data_2JIL
# 
_entry.id   2JIL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JIL         
PDBE  EBI-33052    
WWPDB D_1290033052 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2JIL 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tickle, J.'        1  
'Elkins, J.'        2  
'Pike, A.C.W.'      3  
'Cooper, C.'        4  
'Salah, E.'         5  
'Papagrigoriou, E.' 6  
'von Delft, F.'     7  
'Edwards, A.'       8  
'Arrowsmith, C.H.'  9  
'Weigelt, J.'       10 
'Sundstrom, M.'     11 
'Doyle, D.'         12 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of 2Nd Pdz Domain of Glutamate Receptor Interacting Protein-1 (Grip1)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tickle, J.'        1  
primary 'Elkins, J.'        2  
primary 'Pike, A.C.W.'      3  
primary 'Cooper, C.'        4  
primary 'Salah, E.'         5  
primary 'Papagrigoriou, E.' 6  
primary 'von Delft, F.'     7  
primary 'Edwards, A.'       8  
primary 'Arrowsmith, C.H.'  9  
primary 'Weigelt, J.'       10 
primary 'Sundstrom, M.'     11 
primary 'Doyle, D.'         12 
# 
_cell.entry_id           2JIL 
_cell.length_a           56.060 
_cell.length_b           61.057 
_cell.length_c           96.397 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JIL 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLUTAMATE RECEPTOR INTERACTING PROTEIN-1' 10429.821 2   ? YES 'PDZ DOMAIN 2, RESIDUES 149-239' ? 
2 non-polymer syn 'THIOCYANATE ION'                          58.082    2   ? ?   ?                                ? 
3 non-polymer syn 1,2-ETHANEDIOL                             62.068    3   ? ?   ?                                ? 
4 water       nat water                                      18.015    151 ? ?   ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GRIP1 PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITSVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQC
GQEAALLIEYDVSETAV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITSVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQC
GQEAALLIEYDVSETAV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  ARG n 
1 4  THR n 
1 5  VAL n 
1 6  GLU n 
1 7  VAL n 
1 8  THR n 
1 9  LEU n 
1 10 HIS n 
1 11 LYS n 
1 12 GLU n 
1 13 GLY n 
1 14 ASN n 
1 15 THR n 
1 16 PHE n 
1 17 GLY n 
1 18 PHE n 
1 19 VAL n 
1 20 ILE n 
1 21 ARG n 
1 22 GLY n 
1 23 GLY n 
1 24 ALA n 
1 25 HIS n 
1 26 ASP n 
1 27 ASP n 
1 28 ARG n 
1 29 ASN n 
1 30 LYS n 
1 31 SER n 
1 32 ARG n 
1 33 PRO n 
1 34 VAL n 
1 35 VAL n 
1 36 ILE n 
1 37 THR n 
1 38 SER n 
1 39 VAL n 
1 40 ARG n 
1 41 PRO n 
1 42 GLY n 
1 43 GLY n 
1 44 PRO n 
1 45 ALA n 
1 46 ASP n 
1 47 ARG n 
1 48 GLU n 
1 49 GLY n 
1 50 THR n 
1 51 ILE n 
1 52 LYS n 
1 53 PRO n 
1 54 GLY n 
1 55 ASP n 
1 56 ARG n 
1 57 LEU n 
1 58 LEU n 
1 59 SER n 
1 60 VAL n 
1 61 ASP n 
1 62 GLY n 
1 63 ILE n 
1 64 ARG n 
1 65 LEU n 
1 66 LEU n 
1 67 GLY n 
1 68 THR n 
1 69 THR n 
1 70 HIS n 
1 71 ALA n 
1 72 GLU n 
1 73 ALA n 
1 74 MET n 
1 75 SER n 
1 76 ILE n 
1 77 LEU n 
1 78 LYS n 
1 79 GLN n 
1 80 CYS n 
1 81 GLY n 
1 82 GLN n 
1 83 GLU n 
1 84 ALA n 
1 85 ALA n 
1 86 LEU n 
1 87 LEU n 
1 88 ILE n 
1 89 GLU n 
1 90 TYR n 
1 91 ASP n 
1 92 VAL n 
1 93 SER n 
1 94 GLU n 
1 95 THR n 
1 96 ALA n 
1 97 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC28-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2JIL        1 ? ? 2JIL   ? 
2 UNP GRIP1_HUMAN 1 ? ? Q9Y3R0 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JIL A 1  ? 2  ? 2JIL   -1  ? 0   ? -1  0   
2 2 2JIL A 3  ? 93 ? Q9Y3R0 149 ? 239 ? 149 239 
3 1 2JIL A 94 ? 97 ? 2JIL   240 ? 243 ? 240 243 
4 1 2JIL B 1  ? 2  ? 2JIL   -1  ? 0   ? -1  0   
5 2 2JIL B 3  ? 93 ? Q9Y3R0 149 ? 239 ? 149 239 
6 1 2JIL B 94 ? 97 ? 2JIL   240 ? 243 ? 240 243 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JIL SER A 38 ? UNP Q9Y3R0 CYS 184 'engineered mutation' 184 1 
4 2JIL SER B 38 ? UNP Q9Y3R0 CYS 184 'engineered mutation' 184 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL    'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
SCN non-polymer         . 'THIOCYANATE ION' ?                 'C N S -1'       58.082  
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2JIL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.98 
_exptl_crystal.density_percent_sol   38 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.20M POTASSIUM THIOCYANATE, 10% ETHYLENE GLYCOL, 0.1M BIS TRIS PROPANE PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-05-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.9999 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2JIL 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             41.310 
_reflns.d_resolution_high            1.500 
_reflns.number_obs                   26857 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.0000 
_reflns.B_iso_Wilson_estimate        21.03 
_reflns.pdbx_redundancy              4.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.58 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.56000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.600 
_reflns_shell.pdbx_redundancy        3.40 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2JIL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     24603 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.22 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.192 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.228 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.300 
_refine.ls_number_reflns_R_free                  2226 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.954 
_refine.B_iso_mean                               17.94 
_refine.aniso_B[1][1]                            0.89000 
_refine.aniso_B[2][2]                            0.19000 
_refine.aniso_B[3][3]                            -1.08000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1N7E 1TQ3 1BE9 1MFG 2HE2 1N7F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.087 
_refine.pdbx_overall_ESU_R_Free                  0.090 
_refine.overall_SU_ML                            0.069 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.642 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1411 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             151 
_refine_hist.number_atoms_total               1580 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        48.22 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.021  ? 1487 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.004  0.020  ? 1020 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.519  1.981  ? 2004 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.678  3.000  ? 2490 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.920  5.000  ? 193  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       29.306 21.724 ? 58   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.705 15.000 ? 259  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.649 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.085  0.200  ? 242  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 1635 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 295  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.264  0.200  ? 306  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.228  0.200  ? 1077 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.164  0.200  ? 706  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.087  0.200  ? 854  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.156  0.200  ? 93   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.367  0.200  ? 39   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.377  0.200  ? 91   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.139  0.200  ? 21   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.646  3.000  ? 960  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.035  5.000  ? 1552 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.146  8.000  ? 527  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.437  11.000 ? 450  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.54 
_refine_ls_shell.number_reflns_R_work             1792 
_refine_ls_shell.R_factor_R_work                  0.3140 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4030 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             166 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.083570 
_struct_ncs_oper.matrix[1][2]   0.996490 
_struct_ncs_oper.matrix[1][3]   -0.004910 
_struct_ncs_oper.matrix[2][1]   0.995870 
_struct_ncs_oper.matrix[2][2]   0.083690 
_struct_ncs_oper.matrix[2][3]   0.035180 
_struct_ncs_oper.matrix[3][1]   0.035460 
_struct_ncs_oper.matrix[3][2]   -0.001950 
_struct_ncs_oper.matrix[3][3]   -0.999370 
_struct_ncs_oper.vector[1]      28.96959 
_struct_ncs_oper.vector[2]      1.05976 
_struct_ncs_oper.vector[3]      23.91029 
# 
_struct.entry_id                  2JIL 
_struct.title                     'Crystal structure of 2nd PDZ domain of glutamate receptor interacting protein-1 (GRIP1)' 
_struct.pdbx_descriptor           'GLUTAMATE RECEPTOR INTERACTING PROTEIN-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JIL 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'ENDOPLASMIC RETICULUM, POSTSYNAPTIC MEMBRANE, MEMBRANE, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 43 ? GLY A 49 ? GLY A 189 GLY A 195 1 ? 7  
HELX_P HELX_P2 2 THR A 69 ? CYS A 80 ? THR A 215 CYS A 226 1 ? 12 
HELX_P HELX_P3 3 ASP B 27 ? SER B 31 ? ASP B 173 SER B 177 5 ? 5  
HELX_P HELX_P4 4 GLY B 43 ? GLY B 49 ? GLY B 189 GLY B 195 1 ? 7  
HELX_P HELX_P5 5 THR B 69 ? CYS B 80 ? THR B 215 CYS B 226 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 3 ? 
BA ? 4 ? 
BB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 2  ? HIS A 10 ? MET A 0   HIS A 156 
AA 2 GLU A 83 ? ASP A 91 ? GLU A 229 ASP A 237 
AA 3 ARG A 56 ? VAL A 60 ? ARG A 202 VAL A 206 
AA 4 ILE A 63 ? ARG A 64 ? ILE A 209 ARG A 210 
AB 1 ARG A 32 ? VAL A 39 ? ARG A 178 VAL A 185 
AB 2 PHE A 18 ? GLY A 23 ? PHE A 164 GLY A 169 
AB 3 GLU B 94 ? ALA B 96 ? GLU B 240 ALA B 242 
BA 1 MET B 2  ? HIS B 10 ? MET B 0   HIS B 156 
BA 2 GLU B 83 ? ASP B 91 ? GLU B 229 ASP B 237 
BA 3 ARG B 56 ? VAL B 60 ? ARG B 202 VAL B 206 
BA 4 ILE B 63 ? ARG B 64 ? ILE B 209 ARG B 210 
BB 1 PHE B 18 ? GLY B 23 ? PHE B 164 GLY B 169 
BB 2 ARG B 32 ? VAL B 39 ? ARG B 178 VAL B 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 9  ? N LEU A 155 O ALA A 84 ? O ALA A 230 
AA 2 3 N GLU A 89 ? N GLU A 235 O ARG A 56 ? O ARG A 202 
AA 3 4 N VAL A 60 ? N VAL A 206 O ILE A 63 ? O ILE A 209 
AB 1 2 N THR A 37 ? N THR A 183 O VAL A 19 ? O VAL A 165 
AB 2 3 N ILE A 20 ? N ILE A 166 O THR B 95 ? O THR B 241 
BA 1 2 N LEU B 9  ? N LEU B 155 O ALA B 84 ? O ALA B 230 
BA 2 3 N GLU B 89 ? N GLU B 235 O ARG B 56 ? O ARG B 202 
BA 3 4 N VAL B 60 ? N VAL B 206 O ILE B 63 ? O ILE B 209 
BB 1 2 N GLY B 23 ? N GLY B 169 O ARG B 32 ? O ARG B 178 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SCN A1244' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SCN A1245' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A1246' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO B1244' 
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO B1245' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG A 21 ? ARG A 167  . ? 1_555 ? 
2  AC1 4 GLY A 22 ? GLY A 168  . ? 1_555 ? 
3  AC1 4 TYR B 90 ? TYR B 236  . ? 1_555 ? 
4  AC1 4 SER B 93 ? SER B 239  . ? 1_555 ? 
5  AC2 4 TYR A 90 ? TYR A 236  . ? 1_555 ? 
6  AC2 4 SER A 93 ? SER A 239  . ? 1_555 ? 
7  AC2 4 ARG B 21 ? ARG B 167  . ? 1_555 ? 
8  AC2 4 GLY B 22 ? GLY B 168  . ? 1_555 ? 
9  AC3 6 THR A 4  ? THR A 150  . ? 1_555 ? 
10 AC3 6 VAL A 5  ? VAL A 151  . ? 1_555 ? 
11 AC3 6 VAL A 92 ? VAL A 238  . ? 1_555 ? 
12 AC3 6 GLU A 94 ? GLU A 240  . ? 1_555 ? 
13 AC3 6 ARG B 21 ? ARG B 167  . ? 1_555 ? 
14 AC3 6 THR B 37 ? THR B 183  . ? 1_555 ? 
15 AC4 4 MET B 2  ? MET B 0    . ? 1_555 ? 
16 AC4 4 ARG B 3  ? ARG B 149  . ? 1_555 ? 
17 AC4 4 THR B 4  ? THR B 150  . ? 1_555 ? 
18 AC4 4 GLU B 89 ? GLU B 235  . ? 1_555 ? 
19 AC5 8 ARG A 64 ? ARG A 210  . ? 1_555 ? 
20 AC5 8 LEU A 66 ? LEU A 212  . ? 1_555 ? 
21 AC5 8 GLY B 17 ? GLY B 163  . ? 1_555 ? 
22 AC5 8 PHE B 18 ? PHE B 164  . ? 1_555 ? 
23 AC5 8 VAL B 19 ? VAL B 165  . ? 1_555 ? 
24 AC5 8 SER B 38 ? SER B 184  . ? 1_555 ? 
25 AC5 8 ARG B 40 ? ARG B 186  . ? 1_555 ? 
26 AC5 8 HOH I .  ? HOH B 2078 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2JIL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2JIL 
_atom_sites.fract_transf_matrix[1][1]   0.017838 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016378 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010374 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1  ? 21.850 -6.573  5.210  1.00 24.46 ? -1   SER A N   1 
ATOM   2    C CA  . SER A 1 1  ? 22.261 -5.402  4.392  1.00 28.75 ? -1   SER A CA  1 
ATOM   3    C C   . SER A 1 1  ? 21.259 -4.289  4.577  1.00 26.83 ? -1   SER A C   1 
ATOM   4    O O   . SER A 1 1  ? 20.161 -4.506  5.101  1.00 24.20 ? -1   SER A O   1 
ATOM   5    C CB  . SER A 1 1  ? 22.373 -5.785  2.910  1.00 34.77 ? -1   SER A CB  1 
ATOM   6    O OG  . SER A 1 1  ? 21.274 -6.588  2.508  1.00 47.29 ? -1   SER A OG  1 
ATOM   7    N N   . MET A 1 2  ? 21.646 -3.098  4.139  1.00 25.35 ? 0    MET A N   1 
ATOM   8    C CA  . MET A 1 2  ? 20.782 -1.916  4.212  1.00 24.44 ? 0    MET A CA  1 
ATOM   9    C C   . MET A 1 2  ? 19.528 -2.104  3.364  1.00 27.19 ? 0    MET A C   1 
ATOM   10   O O   . MET A 1 2  ? 19.588 -2.296  2.155  1.00 27.59 ? 0    MET A O   1 
ATOM   11   C CB  . MET A 1 2  ? 21.559 -0.682  3.760  1.00 26.78 ? 0    MET A CB  1 
ATOM   12   C CG  A MET A 1 2  ? 22.279 0.006   4.904  0.50 32.84 ? 0    MET A CG  1 
ATOM   13   C CG  B MET A 1 2  ? 22.600 -0.160  4.760  0.50 34.66 ? 0    MET A CG  1 
ATOM   14   S SD  A MET A 1 2  ? 21.050 0.994   5.799  0.50 34.06 ? 0    MET A SD  1 
ATOM   15   S SD  B MET A 1 2  ? 22.030 0.249   6.415  0.50 34.29 ? 0    MET A SD  1 
ATOM   16   C CE  A MET A 1 2  ? 21.963 1.570   7.224  0.50 25.15 ? 0    MET A CE  1 
ATOM   17   C CE  B MET A 1 2  ? 20.460 0.990   6.014  0.50 20.43 ? 0    MET A CE  1 
ATOM   18   N N   . ARG A 1 3  ? 18.384 -2.073  4.034  1.00 22.10 ? 149  ARG A N   1 
ATOM   19   C CA  . ARG A 1 3  ? 17.110 -2.351  3.409  1.00 26.30 ? 149  ARG A CA  1 
ATOM   20   C C   . ARG A 1 3  ? 16.093 -1.444  4.068  1.00 20.29 ? 149  ARG A C   1 
ATOM   21   O O   . ARG A 1 3  ? 16.325 -0.921  5.167  1.00 22.56 ? 149  ARG A O   1 
ATOM   22   C CB  . ARG A 1 3  ? 16.716 -3.815  3.588  1.00 25.80 ? 149  ARG A CB  1 
ATOM   23   C CG  . ARG A 1 3  ? 17.657 -4.797  2.873  1.00 43.83 ? 149  ARG A CG  1 
ATOM   24   C CD  . ARG A 1 3  ? 16.900 -5.945  2.229  1.00 57.75 ? 149  ARG A CD  1 
ATOM   25   N NE  . ARG A 1 3  ? 17.619 -6.489  1.077  1.00 64.75 ? 149  ARG A NE  1 
ATOM   26   C CZ  . ARG A 1 3  ? 17.715 -5.890  -0.112 1.00 63.98 ? 149  ARG A CZ  1 
ATOM   27   N NH1 . ARG A 1 3  ? 17.151 -4.701  -0.324 1.00 48.71 ? 149  ARG A NH1 1 
ATOM   28   N NH2 . ARG A 1 3  ? 18.391 -6.479  -1.097 1.00 58.02 ? 149  ARG A NH2 1 
ATOM   29   N N   . THR A 1 4  ? 14.994 -1.230  3.355  1.00 18.27 ? 150  THR A N   1 
ATOM   30   C CA  . THR A 1 4  ? 13.895 -0.419  3.855  1.00 19.06 ? 150  THR A CA  1 
ATOM   31   C C   . THR A 1 4  ? 12.841 -1.364  4.419  1.00 19.00 ? 150  THR A C   1 
ATOM   32   O O   . THR A 1 4  ? 12.530 -2.405  3.801  1.00 20.81 ? 150  THR A O   1 
ATOM   33   C CB  . THR A 1 4  ? 13.246 0.414   2.746  1.00 25.43 ? 150  THR A CB  1 
ATOM   34   O OG1 . THR A 1 4  ? 12.531 -0.463  1.897  1.00 37.55 ? 150  THR A OG1 1 
ATOM   35   C CG2 . THR A 1 4  ? 14.280 1.164   1.926  1.00 24.55 ? 150  THR A CG2 1 
ATOM   36   N N   . VAL A 1 5  ? 12.292 -0.991  5.559  1.00 19.22 ? 151  VAL A N   1 
ATOM   37   C CA  . VAL A 1 5  ? 11.262 -1.756  6.278  1.00 16.73 ? 151  VAL A CA  1 
ATOM   38   C C   . VAL A 1 5  ? 10.094 -0.851  6.571  1.00 17.63 ? 151  VAL A C   1 
ATOM   39   O O   . VAL A 1 5  ? 10.258 0.276   7.028  1.00 17.53 ? 151  VAL A O   1 
ATOM   40   C CB  . VAL A 1 5  ? 11.833 -2.340  7.596  1.00 18.40 ? 151  VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 5  ? 10.760 -3.013  8.501  1.00 22.45 ? 151  VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 5  ? 13.021 -3.253  7.265  1.00 20.96 ? 151  VAL A CG2 1 
ATOM   43   N N   . GLU A 1 6  ? 8.904  -1.374  6.327  1.00 19.22 ? 152  GLU A N   1 
ATOM   44   C CA  . GLU A 1 6  ? 7.684  -0.668  6.650  1.00 20.04 ? 152  GLU A CA  1 
ATOM   45   C C   . GLU A 1 6  ? 7.190  -1.072  8.042  1.00 25.99 ? 152  GLU A C   1 
ATOM   46   O O   . GLU A 1 6  ? 6.984  -2.252  8.315  1.00 24.87 ? 152  GLU A O   1 
ATOM   47   C CB  . GLU A 1 6  ? 6.588  -0.941  5.624  1.00 25.07 ? 152  GLU A CB  1 
ATOM   48   C CG  . GLU A 1 6  ? 5.422  0.028   5.814  1.00 28.72 ? 152  GLU A CG  1 
ATOM   49   C CD  . GLU A 1 6  ? 4.340  -0.148  4.804  1.00 36.10 ? 152  GLU A CD  1 
ATOM   50   O OE1 . GLU A 1 6  ? 4.285  0.679   3.865  1.00 25.05 ? 152  GLU A OE1 1 
ATOM   51   O OE2 . GLU A 1 6  ? 3.554  -1.108  4.958  1.00 34.03 ? 152  GLU A OE2 1 
ATOM   52   N N   . VAL A 1 7  ? 7.014  -0.073  8.901  1.00 23.90 ? 153  VAL A N   1 
ATOM   53   C CA  . VAL A 1 7  ? 6.531  -0.259  10.249 1.00 22.98 ? 153  VAL A CA  1 
ATOM   54   C C   . VAL A 1 7  ? 5.243  0.561   10.337 1.00 18.70 ? 153  VAL A C   1 
ATOM   55   O O   . VAL A 1 7  ? 5.256  1.761   10.050 1.00 24.45 ? 153  VAL A O   1 
ATOM   56   C CB  . VAL A 1 7  ? 7.573  0.285   11.280 1.00 23.84 ? 153  VAL A CB  1 
ATOM   57   C CG1 . VAL A 1 7  ? 7.031  0.290   12.709 1.00 25.37 ? 153  VAL A CG1 1 
ATOM   58   C CG2 . VAL A 1 7  ? 8.904  -0.500  11.227 1.00 24.71 ? 153  VAL A CG2 1 
ATOM   59   N N   . THR A 1 8  ? 4.150  -0.081  10.765 1.00 19.23 ? 154  THR A N   1 
ATOM   60   C CA  . THR A 1 8  ? 2.893  0.588   11.057 1.00 18.83 ? 154  THR A CA  1 
ATOM   61   C C   . THR A 1 8  ? 2.784  0.790   12.565 1.00 24.84 ? 154  THR A C   1 
ATOM   62   O O   . THR A 1 8  ? 2.870  -0.174  13.327 1.00 22.60 ? 154  THR A O   1 
ATOM   63   C CB  A THR A 1 8  ? 1.675  -0.223  10.590 0.50 22.13 ? 154  THR A CB  1 
ATOM   64   C CB  B THR A 1 8  ? 1.675  -0.211  10.568 0.50 23.74 ? 154  THR A CB  1 
ATOM   65   O OG1 A THR A 1 8  ? 1.755  -0.429  9.176  0.50 17.95 ? 154  THR A OG1 1 
ATOM   66   O OG1 B THR A 1 8  ? 1.845  -1.589  10.908 0.50 37.17 ? 154  THR A OG1 1 
ATOM   67   C CG2 A THR A 1 8  ? 0.399  0.518   10.912 0.50 13.61 ? 154  THR A CG2 1 
ATOM   68   C CG2 B THR A 1 8  ? 1.528  -0.076  9.057  0.50 24.55 ? 154  THR A CG2 1 
ATOM   69   N N   . LEU A 1 9  ? 2.613  2.044   12.971 1.00 22.26 ? 155  LEU A N   1 
ATOM   70   C CA  . LEU A 1 9  ? 2.414  2.383   14.383 1.00 20.37 ? 155  LEU A CA  1 
ATOM   71   C C   . LEU A 1 9  ? 1.076  3.061   14.602 1.00 21.80 ? 155  LEU A C   1 
ATOM   72   O O   . LEU A 1 9  ? 0.580  3.783   13.736 1.00 22.06 ? 155  LEU A O   1 
ATOM   73   C CB  . LEU A 1 9  ? 3.529  3.318   14.869 1.00 19.08 ? 155  LEU A CB  1 
ATOM   74   C CG  . LEU A 1 9  ? 4.966  2.767   14.882 1.00 18.53 ? 155  LEU A CG  1 
ATOM   75   C CD1 . LEU A 1 9  ? 5.899  3.811   15.437 1.00 22.32 ? 155  LEU A CD1 1 
ATOM   76   C CD2 . LEU A 1 9  ? 5.054  1.496   15.680 1.00 25.96 ? 155  LEU A CD2 1 
ATOM   77   N N   . HIS A 1 10 ? 0.524  2.860   15.795 1.00 18.97 ? 156  HIS A N   1 
ATOM   78   C CA  . HIS A 1 10 ? -0.694 3.535   16.232 1.00 19.41 ? 156  HIS A CA  1 
ATOM   79   C C   . HIS A 1 10 ? -0.342 4.524   17.352 1.00 19.90 ? 156  HIS A C   1 
ATOM   80   O O   . HIS A 1 10 ? 0.089  4.133   18.439 1.00 19.09 ? 156  HIS A O   1 
ATOM   81   C CB  . HIS A 1 10 ? -1.746 2.521   16.683 1.00 20.47 ? 156  HIS A CB  1 
ATOM   82   C CG  . HIS A 1 10 ? -2.114 1.525   15.618 1.00 30.05 ? 156  HIS A CG  1 
ATOM   83   N ND1 . HIS A 1 10 ? -3.281 1.608   14.889 1.00 31.43 ? 156  HIS A ND1 1 
ATOM   84   C CD2 . HIS A 1 10 ? -1.452 0.439   15.145 1.00 35.87 ? 156  HIS A CD2 1 
ATOM   85   C CE1 . HIS A 1 10 ? -3.331 0.607   14.026 1.00 35.81 ? 156  HIS A CE1 1 
ATOM   86   N NE2 . HIS A 1 10 ? -2.232 -0.115  14.158 1.00 28.84 ? 156  HIS A NE2 1 
ATOM   87   N N   . LYS A 1 11 ? -0.491 5.807   17.041 1.00 17.42 ? 157  LYS A N   1 
ATOM   88   C CA  . LYS A 1 11 ? -0.233 6.870   17.974 1.00 16.58 ? 157  LYS A CA  1 
ATOM   89   C C   . LYS A 1 11 ? -1.139 6.785   19.186 1.00 13.89 ? 157  LYS A C   1 
ATOM   90   O O   . LYS A 1 11 ? -2.321 6.372   19.110 1.00 17.60 ? 157  LYS A O   1 
ATOM   91   C CB  . LYS A 1 11 ? -0.426 8.232   17.320 1.00 16.59 ? 157  LYS A CB  1 
ATOM   92   C CG  . LYS A 1 11 ? 0.654  8.575   16.343 1.00 20.76 ? 157  LYS A CG  1 
ATOM   93   C CD  . LYS A 1 11 ? 0.666  10.032  15.981 1.00 22.00 ? 157  LYS A CD  1 
ATOM   94   C CE  . LYS A 1 11 ? -0.362 10.379  14.969 1.00 23.25 ? 157  LYS A CE  1 
ATOM   95   N NZ  . LYS A 1 11 ? -0.205 11.759  14.514 1.00 23.35 ? 157  LYS A NZ  1 
ATOM   96   N N   . GLU A 1 12 ? -0.577 7.216   20.314 1.00 14.94 ? 158  GLU A N   1 
