data_2JM1
# 
_entry.id   2JM1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JM1         
RCSB  RCSB100001   
BMRB  15001        
WWPDB D_1000100001 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          15001 
_pdbx_database_related.details        'chemical shift assignments' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JM1 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-13 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, J.'    1 
'Neuhaus, D.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural consequences of disease-causing mutations in the ATRX-DNMT3-DNMT3L (ADD) domain of the chromatin-associated protein ATRX.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            104 
_citation.page_first                11939 
_citation.page_last                 11944 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17609377 
_citation.pdbx_database_id_DOI      10.1073/pnas.0704057104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Argentaro, A.'   1 
primary 'Yang, J.C.'      2 
primary 'Chapman, L.'     3 
primary 'Kowalczyk, M.S.' 4 
primary 'Gibbons, R.J.'   5 
primary 'Higgs, D.R.'     6 
primary 'Neuhaus, D.'     7 
primary 'Rhodes, D.'      8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcriptional regulator ATRX' 16217.552 1 3.6.1.- ? 'ADD domain, residues 159-296' ? 
2 non-polymer syn 'ZINC ION'                       65.409    3 ?       ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ATP-dependent helicase ATRX, X-linked helicase II, X-linked nuclear protein, XNP, Znf- HX' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFC
HNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFC
HNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   LYS n 
1 5   ARG n 
1 6   GLY n 
1 7   GLU n 
1 8   ASP n 
1 9   GLY n 
1 10  LEU n 
1 11  HIS n 
1 12  GLY n 
1 13  ILE n 
1 14  VAL n 
1 15  SER n 
1 16  CYS n 
1 17  THR n 
1 18  ALA n 
1 19  CYS n 
1 20  GLY n 
1 21  GLN n 
1 22  GLN n 
1 23  VAL n 
1 24  ASN n 
1 25  HIS n 
1 26  PHE n 
1 27  GLN n 
1 28  LYS n 
1 29  ASP n 
1 30  SER n 
1 31  ILE n 
1 32  TYR n 
1 33  ARG n 
1 34  HIS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  GLN n 
1 39  VAL n 
1 40  LEU n 
1 41  ILE n 
1 42  CYS n 
1 43  LYS n 
1 44  ASN n 
1 45  CYS n 
1 46  PHE n 
1 47  LYS n 
1 48  TYR n 
1 49  TYR n 
1 50  MET n 
1 51  SER n 
1 52  ASP n 
1 53  ASP n 
1 54  ILE n 
1 55  SER n 
1 56  ARG n 
1 57  ASP n 
1 58  SER n 
1 59  ASP n 
1 60  GLY n 
1 61  MET n 
1 62  ASP n 
1 63  GLU n 
1 64  GLN n 
1 65  CYS n 
1 66  ARG n 
1 67  TRP n 
1 68  CYS n 
1 69  ALA n 
1 70  GLU n 
1 71  GLY n 
1 72  GLY n 
1 73  ASN n 
1 74  LEU n 
1 75  ILE n 
1 76  CYS n 
1 77  CYS n 
1 78  ASP n 
1 79  PHE n 
1 80  CYS n 
1 81  HIS n 
1 82  ASN n 
1 83  ALA n 
1 84  PHE n 
1 85  CYS n 
1 86  LYS n 
1 87  LYS n 
1 88  CYS n 
1 89  ILE n 
1 90  LEU n 
1 91  ARG n 
1 92  ASN n 
1 93  LEU n 
1 94  GLY n 
1 95  ARG n 
1 96  LYS n 
1 97  GLU n 
1 98  LEU n 
1 99  SER n 
1 100 THR n 
1 101 ILE n 
1 102 MET n 
1 103 ASP n 
1 104 GLU n 
1 105 ASN n 
1 106 ASN n 
1 107 GLN n 
1 108 TRP n 
1 109 TYR n 
1 110 CYS n 
1 111 TYR n 
1 112 ILE n 
1 113 CYS n 
1 114 HIS n 
1 115 PRO n 
1 116 GLU n 
1 117 PRO n 
1 118 LEU n 
1 119 LEU n 
1 120 ASP n 
1 121 LEU n 
1 122 VAL n 
1 123 THR n 
1 124 ALA n 
1 125 CYS n 
1 126 ASN n 
1 127 SER n 
1 128 VAL n 
1 129 PHE n 
1 130 GLU n 
1 131 ASN n 
1 132 LEU n 
1 133 GLU n 
1 134 GLN n 
1 135 LEU n 
1 136 LEU n 
1 137 GLN n 
1 138 GLN n 
1 139 ASN n 
1 140 LYS n 
1 141 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ATRX, RAD54L, XH2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3 Rosetta pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET30a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATRX_HUMAN 
_struct_ref.pdbx_db_accession          P46100 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNA
FCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
;
_struct_ref.pdbx_align_begin           159 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JM1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 141 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P46100 
_struct_ref_seq.db_align_beg                  159 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  296 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       156 
_struct_ref_seq.pdbx_auth_seq_align_end       296 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JM1 GLY A 1 ? UNP P46100 ? ? 'CLONING ARTIFACT' 156 1 
1 2JM1 ALA A 2 ? UNP P46100 ? ? 'CLONING ARTIFACT' 157 2 
1 2JM1 MET A 3 ? UNP P46100 ? ? 'CLONING ARTIFACT' 158 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D NOESY'        
1 3  1 '3D 1H-15N NOESY' 
1 4  1 '3D HNHB'         
1 5  2 '2D 1H-15N HSQC'  
1 6  2 '2D 1H-13C HSQC'  
1 7  2 '3D HNCACB'       
1 8  2 '3D HN(COCA)CB'   
1 9  2 '3D HNCA'         
1 10 2 '3D HN(CO)CA'     
1 11 2 HNHAHB            
1 12 2 'HN(CO)HAHB'      
1 13 2 '3D HCCH-TOCSY'   
1 14 2 '3D HCCH-COSY'    
1 15 2 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.5 
_pdbx_nmr_exptl_sample_conditions.pH                  6.7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.7 mM [U-15N] ADD domain 156-296, 20 mM TRIS, 1 mM DTT, 100 uM zinc chloride, 0.5 M sodium chloride, 93% H2O, 7% D2O'         1 
'93% H2O/7% D2O' 
'0.35 mM [U-13C; U-15N] ADD domain 156-296, 20 mM TRIS, 1 mM DTT, 100 uM zinc chloride, 0.5 M sodium chloride, 93% H2O, 7% D2O' 2 
'93% H2O/7% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
500 Bruker DRX    2 'Bruker DRX'    
# 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.entry_id           2JM1 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             32 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JM1 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.27 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JM1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin' collection           xwinnmr 3.5 1 
'Bruker Biospin' processing           xwinnmr 3.5 2 
'T Goddard'      'data analysis'      SPARKY  ?   3 
'T Goddard'      'peak picking'       SPARKY  ?   4 
'AT Brunger'     'structure solution' X-PLOR  3.8 5 
'AT Brunger'     refinement           X-PLOR  3.8 6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JM1 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JM1 
_struct.title                     'Structures and chemical shift assignments for the ADD domain of the ATRX protein' 
_struct.pdbx_descriptor           'Transcriptional regulator ATRX (E.C.3.6.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JM1 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'ADD domain, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 42  ? ASP A 52  ? CYS A 197 ASP A 207 1 ? 11 
HELX_P HELX_P2 2 LYS A 86  ? GLY A 94  ? LYS A 241 GLY A 249 1 ? 9  
HELX_P HELX_P3 3 ARG A 95  ? MET A 102 ? ARG A 250 MET A 257 1 ? 8  
HELX_P HELX_P4 4 LEU A 118 ? GLN A 137 ? LEU A 273 GLN A 292 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 16  SG ? ? A ZN 1 A CYS 171 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc2  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 19  SG ? ? A ZN 1 A CYS 174 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc3  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 42  SG ? ? A ZN 1 A CYS 197 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc4  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 45  SG ? ? A ZN 1 A CYS 200 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc5  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 65  SG ? ? A ZN 2 A CYS 220 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc6  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 68  SG ? ? A ZN 2 A CYS 223 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc7  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 85  SG ? ? A ZN 2 A CYS 240 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc8  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 88  SG ? ? A ZN 2 A CYS 243 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc9  metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 77  SG ? ? A ZN 3 A CYS 232 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc10 metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 80  SG ? ? A ZN 3 A CYS 235 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc11 metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 110 SG ? ? A ZN 3 A CYS 265 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc12 metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 113 SG ? ? A ZN 3 A CYS 268 1_555 ? ? ? ? ? ? ? 2.309 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 32 ? ARG A 33 ? TYR A 187 ARG A 188 
A 2 LEU A 40 ? ILE A 41 ? LEU A 195 ILE A 196 
B 1 LEU A 74 ? CYS A 76 ? LEU A 229 CYS A 231 
B 2 ALA A 83 ? CYS A 85 ? ALA A 238 CYS A 240 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 32 ? N TYR A 187 O ILE A 41 ? O ILE A 196 
B 1 2 N ILE A 75 ? N ILE A 230 O PHE A 84 ? O PHE A 239 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 3' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 16  ? CYS A 171 . ? 1_555 ? 
