.460 142.341 -11.680 0.50 27.09 ? 245  HIS D CG    1 
ATOM   10302 C  CG    B HIS D  1 217 ? 131.640 142.383 -14.155 0.50 26.76 ? 245  HIS D CG    1 
ATOM   10303 N  ND1   A HIS D  1 217 ? 129.248 141.767 -11.357 0.50 29.18 ? 245  HIS D ND1   1 
ATOM   10304 N  ND1   B HIS D  1 217 ? 132.168 143.645 -14.343 0.50 28.59 ? 245  HIS D ND1   1 
ATOM   10305 C  CD2   A HIS D  1 217 ? 130.602 143.402 -10.848 0.50 27.87 ? 245  HIS D CD2   1 
ATOM   10306 C  CD2   B HIS D  1 217 ? 131.459 141.864 -15.393 0.50 27.34 ? 245  HIS D CD2   1 
ATOM   10307 C  CE1   A HIS D  1 217 ? 128.693 142.442 -10.367 0.50 28.29 ? 245  HIS D CE1   1 
ATOM   10308 C  CE1   B HIS D  1 217 ? 132.312 143.873 -15.636 0.50 27.95 ? 245  HIS D CE1   1 
ATOM   10309 N  NE2   A HIS D  1 217 ? 129.497 143.435 -10.035 0.50 27.66 ? 245  HIS D NE2   1 
ATOM   10310 N  NE2   B HIS D