ATOM   97   C CA  . GLU A 1 12 ? -1.295 7.356   21.584 1.00 18.92 ? 158  GLU A CA  1 
ATOM   98   C C   . GLU A 1 12 ? -0.969 8.711   22.181 1.00 16.81 ? 158  GLU A C   1 
ATOM   99   O O   . GLU A 1 12 ? 0.196  9.057   22.299 1.00 16.93 ? 158  GLU A O   1 
ATOM   100  C CB  . GLU A 1 12 ? -0.903 6.249   22.564 1.00 17.78 ? 158  GLU A CB  1 
ATOM   101  C CG  A GLU A 1 12 ? -1.333 4.853   22.127 0.50 21.74 ? 158  GLU A CG  1 
ATOM   102  C CG  B GLU A 1 12 ? -1.348 4.854   22.145 0.50 23.24 ? 158  GLU A CG  1 
ATOM   103  C CD  A GLU A 1 12 ? -2.806 4.783   21.826 0.50 15.03 ? 158  GLU A CD  1 
ATOM   104  C CD  B GLU A 1 12 ? -0.940 3.799   23.154 0.50 25.53 ? 158  GLU A CD  1 
ATOM   105  O OE1 A GLU A 1 12 ? -3.563 5.574   22.432 0.50 14.98 ? 158  GLU A OE1 1 
ATOM   106  O OE1 B GLU A 1 12 ? -1.167 4.001   24.368 0.50 25.37 ? 158  GLU A OE1 1 
ATOM   107  O OE2 A GLU A 1 12 ? -3.201 3.967   20.971 0.50 22.92 ? 158  GLU A OE2 1 
ATOM   108  O OE2 B GLU A 1 12 ? -0.398 2.751   22.746 0.50 21.06 ? 158  GLU A OE2 1 
ATOM   109  N N   . GLY A 1 13 ? -1.985 9.487   22.525 1.00 18.59 ? 159  GLY A N   1 
ATOM   110  C CA  . GLY A 1 13 ? -1.754 10.878  22.933 1.00 19.30 ? 159  GLY A CA  1 
ATOM   111  C C   . GLY A 1 13 ? -1.148 11.677  21.790 1.00 21.26 ? 159  GLY A C   1 
ATOM   112  O O   . GLY A 1 13 ? -0.366 12.622  22.012 1.00 15.15 ? 159  GLY A O   1 
ATOM   113  N N   . ASN A 1 14 ? -1.511 11.305  20.558 1.00 19.05 ? 160  ASN A N   1 
ATOM   114  C CA  . ASN A 1 14 ? -0.873 11.853  19.348 1.00 17.56 ? 160  ASN A CA  1 
ATOM   115  C C   . ASN A 1 14 ? 0.665  11.787  19.321 1.00 17.46 ? 160  ASN A C   1 
ATOM   116  O O   . ASN A 1 14 ? 1.338  12.657  18.742 1.00 19.24 ? 160  ASN A O   1 
ATOM   117  C CB  . ASN A 1 14 ? -1.351 13.271  19.069 1.00 18.19 ? 160  ASN A CB  1 
ATOM   118  C CG  . ASN A 1 14 ? -1.249 13.640  17.587 1.00 27.20 ? 160  ASN A CG  1 
ATOM   119  O OD1 . ASN A 1 14 ? -1.528 12.815  16.714 1.00 24.74 ? 160  ASN A OD1 1 
ATOM   120  N ND2 . ASN A 1 14 ? -0.872 14.885  17.306 1.00 28.71 ? 160  ASN A ND2 1 
ATOM   121  N N   . THR A 1 15 ? 1.216  10.723  19.915 1.00 17.37 ? 161  THR A N   1 
ATOM   122  C CA  . THR A 1 15 ? 2.656  10.469  19.906 1.00 16.89 ? 161  THR A CA  1 
ATOM   123  C C   . THR A 1 15 ? 2.948  9.034   19.469 1.00 15.56 ? 161  THR A C   1 
ATOM   124  O O   . THR A 1 15 ? 2.170  8.136   19.705 1.00 17.97 ? 161  THR A O   1 
ATOM   125  C CB  A THR A 1 15 ? 3.284  10.718  21.303 0.50 18.20 ? 161  THR A CB  1 
ATOM   126  C CB  B THR A 1 15 ? 3.292  10.709  21.297 0.50 18.84 ? 161  THR A CB  1 
ATOM   127  O OG1 A THR A 1 15 ? 2.759  9.781   22.247 0.50 19.50 ? 161  THR A OG1 1 
ATOM   128  O OG1 B THR A 1 15 ? 4.670  11.058  21.136 0.50 33.81 ? 161  THR A OG1 1 
ATOM   129  C CG2 A THR A 1 15 ? 2.992  12.129  21.771 0.50 10.74 ? 161  THR A CG2 1 
ATOM   130  C CG2 B THR A 1 15 ? 3.204  9.470   22.142 0.50 11.22 ? 161  THR A CG2 1 
ATOM   131  N N   . PHE A 1 16 ? 4.082  8.860   18.813 1.00 15.55 ? 162  PHE A N   1 
ATOM   132  C CA  . PHE A 1 16 ? 4.645  7.571   18.425 1.00 16.49 ? 162  PHE A CA  1 
ATOM   133  C C   . PHE A 1 16 ? 5.598  7.003   19.456 1.00 16.51 ? 162  PHE A C   1 
ATOM   134  O O   . PHE A 1 16 ? 5.841  5.809   19.454 1.00 19.22 ? 162  PHE A O   1 
ATOM   135  C CB  . PHE A 1 16 ? 5.422  7.668   17.106 1.00 18.88 ? 162  PHE A CB  1 
ATOM   136  C CG  . PHE A 1 16 ? 4.559  7.855   15.910 1.00 27.22 ? 162  PHE A CG  1 
ATOM   137  C CD1 . PHE A 1 16 ? 3.740  6.828   15.478 1.00 23.68 ? 162  PHE A CD1 1 
ATOM   138  C CD2 . PHE A 1 16 ? 4.549  9.060   15.224 1.00 20.00 ? 162  PHE A CD2 1 
ATOM   139  C CE1 . PHE A 1 16 ? 2.927  6.997   14.379 1.00 26.93 ? 162  PHE A CE1 1 
ATOM   140  C CE2 . PHE A 1 16 ? 3.746  9.225   14.119 1.00 23.61 ? 162  PHE A CE2 1 
ATOM   141  C CZ  . PHE A 1 16 ? 2.944  8.195   13.694 1.00 26.46 ? 162  PHE A CZ  1 
ATOM   142  N N   . GLY A 1 17 ? 6.167  7.854   20.319 1.00 17.74 ? 163  GLY A N   1 
ATOM   143  C CA  . GLY A 1 17 ? 7.075  7.348   21.348 1.00 18.40 ? 163  GLY A CA  1 
ATOM   144  C C   . GLY A 1 17 ? 8.491  7.209   20.869 1.00 17.57 ? 163  GLY A C   1 
ATOM   145  O O   . GLY A 1 17 ? 9.184  6.275   21.220 1.00 19.04 ? 163  GLY A O   1 
ATOM   146  N N   . PHE A 1 18 ? 8.946  8.141   20.047 1.00 19.51 ? 164  PHE A N   1 
ATOM   147  C CA  . PHE A 1 18 ? 10.366 8.130   19.666 1.00 18.69 ? 164  PHE A CA  1 
ATOM   148  C C   . PHE A 1 18 ? 10.828 9.566   19.450 1.00 20.38 ? 164  PHE A C   1 
ATOM   149  O O   . PHE A 1 18 ? 10.020 10.465  19.427 1.00 18.83 ? 164  PHE A O   1 
ATOM   150  C CB  . PHE A 1 18 ? 10.693 7.188   18.480 1.00 16.69 ? 164  PHE A CB  1 
ATOM   151  C CG  . PHE A 1 18 ? 10.038 7.517   17.162 1.00 17.39 ? 164  PHE A CG  1 
ATOM   152  C CD1 . PHE A 1 18 ? 10.526 8.510   16.321 1.00 21.42 ? 164  PHE A CD1 1 
ATOM   153  C CD2 . PHE A 1 18 ? 8.993  6.772   16.701 1.00 22.53 ? 164  PHE A CD2 1 
ATOM   154  C CE1 . PHE A 1 18 ? 9.933  8.774   15.079 1.00 21.52 ? 164  PHE A CE1 1 
ATOM   155  C CE2 . PHE A 1 18 ? 8.425  7.022   15.488 1.00 20.83 ? 164  PHE A CE2 1 
ATOM   156  C CZ  . PHE A 1 18 ? 8.875  8.031   14.680 1.00 18.11 ? 164  PHE A CZ  1 
ATOM   157  N N   . VAL A 1 19 ? 12.137 9.771   19.392 1.00 16.99 ? 165  VAL A N   1 
ATOM   158  C CA  . VAL A 1 19 ? 12.721 11.111  19.186 1.00 18.81 ? 165  VAL A CA  1 
ATOM   159  C C   . VAL A 1 19 ? 13.409 11.101  17.832 1.00 16.55 ? 165  VAL A C   1 
ATOM   160  O O   . VAL A 1 19 ? 14.040 10.088  17.472 1.00 18.27 ? 165  VAL A O   1 
ATOM   161  C CB  . VAL A 1 19 ? 13.695 11.434  20.298 1.00 18.78 ? 165  VAL A CB  1 
ATOM   162  C CG1 . VAL A 1 19 ? 14.374 12.805  20.065 1.00 18.85 ? 165  VAL A CG1 1 
ATOM   163  C CG2 . VAL A 1 19 ? 12.989 11.369  21.677 1.00 19.87 ? 165  VAL A CG2 1 
ATOM   164  N N   . ILE A 1 20 ? 13.296 12.196  17.068 1.00 18.16 ? 166  ILE A N   1 
ATOM   165  C CA  . ILE A 1 20 ? 13.996 12.338  15.789 1.00 16.51 ? 166  ILE A CA  1 
ATOM   166  C C   . ILE A 1 20 ? 14.988 13.492  15.812 1.00 19.02 ? 166  ILE A C   1 
ATOM   167  O O   . ILE A 1 20 ? 14.741 14.507  16.454 1.00 19.06 ? 166  ILE A O   1 
ATOM   168  C CB  . ILE A 1 20 ? 13.057 12.594  14.584 1.00 20.20 ? 166  ILE A CB  1 
ATOM   169  C CG1 . ILE A 1 20 ? 12.078 13.752  14.825 1.00 20.92 ? 166  ILE A CG1 1 
ATOM   170  C CG2 . ILE A 1 20 ? 12.329 11.292  14.231 1.00 20.93 ? 166  ILE A CG2 1 
ATOM   171  C CD1 . ILE A 1 20 ? 11.468 14.324  13.517 1.00 21.85 ? 166  ILE A CD1 1 
ATOM   172  N N   . ARG A 1 21 ? 16.071 13.338  15.042 1.00 16.78 ? 167  ARG A N   1 
ATOM   173  C CA  . ARG A 1 21 ? 16.966 14.450  14.758 1.00 16.93 ? 167  ARG A CA  1 
ATOM   174  C C   . ARG A 1 21 ? 17.063 14.542  13.254 1.00 17.96 ? 167  ARG A C   1 
ATOM   175  O O   . ARG A 1 21 ? 16.712 13.617  12.523 1.00 17.33 ? 167  ARG A O   1 
ATOM   176  C CB  . ARG A 1 21 ? 18.341 14.234  15.337 1.00 16.16 ? 167  ARG A CB  1 
ATOM   177  C CG  . ARG A 1 21 ? 19.183 13.137  14.665 1.00 17.59 ? 167  ARG A CG  1 
ATOM   178  C CD  . ARG A 1 21 ? 20.635 13.109  15.225 1.00 17.82 ? 167  ARG A CD  1 
ATOM   179  N NE  . ARG A 1 21 ? 21.377 11.967  14.731 1.00 18.10 ? 167  ARG A NE  1 
ATOM   180  C CZ  . ARG A 1 21 ? 21.792 11.837  13.475 1.00 19.69 ? 167  ARG A CZ  1 
ATOM   181  N NH1 . ARG A 1 21 ? 21.588 12.796  12.580 1.00 20.01 ? 167  ARG A NH1 1 
ATOM   182  N NH2 . ARG A 1 21 ? 22.482 10.757  13.113 1.00 19.62 ? 167  ARG A NH2 1 
ATOM   183  N N   . GLY A 1 22 ? 17.501 15.671  12.774 1.00 16.47 ? 168  GLY A N   1 
ATOM   184  C CA  . GLY A 1 22 ? 17.762 15.828  11.350 1.00 17.42 ? 168  GLY A CA  1 
ATOM   185  C C   . GLY A 1 22 ? 16.714 16.559  10.553 1.00 17.52 ? 168  GLY A C   1 
ATOM   186  O O   . GLY A 1 22 ? 15.708 17.025  11.055 1.00 18.65 ? 168  GLY A O   1 
ATOM   187  N N   . GLY A 1 23 ? 16.944 16.626  9.254  1.00 16.48 ? 169  GLY A N   1 
ATOM   188  C CA  . GLY A 1 23 ? 16.107 17.435  8.347  1.00 17.42 ? 169  GLY A CA  1 
ATOM   189  C C   . GLY A 1 23 ? 16.877 18.304  7.360  1.00 20.40 ? 169  GLY A C   1 
ATOM   190  O O   . GLY A 1 23 ? 18.106 18.529  7.477  1.00 18.29 ? 169  GLY A O   1 
ATOM   191  N N   . ALA A 1 24 ? 16.140 18.764  6.352  1.00 21.38 ? 170  ALA A N   1 
ATOM   192  C CA  . ALA A 1 24 ? 16.710 19.561  5.259  1.00 26.69 ? 170  ALA A CA  1 
ATOM   193  C C   . ALA A 1 24 ? 17.000 20.994  5.680  1.00 30.67 ? 170  ALA A C   1 
ATOM   194  O O   . ALA A 1 24 ? 16.502 21.497  6.688  1.00 29.74 ? 170  ALA A O   1 
ATOM   195  C CB  . ALA A 1 24 ? 15.787 19.549  4.023  1.00 22.26 ? 170  ALA A CB  1 
ATOM   196  N N   . HIS A 1 25 ? 17.824 21.643  4.870  1.00 37.52 ? 171  HIS A N   1 
ATOM   197  C CA  . HIS A 1 25 ? 18.195 23.024  5.095  1.00 40.93 ? 171  HIS A CA  1 
ATOM   198  C C   . HIS A 1 25 ? 18.619 23.641  3.765  1.00 37.49 ? 171  HIS A C   1 
ATOM   199  O O   . HIS A 1 25 ? 19.164 22.947  2.899  1.00 28.37 ? 171  HIS A O   1 
ATOM   200  C CB  . HIS A 1 25 ? 19.334 23.080  6.113  1.00 42.58 ? 171  HIS A CB  1 
ATOM   201  C CG  . HIS A 1 25 ? 19.454 24.396  6.812  1.00 49.20 ? 171  HIS A CG  1 
ATOM   202  N ND1 . HIS A 1 25 ? 19.725 25.569  6.143  1.00 51.56 ? 171  HIS A ND1 1 
ATOM   203  C CD2 . HIS A 1 25 ? 19.357 24.723  8.122  1.00 52.29 ? 171  HIS A CD2 1 
ATOM   204  C CE1 . HIS A 1 25 ? 19.776 26.565  7.007  1.00 60.83 ? 171  HIS A CE1 1 
ATOM   205  N NE2 . HIS A 1 25 ? 19.559 26.078  8.216  1.00 67.72 ? 171  HIS A NE2 1 
ATOM   206  N N   . ASP A 1 26 ? 18.349 24.935  3.604  1.00 44.08 ? 172  ASP A N   1 
ATOM   207  C CA  . ASP A 1 26 ? 18.814 25.692  2.441  1.00 49.74 ? 172  ASP A CA  1 
ATOM   208  C C   . ASP A 1 26 ? 20.299 25.396  2.149  1.00 52.02 ? 172  ASP A C   1 
ATOM   209  O O   . ASP A 1 26 ? 20.692 25.196  0.997  1.00 49.33 ? 172  ASP A O   1 
ATOM   210  C CB  . ASP A 1 26 ? 18.592 27.195  2.673  1.00 50.70 ? 172  ASP A CB  1 
ATOM   211  N N   . ASP A 1 27 ? 21.104 25.362  3.210  1.00 53.78 ? 173  ASP A N   1 
ATOM   212  C CA  . ASP A 1 27 ? 22.512 24.966  3.141  1.00 55.24 ? 173  ASP A CA  1 
ATOM   213  C C   . ASP A 1 27 ? 22.654 23.434  3.028  1.00 53.85 ? 173  ASP A C   1 
ATOM   214  O O   . ASP A 1 27 ? 22.285 22.699  3.951  1.00 54.56 ? 173  ASP A O   1 
ATOM   215  C CB  . ASP A 1 27 ? 23.235 25.483  4.397  1.00 56.70 ? 173  ASP A CB  1 
ATOM   216  C CG  . ASP A 1 27 ? 24.754 25.387  4.303  1.00 58.76 ? 173  ASP A CG  1 
ATOM   217  O OD1 . ASP A 1 27 ? 25.293 24.935  3.265  1.00 54.48 ? 173  ASP A OD1 1 
ATOM   218  O OD2 . ASP A 1 27 ? 25.414 25.777  5.292  1.00 59.80 ? 173  ASP A OD2 1 
ATOM   219  N N   . ARG A 1 28 ? 23.187 22.964  1.899  1.00 51.79 ? 174  ARG A N   1 
ATOM   220  C CA  . ARG A 1 28 ? 23.395 21.531  1.661  1.00 52.35 ? 174  ARG A CA  1 
ATOM   221  C C   . ARG A 1 28 ? 24.882 21.186  1.544  1.00 51.98 ? 174  ARG A C   1 
ATOM   222  O O   . ARG A 1 28 ? 25.620 21.796  0.767  1.00 57.05 ? 174  ARG A O   1 
ATOM   223  C CB  . ARG A 1 28 ? 22.653 21.086  0.397  1.00 51.72 ? 174  ARG A CB  1 
ATOM   224  N N   . SER A 1 31 ? 21.895 19.937  5.628  1.00 34.78 ? 177  SER A N   1 
ATOM   225  C CA  . SER A 1 31 ? 20.896 18.917  5.283  1.00 28.61 ? 177  SER A CA  1 
ATOM   226  C C   . SER A 1 31 ? 21.323 17.514  5.681  1.00 18.74 ? 177  SER A C   1 
ATOM   227  O O   . SER A 1 31 ? 22.253 16.963  5.096  1.00 24.62 ? 177  SER A O   1 
ATOM   228  C CB  A SER A 1 31 ? 20.618 18.945  3.789  0.50 24.70 ? 177  SER A CB  1 
ATOM   229  C CB  B SER A 1 31 ? 20.591 18.935  3.788  0.50 25.97 ? 177  SER A CB  1 
ATOM   230  O OG  A SER A 1 31 ? 19.676 19.944  3.531  0.50 14.69 ? 177  SER A OG  1 
ATOM   231  O OG  B SER A 1 31 ? 19.750 17.842  3.472  0.50 33.45 ? 177  SER A OG  1 
ATOM   232  N N   . ARG A 1 32 ? 20.630 16.938  6.664  1.00 15.96 ? 178  ARG A N   1 
ATOM   233  C CA  . ARG A 1 32 ? 20.981 15.649  7.216  1.00 16.52 ? 178  ARG A CA  1 
ATOM   234  C C   . ARG A 1 32 ? 19.759 14.733  7.260  1.00 19.14 ? 178  ARG A C   1 
ATOM   235  O O   . ARG A 1 32 ? 18.659 15.196  7.477  1.00 17.97 ? 178  ARG A O   1 
ATOM   236  C CB  . ARG A 1 32 ? 21.501 15.852  8.611  1.00 16.62 ? 178  ARG A CB  1 
ATOM   237  C CG  . ARG A 1 32 ? 22.711 16.770  8.654  1.00 19.55 ? 178  ARG A CG  1 
ATOM   238  C CD  . ARG A 1 32 ? 23.140 16.975  10.108 1.00 16.56 ? 178  ARG A CD  1 
ATOM   239  N NE  . ARG A 1 32 ? 23.939 18.165  10.367 1.00 14.56 ? 178  ARG A NE  1 
ATOM   240  C CZ  . ARG A 1 32 ? 25.254 18.192  10.594 1.00 10.78 ? 178  ARG A CZ  1 
ATOM   241  N NH1 . ARG A 1 32 ? 25.942 17.067  10.666 1.00 10.84 ? 178  ARG A NH1 1 
ATOM   242  N NH2 . ARG A 1 32 ? 25.830 19.315  10.877 1.00 13.63 ? 178  ARG A NH2 1 
ATOM   243  N N   . PRO A 1 33 ? 19.939 13.432  7.010  1.00 19.74 ? 179  PRO A N   1 
ATOM   244  C CA  . PRO A 1 33 ? 18.763 12.560  7.088  1.00 18.49 ? 179  PRO A CA  1 
ATOM   245  C C   . PRO A 1 33 ? 18.103 12.607  8.438  1.00 17.48 ? 179  PRO A C   1 
ATOM   246  O O   . PRO A 1 33 ? 18.741 12.913  9.464  1.00 18.94 ? 179  PRO A O   1 
ATOM   247  C CB  . PRO A 1 33 ? 19.347 11.172  6.812  1.00 19.63 ? 179  PRO A CB  1 
ATOM   248  C CG  . PRO A 1 33 ? 20.581 11.438  5.996  1.00 22.22 ? 179  PRO A CG  1 
ATOM   249  C CD  . PRO A 1 33 ? 21.149 12.696  6.604  1.00 23.11 ? 179  PRO A CD  1 
ATOM   250  N N   . VAL A 1 34 ? 16.812 12.282  8.462  1.00 17.50 ? 180  VAL A N   1 
ATOM   251  C CA  . VAL A 1 34 ? 16.054 12.167  9.684  1.00 17.66 ? 180  VAL A CA  1 
ATOM   252  C C   . VAL A 1 34 ? 16.349 10.813  10.301 1.00 17.08 ? 180  VAL A C   1 
ATOM   253  O O   . VAL A 1 34 ? 16.275 9.745   9.654  1.00 16.80 ? 180  VAL A O   1 
ATOM   254  C CB  . VAL A 1 34 ? 14.530 12.333  9.428  1.00 19.13 ? 180  VAL A CB  1 
ATOM   255  C CG1 . VAL A 1 34 ? 13.753 12.132  10.701 1.00 19.67 ? 180  VAL A CG1 1 
ATOM   256  C CG2 . VAL A 1 34 ? 14.254 13.703  8.804  1.00 17.67 ? 180  VAL A CG2 1 
ATOM   257  N N   . VAL A 1 35 ? 16.805 10.840  11.558 1.00 17.24 ? 181  VAL A N   1 
ATOM   258  C CA  . VAL A 1 35 ? 17.326 9.661   12.240 1.00 15.44 ? 181  VAL A CA  1 
ATOM   259  C C   . VAL A 1 35 ? 16.664 9.553   13.604 1.00 18.60 ? 181  VAL A C   1 
ATOM   260  O O   . VAL A 1 35 ? 16.534 10.536  14.309 1.00 18.70 ? 181  VAL A O   1 
ATOM   261  C CB  . VAL A 1 35 ? 18.838 9.751   12.385 1.00 15.96 ? 181  VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 35 ? 19.387 8.609   13.259 1.00 19.79 ? 181  VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 35 ? 19.485 9.715   11.014 1.00 19.77 ? 181  VAL A CG2 1 
ATOM   264  N N   . ILE A 1 36 ? 16.243 8.352   13.970 1.00 18.64 ? 182  ILE A N   1 
ATOM   265  C CA  . ILE A 1 36 ? 15.630 8.122   15.276 1.00 21.09 ? 182  ILE A CA  1 
ATOM   266  C C   . ILE A 1 36 ? 16.740 8.045   16.330 1.00 18.75 ? 182  ILE A C   1 
ATOM   267  O O   . ILE A 1 36 ? 17.755 7.353   16.150 1.00 21.56 ? 182  ILE A O   1 
ATOM   268  C CB  . ILE A 1 36 ? 14.698 6.892   15.215 1.00 25.34 ? 182  ILE A CB  1 
ATOM   269  C CG1 . ILE A 1 36 ? 13.432 7.286   14.409 1.00 24.44 ? 182  ILE A CG1 1 
ATOM   270  C CG2 . ILE A 1 36 ? 14.354 6.420   16.666 1.00 23.48 ? 182  ILE A CG2 1 
ATOM   271  C CD1 . ILE A 1 36 ? 12.660 6.172   13.717 1.00 36.26 ? 182  ILE A CD1 1 
ATOM   272  N N   . THR A 1 37 ? 16.587 8.834   17.413 1.00 17.63 ? 183  THR A N   1 
ATOM   273  C CA  . THR A 1 37 ? 17.625 8.964   18.436 1.00 17.40 ? 183  THR A CA  1 
ATOM   274  C C   . THR A 1 37 ? 17.282 8.292   19.780 1.00 19.04 ? 183  THR A C   1 
ATOM   275  O O   . THR A 1 37 ? 18.167 8.064   20.603 1.00 21.10 ? 183  THR A O   1 
ATOM   276  C CB  . THR A 1 37 ? 17.984 10.423  18.751 1.00 18.77 ? 183  THR A CB  1 
ATOM   277  O OG1 . THR A 1 37 ? 16.856 11.100  19.324 1.00 20.46 ? 183  THR A OG1 1 
ATOM   278  C CG2 . THR A 1 37 ? 18.464 11.195  17.491 1.00 19.40 ? 183  THR A CG2 1 
ATOM   279  N N   . SER A 1 38 ? 16.013 7.931   19.969 1.00 19.29 ? 184  SER A N   1 
ATOM   280  C CA  . SER A 1 38 ? 15.555 7.409   21.259 1.00 18.11 ? 184  SER A CA  1 
ATOM   281  C C   . SER A 1 38 ? 14.184 6.823   21.056 1.00 17.96 ? 184  SER A C   1 
ATOM   282  O O   . SER A 1 38 ? 13.433 7.339   20.234 1.00 17.31 ? 184  SER A O   1 
ATOM   283  C CB  . SER A 1 38 ? 15.460 8.536   22.287 1.00 17.77 ? 184  SER A CB  1 
ATOM   284  O OG  . SER A 1 38 ? 15.113 8.073   23.584 1.00 20.09 ? 184  SER A OG  1 
ATOM   285  N N   . VAL A 1 39 ? 13.867 5.767   21.805 1.00 17.82 ? 185  VAL A N   1 
ATOM   286  C CA  . VAL A 1 39 ? 12.562 5.119   21.779 1.00 18.24 ? 185  VAL A CA  1 
ATOM   287  C C   . VAL A 1 39 ? 12.068 5.048   23.223 1.00 20.93 ? 185  VAL A C   1 
ATOM   288  O O   . VAL A 1 39 ? 12.784 4.591   24.109 1.00 20.73 ? 185  VAL A O   1 
ATOM   289  C CB  . VAL A 1 39 ? 12.710 3.747   21.170 1.00 15.58 ? 185  VAL A CB  1 
ATOM   290  C CG1 . VAL A 1 39 ? 11.393 2.998   21.341 1.00 18.19 ? 185  VAL A CG1 1 
ATOM   291  C CG2 . VAL A 1 39 ? 13.040 3.837   19.687 1.00 18.08 ? 185  VAL A CG2 1 
ATOM   292  N N   . ARG A 1 40 ? 10.840 5.507   23.447 1.00 18.10 ? 186  ARG A N   1 
ATOM   293  C CA  . ARG A 1 40 ? 10.289 5.619   24.795 1.00 17.19 ? 186  ARG A CA  1 
ATOM   294  C C   . ARG A 1 40 ? 9.768  4.269   25.255 1.00 17.94 ? 186  ARG A C   1 
ATOM   295  O O   . ARG A 1 40 ? 8.898  3.708   24.611 1.00 19.05 ? 186  ARG A O   1 
ATOM   296  C CB  . ARG A 1 40 ? 9.191  6.684   24.834 1.00 20.97 ? 186  ARG A CB  1 
ATOM   297  C CG  . ARG A 1 40 ? 8.648  6.944   26.208 1.00 31.34 ? 186  ARG A CG  1 
ATOM   298  C CD  A ARG A 1 40 ? 7.707  8.171   26.137 0.50 39.94 ? 186  ARG A CD  1 
ATOM   299  C CD  B ARG A 1 40 ? 8.868  8.341   26.942 0.50 20.68 ? 186  ARG A CD  1 
ATOM   300  N NE  A ARG A 1 40 ? 6.413  7.684   25.588 0.50 37.92 ? 186  ARG A NE  1 
ATOM   301  N NE  B ARG A 1 40 ? 8.941  9.563   26.136 0.50 33.24 ? 186  ARG A NE  1 
ATOM   302  C CZ  A ARG A 1 40 ? 5.606  8.296   24.712 0.50 23.17 ? 186  ARG A CZ  1 
ATOM   303  C CZ  B ARG A 1 40 ? 8.195  10.652  26.345 0.50 18.51 ? 186  ARG A CZ  1 
ATOM   304  N NH1 A ARG A 1 40 ? 5.888  9.482   24.177 0.50 23.20 ? 186  ARG A NH1 1 
ATOM   305  N NH1 B ARG A 1 40 ? 7.289  10.673  27.309 0.50 34.62 ? 186  ARG A NH1 1 
ATOM   306  N NH2 A ARG A 1 40 ? 4.481  7.679   24.355 0.50 21.97 ? 186  ARG A NH2 1 
ATOM   307  N NH2 B ARG A 1 40 ? 8.331  11.727  25.574 0.50 26.04 ? 186  ARG A NH2 1 
ATOM   308  N N   . PRO A 1 41 ? 10.296 3.745   26.372 1.00 19.06 ? 187  PRO A N   1 
ATOM   309  C CA  . PRO A 1 41 ? 9.801  2.487   26.916 1.00 23.57 ? 187  PRO A CA  1 
ATOM   310  C C   . PRO A 1 41 ? 8.309  2.536   27.119 1.00 23.16 ? 187  PRO A C   1 
ATOM   311  O O   . PRO A 1 41 ? 7.775  3.525   27.620 1.00 22.28 ? 187  PRO A O   1 
ATOM   312  C CB  . PRO A 1 41 ? 10.515 2.369   28.255 1.00 24.65 ? 187  PRO A CB  1 
ATOM   313  C CG  . PRO A 1 41 ? 11.736 3.093   28.071 1.00 27.58 ? 187  PRO A CG  1 
ATOM   314  C CD  . PRO A 1 41 ? 11.381 4.272   27.201 1.00 21.71 ? 187  PRO A CD  1 
ATOM   315  N N   . GLY A 1 42 ? 7.637  1.496   26.666 1.00 23.99 ? 188  GLY A N   1 
ATOM   316  C CA  . GLY A 1 42 ? 6.188  1.384   26.825 1.00 23.11 ? 188  GLY A CA  1 
ATOM   317  C C   . GLY A 1 42 ? 5.340  2.059   25.759 1.00 20.85 ? 188  GLY A C   1 
ATOM   318  O O   . GLY A 1 42 ? 4.117  1.831   25.702 1.00 21.57 ? 188  GLY A O   1 
ATOM   319  N N   . GLY A 1 43 ? 5.971  2.895   24.931 1.00 18.88 ? 189  GLY A N   1 
ATOM   320  C CA  . GLY A 1 43 ? 5.301  3.612   23.864 1.00 18.83 ? 189  GLY A CA  1 
ATOM   321  C C   . GLY A 1 43 ? 4.997  2.783   22.642 1.00 16.30 ? 189  GLY A C   1 
ATOM   322  O O   . GLY A 1 43 ? 5.365  1.615   22.579 1.00 19.38 ? 189  GLY A O   1 
ATOM   323  N N   . PRO A 1 44 ? 4.249  3.371   21.698 1.00 20.05 ? 190  PRO A N   1 
ATOM   324  C CA  . PRO A 1 44 ? 3.864  2.638   20.489 1.00 21.68 ? 190  PRO A CA  1 
ATOM   325  C C   . PRO A 1 44 ? 5.058  2.070   19.741 1.00 18.76 ? 190  PRO A C   1 
ATOM   326  O O   . PRO A 1 44 ? 5.015  0.891   19.354 1.00 20.82 ? 190  PRO A O   1 
ATOM   327  C CB  . PRO A 1 44 ? 3.101  3.674   19.661 1.00 17.63 ? 190  PRO A CB  1 
ATOM   328  C CG  . PRO A 1 44 ? 2.605  4.686   20.649 1.00 18.31 ? 190  PRO A CG  1 
ATOM   329  C CD  . PRO A 1 44 ? 3.634  4.719   21.764 1.00 22.24 ? 190  PRO A CD  1 
ATOM   330  N N   . ALA A 1 45 ? 6.121  2.859   19.561 1.00 17.08 ? 191  ALA A N   1 
ATOM   331  C CA  . ALA A 1 45 ? 7.309  2.335   18.840 1.00 18.89 ? 191  ALA A CA  1 
ATOM   332  C C   . ALA A 1 45 ? 7.987  1.208   19.621 1.00 17.54 ? 191  ALA A C   1 
ATOM   333  O O   . ALA A 1 45 ? 8.488  0.251   19.003 1.00 19.71 ? 191  ALA A O   1 
ATOM   334  C CB  . ALA A 1 45 ? 8.294  3.441   18.534 1.00 19.88 ? 191  ALA A CB  1 
ATOM   335  N N   . ASP A 1 46 ? 8.086  1.339   20.945 1.00 18.86 ? 192  ASP A N   1 
ATOM   336  C CA  . ASP A 1 46 ? 8.708  0.307   21.771 1.00 20.15 ? 192  ASP A CA  1 
ATOM   337  C C   . ASP A 1 46 ? 7.908  -0.987  21.652 1.00 19.79 ? 192  ASP A C   1 
ATOM   338  O O   . ASP A 1 46 ? 8.458  -2.088  21.511 1.00 20.98 ? 192  ASP A O   1 
ATOM   339  C CB  . ASP A 1 46 ? 8.748  0.722   23.233 1.00 19.80 ? 192  ASP A CB  1 
ATOM   340  C CG  . ASP A 1 46 ? 9.654  -0.185  24.082 1.00 27.05 ? 192  ASP A CG  1 