2  AC1 4 CYS A 19  ? CYS A 174 . ? 1_555 ? 
3  AC1 4 CYS A 42  ? CYS A 197 . ? 1_555 ? 
4  AC1 4 CYS A 45  ? CYS A 200 . ? 1_555 ? 
5  AC2 4 CYS A 65  ? CYS A 220 . ? 1_555 ? 
6  AC2 4 CYS A 68  ? CYS A 223 . ? 1_555 ? 
7  AC2 4 CYS A 85  ? CYS A 240 . ? 1_555 ? 
8  AC2 4 CYS A 88  ? CYS A 243 . ? 1_555 ? 
9  AC3 4 CYS A 77  ? CYS A 232 . ? 1_555 ? 
10 AC3 4 CYS A 80  ? CYS A 235 . ? 1_555 ? 
11 AC3 4 CYS A 110 ? CYS A 265 . ? 1_555 ? 
12 AC3 4 CYS A 113 ? CYS A 268 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2JM1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? -38.789 9.854   3.878   1.00 0.00 ? 156 GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1   ? -37.824 8.822   3.403   1.00 0.00 ? 156 GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1   ? -36.930 9.421   2.308   1.00 0.00 ? 156 GLY A C    1  
ATOM   4     O  O    . GLY A 1 1   ? -37.375 9.641   1.197   1.00 0.00 ? 156 GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1   ? -39.528 9.400   4.452   1.00 0.00 ? 156 GLY A H1   1  
ATOM   6     H  H2   . GLY A 1 1   ? -39.224 10.325  3.058   1.00 0.00 ? 156 GLY A H2   1  
ATOM   7     H  H3   . GLY A 1 1   ? -38.288 10.558  4.457   1.00 0.00 ? 156 GLY A H3   1  
ATOM   8     H  HA2  . GLY A 1 1   ? -37.211 8.495   4.232   1.00 0.00 ? 156 GLY A HA2  1  
ATOM   9     H  HA3  . GLY A 1 1   ? -38.366 7.981   3.001   1.00 0.00 ? 156 GLY A HA3  1  
ATOM   10    N  N    . ALA A 1 2   ? -35.674 9.686   2.606   1.00 0.00 ? 157 ALA A N    1  
ATOM   11    C  CA   . ALA A 1 2   ? -34.767 10.268  1.573   1.00 0.00 ? 157 ALA A CA   1  
ATOM   12    C  C    . ALA A 1 2   ? -33.388 9.591   1.634   1.00 0.00 ? 157 ALA A C    1  
ATOM   13    O  O    . ALA A 1 2   ? -32.463 10.120  2.222   1.00 0.00 ? 157 ALA A O    1  
ATOM   14    C  CB   . ALA A 1 2   ? -34.653 11.750  1.935   1.00 0.00 ? 157 ALA A CB   1  
ATOM   15    H  H    . ALA A 1 2   ? -35.327 9.503   3.507   1.00 0.00 ? 157 ALA A H    1  
ATOM   16    H  HA   . ALA A 1 2   ? -35.196 10.161  0.589   1.00 0.00 ? 157 ALA A HA   1  
ATOM   17    H  HB1  . ALA A 1 2   ? -35.376 12.315  1.365   1.00 0.00 ? 157 ALA A HB1  1  
ATOM   18    H  HB2  . ALA A 1 2   ? -33.658 12.101  1.705   1.00 0.00 ? 157 ALA A HB2  1  
ATOM   19    H  HB3  . ALA A 1 2   ? -34.846 11.878  2.990   1.00 0.00 ? 157 ALA A HB3  1  
ATOM   20    N  N    . MET A 1 3   ? -33.241 8.427   1.035   1.00 0.00 ? 158 MET A N    1  
ATOM   21    C  CA   . MET A 1 3   ? -31.920 7.729   1.068   1.00 0.00 ? 158 MET A CA   1  
ATOM   22    C  C    . MET A 1 3   ? -31.635 7.067   -0.292  1.00 0.00 ? 158 MET A C    1  
ATOM   23    O  O    . MET A 1 3   ? -31.544 5.857   -0.388  1.00 0.00 ? 158 MET A O    1  
ATOM   24    C  CB   . MET A 1 3   ? -32.057 6.674   2.167   1.00 0.00 ? 158 MET A CB   1  
ATOM   25    C  CG   . MET A 1 3   ? -31.660 7.283   3.513   1.00 0.00 ? 158 MET A CG   1  
ATOM   26    S  SD   . MET A 1 3   ? -31.410 5.961   4.724   1.00 0.00 ? 158 MET A SD   1  
ATOM   27    C  CE   . MET A 1 3   ? -31.967 6.881   6.179   1.00 0.00 ? 158 MET A CE   1  
ATOM   28    H  H    . MET A 1 3   ? -33.996 8.009   0.564   1.00 0.00 ? 158 MET A H    1  
ATOM   29    H  HA   . MET A 1 3   ? -31.133 8.425   1.319   1.00 0.00 ? 158 MET A HA   1  
ATOM   30    H  HB2  . MET A 1 3   ? -33.082 6.335   2.213   1.00 0.00 ? 158 MET A HB2  1  
ATOM   31    H  HB3  . MET A 1 3   ? -31.411 5.838   1.947   1.00 0.00 ? 158 MET A HB3  1  
ATOM   32    H  HG2  . MET A 1 3   ? -30.744 7.844   3.397   1.00 0.00 ? 158 MET A HG2  1  
ATOM   33    H  HG3  . MET A 1 3   ? -32.443 7.942   3.855   1.00 0.00 ? 158 MET A HG3  1  
ATOM   34    H  HE1  . MET A 1 3   ? -31.767 7.934   6.038   1.00 0.00 ? 158 MET A HE1  1  
ATOM   35    H  HE2  . MET A 1 3   ? -31.438 6.531   7.051   1.00 0.00 ? 158 MET A HE2  1  
ATOM   36    H  HE3  . MET A 1 3   ? -33.028 6.725   6.318   1.00 0.00 ? 158 MET A HE3  1  
ATOM   37    N  N    . LYS A 1 4   ? -31.495 7.848   -1.345  1.00 0.00 ? 159 LYS A N    1  
ATOM   38    C  CA   . LYS A 1 4   ? -31.217 7.252   -2.686  1.00 0.00 ? 159 LYS A CA   1  
ATOM   39    C  C    . LYS A 1 4   ? -30.019 7.956   -3.343  1.00 0.00 ? 159 LYS A C    1  
ATOM   40    O  O    . LYS A 1 4   ? -30.092 8.374   -4.484  1.00 0.00 ? 159 LYS A O    1  
ATOM   41    C  CB   . LYS A 1 4   ? -32.492 7.491   -3.497  1.00 0.00 ? 159 LYS A CB   1  
ATOM   42    C  CG   . LYS A 1 4   ? -33.581 6.520   -3.037  1.00 0.00 ? 159 LYS A CG   1  
ATOM   43    C  CD   . LYS A 1 4   ? -34.572 6.285   -4.179  1.00 0.00 ? 159 LYS A CD   1  
ATOM   44    C  CE   . LYS A 1 4   ? -35.885 5.742   -3.612  1.00 0.00 ? 159 LYS A CE   1  
ATOM   45    N  NZ   . LYS A 1 4   ? -36.628 5.221   -4.793  1.00 0.00 ? 159 LYS A NZ   1  
ATOM   46    H  H    . LYS A 1 4   ? -31.571 8.823   -1.255  1.00 0.00 ? 159 LYS A H    1  
ATOM   47    H  HA   . LYS A 1 4   ? -31.031 6.193   -2.598  1.00 0.00 ? 159 LYS A HA   1  
ATOM   48    H  HB2  . LYS A 1 4   ? -32.829 8.508   -3.345  1.00 0.00 ? 159 LYS A HB2  1  
ATOM   49    H  HB3  . LYS A 1 4   ? -32.289 7.332   -4.544  1.00 0.00 ? 159 LYS A HB3  1  
ATOM   50    H  HG2  . LYS A 1 4   ? -33.127 5.580   -2.753  1.00 0.00 ? 159 LYS A HG2  1  
ATOM   51    H  HG3  . LYS A 1 4   ? -34.103 6.938   -2.190  1.00 0.00 ? 159 LYS A HG3  1  
ATOM   52    H  HD2  . LYS A 1 4   ? -34.758 7.217   -4.691  1.00 0.00 ? 159 LYS A HD2  1  
ATOM   53    H  HD3  . LYS A 1 4   ? -34.158 5.568   -4.872  1.00 0.00 ? 159 LYS A HD3  1  
ATOM   54    H  HE2  . LYS A 1 4   ? -35.688 4.946   -2.907  1.00 0.00 ? 159 LYS A HE2  1  
ATOM   55    H  HE3  . LYS A 1 4   ? -36.448 6.533   -3.141  1.00 0.00 ? 159 LYS A HE3  1  
ATOM   56    H  HZ1  . LYS A 1 4   ? -36.905 6.014   -5.406  1.00 0.00 ? 159 LYS A HZ1  1  
ATOM   57    H  HZ2  . LYS A 1 4   ? -37.479 4.715   -4.472  1.00 0.00 ? 159 LYS A HZ2  1  
ATOM   58    H  HZ3  . LYS A 1 4   ? -36.018 4.570   -5.327  1.00 0.00 ? 159 LYS A HZ3  1  
ATOM   59    N  N    . ARG A 1 5   ? -28.915 8.092   -2.635  1.00 0.00 ? 160 ARG A N    1  
ATOM   60    C  CA   . ARG A 1 5   ? -27.724 8.770   -3.230  1.00 0.00 ? 160 ARG A CA   1  
ATOM   61    C  C    . ARG A 1 5   ? -26.547 7.786   -3.327  1.00 0.00 ? 160 ARG A C    1  
ATOM   62    O  O    . ARG A 1 5   ? -26.329 6.988   -2.435  1.00 0.00 ? 160 ARG A O    1  
ATOM   63    C  CB   . ARG A 1 5   ? -27.390 9.908   -2.264  1.00 0.00 ? 160 ARG A CB   1  
ATOM   64    C  CG   . ARG A 1 5   ? -28.046 11.202  -2.752  1.00 0.00 ? 160 ARG A CG   1  
ATOM   65    C  CD   . ARG A 1 5   ? -29.400 11.381  -2.062  1.00 0.00 ? 160 ARG A CD   1  
ATOM   66    N  NE   . ARG A 1 5   ? -29.725 12.825  -2.223  1.00 0.00 ? 160 ARG A NE   1  
ATOM   67    C  CZ   . ARG A 1 5   ? -29.099 13.720  -1.506  1.00 0.00 ? 160 ARG A CZ   1  
ATOM   68    N  NH1  . ARG A 1 5   ? -29.011 13.574  -0.212  1.00 0.00 ? 160 ARG A NH1  1  
ATOM   69    N  NH2  . ARG A 1 5   ? -28.562 14.759  -2.085  1.00 0.00 ? 160 ARG A NH2  1  
ATOM   70    H  H    . ARG A 1 5   ? -28.868 7.751   -1.715  1.00 0.00 ? 160 ARG A H    1  
ATOM   71    H  HA   . ARG A 1 5   ? -27.963 9.169   -4.202  1.00 0.00 ? 160 ARG A HA   1  
ATOM   72    H  HB2  . ARG A 1 5   ? -27.762 9.664   -1.279  1.00 0.00 ? 160 ARG A HB2  1  
ATOM   73    H  HB3  . ARG A 1 5   ? -26.320 10.043  -2.222  1.00 0.00 ? 160 ARG A HB3  1  
ATOM   74    H  HG2  . ARG A 1 5   ? -27.406 12.040  -2.516  1.00 0.00 ? 160 ARG A HG2  1  
ATOM   75    H  HG3  . ARG A 1 5   ? -28.193 11.151  -3.820  1.00 0.00 ? 160 ARG A HG3  1  
ATOM   76    H  HD2  . ARG A 1 5   ? -30.150 10.768  -2.543  1.00 0.00 ? 160 ARG A HD2  1  
ATOM   77    H  HD3  . ARG A 1 5   ? -29.324 11.133  -1.014  1.00 0.00 ? 160 ARG A HD3  1  
ATOM   78    H  HE   . ARG A 1 5   ? -30.409 13.105  -2.867  1.00 0.00 ? 160 ARG A HE   1  
ATOM   79    H  HH11 . ARG A 1 5   ? -29.423 12.776  0.230   1.00 0.00 ? 160 ARG A HH11 1  
ATOM   80    H  HH12 . ARG A 1 5   ? -28.531 14.258  0.336   1.00 0.00 ? 160 ARG A HH12 1  
ATOM   81    H  HH21 . ARG A 1 5   ? -28.629 14.870  -3.075  1.00 0.00 ? 160 ARG A HH21 1  
ATOM   82    H  HH22 . ARG A 1 5   ? -28.081 15.443  -1.535  1.00 0.00 ? 160 ARG A HH22 1  