ATOM   341  O OD1 . ASP A 1 46 ? 10.704 -0.654  23.566 1.00 26.95 ? 192  ASP A OD1 1 
ATOM   342  O OD2 . ASP A 1 46 ? 9.329  -0.397  25.276 1.00 24.59 ? 192  ASP A OD2 1 
ATOM   343  N N   . ARG A 1 47 ? 6.591  -0.849  21.727 1.00 18.43 ? 193  ARG A N   1 
ATOM   344  C CA  . ARG A 1 47 ? 5.751  -2.029  21.737 1.00 18.69 ? 193  ARG A CA  1 
ATOM   345  C C   . ARG A 1 47 ? 5.691  -2.694  20.387 1.00 20.13 ? 193  ARG A C   1 
ATOM   346  O O   . ARG A 1 47 ? 5.584  -3.921  20.335 1.00 24.86 ? 193  ARG A O   1 
ATOM   347  C CB  . ARG A 1 47 ? 4.356  -1.747  22.311 1.00 20.96 ? 193  ARG A CB  1 
ATOM   348  C CG  . ARG A 1 47 ? 4.232  -2.270  23.739 1.00 37.88 ? 193  ARG A CG  1 
ATOM   349  C CD  . ARG A 1 47 ? 2.870  -2.019  24.319 1.00 40.51 ? 193  ARG A CD  1 
ATOM   350  N NE  . ARG A 1 47 ? 2.727  -0.590  24.481 1.00 30.93 ? 193  ARG A NE  1 
ATOM   351  C CZ  . ARG A 1 47 ? 2.013  0.214   23.702 1.00 20.64 ? 193  ARG A CZ  1 
ATOM   352  N NH1 . ARG A 1 47 ? 2.016  1.495   23.986 1.00 30.69 ? 193  ARG A NH1 1 
ATOM   353  N NH2 . ARG A 1 47 ? 1.265  -0.234  22.694 1.00 40.00 ? 193  ARG A NH2 1 
ATOM   354  N N   . GLU A 1 48 ? 5.764  -1.925  19.307 1.00 19.65 ? 194  GLU A N   1 
ATOM   355  C CA  . GLU A 1 48 ? 5.834  -2.563  17.968 1.00 21.77 ? 194  GLU A CA  1 
ATOM   356  C C   . GLU A 1 48 ? 7.187  -3.278  17.810 1.00 23.10 ? 194  GLU A C   1 
ATOM   357  O O   . GLU A 1 48 ? 7.253  -4.327  17.206 1.00 24.07 ? 194  GLU A O   1 
ATOM   358  C CB  . GLU A 1 48 ? 5.526  -1.569  16.844 1.00 22.86 ? 194  GLU A CB  1 
ATOM   359  C CG  . GLU A 1 48 ? 5.378  -2.203  15.470 1.00 21.05 ? 194  GLU A CG  1 
ATOM   360  C CD  . GLU A 1 48 ? 6.714  -2.512  14.806 1.00 28.85 ? 194  GLU A CD  1 
ATOM   361  O OE1 . GLU A 1 48 ? 7.760  -2.089  15.325 1.00 25.54 ? 194  GLU A OE1 1 
ATOM   362  O OE2 . GLU A 1 48 ? 6.698  -3.207  13.760 1.00 30.78 ? 194  GLU A OE2 1 
ATOM   363  N N   . GLY A 1 49 ? 8.258  -2.713  18.353 1.00 21.93 ? 195  GLY A N   1 
ATOM   364  C CA  . GLY A 1 49 ? 9.526  -3.429  18.606 1.00 20.78 ? 195  GLY A CA  1 
ATOM   365  C C   . GLY A 1 49 ? 10.602 -3.297  17.537 1.00 21.54 ? 195  GLY A C   1 
ATOM   366  O O   . GLY A 1 49 ? 11.751 -3.621  17.792 1.00 24.25 ? 195  GLY A O   1 
ATOM   367  N N   . THR A 1 50 ? 10.254 -2.797  16.350 1.00 22.36 ? 196  THR A N   1 
ATOM   368  C CA  . THR A 1 50 ? 11.236 -2.750  15.239 1.00 22.65 ? 196  THR A CA  1 
ATOM   369  C C   . THR A 1 50 ? 12.214 -1.593  15.339 1.00 21.72 ? 196  THR A C   1 
ATOM   370  O O   . THR A 1 50 ? 13.428 -1.769  15.244 1.00 21.17 ? 196  THR A O   1 
ATOM   371  C CB  . THR A 1 50 ? 10.524 -2.652  13.868 1.00 20.43 ? 196  THR A CB  1 
ATOM   372  O OG1 . THR A 1 50 ? 9.560  -3.700  13.745 1.00 24.33 ? 196  THR A OG1 1 
ATOM   373  C CG2 . THR A 1 50 ? 11.523 -2.757  12.722 1.00 18.74 ? 196  THR A CG2 1 
ATOM   374  N N   . ILE A 1 51 ? 11.685 -0.388  15.536 1.00 21.40 ? 197  ILE A N   1 
ATOM   375  C CA  . ILE A 1 51 ? 12.507 0.834   15.470 1.00 20.27 ? 197  ILE A CA  1 
ATOM   376  C C   . ILE A 1 51 ? 13.525 0.849   16.615 1.00 19.50 ? 197  ILE A C   1 
ATOM   377  O O   . ILE A 1 51 ? 13.193 0.610   17.806 1.00 20.13 ? 197  ILE A O   1 
ATOM   378  C CB  . ILE A 1 51 ? 11.583 2.084   15.578 1.00 19.92 ? 197  ILE A CB  1 
ATOM   379  C CG1 . ILE A 1 51 ? 10.723 2.191   14.309 1.00 21.39 ? 197  ILE A CG1 1 
ATOM   380  C CG2 . ILE A 1 51 ? 12.396 3.396   15.891 1.00 21.49 ? 197  ILE A CG2 1 
ATOM   381  C CD1 . ILE A 1 51 ? 9.584  3.260   14.346 1.00 18.94 ? 197  ILE A CD1 1 
ATOM   382  N N   . LYS A 1 52 ? 14.751 1.230   16.274 1.00 18.51 ? 198  LYS A N   1 
ATOM   383  C CA  . LYS A 1 52 ? 15.789 1.411   17.209 1.00 19.86 ? 198  LYS A CA  1 
ATOM   384  C C   . LYS A 1 52 ? 16.566 2.700   16.952 1.00 19.42 ? 198  LYS A C   1 
ATOM   385  O O   . LYS A 1 52 ? 16.670 3.172   15.809 1.00 18.63 ? 198  LYS A O   1 
ATOM   386  C CB  . LYS A 1 52 ? 16.784 0.258   17.072 1.00 21.31 ? 198  LYS A CB  1 
ATOM   387  C CG  . LYS A 1 52 ? 16.218 -1.087  17.359 1.00 19.58 ? 198  LYS A CG  1 
ATOM   388  C CD  . LYS A 1 52 ? 15.728 -1.188  18.807 1.00 22.41 ? 198  LYS A CD  1 
ATOM   389  C CE  . LYS A 1 52 ? 15.117 -2.526  19.088 1.00 30.23 ? 198  LYS A CE  1 
ATOM   390  N NZ  . LYS A 1 52 ? 14.702 -2.701  20.538 1.00 27.25 ? 198  LYS A NZ  1 
ATOM   391  N N   . PRO A 1 53 ? 17.196 3.259   18.009 1.00 17.67 ? 199  PRO A N   1 
ATOM   392  C CA  . PRO A 1 53 ? 18.058 4.385   17.773 1.00 19.82 ? 199  PRO A CA  1 
ATOM   393  C C   . PRO A 1 53 ? 19.119 4.141   16.696 1.00 21.14 ? 199  PRO A C   1 
ATOM   394  O O   . PRO A 1 53 ? 19.694 3.023   16.624 1.00 21.74 ? 199  PRO A O   1 
ATOM   395  C CB  . PRO A 1 53 ? 18.691 4.629   19.137 1.00 21.29 ? 199  PRO A CB  1 
ATOM   396  C CG  . PRO A 1 53 ? 17.748 4.074   20.088 1.00 19.95 ? 199  PRO A CG  1 
ATOM   397  C CD  . PRO A 1 53 ? 17.181 2.880   19.424 1.00 17.57 ? 199  PRO A CD  1 
ATOM   398  N N   . GLY A 1 54 ? 19.235 5.120   15.815 1.00 18.08 ? 200  GLY A N   1 
ATOM   399  C CA  . GLY A 1 54 ? 20.125 5.075   14.660 1.00 20.50 ? 200  GLY A CA  1 
ATOM   400  C C   . GLY A 1 54 ? 19.442 4.690   13.355 1.00 20.33 ? 200  GLY A C   1 
ATOM   401  O O   . GLY A 1 54 ? 20.034 4.855   12.252 1.00 22.75 ? 200  GLY A O   1 
ATOM   402  N N   . ASP A 1 55 ? 18.197 4.219   13.439 1.00 18.72 ? 201  ASP A N   1 
ATOM   403  C CA  . ASP A 1 55 ? 17.461 3.921   12.196 1.00 20.62 ? 201  ASP A CA  1 
ATOM   404  C C   . ASP A 1 55 ? 17.152 5.205   11.453 1.00 20.66 ? 201  ASP A C   1 
ATOM   405  O O   . ASP A 1 55 ? 16.880 6.239   12.076 1.00 20.61 ? 201  ASP A O   1 
ATOM   406  C CB  . ASP A 1 55 ? 16.152 3.180   12.459 1.00 18.53 ? 201  ASP A CB  1 
ATOM   407  C CG  . ASP A 1 55 ? 16.369 1.751   12.999 1.00 18.19 ? 201  ASP A CG  1 
ATOM   408  O OD1 . ASP A 1 55 ? 17.555 1.296   12.932 1.00 21.31 ? 201  ASP A OD1 1 
ATOM   409  O OD2 . ASP A 1 55 ? 15.368 1.175   13.436 1.00 20.58 ? 201  ASP A OD2 1 
ATOM   410  N N   . ARG A 1 56 ? 17.235 5.154   10.132 1.00 18.32 ? 202  ARG A N   1 
ATOM   411  C CA  . ARG A 1 56 ? 16.864 6.323   9.318  1.00 18.89 ? 202  ARG A CA  1 
ATOM   412  C C   . ARG A 1 56 ? 15.366 6.275   9.012  1.00 21.39 ? 202  ARG A C   1 
ATOM   413  O O   . ARG A 1 56 ? 14.840 5.198   8.673  1.00 19.12 ? 202  ARG A O   1 
ATOM   414  C CB  . ARG A 1 56 ? 17.661 6.311   8.029  1.00 21.14 ? 202  ARG A CB  1 
ATOM   415  C CG  . ARG A 1 56 ? 17.529 7.524   7.165  1.00 25.89 ? 202  ARG A CG  1 
ATOM   416  C CD  . ARG A 1 56 ? 18.509 7.455   6.014  1.00 33.56 ? 202  ARG A CD  1 
ATOM   417  N NE  . ARG A 1 56 ? 18.193 8.408   4.951  1.00 55.67 ? 202  ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 56 ? 18.832 8.467   3.783  1.00 75.48 ? 202  ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 56 ? 19.828 7.624   3.518  1.00 73.82 ? 202  ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 56 ? 18.476 9.368   2.871  1.00 83.20 ? 202  ARG A NH2 1 
ATOM   421  N N   . LEU A 1 57 ? 14.672 7.419   9.127  1.00 18.59 ? 203  LEU A N   1 
ATOM   422  C CA  . LEU A 1 57 ? 13.245 7.522   8.817  1.00 17.31 ? 203  LEU A CA  1 
ATOM   423  C C   . LEU A 1 57 ? 13.109 8.152   7.420  1.00 16.68 ? 203  LEU A C   1 
ATOM   424  O O   . LEU A 1 57 ? 13.421 9.324   7.222  1.00 18.54 ? 203  LEU A O   1 
ATOM   425  C CB  . LEU A 1 57 ? 12.510 8.366   9.849  1.00 17.85 ? 203  LEU A CB  1 
ATOM   426  C CG  . LEU A 1 57 ? 11.002 8.550   9.675  1.00 19.79 ? 203  LEU A CG  1 
ATOM   427  C CD1 . LEU A 1 57 ? 10.270 7.188   9.618  1.00 18.61 ? 203  LEU A CD1 1 
ATOM   428  C CD2 . LEU A 1 57 ? 10.382 9.482   10.778 1.00 17.20 ? 203  LEU A CD2 1 
ATOM   429  N N   . LEU A 1 58 ? 12.696 7.350   6.440  1.00 18.29 ? 204  LEU A N   1 
ATOM   430  C CA  . LEU A 1 58 ? 12.631 7.800   5.066  1.00 16.81 ? 204  LEU A CA  1 
ATOM   431  C C   . LEU A 1 58 ? 11.320 8.438   4.678  1.00 18.13 ? 204  LEU A C   1 
ATOM   432  O O   . LEU A 1 58 ? 11.312 9.359   3.867  1.00 19.20 ? 204  LEU A O   1 
ATOM   433  C CB  . LEU A 1 58 ? 12.825 6.596   4.148  1.00 20.09 ? 204  LEU A CB  1 
ATOM   434  C CG  . LEU A 1 58 ? 14.104 5.785   4.276  1.00 23.60 ? 204  LEU A CG  1 
ATOM   435  C CD1 . LEU A 1 58 ? 14.036 4.643   3.279  1.00 24.59 ? 204  LEU A CD1 1 
ATOM   436  C CD2 . LEU A 1 58 ? 15.321 6.677   4.016  1.00 28.71 ? 204  LEU A CD2 1 
ATOM   437  N N   . SER A 1 59 ? 10.229 7.893   5.193  1.00 15.13 ? 205  SER A N   1 
ATOM   438  C CA  A SER A 1 59 ? 8.898  8.346   4.804  0.33 16.32 ? 205  SER A CA  1 
ATOM   439  C CA  B SER A 1 59 ? 8.884  8.273   4.759  0.33 15.97 ? 205  SER A CA  1 
ATOM   440  C CA  C SER A 1 59 ? 8.889  8.312   4.784  0.33 16.68 ? 205  SER A CA  1 
ATOM   441  C C   . SER A 1 59 ? 7.835  8.053   5.859  1.00 19.07 ? 205  SER A C   1 
ATOM   442  O O   . SER A 1 59 ? 7.953  7.136   6.689  1.00 18.46 ? 205  SER A O   1 
ATOM   443  C CB  A SER A 1 59 ? 8.481  7.699   3.486  0.33 19.23 ? 205  SER A CB  1 
ATOM   444  C CB  B SER A 1 59 ? 8.493  7.463   3.510  0.33 18.24 ? 205  SER A CB  1 
ATOM   445  C CB  C SER A 1 59 ? 8.483  7.601   3.487  0.33 19.51 ? 205  SER A CB  1 
ATOM   446  O OG  A SER A 1 59 ? 7.944  6.417   3.732  0.33 18.94 ? 205  SER A OG  1 
ATOM   447  O OG  B SER A 1 59 ? 9.427  7.631   2.449  0.33 15.79 ? 205  SER A OG  1 
ATOM   448  O OG  C SER A 1 59 ? 7.182  7.991   3.073  0.33 20.97 ? 205  SER A OG  1 
ATOM   449  N N   . VAL A 1 60 ? 6.801  8.880   5.842  1.00 19.38 ? 206  VAL A N   1 
ATOM   450  C CA  . VAL A 1 60 ? 5.680  8.814   6.755  1.00 19.38 ? 206  VAL A CA  1 
ATOM   451  C C   . VAL A 1 60 ? 4.414  8.864   5.880  1.00 21.30 ? 206  VAL A C   1 
ATOM   452  O O   . VAL A 1 60 ? 4.145  9.893   5.264  1.00 22.53 ? 206  VAL A O   1 
ATOM   453  C CB  . VAL A 1 60 ? 5.695  10.049  7.745  1.00 24.27 ? 206  VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 60 ? 4.416  10.075  8.604  1.00 20.58 ? 206  VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 60 ? 6.979  10.085  8.606  1.00 20.59 ? 206  VAL A CG2 1 
ATOM   456  N N   . ASP A 1 61 ? 3.712  7.735   5.734  1.00 21.98 ? 207  ASP A N   1 
ATOM   457  C CA  . ASP A 1 61 ? 2.536  7.612   4.840  1.00 23.49 ? 207  ASP A CA  1 
ATOM   458  C C   . ASP A 1 61 ? 2.794  7.983   3.384  1.00 24.76 ? 207  ASP A C   1 
ATOM   459  O O   . ASP A 1 61 ? 1.954  8.621   2.728  1.00 25.92 ? 207  ASP A O   1 
ATOM   460  C CB  . ASP A 1 61 ? 1.368  8.444   5.368  1.00 31.60 ? 207  ASP A CB  1 
ATOM   461  C CG  . ASP A 1 61 ? 0.854  7.950   6.691  1.00 35.42 ? 207  ASP A CG  1 
ATOM   462  O OD1 . ASP A 1 61 ? 0.943  6.729   6.930  1.00 33.77 ? 207  ASP A OD1 1 
ATOM   463  O OD2 . ASP A 1 61 ? 0.328  8.780   7.469  1.00 38.03 ? 207  ASP A OD2 1 
ATOM   464  N N   . GLY A 1 62 ? 3.937  7.567   2.865  1.00 25.48 ? 208  GLY A N   1 
ATOM   465  C CA  . GLY A 1 62 ? 4.291  7.885   1.495  1.00 24.86 ? 208  GLY A CA  1 
ATOM   466  C C   . GLY A 1 62 ? 4.712  9.328   1.298  1.00 26.31 ? 208  GLY A C   1 
ATOM   467  O O   . GLY A 1 62 ? 4.883  9.775   0.149  1.00 26.61 ? 208  GLY A O   1 
ATOM   468  N N   . ILE A 1 63 ? 4.863  10.079  2.389  1.00 17.46 ? 209  ILE A N   1 
ATOM   469  C CA  . ILE A 1 63 ? 5.460  11.382  2.277  1.00 18.11 ? 209  ILE A CA  1 
ATOM   470  C C   . ILE A 1 63 ? 6.929  11.169  2.551  1.00 16.21 ? 209  ILE A C   1 
ATOM   471  O O   . ILE A 1 63 ? 7.294  10.874  3.676  1.00 17.29 ? 209  ILE A O   1 
ATOM   472  C CB  . ILE A 1 63 ? 4.840  12.426  3.268  1.00 17.66 ? 209  ILE A CB  1 
ATOM   473  C CG1 . ILE A 1 63 ? 3.318  12.518  3.090  1.00 23.73 ? 209  ILE A CG1 1 
ATOM   474  C CG2 . ILE A 1 63 ? 5.506  13.771  3.058  1.00 22.02 ? 209  ILE A CG2 1 
ATOM   475  C CD1 . ILE A 1 63 ? 2.582  12.969  4.323  1.00 26.37 ? 209  ILE A CD1 1 
ATOM   476  N N   . ARG A 1 64 ? 7.767  11.311  1.516  1.00 18.36 ? 210  ARG A N   1 
ATOM   477  C CA  . ARG A 1 64 ? 9.220  11.214  1.623  1.00 17.23 ? 210  ARG A CA  1 
ATOM   478  C C   . ARG A 1 64 ? 9.760  12.396  2.453  1.00 18.03 ? 210  ARG A C   1 
ATOM   479  O O   . ARG A 1 64 ? 9.392  13.567  2.231  1.00 20.48 ? 210  ARG A O   1 
ATOM   480  C CB  . ARG A 1 64 ? 9.856  11.264  0.241  1.00 18.92 ? 210  ARG A CB  1 
ATOM   481  C CG  . ARG A 1 64 ? 11.356 10.993  0.173  1.00 24.81 ? 210  ARG A CG  1 
ATOM   482  C CD  A ARG A 1 64 ? 11.718 9.494   0.220  0.50 16.72 ? 210  ARG A CD  1 
ATOM   483  C CD  B ARG A 1 64 ? 11.672 9.479   0.168  0.50 38.37 ? 210  ARG A CD  1 
ATOM   484  N NE  A ARG A 1 64 ? 13.162 9.295   0.096  0.50 20.02 ? 210  ARG A NE  1 
ATOM   485  N NE  B ARG A 1 64 ? 10.662 8.657   -0.522 0.50 27.46 ? 210  ARG A NE  1 
ATOM   486  C CZ  A ARG A 1 64 ? 14.037 9.578   1.053  0.50 16.77 ? 210  ARG A CZ  1 
ATOM   487  C CZ  B ARG A 1 64 ? 10.458 8.622   -1.838 0.50 37.97 ? 210  ARG A CZ  1 
ATOM   488  N NH1 A ARG A 1 64 ? 13.617 10.055  2.216  0.50 13.24 ? 210  ARG A NH1 1 
ATOM   489  N NH1 B ARG A 1 64 ? 9.510  7.837   -2.340 0.50 37.24 ? 210  ARG A NH1 1 
ATOM   490  N NH2 A ARG A 1 64 ? 15.335 9.384   0.833  0.50 22.89 ? 210  ARG A NH2 1 
ATOM   491  N NH2 B ARG A 1 64 ? 11.171 9.372   -2.663 0.50 37.30 ? 210  ARG A NH2 1 
ATOM   492  N N   . LEU A 1 65 ? 10.644 12.107  3.411  1.00 15.30 ? 211  LEU A N   1 
ATOM   493  C CA  . LEU A 1 65 ? 11.276 13.153  4.224  1.00 14.83 ? 211  LEU A CA  1 
ATOM   494  C C   . LEU A 1 65 ? 12.641 13.524  3.661  1.00 25.70 ? 211  LEU A C   1 
ATOM   495  O O   . LEU A 1 65 ? 13.632 13.681  4.378  1.00 28.33 ? 211  LEU A O   1 
ATOM   496  C CB  . LEU A 1 65 ? 11.443 12.621  5.645  1.00 14.52 ? 211  LEU A CB  1 
ATOM   497  C CG  . LEU A 1 65 ? 10.209 12.147  6.434  1.00 17.10 ? 211  LEU A CG  1 
ATOM   498  C CD1 . LEU A 1 65 ? 10.599 11.898  7.928  1.00 16.67 ? 211  LEU A CD1 1 
ATOM   499  C CD2 . LEU A 1 65 ? 9.042  13.097  6.394  1.00 16.24 ? 211  LEU A CD2 1 
ATOM   500  N N   . LEU A 1 66 ? 12.728 13.511  2.350  1.00 21.33 ? 212  LEU A N   1 
ATOM   501  C CA  . LEU A 1 66 ? 13.849 14.085  1.646  1.00 24.71 ? 212  LEU A CA  1 
ATOM   502  C C   . LEU A 1 66 ? 13.401 15.490  1.353  1.00 23.95 ? 212  LEU A C   1 
ATOM   503  O O   . LEU A 1 66 ? 12.310 15.690  0.811  1.00 28.67 ? 212  LEU A O   1 
ATOM   504  C CB  . LEU A 1 66 ? 14.079 13.321  0.336  1.00 24.57 ? 212  LEU A CB  1 
ATOM   505  C CG  . LEU A 1 66 ? 15.289 13.744  -0.500 1.00 24.73 ? 212  LEU A CG  1 
ATOM   506  C CD1 . LEU A 1 66 ? 16.541 13.514  0.315  1.00 24.43 ? 212  LEU A CD1 1 
ATOM   507  C CD2 . LEU A 1 66 ? 15.362 12.978  -1.808 1.00 16.52 ? 212  LEU A CD2 1 
ATOM   508  N N   . GLY A 1 67 ? 14.218 16.471  1.709  1.00 25.45 ? 213  GLY A N   1 
ATOM   509  C CA  . GLY A 1 67 ? 13.908 17.872  1.427  1.00 22.41 ? 213  GLY A CA  1 
ATOM   510  C C   . GLY A 1 67 ? 12.978 18.564  2.419  1.00 22.04 ? 213  GLY A C   1 
ATOM   511  O O   . GLY A 1 67 ? 12.747 19.751  2.307  1.00 25.65 ? 213  GLY A O   1 
ATOM   512  N N   . THR A 1 68 ? 12.434 17.812  3.375  1.00 17.41 ? 214  THR A N   1 
ATOM   513  C CA  . THR A 1 68 ? 11.631 18.387  4.439  1.00 17.28 ? 214  THR A CA  1 
ATOM   514  C C   . THR A 1 68 ? 12.522 18.884  5.569  1.00 16.88 ? 214  THR A C   1 
ATOM   515  O O   . THR A 1 68 ? 13.462 18.210  5.979  1.00 15.29 ? 214  THR A O   1 
ATOM   516  C CB  . THR A 1 68 ? 10.627 17.356  5.036  1.00 17.48 ? 214  THR A CB  1 
ATOM   517  O OG1 . THR A 1 68 ? 11.337 16.239  5.551  1.00 18.22 ? 214  THR A OG1 1 
ATOM   518  C CG2 . THR A 1 68 ? 9.593  16.889  4.008  1.00 16.86 ? 214  THR A CG2 1 
ATOM   519  N N   . THR A 1 69 ? 12.212 20.066  6.086  1.00 15.94 ? 215  THR A N   1 
ATOM   520  C CA  . THR A 1 69 ? 12.915 20.584  7.243  1.00 15.60 ? 215  THR A CA  1 
ATOM   521  C C   . THR A 1 69 ? 12.559 19.751  8.482  1.00 16.09 ? 215  THR A C   1 
ATOM   522  O O   . THR A 1 69 ? 11.585 19.000  8.498  1.00 16.93 ? 215  THR A O   1 
ATOM   523  C CB  . THR A 1 69 ? 12.550 22.043  7.529  1.00 14.05 ? 215  THR A CB  1 
ATOM   524  O OG1 . THR A 1 69 ? 11.183 22.138  7.950  1.00 19.96 ? 215  THR A OG1 1 
ATOM   525  C CG2 . THR A 1 69 ? 12.794 22.930  6.342  1.00 18.79 ? 215  THR A CG2 1 
ATOM   526  N N   . HIS A 1 70 ? 13.322 19.926  9.561  1.00 17.51 ? 216  HIS A N   1 
ATOM   527  C CA  . HIS A 1 70 ? 13.005 19.268  10.823 1.00 17.89 ? 216  HIS A CA  1 
ATOM   528  C C   . HIS A 1 70 ? 11.574 19.596  11.254 1.00 16.92 ? 216  HIS A C   1 
ATOM   529  O O   . HIS A 1 70 ? 10.793 18.708  11.644 1.00 17.79 ? 216  HIS A O   1 
ATOM   530  C CB  . HIS A 1 70 ? 14.007 19.706  11.897 1.00 17.56 ? 216  HIS A CB  1 
ATOM   531  C CG  . HIS A 1 70 ? 13.852 18.960  13.186 1.00 18.43 ? 216  HIS A CG  1 
ATOM   532  N ND1 . HIS A 1 70 ? 14.387 17.710  13.376 1.00 16.65 ? 216  HIS A ND1 1 
ATOM   533  C CD2 . HIS A 1 70 ? 13.174 19.262  14.322 1.00 19.58 ? 216  HIS A CD2 1 
ATOM   534  C CE1 . HIS A 1 70 ? 14.076 17.282  14.591 1.00 16.99 ? 216  HIS A CE1 1 
ATOM   535  N NE2 . HIS A 1 70 ? 13.311 18.195  15.176 1.00 18.81 ? 216  HIS A NE2 1 
ATOM   536  N N   . ALA A 1 71 ? 11.225 20.877  11.197 1.00 16.77 ? 217  ALA A N   1 
ATOM   537  C CA  . ALA A 1 71 ? 9.917  21.302  11.625 1.00 17.94 ? 217  ALA A CA  1 
ATOM   538  C C   . ALA A 1 71 ? 8.812  20.687  10.745 1.00 15.45 ? 217  ALA A C   1 
ATOM   539  O O   . ALA A 1 71 ? 7.759  20.296  11.240 1.00 19.73 ? 217  ALA A O   1 
ATOM   540  C CB  . ALA A 1 71 ? 9.847  22.818  11.612 1.00 17.70 ? 217  ALA A CB  1 
ATOM   541  N N   . GLU A 1 72 ? 9.067  20.553  9.446  1.00 16.23 ? 218  GLU A N   1 
ATOM   542  C CA  . GLU A 1 72 ? 8.083  19.934  8.523  1.00 15.62 ? 218  GLU A CA  1 
ATOM   543  C C   . GLU A 1 72 ? 7.927  18.434  8.845  1.00 15.35 ? 218  GLU A C   1 
ATOM   544  O O   . GLU A 1 72 ? 6.804  17.908  8.855  1.00 18.29 ? 218  GLU A O   1 
ATOM   545  C CB  . GLU A 1 72 ? 8.485  20.140  7.062  1.00 20.13 ? 218  GLU A CB  1 
ATOM   546  C CG  . GLU A 1 72 ? 8.309  21.587  6.584  1.00 16.08 ? 218  GLU A CG  1 
ATOM   547  C CD  . GLU A 1 72 ? 9.036  21.899  5.269  1.00 17.45 ? 218  GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 72 ? 9.899  21.123  4.838  1.00 19.50 ? 218  GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 72 ? 8.733  22.940  4.638  1.00 29.19 ? 218  GLU A OE2 1 
ATOM   550  N N   . ALA A 1 73 ? 9.049  17.748  9.083  1.00 16.60 ? 219  ALA A N   1 
ATOM   551  C CA  . ALA A 1 73 ? 9.006  16.333  9.495  1.00 12.78 ? 219  ALA A CA  1 
ATOM   552  C C   . ALA A 1 73 ? 8.225  16.157  10.786 1.00 16.41 ? 219  ALA A C   1 
ATOM   553  O O   . ALA A 1 73 ? 7.379  15.267  10.880 1.00 18.50 ? 219  ALA A O   1 
ATOM   554  C CB  . ALA A 1 73 ? 10.433 15.760  9.639  1.00 20.56 ? 219  ALA A CB  1 
ATOM   555  N N   . MET A 1 74 ? 8.494  17.000  11.798 1.00 17.96 ? 220  MET A N   1 
ATOM   556  C CA  . MET A 1 74 ? 7.726  16.944  13.054 1.00 22.38 ? 220  MET A CA  1 
ATOM   557  C C   . MET A 1 74 ? 6.226  17.157  12.791 1.00 18.85 ? 220  MET A C   1 
ATOM   558  O O   . MET A 1 74 ? 5.382  16.414  13.320 1.00 20.79 ? 220  MET A O   1 
ATOM   559  C CB  . MET A 1 74 ? 8.311  17.925  14.120 1.00 28.68 ? 220  MET A CB  1 
ATOM   560  C CG  . MET A 1 74 ? 7.606  19.261  14.285 1.00 38.64 ? 220  MET A CG  1 
ATOM   561  S SD  . MET A 1 74 ? 6.045  19.157  15.209 1.00 44.99 ? 220  MET A SD  1 
ATOM   562  C CE  . MET A 1 74 ? 5.086  20.492  14.475 1.00 51.47 ? 220  MET A CE  1 
ATOM   563  N N   . SER A 1 75 ? 5.877  18.123  11.935 1.00 16.35 ? 221  SER A N   1 
ATOM   564  C CA  . SER A 1 75 ? 4.474  18.427  11.635 1.00 17.63 ? 221  SER A CA  1 
ATOM   565  C C   . SER A 1 75 ? 3.811  17.286  10.888 1.00 17.64 ? 221  SER A C   1 
ATOM   566  O O   . SER A 1 75 ? 2.635  16.973  11.108 1.00 21.19 ? 221  SER A O   1 
ATOM   567  C CB  . SER A 1 75 ? 4.371  19.722  10.839 1.00 22.72 ? 221  SER A CB  1 
ATOM   568  O OG  . SER A 1 75 ? 5.032  20.761  11.536 1.00 35.49 ? 221  SER A OG  1 
ATOM   569  N N   . ILE A 1 76 ? 4.570  16.650  9.995  1.00 18.73 ? 222  ILE A N   1 
ATOM   570  C CA  . ILE A 1 76 ? 4.080  15.473  9.281  1.00 19.54 ? 222  ILE A CA  1 
ATOM   571  C C   . ILE A 1 76 ? 3.706  14.343  10.241 1.00 13.16 ? 222  ILE A C   1 
ATOM   572  O O   . ILE A 1 76 ? 2.613  13.738  10.120 1.00 17.45 ? 222  ILE A O   1 
ATOM   573  C CB  . ILE A 1 76 ? 5.114  14.986  8.211  1.00 19.71 ? 222  ILE A CB  1 
ATOM   574  C CG1 . ILE A 1 76 ? 5.094  15.960  7.037  1.00 15.66 ? 222  ILE A CG1 1 
ATOM   575  C CG2 . ILE A 1 76 ? 4.797  13.558  7.733  1.00 17.33 ? 222  ILE A CG2 1 
ATOM   576  C CD1 . ILE A 1 76 ? 6.209  15.820  6.065  1.00 19.07 ? 222  ILE A CD1 1 
ATOM   577  N N   . LEU A 1 77 ? 4.598  14.085  11.196 1.00 16.91 ? 223  LEU A N   1 
ATOM   578  C CA  . LEU A 1 77 ? 4.379  13.070  12.234 1.00 17.57 ? 223  LEU A CA  1 
ATOM   579  C C   . LEU A 1 77 ? 3.192  13.439  13.140 1.00 17.34 ? 223  LEU A C   1 
ATOM   580  O O   . LEU A 1 77 ? 2.416  12.555  13.541 1.00 21.56 ? 223  LEU A O   1 
ATOM   581  C CB  . LEU A 1 77 ? 5.658  12.848  13.031 1.00 21.21 ? 223  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 77 ? 6.695  12.069  12.206 1.00 19.12 ? 223  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 77 ? 8.112  12.361  12.639 1.00 20.70 ? 223  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 77 ? 6.382  10.572  12.281 1.00 18.87 ? 223  LEU A CD2 1 
ATOM   585  N N   . LYS A 1 78 ? 3.069  14.729  13.447 1.00 19.18 ? 224  LYS A N   1 
ATOM   586  C CA  . LYS A 1 78 ? 1.946  15.227  14.286 1.00 19.26 ? 224  LYS A CA  1 
ATOM   587  C C   . LYS A 1 78 ? 0.580  15.102  13.614 1.00 27.22 ? 224  LYS A C   1 
ATOM   588  O O   . LYS A 1 78 ? -0.418 14.778  14.265 1.00 24.27 ? 224  LYS A O   1 
ATOM   589  C CB  . LYS A 1 78 ? 2.220  16.682  14.711 1.00 20.26 ? 224  LYS A CB  1 
ATOM   590  C CG  . LYS A 1 78 ? 1.220  17.279  15.700 1.00 24.56 ? 224  LYS A CG  1 
ATOM   591  N N   . GLN A 1 79 ? 0.538  15.320  12.304 1.00 22.05 ? 225  GLN A N   1 
ATOM   592  C CA  . GLN A 1 79 ? -0.715 15.433  11.597 1.00 22.63 ? 225  GLN A CA  1 
ATOM   593  C C   . GLN A 1 79 ? -1.176 14.153  10.911 1.00 21.06 ? 225  GLN A C   1 
ATOM   594  O O   . GLN A 1 79 ? -2.288 14.111  10.383 1.00 20.45 ? 225  GLN A O   1 
ATOM   595  C CB  . GLN A 1 79 ? -0.646 16.604  10.625 1.00 22.47 ? 225  GLN A CB  1 
ATOM   596  C CG  . GLN A 1 79 ? -0.560 17.936  11.366 1.00 37.66 ? 225  GLN A CG  1 
ATOM   597  C CD  . GLN A 1 79 ? -0.196 19.100  10.480 1.00 49.27 ? 225  GLN A CD  1 
ATOM   598  O OE1 . GLN A 1 79 ? 0.277  20.132  10.963 1.00 58.80 ? 225  GLN A OE1 1 
ATOM   599  N NE2 . GLN A 1 79 ? -0.417 18.950  9.177  1.00 58.91 ? 225  GLN A NE2 1 
ATOM   600  N N   . CYS A 1 80 ? -0.371 13.096  10.938 1.00 23.27 ? 226  CYS A N   1 
ATOM   601  C CA  . CYS A 1 80 ? -0.805 11.885  10.253 1.00 23.26 ? 226  CYS A CA  1 
ATOM   602  C C   . CYS A 1 80 ? -1.821 11.091  11.096 1.00 21.04 ? 226  CYS A C   1 
ATOM   603  O O   . CYS A 1 80 ? -1.955 11.309  12.306 1.00 22.88 ? 226  CYS A O   1 
ATOM   604  C CB  . CYS A 1 80 ? 0.384  11.031  9.855  1.00 26.01 ? 226  CYS A CB  1 
ATOM   605  S SG  . CYS A 1 80 ? 1.259  10.375  11.224 1.00 25.95 ? 226  CYS A SG  1 
ATOM   606  N N   . GLY A 1 81 ? -2.577 10.207  10.449 1.00 18.70 ? 227  GLY A N   1 
ATOM   607  C CA  . GLY A 1 81 ? -3.596 9.425   11.163 1.00 22.00 ? 227  GLY A CA  1 
ATOM   608  C C   . GLY A 1 81 ? -2.994 8.603   12.298 1.00 22.03 ? 227  GLY A C   1 
ATOM   609  O O   . GLY A 1 81 ? -1.759 8.432   12.366 1.00 19.78 ? 227  GLY A O   1 
ATOM   610  N N   . GLN A 1 82 ? -3.858 8.107   13.188 1.00 22.10 ? 228  GLN A N   1 
ATOM   611  C CA  . GLN A 1 82 ? -3.429 7.288   14.335 1.00 24.24 ? 228  GLN A CA  1 
ATOM   612  C C   . GLN A 1 82 ? -2.621 6.066   13.872 1.00 24.23 ? 228  GLN A C   1 
ATOM   613  O O   . GLN A 1 82 ? -1.540 5.835   14.385 1.00 26.73 ? 228  GLN A O   1 
ATOM   614  C CB  . GLN A 1 82 ? -4.628 6.869   15.209 1.00 30.88 ? 228  GLN A CB  1 
ATOM   615  N N   . GLU A 1 83 ? -3.148 5.319   12.894 1.00 20.79 ? 229  GLU A N   1 
ATOM   616  C CA  . GLU A 1 83 ? -2.388 4.278   12.195 1.00 24.02 ? 229  GLU A CA  1 
ATOM   617  C C   . GLU A 1 83 ? -1.572 4.918   11.061 1.00 27.03 ? 229  GLU A C   1 
ATOM   618  O O   . GLU A 1 83 ? -2.124 5.509   10.134 1.00 27.65 ? 229  GLU A O   1 
ATOM   619  C CB  . GLU A 1 83 ? -3.307 3.171   11.657 1.00 31.60 ? 229  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 83 ? -2.560 1.937   11.108 1.00 32.09 ? 229  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 83 ? -3.499 0.867   10.561 1.00 39.65 ? 229  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 83 ? -3.027 -0.238  10.209 1.00 47.95 ? 229  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 83 ? -4.714 1.135   10.473 1.00 38.54 ? 229  GLU A OE2 1 
ATOM   624  N N   . ALA A 1 84 ? -0.257 4.779   11.155 1.00 21.82 ? 230  ALA A N   1 
ATOM   625  C CA  . ALA A 1 84 ? 0.704  5.387   10.212 1.00 19.42 ? 230  ALA A CA  1 
ATOM   626  C C   . ALA A 1 84 ? 1.721  4.338   9.743  1.00 21.31 ? 230  ALA A C   1 
ATOM   627  O O   . ALA A 1 84 ? 2.217  3.542   10.542 1.00 21.90 ? 230  ALA A O   1 
ATOM   628  C CB  . ALA A 1 84 ? 1.441  6.564   10.835 1.00 22.72 ? 230  ALA A CB  1 
ATOM   629  N N   . ALA A 1 85 ? 1.994  4.333   8.441  1.00 19.53 ? 231  ALA A N   1 
ATOM   630  C CA  . ALA A 1 85 ? 3.073  3.520   7.869  1.00 20.10 ? 231  ALA A CA  1 
ATOM   631  C C   . ALA A 1 85 ? 4.350  4.343   7.792  1.00 16.45 ? 231  ALA A C   1 
ATOM   632  O O   . ALA A 1 85 ? 4.404  5.370   7.120  1.00 22.24 ? 231  ALA A O   1 
ATOM   633  C CB  . ALA A 1 85 ? 2.670  3.022   6.482  1.00 16.66 ? 231  ALA A CB  1 
ATOM   634  N N   . LEU A 1 86 ? 5.377  3.904   8.506  1.00 17.02 ? 232  LEU A N   1 
ATOM   635  C CA  . LEU A 1 86 ? 6.671  4.554   8.507  1.00 20.02 ? 232  LEU A CA  1 
ATOM   636  C C   . LEU A 1 86 ? 7.658  3.653   7.750  1.00 25.21 ? 232  LEU A C   1 
ATOM   637  O O   . LEU A 1 86 ? 7.727  2.460   7.993  1.00 25.60 ? 232  LEU A O   1 
ATOM   638  C CB  . LEU A 1 86 ? 7.144  4.734   9.941  1.00 20.63 ? 232  LEU A CB  1 
ATOM   639  C CG  . LEU A 1 86 ? 6.162  5.368   10.931 1.00 22.94 ? 232  LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 86 ? 6.885  5.552   12.265 1.00 24.37 ? 232  LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 86 ? 5.612  6.702   10.438 1.00 23.62 ? 232  LEU A CD2 1 
ATOM   642  N N   . LEU A 1 87 ? 8.406  4.232   6.824  1.00 18.54 ? 233  LEU A N   1 
ATOM   643  C CA  . LEU A 1 87 ? 9.440  3.499   6.146  1.00 17.40 ? 233  LEU A CA  1 
ATOM   644  C C   . LEU A 1 87 ? 10.761 3.866   6.796  1.00 20.25 ? 233  LEU A C   1 
ATOM   645  O O   . LEU A 1 87 ? 11.144 5.045   6.813  1.00 18.34 ? 233  LEU A O   1 
ATOM   646  C CB  . LEU A 1 87 ? 9.474  3.860   4.689  1.00 18.75 ? 233  LEU A CB  1 
ATOM   647  C CG  . LEU A 1 87 ? 10.213 2.905   3.798  1.00 25.92 ? 233  LEU A CG  1 
ATOM   648  C CD1 . LEU A 1 87 ? 9.421  1.591   3.703  1.00 24.49 ? 233  LEU A CD1 1 
ATOM   649  C CD2 . LEU A 1 87 ? 10.367 3.547   2.431  1.00 27.03 ? 233  LEU A CD2 1 
ATOM   650  N N   . ILE A 1 88 ? 11.436 2.878   7.378  1.00 17.87 ? 234  ILE A N   1 
ATOM   651  C CA  . ILE A 1 88 ? 12.755 3.091   7.961  1.00 17.06 ? 234  ILE A CA  1 
ATOM   652  C C   . ILE A 1 88 ? 13.821 2.278   7.201  1.00 19.34 ? 234  ILE A C   1 
ATOM   653  O O   . ILE A 1 88 ? 13.521 1.405   6.393  1.00 18.20 ? 234  ILE A O   1 
ATOM   654  C CB  . ILE A 1 88 ? 12.790 2.713   9.462  1.00 18.98 ? 234  ILE A CB  1 
ATOM   655  C CG1 . ILE A 1 88 ? 12.476 1.216   9.665  1.00 18.88 ? 234  ILE A CG1 1 
ATOM   656  C CG2 . ILE A 1 88 ? 11.730 3.519   10.253 1.00 19.57 ? 234  ILE A CG2 1 
ATOM   657  C CD1 . ILE A 1 88 ? 12.553 0.733   11.131 1.00 23.95 ? 234  ILE A CD1 1 
ATOM   658  N N   . GLU A 1 89 ? 15.080 2.578   7.472  1.00 17.00 ? 235  GLU A N   1 
ATOM   659  C CA  . GLU A 1 89 ? 16.139 1.955   6.731  1.00 17.14 ? 235  GLU A CA  1 
ATOM   660  C C   . GLU A 1 89 ? 17.233 1.618   7.745  1.00 18.19 ? 235  GLU A C   1 
ATOM   661  O O   . GLU A 1 89 ? 17.612 2.468   8.584  1.00 19.52 ? 235  GLU A O   1 
ATOM   662  C CB  . GLU A 1 89 ? 16.623 2.898   5.623  1.00 19.50 ? 235  GLU A CB  1 
ATOM   663  C CG  . GLU A 1 89 ? 17.789 2.387   4.835  1.00 21.69 ? 235  GLU A CG  1 
ATOM   664  C CD  . GLU A 1 89 ? 18.120 3.280   3.652  1.00 26.71 ? 235  GLU A CD  1 
ATOM   665  O OE1 . GLU A 1 89 ? 18.404 4.470   3.895  1.00 29.78 ? 235  GLU A OE1 1 
ATOM   666  O OE2 . GLU A 1 89 ? 18.136 2.779   2.511  1.00 31.53 ? 235  GLU A OE2 1 
ATOM   667  N N   . TYR A 1 90 ? 17.655 0.351   7.726  1.00 17.68 ? 236  TYR A N   1 
ATOM   668  C CA  . TYR A 1 90 ? 18.759 -0.110  8.585  1.00 18.24 ? 236  TYR A CA  1 
ATOM   669  C C   . TYR A 1 90 ? 19.293 -1.412  8.033  1.00 18.41 ? 236  TYR A C   1 
ATOM   670  O O   . TYR A 1 90 ? 18.826 -1.906  7.031  1.00 18.02 ? 236  TYR A O   1 
ATOM   671  C CB  . TYR A 1 90 ? 18.322 -0.264  10.059 1.00 18.92 ? 236  TYR A CB  1 
ATOM   672  C CG  . TYR A 1 90 ? 17.191 -1.281  10.238 1.00 18.75 ? 236  TYR A CG  1 
ATOM   673  C CD1 . TYR A 1 90 ? 17.474 -2.604  10.589 1.00 19.22 ? 236  TYR A CD1 1 
ATOM   674  C CD2 . TYR A 1 90 ? 15.840 -0.934  10.052 1.00 17.62 ? 236  TYR A CD2 1 
ATOM   675  C CE1 . TYR A 1 90 ? 16.465 -3.515  10.747 1.00 14.95 ? 236  TYR A CE1 1 
ATOM   676  C CE2 . TYR A 1 90 ? 14.818 -1.832  10.234 1.00 21.52 ? 236  TYR A CE2 1 
ATOM   677  C CZ  . TYR A 1 90 ? 15.111 -3.152  10.563 1.00 16.49 ? 236  TYR A CZ  1 
ATOM   678  O OH  . TYR A 1 90 ? 14.033 -4.032  10.744 1.00 19.42 ? 236  TYR A OH  1 
ATOM   679  N N   . ASP A 1 91 ? 20.307 -1.940  8.699  1.00 16.48 ? 237  ASP A N   1 
ATOM   680  C CA  . ASP A 1 91 ? 20.943 -3.178  8.252  1.00 18.05 ? 237  ASP A CA  1 
ATOM   681  C C   . ASP A 1 91 ? 20.104 -4.387  8.689  1.00 17.25 ? 237  ASP A C   1 
ATOM   682  O O   . ASP A 1 91 ? 20.144 -4.783  9.852  1.00 19.26 ? 237  ASP A O   1 
ATOM   683  C CB  . ASP A 1 91 ? 22.329 -3.262  8.860  1.00 21.13 ? 237  ASP A CB  1 
ATOM   684  C CG  . ASP A 1 91 ? 23.142 -4.408  8.322  1.00 23.74 ? 237  ASP A CG  1 
ATOM   685  O OD1 . ASP A 1 91 ? 22.699 -5.095  7.368  1.00 25.91 ? 237  ASP A OD1 1 
ATOM   686  O OD2 . ASP A 1 91 ? 24.251 -4.584  8.857  1.00 33.54 ? 237  ASP A OD2 1 
ATOM   687  N N   . VAL A 1 92 ? 19.315 -4.922  7.757  1.00 18.06 ? 238  VAL A N   1 
ATOM   688  C CA  . VAL A 1 92 ? 18.360 -5.984  8.026  1.00 16.32 ? 238  VAL A CA  1 
ATOM   689  C C   . VAL A 1 92 ? 18.961 -7.362  7.712  1.00 19.29 ? 238  VAL A C   1 
ATOM   690  O O   . VAL A 1 92 ? 19.616 -7.535  6.669  1.00 17.79 ? 238  VAL A O   1 
ATOM   691  C CB  . VAL A 1 92 ? 17.100 -5.786  7.160  1.00 20.28 ? 238  VAL A CB  1 
ATOM   692  C CG1 . VAL A 1 92 ? 16.086 -6.929  7.388  1.00 21.80 ? 238  VAL A CG1 1 
ATOM   693  C CG2 . VAL A 1 92 ? 16.442 -4.464  7.441  1.00 21.43 ? 238  VAL A CG2 1 
ATOM   694  N N   . SER A 1 93 ? 18.730 -8.316  8.628  1.00 15.35 ? 239  SER A N   1 
ATOM   695  C CA  . SER A 1 93 ? 19.006 -9.700  8.460  1.00 14.00 ? 239  SER A CA  1 
ATOM   696  C C   . SER A 1 93 ? 17.686 -10.362 8.068  1.00 14.96 ? 239  SER A C   1 
ATOM   697  O O   . SER A 1 93 ? 16.691 -10.218 8.786  1.00 17.66 ? 239  SER A O   1 
ATOM   698  C CB  . SER A 1 93 ? 19.532 -10.341 9.744  1.00 17.33 ? 239  SER A CB  1 
ATOM   699  O OG  . SER A 1 93 ? 20.807 -9.825  10.116 1.00 21.78 ? 239  SER A OG  1 
ATOM   700  N N   . GLU A 1 94 ? 17.681 -10.977 6.901  1.00 15.25 ? 240  GLU A N   1 
ATOM   701  C CA  . GLU A 1 94 ? 16.476 -11.573 6.353  1.00 19.11 ? 240  GLU A CA  1 
ATOM   702  C C   . GLU A 1 94 ? 16.812 -12.861 5.670  1.00 17.74 ? 240  GLU A C   1 
ATOM   703  O O   . GLU A 1 94 ? 17.742 -12.900 4.840  1.00 17.34 ? 240  GLU A O   1 
ATOM   704  C CB  . GLU A 1 94 ? 15.862 -10.610 5.358  1.00 22.02 ? 240  GLU A CB  1 
ATOM   705  C CG  . GLU A 1 94 ? 14.512 -11.014 4.874  1.00 33.54 ? 240  GLU A CG  1 
ATOM   706  C CD  . GLU A 1 94 ? 13.769 -9.865  4.263  1.00 37.42 ? 240  GLU A CD  1 
ATOM   707  O OE1 . GLU A 1 94 ? 14.250 -9.298  3.245  1.00 28.86 ? 240  GLU A OE1 1 
ATOM   708  O OE2 . GLU A 1 94 ? 12.690 -9.544  4.801  1.00 40.34 ? 240  GLU A OE2 1 
ATOM   709  N N   . THR A 1 95 ? 16.062 -13.932 5.971  1.00 13.46 ? 241  THR A N   1 
ATOM   710  C CA  . THR A 1 95 ? 16.336 -15.278 5.475  1.00 15.11 ? 241  THR A CA  1 
ATOM   711  C C   . THR A 1 95 ? 15.013 -15.994 5.122  1.00 14.57 ? 241  THR A C   1 
ATOM   712  O O   . THR A 1 95 ? 14.023 -15.894 5.885  1.00 14.45 ? 241  THR A O   1 
ATOM   713  C CB  . THR A 1 95 ? 17.114 -16.138 6.527  1.00 15.64 ? 241  THR A CB  1 
ATOM   714  O OG1 . THR A 1 95 ? 18.316 -15.457 6.916  1.00 14.57 ? 241  THR A OG1 1 
ATOM   715  C CG2 . THR A 1 95 ? 17.455 -17.485 5.998  1.00 15.74 ? 241  THR A CG2 1 
ATOM   716  N N   . ALA A 1 96 ? 14.957 -16.642 3.966  1.00 10.23 ? 242  ALA A N   1 
ATOM   717  C CA  . ALA A 1 96 ? 13.856 -17.507 3.666  1.00 8.11  ? 242  ALA A CA  1 
ATOM   718  C C   . ALA A 1 96 ? 13.979 -18.814 4.449  1.00 13.92 ? 242  ALA A C   1 
ATOM   719  O O   . ALA A 1 96 ? 15.022 -19.480 4.425  1.00 15.79 ? 242  ALA A O   1 
ATOM   720  C CB  . ALA A 1 96 ? 13.795 -17.741 2.168  1.00 10.21 ? 242  ALA A CB  1 
ATOM   721  N N   . VAL A 1 97 ? 12.886 -19.197 5.120  1.00 16.29 ? 243  VAL A N   1 
ATOM   722  C CA  . VAL A 1 97 ? 12.858 -20.418 5.911  1.00 14.53 ? 243  VAL A CA  1 
ATOM   723  C C   . VAL A 1 97 ? 11.663 -21.289 5.580  1.00 12.94 ? 243  VAL A C   1 
ATOM   724  O O   . VAL A 1 97 ? 10.840 -20.974 4.682  1.00 19.92 ? 243  VAL A O   1 
ATOM   725  C CB  . VAL A 1 97 ? 12.785 -20.094 7.428  1.00 13.57 ? 243  VAL A CB  1 
ATOM   726  C CG1 . VAL A 1 97 ? 14.065 -19.339 7.882  1.00 15.42 ? 243  VAL A CG1 1 
ATOM   727  C CG2 . VAL A 1 97 ? 11.553 -19.236 7.773  1.00 20.24 ? 243  VAL A CG2 1 
ATOM   728  O OXT . VAL A 1 97 ? 11.505 -22.392 6.154  1.00 23.29 ? 243  VAL A OXT 1 
ATOM   729  N N   . SER B 1 1  ? 20.459 22.567  19.370 1.00 22.79 ? -1   SER B N   1 
ATOM   730  C CA  . SER B 1 1  ? 21.447 22.860  20.452 1.00 22.36 ? -1   SER B CA  1 
ATOM   731  C C   . SER B 1 1  ? 22.696 22.055  20.183 1.00 19.08 ? -1   SER B C   1 
ATOM   732  O O   . SER B 1 1  ? 22.616 21.016  19.560 1.00 19.37 ? -1   SER B O   1 
ATOM   733  C CB  . SER B 1 1  ? 20.907 22.460  21.831 1.00 24.58 ? -1   SER B CB  1 
ATOM   734  O OG  . SER B 1 1  ? 19.636 23.026  22.085 1.00 38.50 ? -1   SER B OG  1 
ATOM   735  N N   . MET B 1 2  ? 23.843 22.484  20.710 1.00 19.22 ? 0    MET B N   1 
ATOM   736  C CA  . MET B 1 2  ? 25.033 21.712  20.497 1.00 15.88 ? 0    MET B CA  1 
ATOM   737  C C   . MET B 1 2  ? 24.837 20.357  21.157 1.00 16.53 ? 0    MET B C   1 
ATOM   738  O O   . MET B 1 2  ? 24.380 20.286  22.298 1.00 18.23 ? 0    MET B O   1 
ATOM   739  C CB  . MET B 1 2  ? 26.205 22.397  21.169 1.00 18.89 ? 0    MET B CB  1 
ATOM   740  C CG  A MET B 1 2  ? 26.988 23.482  20.407 0.50 18.55 ? 0    MET B CG  1 
ATOM   741  C CG  B MET B 1 2  ? 27.624 22.143  20.596 0.50 17.84 ? 0    MET B CG  1 
ATOM   742  S SD  A MET B 1 2  ? 27.142 23.372  18.626 0.50 28.13 ? 0    MET B SD  1 
ATOM   743  S SD  B MET B 1 2  ? 27.850 22.363  18.844 0.50 26.70 ? 0    MET B SD  1 
ATOM   744  C CE  A MET B 1 2  ? 28.234 21.956  18.583 0.50 23.10 ? 0    MET B CE  1 
ATOM   745  C CE  B MET B 1 2  ? 26.716 23.761  18.730 0.50 11.34 ? 0    MET B CE  1 
ATOM   746  N N   . ARG B 1 3  ? 25.212 19.298  20.441 1.00 16.69 ? 149  ARG B N   1 
ATOM   747  C CA  . ARG B 1 3  ? 25.020 17.927  20.927 1.00 15.78 ? 149  ARG B CA  1 
ATOM   748  C C   . ARG B 1 3  ? 26.126 17.048  20.373 1.00 15.95 ? 149  ARG B C   1 
ATOM   749  O O   . ARG B 1 3  ? 26.601 17.265  19.258 1.00 17.74 ? 149  ARG B O   1 
ATOM   750  C CB  . ARG B 1 3  ? 23.675 17.445  20.428 1.00 19.18 ? 149  ARG B CB  1 
ATOM   751  C CG  . ARG B 1 3  ? 23.082 16.170  21.015 1.00 18.93 ? 149  ARG B CG  1 
ATOM   752  C CD  . ARG B 1 3  ? 22.123 15.593  20.030 1.00 23.25 ? 149  ARG B CD  1 
ATOM   753  N NE  . ARG B 1 3  ? 21.272 14.480  20.495 1.00 22.83 ? 149  ARG B NE  1 
ATOM   754  C CZ  . ARG B 1 3  ? 21.557 13.181  20.385 1.00 24.24 ? 149  ARG B CZ  1 
ATOM   755  N NH1 . ARG B 1 3  ? 22.752 12.744  19.984 1.00 24.24 ? 149  ARG B NH1 1 
ATOM   756  N NH2 . ARG B 1 3  ? 20.631 12.294  20.710 1.00 21.51 ? 149  ARG B NH2 1 
ATOM   757  N N   . THR B 1 4  ? 26.452 16.033  21.183 1.00 16.00 ? 150  THR B N   1 
ATOM   758  C CA  . THR B 1 4  ? 27.353 14.969  20.765 1.00 15.99 ? 150  THR B CA  1 
ATOM   759  C C   . THR B 1 4  ? 26.542 13.854  20.124 1.00 16.93 ? 150  THR B C   1 
ATOM   760  O O   . THR B 1 4  ? 25.544 13.382  20.717 1.00 18.18 ? 150  THR B O   1 
ATOM   761  C CB  . THR B 1 4  ? 28.164 14.493  21.962 1.00 17.17 ? 150  THR B CB  1 
ATOM   762  O OG1 . THR B 1 4  ? 28.926 15.615  22.473 1.00 18.18 ? 150  THR B OG1 1 
ATOM   763  C CG2 . THR B 1 4  ? 29.100 13.334  21.632 1.00 19.66 ? 150  THR B CG2 1 
ATOM   764  N N   . VAL B 1 5  ? 26.975 13.420  18.943 1.00 16.81 ? 151  VAL B N   1 
ATOM   765  C CA  . VAL B 1 5  ? 26.230 12.459  18.159 1.00 18.01 ? 151  VAL B CA  1 
ATOM   766  C C   . VAL B 1 5  ? 27.156 11.301  17.774 1.00 18.29 ? 151  VAL B C   1 
ATOM   767  O O   . VAL B 1 5  ? 28.288 11.514  17.332 1.00 17.91 ? 151  VAL B O   1 
ATOM   768  C CB  . VAL B 1 5  ? 25.644 13.110  16.871 1.00 18.48 ? 151  VAL B CB  1 
ATOM   769  C CG1 . VAL B 1 5  ? 24.984 12.037  15.973 1.00 18.89 ? 151  VAL B CG1 1 
ATOM   770  C CG2 . VAL B 1 5  ? 24.657 14.254  17.238 1.00 20.46 ? 151  VAL B CG2 1 
ATOM   771  N N   . GLU B 1 6  ? 26.667 10.062  17.922 1.00 17.15 ? 152  GLU B N   1 
ATOM   772  C CA  . GLU B 1 6  ? 27.430 8.897   17.553 1.00 17.33 ? 152  GLU B CA  1 
ATOM   773  C C   . GLU B 1 6  ? 27.051 8.439   16.138 1.00 19.74 ? 152  GLU B C   1 
ATOM   774  O O   . GLU B 1 6  ? 25.870 8.221   15.863 1.00 23.23 ? 152  GLU B O   1 
ATOM   775  C CB  . GLU B 1 6  ? 27.189 7.754   18.542 1.00 22.34 ? 152  GLU B CB  1 
ATOM   776  C CG  . GLU B 1 6  ? 27.954 6.483   18.228 1.00 26.17 ? 152  GLU B CG  1 
ATOM   777  C CD  . GLU B 1 6  ? 27.614 5.367   19.196 1.00 27.84 ? 152  GLU B CD  1 
ATOM   778  O OE1 . GLU B 1 6  ? 26.783 4.499   18.846 1.00 37.23 ? 152  GLU B OE1 1 
ATOM   779  O OE2 . GLU B 1 6  ? 28.156 5.387   20.314 1.00 35.03 ? 152  GLU B OE2 1 
ATOM   780  N N   . VAL B 1 7  ? 28.072 8.321   15.288 1.00 18.16 ? 153  VAL B N   1 
ATOM   781  C CA  . VAL B 1 7  ? 27.982 7.847   13.905 1.00 22.04 ? 153  VAL B CA  1 
ATOM   782  C C   . VAL B 1 7  ? 28.883 6.610   13.763 1.00 17.91 ? 153  VAL B C   1 
ATOM   783  O O   . VAL B 1 7  ? 30.097 6.685   14.006 1.00 22.03 ? 153  VAL B O   1 
ATOM   784  C CB  . VAL B 1 7  ? 28.474 8.938   12.924 1.00 20.11 ? 153  VAL B CB  1 
ATOM   785  C CG1 . VAL B 1 7  ? 28.539 8.405   11.457 1.00 32.13 ? 153  VAL B CG1 1 
ATOM   786  C CG2 . VAL B 1 7  ? 27.572 10.172  12.939 1.00 26.90 ? 153  VAL B CG2 1 
ATOM   787  N N   . THR B 1 8  ? 28.324 5.517   13.230 1.00 20.54 ? 154  THR B N   1 
ATOM   788  C CA  . THR B 1 8  ? 29.115 4.332   12.919 1.00 19.75 ? 154  THR B CA  1 
ATOM   789  C C   . THR B 1 8  ? 29.329 4.245   11.396 1.00 20.13 ? 154  THR B C   1 
ATOM   790  O O   . THR B 1 8  ? 28.371 4.287   10.637 1.00 20.96 ? 154  THR B O   1 
ATOM   791  C CB  . THR B 1 8  ? 28.444 3.013   13.448 1.00 22.48 ? 154  THR B CB  1 
ATOM   792  O OG1 . THR B 1 8  ? 28.290 3.070   14.882 1.00 22.62 ? 154  THR B OG1 1 
ATOM   793  C CG2 . THR B 1 8  ? 29.274 1.773   13.039 1.00 23.05 ? 154  THR B CG2 1 
ATOM   794  N N   . LEU B 1 9  ? 30.587 4.198   10.986 1.00 19.19 ? 155  LEU B N   1 
ATOM   795  C CA  . LEU B 1 9  ? 30.958 4.087   9.568  1.00 18.64 ? 155  LEU B CA  1 
ATOM   796  C C   . LEU B 1 9  ? 31.704 2.781   9.323  1.00 21.48 ? 155  LEU B C   1 
ATOM   797  O O   . LEU B 1 9  ? 32.454 2.287   10.158 1.00 17.96 ? 155  LEU B O   1 
ATOM   798  C CB  . LEU B 1 9  ? 31.858 5.243   9.134  1.00 19.95 ? 155  LEU B CB  1 
ATOM   799  C CG  . LEU B 1 9  ? 31.332 6.672   9.267  1.00 20.07 ? 155  LEU B CG  1 
ATOM   800  C CD1 . LEU B 1 9  ? 32.334 7.663   8.668  1.00 20.75 ? 155  LEU B CD1 1 
ATOM   801  C CD2 . LEU B 1 9  ? 29.957 6.834   8.660  1.00 25.23 ? 155  LEU B CD2 1 
ATOM   802  N N   . HIS B 1 10 ? 31.536 2.239   8.129  1.00 22.22 ? 156  HIS B N   1 
ATOM   803  C CA  . HIS B 1 10 ? 32.295 1.066   7.730  1.00 19.68 ? 156  HIS B CA  1 
ATOM   804  C C   . HIS B 1 10 ? 33.236 1.503   6.611  1.00 27.56 ? 156  HIS B C   1 
ATOM   805  O O   . HIS B 1 10 ? 32.775 1.994   5.580  1.00 22.18 ? 156  HIS B O   1 
ATOM   806  C CB  . HIS B 1 10 ? 31.348 -0.043  7.254  1.00 28.48 ? 156  HIS B CB  1 
ATOM   807  C CG  . HIS B 1 10 ? 30.309 -0.420  8.265  1.00 34.51 ? 156  HIS B CG  1 
ATOM   808  N ND1 . HIS B 1 10 ? 30.379 -1.582  9.003  1.00 36.83 ? 156  HIS B ND1 1 
ATOM   809  C CD2 . HIS B 1 10 ? 29.176 0.213   8.663  1.00 33.07 ? 156  HIS B CD2 1 
ATOM   810  C CE1 . HIS B 1 10 ? 29.336 -1.644  9.815  1.00 48.06 ? 156  HIS B CE1 1 
ATOM   811  N NE2 . HIS B 1 10 ? 28.594 -0.565  9.632  1.00 35.73 ? 156  HIS B NE2 1 
ATOM   812  N N   . LYS B 1 11 ? 34.542 1.366   6.846  1.00 24.31 ? 157  LYS B N   1 
ATOM   813  C CA  . LYS B 1 11 ? 35.544 1.858   5.916  1.00 28.92 ? 157  LYS B CA  1 
ATOM   814  C C   . LYS B 1 11 ? 35.474 1.082   4.615  1.00 29.16 ? 157  LYS B C   1 
ATOM   815  O O   . LYS B 1 11 ? 35.278 -0.152  4.600  1.00 31.30 ? 157  LYS B O   1 
ATOM   816  C CB  . LYS B 1 11 ? 36.966 1.711   6.476  1.00 25.42 ? 157  LYS B CB  1 
ATOM   817  C CG  . LYS B 1 11 ? 37.322 2.591   7.667  1.00 35.85 ? 157  LYS B CG  1 
ATOM   818  C CD  . LYS B 1 11 ? 38.564 2.030   8.376  1.00 45.38 ? 157  LYS B CD  1 
ATOM   819  C CE  . LYS B 1 11 ? 39.484 3.110   8.911  1.00 26.10 ? 157  LYS B CE  1 
ATOM   820  N NZ  . LYS B 1 11 ? 40.785 2.566   9.438  1.00 25.33 ? 157  LYS B NZ  1 
ATOM   821  N N   . GLU B 1 12 ? 35.650 1.811   3.516  1.00 34.71 ? 158  GLU B N   1 
ATOM   822  C CA  . GLU B 1 12 ? 36.000 1.206   2.228  1.00 32.45 ? 158  GLU B CA  1 
ATOM   823  C C   . GLU B 1 12 ? 37.497 1.422   2.053  1.00 32.29 ? 158  GLU B C   1 
ATOM   824  O O   . GLU B 1 12 ? 37.958 2.573   2.043  1.00 27.74 ? 158  GLU B O   1 
ATOM   825  C CB  . GLU B 1 12 ? 35.278 1.905   1.077  1.00 39.61 ? 158  GLU B CB  1 