ATOM   83    N  N    . GLY A 1 6   ? -25.786 7.832   -4.403  1.00 0.00 ? 161 GLY A N    1  
ATOM   84    C  CA   . GLY A 1 6   ? -24.632 6.895   -4.543  1.00 0.00 ? 161 GLY A CA   1  
ATOM   85    C  C    . GLY A 1 6   ? -23.409 7.473   -3.815  1.00 0.00 ? 161 GLY A C    1  
ATOM   86    O  O    . GLY A 1 6   ? -22.807 6.811   -2.992  1.00 0.00 ? 161 GLY A O    1  
ATOM   87    H  H    . GLY A 1 6   ? -25.972 8.481   -5.117  1.00 0.00 ? 161 GLY A H    1  
ATOM   88    H  HA2  . GLY A 1 6   ? -24.890 5.938   -4.112  1.00 0.00 ? 161 GLY A HA2  1  
ATOM   89    H  HA3  . GLY A 1 6   ? -24.396 6.768   -5.588  1.00 0.00 ? 161 GLY A HA3  1  
ATOM   90    N  N    . GLU A 1 7   ? -23.037 8.703   -4.107  1.00 0.00 ? 162 GLU A N    1  
ATOM   91    C  CA   . GLU A 1 7   ? -21.854 9.309   -3.425  1.00 0.00 ? 162 GLU A CA   1  
ATOM   92    C  C    . GLU A 1 7   ? -22.129 10.784  -3.094  1.00 0.00 ? 162 GLU A C    1  
ATOM   93    O  O    . GLU A 1 7   ? -22.680 11.509  -3.901  1.00 0.00 ? 162 GLU A O    1  
ATOM   94    C  CB   . GLU A 1 7   ? -20.711 9.191   -4.433  1.00 0.00 ? 162 GLU A CB   1  
ATOM   95    C  CG   . GLU A 1 7   ? -19.373 9.202   -3.693  1.00 0.00 ? 162 GLU A CG   1  
ATOM   96    C  CD   . GLU A 1 7   ? -18.329 8.441   -4.511  1.00 0.00 ? 162 GLU A CD   1  
ATOM   97    O  OE1  . GLU A 1 7   ? -18.237 8.693   -5.701  1.00 0.00 ? 162 GLU A OE1  1  
ATOM   98    O  OE2  . GLU A 1 7   ? -17.638 7.617   -3.933  1.00 0.00 ? 162 GLU A OE2  1  
ATOM   99    H  H    . GLU A 1 7   ? -23.532 9.230   -4.774  1.00 0.00 ? 162 GLU A H    1  
ATOM   100   H  HA   . GLU A 1 7   ? -21.614 8.760   -2.528  1.00 0.00 ? 162 GLU A HA   1  
ATOM   101   H  HB2  . GLU A 1 7   ? -20.811 8.265   -4.983  1.00 0.00 ? 162 GLU A HB2  1  
ATOM   102   H  HB3  . GLU A 1 7   ? -20.748 10.023  -5.119  1.00 0.00 ? 162 GLU A HB3  1  
ATOM   103   H  HG2  . GLU A 1 7   ? -19.047 10.224  -3.555  1.00 0.00 ? 162 GLU A HG2  1  
ATOM   104   H  HG3  . GLU A 1 7   ? -19.489 8.728   -2.730  1.00 0.00 ? 162 GLU A HG3  1  
ATOM   105   N  N    . ASP A 1 8   ? -21.752 11.238  -1.915  1.00 0.00 ? 163 ASP A N    1  
ATOM   106   C  CA   . ASP A 1 8   ? -21.998 12.665  -1.548  1.00 0.00 ? 163 ASP A CA   1  
ATOM   107   C  C    . ASP A 1 8   ? -20.684 13.334  -1.113  1.00 0.00 ? 163 ASP A C    1  
ATOM   108   O  O    . ASP A 1 8   ? -20.037 12.886  -0.186  1.00 0.00 ? 163 ASP A O    1  
ATOM   109   C  CB   . ASP A 1 8   ? -22.983 12.610  -0.380  1.00 0.00 ? 163 ASP A CB   1  
ATOM   110   C  CG   . ASP A 1 8   ? -24.392 12.341  -0.912  1.00 0.00 ? 163 ASP A CG   1  
ATOM   111   O  OD1  . ASP A 1 8   ? -24.511 11.578  -1.856  1.00 0.00 ? 163 ASP A OD1  1  
ATOM   112   O  OD2  . ASP A 1 8   ? -25.328 12.904  -0.367  1.00 0.00 ? 163 ASP A OD2  1  
ATOM   113   H  H    . ASP A 1 8   ? -21.308 10.643  -1.271  1.00 0.00 ? 163 ASP A H    1  
ATOM   114   H  HA   . ASP A 1 8   ? -22.437 13.197  -2.376  1.00 0.00 ? 163 ASP A HA   1  
ATOM   115   H  HB2  . ASP A 1 8   ? -22.695 11.817  0.297   1.00 0.00 ? 163 ASP A HB2  1  
ATOM   116   H  HB3  . ASP A 1 8   ? -22.973 13.553  0.145   1.00 0.00 ? 163 ASP A HB3  1  
ATOM   117   N  N    . GLY A 1 9   ? -20.284 14.404  -1.773  1.00 0.00 ? 164 GLY A N    1  
ATOM   118   C  CA   . GLY A 1 9   ? -19.014 15.089  -1.387  1.00 0.00 ? 164 GLY A CA   1  
ATOM   119   C  C    . GLY A 1 9   ? -17.832 14.420  -2.104  1.00 0.00 ? 164 GLY A C    1  
ATOM   120   O  O    . GLY A 1 9   ? -17.843 13.226  -2.337  1.00 0.00 ? 164 GLY A O    1  
ATOM   121   H  H    . GLY A 1 9   ? -20.816 14.756  -2.520  1.00 0.00 ? 164 GLY A H    1  
ATOM   122   H  HA2  . GLY A 1 9   ? -19.067 16.130  -1.671  1.00 0.00 ? 164 GLY A HA2  1  
ATOM   123   H  HA3  . GLY A 1 9   ? -18.873 15.012  -0.320  1.00 0.00 ? 164 GLY A HA3  1  
ATOM   124   N  N    . LEU A 1 10  ? -16.812 15.175  -2.458  1.00 0.00 ? 165 LEU A N    1  
ATOM   125   C  CA   . LEU A 1 10  ? -15.639 14.570  -3.157  1.00 0.00 ? 165 LEU A CA   1  
ATOM   126   C  C    . LEU A 1 10  ? -14.329 15.053  -2.515  1.00 0.00 ? 165 LEU A C    1  
ATOM   127   O  O    . LEU A 1 10  ? -13.389 15.397  -3.206  1.00 0.00 ? 165 LEU A O    1  
ATOM   128   C  CB   . LEU A 1 10  ? -15.742 15.062  -4.602  1.00 0.00 ? 165 LEU A CB   1  
ATOM   129   C  CG   . LEU A 1 10  ? -15.062 14.057  -5.533  1.00 0.00 ? 165 LEU A CG   1  
ATOM   130   C  CD1  . LEU A 1 10  ? -16.090 13.030  -6.012  1.00 0.00 ? 165 LEU A CD1  1  
ATOM   131   C  CD2  . LEU A 1 10  ? -14.481 14.795  -6.741  1.00 0.00 ? 165 LEU A CD2  1  
ATOM   132   H  H    . LEU A 1 10  ? -16.814 16.139  -2.265  1.00 0.00 ? 165 LEU A H    1  
ATOM   133   H  HA   . LEU A 1 10  ? -15.698 13.493  -3.130  1.00 0.00 ? 165 LEU A HA   1  
ATOM   134   H  HB2  . LEU A 1 10  ? -16.782 15.161  -4.874  1.00 0.00 ? 165 LEU A HB2  1  
ATOM   135   H  HB3  . LEU A 1 10  ? -15.252 16.020  -4.691  1.00 0.00 ? 165 LEU A HB3  1  
ATOM   136   H  HG   . LEU A 1 10  ? -14.270 13.552  -5.001  1.00 0.00 ? 165 LEU A HG   1  
ATOM   137   H  HD11 . LEU A 1 10  ? -16.317 12.346  -5.206  1.00 0.00 ? 165 LEU A HD11 1  
ATOM   138   H  HD12 . LEU A 1 10  ? -15.685 12.479  -6.847  1.00 0.00 ? 165 LEU A HD12 1  
ATOM   139   H  HD13 . LEU A 1 10  ? -16.992 13.538  -6.318  1.00 0.00 ? 165 LEU A HD13 1  
ATOM   140   H  HD21 . LEU A 1 10  ? -15.126 15.622  -7.002  1.00 0.00 ? 165 LEU A HD21 1  
ATOM   141   H  HD22 . LEU A 1 10  ? -14.409 14.116  -7.577  1.00 0.00 ? 165 LEU A HD22 1  
ATOM   142   H  HD23 . LEU A 1 10  ? -13.498 15.170  -6.495  1.00 0.00 ? 165 LEU A HD23 1  
ATOM   143   N  N    . HIS A 1 11  ? -14.256 15.083  -1.200  1.00 0.00 ? 166 HIS A N    1  
ATOM   144   C  CA   . HIS A 1 11  ? -13.003 15.545  -0.529  1.00 0.00 ? 166 HIS A CA   1  
ATOM   145   C  C    . HIS A 1 11  ? -12.526 14.493  0.485   1.00 0.00 ? 166 HIS A C    1  
ATOM   146   O  O    . HIS A 1 11  ? -13.327 13.877  1.162   1.00 0.00 ? 166 HIS A O    1  
ATOM   147   C  CB   . HIS A 1 11  ? -13.390 16.842  0.183   1.00 0.00 ? 166 HIS A CB   1  
ATOM   148   C  CG   . HIS A 1 11  ? -13.125 18.012  -0.724  1.00 0.00 ? 166 HIS A CG   1  
ATOM   149   N  ND1  . HIS A 1 11  ? -14.076 18.992  -0.962  1.00 0.00 ? 166 HIS A ND1  1  
ATOM   150   C  CD2  . HIS A 1 11  ? -12.022 18.373  -1.458  1.00 0.00 ? 166 HIS A CD2  1  
ATOM   151   C  CE1  . HIS A 1 11  ? -13.532 19.886  -1.808  1.00 0.00 ? 166 HIS A CE1  1  
ATOM   152   N  NE2  . HIS A 1 11  ? -12.282 19.556  -2.142  1.00 0.00 ? 166 HIS A NE2  1  
ATOM   153   H  H    . HIS A 1 11  ? -15.022 14.802  -0.652  1.00 0.00 ? 166 HIS A H    1  
ATOM   154   H  HA   . HIS A 1 11  ? -12.234 15.740  -1.260  1.00 0.00 ? 166 HIS A HA   1  
ATOM   155   H  HB2  . HIS A 1 11  ? -14.440 16.813  0.439   1.00 0.00 ? 166 HIS A HB2  1  
ATOM   156   H  HB3  . HIS A 1 11  ? -12.804 16.946  1.085   1.00 0.00 ? 166 HIS A HB3  1  
ATOM   157   H  HD1  . HIS A 1 11  ? -14.980 19.027  -0.585  1.00 0.00 ? 166 HIS A HD1  1  
ATOM   158   H  HD2  . HIS A 1 11  ? -11.094 17.821  -1.498  1.00 0.00 ? 166 HIS A HD2  1  
ATOM   159   H  HE1  . HIS A 1 11  ? -14.045 20.764  -2.173  1.00 0.00 ? 166 HIS A HE1  1  
ATOM   160   N  N    . GLY A 1 12  ? -11.230 14.280  0.597   1.00 0.00 ? 167 GLY A N    1  
ATOM   161   C  CA   . GLY A 1 12  ? -10.719 13.267  1.567   1.00 0.00 ? 167 GLY A CA   1  
ATOM   162   C  C    . GLY A 1 12  ? -11.201 11.869  1.153   1.00 0.00 ? 167 GLY A C    1  
ATOM   163   O  O    . GLY A 1 12  ? -12.271 11.441  1.544   1.00 0.00 ? 167 GLY A O    1  
ATOM   164   H  H    . GLY A 1 12  ? -10.593 14.783  0.042   1.00 0.00 ? 167 GLY A H    1  
ATOM   165   H  HA2  . GLY A 1 12  ? -9.638  13.290  1.575   1.00 0.00 ? 167 GLY A HA2  1  
ATOM   166   H  HA3  . GLY A 1 12  ? -11.092 13.494  2.554   1.00 0.00 ? 167 GLY A HA3  1  
ATOM   167   N  N    . ILE A 1 13  ? -10.424 11.152  0.365   1.00 0.00 ? 168 ILE A N    1  
ATOM   168   C  CA   . ILE A 1 13  ? -10.851 9.785   -0.065  1.00 0.00 ? 168 ILE A CA   1  
ATOM   169   C  C    . ILE A 1 13  ? -9.850  8.735   0.443   1.00 0.00 ? 168 ILE A C    1  
ATOM   170   O  O    . ILE A 1 13  ? -8.681  9.024   0.623   1.00 0.00 ? 168 ILE A O    1  