ATOM   826  C CG  . GLU B 1 12 ? 33.770 1.881   1.126  1.00 26.01 ? 158  GLU B CG  1 
ATOM   827  C CD  . GLU B 1 12 ? 33.172 2.486   -0.140 1.00 37.56 ? 158  GLU B CD  1 
ATOM   828  N N   . GLY B 1 13 ? 38.251 0.330   1.931  1.00 29.04 ? 159  GLY B N   1 
ATOM   829  C CA  . GLY B 1 13 ? 39.695 0.408   1.734  1.00 31.76 ? 159  GLY B CA  1 
ATOM   830  C C   . GLY B 1 13 ? 40.400 1.280   2.755  1.00 33.43 ? 159  GLY B C   1 
ATOM   831  O O   . GLY B 1 13 ? 41.192 2.161   2.399  1.00 35.46 ? 159  GLY B O   1 
ATOM   832  N N   . ASN B 1 14 ? 40.085 1.047   4.026  1.00 35.08 ? 160  ASN B N   1 
ATOM   833  C CA  . ASN B 1 14 ? 40.682 1.781   5.157  1.00 36.40 ? 160  ASN B CA  1 
ATOM   834  C C   . ASN B 1 14 ? 40.509 3.318   5.175  1.00 32.99 ? 160  ASN B C   1 
ATOM   835  O O   . ASN B 1 14 ? 41.174 4.010   5.962  1.00 33.95 ? 160  ASN B O   1 
ATOM   836  C CB  . ASN B 1 14 ? 42.173 1.421   5.302  1.00 38.04 ? 160  ASN B CB  1 
ATOM   837  C CG  . ASN B 1 14 ? 42.669 1.545   6.745  1.00 34.21 ? 160  ASN B CG  1 
ATOM   838  O OD1 . ASN B 1 14 ? 42.058 1.001   7.672  1.00 36.71 ? 160  ASN B OD1 1 
ATOM   839  N ND2 . ASN B 1 14 ? 43.783 2.256   6.936  1.00 28.01 ? 160  ASN B ND2 1 
ATOM   840  N N   . THR B 1 15 ? 39.618 3.847   4.335  1.00 31.99 ? 161  THR B N   1 
ATOM   841  C CA  . THR B 1 15 ? 39.276 5.277   4.348  1.00 29.74 ? 161  THR B CA  1 
ATOM   842  C C   . THR B 1 15 ? 37.798 5.458   4.706  1.00 24.36 ? 161  THR B C   1 
ATOM   843  O O   . THR B 1 15 ? 36.959 4.611   4.385  1.00 24.87 ? 161  THR B O   1 
ATOM   844  C CB  A THR B 1 15 ? 39.553 5.957   2.992  0.50 32.34 ? 161  THR B CB  1 
ATOM   845  C CB  B THR B 1 15 ? 39.560 5.926   2.970  0.50 31.98 ? 161  THR B CB  1 
ATOM   846  O OG1 A THR B 1 15 ? 38.494 5.663   2.071  0.50 38.39 ? 161  THR B OG1 1 
ATOM   847  O OG1 B THR B 1 15 ? 39.654 7.345   3.109  0.50 27.12 ? 161  THR B OG1 1 
ATOM   848  C CG2 A THR B 1 15 ? 40.877 5.480   2.422  0.50 35.18 ? 161  THR B CG2 1 
ATOM   849  C CG2 B THR B 1 15 ? 38.465 5.595   1.963  0.50 35.82 ? 161  THR B CG2 1 
ATOM   850  N N   . PHE B 1 16 ? 37.478 6.570   5.356  1.00 19.83 ? 162  PHE B N   1 
ATOM   851  C CA  . PHE B 1 16 ? 36.109 6.902   5.703  1.00 19.66 ? 162  PHE B CA  1 
ATOM   852  C C   . PHE B 1 16 ? 35.471 7.869   4.684  1.00 19.07 ? 162  PHE B C   1 
ATOM   853  O O   . PHE B 1 16 ? 34.265 8.047   4.702  1.00 18.58 ? 162  PHE B O   1 
ATOM   854  C CB  . PHE B 1 16 ? 36.033 7.528   7.087  1.00 20.76 ? 162  PHE B CB  1 
ATOM   855  C CG  . PHE B 1 16 ? 36.238 6.571   8.239  1.00 28.34 ? 162  PHE B CG  1 
ATOM   856  C CD1 . PHE B 1 16 ? 35.252 5.659   8.588  1.00 29.54 ? 162  PHE B CD1 1 
ATOM   857  C CD2 . PHE B 1 16 ? 37.395 6.638   9.019  1.00 24.64 ? 162  PHE B CD2 1 
ATOM   858  C CE1 . PHE B 1 16 ? 35.429 4.797   9.666  1.00 34.60 ? 162  PHE B CE1 1 
ATOM   859  C CE2 . PHE B 1 16 ? 37.571 5.798   10.106 1.00 30.05 ? 162  PHE B CE2 1 
ATOM   860  C CZ  . PHE B 1 16 ? 36.586 4.875   10.433 1.00 29.52 ? 162  PHE B CZ  1 
ATOM   861  N N   . GLY B 1 17 ? 36.264 8.554   3.857  1.00 19.07 ? 163  GLY B N   1 
ATOM   862  C CA  . GLY B 1 17 ? 35.715 9.454   2.852  1.00 19.45 ? 163  GLY B CA  1 
ATOM   863  C C   . GLY B 1 17 ? 35.339 10.816  3.426  1.00 17.56 ? 163  GLY B C   1 
ATOM   864  O O   . GLY B 1 17 ? 34.299 11.382  3.090  1.00 19.89 ? 163  GLY B O   1 
ATOM   865  N N   . PHE B 1 18 ? 36.201 11.364  4.279  1.00 19.05 ? 164  PHE B N   1 
ATOM   866  C CA  . PHE B 1 18 ? 36.076 12.745  4.686  1.00 17.12 ? 164  PHE B CA  1 
ATOM   867  C C   . PHE B 1 18 ? 37.475 13.340  4.939  1.00 19.78 ? 164  PHE B C   1 
ATOM   868  O O   . PHE B 1 18 ? 38.475 12.605  4.994  1.00 17.94 ? 164  PHE B O   1 
ATOM   869  C CB  . PHE B 1 18 ? 35.107 12.946  5.871  1.00 18.48 ? 164  PHE B CB  1 
ATOM   870  C CG  . PHE B 1 18 ? 35.498 12.250  7.169  1.00 19.40 ? 164  PHE B CG  1 
ATOM   871  C CD1 . PHE B 1 18 ? 36.388 12.836  8.047  1.00 18.62 ? 164  PHE B CD1 1 
ATOM   872  C CD2 . PHE B 1 18 ? 34.904 11.071  7.541  1.00 20.42 ? 164  PHE B CD2 1 
ATOM   873  C CE1 . PHE B 1 18 ? 36.700 12.234  9.264  1.00 22.58 ? 164  PHE B CE1 1 
ATOM   874  C CE2 . PHE B 1 18 ? 35.237 10.443  8.738  1.00 19.87 ? 164  PHE B CE2 1 
ATOM   875  C CZ  . PHE B 1 18 ? 36.135 11.029  9.600  1.00 18.35 ? 164  PHE B CZ  1 
ATOM   876  N N   . VAL B 1 19 ? 37.529 14.669  5.003  1.00 19.02 ? 165  VAL B N   1 
ATOM   877  C CA  . VAL B 1 19 ? 38.774 15.402  5.198  1.00 18.94 ? 165  VAL B CA  1 
ATOM   878  C C   . VAL B 1 19 ? 38.713 16.037  6.565  1.00 19.77 ? 165  VAL B C   1 
ATOM   879  O O   . VAL B 1 19 ? 37.668 16.512  6.966  1.00 17.75 ? 165  VAL B O   1 
ATOM   880  C CB  . VAL B 1 19 ? 38.963 16.516  4.137  1.00 19.32 ? 165  VAL B CB  1 
ATOM   881  C CG1 . VAL B 1 19 ? 40.251 17.275  4.395  1.00 22.23 ? 165  VAL B CG1 1 
ATOM   882  C CG2 . VAL B 1 19 ? 38.944 15.920  2.724  1.00 17.20 ? 165  VAL B CG2 1 
ATOM   883  N N   . ILE B 1 20 ? 39.837 16.014  7.276  1.00 17.45 ? 166  ILE B N   1 
ATOM   884  C CA  . ILE B 1 20 ? 39.959 16.706  8.580  1.00 18.07 ? 166  ILE B CA  1 
ATOM   885  C C   . ILE B 1 20 ? 41.036 17.777  8.547  1.00 20.49 ? 166  ILE B C   1 
ATOM   886  O O   . ILE B 1 20 ? 42.077 17.625  7.885  1.00 17.98 ? 166  ILE B O   1 
ATOM   887  C CB  . ILE B 1 20 ? 40.280 15.755  9.744  1.00 18.24 ? 166  ILE B CB  1 
ATOM   888  C CG1 . ILE B 1 20 ? 41.506 14.875  9.508  1.00 20.43 ? 166  ILE B CG1 1 
ATOM   889  C CG2 . ILE B 1 20 ? 39.031 14.882  10.122 1.00 18.22 ? 166  ILE B CG2 1 
ATOM   890  C CD1 . ILE B 1 20 ? 42.125 14.356  10.765 1.00 19.73 ? 166  ILE B CD1 1 
ATOM   891  N N   . ARG B 1 21 ? 40.770 18.859  9.280  1.00 16.92 ? 167  ARG B N   1 
ATOM   892  C CA  . ARG B 1 21 ? 41.832 19.774  9.708  1.00 16.75 ? 167  ARG B CA  1 
ATOM   893  C C   . ARG B 1 21 ? 41.937 19.761  11.225 1.00 18.43 ? 167  ARG B C   1 
ATOM   894  O O   . ARG B 1 21 ? 41.024 19.325  11.929 1.00 17.94 ? 167  ARG B O   1 
ATOM   895  C CB  . ARG B 1 21 ? 41.589 21.185  9.165  1.00 15.39 ? 167  ARG B CB  1 
ATOM   896  C CG  . ARG B 1 21 ? 40.332 21.845  9.738  1.00 19.54 ? 167  ARG B CG  1 
ATOM   897  C CD  . ARG B 1 21 ? 40.155 23.250  9.162  1.00 21.48 ? 167  ARG B CD  1 
ATOM   898  N NE  . ARG B 1 21 ? 38.920 23.910  9.592  1.00 26.36 ? 167  ARG B NE  1 
ATOM   899  C CZ  . ARG B 1 21 ? 38.724 24.390  10.813 1.00 26.65 ? 167  ARG B CZ  1 
ATOM   900  N NH1 . ARG B 1 21 ? 39.673 24.313  11.715 1.00 33.15 ? 167  ARG B NH1 1 
ATOM   901  N NH2 . ARG B 1 21 ? 37.584 24.978  11.142 1.00 23.56 ? 167  ARG B NH2 1 
ATOM   902  N N   . GLY B 1 22 ? 43.070 20.239  11.727 1.00 15.39 ? 168  GLY B N   1 
ATOM   903  C CA  . GLY B 1 22 ? 43.174 20.535  13.136 1.00 17.07 ? 168  GLY B CA  1 
ATOM   904  C C   . GLY B 1 22 ? 44.112 19.636  13.858 1.00 21.87 ? 168  GLY B C   1 
ATOM   905  O O   . GLY B 1 22 ? 44.679 18.727  13.268 1.00 19.34 ? 168  GLY B O   1 
ATOM   906  N N   . GLY B 1 23 ? 44.231 19.899  15.153 1.00 18.04 ? 169  GLY B N   1 
ATOM   907  C CA  . GLY B 1 23 ? 45.082 19.118  16.023 1.00 17.82 ? 169  GLY B CA  1 
ATOM   908  C C   . GLY B 1 23 ? 45.873 19.919  17.032 1.00 20.61 ? 169  GLY B C   1 
ATOM   909  O O   . GLY B 1 23 ? 45.930 21.148  16.990 1.00 18.24 ? 169  GLY B O   1 
ATOM   910  N N   . ALA B 1 24 ? 46.491 19.205  17.959 1.00 18.18 ? 170  ALA B N   1 
ATOM   911  C CA  . ALA B 1 24 ? 47.251 19.823  19.035 1.00 21.60 ? 170  ALA B CA  1 
ATOM   912  C C   . ALA B 1 24 ? 48.568 20.363  18.534 1.00 21.26 ? 170  ALA B C   1 
ATOM   913  O O   . ALA B 1 24 ? 49.132 19.864  17.561 1.00 21.54 ? 170  ALA B O   1 
ATOM   914  C CB  . ALA B 1 24 ? 47.484 18.827  20.179 1.00 24.01 ? 170  ALA B CB  1 
ATOM   915  N N   . HIS B 1 25 ? 49.044 21.406  19.202 1.00 22.38 ? 171  HIS B N   1 
ATOM   916  C CA  . HIS B 1 25 ? 50.321 22.008  18.882 1.00 29.59 ? 171  HIS B CA  1 
ATOM   917  C C   . HIS B 1 25 ? 51.234 21.952  20.103 1.00 31.32 ? 171  HIS B C   1 
ATOM   918  O O   . HIS B 1 25 ? 50.763 21.759  21.228 1.00 28.84 ? 171  HIS B O   1 
ATOM   919  C CB  . HIS B 1 25 ? 50.094 23.445  18.405 1.00 32.37 ? 171  HIS B CB  1 
ATOM   920  C CG  . HIS B 1 25 ? 51.343 24.126  17.957 1.00 46.16 ? 171  HIS B CG  1 
ATOM   921  N ND1 . HIS B 1 25 ? 52.173 23.592  16.995 1.00 60.24 ? 171  HIS B ND1 1 
ATOM   922  C CD2 . HIS B 1 25 ? 51.920 25.283  18.357 1.00 62.32 ? 171  HIS B CD2 1 
ATOM   923  C CE1 . HIS B 1 25 ? 53.205 24.398  16.816 1.00 64.02 ? 171  HIS B CE1 1 
ATOM   924  N NE2 . HIS B 1 25 ? 53.075 25.430  17.631 1.00 53.29 ? 171  HIS B NE2 1 
ATOM   925  N N   . ASP B 1 26 ? 52.539 22.090  19.864 1.00 37.02 ? 172  ASP B N   1 
ATOM   926  C CA  . ASP B 1 26 ? 53.523 22.165  20.940 1.00 41.86 ? 172  ASP B CA  1 
ATOM   927  C C   . ASP B 1 26 ? 53.057 23.187  21.982 1.00 40.30 ? 172  ASP B C   1 
ATOM   928  O O   . ASP B 1 26 ? 52.987 22.873  23.174 1.00 40.38 ? 172  ASP B O   1 
ATOM   929  C CB  . ASP B 1 26 ? 54.907 22.510  20.379 1.00 42.89 ? 172  ASP B CB  1 
ATOM   930  N N   . ASP B 1 27 ? 52.697 24.384  21.509 1.00 41.30 ? 173  ASP B N   1 
ATOM   931  C CA  . ASP B 1 27 ? 52.015 25.401  22.325 1.00 42.74 ? 173  ASP B CA  1 
ATOM   932  C C   . ASP B 1 27 ? 50.525 25.069  22.489 1.00 43.11 ? 173  ASP B C   1 
ATOM   933  O O   . ASP B 1 27 ? 49.722 25.339  21.593 1.00 42.86 ? 173  ASP B O   1 
ATOM   934  C CB  . ASP B 1 27 ? 52.168 26.787  21.681 1.00 45.17 ? 173  ASP B CB  1 
ATOM   935  C CG  . ASP B 1 27 ? 51.703 27.926  22.590 1.00 52.37 ? 173  ASP B CG  1 
ATOM   936  O OD1 . ASP B 1 27 ? 51.298 27.664  23.746 1.00 43.98 ? 173  ASP B OD1 1 
ATOM   937  O OD2 . ASP B 1 27 ? 51.742 29.094  22.133 1.00 53.32 ? 173  ASP B OD2 1 
ATOM   938  N N   . ARG B 1 28 ? 50.173 24.502  23.644 1.00 40.24 ? 174  ARG B N   1 
ATOM   939  C CA  . ARG B 1 28 ? 48.819 24.003  23.926 1.00 42.75 ? 174  ARG B CA  1 
ATOM   940  C C   . ARG B 1 28 ? 47.685 25.013  23.682 1.00 41.66 ? 174  ARG B C   1 
ATOM   941  O O   . ARG B 1 28 ? 46.578 24.626  23.282 1.00 31.93 ? 174  ARG B O   1 
ATOM   942  C CB  . ARG B 1 28 ? 48.750 23.489  25.368 1.00 46.16 ? 174  ARG B CB  1 
ATOM   943  C CG  . ARG B 1 28 ? 47.430 22.828  25.740 1.00 50.86 ? 174  ARG B CG  1 
ATOM   944  C CD  . ARG B 1 28 ? 47.566 22.065  27.044 1.00 62.68 ? 174  ARG B CD  1 
ATOM   945  N NE  . ARG B 1 28 ? 46.275 21.823  27.685 1.00 64.73 ? 174  ARG B NE  1 
ATOM   946  C CZ  . ARG B 1 28 ? 46.124 21.269  28.887 1.00 71.54 ? 174  ARG B CZ  1 
ATOM   947  N NH1 . ARG B 1 28 ? 47.186 20.885  29.599 1.00 72.19 ? 174  ARG B NH1 1 
ATOM   948  N NH2 . ARG B 1 28 ? 44.904 21.097  29.382 1.00 73.83 ? 174  ARG B NH2 1 
ATOM   949  N N   . ASN B 1 29 ? 47.953 26.299  23.918 1.00 42.07 ? 175  ASN B N   1 
ATOM   950  C CA  . ASN B 1 29 ? 46.957 27.347  23.651 1.00 41.96 ? 175  ASN B CA  1 
ATOM   951  C C   . ASN B 1 29 ? 46.665 27.488  22.145 1.00 36.59 ? 175  ASN B C   1 
ATOM   952  O O   . ASN B 1 29 ? 45.582 27.934  21.753 1.00 42.06 ? 175  ASN B O   1 
ATOM   953  C CB  . ASN B 1 29 ? 47.404 28.688  24.251 1.00 40.74 ? 175  ASN B CB  1 
ATOM   954  C CG  . ASN B 1 29 ? 47.410 28.678  25.772 1.00 42.79 ? 175  ASN B CG  1 
ATOM   955  N N   . LYS B 1 30 ? 47.626 27.070  21.319 1.00 27.45 ? 176  LYS B N   1 
ATOM   956  C CA  . LYS B 1 30 ? 47.529 27.173  19.854 1.00 33.63 ? 176  LYS B CA  1 
ATOM   957  C C   . LYS B 1 30 ? 47.014 25.887  19.167 1.00 28.79 ? 176  LYS B C   1 
ATOM   958  O O   . LYS B 1 30 ? 46.949 25.794  17.944 1.00 23.63 ? 176  LYS B O   1 
ATOM   959  C CB  . LYS B 1 30 ? 48.881 27.545  19.274 1.00 33.60 ? 176  LYS B CB  1 
ATOM   960  C CG  . LYS B 1 30 ? 49.524 28.737  19.955 1.00 40.15 ? 176  LYS B CG  1 
ATOM   961  N N   . SER B 1 31 ? 46.658 24.902  19.972 1.00 28.47 ? 177  SER B N   1 
ATOM   962  C CA  . SER B 1 31 ? 45.984 23.727  19.472 1.00 19.93 ? 177  SER B CA  1 
ATOM   963  C C   . SER B 1 31 ? 44.652 24.131  18.858 1.00 20.58 ? 177  SER B C   1 
ATOM   964  O O   . SER B 1 31 ? 44.021 25.042  19.376 1.00 20.88 ? 177  SER B O   1 
ATOM   965  C CB  . SER B 1 31 ? 45.791 22.783  20.642 1.00 21.79 ? 177  SER B CB  1 
ATOM   966  O OG  . SER B 1 31 ? 47.084 22.449  21.128 1.00 25.01 ? 177  SER B OG  1 
ATOM   967  N N   . ARG B 1 32 ? 44.218 23.458  17.784 1.00 15.62 ? 178  ARG B N   1 
ATOM   968  C CA  . ARG B 1 32 ? 42.889 23.697  17.235 1.00 15.70 ? 178  ARG B CA  1 
ATOM   969  C C   . ARG B 1 32 ? 42.103 22.423  17.153 1.00 18.96 ? 178  ARG B C   1 
ATOM   970  O O   . ARG B 1 32 ? 42.687 21.337  17.004 1.00 15.96 ? 178  ARG B O   1 
ATOM   971  C CB  . ARG B 1 32 ? 42.976 24.299  15.842 1.00 16.54 ? 178  ARG B CB  1 
ATOM   972  C CG  . ARG B 1 32 ? 43.748 25.625  15.796 1.00 18.50 ? 178  ARG B CG  1 
ATOM   973  C CD  . ARG B 1 32 ? 43.965 26.122  14.388 1.00 18.38 ? 178  ARG B CD  1 
ATOM   974  N NE  . ARG B 1 32 ? 45.081 27.048  14.195 1.00 15.43 ? 178  ARG B NE  1 
ATOM   975  C CZ  . ARG B 1 32 ? 44.972 28.361  13.917 1.00 14.22 ? 178  ARG B CZ  1 
ATOM   976  N NH1 . ARG B 1 32 ? 43.768 28.948  13.803 1.00 15.46 ? 178  ARG B NH1 1 
ATOM   977  N NH2 . ARG B 1 32 ? 46.040 29.049  13.733 1.00 16.58 ? 178  ARG B NH2 1 
ATOM   978  N N   . PRO B 1 33 ? 40.775 22.525  17.253 1.00 18.35 ? 179  PRO B N   1 
ATOM   979  C CA  . PRO B 1 33 ? 39.923 21.370  17.223 1.00 19.32 ? 179  PRO B CA  1 
ATOM   980  C C   . PRO B 1 33 ? 40.057 20.629  15.914 1.00 16.92 ? 179  PRO B C   1 
ATOM   981  O O   . PRO B 1 33 ? 40.312 21.232  14.847 1.00 16.00 ? 179  PRO B O   1 
ATOM   982  C CB  . PRO B 1 33 ? 38.504 21.963  17.329 1.00 23.64 ? 179  PRO B CB  1 
ATOM   983  C CG  . PRO B 1 33 ? 38.686 23.200  18.037 1.00 29.84 ? 179  PRO B CG  1 
ATOM   984  C CD  . PRO B 1 33 ? 39.973 23.746  17.495 1.00 22.85 ? 179  PRO B CD  1 
ATOM   985  N N   . VAL B 1 34 ? 39.841 19.318  15.988 1.00 17.70 ? 180  VAL B N   1 
ATOM   986  C CA  . VAL B 1 34 ? 39.744 18.510  14.763 1.00 17.48 ? 180  VAL B CA  1 
ATOM   987  C C   . VAL B 1 34 ? 38.353 18.690  14.152 1.00 18.52 ? 180  VAL B C   1 
ATOM   988  O O   . VAL B 1 34 ? 37.339 18.414  14.798 1.00 17.33 ? 180  VAL B O   1 
ATOM   989  C CB  . VAL B 1 34 ? 40.042 17.039  15.051 1.00 18.28 ? 180  VAL B CB  1 
ATOM   990  C CG1 . VAL B 1 34 ? 39.948 16.234  13.758 1.00 21.22 ? 180  VAL B CG1 1 
ATOM   991  C CG2 . VAL B 1 34 ? 41.411 16.865  15.725 1.00 18.75 ? 180  VAL B CG2 1 
ATOM   992  N N   . VAL B 1 35 ? 38.315 19.223  12.937 1.00 17.84 ? 181  VAL B N   1 
ATOM   993  C CA  . VAL B 1 35 ? 37.070 19.598  12.255 1.00 17.28 ? 181  VAL B CA  1 
ATOM   994  C C   . VAL B 1 35 ? 37.032 18.912  10.871 1.00 18.99 ? 181  VAL B C   1 
ATOM   995  O O   . VAL B 1 35 ? 38.049 18.883  10.141 1.00 19.33 ? 181  VAL B O   1 
ATOM   996  C CB  . VAL B 1 35 ? 37.013 21.115  12.077 1.00 18.67 ? 181  VAL B CB  1 
ATOM   997  C CG1 . VAL B 1 35 ? 35.836 21.557  11.254 1.00 20.54 ? 181  VAL B CG1 1 
ATOM   998  C CG2 . VAL B 1 35 ? 36.925 21.745  13.466 1.00 19.59 ? 181  VAL B CG2 1 
ATOM   999  N N   . ILE B 1 36 ? 35.850 18.393  10.522 1.00 19.62 ? 182  ILE B N   1 
ATOM   1000 C CA  . ILE B 1 36 ? 35.630 17.782  9.216  1.00 17.99 ? 182  ILE B CA  1 
ATOM   1001 C C   . ILE B 1 36 ? 35.332 18.891  8.204  1.00 20.01 ? 182  ILE B C   1 
ATOM   1002 O O   . ILE B 1 36 ? 34.470 19.735  8.448  1.00 23.89 ? 182  ILE B O   1 
ATOM   1003 C CB  . ILE B 1 36 ? 34.447 16.767  9.302  1.00 21.54 ? 182  ILE B CB  1 
ATOM   1004 C CG1 . ILE B 1 36 ? 34.860 15.614  10.245 1.00 21.14 ? 182  ILE B CG1 1 
ATOM   1005 C CG2 . ILE B 1 36 ? 34.113 16.285  7.912  1.00 20.58 ? 182  ILE B CG2 1 
ATOM   1006 C CD1 . ILE B 1 36 ? 33.805 14.535  10.633 1.00 25.28 ? 182  ILE B CD1 1 
ATOM   1007 N N   . THR B 1 37 ? 36.073 18.928  7.079  1.00 17.70 ? 183  THR B N   1 
ATOM   1008 C CA  . THR B 1 37 ? 36.041 20.051  6.157  1.00 20.55 ? 183  THR B CA  1 
ATOM   1009 C C   . THR B 1 37 ? 35.364 19.708  4.832  1.00 23.72 ? 183  THR B C   1 
ATOM   1010 O O   . THR B 1 37 ? 34.997 20.601  4.079  1.00 22.16 ? 183  THR B O   1 
ATOM   1011 C CB  . THR B 1 37 ? 37.452 20.572  5.859  1.00 22.24 ? 183  THR B CB  1 
ATOM   1012 O OG1 . THR B 1 37 ? 38.180 19.580  5.138  1.00 23.23 ? 183  THR B OG1 1 
ATOM   1013 C CG2 . THR B 1 37 ? 38.210 20.938  7.143  1.00 23.89 ? 183  THR B CG2 1 
ATOM   1014 N N   . SER B 1 38 ? 35.153 18.413  4.583  1.00 20.06 ? 184  SER B N   1 
ATOM   1015 C CA  . SER B 1 38 ? 34.592 17.949  3.327  1.00 18.32 ? 184  SER B CA  1 
ATOM   1016 C C   . SER B 1 38 ? 34.232 16.466  3.418  1.00 15.17 ? 184  SER B C   1 
ATOM   1017 O O   . SER B 1 38 ? 34.824 15.704  4.201  1.00 15.55 ? 184  SER B O   1 
ATOM   1018 C CB  . SER B 1 38 ? 35.537 18.218  2.157  1.00 18.99 ? 184  SER B CB  1 
ATOM   1019 O OG  . SER B 1 38 ? 34.982 17.817  0.916  1.00 18.16 ? 184  SER B OG  1 
ATOM   1020 N N   . VAL B 1 39 ? 33.222 16.081  2.635  1.00 16.61 ? 185  VAL B N   1 
ATOM   1021 C CA  . VAL B 1 39 ? 32.753 14.693  2.627  1.00 17.50 ? 185  VAL B CA  1 
ATOM   1022 C C   . VAL B 1 39 ? 32.752 14.250  1.194  1.00 18.82 ? 185  VAL B C   1 
ATOM   1023 O O   . VAL B 1 39 ? 32.144 14.892  0.398  1.00 19.86 ? 185  VAL B O   1 
ATOM   1024 C CB  . VAL B 1 39 ? 31.385 14.612  3.246  1.00 17.65 ? 185  VAL B CB  1 
ATOM   1025 C CG1 . VAL B 1 39 ? 30.780 13.204  3.077  1.00 19.73 ? 185  VAL B CG1 1 
ATOM   1026 C CG2 . VAL B 1 39 ? 31.503 15.015  4.717  1.00 19.51 ? 185  VAL B CG2 1 
ATOM   1027 N N   . ARG B 1 40 ? 33.436 13.153  0.900  1.00 17.15 ? 186  ARG B N   1 
ATOM   1028 C CA  . ARG B 1 40 ? 33.585 12.647  -0.467 1.00 20.73 ? 186  ARG B CA  1 
ATOM   1029 C C   . ARG B 1 40 ? 32.286 11.990  -0.938 1.00 20.22 ? 186  ARG B C   1 
ATOM   1030 O O   . ARG B 1 40 ? 31.823 11.045  -0.293 1.00 17.24 ? 186  ARG B O   1 
ATOM   1031 C CB  . ARG B 1 40 ? 34.709 11.595  -0.500 1.00 20.81 ? 186  ARG B CB  1 
ATOM   1032 C CG  . ARG B 1 40 ? 35.094 11.070  -1.876 1.00 29.81 ? 186  ARG B CG  1 
ATOM   1033 C CD  A ARG B 1 40 ? 36.304 10.112  -1.727 0.50 30.77 ? 186  ARG B CD  1 
ATOM   1034 C CD  B ARG B 1 40 ? 36.310 10.158  -1.876 0.50 29.98 ? 186  ARG B CD  1 
ATOM   1035 N NE  A ARG B 1 40 ? 35.938 8.806   -1.152 0.50 28.44 ? 186  ARG B NE  1 
ATOM   1036 N NE  B ARG B 1 40 ? 36.142 8.896   -1.157 0.50 23.49 ? 186  ARG B NE  1 
ATOM   1037 C CZ  A ARG B 1 40 ? 36.715 8.038   -0.374 0.50 16.93 ? 186  ARG B CZ  1 
ATOM   1038 C CZ  B ARG B 1 40 ? 35.318 7.905   -1.499 0.50 12.74 ? 186  ARG B CZ  1 
ATOM   1039 N NH1 A ARG B 1 40 ? 37.941 8.405   -0.017 0.50 20.31 ? 186  ARG B NH1 1 
ATOM   1040 N NH1 B ARG B 1 40 ? 34.499 7.991   -2.548 0.50 17.53 ? 186  ARG B NH1 1 
ATOM   1041 N NH2 A ARG B 1 40 ? 36.250 6.876   0.068  0.50 25.33 ? 186  ARG B NH2 1 
ATOM   1042 N NH2 B ARG B 1 40 ? 35.294 6.804   -0.755 0.50 32.63 ? 186  ARG B NH2 1 
ATOM   1043 N N   . PRO B 1 41 ? 31.693 12.466  -2.061 1.00 19.35 ? 187  PRO B N   1 
ATOM   1044 C CA  . PRO B 1 41 ? 30.482 11.833  -2.524 1.00 18.37 ? 187  PRO B CA  1 
ATOM   1045 C C   . PRO B 1 41 ? 30.656 10.331  -2.753 1.00 16.29 ? 187  PRO B C   1 
ATOM   1046 O O   . PRO B 1 41 ? 31.664 9.877   -3.316 1.00 19.06 ? 187  PRO B O   1 
ATOM   1047 C CB  . PRO B 1 41 ? 30.166 12.572  -3.857 1.00 17.66 ? 187  PRO B CB  1 
ATOM   1048 C CG  . PRO B 1 41 ? 30.852 13.886  -3.707 1.00 26.45 ? 187  PRO B CG  1 
ATOM   1049 C CD  . PRO B 1 41 ? 32.074 13.610  -2.908 1.00 19.67 ? 187  PRO B CD  1 
ATOM   1050 N N   . GLY B 1 42 ? 29.655 9.575   -2.303 1.00 19.87 ? 188  GLY B N   1 
ATOM   1051 C CA  . GLY B 1 42 ? 29.638 8.124   -2.454 1.00 20.04 ? 188  GLY B CA  1 
ATOM   1052 C C   . GLY B 1 42 ? 30.506 7.346   -1.475 1.00 21.40 ? 188  GLY B C   1 
ATOM   1053 O O   . GLY B 1 42 ? 30.514 6.118   -1.504 1.00 22.25 ? 188  GLY B O   1 
ATOM   1054 N N   . GLY B 1 43 ? 31.256 8.052   -0.632 1.00 16.36 ? 189  GLY B N   1 
ATOM   1055 C CA  . GLY B 1 43 ? 32.101 7.414   0.368  1.00 18.29 ? 189  GLY B CA  1 
ATOM   1056 C C   . GLY B 1 43 ? 31.294 6.984   1.589  1.00 19.06 ? 189  GLY B C   1 
ATOM   1057 O O   . GLY B 1 43 ? 30.088 7.302   1.693  1.00 17.51 ? 189  GLY B O   1 
ATOM   1058 N N   . PRO B 1 44 ? 31.950 6.265   2.526  1.00 15.22 ? 190  PRO B N   1 
ATOM   1059 C CA  . PRO B 1 44 ? 31.286 5.811   3.743  1.00 15.58 ? 190  PRO B CA  1 
ATOM   1060 C C   . PRO B 1 44 ? 30.553 6.904   4.507  1.00 17.32 ? 190  PRO B C   1 
ATOM   1061 O O   . PRO B 1 44 ? 29.396 6.716   4.914  1.00 17.07 ? 190  PRO B O   1 
ATOM   1062 C CB  . PRO B 1 44 ? 32.456 5.275   4.589  1.00 19.65 ? 190  PRO B CB  1 
ATOM   1063 C CG  . PRO B 1 44 ? 33.395 4.747   3.591  1.00 14.68 ? 190  PRO B CG  1 
ATOM   1064 C CD  . PRO B 1 44 ? 33.325 5.732   2.440  1.00 15.46 ? 190  PRO B CD  1 
ATOM   1065 N N   . ALA B 1 45 ? 31.213 8.040   4.681  1.00 16.42 ? 191  ALA B N   1 
ATOM   1066 C CA  . ALA B 1 45 ? 30.615 9.125   5.412  1.00 14.27 ? 191  ALA B CA  1 
ATOM   1067 C C   . ALA B 1 45 ? 29.405 9.705   4.665  1.00 16.51 ? 191  ALA B C   1 
ATOM   1068 O O   . ALA B 1 45 ? 28.388 10.008  5.281  1.00 17.04 ? 191  ALA B O   1 
ATOM   1069 C CB  . ALA B 1 45 ? 31.660 10.247  5.758  1.00 16.48 ? 191  ALA B CB  1 