ATOM   171   C  CB   . ILE A 1 13  ? -10.858 9.830   -1.598  1.00 0.00 ? 168 ILE A CB   1  
ATOM   172   C  CG1  . ILE A 1 13  ? -11.851 10.894  -2.076  1.00 0.00 ? 168 ILE A CG1  1  
ATOM   173   C  CG2  . ILE A 1 13  ? -11.277 8.465   -2.155  1.00 0.00 ? 168 ILE A CG2  1  
ATOM   174   C  CD1  . ILE A 1 13  ? -11.523 11.288  -3.517  1.00 0.00 ? 168 ILE A CD1  1  
ATOM   175   H  H    . ILE A 1 13  ? -9.562  11.508  0.057   1.00 0.00 ? 168 ILE A H    1  
ATOM   176   H  HA   . ILE A 1 13  ? -11.841 9.564   0.302   1.00 0.00 ? 168 ILE A HA   1  
ATOM   177   H  HB   . ILE A 1 13  ? -9.868  10.075  -1.953  1.00 0.00 ? 168 ILE A HB   1  
ATOM   178   H  HG12 . ILE A 1 13  ? -12.855 10.496  -2.030  1.00 0.00 ? 168 ILE A HG12 1  
ATOM   179   H  HG13 . ILE A 1 13  ? -11.780 11.765  -1.442  1.00 0.00 ? 168 ILE A HG13 1  
ATOM   180   H  HG21 . ILE A 1 13  ? -11.740 8.598   -3.122  1.00 0.00 ? 168 ILE A HG21 1  
ATOM   181   H  HG22 . ILE A 1 13  ? -11.980 8.000   -1.481  1.00 0.00 ? 168 ILE A HG22 1  
ATOM   182   H  HG23 . ILE A 1 13  ? -10.406 7.834   -2.258  1.00 0.00 ? 168 ILE A HG23 1  
ATOM   183   H  HD11 . ILE A 1 13  ? -12.436 11.534  -4.039  1.00 0.00 ? 168 ILE A HD11 1  
ATOM   184   H  HD12 . ILE A 1 13  ? -11.036 10.462  -4.014  1.00 0.00 ? 168 ILE A HD12 1  
ATOM   185   H  HD13 . ILE A 1 13  ? -10.865 12.144  -3.516  1.00 0.00 ? 168 ILE A HD13 1  
ATOM   186   N  N    . VAL A 1 14  ? -10.297 7.517   0.663   1.00 0.00 ? 169 VAL A N    1  
ATOM   187   C  CA   . VAL A 1 14  ? -9.360  6.450   1.145   1.00 0.00 ? 169 VAL A CA   1  
ATOM   188   C  C    . VAL A 1 14  ? -8.965  5.550   -0.033  1.00 0.00 ? 169 VAL A C    1  
ATOM   189   O  O    . VAL A 1 14  ? -9.772  5.281   -0.901  1.00 0.00 ? 169 VAL A O    1  
ATOM   190   C  CB   . VAL A 1 14  ? -10.142 5.654   2.202   1.00 0.00 ? 169 VAL A CB   1  
ATOM   191   C  CG1  . VAL A 1 14  ? -9.264  4.530   2.760   1.00 0.00 ? 169 VAL A CG1  1  
ATOM   192   C  CG2  . VAL A 1 14  ? -10.553 6.589   3.344   1.00 0.00 ? 169 VAL A CG2  1  
ATOM   193   H  H    . VAL A 1 14  ? -11.245 7.301   0.500   1.00 0.00 ? 169 VAL A H    1  
ATOM   194   H  HA   . VAL A 1 14  ? -8.482  6.894   1.589   1.00 0.00 ? 169 VAL A HA   1  
ATOM   195   H  HB   . VAL A 1 14  ? -11.025 5.229   1.748   1.00 0.00 ? 169 VAL A HB   1  
ATOM   196   H  HG11 . VAL A 1 14  ? -9.893  3.758   3.178   1.00 0.00 ? 169 VAL A HG11 1  
ATOM   197   H  HG12 . VAL A 1 14  ? -8.620  4.926   3.531   1.00 0.00 ? 169 VAL A HG12 1  
ATOM   198   H  HG13 . VAL A 1 14  ? -8.662  4.113   1.967   1.00 0.00 ? 169 VAL A HG13 1  
ATOM   199   H  HG21 . VAL A 1 14  ? -11.517 6.287   3.725   1.00 0.00 ? 169 VAL A HG21 1  
ATOM   200   H  HG22 . VAL A 1 14  ? -10.612 7.603   2.978   1.00 0.00 ? 169 VAL A HG22 1  
ATOM   201   H  HG23 . VAL A 1 14  ? -9.820  6.535   4.136   1.00 0.00 ? 169 VAL A HG23 1  
ATOM   202   N  N    . SER A 1 15  ? -7.731  5.089   -0.081  1.00 0.00 ? 170 SER A N    1  
ATOM   203   C  CA   . SER A 1 15  ? -7.312  4.216   -1.219  1.00 0.00 ? 170 SER A CA   1  
ATOM   204   C  C    . SER A 1 15  ? -6.244  3.206   -0.778  1.00 0.00 ? 170 SER A C    1  
ATOM   205   O  O    . SER A 1 15  ? -5.475  3.463   0.129   1.00 0.00 ? 170 SER A O    1  
ATOM   206   C  CB   . SER A 1 15  ? -6.741  5.176   -2.262  1.00 0.00 ? 170 SER A CB   1  
ATOM   207   O  OG   . SER A 1 15  ? -6.723  4.533   -3.531  1.00 0.00 ? 170 SER A OG   1  
ATOM   208   H  H    . SER A 1 15  ? -7.084  5.318   0.623   1.00 0.00 ? 170 SER A H    1  
ATOM   209   H  HA   . SER A 1 15  ? -8.161  3.698   -1.626  1.00 0.00 ? 170 SER A HA   1  
ATOM   210   H  HB2  . SER A 1 15  ? -7.360  6.056   -2.320  1.00 0.00 ? 170 SER A HB2  1  
ATOM   211   H  HB3  . SER A 1 15  ? -5.738  5.461   -1.976  1.00 0.00 ? 170 SER A HB3  1  
ATOM   212   H  HG   . SER A 1 15  ? -5.966  3.942   -3.552  1.00 0.00 ? 170 SER A HG   1  
ATOM   213   N  N    . CYS A 1 16  ? -6.186  2.059   -1.424  1.00 0.00 ? 171 CYS A N    1  
ATOM   214   C  CA   . CYS A 1 16  ? -5.155  1.038   -1.045  1.00 0.00 ? 171 CYS A CA   1  
ATOM   215   C  C    . CYS A 1 16  ? -3.974  1.099   -2.026  1.00 0.00 ? 171 CYS A C    1  
ATOM   216   O  O    . CYS A 1 16  ? -4.166  1.270   -3.218  1.00 0.00 ? 171 CYS A O    1  
ATOM   217   C  CB   . CYS A 1 16  ? -5.852  -0.324  -1.136  1.00 0.00 ? 171 CYS A CB   1  
ATOM   218   S  SG   . CYS A 1 16  ? -4.749  -1.604  -0.487  1.00 0.00 ? 171 CYS A SG   1  
ATOM   219   H  H    . CYS A 1 16  ? -6.814  1.876   -2.164  1.00 0.00 ? 171 CYS A H    1  
ATOM   220   H  HA   . CYS A 1 16  ? -4.813  1.210   -0.037  1.00 0.00 ? 171 CYS A HA   1  
ATOM   221   H  HB2  . CYS A 1 16  ? -6.763  -0.303  -0.557  1.00 0.00 ? 171 CYS A HB2  1  
ATOM   222   H  HB3  . CYS A 1 16  ? -6.083  -0.538  -2.167  1.00 0.00 ? 171 CYS A HB3  1  
ATOM   223   N  N    . THR A 1 17  ? -2.755  0.964   -1.537  1.00 0.00 ? 172 THR A N    1  
ATOM   224   C  CA   . THR A 1 17  ? -1.565  1.024   -2.460  1.00 0.00 ? 172 THR A CA   1  
ATOM   225   C  C    . THR A 1 17  ? -1.345  -0.329  -3.166  1.00 0.00 ? 172 THR A C    1  
ATOM   226   O  O    . THR A 1 17  ? -0.981  -0.368  -4.327  1.00 0.00 ? 172 THR A O    1  
ATOM   227   C  CB   . THR A 1 17  ? -0.342  1.403   -1.587  1.00 0.00 ? 172 THR A CB   1  
ATOM   228   O  OG1  . THR A 1 17  ? 0.749   1.733   -2.434  1.00 0.00 ? 172 THR A OG1  1  
ATOM   229   C  CG2  . THR A 1 17  ? 0.069   0.239   -0.671  1.00 0.00 ? 172 THR A CG2  1  
ATOM   230   H  H    . THR A 1 17  ? -2.628  0.829   -0.569  1.00 0.00 ? 172 THR A H    1  
ATOM   231   H  HA   . THR A 1 17  ? -1.725  1.793   -3.201  1.00 0.00 ? 172 THR A HA   1  
ATOM   232   H  HB   . THR A 1 17  ? -0.590  2.259   -0.976  1.00 0.00 ? 172 THR A HB   1  
ATOM   233   H  HG1  . THR A 1 17  ? 0.563   2.582   -2.843  1.00 0.00 ? 172 THR A HG1  1  
ATOM   234   H  HG21 . THR A 1 17  ? 0.811   0.583   0.034   1.00 0.00 ? 172 THR A HG21 1  
ATOM   235   H  HG22 . THR A 1 17  ? 0.483   -0.559  -1.268  1.00 0.00 ? 172 THR A HG22 1  
ATOM   236   H  HG23 . THR A 1 17  ? -0.793  -0.126  -0.134  1.00 0.00 ? 172 THR A HG23 1  
ATOM   237   N  N    . ALA A 1 18  ? -1.558  -1.436  -2.483  1.00 0.00 ? 173 ALA A N    1  
ATOM   238   C  CA   . ALA A 1 18  ? -1.348  -2.773  -3.148  1.00 0.00 ? 173 ALA A CA   1  
ATOM   239   C  C    . ALA A 1 18  ? -2.484  -3.073  -4.146  1.00 0.00 ? 173 ALA A C    1  
ATOM   240   O  O    . ALA A 1 18  ? -2.272  -3.749  -5.136  1.00 0.00 ? 173 ALA A O    1  
ATOM   241   C  CB   . ALA A 1 18  ? -1.319  -3.824  -2.028  1.00 0.00 ? 173 ALA A CB   1  
ATOM   242   H  H    . ALA A 1 18  ? -1.855  -1.386  -1.543  1.00 0.00 ? 173 ALA A H    1  
ATOM   243   H  HA   . ALA A 1 18  ? -0.405  -2.773  -3.666  1.00 0.00 ? 173 ALA A HA   1  
ATOM   244   H  HB1  . ALA A 1 18  ? -0.973  -3.365  -1.111  1.00 0.00 ? 173 ALA A HB1  1  
ATOM   245   H  HB2  . ALA A 1 18  ? -0.647  -4.625  -2.303  1.00 0.00 ? 173 ALA A HB2  1  
ATOM   246   H  HB3  . ALA A 1 18  ? -2.312  -4.223  -1.880  1.00 0.00 ? 173 ALA A HB3  1  
ATOM   247   N  N    . CYS A 1 19  ? -3.682  -2.574  -3.911  1.00 0.00 ? 174 CYS A N    1  
ATOM   248   C  CA   . CYS A 1 19  ? -4.806  -2.837  -4.868  1.00 0.00 ? 174 CYS A CA   1  
ATOM   249   C  C    . CYS A 1 19  ? -4.916  -1.698  -5.896  1.00 0.00 ? 174 CYS A C    1  
ATOM   250   O  O    . CYS A 1 19  ? -5.287  -1.926  -7.032  1.00 0.00 ? 174 CYS A O    1  
ATOM   251   C  CB   . CYS A 1 19  ? -6.081  -2.904  -4.018  1.00 0.00 ? 174 CYS A CB   1  
ATOM   252   S  SG   . CYS A 1 19  ? -5.999  -4.319  -2.895  1.00 0.00 ? 174 CYS A SG   1  
ATOM   253   H  H    . CYS A 1 19  ? -3.842  -2.023  -3.117  1.00 0.00 ? 174 CYS A H    1  
ATOM   254   H  HA   . CYS A 1 19  ? -4.654  -3.771  -5.370  1.00 0.00 ? 174 CYS A HA   1  
ATOM   255   H  HB2  . CYS A 1 19  ? -6.178  -1.997  -3.445  1.00 0.00 ? 174 CYS A HB2  1  
ATOM   256   H  HB3  . CYS A 1 19  ? -6.934  -3.008  -4.665  1.00 0.00 ? 174 CYS A HB3  1  
ATOM   257   N  N    . GLY A 1 20  ? -4.612  -0.473  -5.512  1.00 0.00 ? 175 GLY A N    1  
ATOM   258   C  CA   . GLY A 1 20  ? -4.721  0.661   -6.473  1.00 0.00 ? 175 GLY A CA   1  
ATOM   259   C  C    . GLY A 1 20  ? -6.197  1.054   -6.608  1.00 0.00 ? 175 GLY A C    1  
ATOM   260   O  O    . GLY A 1 20  ? -6.671  1.323   -7.696  1.00 0.00 ? 175 GLY A O    1  
ATOM   261   H  H    . GLY A 1 20  ? -4.326  -0.296  -4.593  1.00 0.00 ? 175 GLY A H    1  
ATOM   262   H  HA2  . GLY A 1 20  ? -4.149  1.502   -6.107  1.00 0.00 ? 175 GLY A HA2  1  
ATOM   263   H  HA3  . GLY A 1 20  ? -4.342  0.356   -7.437  1.00 0.00 ? 175 GLY A HA3  1  
ATOM   264   N  N    . GLN A 1 21  ? -6.934  1.082   -5.513  1.00 0.00 ? 176 GLN A N    1  
ATOM   265   C  CA   . GLN A 1 21  ? -8.384  1.451   -5.602  1.00 0.00 ? 176 GLN A CA   1  
ATOM   266   C  C    . GLN A 1 21  ? -8.959  1.794   -4.218  1.00 0.00 ? 176 GLN A C    1  
ATOM   267   O  O    . GLN A 1 21  ? -8.429  1.385   -3.202  1.00 0.00 ? 176 GLN A O    1  
ATOM   268   C  CB   . GLN A 1 21  ? -9.071  0.205   -6.167  1.00 0.00 ? 176 GLN A CB   1  
ATOM   269   C  CG   . GLN A 1 21  ? -9.237  0.351   -7.681  1.00 0.00 ? 176 GLN A CG   1  
ATOM   270   C  CD   . GLN A 1 21  ? -10.494 -0.401  -8.134  1.00 0.00 ? 176 GLN A CD   1  
ATOM   271   O  OE1  . GLN A 1 21  ? -11.493 0.211   -8.456  1.00 0.00 ? 176 GLN A OE1  1  
ATOM   272   N  NE2  . GLN A 1 21  ? -10.495 -1.712  -8.172  1.00 0.00 ? 176 GLN A NE2  1  
ATOM   273   H  H    . GLN A 1 21  ? -6.536  0.854   -4.638  1.00 0.00 ? 176 GLN A H    1  
ATOM   274   H  HA   . GLN A 1 21  ? -8.523  2.281   -6.276  1.00 0.00 ? 176 GLN A HA   1  
ATOM   275   H  HB2  . GLN A 1 21  ? -8.468  -0.665  -5.953  1.00 0.00 ? 176 GLN A HB2  1  
ATOM   276   H  HB3  . GLN A 1 21  ? -10.043 0.092   -5.710  1.00 0.00 ? 176 GLN A HB3  1  
ATOM   277   H  HG2  . GLN A 1 21  ? -9.332  1.398   -7.933  1.00 0.00 ? 176 GLN A HG2  1  
ATOM   278   H  HG3  . GLN A 1 21  ? -8.373  -0.063  -8.180  1.00 0.00 ? 176 GLN A HG3  1  
ATOM   279   H  HE21 . GLN A 1 21  ? -9.693  -2.217  -7.914  1.00 0.00 ? 176 GLN A HE21 1  
ATOM   280   H  HE22 . GLN A 1 21  ? -11.300 -2.189  -8.462  1.00 0.00 ? 176 GLN A HE22 1  
ATOM   281   N  N    . GLN A 1 22  ? -10.041 2.547   -4.173  1.00 0.00 ? 177 GLN A N    1  
ATOM   282   C  CA   . GLN A 1 22  ? -10.644 2.916   -2.839  1.00 0.00 ? 177 GLN A CA   1  
ATOM   283   C  C    . GLN A 1 22  ? -10.976 1.652   -2.027  1.00 0.00 ? 177 GLN A C    1  
ATOM   284   O  O    . GLN A 1 22  ? -11.249 0.607   -2.587  1.00 0.00 ? 177 GLN A O    1  
ATOM   285   C  CB   . GLN A 1 22  ? -11.933 3.702   -3.140  1.00 0.00 ? 177 GLN A CB   1  
ATOM   286   C  CG   . GLN A 1 22  ? -12.225 4.671   -1.992  1.00 0.00 ? 177 GLN A CG   1  
ATOM   287   C  CD   . GLN A 1 22  ? -13.713 5.040   -2.000  1.00 0.00 ? 177 GLN A CD   1  
ATOM   288   O  OE1  . GLN A 1 22  ? -14.314 5.147   -3.050  1.00 0.00 ? 177 GLN A OE1  1  
ATOM   289   N  NE2  . GLN A 1 22  ? -14.344 5.242   -0.868  1.00 0.00 ? 177 GLN A NE2  1  
ATOM   290   H  H    . GLN A 1 22  ? -10.447 2.869   -5.012  1.00 0.00 ? 177 GLN A H    1  
ATOM   291   H  HA   . GLN A 1 22  ? -9.963  3.536   -2.284  1.00 0.00 ? 177 GLN A HA   1  
ATOM   292   H  HB2  . GLN A 1 22  ? -11.809 4.259   -4.057  1.00 0.00 ? 177 GLN A HB2  1  
ATOM   293   H  HB3  . GLN A 1 22  ? -12.758 3.014   -3.246  1.00 0.00 ? 177 GLN A HB3  1  
ATOM   294   H  HG2  . GLN A 1 22  ? -11.975 4.202   -1.052  1.00 0.00 ? 177 GLN A HG2  1  
ATOM   295   H  HG3  . GLN A 1 22  ? -11.634 5.566   -2.117  1.00 0.00 ? 177 GLN A HG3  1  
ATOM   296   H  HE21 . GLN A 1 22  ? -13.869 5.158   -0.012  1.00 0.00 ? 177 GLN A HE21 1  
ATOM   297   H  HE22 . GLN A 1 22  ? -15.295 5.478   -0.876  1.00 0.00 ? 177 GLN A HE22 1  
ATOM   298   N  N    . VAL A 1 23  ? -10.958 1.741   -0.712  1.00 0.00 ? 178 VAL A N    1  
ATOM   299   C  CA   . VAL A 1 23  ? -11.281 0.532   0.123   1.00 0.00 ? 178 VAL A CA   1  
ATOM   300   C  C    . VAL A 1 23  ? -12.805 0.406   0.288   1.00 0.00 ? 178 VAL A C    1  
ATOM   301   O  O    . VAL A 1 23  ? -13.531 1.361   0.090   1.00 0.00 ? 178 VAL A O    1  
ATOM   302   C  CB   . VAL A 1 23  ? -10.604 0.749   1.488   1.00 0.00 ? 178 VAL A CB   1  
ATOM   303   C  CG1  . VAL A 1 23  ? -10.853 -0.465  2.386   1.00 0.00 ? 178 VAL A CG1  1  
ATOM   304   C  CG2  . VAL A 1 23  ? -9.097  0.926   1.284   1.00 0.00 ? 178 VAL A CG2  1  
ATOM   305   H  H    . VAL A 1 23  ? -10.739 2.601   -0.278  1.00 0.00 ? 178 VAL A H    1  
ATOM   306   H  HA   . VAL A 1 23  ? -10.886 -0.357  -0.344  1.00 0.00 ? 178 VAL A HA   1  
ATOM   307   H  HB   . VAL A 1 23  ? -11.012 1.633   1.959   1.00 0.00 ? 178 VAL A HB   1  
ATOM   308   H  HG11 . VAL A 1 23  ? -10.788 -1.367  1.798   1.00 0.00 ? 178 VAL A HG11 1  
ATOM   309   H  HG12 . VAL A 1 23  ? -11.836 -0.392  2.827   1.00 0.00 ? 178 VAL A HG12 1  
ATOM   310   H  HG13 . VAL A 1 23  ? -10.109 -0.491  3.169   1.00 0.00 ? 178 VAL A HG13 1  
ATOM   311   H  HG21 . VAL A 1 23  ? -8.575  0.633   2.183   1.00 0.00 ? 178 VAL A HG21 1  
ATOM   312   H  HG22 . VAL A 1 23  ? -8.884  1.962   1.064   1.00 0.00 ? 178 VAL A HG22 1  
ATOM   313   H  HG23 . VAL A 1 23  ? -8.770  0.309   0.460   1.00 0.00 ? 178 VAL A HG23 1  
ATOM   314   N  N    . ASN A 1 24  ? -13.303 -0.767  0.636   1.00 0.00 ? 179 ASN A N    1  
ATOM   315   C  CA   . ASN A 1 24  ? -14.798 -0.939  0.797   1.00 0.00 ? 179 ASN A CA   1  
ATOM   316   C  C    . ASN A 1 24  ? -15.382 0.150   1.716   1.00 0.00 ? 179 ASN A C    1  
ATOM   317   O  O    . ASN A 1 24  ? -15.380 0.012   2.924   1.00 0.00 ? 179 ASN A O    1  
ATOM   318   C  CB   . ASN A 1 24  ? -15.016 -2.324  1.427   1.00 0.00 ? 179 ASN A CB   1  
ATOM   319   C  CG   . ASN A 1 24  ? -16.495 -2.714  1.302   1.00 0.00 ? 179 ASN A CG   1  
ATOM   320   O  OD1  . ASN A 1 24  ? -17.100 -2.507  0.270   1.00 0.00 ? 179 ASN A OD1  1  
ATOM   321   N  ND2  . ASN A 1 24  ? -17.110 -3.276  2.314   1.00 0.00 ? 179 ASN A ND2  1  
ATOM   322   H  H    . ASN A 1 24  ? -12.696 -1.533  0.781   1.00 0.00 ? 179 ASN A H    1  
ATOM   323   H  HA   . ASN A 1 24  ? -15.277 -0.900  -0.169  1.00 0.00 ? 179 ASN A HA   1  
ATOM   324   H  HB2  . ASN A 1 24  ? -14.406 -3.053  0.913   1.00 0.00 ? 179 ASN A HB2  1  
ATOM   325   H  HB3  . ASN A 1 24  ? -14.740 -2.293  2.470   1.00 0.00 ? 179 ASN A HB3  1  
ATOM   326   H  HD21 . ASN A 1 24  ? -16.631 -3.449  3.154   1.00 0.00 ? 179 ASN A HD21 1  
ATOM   327   H  HD22 . ASN A 1 24  ? -18.054 -3.525  2.233   1.00 0.00 ? 179 ASN A HD22 1  
ATOM   328   N  N    . HIS A 1 25  ? -15.890 1.233   1.153   1.00 0.00 ? 180 HIS A N    1  
ATOM   329   C  CA   . HIS A 1 25  ? -16.481 2.327   1.993   1.00 0.00 ? 180 HIS A CA   1  
ATOM   330   C  C    . HIS A 1 25  ? -15.506 2.764   3.102   1.00 0.00 ? 180 HIS A C    1  
ATOM   331   O  O    . HIS A 1 25  ? -14.386 2.293   3.168   1.00 0.00 ? 180 HIS A O    1  
ATOM   332   C  CB   . HIS A 1 25  ? -17.749 1.722   2.604   1.00 0.00 ? 180 HIS A CB   1  
ATOM   333   C  CG   . HIS A 1 25  ? -18.831 2.767   2.661   1.00 0.00 ? 180 HIS A CG   1  
ATOM   334   N  ND1  . HIS A 1 25  ? -19.505 3.068   3.835   1.00 0.00 ? 180 HIS A ND1  1  
ATOM   335   C  CD2  . HIS A 1 25  ? -19.365 3.590   1.701   1.00 0.00 ? 180 HIS A CD2  1  
ATOM   336   C  CE1  . HIS A 1 25  ? -20.398 4.034   3.552   1.00 0.00 ? 180 HIS A CE1  1  
ATOM   337   N  NE2  . HIS A 1 25  ? -20.354 4.389   2.265   1.00 0.00 ? 180 HIS A NE2  1  
ATOM   338   H  H    . HIS A 1 25  ? -15.888 1.328   0.175   1.00 0.00 ? 180 HIS A H    1  
ATOM   339   H  HA   . HIS A 1 25  ? -16.741 3.171   1.373   1.00 0.00 ? 180 HIS A HA   1  
ATOM   340   H  HB2  . HIS A 1 25  ? -18.082 0.894   1.995   1.00 0.00 ? 180 HIS A HB2  1  
ATOM   341   H  HB3  . HIS A 1 25  ? -17.536 1.372   3.602   1.00 0.00 ? 180 HIS A HB3  1  
ATOM   342   H  HD1  . HIS A 1 25  ? -19.358 2.654   4.710   1.00 0.00 ? 180 HIS A HD1  1  
ATOM   343   H  HD2  . HIS A 1 25  ? -19.063 3.612   0.664   1.00 0.00 ? 180 HIS A HD2  1  
ATOM   344   H  HE1  . HIS A 1 25  ? -21.069 4.470   4.278   1.00 0.00 ? 180 HIS A HE1  1  
ATOM   345   N  N    . PHE A 1 26  ? -15.924 3.658   3.976   1.00 0.00 ? 181 PHE A N    1  
ATOM   346   C  CA   . PHE A 1 26  ? -15.022 4.116   5.075   1.00 0.00 ? 181 PHE A CA   1  