ATOM   1070 N N   . ASP B 1 46 ? 29.547 9.891   3.352  1.00 15.92 ? 192  ASP B N   1 
ATOM   1071 C CA  . ASP B 1 46 ? 28.427 10.356  2.535  1.00 18.07 ? 192  ASP B CA  1 
ATOM   1072 C C   . ASP B 1 46 ? 27.270 9.377   2.629  1.00 15.08 ? 192  ASP B C   1 
ATOM   1073 O O   . ASP B 1 46 ? 26.109 9.782   2.767  1.00 19.20 ? 192  ASP B O   1 
ATOM   1074 C CB  . ASP B 1 46 ? 28.848 10.604  1.089  1.00 18.39 ? 192  ASP B CB  1 
ATOM   1075 C CG  . ASP B 1 46 ? 27.762 11.288  0.253  1.00 18.35 ? 192  ASP B CG  1 
ATOM   1076 O OD1 . ASP B 1 46 ? 27.142 12.243  0.766  1.00 24.41 ? 192  ASP B OD1 1 
ATOM   1077 O OD2 . ASP B 1 46 ? 27.535 10.862  -0.901 1.00 24.14 ? 192  ASP B OD2 1 
ATOM   1078 N N   . ARG B 1 47 ? 27.570 8.098   2.509  1.00 17.81 ? 193  ARG B N   1 
ATOM   1079 C CA  . ARG B 1 47 ? 26.492 7.071   2.538  1.00 15.70 ? 193  ARG B CA  1 
ATOM   1080 C C   . ARG B 1 47 ? 25.703 7.039   3.850  1.00 16.87 ? 193  ARG B C   1 
ATOM   1081 O O   . ARG B 1 47 ? 24.480 6.824   3.831  1.00 20.43 ? 193  ARG B O   1 
ATOM   1082 C CB  . ARG B 1 47 ? 27.065 5.684   2.197  1.00 18.25 ? 193  ARG B CB  1 
ATOM   1083 C CG  . ARG B 1 47 ? 27.295 5.526   0.684  1.00 22.45 ? 193  ARG B CG  1 
ATOM   1084 C CD  . ARG B 1 47 ? 27.771 4.139   0.236  1.00 29.79 ? 193  ARG B CD  1 
ATOM   1085 N NE  . ARG B 1 47 ? 29.182 3.905   0.571  1.00 32.62 ? 193  ARG B NE  1 
ATOM   1086 C CZ  . ARG B 1 47 ? 29.621 3.099   1.539  1.00 34.80 ? 193  ARG B CZ  1 
ATOM   1087 N NH1 . ARG B 1 47 ? 28.782 2.405   2.301  1.00 54.27 ? 193  ARG B NH1 1 
ATOM   1088 N NH2 . ARG B 1 47 ? 30.921 2.982   1.749  1.00 38.20 ? 193  ARG B NH2 1 
ATOM   1089 N N   . GLU B 1 48 ? 26.377 7.206   4.970  1.00 16.67 ? 194  GLU B N   1 
ATOM   1090 C CA  . GLU B 1 48 ? 25.686 7.235   6.249  1.00 18.67 ? 194  GLU B CA  1 
ATOM   1091 C C   . GLU B 1 48 ? 24.892 8.540   6.427  1.00 17.66 ? 194  GLU B C   1 
ATOM   1092 O O   . GLU B 1 48 ? 23.796 8.544   6.990  1.00 24.27 ? 194  GLU B O   1 
ATOM   1093 C CB  . GLU B 1 48 ? 26.661 6.939   7.380  1.00 19.56 ? 194  GLU B CB  1 
ATOM   1094 C CG  . GLU B 1 48 ? 26.009 6.752   8.744  1.00 21.76 ? 194  GLU B CG  1 
ATOM   1095 C CD  . GLU B 1 48 ? 25.619 8.062   9.397  1.00 29.73 ? 194  GLU B CD  1 
ATOM   1096 O OE1 . GLU B 1 48 ? 26.197 9.092   9.053  1.00 20.16 ? 194  GLU B OE1 1 
ATOM   1097 O OE2 . GLU B 1 48 ? 24.737 8.080   10.271 1.00 27.68 ? 194  GLU B OE2 1 
ATOM   1098 N N   . GLY B 1 49 ? 25.435 9.640   5.898  1.00 20.00 ? 195  GLY B N   1 
ATOM   1099 C CA  . GLY B 1 49 ? 24.700 10.873  5.646  1.00 18.86 ? 195  GLY B CA  1 
ATOM   1100 C C   . GLY B 1 49 ? 24.698 11.931  6.741  1.00 19.53 ? 195  GLY B C   1 
ATOM   1101 O O   . GLY B 1 49 ? 24.267 13.048  6.492  1.00 22.73 ? 195  GLY B O   1 
ATOM   1102 N N   . THR B 1 50 ? 25.199 11.603  7.943  1.00 18.95 ? 196  THR B N   1 
ATOM   1103 C CA  . THR B 1 50 ? 25.109 12.545  9.074  1.00 19.57 ? 196  THR B CA  1 
ATOM   1104 C C   . THR B 1 50 ? 26.156 13.618  9.013  1.00 20.74 ? 196  THR B C   1 
ATOM   1105 O O   . THR B 1 50 ? 25.849 14.780  9.232  1.00 22.58 ? 196  THR B O   1 
ATOM   1106 C CB  . THR B 1 50 ? 25.250 11.843  10.428 1.00 18.50 ? 196  THR B CB  1 
ATOM   1107 O OG1 . THR B 1 50 ? 24.252 10.800  10.501 1.00 21.54 ? 196  THR B OG1 1 
ATOM   1108 C CG2 . THR B 1 50 ? 25.100 12.824  11.611 1.00 20.94 ? 196  THR B CG2 1 
ATOM   1109 N N   . ILE B 1 51 ? 27.404 13.184  8.805  1.00 19.62 ? 197  ILE B N   1 
ATOM   1110 C CA  . ILE B 1 51 ? 28.587 14.058  8.906  1.00 19.72 ? 197  ILE B CA  1 
ATOM   1111 C C   . ILE B 1 51 ? 28.531 15.125  7.813  1.00 19.95 ? 197  ILE B C   1 
ATOM   1112 O O   . ILE B 1 51 ? 28.249 14.829  6.651  1.00 19.34 ? 197  ILE B O   1 
ATOM   1113 C CB  . ILE B 1 51 ? 29.914 13.235  8.756  1.00 20.62 ? 197  ILE B CB  1 
ATOM   1114 C CG1 . ILE B 1 51 ? 30.125 12.376  9.998  1.00 21.33 ? 197  ILE B CG1 1 
ATOM   1115 C CG2 . ILE B 1 51 ? 31.133 14.185  8.483  1.00 19.83 ? 197  ILE B CG2 1 
ATOM   1116 C CD1 . ILE B 1 51 ? 31.191 11.316  9.911  1.00 21.69 ? 197  ILE B CD1 1 
ATOM   1117 N N   . LYS B 1 52 ? 28.836 16.361  8.196  1.00 18.95 ? 198  LYS B N   1 
ATOM   1118 C CA  . LYS B 1 52 ? 28.838 17.513  7.301  1.00 17.59 ? 198  LYS B CA  1 
ATOM   1119 C C   . LYS B 1 52 ? 30.055 18.369  7.599  1.00 19.19 ? 198  LYS B C   1 
ATOM   1120 O O   . LYS B 1 52 ? 30.543 18.378  8.718  1.00 18.54 ? 198  LYS B O   1 
ATOM   1121 C CB  . LYS B 1 52 ? 27.569 18.350  7.499  1.00 18.90 ? 198  LYS B CB  1 
ATOM   1122 C CG  . LYS B 1 52 ? 26.255 17.656  7.151  1.00 19.37 ? 198  LYS B CG  1 
ATOM   1123 C CD  . LYS B 1 52 ? 26.035 17.377  5.671  1.00 20.99 ? 198  LYS B CD  1 
ATOM   1124 C CE  . LYS B 1 52 ? 25.109 16.198  5.451  1.00 29.24 ? 198  LYS B CE  1 
ATOM   1125 N NZ  . LYS B 1 52 ? 24.775 15.999  3.977  1.00 24.57 ? 198  LYS B NZ  1 
ATOM   1126 N N   . PRO B 1 53 ? 30.534 19.104  6.583  1.00 18.12 ? 199  PRO B N   1 
ATOM   1127 C CA  . PRO B 1 53 ? 31.595 20.055  6.823  1.00 18.76 ? 199  PRO B CA  1 
ATOM   1128 C C   . PRO B 1 53 ? 31.259 20.986  7.972  1.00 20.58 ? 199  PRO B C   1 
ATOM   1129 O O   . PRO B 1 53 ? 30.124 21.482  8.079  1.00 20.80 ? 199  PRO B O   1 
ATOM   1130 C CB  . PRO B 1 53 ? 31.660 20.822  5.512  1.00 20.85 ? 199  PRO B CB  1 
ATOM   1131 C CG  . PRO B 1 53 ? 31.147 19.881  4.491  1.00 23.38 ? 199  PRO B CG  1 
ATOM   1132 C CD  . PRO B 1 53 ? 30.113 19.067  5.173  1.00 19.42 ? 199  PRO B CD  1 
ATOM   1133 N N   . GLY B 1 54 ? 32.233 21.138  8.856  1.00 19.20 ? 200  GLY B N   1 
ATOM   1134 C CA  . GLY B 1 54 ? 32.113 21.970  10.027 1.00 18.35 ? 200  GLY B CA  1 
ATOM   1135 C C   . GLY B 1 54 ? 31.926 21.208  11.313 1.00 21.56 ? 200  GLY B C   1 
ATOM   1136 O O   . GLY B 1 54 ? 32.054 21.777  12.414 1.00 22.31 ? 200  GLY B O   1 
ATOM   1137 N N   . ASP B 1 55 ? 31.561 19.933  11.217 1.00 17.06 ? 201  ASP B N   1 
ATOM   1138 C CA  . ASP B 1 55 ? 31.316 19.103  12.387 1.00 18.49 ? 201  ASP B CA  1 
ATOM   1139 C C   . ASP B 1 55 ? 32.645 18.878  13.098 1.00 18.56 ? 201  ASP B C   1 
ATOM   1140 O O   . ASP B 1 55 ? 33.654 18.632  12.455 1.00 19.04 ? 201  ASP B O   1 
ATOM   1141 C CB  . ASP B 1 55 ? 30.654 17.753  11.992 1.00 17.77 ? 201  ASP B CB  1 
ATOM   1142 C CG  . ASP B 1 55 ? 29.205 17.904  11.490 1.00 17.04 ? 201  ASP B CG  1 
ATOM   1143 O OD1 . ASP B 1 55 ? 28.671 19.039  11.569 1.00 20.97 ? 201  ASP B OD1 1 
ATOM   1144 O OD2 . ASP B 1 55 ? 28.646 16.894  11.018 1.00 19.85 ? 201  ASP B OD2 1 
ATOM   1145 N N   . ARG B 1 56 ? 32.627 18.886  14.436 1.00 19.29 ? 202  ARG B N   1 
ATOM   1146 C CA  . ARG B 1 56 ? 33.813 18.688  15.261 1.00 19.27 ? 202  ARG B CA  1 
ATOM   1147 C C   . ARG B 1 56 ? 33.918 17.197  15.505 1.00 21.37 ? 202  ARG B C   1 
ATOM   1148 O O   . ARG B 1 56 ? 32.918 16.572  15.824 1.00 20.87 ? 202  ARG B O   1 
ATOM   1149 C CB  . ARG B 1 56 ? 33.697 19.375  16.619 1.00 21.16 ? 202  ARG B CB  1 
ATOM   1150 C CG  . ARG B 1 56 ? 35.063 19.437  17.374 1.00 28.22 ? 202  ARG B CG  1 
ATOM   1151 C CD  . ARG B 1 56 ? 35.111 20.421  18.571 1.00 33.25 ? 202  ARG B CD  1 
ATOM   1152 N NE  . ARG B 1 56 ? 34.662 21.780  18.234 1.00 33.69 ? 202  ARG B NE  1 
ATOM   1153 C CZ  . ARG B 1 56 ? 34.768 22.829  19.043 1.00 46.50 ? 202  ARG B CZ  1 
ATOM   1154 N NH1 . ARG B 1 56 ? 35.323 22.703  20.249 1.00 51.51 ? 202  ARG B NH1 1 
ATOM   1155 N NH2 . ARG B 1 56 ? 34.317 24.014  18.642 1.00 43.95 ? 202  ARG B NH2 1 
ATOM   1156 N N   . LEU B 1 57 ? 35.110 16.624  15.346 1.00 18.47 ? 203  LEU B N   1 
ATOM   1157 C CA  . LEU B 1 57 ? 35.322 15.190  15.588 1.00 17.42 ? 203  LEU B CA  1 
ATOM   1158 C C   . LEU B 1 57 ? 35.943 15.013  16.974 1.00 17.86 ? 203  LEU B C   1 
ATOM   1159 O O   . LEU B 1 57 ? 37.061 15.466  17.206 1.00 18.78 ? 203  LEU B O   1 
ATOM   1160 C CB  . LEU B 1 57 ? 36.221 14.562  14.508 1.00 17.61 ? 203  LEU B CB  1 
ATOM   1161 C CG  . LEU B 1 57 ? 36.533 13.082  14.645 1.00 18.43 ? 203  LEU B CG  1 
ATOM   1162 C CD1 . LEU B 1 57 ? 35.218 12.287  14.641 1.00 16.82 ? 203  LEU B CD1 1 
ATOM   1163 C CD2 . LEU B 1 57 ? 37.437 12.649  13.500 1.00 21.57 ? 203  LEU B CD2 1 
ATOM   1164 N N   . LEU B 1 58 ? 35.206 14.384  17.898 1.00 17.07 ? 204  LEU B N   1 
ATOM   1165 C CA  . LEU B 1 58 ? 35.646 14.265  19.285 1.00 16.16 ? 204  LEU B CA  1 
ATOM   1166 C C   . LEU B 1 58 ? 36.349 12.958  19.619 1.00 15.86 ? 204  LEU B C   1 
ATOM   1167 O O   . LEU B 1 58 ? 37.259 12.922  20.430 1.00 15.79 ? 204  LEU B O   1 
ATOM   1168 C CB  . LEU B 1 58 ? 34.445 14.413  20.237 1.00 15.88 ? 204  LEU B CB  1 
ATOM   1169 C CG  . LEU B 1 58 ? 33.573 15.658  20.108 1.00 18.42 ? 204  LEU B CG  1 
ATOM   1170 C CD1 . LEU B 1 58 ? 32.431 15.666  21.126 1.00 20.93 ? 204  LEU B CD1 1 
ATOM   1171 C CD2 . LEU B 1 58 ? 34.460 16.840  20.370 1.00 23.06 ? 204  LEU B CD2 1 
ATOM   1172 N N   . SER B 1 59 ? 35.880 11.865  19.030 1.00 16.62 ? 205  SER B N   1 
ATOM   1173 C CA  . SER B 1 59 ? 36.384 10.542  19.389 1.00 15.56 ? 205  SER B CA  1 
ATOM   1174 C C   . SER B 1 59 ? 36.262 9.584   18.221 1.00 16.81 ? 205  SER B C   1 
ATOM   1175 O O   . SER B 1 59 ? 35.351 9.711   17.410 1.00 17.58 ? 205  SER B O   1 
ATOM   1176 C CB  . SER B 1 59 ? 35.558 10.024  20.565 1.00 16.43 ? 205  SER B CB  1 
ATOM   1177 O OG  . SER B 1 59 ? 35.955 8.752   20.985 1.00 24.36 ? 205  SER B OG  1 
ATOM   1178 N N   . VAL B 1 60 ? 37.201 8.643   18.150 1.00 18.77 ? 206  VAL B N   1 
ATOM   1179 C CA  . VAL B 1 60 ? 37.230 7.607   17.110 1.00 19.26 ? 206  VAL B CA  1 
ATOM   1180 C C   . VAL B 1 60 ? 37.432 6.261   17.813 1.00 18.89 ? 206  VAL B C   1 
ATOM   1181 O O   . VAL B 1 60 ? 38.483 6.023   18.424 1.00 15.92 ? 206  VAL B O   1 
ATOM   1182 C CB  . VAL B 1 60 ? 38.408 7.830   16.170 1.00 17.82 ? 206  VAL B CB  1 
ATOM   1183 C CG1 . VAL B 1 60 ? 38.483 6.683   15.060 1.00 17.84 ? 206  VAL B CG1 1 
ATOM   1184 C CG2 . VAL B 1 60 ? 38.350 9.204   15.568 1.00 17.41 ? 206  VAL B CG2 1 
ATOM   1185 N N   . ASP B 1 61 ? 36.443 5.380   17.750 1.00 17.25 ? 207  ASP B N   1 
ATOM   1186 C CA  . ASP B 1 61 ? 36.562 4.069   18.390 1.00 23.74 ? 207  ASP B CA  1 
ATOM   1187 C C   . ASP B 1 61 ? 36.795 4.165   19.897 1.00 23.43 ? 207  ASP B C   1 
ATOM   1188 O O   . ASP B 1 61 ? 37.504 3.341   20.484 1.00 24.16 ? 207  ASP B O   1 
ATOM   1189 C CB  . ASP B 1 61 ? 37.734 3.271   17.762 1.00 25.42 ? 207  ASP B CB  1 
ATOM   1190 C CG  . ASP B 1 61 ? 37.267 2.181   16.841 1.00 44.26 ? 207  ASP B CG  1 
ATOM   1191 O OD1 . ASP B 1 61 ? 36.211 2.380   16.206 1.00 50.71 ? 207  ASP B OD1 1 
ATOM   1192 O OD2 . ASP B 1 61 ? 37.968 1.139   16.759 1.00 32.40 ? 207  ASP B OD2 1 
ATOM   1193 N N   . GLY B 1 62 ? 36.203 5.162   20.518 1.00 19.00 ? 208  GLY B N   1 
ATOM   1194 C CA  . GLY B 1 62 ? 36.410 5.407   21.925 1.00 17.37 ? 208  GLY B CA  1 
ATOM   1195 C C   . GLY B 1 62 ? 37.747 6.040   22.272 1.00 14.21 ? 208  GLY B C   1 
ATOM   1196 O O   . GLY B 1 62 ? 38.081 6.189   23.443 1.00 17.04 ? 208  GLY B O   1 
ATOM   1197 N N   . ILE B 1 63 ? 38.518 6.420   21.263 1.00 14.10 ? 209  ILE B N   1 
ATOM   1198 C CA  . ILE B 1 63 ? 39.800 7.090   21.456 1.00 15.86 ? 209  ILE B CA  1 
ATOM   1199 C C   . ILE B 1 63 ? 39.559 8.600   21.299 1.00 16.52 ? 209  ILE B C   1 
ATOM   1200 O O   . ILE B 1 63 ? 39.234 9.075   20.178 1.00 15.27 ? 209  ILE B O   1 
ATOM   1201 C CB  . ILE B 1 63 ? 40.854 6.618   20.422 1.00 15.38 ? 209  ILE B CB  1 
ATOM   1202 C CG1 . ILE B 1 63 ? 40.904 5.083   20.391 1.00 20.33 ? 209  ILE B CG1 1 
ATOM   1203 C CG2 . ILE B 1 63 ? 42.188 7.203   20.758 1.00 15.89 ? 209  ILE B CG2 1 
ATOM   1204 C CD1 . ILE B 1 63 ? 41.545 4.560   19.147 1.00 25.72 ? 209  ILE B CD1 1 
ATOM   1205 N N   . ARG B 1 64 ? 39.679 9.338   22.412 1.00 14.96 ? 210  ARG B N   1 
ATOM   1206 C CA  . ARG B 1 64 ? 39.472 10.790  22.343 1.00 15.95 ? 210  ARG B CA  1 
ATOM   1207 C C   . ARG B 1 64 ? 40.573 11.473  21.560 1.00 15.16 ? 210  ARG B C   1 
ATOM   1208 O O   . ARG B 1 64 ? 41.759 11.187  21.752 1.00 20.41 ? 210  ARG B O   1 
ATOM   1209 C CB  . ARG B 1 64 ? 39.425 11.373  23.742 1.00 16.60 ? 210  ARG B CB  1 
ATOM   1210 C CG  . ARG B 1 64 ? 38.188 10.957  24.470 1.00 21.10 ? 210  ARG B CG  1 
ATOM   1211 C CD  . ARG B 1 64 ? 36.979 11.802  24.056 1.00 24.59 ? 210  ARG B CD  1 
ATOM   1212 N NE  . ARG B 1 64 ? 35.731 11.139  24.414 1.00 28.40 ? 210  ARG B NE  1 
ATOM   1213 C CZ  . ARG B 1 64 ? 34.536 11.740  24.515 1.00 26.56 ? 210  ARG B CZ  1 
ATOM   1214 N NH1 . ARG B 1 64 ? 34.384 13.064  24.311 1.00 22.57 ? 210  ARG B NH1 1 
ATOM   1215 N NH2 . ARG B 1 64 ? 33.476 11.004  24.857 1.00 30.16 ? 210  ARG B NH2 1 
ATOM   1216 N N   . LEU B 1 65 ? 40.167 12.412  20.703 1.00 14.96 ? 211  LEU B N   1 
ATOM   1217 C CA  . LEU B 1 65 ? 41.128 13.156  19.906 1.00 16.70 ? 211  LEU B CA  1 
ATOM   1218 C C   . LEU B 1 65 ? 41.734 14.383  20.593 1.00 20.98 ? 211  LEU B C   1 
ATOM   1219 O O   . LEU B 1 65 ? 42.667 15.021  20.067 1.00 27.53 ? 211  LEU B O   1 
ATOM   1220 C CB  . LEU B 1 65 ? 40.546 13.513  18.550 1.00 17.31 ? 211  LEU B CB  1 
ATOM   1221 C CG  . LEU B 1 65 ? 40.192 12.363  17.606 1.00 16.87 ? 211  LEU B CG  1 
ATOM   1222 C CD1 . LEU B 1 65 ? 39.865 12.905  16.199 1.00 19.21 ? 211  LEU B CD1 1 
ATOM   1223 C CD2 . LEU B 1 65 ? 41.373 11.370  17.539 1.00 16.70 ? 211  LEU B CD2 1 
ATOM   1224 N N   . LEU B 1 66 ? 41.249 14.654  21.786 1.00 22.91 ? 212  LEU B N   1 
ATOM   1225 C CA  . LEU B 1 66 ? 41.818 15.633  22.681 1.00 25.82 ? 212  LEU B CA  1 
ATOM   1226 C C   . LEU B 1 66 ? 43.317 15.437  22.911 1.00 19.41 ? 212  LEU B C   1 
ATOM   1227 O O   . LEU B 1 66 ? 43.787 14.380  23.380 1.00 25.20 ? 212  LEU B O   1 
ATOM   1228 C CB  . LEU B 1 66 ? 41.056 15.571  24.005 1.00 23.37 ? 212  LEU B CB  1 
ATOM   1229 C CG  . LEU B 1 66 ? 41.345 16.658  25.028 1.00 32.27 ? 212  LEU B CG  1 
ATOM   1230 C CD1 . LEU B 1 66 ? 40.118 16.987  25.856 1.00 43.44 ? 212  LEU B CD1 1 
ATOM   1231 C CD2 . LEU B 1 66 ? 42.489 16.230  25.902 1.00 31.97 ? 212  LEU B CD2 1 
ATOM   1232 N N   . GLY B 1 67 ? 44.087 16.474  22.601 1.00 21.01 ? 213  GLY B N   1 
ATOM   1233 C CA  . GLY B 1 67 ? 45.509 16.447  22.815 1.00 18.01 ? 213  GLY B CA  1 
ATOM   1234 C C   . GLY B 1 67 ? 46.321 15.683  21.777 1.00 19.88 ? 213  GLY B C   1 
ATOM   1235 O O   . GLY B 1 67 ? 47.506 15.442  21.972 1.00 20.27 ? 213  GLY B O   1 
ATOM   1236 N N   . THR B 1 68 ? 45.693 15.262  20.696 1.00 20.52 ? 214  THR B N   1 
ATOM   1237 C CA  . THR B 1 68 ? 46.424 14.586  19.598 1.00 16.39 ? 214  THR B CA  1 
ATOM   1238 C C   . THR B 1 68 ? 46.878 15.607  18.556 1.00 17.97 ? 214  THR B C   1 
ATOM   1239 O O   . THR B 1 68 ? 46.054 16.450  18.183 1.00 17.52 ? 214  THR B O   1 
ATOM   1240 C CB  . THR B 1 68 ? 45.499 13.587  18.920 1.00 18.91 ? 214  THR B CB  1 
ATOM   1241 O OG1 . THR B 1 68 ? 44.267 14.224  18.555 1.00 20.71 ? 214  THR B OG1 1 
ATOM   1242 C CG2 . THR B 1 68 ? 45.206 12.454  19.865 1.00 19.11 ? 214  THR B CG2 1 
ATOM   1243 N N   . THR B 1 69 ? 48.121 15.531  18.076 1.00 16.66 ? 215  THR B N   1 
ATOM   1244 C CA  . THR B 1 69 ? 48.537 16.322  16.915 1.00 15.29 ? 215  THR B CA  1 
ATOM   1245 C C   . THR B 1 69 ? 47.759 15.902  15.694 1.00 18.37 ? 215  THR B C   1 
ATOM   1246 O O   . THR B 1 69 ? 47.089 14.881  15.692 1.00 18.25 ? 215  THR B O   1 
ATOM   1247 C CB  . THR B 1 69 ? 50.004 16.143  16.565 1.00 15.43 ? 215  THR B CB  1 
ATOM   1248 O OG1 . THR B 1 69 ? 50.211 14.797  16.102 1.00 18.32 ? 215  THR B OG1 1 
ATOM   1249 C CG2 . THR B 1 69 ? 50.882 16.447  17.771 1.00 19.81 ? 215  THR B CG2 1 
ATOM   1250 N N   . HIS B 1 70 ? 47.846 16.700  14.640 1.00 15.28 ? 216  HIS B N   1 
ATOM   1251 C CA  . HIS B 1 70 ? 47.153 16.349  13.413 1.00 16.98 ? 216  HIS B CA  1 
ATOM   1252 C C   . HIS B 1 70 ? 47.551 14.950  12.963 1.00 16.76 ? 216  HIS B C   1 
ATOM   1253 O O   . HIS B 1 70 ? 46.707 14.130  12.604 1.00 15.90 ? 216  HIS B O   1 
ATOM   1254 C CB  . HIS B 1 70 ? 47.436 17.380  12.320 1.00 16.38 ? 216  HIS B CB  1 
ATOM   1255 C CG  . HIS B 1 70 ? 46.653 17.146  11.065 1.00 17.61 ? 216  HIS B CG  1 
ATOM   1256 N ND1 . HIS B 1 70 ? 45.332 17.520  10.925 1.00 15.77 ? 216  HIS B ND1 1 
ATOM   1257 C CD2 . HIS B 1 70 ? 47.002 16.552  9.903  1.00 16.45 ? 216  HIS B CD2 1 
ATOM   1258 C CE1 . HIS B 1 70 ? 44.918 17.191  9.713  1.00 19.05 ? 216  HIS B CE1 1 
ATOM   1259 N NE2 . HIS B 1 70 ? 45.910 16.593  9.076  1.00 20.96 ? 216  HIS B NE2 1 
ATOM   1260 N N   . ALA B 1 71 ? 48.858 14.702  12.930 1.00 15.23 ? 217  ALA B N   1 
ATOM   1261 C CA  . ALA B 1 71 ? 49.374 13.403  12.484 1.00 15.28 ? 217  ALA B CA  1 
ATOM   1262 C C   . ALA B 1 71 ? 48.855 12.263  13.328 1.00 16.15 ? 217  ALA B C   1 
ATOM   1263 O O   . ALA B 1 71 ? 48.553 11.192  12.804 1.00 18.22 ? 217  ALA B O   1 
ATOM   1264 C CB  . ALA B 1 71 ? 50.880 13.407  12.506 1.00 15.42 ? 217  ALA B CB  1 
ATOM   1265 N N   . GLU B 1 72 ? 48.753 12.504  14.646 1.00 14.79 ? 218  GLU B N   1 
ATOM   1266 C CA  . GLU B 1 72 ? 48.283 11.497  15.602 1.00 12.67 ? 218  GLU B CA  1 
ATOM   1267 C C   . GLU B 1 72 ? 46.819 11.217  15.361 1.00 19.13 ? 218  GLU B C   1 
ATOM   1268 O O   . GLU B 1 72 ? 46.375 10.083  15.430 1.00 16.61 ? 218  GLU B O   1 
ATOM   1269 C CB  . GLU B 1 72 ? 48.511 11.933  17.059 1.00 19.26 ? 218  GLU B CB  1 
ATOM   1270 C CG  . GLU B 1 72 ? 49.958 11.798  17.493 1.00 18.74 ? 218  GLU B CG  1 
ATOM   1271 C CD  . GLU B 1 72 ? 50.248 12.382  18.866 1.00 31.51 ? 218  GLU B CD  1 
ATOM   1272 O OE1 . GLU B 1 72 ? 49.719 13.460  19.207 1.00 22.74 ? 218  GLU B OE1 1 
ATOM   1273 O OE2 . GLU B 1 72 ? 50.999 11.748  19.632 1.00 23.57 ? 218  GLU B OE2 1 
ATOM   1274 N N   . ALA B 1 73 ? 46.052 12.261  15.048 1.00 18.25 ? 219  ALA B N   1 
ATOM   1275 C CA  . ALA B 1 73 ? 44.613 12.078  14.748 1.00 17.90 ? 219  ALA B CA  1 
ATOM   1276 C C   . ALA B 1 73 ? 44.379 11.286  13.467 1.00 18.51 ? 219  ALA B C   1 
ATOM   1277 O O   . ALA B 1 73 ? 43.596 10.339  13.408 1.00 17.83 ? 219  ALA B O   1 
ATOM   1278 C CB  . ALA B 1 73 ? 43.915 13.439  14.641 1.00 19.62 ? 219  ALA B CB  1 
ATOM   1279 N N   . MET B 1 74 ? 45.085 11.673  12.417 1.00 17.10 ? 220  MET B N   1 
ATOM   1280 C CA  . MET B 1 74 ? 44.993 10.994  11.159 1.00 18.86 ? 220  MET B CA  1 
ATOM   1281 C C   . MET B 1 74 ? 45.416 9.535   11.344 1.00 18.42 ? 220  MET B C   1 
ATOM   1282 O O   . MET B 1 74 ? 44.807 8.624   10.772 1.00 18.27 ? 220  MET B O   1 
ATOM   1283 C CB  . MET B 1 74 ? 45.831 11.777  10.123 1.00 23.46 ? 220  MET B CB  1 
ATOM   1284 C CG  . MET B 1 74 ? 46.140 11.070  8.832  1.00 37.08 ? 220  MET B CG  1 
ATOM   1285 S SD  . MET B 1 74 ? 47.601 10.015  8.924  1.00 35.70 ? 220  MET B SD  1 
ATOM   1286 C CE  . MET B 1 74 ? 48.963 11.158  9.231  1.00 37.20 ? 220  MET B CE  1 
ATOM   1287 N N   . SER B 1 75 ? 46.471 9.305   12.143 1.00 17.88 ? 221  SER B N   1 
ATOM   1288 C CA  . SER B 1 75 ? 46.954 7.944   12.422 1.00 18.76 ? 221  SER B CA  1 
ATOM   1289 C C   . SER B 1 75 ? 45.873 7.131   13.109 1.00 11.60 ? 221  SER B C   1 
ATOM   1290 O O   . SER B 1 75 ? 45.643 5.973   12.791 1.00 14.81 ? 221  SER B O   1 
ATOM   1291 C CB  A SER B 1 75 ? 48.227 7.988   13.286 0.50 19.35 ? 221  SER B CB  1 
ATOM   1292 C CB  B SER B 1 75 ? 48.188 7.979   13.329 0.50 20.02 ? 221  SER B CB  1 
ATOM   1293 O OG  A SER B 1 75 ? 49.334 8.558   12.579 0.50 13.57 ? 221  SER B OG  1 
ATOM   1294 O OG  B SER B 1 75 ? 48.489 6.691   13.842 0.50 29.15 ? 221  SER B OG  1 
ATOM   1295 N N   . ILE B 1 76 ? 45.223 7.722   14.092 1.00 13.79 ? 222  ILE B N   1 
ATOM   1296 C CA  . ILE B 1 76 ? 44.176 7.006   14.830 1.00 12.07 ? 222  ILE B CA  1 
ATOM   1297 C C   . ILE B 1 76 ? 43.031 6.578   13.909 1.00 15.85 ? 222  ILE B C   1 
ATOM   1298 O O   . ILE B 1 76 ? 42.547 5.467   14.001 1.00 17.91 ? 222  ILE B O   1 
ATOM   1299 C CB  . ILE B 1 76 ? 43.631 7.894   15.993 1.00 16.57 ? 222  ILE B CB  1 
ATOM   1300 C CG1 . ILE B 1 76 ? 44.642 7.904   17.161 1.00 13.91 ? 222  ILE B CG1 1 
ATOM   1301 C CG2 . ILE B 1 76 ? 42.223 7.429   16.435 1.00 16.02 ? 222  ILE B CG2 1 
ATOM   1302 C CD1 . ILE B 1 76 ? 44.496 9.059   18.122 1.00 20.28 ? 222  ILE B CD1 1 
ATOM   1303 N N   . LEU B 1 77 ? 42.606 7.464   13.019 1.00 15.15 ? 223  LEU B N   1 
ATOM   1304 C CA  . LEU B 1 77 ? 41.625 7.116   11.995 1.00 14.26 ? 223  LEU B CA  1 
ATOM   1305 C C   . LEU B 1 77 ? 42.132 6.034   11.019 1.00 15.79 ? 223  LEU B C   1 
ATOM   1306 O O   . LEU B 1 77 ? 41.352 5.198   10.582 1.00 17.91 ? 223  LEU B O   1 
ATOM   1307 C CB  . LEU B 1 77 ? 41.238 8.365   11.198 1.00 15.36 ? 223  LEU B CB  1 
ATOM   1308 C CG  . LEU B 1 77 ? 40.345 9.320   11.998 1.00 20.05 ? 223  LEU B CG  1 
ATOM   1309 C CD1 . LEU B 1 77 ? 40.556 10.748  11.573 1.00 20.04 ? 223  LEU B CD1 1 
ATOM   1310 C CD2 . LEU B 1 77 ? 38.854 8.932   11.861 1.00 19.41 ? 223  LEU B CD2 1 
ATOM   1311 N N   . LYS B 1 78 ? 43.415 6.079   10.661 1.00 14.72 ? 224  LYS B N   1 
ATOM   1312 C CA  . LYS B 1 78 ? 43.982 5.125   9.694  1.00 16.68 ? 224  LYS B CA  1 
ATOM   1313 C C   . LYS B 1 78 ? 44.078 3.755   10.315 1.00 18.21 ? 224  LYS B C   1 