ATOM   347   C  C    . PHE A 1 26  ? -15.611 3.709   6.437   1.00 0.00 ? 181 PHE A C    1  
ATOM   348   O  O    . PHE A 1 26  ? -16.501 4.361   6.949   1.00 0.00 ? 181 PHE A O    1  
ATOM   349   C  CB   . PHE A 1 26  ? -14.971 5.644   4.929   1.00 0.00 ? 181 PHE A CB   1  
ATOM   350   C  CG   . PHE A 1 26  ? -14.143 6.258   6.039   1.00 0.00 ? 181 PHE A CG   1  
ATOM   351   C  CD1  . PHE A 1 26  ? -12.875 5.744   6.349   1.00 0.00 ? 181 PHE A CD1  1  
ATOM   352   C  CD2  . PHE A 1 26  ? -14.646 7.350   6.756   1.00 0.00 ? 181 PHE A CD2  1  
ATOM   353   C  CE1  . PHE A 1 26  ? -12.117 6.323   7.373   1.00 0.00 ? 181 PHE A CE1  1  
ATOM   354   C  CE2  . PHE A 1 26  ? -13.887 7.929   7.778   1.00 0.00 ? 181 PHE A CE2  1  
ATOM   355   C  CZ   . PHE A 1 26  ? -12.622 7.415   8.088   1.00 0.00 ? 181 PHE A CZ   1  
ATOM   356   H  H    . PHE A 1 26  ? -16.833 4.028   3.912   1.00 0.00 ? 181 PHE A H    1  
ATOM   357   H  HA   . PHE A 1 26  ? -14.034 3.700   4.951   1.00 0.00 ? 181 PHE A HA   1  
ATOM   358   H  HB2  . PHE A 1 26  ? -14.531 5.896   3.975   1.00 0.00 ? 181 PHE A HB2  1  
ATOM   359   H  HB3  . PHE A 1 26  ? -15.976 6.039   4.973   1.00 0.00 ? 181 PHE A HB3  1  
ATOM   360   H  HD1  . PHE A 1 26  ? -12.484 4.901   5.800   1.00 0.00 ? 181 PHE A HD1  1  
ATOM   361   H  HD2  . PHE A 1 26  ? -15.622 7.748   6.518   1.00 0.00 ? 181 PHE A HD2  1  
ATOM   362   H  HE1  . PHE A 1 26  ? -11.141 5.927   7.613   1.00 0.00 ? 181 PHE A HE1  1  
ATOM   363   H  HE2  . PHE A 1 26  ? -14.277 8.771   8.331   1.00 0.00 ? 181 PHE A HE2  1  
ATOM   364   H  HZ   . PHE A 1 26  ? -12.037 7.862   8.876   1.00 0.00 ? 181 PHE A HZ   1  
ATOM   365   N  N    . GLN A 1 27  ? -15.122 2.637   7.027   1.00 0.00 ? 182 GLN A N    1  
ATOM   366   C  CA   . GLN A 1 27  ? -15.661 2.201   8.353   1.00 0.00 ? 182 GLN A CA   1  
ATOM   367   C  C    . GLN A 1 27  ? -14.618 2.448   9.455   1.00 0.00 ? 182 GLN A C    1  
ATOM   368   O  O    . GLN A 1 27  ? -13.428 2.423   9.204   1.00 0.00 ? 182 GLN A O    1  
ATOM   369   C  CB   . GLN A 1 27  ? -15.945 0.703   8.199   1.00 0.00 ? 182 GLN A CB   1  
ATOM   370   C  CG   . GLN A 1 27  ? -16.588 0.161   9.479   1.00 0.00 ? 182 GLN A CG   1  
ATOM   371   C  CD   . GLN A 1 27  ? -17.704 -0.828  9.120   1.00 0.00 ? 182 GLN A CD   1  
ATOM   372   O  OE1  . GLN A 1 27  ? -18.862 -0.459  9.080   1.00 0.00 ? 182 GLN A OE1  1  
ATOM   373   N  NE2  . GLN A 1 27  ? -17.411 -2.078  8.853   1.00 0.00 ? 182 GLN A NE2  1  
ATOM   374   H  H    . GLN A 1 27  ? -14.401 2.121   6.601   1.00 0.00 ? 182 GLN A H    1  
ATOM   375   H  HA   . GLN A 1 27  ? -16.574 2.727   8.576   1.00 0.00 ? 182 GLN A HA   1  
ATOM   376   H  HB2  . GLN A 1 27  ? -16.615 0.551   7.365   1.00 0.00 ? 182 GLN A HB2  1  
ATOM   377   H  HB3  . GLN A 1 27  ? -15.022 0.180   8.016   1.00 0.00 ? 182 GLN A HB3  1  
ATOM   378   H  HG2  . GLN A 1 27  ? -15.836 -0.346  10.067  1.00 0.00 ? 182 GLN A HG2  1  
ATOM   379   H  HG3  . GLN A 1 27  ? -17.002 0.977   10.051  1.00 0.00 ? 182 GLN A HG3  1  
ATOM   380   H  HE21 . GLN A 1 27  ? -16.480 -2.387  8.882   1.00 0.00 ? 182 GLN A HE21 1  
ATOM   381   H  HE22 . GLN A 1 27  ? -18.126 -2.708  8.624   1.00 0.00 ? 182 GLN A HE22 1  
ATOM   382   N  N    . LYS A 1 28  ? -15.052 2.706   10.674  1.00 0.00 ? 183 LYS A N    1  
ATOM   383   C  CA   . LYS A 1 28  ? -14.067 2.974   11.788  1.00 0.00 ? 183 LYS A CA   1  
ATOM   384   C  C    . LYS A 1 28  ? -12.977 1.884   11.874  1.00 0.00 ? 183 LYS A C    1  
ATOM   385   O  O    . LYS A 1 28  ? -11.871 2.155   12.307  1.00 0.00 ? 183 LYS A O    1  
ATOM   386   C  CB   . LYS A 1 28  ? -14.880 3.013   13.097  1.00 0.00 ? 183 LYS A CB   1  
ATOM   387   C  CG   . LYS A 1 28  ? -15.550 1.656   13.342  1.00 0.00 ? 183 LYS A CG   1  
ATOM   388   C  CD   . LYS A 1 28  ? -16.732 1.836   14.298  1.00 0.00 ? 183 LYS A CD   1  
ATOM   389   C  CE   . LYS A 1 28  ? -16.868 0.595   15.184  1.00 0.00 ? 183 LYS A CE   1  
ATOM   390   N  NZ   . LYS A 1 28  ? -18.308 0.549   15.561  1.00 0.00 ? 183 LYS A NZ   1  
ATOM   391   H  H    . LYS A 1 28  ? -16.023 2.737   10.850  1.00 0.00 ? 183 LYS A H    1  
ATOM   392   H  HA   . LYS A 1 28  ? -13.605 3.932   11.632  1.00 0.00 ? 183 LYS A HA   1  
ATOM   393   H  HB2  . LYS A 1 28  ? -14.220 3.240   13.921  1.00 0.00 ? 183 LYS A HB2  1  
ATOM   394   H  HB3  . LYS A 1 28  ? -15.639 3.777   13.026  1.00 0.00 ? 183 LYS A HB3  1  
ATOM   395   H  HG2  . LYS A 1 28  ? -15.901 1.251   12.405  1.00 0.00 ? 183 LYS A HG2  1  
ATOM   396   H  HG3  . LYS A 1 28  ? -14.836 0.976   13.783  1.00 0.00 ? 183 LYS A HG3  1  
ATOM   397   H  HD2  . LYS A 1 28  ? -16.566 2.705   14.917  1.00 0.00 ? 183 LYS A HD2  1  
ATOM   398   H  HD3  . LYS A 1 28  ? -17.639 1.969   13.727  1.00 0.00 ? 183 LYS A HD3  1  
ATOM   399   H  HE2  . LYS A 1 28  ? -16.592 -0.292  14.630  1.00 0.00 ? 183 LYS A HE2  1  
ATOM   400   H  HE3  . LYS A 1 28  ? -16.258 0.695   16.067  1.00 0.00 ? 183 LYS A HE3  1  
ATOM   401   H  HZ1  . LYS A 1 28  ? -18.555 1.406   16.094  1.00 0.00 ? 183 LYS A HZ1  1  
ATOM   402   H  HZ2  . LYS A 1 28  ? -18.484 -0.290  16.150  1.00 0.00 ? 183 LYS A HZ2  1  
ATOM   403   H  HZ3  . LYS A 1 28  ? -18.891 0.498   14.702  1.00 0.00 ? 183 LYS A HZ3  1  
ATOM   404   N  N    . ASP A 1 29  ? -13.268 0.659   11.489  1.00 0.00 ? 184 ASP A N    1  
ATOM   405   C  CA   . ASP A 1 29  ? -12.231 -0.414  11.586  1.00 0.00 ? 184 ASP A CA   1  
ATOM   406   C  C    . ASP A 1 29  ? -12.081 -1.181  10.261  1.00 0.00 ? 184 ASP A C    1  
ATOM   407   O  O    . ASP A 1 29  ? -11.842 -2.375  10.266  1.00 0.00 ? 184 ASP A O    1  
ATOM   408   C  CB   . ASP A 1 29  ? -12.735 -1.348  12.686  1.00 0.00 ? 184 ASP A CB   1  
ATOM   409   C  CG   . ASP A 1 29  ? -12.272 -0.829  14.048  1.00 0.00 ? 184 ASP A CG   1  
ATOM   410   O  OD1  . ASP A 1 29  ? -11.089 -0.932  14.329  1.00 0.00 ? 184 ASP A OD1  1  
ATOM   411   O  OD2  . ASP A 1 29  ? -13.107 -0.336  14.788  1.00 0.00 ? 184 ASP A OD2  1  
ATOM   412   H  H    . ASP A 1 29  ? -14.159 0.444   11.156  1.00 0.00 ? 184 ASP A H    1  
ATOM   413   H  HA   . ASP A 1 29  ? -11.283 0.010   11.877  1.00 0.00 ? 184 ASP A HA   1  
ATOM   414   H  HB2  . ASP A 1 29  ? -13.815 -1.383  12.661  1.00 0.00 ? 184 ASP A HB2  1  
ATOM   415   H  HB3  . ASP A 1 29  ? -12.338 -2.340  12.527  1.00 0.00 ? 184 ASP A HB3  1  
ATOM   416   N  N    . SER A 1 30  ? -12.196 -0.517  9.129   1.00 0.00 ? 185 SER A N    1  
ATOM   417   C  CA   . SER A 1 30  ? -12.027 -1.245  7.825   1.00 0.00 ? 185 SER A CA   1  
ATOM   418   C  C    . SER A 1 30  ? -10.575 -1.104  7.338   1.00 0.00 ? 185 SER A C    1  
ATOM   419   O  O    . SER A 1 30  ? -9.838  -2.066  7.320   1.00 0.00 ? 185 SER A O    1  
ATOM   420   C  CB   . SER A 1 30  ? -12.996 -0.593  6.834   1.00 0.00 ? 185 SER A CB   1  
ATOM   421   O  OG   . SER A 1 30  ? -12.481 -0.729  5.515   1.00 0.00 ? 185 SER A OG   1  
ATOM   422   H  H    . SER A 1 30  ? -12.373 0.452   9.137   1.00 0.00 ? 185 SER A H    1  
ATOM   423   H  HA   . SER A 1 30  ? -12.276 -2.288  7.949   1.00 0.00 ? 185 SER A HA   1  
ATOM   424   H  HB2  . SER A 1 30  ? -13.955 -1.079  6.891   1.00 0.00 ? 185 SER A HB2  1  
ATOM   425   H  HB3  . SER A 1 30  ? -13.110 0.454   7.081   1.00 0.00 ? 185 SER A HB3  1  
ATOM   426   H  HG   . SER A 1 30  ? -13.117 -0.344  4.908   1.00 0.00 ? 185 SER A HG   1  
ATOM   427   N  N    . ILE A 1 31  ? -10.158 0.084   6.935   1.00 0.00 ? 186 ILE A N    1  
ATOM   428   C  CA   . ILE A 1 31  ? -8.736  0.263   6.442   1.00 0.00 ? 186 ILE A CA   1  
ATOM   429   C  C    . ILE A 1 31  ? -7.716  -0.338  7.426   1.00 0.00 ? 186 ILE A C    1  
ATOM   430   O  O    . ILE A 1 31  ? -7.992  -0.496  8.600   1.00 0.00 ? 186 ILE A O    1  
ATOM   431   C  CB   . ILE A 1 31  ? -8.483  1.777   6.312   1.00 0.00 ? 186 ILE A CB   1  
ATOM   432   C  CG1  . ILE A 1 31  ? -8.775  2.479   7.645   1.00 0.00 ? 186 ILE A CG1  1  
ATOM   433   C  CG2  . ILE A 1 31  ? -9.376  2.361   5.219   1.00 0.00 ? 186 ILE A CG2  1  
ATOM   434   C  CD1  . ILE A 1 31  ? -8.315  3.934   7.564   1.00 0.00 ? 186 ILE A CD1  1  
ATOM   435   H  H    . ILE A 1 31  ? -10.779 0.847   6.945   1.00 0.00 ? 186 ILE A H    1  
ATOM   436   H  HA   . ILE A 1 31  ? -8.619  -0.205  5.477   1.00 0.00 ? 186 ILE A HA   1  
ATOM   437   H  HB   . ILE A 1 31  ? -7.448  1.938   6.044   1.00 0.00 ? 186 ILE A HB   1  
ATOM   438   H  HG12 . ILE A 1 31  ? -9.833  2.453   7.851   1.00 0.00 ? 186 ILE A HG12 1  
ATOM   439   H  HG13 . ILE A 1 31  ? -8.241  1.980   8.440   1.00 0.00 ? 186 ILE A HG13 1  
ATOM   440   H  HG21 . ILE A 1 31  ? -8.986  3.322   4.916   1.00 0.00 ? 186 ILE A HG21 1  
ATOM   441   H  HG22 . ILE A 1 31  ? -10.379 2.483   5.597   1.00 0.00 ? 186 ILE A HG22 1  
ATOM   442   H  HG23 . ILE A 1 31  ? -9.387  1.691   4.369   1.00 0.00 ? 186 ILE A HG23 1  
ATOM   443   H  HD11 . ILE A 1 31  ? -9.099  4.535   7.127   1.00 0.00 ? 186 ILE A HD11 1  
ATOM   444   H  HD12 . ILE A 1 31  ? -7.429  3.998   6.952   1.00 0.00 ? 186 ILE A HD12 1  
ATOM   445   H  HD13 . ILE A 1 31  ? -8.095  4.297   8.556   1.00 0.00 ? 186 ILE A HD13 1  
ATOM   446   N  N    . TYR A 1 32  ? -6.534  -0.667  6.947   1.00 0.00 ? 187 TYR A N    1  
ATOM   447   C  CA   . TYR A 1 32  ? -5.486  -1.251  7.838   1.00 0.00 ? 187 TYR A CA   1  
ATOM   448   C  C    . TYR A 1 32  ? -4.124  -0.629  7.525   1.00 0.00 ? 187 TYR A C    1  
ATOM   449   O  O    . TYR A 1 32  ? -3.972  0.087   6.552   1.00 0.00 ? 187 TYR A O    1  
ATOM   450   C  CB   . TYR A 1 32  ? -5.469  -2.744  7.509   1.00 0.00 ? 187 TYR A CB   1  
ATOM   451   C  CG   . TYR A 1 32  ? -6.421  -3.476  8.420   1.00 0.00 ? 187 TYR A CG   1  
ATOM   452   C  CD1  . TYR A 1 32  ? -5.985  -3.939  9.668   1.00 0.00 ? 187 TYR A CD1  1  
ATOM   453   C  CD2  . TYR A 1 32  ? -7.741  -3.695  8.014   1.00 0.00 ? 187 TYR A CD2  1  
ATOM   454   C  CE1  . TYR A 1 32  ? -6.873  -4.622  10.508  1.00 0.00 ? 187 TYR A CE1  1  
ATOM   455   C  CE2  . TYR A 1 32  ? -8.628  -4.378  8.853   1.00 0.00 ? 187 TYR A CE2  1  
ATOM   456   C  CZ   . TYR A 1 32  ? -8.194  -4.842  10.101  1.00 0.00 ? 187 TYR A CZ   1  
ATOM   457   O  OH   . TYR A 1 32  ? -9.069  -5.515  10.929  1.00 0.00 ? 187 TYR A OH   1  
ATOM   458   H  H    . TYR A 1 32  ? -6.332  -0.528  5.994   1.00 0.00 ? 187 TYR A H    1  
ATOM   459   H  HA   . TYR A 1 32  ? -5.730  -1.102  8.878   1.00 0.00 ? 187 TYR A HA   1  
ATOM   460   H  HB2  . TYR A 1 32  ? -5.769  -2.889  6.482   1.00 0.00 ? 187 TYR A HB2  1  
ATOM   461   H  HB3  . TYR A 1 32  ? -4.470  -3.130  7.650   1.00 0.00 ? 187 TYR A HB3  1  
ATOM   462   H  HD1  . TYR A 1 32  ? -4.966  -3.769  9.981   1.00 0.00 ? 187 TYR A HD1  1  
ATOM   463   H  HD2  . TYR A 1 32  ? -8.074  -3.340  7.049   1.00 0.00 ? 187 TYR A HD2  1  
ATOM   464   H  HE1  . TYR A 1 32  ? -6.536  -4.981  11.471  1.00 0.00 ? 187 TYR A HE1  1  
ATOM   465   H  HE2  . TYR A 1 32  ? -9.646  -4.547  8.536   1.00 0.00 ? 187 TYR A HE2  1  
ATOM   466   H  HH   . TYR A 1 32  ? -8.977  -6.455  10.756  1.00 0.00 ? 187 TYR A HH   1  
ATOM   467   N  N    . ARG A 1 33  ? -3.130  -0.902  8.337   1.00 0.00 ? 188 ARG A N    1  
ATOM   468   C  CA   . ARG A 1 33  ? -1.775  -0.332  8.079   1.00 0.00 ? 188 ARG A CA   1  
ATOM   469   C  C    . ARG A 1 33  ? -0.804  -1.456  7.701   1.00 0.00 ? 188 ARG A C    1  
ATOM   470   O  O    . ARG A 1 33  ? -0.663  -2.418  8.431   1.00 0.00 ? 188 ARG A O    1  
ATOM   471   C  CB   . ARG A 1 33  ? -1.349  0.319   9.397   1.00 0.00 ? 188 ARG A CB   1  
ATOM   472   C  CG   . ARG A 1 33  ? -2.300  1.467   9.736   1.00 0.00 ? 188 ARG A CG   1  
ATOM   473   C  CD   . ARG A 1 33  ? -1.730  2.276   10.904  1.00 0.00 ? 188 ARG A CD   1  
ATOM   474   N  NE   . ARG A 1 33  ? -1.919  1.412   12.103  1.00 0.00 ? 188 ARG A NE   1  
ATOM   475   C  CZ   . ARG A 1 33  ? -0.900  1.122   12.866  1.00 0.00 ? 188 ARG A CZ   1  
ATOM   476   N  NH1  . ARG A 1 33  ? 0.106   0.445   12.381  1.00 0.00 ? 188 ARG A NH1  1  
ATOM   477   N  NH2  . ARG A 1 33  ? -0.887  1.509   14.112  1.00 0.00 ? 188 ARG A NH2  1  
ATOM   478   H  H    . ARG A 1 33  ? -3.274  -1.492  9.115   1.00 0.00 ? 188 ARG A H    1  
ATOM   479   H  HA   . ARG A 1 33  ? -1.820  0.411   7.295   1.00 0.00 ? 188 ARG A HA   1  
ATOM   480   H  HB2  . ARG A 1 33  ? -1.378  -0.417  10.187  1.00 0.00 ? 188 ARG A HB2  1  
ATOM   481   H  HB3  . ARG A 1 33  ? -0.344  0.704   9.300   1.00 0.00 ? 188 ARG A HB3  1  
ATOM   482   H  HG2  . ARG A 1 33  ? -2.411  2.108   8.872   1.00 0.00 ? 188 ARG A HG2  1  
ATOM   483   H  HG3  . ARG A 1 33  ? -3.263  1.067   10.014  1.00 0.00 ? 188 ARG A HG3  1  
ATOM   484   H  HD2  . ARG A 1 33  ? -0.679  2.477   10.744  1.00 0.00 ? 188 ARG A HD2  1  
ATOM   485   H  HD3  . ARG A 1 33  ? -2.276  3.199   11.024  1.00 0.00 ? 188 ARG A HD3  1  
ATOM   486   H  HE   . ARG A 1 33  ? -2.809  1.063   12.322  1.00 0.00 ? 188 ARG A HE   1  
ATOM   487   H  HH11 . ARG A 1 33  ? 0.097   0.149   11.427  1.00 0.00 ? 188 ARG A HH11 1  
ATOM   488   H  HH12 . ARG A 1 33  ? 0.887   0.224   12.966  1.00 0.00 ? 188 ARG A HH12 1  
ATOM   489   H  HH21 . ARG A 1 33  ? -1.657  2.027   14.482  1.00 0.00 ? 188 ARG A HH21 1  
ATOM   490   H  HH22 . ARG A 1 33  ? -0.106  1.286   14.696  1.00 0.00 ? 188 ARG A HH22 1  
ATOM   491   N  N    . HIS A 1 34  ? -0.121  -1.348  6.578   1.00 0.00 ? 189 HIS A N    1  
ATOM   492   C  CA   . HIS A 1 34  ? 0.844   -2.434  6.199   1.00 0.00 ? 189 HIS A CA   1  
ATOM   493   C  C    . HIS A 1 34  ? 1.974   -2.464  7.244   1.00 0.00 ? 189 HIS A C    1  
ATOM   494   O  O    . HIS A 1 34  ? 2.511   -1.428  7.585   1.00 0.00 ? 189 HIS A O    1  
ATOM   495   C  CB   . HIS A 1 34  ? 1.381   -2.077  4.804   1.00 0.00 ? 189 HIS A CB   1  
ATOM   496   C  CG   . HIS A 1 34  ? 1.702   -3.340  4.053   1.00 0.00 ? 189 HIS A CG   1  
ATOM   497   N  ND1  . HIS A 1 34  ? 2.726   -4.180  4.440   1.00 0.00 ? 189 HIS A ND1  1  
ATOM   498   C  CD2  . HIS A 1 34  ? 1.143   -3.918  2.942   1.00 0.00 ? 189 HIS A CD2  1  
ATOM   499   C  CE1  . HIS A 1 34  ? 2.758   -5.211  3.581   1.00 0.00 ? 189 HIS A CE1  1  
ATOM   500   N  NE2  . HIS A 1 34  ? 1.813   -5.103  2.644   1.00 0.00 ? 189 HIS A NE2  1  
ATOM   501   H  H    . HIS A 1 34  ? -0.235  -0.554  6.001   1.00 0.00 ? 189 HIS A H    1  
ATOM   502   H  HA   . HIS A 1 34  ? 0.332   -3.381  6.165   1.00 0.00 ? 189 HIS A HA   1  
ATOM   503   H  HB2  . HIS A 1 34  ? 0.630   -1.520  4.264   1.00 0.00 ? 189 HIS A HB2  1  
ATOM   504   H  HB3  . HIS A 1 34  ? 2.270   -1.476  4.905   1.00 0.00 ? 189 HIS A HB3  1  
ATOM   505   H  HD1  . HIS A 1 34  ? 3.313   -4.052  5.202   1.00 0.00 ? 189 HIS A HD1  1  
ATOM   506   H  HD2  . HIS A 1 34  ? 0.311   -3.516  2.384   1.00 0.00 ? 189 HIS A HD2  1  
ATOM   507   H  HE1  . HIS A 1 34  ? 3.467   -6.025  3.642   1.00 0.00 ? 189 HIS A HE1  1  
ATOM   508   N  N    . PRO A 1 35  ? 2.280   -3.637  7.758   1.00 0.00 ? 190 PRO A N    1  
ATOM   509   C  CA   . PRO A 1 35  ? 3.325   -3.741  8.807   1.00 0.00 ? 190 PRO A CA   1  
ATOM   510   C  C    . PRO A 1 35  ? 4.745   -3.559  8.231   1.00 0.00 ? 190 PRO A C    1  
ATOM   511   O  O    . PRO A 1 35  ? 5.499   -2.733  8.709   1.00 0.00 ? 190 PRO A O    1  
ATOM   512   C  CB   . PRO A 1 35  ? 3.118   -5.143  9.379   1.00 0.00 ? 190 PRO A CB   1  
ATOM   513   C  CG   . PRO A 1 35  ? 2.455   -5.930  8.292   1.00 0.00 ? 190 PRO A CG   1  
ATOM   514   C  CD   . PRO A 1 35  ? 1.705   -4.955  7.423   1.00 0.00 ? 190 PRO A CD   1  
ATOM   515   H  HA   . PRO A 1 35  ? 3.144   -3.009  9.578   1.00 0.00 ? 190 PRO A HA   1  
ATOM   516   H  HB2  . PRO A 1 35  ? 4.068   -5.586  9.642   1.00 0.00 ? 190 PRO A HB2  1  
ATOM   517   H  HB3  . PRO A 1 35  ? 2.469   -5.099  10.243  1.00 0.00 ? 190 PRO A HB3  1  
ATOM   518   H  HG2  . PRO A 1 35  ? 3.198   -6.455  7.708   1.00 0.00 ? 190 PRO A HG2  1  
ATOM   519   H  HG3  . PRO A 1 35  ? 1.761   -6.637  8.721   1.00 0.00 ? 190 PRO A HG3  1  
ATOM   520   H  HD2  . PRO A 1 35  ? 1.864   -5.184  6.378   1.00 0.00 ? 190 PRO A HD2  1  
ATOM   521   H  HD3  . PRO A 1 35  ? 0.653   -4.970  7.659   1.00 0.00 ? 190 PRO A HD3  1  