ATOM   1314 O O   . LYS B 1 78 ? 43.869 2.729   9.633  1.00 26.00 ? 224  LYS B O   1 
ATOM   1315 C CB  . LYS B 1 78 ? 45.381 5.564   9.226  1.00 20.86 ? 224  LYS B CB  1 
ATOM   1316 C CG  . LYS B 1 78 ? 46.026 4.626   8.220  1.00 34.41 ? 224  LYS B CG  1 
ATOM   1317 N N   . GLN B 1 79 ? 44.442 3.730   11.599 1.00 18.02 ? 225  GLN B N   1 
ATOM   1318 C CA  . GLN B 1 79 ? 44.750 2.520   12.330 1.00 18.64 ? 225  GLN B CA  1 
ATOM   1319 C C   . GLN B 1 79 ? 43.538 1.873   12.980 1.00 19.41 ? 225  GLN B C   1 
ATOM   1320 O O   . GLN B 1 79 ? 43.649 0.773   13.470 1.00 21.74 ? 225  GLN B O   1 
ATOM   1321 C CB  . GLN B 1 79 ? 45.791 2.807   13.413 1.00 16.17 ? 225  GLN B CB  1 
ATOM   1322 C CG  . GLN B 1 79 ? 47.182 3.152   12.914 1.00 19.37 ? 225  GLN B CG  1 
ATOM   1323 N N   . CYS B 1 80 ? 42.384 2.530   13.013 1.00 21.99 ? 226  CYS B N   1 
ATOM   1324 C CA  . CYS B 1 80 ? 41.260 1.948   13.755 1.00 25.40 ? 226  CYS B CA  1 
ATOM   1325 C C   . CYS B 1 80 ? 40.592 0.803   12.967 1.00 32.09 ? 226  CYS B C   1 
ATOM   1326 O O   . CYS B 1 80 ? 40.943 0.543   11.811 1.00 29.74 ? 226  CYS B O   1 
ATOM   1327 C CB  . CYS B 1 80 ? 40.254 3.013   14.228 1.00 22.81 ? 226  CYS B CB  1 
ATOM   1328 S SG  . CYS B 1 80 ? 39.278 3.818   12.968 1.00 25.87 ? 226  CYS B SG  1 
ATOM   1329 N N   . GLY B 1 81 ? 39.658 0.108   13.616 1.00 34.92 ? 227  GLY B N   1 
ATOM   1330 C CA  . GLY B 1 81 ? 38.919 -0.983  12.981 1.00 41.97 ? 227  GLY B CA  1 
ATOM   1331 C C   . GLY B 1 81 ? 38.113 -0.532  11.771 1.00 43.94 ? 227  GLY B C   1 
ATOM   1332 O O   . GLY B 1 81 ? 37.749 0.647   11.656 1.00 46.17 ? 227  GLY B O   1 
ATOM   1333 N N   . GLN B 1 82 ? 37.822 -1.478  10.875 1.00 41.51 ? 228  GLN B N   1 
ATOM   1334 C CA  . GLN B 1 82 ? 37.079 -1.177  9.646  1.00 40.89 ? 228  GLN B CA  1 
ATOM   1335 C C   . GLN B 1 82 ? 35.634 -0.735  9.929  1.00 36.70 ? 228  GLN B C   1 
ATOM   1336 O O   . GLN B 1 82 ? 35.101 0.073   9.173  1.00 36.22 ? 228  GLN B O   1 
ATOM   1337 C CB  . GLN B 1 82 ? 37.120 -2.351  8.658  1.00 39.38 ? 228  GLN B CB  1 
ATOM   1338 C CG  . GLN B 1 82 ? 38.534 -2.763  8.220  1.00 41.94 ? 228  GLN B CG  1 
ATOM   1339 C CD  . GLN B 1 82 ? 39.279 -1.689  7.425  1.00 51.79 ? 228  GLN B CD  1 
ATOM   1340 O OE1 . GLN B 1 82 ? 39.014 -1.481  6.234  1.00 49.83 ? 228  GLN B OE1 1 
ATOM   1341 N NE2 . GLN B 1 82 ? 40.245 -1.030  8.072  1.00 35.89 ? 228  GLN B NE2 1 
ATOM   1342 N N   . GLU B 1 83 ? 35.010 -1.271  10.992 1.00 29.29 ? 229  GLU B N   1 
ATOM   1343 C CA  . GLU B 1 83 ? 33.742 -0.725  11.525 1.00 26.33 ? 229  GLU B CA  1 
ATOM   1344 C C   . GLU B 1 83 ? 34.085 0.145   12.730 1.00 26.89 ? 229  GLU B C   1 
ATOM   1345 O O   . GLU B 1 83 ? 34.656 -0.366  13.688 1.00 30.03 ? 229  GLU B O   1 
ATOM   1346 C CB  . GLU B 1 83 ? 32.773 -1.831  11.979 1.00 26.30 ? 229  GLU B CB  1 
ATOM   1347 C CG  . GLU B 1 83 ? 31.483 -1.260  12.592 1.00 23.68 ? 229  GLU B CG  1 
ATOM   1348 C CD  . GLU B 1 83 ? 30.543 -2.291  13.194 1.00 42.72 ? 229  GLU B CD  1 
ATOM   1349 O OE1 . GLU B 1 83 ? 30.785 -3.501  13.024 1.00 49.34 ? 229  GLU B OE1 1 
ATOM   1350 O OE2 . GLU B 1 83 ? 29.546 -1.876  13.832 1.00 44.65 ? 229  GLU B OE2 1 
ATOM   1351 N N   . ALA B 1 84 ? 33.716 1.433   12.705 1.00 25.26 ? 230  ALA B N   1 
ATOM   1352 C CA  . ALA B 1 84 ? 34.107 2.383   13.765 1.00 22.02 ? 230  ALA B CA  1 
ATOM   1353 C C   . ALA B 1 84 ? 32.985 3.326   14.165 1.00 22.78 ? 230  ALA B C   1 
ATOM   1354 O O   . ALA B 1 84 ? 32.260 3.823   13.323 1.00 26.05 ? 230  ALA B O   1 
ATOM   1355 C CB  . ALA B 1 84 ? 35.312 3.214   13.327 1.00 23.33 ? 230  ALA B CB  1 
ATOM   1356 N N   . ALA B 1 85 ? 32.879 3.574   15.470 1.00 25.75 ? 231  ALA B N   1 
ATOM   1357 C CA  . ALA B 1 85 ? 31.957 4.536   16.041 1.00 22.17 ? 231  ALA B CA  1 
ATOM   1358 C C   . ALA B 1 85 ? 32.702 5.857   16.202 1.00 21.09 ? 231  ALA B C   1 
ATOM   1359 O O   . ALA B 1 85 ? 33.753 5.935   16.842 1.00 20.65 ? 231  ALA B O   1 
ATOM   1360 C CB  . ALA B 1 85 ? 31.424 4.049   17.419 1.00 22.47 ? 231  ALA B CB  1 
ATOM   1361 N N   . LEU B 1 86 ? 32.189 6.884   15.567 1.00 18.03 ? 232  LEU B N   1 
ATOM   1362 C CA  . LEU B 1 86 ? 32.767 8.213   15.700 1.00 18.08 ? 232  LEU B CA  1 
ATOM   1363 C C   . LEU B 1 86 ? 31.829 9.067   16.547 1.00 21.96 ? 232  LEU B C   1 
ATOM   1364 O O   . LEU B 1 86 ? 30.603 8.999   16.401 1.00 21.82 ? 232  LEU B O   1 
ATOM   1365 C CB  . LEU B 1 86 ? 32.895 8.872   14.340 1.00 22.12 ? 232  LEU B CB  1 
ATOM   1366 C CG  . LEU B 1 86 ? 33.717 8.104   13.314 1.00 21.49 ? 232  LEU B CG  1 
ATOM   1367 C CD1 . LEU B 1 86 ? 33.711 8.958   12.043 1.00 20.73 ? 232  LEU B CD1 1 
ATOM   1368 C CD2 . LEU B 1 86 ? 35.122 7.784   13.771 1.00 27.67 ? 232  LEU B CD2 1 
ATOM   1369 N N   . LEU B 1 87 ? 32.393 9.901   17.415 1.00 18.00 ? 233  LEU B N   1 
ATOM   1370 C CA  . LEU B 1 87 ? 31.579 10.912  18.113 1.00 16.91 ? 233  LEU B CA  1 
ATOM   1371 C C   . LEU B 1 87 ? 31.868 12.274  17.522 1.00 16.84 ? 233  LEU B C   1 
ATOM   1372 O O   . LEU B 1 87 ? 33.031 12.700  17.478 1.00 18.14 ? 233  LEU B O   1 
ATOM   1373 C CB  . LEU B 1 87 ? 31.831 10.981  19.628 1.00 17.91 ? 233  LEU B CB  1 
ATOM   1374 C CG  . LEU B 1 87 ? 31.356 9.807   20.464 1.00 21.61 ? 233  LEU B CG  1 
ATOM   1375 C CD1 . LEU B 1 87 ? 31.702 10.006  21.960 1.00 18.05 ? 233  LEU B CD1 1 
ATOM   1376 C CD2 . LEU B 1 87 ? 29.876 9.536   20.352 1.00 23.02 ? 233  LEU B CD2 1 
ATOM   1377 N N   . ILE B 1 88 ? 30.814 12.918  17.020 1.00 18.45 ? 234  ILE B N   1 
ATOM   1378 C CA  . ILE B 1 88 ? 30.930 14.254  16.423 1.00 18.26 ? 234  ILE B CA  1 
ATOM   1379 C C   . ILE B 1 88 ? 30.066 15.217  17.222 1.00 16.75 ? 234  ILE B C   1 
ATOM   1380 O O   . ILE B 1 88 ? 29.237 14.822  18.017 1.00 18.33 ? 234  ILE B O   1 
ATOM   1381 C CB  . ILE B 1 88 ? 30.538 14.304  14.921 1.00 19.53 ? 234  ILE B CB  1 
ATOM   1382 C CG1 . ILE B 1 88 ? 29.100 13.837  14.711 1.00 20.06 ? 234  ILE B CG1 1 
ATOM   1383 C CG2 . ILE B 1 88 ? 31.499 13.471  14.124 1.00 20.18 ? 234  ILE B CG2 1 
ATOM   1384 C CD1 . ILE B 1 88 ? 28.631 13.925  13.243 1.00 21.09 ? 234  ILE B CD1 1 
ATOM   1385 N N   . GLU B 1 89 ? 30.288 16.502  16.998 1.00 17.92 ? 235  GLU B N   1 
ATOM   1386 C CA  . GLU B 1 89 ? 29.558 17.539  17.720 1.00 18.50 ? 235  GLU B CA  1 
ATOM   1387 C C   . GLU B 1 89 ? 29.127 18.649  16.771 1.00 19.63 ? 235  GLU B C   1 
ATOM   1388 O O   . GLU B 1 89 ? 29.927 19.140  16.015 1.00 19.01 ? 235  GLU B O   1 
ATOM   1389 C CB  . GLU B 1 89 ? 30.471 18.108  18.787 1.00 21.80 ? 235  GLU B CB  1 
ATOM   1390 C CG  . GLU B 1 89 ? 29.949 19.185  19.607 1.00 23.71 ? 235  GLU B CG  1 
ATOM   1391 C CD  . GLU B 1 89 ? 30.909 19.505  20.701 1.00 24.78 ? 235  GLU B CD  1 
ATOM   1392 O OE1 . GLU B 1 89 ? 31.965 20.090  20.392 1.00 23.48 ? 235  GLU B OE1 1 
ATOM   1393 O OE2 . GLU B 1 89 ? 30.664 19.113  21.840 1.00 24.77 ? 235  GLU B OE2 1 
ATOM   1394 N N   . TYR B 1 90 ? 27.858 19.004  16.817 1.00 18.64 ? 236  TYR B N   1 
ATOM   1395 C CA  . TYR B 1 90 ? 27.308 20.022  15.979 1.00 17.78 ? 236  TYR B CA  1 
ATOM   1396 C C   . TYR B 1 90 ? 25.947 20.455  16.527 1.00 18.18 ? 236  TYR B C   1 
ATOM   1397 O O   . TYR B 1 90 ? 25.499 19.958  17.556 1.00 16.76 ? 236  TYR B O   1 
ATOM   1398 C CB  . TYR B 1 90 ? 27.210 19.568  14.529 1.00 17.12 ? 236  TYR B CB  1 
ATOM   1399 C CG  . TYR B 1 90 ? 26.285 18.405  14.268 1.00 15.11 ? 236  TYR B CG  1 
ATOM   1400 C CD1 . TYR B 1 90 ? 24.965 18.609  13.910 1.00 18.93 ? 236  TYR B CD1 1 
ATOM   1401 C CD2 . TYR B 1 90 ? 26.709 17.096  14.449 1.00 17.89 ? 236  TYR B CD2 1 
ATOM   1402 C CE1 . TYR B 1 90 ? 24.141 17.528  13.723 1.00 20.86 ? 236  TYR B CE1 1 
ATOM   1403 C CE2 . TYR B 1 90 ? 25.917 16.018  14.221 1.00 20.29 ? 236  TYR B CE2 1 
ATOM   1404 C CZ  . TYR B 1 90 ? 24.600 16.212  13.872 1.00 18.28 ? 236  TYR B CZ  1 
ATOM   1405 O OH  . TYR B 1 90 ? 23.755 15.142  13.657 1.00 19.23 ? 236  TYR B OH  1 
ATOM   1406 N N   . ASP B 1 91 ? 25.366 21.480  15.907 1.00 19.55 ? 237  ASP B N   1 
ATOM   1407 C CA  . ASP B 1 91 ? 24.118 22.007  16.404 1.00 20.25 ? 237  ASP B CA  1 
ATOM   1408 C C   . ASP B 1 91 ? 22.969 21.162  15.855 1.00 21.45 ? 237  ASP B C   1 
ATOM   1409 O O   . ASP B 1 91 ? 22.655 21.203  14.659 1.00 18.10 ? 237  ASP B O   1 
ATOM   1410 C CB  . ASP B 1 91 ? 24.000 23.463  15.972 1.00 19.83 ? 237  ASP B CB  1 
ATOM   1411 C CG  . ASP B 1 91 ? 22.760 24.159  16.508 1.00 26.86 ? 237  ASP B CG  1 
ATOM   1412 O OD1 . ASP B 1 91 ? 22.018 23.609  17.324 1.00 24.32 ? 237  ASP B OD1 1 
ATOM   1413 O OD2 . ASP B 1 91 ? 22.539 25.325  16.086 1.00 31.47 ? 237  ASP B OD2 1 
ATOM   1414 N N   . VAL B 1 92 ? 22.369 20.394  16.748 1.00 17.37 ? 238  VAL B N   1 
ATOM   1415 C CA  . VAL B 1 92 ? 21.362 19.411  16.380 1.00 17.78 ? 238  VAL B CA  1 
ATOM   1416 C C   . VAL B 1 92 ? 19.924 19.899  16.610 1.00 19.53 ? 238  VAL B C   1 
ATOM   1417 O O   . VAL B 1 92 ? 19.601 20.478  17.662 1.00 20.04 ? 238  VAL B O   1 
ATOM   1418 C CB  . VAL B 1 92 ? 21.605 18.097  17.203 1.00 19.00 ? 238  VAL B CB  1 
ATOM   1419 C CG1 . VAL B 1 92 ? 20.415 17.117  17.104 1.00 23.43 ? 238  VAL B CG1 1 
ATOM   1420 C CG2 . VAL B 1 92 ? 22.976 17.439  16.877 1.00 19.83 ? 238  VAL B CG2 1 
ATOM   1421 N N   . SER B 1 93 ? 19.049 19.632  15.621 1.00 16.85 ? 239  SER B N   1 
ATOM   1422 C CA  . SER B 1 93 ? 17.612 19.736  15.830 1.00 15.24 ? 239  SER B CA  1 
ATOM   1423 C C   . SER B 1 93 ? 17.058 18.375  16.243 1.00 18.38 ? 239  SER B C   1 
ATOM   1424 O O   . SER B 1 93 ? 17.203 17.445  15.494 1.00 18.82 ? 239  SER B O   1 
ATOM   1425 C CB  . SER B 1 93 ? 16.962 20.210  14.534 1.00 20.01 ? 239  SER B CB  1 
ATOM   1426 O OG  . SER B 1 93 ? 17.435 21.475  14.162 1.00 20.80 ? 239  SER B OG  1 
ATOM   1427 N N   . GLU B 1 94 ? 16.427 18.299  17.395 1.00 18.54 ? 240  GLU B N   1 
ATOM   1428 C CA  . GLU B 1 94 ? 15.925 17.055  17.966 1.00 16.50 ? 240  GLU B CA  1 
ATOM   1429 C C   . GLU B 1 94 ? 14.538 17.293  18.615 1.00 18.00 ? 240  GLU B C   1 
ATOM   1430 O O   . GLU B 1 94 ? 14.361 18.250  19.377 1.00 19.95 ? 240  GLU B O   1 
ATOM   1431 C CB  . GLU B 1 94 ? 16.940 16.555  19.009 1.00 22.02 ? 240  GLU B CB  1 
ATOM   1432 C CG  . GLU B 1 94 ? 16.767 15.112  19.381 1.00 21.35 ? 240  GLU B CG  1 
ATOM   1433 C CD  . GLU B 1 94 ? 17.827 14.586  20.345 1.00 21.41 ? 240  GLU B CD  1 
ATOM   1434 O OE1 . GLU B 1 94 ? 18.550 15.376  21.027 1.00 19.88 ? 240  GLU B OE1 1 
ATOM   1435 O OE2 . GLU B 1 94 ? 17.888 13.335  20.504 1.00 18.89 ? 240  GLU B OE2 1 
ATOM   1436 N N   . THR B 1 95 ? 13.575 16.429  18.335 1.00 17.20 ? 241  THR B N   1 
ATOM   1437 C CA  . THR B 1 95 ? 12.201 16.564  18.813 1.00 17.38 ? 241  THR B CA  1 
ATOM   1438 C C   . THR B 1 95 ? 11.590 15.214  19.145 1.00 16.10 ? 241  THR B C   1 
ATOM   1439 O O   . THR B 1 95 ? 11.767 14.284  18.386 1.00 16.91 ? 241  THR B O   1 
ATOM   1440 C CB  . THR B 1 95 ? 11.349 17.264  17.775 1.00 19.54 ? 241  THR B CB  1 
ATOM   1441 O OG1 . THR B 1 95 ? 11.952 18.507  17.419 1.00 21.35 ? 241  THR B OG1 1 
ATOM   1442 C CG2 . THR B 1 95 ? 9.916  17.495  18.340 1.00 20.50 ? 241  THR B CG2 1 
ATOM   1443 N N   . ALA B 1 96 ? 10.884 15.117  20.276 1.00 16.12 ? 242  ALA B N   1 
ATOM   1444 C CA  . ALA B 1 96 ? 10.093 13.963  20.632 1.00 14.46 ? 242  ALA B CA  1 
ATOM   1445 C C   . ALA B 1 96 ? 8.805  14.025  19.811 1.00 21.41 ? 242  ALA B C   1 
ATOM   1446 O O   . ALA B 1 96 ? 8.188  15.096  19.645 1.00 21.85 ? 242  ALA B O   1 
ATOM   1447 C CB  . ALA B 1 96 ? 9.758  13.950  22.096 1.00 16.21 ? 242  ALA B CB  1 
ATOM   1448 N N   . VAL B 1 97 ? 8.433  12.868  19.277 1.00 17.11 ? 243  VAL B N   1 
ATOM   1449 C CA  . VAL B 1 97 ? 7.250  12.728  18.442 1.00 16.30 ? 243  VAL B CA  1 
ATOM   1450 C C   . VAL B 1 97 ? 6.493  11.452  18.784 1.00 14.48 ? 243  VAL B C   1 
ATOM   1451 O O   . VAL B 1 97 ? 5.465  11.185  18.112 1.00 19.04 ? 243  VAL B O   1 
ATOM   1452 C CB  . VAL B 1 97 ? 7.642  12.702  16.941 1.00 19.36 ? 243  VAL B CB  1 
ATOM   1453 C CG1 . VAL B 1 97 ? 8.260  14.000  16.525 1.00 17.06 ? 243  VAL B CG1 1 
ATOM   1454 C CG2 . VAL B 1 97 ? 8.582  11.535  16.663 1.00 21.18 ? 243  VAL B CG2 1 
ATOM   1455 O OXT . VAL B 1 97 ? 6.809  10.687  19.699 1.00 15.27 ? 243  VAL B OXT 1 
HETATM 1456 S S   . SCN C 2 .  ? 20.025 18.377  12.714 1.00 12.83 ? 1244 SCN A S   1 
HETATM 1457 C C   . SCN C 2 .  ? 20.666 16.797  12.992 1.00 10.01 ? 1244 SCN A C   1 
HETATM 1458 N N   . SCN C 2 .  ? 21.122 15.732  13.066 1.00 12.13 ? 1244 SCN A N   1 
HETATM 1459 S S   . SCN D 2 .  ? 17.428 -7.532  11.603 1.00 16.42 ? 1245 SCN A S   1 
HETATM 1460 C C   . SCN D 2 .  ? 15.769 -6.938  11.543 1.00 15.82 ? 1245 SCN A C   1 
HETATM 1461 N N   . SCN D 2 .  ? 14.652 -6.589  11.518 1.00 18.05 ? 1245 SCN A N   1 
HETATM 1462 C C1  . EDO E 3 .  ? 13.282 -6.282  5.181  1.00 31.55 ? 1246 EDO A C1  1 
HETATM 1463 O O1  . EDO E 3 .  ? 12.014 -6.763  5.668  1.00 30.86 ? 1246 EDO A O1  1 
HETATM 1464 C C2  . EDO E 3 .  ? 13.075 -5.526  3.879  1.00 41.12 ? 1246 EDO A C2  1 
HETATM 1465 O O2  . EDO E 3 .  ? 11.766 -4.945  3.914  1.00 30.10 ? 1246 EDO A O2  1 
HETATM 1466 C C1  . EDO F 3 .  ? 27.640 19.177  23.436 0.50 11.80 ? 1244 EDO B C1  1 
HETATM 1467 O O1  . EDO F 3 .  ? 28.300 18.238  22.596 0.50 13.66 ? 1244 EDO B O1  1 
HETATM 1468 C C2  . EDO F 3 .  ? 28.321 19.238  24.801 0.50 11.25 ? 1244 EDO B C2  1 
HETATM 1469 O O2  . EDO F 3 .  ? 27.805 18.203  25.625 0.50 13.81 ? 1244 EDO B O2  1 
HETATM 1470 C C1  . EDO G 3 .  ? 37.287 15.096  0.210  1.00 22.29 ? 1245 EDO B C1  1 
HETATM 1471 O O1  . EDO G 3 .  ? 35.973 15.440  -0.232 1.00 18.61 ? 1245 EDO B O1  1 
HETATM 1472 C C2  . EDO G 3 .  ? 37.640 13.609  0.077  1.00 29.87 ? 1245 EDO B C2  1 
HETATM 1473 O O2  . EDO G 3 .  ? 37.432 12.922  1.323  1.00 25.92 ? 1245 EDO B O2  1 
HETATM 1474 O O   . HOH H 4 .  ? 9.749  -2.524  2.250  1.00 39.08 ? 2001 HOH A O   1 
HETATM 1475 O O   . HOH H 4 .  ? 14.847 -2.487  0.753  1.00 29.13 ? 2002 HOH A O   1 
HETATM 1476 O O   . HOH H 4 .  ? 4.693  3.511   3.356  1.00 39.73 ? 2003 HOH A O   1 
HETATM 1477 O O   . HOH H 4 .  ? 8.777  -3.940  4.939  1.00 24.16 ? 2004 HOH A O   1 
HETATM 1478 O O   . HOH H 4 .  ? 1.778  1.553   3.260  1.00 43.31 ? 2005 HOH A O   1 
HETATM 1479 O O   . HOH H 4 .  ? 3.618  -2.708  8.247  1.00 30.28 ? 2006 HOH A O   1 
HETATM 1480 O O   . HOH H 4 .  ? 4.263  -2.882  11.664 1.00 34.28 ? 2007 HOH A O   1 
HETATM 1481 O O   . HOH H 4 .  ? -5.546 5.478   20.973 1.00 37.38 ? 2008 HOH A O   1 
HETATM 1482 O O   . HOH H 4 .  ? -0.193 2.039   20.253 1.00 29.12 ? 2009 HOH A O   1 
HETATM 1483 O O   . HOH H 4 .  ? -0.064 14.097  23.944 0.50 31.78 ? 2010 HOH A O   1 
HETATM 1484 O O   . HOH H 4 .  ? -3.571 13.714  15.304 1.00 28.99 ? 2011 HOH A O   1 
HETATM 1485 O O   . HOH H 4 .  ? 3.556  15.091  19.421 1.00 40.52 ? 2012 HOH A O   1 
HETATM 1486 O O   . HOH H 4 .  ? 21.961 9.904   16.493 1.00 22.35 ? 2013 HOH A O   1 
HETATM 1487 O O   . HOH H 4 .  ? 16.053 21.187  9.334  1.00 25.96 ? 2014 HOH A O   1 
HETATM 1488 O O   . HOH H 4 .  ? 21.170 29.031  7.985  1.00 42.25 ? 2015 HOH A O   1 
HETATM 1489 O O   . HOH H 4 .  ? 22.073 20.425  10.170 1.00 25.77 ? 2016 HOH A O   1 
HETATM 1490 O O   . HOH H 4 .  ? 16.642 15.318  5.056  1.00 33.61 ? 2017 HOH A O   1 
HETATM 1491 O O   . HOH H 4 .  ? 26.079 22.325  9.053  1.00 26.80 ? 2018 HOH A O   1 
HETATM 1492 O O   . HOH H 4 .  ? 21.481 12.504  9.748  1.00 15.91 ? 2019 HOH A O   1 
HETATM 1493 O O   . HOH H 4 .  ? 20.724 9.336   20.877 1.00 19.87 ? 2020 HOH A O   1 
HETATM 1494 O O   . HOH H 4 .  ? 12.490 8.369   24.084 1.00 23.79 ? 2021 HOH A O   1 
HETATM 1495 O O   . HOH H 4 .  ? 14.476 2.471   24.429 1.00 27.19 ? 2022 HOH A O   1 
HETATM 1496 O O   . HOH H 4 .  ? 7.901  3.938   22.205 1.00 12.65 ? 2023 HOH A O   1 
HETATM 1497 O O   . HOH H 4 .  ? 10.430 9.694   23.017 1.00 22.64 ? 2024 HOH A O   1 
HETATM 1498 O O   . HOH H 4 .  ? 2.634  0.955   27.654 1.00 28.42 ? 2025 HOH A O   1 
HETATM 1499 O O   . HOH H 4 .  ? 2.192  0.259   17.911 1.00 48.04 ? 2026 HOH A O   1 
HETATM 1500 O O   . HOH H 4 .  ? 10.605 -3.714  22.130 1.00 33.31 ? 2027 HOH A O   1 
HETATM 1501 O O   . HOH H 4 .  ? 12.589 -0.584  21.331 1.00 19.99 ? 2028 HOH A O   1 
HETATM 1502 O O   . HOH H 4 .  ? 2.974  -5.579  20.698 1.00 42.48 ? 2029 HOH A O   1 
HETATM 1503 O O   . HOH H 4 .  ? 8.876  0.394   16.135 1.00 13.29 ? 2030 HOH A O   1 
HETATM 1504 O O   . HOH H 4 .  ? 12.422 -4.558  20.283 1.00 21.15 ? 2031 HOH A O   1 
HETATM 1505 O O   . HOH H 4 .  ? 11.180 -0.459  19.058 1.00 13.51 ? 2032 HOH A O   1 
HETATM 1506 O O   . HOH H 4 .  ? 20.372 1.007   18.412 1.00 30.22 ? 2033 HOH A O   1 
HETATM 1507 O O   . HOH H 4 .  ? 20.898 1.716   12.063 1.00 28.73 ? 2034 HOH A O   1 
HETATM 1508 O O   . HOH H 4 .  ? 21.182 7.680   17.529 1.00 32.30 ? 2035 HOH A O   1 
HETATM 1509 O O   . HOH H 4 .  ? 19.824 1.271   14.467 1.00 18.42 ? 2036 HOH A O   1 
HETATM 1510 O O   . HOH H 4 .  ? 16.268 10.840  3.961  1.00 31.19 ? 2037 HOH A O   1 
HETATM 1511 O O   . HOH H 4 .  ? 15.397 10.943  6.152  1.00 20.46 ? 2038 HOH A O   1 
HETATM 1512 O O   . HOH H 4 .  ? 5.724  5.767   4.321  1.00 23.14 ? 2039 HOH A O   1 
HETATM 1513 O O   . HOH H 4 .  ? 8.216  6.622   0.402  1.00 49.50 ? 2040 HOH A O   1 
HETATM 1514 O O   . HOH H 4 .  ? -0.439 4.812   6.175  1.00 42.41 ? 2041 HOH A O   1 
HETATM 1515 O O   . HOH H 4 .  ? -0.136 12.094  6.557  1.00 37.44 ? 2042 HOH A O   1 
HETATM 1516 O O   . HOH H 4 .  ? 5.213  8.850   -2.107 1.00 33.48 ? 2043 HOH A O   1 
HETATM 1517 O O   . HOH H 4 .  ? 14.678 0.960   21.791 1.00 26.95 ? 2044 HOH A O   1 
HETATM 1518 O O   . HOH H 4 .  ? 11.565 22.097  2.730  1.00 29.72 ? 2045 HOH A O   1 
HETATM 1519 O O   . HOH H 4 .  ? 10.195 24.571  8.117  1.00 26.39 ? 2046 HOH A O   1 
HETATM 1520 O O   . HOH H 4 .  ? 13.234 23.061  11.057 1.00 20.48 ? 2047 HOH A O   1 
HETATM 1521 O O   . HOH H 4 .  ? 4.970  19.451  7.380  1.00 26.08 ? 2048 HOH A O   1 
HETATM 1522 O O   . HOH H 4 .  ? 14.015 23.417  2.734  1.00 37.86 ? 2049 HOH A O   1 
HETATM 1523 O O   . HOH H 4 .  ? 5.240  15.476  16.086 1.00 27.77 ? 2050 HOH A O   1 
HETATM 1524 O O   . HOH H 4 .  ? 12.871 23.288  13.893 1.00 32.47 ? 2051 HOH A O   1 
HETATM 1525 O O   . HOH H 4 .  ? 0.964  13.833  8.012  1.00 24.25 ? 2052 HOH A O   1 
HETATM 1526 O O   . HOH H 4 .  ? -3.151 15.812  14.538 1.00 32.68 ? 2053 HOH A O   1 
HETATM 1527 O O   . HOH H 4 .  ? -4.498 16.644  10.589 1.00 35.67 ? 2054 HOH A O   1 
HETATM 1528 O O   . HOH H 4 .  ? 2.445  18.701  7.573  1.00 34.97 ? 2055 HOH A O   1 
HETATM 1529 O O   . HOH H 4 .  ? 0.916  16.553  7.070  1.00 29.90 ? 2056 HOH A O   1 
HETATM 1530 O O   . HOH H 4 .  ? -3.984 10.974  14.716 1.00 26.48 ? 2057 HOH A O   1 
HETATM 1531 O O   . HOH H 4 .  ? 17.219 0.433   1.435  1.00 31.78 ? 2058 HOH A O   1 
HETATM 1532 O O   . HOH H 4 .  ? 20.725 4.953   5.605  1.00 39.95 ? 2059 HOH A O   1 
HETATM 1533 O O   . HOH H 4 .  ? 20.186 2.957   9.594  1.00 22.79 ? 2060 HOH A O   1 
HETATM 1534 O O   . HOH H 4 .  ? 25.758 -6.101  7.040  1.00 41.81 ? 2061 HOH A O   1 
HETATM 1535 O O   . HOH H 4 .  ? 21.701 -0.703  10.978 1.00 21.92 ? 2062 HOH A O   1 
HETATM 1536 O O   . HOH H 4 .  ? 20.463 -3.228  12.394 1.00 30.16 ? 2063 HOH A O   1 
HETATM 1537 O O   . HOH H 4 .  ? 21.185 -7.158  10.788 1.00 22.89 ? 2064 HOH A O   1 
HETATM 1538 O O   . HOH H 4 .  ? 23.040 -9.802  7.990  1.00 55.67 ? 2065 HOH A O   1 
HETATM 1539 O O   . HOH H 4 .  ? 20.305 -11.165 5.529  1.00 26.63 ? 2066 HOH A O   1 
HETATM 1540 O O   . HOH H 4 .  ? 18.810 -14.353 2.756  1.00 29.96 ? 2067 HOH A O   1 
HETATM 1541 O O   . HOH H 4 .  ? 16.559 -9.065  2.261  1.00 35.11 ? 2068 HOH A O   1 
HETATM 1542 O O   . HOH H 4 .  ? 18.563 -11.067 2.458  1.00 42.14 ? 2069 HOH A O   1 
HETATM 1543 O O   . HOH H 4 .  ? 17.979 -19.242 3.209  1.00 34.40 ? 2070 HOH A O   1 
HETATM 1544 O O   . HOH H 4 .  ? 17.238 -16.388 2.100  1.00 21.34 ? 2071 HOH A O   1 
HETATM 1545 O O   . HOH H 4 .  ? 16.964 -21.196 5.828  1.00 37.88 ? 2072 HOH A O   1 
HETATM 1546 O O   . HOH H 4 .  ? 13.420 -23.800 7.506  1.00 25.45 ? 2073 HOH A O   1 
HETATM 1547 O O   . HOH I 4 .  ? 21.032 25.897  23.159 1.00 39.38 ? 2001 HOH B O   1 
HETATM 1548 O O   . HOH I 4 .  ? 23.942 25.090  22.144 1.00 20.28 ? 2002 HOH B O   1 
HETATM 1549 O O   . HOH I 4 .  ? 24.476 13.259  23.341 1.00 16.63 ? 2003 HOH B O   1 
HETATM 1550 O O   . HOH I 4 .  ? 30.858 15.897  24.348 1.00 8.03  ? 2004 HOH B O   1 
HETATM 1551 O O   . HOH I 4 .  ? 23.380 8.433   14.657 1.00 21.95 ? 2005 HOH B O   1 
HETATM 1552 O O   . HOH I 4 .  ? 26.023 4.747   16.015 1.00 31.80 ? 2006 HOH B O   1 
HETATM 1553 O O   . HOH I 4 .  ? 25.694 3.435   21.109 1.00 50.04 ? 2007 HOH B O   1 
HETATM 1554 O O   . HOH I 4 .  ? 30.319 5.694   22.049 1.00 43.08 ? 2008 HOH B O   1 
HETATM 1555 O O   . HOH I 4 .  ? 23.860 9.769   19.210 1.00 12.62 ? 2009 HOH B O   1 
HETATM 1556 O O   . HOH I 4 .  ? 25.557 5.841   12.314 1.00 27.63 ? 2010 HOH B O   1 
HETATM 1557 O O   . HOH I 4 .  ? 33.171 -2.771  8.181  1.00 44.59 ? 2011 HOH B O   1 
HETATM 1558 O O   . HOH I 4 .  ? 36.597 24.170  7.694  1.00 37.62 ? 2012 HOH B O   1 
HETATM 1559 O O   . HOH I 4 .  ? 40.089 23.612  13.884 1.00 29.55 ? 2013 HOH B O   1 
HETATM 1560 O O   . HOH I 4 .  ? 47.737 22.500  14.829 1.00 41.68 ? 2014 HOH B O   1 
HETATM 1561 O O   . HOH I 4 .  ? 48.634 19.591  14.845 1.00 23.09 ? 2015 HOH B O   1 
HETATM 1562 O O   . HOH I 4 .  ? 41.662 21.829  30.662 1.00 44.60 ? 2016 HOH B O   1 
HETATM 1563 O O   . HOH I 4 .  ? 45.370 30.831  22.086 1.00 23.65 ? 2017 HOH B O   1 
HETATM 1564 O O   . HOH I 4 .  ? 43.337 28.547  23.686 1.00 48.38 ? 2018 HOH B O   1 
HETATM 1565 O O   . HOH I 4 .  ? 46.311 20.487  23.220 1.00 34.91 ? 2019 HOH B O   1 
HETATM 1566 O O   . HOH I 4 .  ? 41.305 23.282  20.755 1.00 36.59 ? 2020 HOH B O   1 
HETATM 1567 O O   . HOH I 4 .  ? 43.096 19.664  19.264 1.00 23.13 ? 2021 HOH B O   1 
HETATM 1568 O O   . HOH I 4 .  ? 48.659 29.651  16.204 1.00 33.38 ? 2022 HOH B O   1 
HETATM 1569 O O   . HOH I 4 .  ? 38.154 18.092  18.077 1.00 23.14 ? 2023 HOH B O   1 
HETATM 1570 O O   . HOH I 4 .  ? 31.715 18.225  1.150  1.00 19.75 ? 2024 HOH B O   1 
HETATM 1571 O O   . HOH I 4 .  ? 29.728 16.427  0.034  1.00 28.10 ? 2025 HOH B O   1 
HETATM 1572 O O   . HOH I 4 .  ? 32.148 9.905   2.108  1.00 14.35 ? 2026 HOH B O   1 
HETATM 1573 O O   . HOH I 4 .  ? 29.191 4.058   6.009  1.00 30.61 ? 2027 HOH B O   1 
HETATM 1574 O O   . HOH I 4 .  ? 24.446 11.880  2.083  1.00 27.15 ? 2028 HOH B O   1 
HETATM 1575 O O   . HOH I 4 .  ? 27.040 14.155  3.049  1.00 24.94 ? 2029 HOH B O   1 
HETATM 1576 O O   . HOH I 4 .  ? 25.803 8.647   -1.066 1.00 34.13 ? 2030 HOH B O   1 
HETATM 1577 O O   . HOH I 4 .  ? 21.787 7.639   5.787  1.00 38.04 ? 2031 HOH B O   1 
HETATM 1578 O O   . HOH I 4 .  ? 28.336 10.377  8.025  1.00 11.90 ? 2032 HOH B O   1 
HETATM 1579 O O   . HOH I 4 .  ? 21.063 7.740   8.489  1.00 32.02 ? 2033 HOH B O   1 
HETATM 1580 O O   . HOH I 4 .  ? 22.083 9.913   8.652  1.00 25.38 ? 2034 HOH B O   1 
HETATM 1581 O O   . HOH I 4 .  ? 23.589 13.605  4.006  1.00 19.15 ? 2035 HOH B O   1 
HETATM 1582 O O   . HOH I 4 .  ? 27.562 12.785  5.157  1.00 11.38 ? 2036 HOH B O   1 
HETATM 1583 O O   . HOH I 4 .  ? 28.938 22.775  12.714 1.00 33.09 ? 2037 HOH B O   1 
HETATM 1584 O O   . HOH I 4 .  ? 34.390 23.441  7.313  1.00 38.79 ? 2038 HOH B O   1 
HETATM 1585 O O   . HOH I 4 .  ? 33.372 23.795  13.806 1.00 35.61 ? 2039 HOH B O   1 
HETATM 1586 O O   . HOH I 4 .  ? 23.799 3.571   15.429 1.00 34.11 ? 2040 HOH B O   1 
HETATM 1587 O O   . HOH I 4 .  ? 33.059 6.634   23.666 1.00 34.07 ? 2041 HOH B O   1 
HETATM 1588 O O   . HOH I 4 .  ? 28.610 21.431  10.477 1.00 18.61 ? 2042 HOH B O   1 
HETATM 1589 O O   . HOH I 4 .  ? 36.806 24.761  21.572 1.00 37.46 ? 2043 HOH B O   1 
HETATM 1590 O O   . HOH I 4 .  ? 34.992 23.215  15.907 1.00 29.98 ? 2044 HOH B O   1 
HETATM 1591 O O   . HOH I 4 .  ? 38.133 14.996  22.269 1.00 19.77 ? 2045 HOH B O   1 
HETATM 1592 O O   . HOH I 4 .  ? 36.589 1.269   22.759 1.00 51.52 ? 2046 HOH B O   1 
HETATM 1593 O O   . HOH I 4 .  ? 39.903 4.714   24.892 1.00 15.39 ? 2047 HOH B O   1 
HETATM 1594 O O   . HOH I 4 .  ? 36.763 6.517   25.553 1.00 21.39 ? 2048 HOH B O   1 
HETATM 1595 O O   . HOH I 4 .  ? 35.086 8.482   23.753 1.00 28.51 ? 2049 HOH B O   1 
HETATM 1596 O O   . HOH I 4 .  ? 43.802 9.727   21.965 1.00 31.15 ? 2050 HOH B O   1 
HETATM 1597 O O   . HOH I 4 .  ? 28.456 17.065  2.611  1.00 30.88 ? 2051 HOH B O   1 
HETATM 1598 O O   . HOH I 4 .  ? 43.620 17.273  19.026 1.00 33.59 ? 2052 HOH B O   1 
HETATM 1599 O O   . HOH I 4 .  ? 44.611 11.963  23.375 1.00 25.17 ? 2053 HOH B O   1 
HETATM 1600 O O   . HOH I 4 .  ? 50.992 16.941  12.875 1.00 22.71 ? 2054 HOH B O   1 
HETATM 1601 O O   . HOH I 4 .  ? 51.272 11.691  22.407 1.00 32.36 ? 2055 HOH B O   1 
HETATM 1602 O O   . HOH I 4 .  ? 51.919 14.996  20.853 1.00 44.85 ? 2056 HOH B O   1 
HETATM 1603 O O   . HOH I 4 .  ? 52.674 9.661   19.234 1.00 21.56 ? 2057 HOH B O   1 
HETATM 1604 O O   . HOH I 4 .  ? 43.634 8.283   8.267  1.00 26.47 ? 2058 HOH B O   1 
HETATM 1605 O O   . HOH I 4 .  ? 52.387 13.949  23.295 1.00 37.40 ? 2059 HOH B O   1 
HETATM 1606 O O   . HOH I 4 .  ? 43.210 3.818   16.154 1.00 26.34 ? 2060 HOH B O   1 
HETATM 1607 O O   . HOH I 4 .  ? 35.251 17.550  24.342 1.00 20.77 ? 2061 HOH B O   1 
HETATM 1608 O O   . HOH I 4 .  ? 34.070 6.999   19.544 1.00 14.84 ? 2062 HOH B O   1 
HETATM 1609 O O   . HOH I 4 .  ? 30.267 21.822  15.003 1.00 18.82 ? 2063 HOH B O   1 
HETATM 1610 O O   . HOH I 4 .  ? 32.274 18.186  23.965 1.00 12.49 ? 2064 HOH B O   1 
HETATM 1611 O O   . HOH I 4 .  ? 34.151 20.524  21.969 1.00 23.19 ? 2065 HOH B O   1 
HETATM 1612 O O   . HOH I 4 .  ? 26.627 23.014  13.837 1.00 15.59 ? 2066 HOH B O   1 
HETATM 1613 O O   . HOH I 4 .  ? 24.047 21.801  12.154 1.00 27.19 ? 2067 HOH B O   1 
HETATM 1614 O O   . HOH I 4 .  ? 20.255 21.950  13.461 1.00 23.61 ? 2068 HOH B O   1 
HETATM 1615 O O   . HOH I 4 .  ? 17.697 23.164  17.449 1.00 44.18 ? 2069 HOH B O   1 
HETATM 1616 O O   . HOH I 4 .  ? 16.421 20.868  18.988 1.00 24.86 ? 2070 HOH B O   1 
HETATM 1617 O O   . HOH I 4 .  ? 19.588 17.804  21.316 1.00 19.86 ? 2071 HOH B O   1 
HETATM 1618 O O   . HOH I 4 .  ? 12.911 19.751  21.030 1.00 34.94 ? 2072 HOH B O   1 
HETATM 1619 O O   . HOH I 4 .  ? 19.230 15.139  23.698 1.00 19.39 ? 2073 HOH B O   1 
HETATM 1620 O O   . HOH I 4 .  ? 6.223  16.562  18.473 1.00 33.21 ? 2074 HOH B O   1 
HETATM 1621 O O   . HOH I 4 .  ? 10.667 17.473  21.996 1.00 17.33 ? 2075 HOH B O   1 
HETATM 1622 O O   . HOH I 4 .  ? 3.877  13.012  16.878 1.00 24.61 ? 2076 HOH B O   1 
HETATM 1623 O O   . HOH I 4 .  ? 8.042  10.748  22.213 1.00 21.03 ? 2077 HOH B O   1 
HETATM 1624 O O   . HOH I 4 .  ? 38.893 10.867  2.047  1.00 27.13 ? 2078 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  -1  -1  SER SER A . n 
A 1 2  MET 2  0   0   MET MET A . n 
A 1 3  ARG 3  149 149 ARG ARG A . n 
A 1 4  THR 4  150 150 THR THR A . n 
A 1 5  VAL 5  151 151 VAL VAL A . n 
A 1 6  GLU 6  152 152 GLU GLU A . n 
A 1 7  VAL 7  153 153 VAL VAL A . n 
A 1 8  THR 8  154 154 THR THR A . n 
A 1 9  LEU 9  155 155 LEU LEU A . n 
A 1 10 HIS 10 156 156 HIS HIS A . n 
A 1 11 LYS 11 157 157 LYS LYS A . n 
A 1 12 GLU 12 158 158 GLU GLU A . n 
A 1 13 GLY 13 159 159 GLY GLY A . n 
A 1 14 ASN 14 160 160 ASN ASN A . n 
A 1 15 THR 15 161 161 THR THR A . n 
A 1 16 PHE 16 162 162 PHE PHE A . n 
A 1 17 GLY 17 163 163 GLY GLY A . n 
A 1 18 PHE 18 164 164 PHE PHE A . n 
A 1 19 VAL 19 165 165 VAL VAL A . n 
A 1 20 ILE 20 166 166 ILE ILE A . n 
A 1 21 ARG 21 167 167 ARG ARG A . n 
A 1 22 GLY 22 168 168 GLY GLY A . n 
A 1 23 GLY 23 169 169 GLY GLY A . n 
A 1 24 ALA 24 170 170 ALA ALA A . n 
A 1 25 HIS 25 171 171 HIS HIS A . n 
A 1 26 ASP 26 172 172 ASP ASP A . n 
A 1 27 ASP 27 173 173 ASP ASP A . n 
A 1 28 ARG 28 174 174 ARG ARG A . n 
A 1 29 ASN 29 175 ?   ?   ?   A . n 
A 1 30 LYS 30 176 ?   ?   ?   A . n 
A 1 31 SER 31 177 177 SER SER A . n 
A 1 32 ARG 32 178 178 ARG ARG A . n 
A 1 33 PRO 33 179 179 PRO PRO A . n 
A 1 34 VAL 34 180 180 VAL VAL A . n 
A 1 35 VAL 35 181 181 VAL VAL A . n 
A 1 36 ILE 36 182 182 ILE ILE A . n 
A 1 37 THR 37 183 183 THR THR A . n 
A 1 38 SER 38 184 184 SER SER A . n 
A 1 39 VAL 39 185 185 VAL VAL A . n 
A 1 40 ARG 40 186 186 ARG ARG A . n 
A 1 41 PRO 41 187 187 PRO PRO A . n 
A 1 42 GLY 42 188 188 GLY GLY A . n 
A 1 43 GLY 43 189 189 GLY GLY A . n 
A 1 44 PRO 44 190 190 PRO PRO A . n 
A 1 45 ALA 45 191 191 ALA ALA A . n 
A 1 46 ASP 46 192 192 ASP ASP A . n 
A 1 47 ARG 47 193 193 ARG ARG A . n 
A 1 48 GLU 48 194 194 GLU GLU A . n 
A 1 49 GLY 49 195 195 GLY GLY A . n 
A 1 50 THR 50 196 196 THR THR A . n 
A 1 51 ILE 51 197 197 ILE ILE A . n 
A 1 52 LYS 52 198 198 LYS LYS A . n 
A 1 53 PRO 53 199 199 PRO PRO A . n 
A 1 54 GLY 54 200 200 GLY GLY A . n 
A 1 55 ASP 55 201 201 ASP ASP A . n 
A 1 56 ARG 56 202 202 ARG ARG A . n 
A 1 57 LEU 57 203 203 LEU LEU A . n 
A 1 58 LEU 58 204 204 LEU LEU A . n 
A 1 59 SER 59 205 205 SER SER A . n 
A 1 60 VAL 60 206 206 VAL VAL A . n 
A 1 61 ASP 61 207 207 ASP ASP A . n 
A 1 62 GLY 62 208 208 GLY GLY A . n 
A 1 63 ILE 63 209 209 ILE ILE A . n 
A 1 64 ARG 64 210 210 ARG ARG A . n 
A 1 65 LEU 65 211 211 LEU LEU A . n 
A 1 66 LEU 66 212 212 LEU LEU A . n 
A 1 67 GLY 67 213 213 GLY GLY A . n 
A 1 68 THR 68 214 214 THR THR A . n 
A 1 69 THR 69 215 215 THR THR A . n 
A 1 70 HIS 70 216 216 HIS HIS A . n 
A 1 71 ALA 71 217 217 ALA ALA A . n 
A 1 72 GLU 72 218 218 GLU GLU A . n 
A 1 73 ALA 73 219 219 ALA ALA A . n 
A 1 74 MET 74 220 220 MET MET A . n 
A 1 75 SER 75 221 221 SER SER A . n 
A 1 76 ILE 76 222 222 ILE ILE A . n 
A 1 77 LEU 77 223 223 LEU LEU A . n 
A 1 78 LYS 78 224 224 LYS LYS A . n 
A 1 79 GLN 79 225 225 GLN GLN A . n 
A 1 80 CYS 80 226 226 CYS CYS A . n 
A 1 81 GLY 81 227 227 GLY GLY A . n 
A 1 82 GLN 82 228 228 GLN GLN A . n 
A 1 83 GLU 83 229 229 GLU GLU A . n 
A 1 84 ALA 84 230 230 ALA ALA A . n 
A 1 85 ALA 85 231 231 ALA ALA A . n 
A 1 86 LEU 86 232 232 LEU LEU A . n 
A 1 87 LEU 87 233 233 LEU LEU A . n 
A 1 88 ILE 88 234 234 ILE ILE A . n 
A 1 89 GLU 89 235 235 GLU GLU A . n 
A 1 90 TYR 90 236 236 TYR TYR A . n 
A 1 91 ASP 91 237 237 ASP ASP A . n 
A 1 92 VAL 92 238 238 VAL VAL A . n 
A 1 93 SER 93 239 239 SER SER A . n 
A 1 94 GLU 94 240 240 GLU GLU A . n 
A 1 95 THR 95 241 241 THR THR A . n 
A 1 96 ALA 96 242 242 ALA ALA A . n 
A 1 97 VAL 97 243 243 VAL VAL A . n 
B 1 1  SER 1  -1  -1  SER SER B . n 
B 1 2  MET 2  0   0   MET MET B . n 
B 1 3  ARG 3  149 149 ARG ARG B . n 
B 1 4  THR 4  150 150 THR THR B . n 
B 1 5  VAL 5  151 151 VAL VAL B . n 
B 1 6  GLU 6  152 152 GLU GLU B . n 
B 1 7  VAL 7  153 153 VAL VAL B . n 
B 1 8  THR 8  154 154 THR THR B . n 
B 1 9  LEU 9  155 155 LEU LEU B . n 
B 1 10 HIS 10 156 156 HIS HIS B . n 
B 1 11 LYS 11 157 157 LYS LYS B . n 
B 1 12 GLU 12 158 158 GLU GLU B . n 
B 1 13 GLY 13 159 159 GLY GLY B . n 
B 1 14 ASN 14 160 160 ASN ASN B . n 
B 1 15 THR 15 161 161 THR THR B . n 
B 1 16 PHE 16 162 162 PHE PHE B . n 
B 1 17 GLY 17 163 163 GLY GLY B . n 
B 1 18 PHE 18 164 164 PHE PHE B . n 
B 1 19 VAL 19 165 165 VAL VAL B . n 
B 1 20 ILE 20 166 166 ILE ILE B . n 
B 1 21 ARG 21 167 167 ARG ARG B . n 
B 1 22 GLY 22 168 168 GLY GLY B . n 
B 1 23 GLY 23 169 169 GLY GLY B . n 
B 1 24 ALA 24 170 170 ALA ALA B . n 
B 1 25 HIS 25 171 171 HIS HIS B . n 
B 1 26 ASP 26 172 172 ASP ASP B . n 
B 1 27 ASP 27 173 173 ASP ASP B . n 
B 1 28 ARG 28 174 174 ARG ARG B . n 
B 1 29 ASN 29 175 175 ASN ASN B . n 
B 1 30 LYS 30 176 176 LYS LYS B . n 
B 1 31 SER 31 177 177 SER SER B . n 
B 1 32 ARG 32 178 178 ARG ARG B . n 
B 1 33 PRO 33 179 179 PRO PRO B . n 
B 1 34 VAL 34 180 180 VAL VAL B . n 
B 1 35 VAL 35 181 181 VAL VAL B . n 
B 1 36 ILE 36 182 182 ILE ILE B . n 
B 1 37 THR 37 183 183 THR THR B . n 
B 1 38 SER 38 184 184 SER SER B . n 
B 1 39 VAL 39 185 185 VAL VAL B . n 
B 1 40 ARG 40 186 186 ARG ARG B . n 
B 1 41 PRO 41 187 187 PRO PRO B . n 
B 1 42 GLY 42 188 188 GLY GLY B . n 
B 1 43 GLY 43 189 189 GLY GLY B . n 
B 1 44 PRO 44 190 190 PRO PRO B . n 
B 1 45 ALA 45 191 191 ALA ALA B . n 
B 1 46 ASP 46 192 192 ASP ASP B . n 
B 1 47 ARG 47 193 193 ARG ARG B . n 
B 1 48 GLU 48 194 194 GLU GLU B . n 
B 1 49 GLY 49 195 195 GLY GLY B . n 
B 1 50 THR 50 196 196 THR THR B . n 
B 1 51 ILE 51 197 197 ILE ILE B . n 
B 1 52 LYS 52 198 198 LYS LYS B . n 
B 1 53 PRO 53 199 199 PRO PRO B . n 
B 1 54 GLY 54 200 200 GLY GLY B . n 
B 1 55 ASP 55 201 201 ASP ASP B . n 
B 1 56 ARG 56 202 202 ARG ARG B . n 
B 1 57 LEU 57 203 203 LEU LEU B . n 
B 1 58 LEU 58 204 204 LEU LEU B . n 
B 1 59 SER 59 205 205 SER SER B . n 
B 1 60 VAL 60 206 206 VAL VAL B . n 
B 1 61 ASP 61 207 207 ASP ASP B . n 
B 1 62 GLY 62 208 208 GLY GLY B . n 
B 1 63 ILE 63 209 209 ILE ILE B . n 
B 1 64 ARG 64 210 210 ARG ARG B . n 
B 1 65 LEU 65 211 211 LEU LEU B . n 
B 1 66 LEU 66 212 212 LEU LEU B . n 
B 1 67 GLY 67 213 213 GLY GLY B . n 
B 1 68 THR 68 214 214 THR THR B . n 
B 1 69 THR 69 215 215 THR THR B . n 
B 1 70 HIS 70 216 216 HIS HIS B . n 
B 1 71 ALA 71 217 217 ALA ALA B . n 
B 1 72 GLU 72 218 218 GLU GLU B . n 
B 1 73 ALA 73 219 219 ALA ALA B . n 
B 1 74 MET 74 220 220 MET MET B . n 
B 1 75 SER 75 221 221 SER SER B . n 
B 1 76 ILE 76 222 222 ILE ILE B . n 
B 1 77 LEU 77 223 223 LEU LEU B . n 
B 1 78 LYS 78 224 224 LYS LYS B . n 
B 1 79 GLN 79 225 225 GLN GLN B . n 
B 1 80 CYS 80 226 226 CYS CYS B . n 
B 1 81 GLY 81 227 227 GLY GLY B . n 
B 1 82 GLN 82 228 228 GLN GLN B . n 
B 1 83 GLU 83 229 229 GLU GLU B . n 
B 1 84 ALA 84 230 230 ALA ALA B . n 
B 1 85 ALA 85 231 231 ALA ALA B . n 
B 1 86 LEU 86 232 232 LEU LEU B . n 
B 1 87 LEU 87 233 233 LEU LEU B . n 
B 1 88 ILE 88 234 234 ILE ILE B . n 
B 1 89 GLU 89 235 235 GLU GLU B . n 
B 1 90 TYR 90 236 236 TYR TYR B . n 
B 1 91 ASP 91 237 237 ASP ASP B . n 
B 1 92 VAL 92 238 238 VAL VAL B . n 
B 1 93 SER 93 239 239 SER SER B . n 
B 1 94 GLU 94 240 240 GLU GLU B . n 
B 1 95 THR 95 241 241 THR THR B . n 
B 1 96 ALA 96 242 242 ALA ALA B . n 
B 1 97 VAL 97 243 243 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SCN 1  1244 1244 SCN SCN A . 
D 2 SCN 1  1245 1245 SCN SCN A . 
E 3 EDO 1  1246 1246 EDO EDO A . 
F 3 EDO 1  1244 1244 EDO EDO B . 
G 3 EDO 1  1245 1245 EDO EDO B . 
H 4 HOH 1  2001 2001 HOH HOH A . 
H 4 HOH 2  2002 2002 HOH HOH A . 
H 4 HOH 3  2003 2003 HOH HOH A . 
H 4 HOH 4  2004 2004 HOH HOH A . 
H 4 HOH 5  2005 2005 HOH HOH A . 
H 4 HOH 6  2006 2006 HOH HOH A . 
H 4 HOH 7  2007 2007 HOH HOH A . 
H 4 HOH 8  2008 2008 HOH HOH A . 
H 4 HOH 9  2009 2009 HOH HOH A . 
H 4 HOH 10 2010 2010 HOH HOH A . 
H 4 HOH 11 2011 2011 HOH HOH A . 
H 4 HOH 12 2012 2012 HOH HOH A . 
H 4 HOH 13 2013 2013 HOH HOH A . 
H 4 HOH 14 2014 2014 HOH HOH A . 
H 4 HOH 15 2015 2015 HOH HOH A . 
H 4 HOH 16 2016 2016 HOH HOH A . 
H 4 HOH 17 2017 2017 HOH HOH A . 
H 4 HOH 18 2018 2018 HOH HOH A . 
H 4 HOH 19 2019 2019 HOH HOH A . 
H 4 HOH 20 2020 2020 HOH HOH A . 
H 4 HOH 21 2021 2021 HOH HOH A . 
H 4 HOH 22 2022 2022 HOH HOH A . 
H 4 HOH 23 2023 2023 HOH HOH A . 
H 4 HOH 24 2024 2024 HOH HOH A . 
H 4 HOH 25 2025 2025 HOH HOH A . 
H 4 HOH 26 2026 2026 HOH HOH A . 
H 4 HOH 27 2027 2027 HOH HOH A . 
H 4 HOH 28 2028 2028 HOH HOH A . 
H 4 HOH 29 2029 2029 HOH HOH A . 
H 4 HOH 30 2030 2030 HOH HOH A . 
H 4 HOH 31 2031 2031 HOH HOH A . 
H 4 HOH 32 2032 2032 HOH HOH A . 
H 4 HOH 33 2033 2033 HOH HOH A . 
H 4 HOH 34 2034 2034 HOH HOH A . 
H 4 HOH 35 2035 2035 HOH HOH A . 
H 4 HOH 36 2036 2036 HOH HOH A . 
H 4 HOH 37 2037 2037 HOH HOH A . 
H 4 HOH 38 2038 2038 HOH HOH A . 
H 4 HOH 39 2039 2039 HOH HOH A . 
H 4 HOH 40 2040 2040 HOH HOH A . 
H 4 HOH 41 2041 2041 HOH HOH A . 
H 4 HOH 42 2042 2042 HOH HOH A . 
H 4 HOH 43 2043 2043 HOH HOH A . 
H 4 HOH 44 2044 2044 HOH HOH A . 
H 4 HOH 45 2045 2045 HOH HOH A . 
H 4 HOH 46 2046 2046 HOH HOH A . 
H 4 HOH 47 2047 2047 HOH HOH A . 
H 4 HOH 48 2048 2048 HOH HOH A . 
H 4 HOH 49 2049 2049 HOH HOH A . 
H 4 HOH 50 2050 2050 HOH HOH A . 
H 4 HOH 51 2051 2051 HOH HOH A . 
H 4 HOH 52 2052 2052 HOH HOH A . 
H 4 HOH 53 2053 2053 HOH HOH A . 
H 4 HOH 54 2054 2054 HOH HOH A . 
H 4 HOH 55 2055 2055 HOH HOH A . 
H 4 HOH 56 2056 2056 HOH HOH A . 
H 4 HOH 57 2057 2057 HOH HOH A . 
H 4 HOH 58 2058 2058 HOH HOH A . 
H 4 HOH 59 2059 2059 HOH HOH A . 
H 4 HOH 60 2060 2060 HOH HOH A . 
H 4 HOH 61 2061 2061 HOH HOH A . 
H 4 HOH 62 2062 2062 HOH HOH A . 
H 4 HOH 63 2063 2063 HOH HOH A . 
H 4 HOH 64 2064 2064 HOH HOH A . 
H 4 HOH 65 2065 2065 HOH HOH A . 
H 4 HOH 66 2066 2066 HOH HOH A . 
H 4 HOH 67 2067 2067 HOH HOH A . 
H 4 HOH 68 2068 2068 HOH HOH A . 
H 4 HOH 69 2069 2069 HOH HOH A . 
H 4 HOH 70 2070 2070 HOH HOH A . 
H 4 HOH 71 2071 2071 HOH HOH A . 
H 4 HOH 72 2072 2072 HOH HOH A . 
H 4 HOH 73 2073 2073 HOH HOH A . 
I 4 HOH 1  2001 2001 HOH HOH B . 
I 4 HOH 2  2002 2002 HOH HOH B . 
I 4 HOH 3  2003 2003 HOH HOH B . 
I 4 HOH 4  2004 2004 HOH HOH B . 
I 4 HOH 5  2005 2005 HOH HOH B . 
I 4 HOH 6  2006 2006 HOH HOH B . 
I 4 HOH 7  2007 2007 HOH HOH B . 
I 4 HOH 8  2008 2008 HOH HOH B . 
I 4 HOH 9  2009 2009 HOH HOH B . 
I 4 HOH 10 2010 2010 HOH HOH B . 
I 4 HOH 11 2011 2011 HOH HOH B . 
I 4 HOH 12 2012 2012 HOH HOH B . 
I 4 HOH 13 2013 2013 HOH HOH B . 
I 4 HOH 14 2014 2014 HOH HOH B . 
I 4 HOH 15 2015 2015 HOH HOH B . 
I 4 HOH 16 2016 2016 HOH HOH B . 
I 4 HOH 17 2017 2017 HOH HOH B . 
I 4 HOH 18 2018 2018 HOH HOH B . 
I 4 HOH 19 2019 2019 HOH HOH B . 
I 4 HOH 20 2020 2020 HOH HOH B . 
I 4 HOH 21 2021 2021 HOH HOH B . 
I 4 HOH 22 2022 2022 HOH HOH B . 
I 4 HOH 23 2023 2023 HOH HOH B . 
I 4 HOH 24 2024 2024 HOH HOH B . 
I 4 HOH 25 2025 2025 HOH HOH B . 
I 4 HOH 26 2026 2026 HOH HOH B . 
I 4 HOH 27 2027 2027 HOH HOH B . 
I 4 HOH 28 2028 2028 HOH HOH B . 
I 4 HOH 29 2029 2029 HOH HOH B . 
I 4 HOH 30 2030 2030 HOH HOH B . 
I 4 HOH 31 2031 2031 HOH HOH B . 
I 4 HOH 32 2032 2032 HOH HOH B . 
I 4 HOH 33 2033 2033 HOH HOH B . 
I 4 HOH 34 2034 2034 HOH HOH B . 
I 4 HOH 35 2035 2035 HOH HOH B . 
I 4 HOH 36 2036 2036 HOH HOH B . 
I 4 HOH 37 2037 2037 HOH HOH B . 
I 4 HOH 38 2038 2038 HOH HOH B . 
I 4 HOH 39 2039 2039 HOH HOH B . 
I 4 HOH 40 2040 2040 HOH HOH B . 
I 4 HOH 41 2041 2041 HOH HOH B . 
I 4 HOH 42 2042 2042 HOH HOH B . 
I 4 HOH 43 2043 2043 HOH HOH B . 
I 4 HOH 44 2044 2044 HOH HOH B . 
I 4 HOH 45 2045 2045 HOH HOH B . 
I 4 HOH 46 2046 2046 HOH HOH B . 
I 4 HOH 47 2047 2047 HOH HOH B . 
I 4 HOH 48 2048 2048 HOH HOH B . 
I 4 HOH 49 2049 2049 HOH HOH B . 
I 4 HOH 50 2050 2050 HOH HOH B . 
I 4 HOH 51 2051 2051 HOH HOH B . 
I 4 HOH 52 2052 2052 HOH HOH B . 
I 4 HOH 53 2053 2053 HOH HOH B . 
I 4 HOH 54 2054 2054 HOH HOH B . 
I 4 HOH 55 2055 2055 HOH HOH B . 
I 4 HOH 56 2056 2056 HOH HOH B . 
I 4 HOH 57 2057 2057 HOH HOH B . 
I 4 HOH 58 2058 2058 HOH HOH B . 
I 4 HOH 59 2059 2059 HOH HOH B . 
I 4 HOH 60 2060 2060 HOH HOH B . 
I 4 HOH 61 2061 2061 HOH HOH B . 
I 4 HOH 62 2062 2062 HOH HOH B . 
I 4 HOH 63 2063 2063 HOH HOH B . 
I 4 HOH 64 2064 2064 HOH HOH B . 
I 4 HOH 65 2065 2065 HOH HOH B . 
I 4 HOH 66 2066 2066 HOH HOH B . 
I 4 HOH 67 2067 2067 HOH HOH B . 
I 4 HOH 68 2068 2068 HOH HOH B . 
I 4 HOH 69 2069 2069 HOH HOH B . 
I 4 HOH 70 2070 2070 HOH HOH B . 
I 4 HOH 71 2071 2071 HOH HOH B . 
I 4 HOH 72 2072 2072 HOH HOH B . 
I 4 HOH 73 2073 2073 HOH HOH B . 
I 4 HOH 74 2074 2074 HOH HOH B . 
I 4 HOH 75 2075 2075 HOH HOH B . 
I 4 HOH 76 2076 2076 HOH HOH B . 
I 4 HOH 77 2077 2077 HOH HOH B . 
I 4 HOH 78 2078 2078 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,H 
2 1 B,F,G,I   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-07-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation_author.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 10.8215 6.9709  11.5215 -0.1571 -0.0509 -0.0958 -0.0130 -0.0049 -0.0494 0.8740 3.9928 2.6101 
0.0166 0.3868  0.7546  0.0200  0.2144 -0.0857 -0.1810 -0.2518 0.2378  -0.1133 -0.3423 0.2318 
'X-RAY DIFFRACTION' 2 ? refined 35.2416 13.1015 13.0577 -0.0514 -0.1381 -0.1490 -0.0051 0.0106  -0.0149 4.3902 0.9962 1.9275 
0.3029 -0.5280 -0.2298 -0.1171 0.0613 -0.1948 -0.0728 0.1167  -0.1363 0.2859  0.1776  0.0004 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A -1 ? ? A 243 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B -1 ? ? B 243 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.3.0037 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2JIL 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, CYS 184 TO SER
ENGINEERED RESIDUE IN CHAIN B, CYS 184 TO SER
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 211 ? ? -96.37 36.23 
2 1 ASN B 160 ? ? 58.45  13.26 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 172 ? CG  ? A ASP 26 CG  
2  1 Y 1 A ASP 172 ? OD1 ? A ASP 26 OD1 
3  1 Y 1 A ASP 172 ? OD2 ? A ASP 26 OD2 
4  1 Y 1 A ARG 174 ? CG  ? A ARG 28 CG  
5  1 Y 1 A ARG 174 ? CD  ? A ARG 28 CD  
6  1 Y 1 A ARG 174 ? NE  ? A ARG 28 NE  
7  1 Y 1 A ARG 174 ? CZ  ? A ARG 28 CZ  
8  1 Y 1 A ARG 174 ? NH1 ? A ARG 28 NH1 
9  1 Y 1 A ARG 174 ? NH2 ? A ARG 28 NH2 
10 1 Y 1 A LYS 224 ? CD  ? A LYS 78 CD  
11 1 Y 1 A LYS 224 ? CE  ? A LYS 78 CE  
12 1 Y 1 A LYS 224 ? NZ  ? A LYS 78 NZ  
13 1 Y 1 A GLN 228 ? CG  ? A GLN 82 CG  
14 1 Y 1 A GLN 228 ? CD  ? A GLN 82 CD  
15 1 Y 1 A GLN 228 ? OE1 ? A GLN 82 OE1 
16 1 Y 1 A GLN 228 ? NE2 ? A GLN 82 NE2 
17 1 Y 1 B GLU 158 ? OE1 ? B GLU 12 OE1 
18 1 Y 1 B GLU 158 ? OE2 ? B GLU 12 OE2 
19 1 Y 1 B ASP 172 ? CG  ? B ASP 26 CG  
20 1 Y 1 B ASP 172 ? OD1 ? B ASP 26 OD1 
21 1 Y 1 B ASP 172 ? OD2 ? B ASP 26 OD2 
22 1 Y 1 B ASN 175 ? OD1 ? B ASN 29 OD1 
23 1 Y 1 B ASN 175 ? ND2 ? B ASN 29 ND2 
24 1 Y 1 B LYS 176 ? CD  ? B LYS 30 CD  
25 1 Y 1 B LYS 176 ? CE  ? B LYS 30 CE  
26 1 Y 1 B LYS 176 ? NZ  ? B LYS 30 NZ  
27 1 Y 1 B LYS 224 ? CD  ? B LYS 78 CD  
28 1 Y 1 B LYS 224 ? CE  ? B LYS 78 CE  
29 1 Y 1 B LYS 224 ? NZ  ? B LYS 78 NZ  
30 1 Y 1 B GLN 225 ? CD  ? B GLN 79 CD  
31 1 Y 1 B GLN 225 ? OE1 ? B GLN 79 OE1 
32 1 Y 1 B GLN 225 ? NE2 ? B GLN 79 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 175 ? A ASN 29 
2 1 Y 1 A LYS 176 ? A LYS 30 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'THIOCYANATE ION' SCN 
3 1,2-ETHANEDIOL    EDO 
4 water             HOH 
#