ATOM   522   N  N    . SER A 1 36  ? 5.126   -4.323  7.230   1.00 0.00 ? 191 SER A N    1  
ATOM   523   C  CA   . SER A 1 36  ? 6.521   -4.177  6.664   1.00 0.00 ? 191 SER A CA   1  
ATOM   524   C  C    . SER A 1 36  ? 6.713   -2.873  5.851   1.00 0.00 ? 191 SER A C    1  
ATOM   525   O  O    . SER A 1 36  ? 7.831   -2.553  5.489   1.00 0.00 ? 191 SER A O    1  
ATOM   526   C  CB   . SER A 1 36  ? 6.741   -5.391  5.748   1.00 0.00 ? 191 SER A CB   1  
ATOM   527   O  OG   . SER A 1 36  ? 6.933   -6.552  6.545   1.00 0.00 ? 191 SER A OG   1  
ATOM   528   H  H    . SER A 1 36  ? 4.511   -4.999  6.867   1.00 0.00 ? 191 SER A H    1  
ATOM   529   H  HA   . SER A 1 36  ? 7.240   -4.209  7.467   1.00 0.00 ? 191 SER A HA   1  
ATOM   530   H  HB2  . SER A 1 36  ? 5.877   -5.531  5.117   1.00 0.00 ? 191 SER A HB2  1  
ATOM   531   H  HB3  . SER A 1 36  ? 7.612   -5.219  5.128   1.00 0.00 ? 191 SER A HB3  1  
ATOM   532   H  HG   . SER A 1 36  ? 6.991   -7.309  5.957   1.00 0.00 ? 191 SER A HG   1  
ATOM   533   N  N    . LEU A 1 37  ? 5.667   -2.127  5.532   1.00 0.00 ? 192 LEU A N    1  
ATOM   534   C  CA   . LEU A 1 37  ? 5.874   -0.878  4.716   1.00 0.00 ? 192 LEU A CA   1  
ATOM   535   C  C    . LEU A 1 37  ? 5.355   0.413   5.397   1.00 0.00 ? 192 LEU A C    1  
ATOM   536   O  O    . LEU A 1 37  ? 5.478   1.481   4.827   1.00 0.00 ? 192 LEU A O    1  
ATOM   537   C  CB   . LEU A 1 37  ? 5.099   -1.119  3.416   1.00 0.00 ? 192 LEU A CB   1  
ATOM   538   C  CG   . LEU A 1 37  ? 5.573   -2.408  2.727   1.00 0.00 ? 192 LEU A CG   1  
ATOM   539   C  CD1  . LEU A 1 37  ? 4.840   -2.547  1.393   1.00 0.00 ? 192 LEU A CD1  1  
ATOM   540   C  CD2  . LEU A 1 37  ? 7.085   -2.348  2.467   1.00 0.00 ? 192 LEU A CD2  1  
ATOM   541   H  H    . LEU A 1 37  ? 4.766   -2.387  5.798   1.00 0.00 ? 192 LEU A H    1  
ATOM   542   H  HA   . LEU A 1 37  ? 6.922   -0.767  4.483   1.00 0.00 ? 192 LEU A HA   1  
ATOM   543   H  HB2  . LEU A 1 37  ? 4.046   -1.202  3.642   1.00 0.00 ? 192 LEU A HB2  1  
ATOM   544   H  HB3  . LEU A 1 37  ? 5.255   -0.282  2.750   1.00 0.00 ? 192 LEU A HB3  1  
ATOM   545   H  HG   . LEU A 1 37  ? 5.342   -3.257  3.354   1.00 0.00 ? 192 LEU A HG   1  
ATOM   546   H  HD11 . LEU A 1 37  ? 5.332   -3.293  0.785   1.00 0.00 ? 192 LEU A HD11 1  
ATOM   547   H  HD12 . LEU A 1 37  ? 4.855   -1.595  0.879   1.00 0.00 ? 192 LEU A HD12 1  
ATOM   548   H  HD13 . LEU A 1 37  ? 3.815   -2.845  1.572   1.00 0.00 ? 192 LEU A HD13 1  
ATOM   549   H  HD21 . LEU A 1 37  ? 7.400   -1.317  2.408   1.00 0.00 ? 192 LEU A HD21 1  
ATOM   550   H  HD22 . LEU A 1 37  ? 7.311   -2.849  1.536   1.00 0.00 ? 192 LEU A HD22 1  
ATOM   551   H  HD23 . LEU A 1 37  ? 7.608   -2.840  3.274   1.00 0.00 ? 192 LEU A HD23 1  
ATOM   552   N  N    . GLN A 1 38  ? 4.786   0.356   6.590   1.00 0.00 ? 193 GLN A N    1  
ATOM   553   C  CA   . GLN A 1 38  ? 4.286   1.610   7.251   1.00 0.00 ? 193 GLN A CA   1  
ATOM   554   C  C    . GLN A 1 38  ? 3.332   2.397   6.327   1.00 0.00 ? 193 GLN A C    1  
ATOM   555   O  O    . GLN A 1 38  ? 3.298   3.612   6.373   1.00 0.00 ? 193 GLN A O    1  
ATOM   556   C  CB   . GLN A 1 38  ? 5.540   2.441   7.553   1.00 0.00 ? 193 GLN A CB   1  
ATOM   557   C  CG   . GLN A 1 38  ? 6.180   1.945   8.852   1.00 0.00 ? 193 GLN A CG   1  
ATOM   558   C  CD   . GLN A 1 38  ? 5.412   2.513   10.051  1.00 0.00 ? 193 GLN A CD   1  
ATOM   559   O  OE1  . GLN A 1 38  ? 4.197   2.528   10.051  1.00 0.00 ? 193 GLN A OE1  1  
ATOM   560   N  NE2  . GLN A 1 38  ? 6.067   2.986   11.084  1.00 0.00 ? 193 GLN A NE2  1  
ATOM   561   H  H    . GLN A 1 38  ? 4.687   -0.496  7.055   1.00 0.00 ? 193 GLN A H    1  
ATOM   562   H  HA   . GLN A 1 38  ? 3.786   1.365   8.174   1.00 0.00 ? 193 GLN A HA   1  
ATOM   563   H  HB2  . GLN A 1 38  ? 6.246   2.340   6.741   1.00 0.00 ? 193 GLN A HB2  1  
ATOM   564   H  HB3  . GLN A 1 38  ? 5.267   3.480   7.664   1.00 0.00 ? 193 GLN A HB3  1  
ATOM   565   H  HG2  . GLN A 1 38  ? 6.147   0.866   8.880   1.00 0.00 ? 193 GLN A HG2  1  
ATOM   566   H  HG3  . GLN A 1 38  ? 7.207   2.275   8.896   1.00 0.00 ? 193 GLN A HG3  1  
ATOM   567   H  HE21 . GLN A 1 38  ? 7.049   2.978   11.095  1.00 0.00 ? 193 GLN A HE21 1  
ATOM   568   H  HE22 . GLN A 1 38  ? 5.574   3.347   11.850  1.00 0.00 ? 193 GLN A HE22 1  
ATOM   569   N  N    . VAL A 1 39  ? 2.546   1.728   5.506   1.00 0.00 ? 194 VAL A N    1  
ATOM   570   C  CA   . VAL A 1 39  ? 1.594   2.467   4.610   1.00 0.00 ? 194 VAL A CA   1  
ATOM   571   C  C    . VAL A 1 39  ? 0.160   1.982   4.858   1.00 0.00 ? 194 VAL A C    1  
ATOM   572   O  O    . VAL A 1 39  ? -0.057  1.017   5.563   1.00 0.00 ? 194 VAL A O    1  
ATOM   573   C  CB   . VAL A 1 39  ? 2.044   2.180   3.163   1.00 0.00 ? 194 VAL A CB   1  
ATOM   574   C  CG1  . VAL A 1 39  ? 3.524   2.554   2.988   1.00 0.00 ? 194 VAL A CG1  1  
ATOM   575   C  CG2  . VAL A 1 39  ? 1.835   0.695   2.816   1.00 0.00 ? 194 VAL A CG2  1  
ATOM   576   H  H    . VAL A 1 39  ? 2.568   0.746   5.484   1.00 0.00 ? 194 VAL A H    1  
ATOM   577   H  HA   . VAL A 1 39  ? 1.646   3.527   4.799   1.00 0.00 ? 194 VAL A HA   1  
ATOM   578   H  HB   . VAL A 1 39  ? 1.452   2.786   2.491   1.00 0.00 ? 194 VAL A HB   1  
ATOM   579   H  HG11 . VAL A 1 39  ? 3.604   3.381   2.298   1.00 0.00 ? 194 VAL A HG11 1  
ATOM   580   H  HG12 . VAL A 1 39  ? 4.072   1.707   2.599   1.00 0.00 ? 194 VAL A HG12 1  
ATOM   581   H  HG13 . VAL A 1 39  ? 3.940   2.842   3.941   1.00 0.00 ? 194 VAL A HG13 1  
ATOM   582   H  HG21 . VAL A 1 39  ? 1.506   0.161   3.693   1.00 0.00 ? 194 VAL A HG21 1  
ATOM   583   H  HG22 . VAL A 1 39  ? 2.761   0.268   2.460   1.00 0.00 ? 194 VAL A HG22 1  
ATOM   584   H  HG23 . VAL A 1 39  ? 1.082   0.617   2.044   1.00 0.00 ? 194 VAL A HG23 1  
ATOM   585   N  N    . LEU A 1 40  ? -0.818  2.649   4.293   1.00 0.00 ? 195 LEU A N    1  
ATOM   586   C  CA   . LEU A 1 40  ? -2.240  2.215   4.520   1.00 0.00 ? 195 LEU A CA   1  
ATOM   587   C  C    . LEU A 1 40  ? -2.692  1.206   3.452   1.00 0.00 ? 195 LEU A C    1  
ATOM   588   O  O    . LEU A 1 40  ? -2.393  1.353   2.282   1.00 0.00 ? 195 LEU A O    1  
ATOM   589   C  CB   . LEU A 1 40  ? -3.101  3.481   4.435   1.00 0.00 ? 195 LEU A CB   1  
ATOM   590   C  CG   . LEU A 1 40  ? -4.452  3.224   5.111   1.00 0.00 ? 195 LEU A CG   1  
ATOM   591   C  CD1  . LEU A 1 40  ? -4.899  4.478   5.862   1.00 0.00 ? 195 LEU A CD1  1  
ATOM   592   C  CD2  . LEU A 1 40  ? -5.496  2.871   4.048   1.00 0.00 ? 195 LEU A CD2  1  
ATOM   593   H  H    . LEU A 1 40  ? -0.616  3.435   3.732   1.00 0.00 ? 195 LEU A H    1  
ATOM   594   H  HA   . LEU A 1 40  ? -2.338  1.777   5.501   1.00 0.00 ? 195 LEU A HA   1  
ATOM   595   H  HB2  . LEU A 1 40  ? -2.593  4.291   4.935   1.00 0.00 ? 195 LEU A HB2  1  
ATOM   596   H  HB3  . LEU A 1 40  ? -3.259  3.741   3.400   1.00 0.00 ? 195 LEU A HB3  1  
ATOM   597   H  HG   . LEU A 1 40  ? -4.356  2.405   5.810   1.00 0.00 ? 195 LEU A HG   1  
ATOM   598   H  HD11 . LEU A 1 40  ? -5.468  4.191   6.733   1.00 0.00 ? 195 LEU A HD11 1  
ATOM   599   H  HD12 . LEU A 1 40  ? -5.514  5.086   5.215   1.00 0.00 ? 195 LEU A HD12 1  
ATOM   600   H  HD13 . LEU A 1 40  ? -4.032  5.043   6.170   1.00 0.00 ? 195 LEU A HD13 1  
ATOM   601   H  HD21 . LEU A 1 40  ? -5.232  1.932   3.583   1.00 0.00 ? 195 LEU A HD21 1  
ATOM   602   H  HD22 . LEU A 1 40  ? -5.525  3.648   3.300   1.00 0.00 ? 195 LEU A HD22 1  
ATOM   603   H  HD23 . LEU A 1 40  ? -6.467  2.782   4.513   1.00 0.00 ? 195 LEU A HD23 1  
ATOM   604   N  N    . ILE A 1 41  ? -3.430  0.189   3.848   1.00 0.00 ? 196 ILE A N    1  
ATOM   605   C  CA   . ILE A 1 41  ? -3.928  -0.823  2.866   1.00 0.00 ? 196 ILE A CA   1  
ATOM   606   C  C    . ILE A 1 41  ? -5.419  -1.087  3.145   1.00 0.00 ? 196 ILE A C    1  
ATOM   607   O  O    . ILE A 1 41  ? -6.042  -0.345  3.882   1.00 0.00 ? 196 ILE A O    1  
ATOM   608   C  CB   . ILE A 1 41  ? -3.073  -2.089  3.083   1.00 0.00 ? 196 ILE A CB   1  
ATOM   609   C  CG1  . ILE A 1 41  ? -3.079  -2.495  4.564   1.00 0.00 ? 196 ILE A CG1  1  
ATOM   610   C  CG2  . ILE A 1 41  ? -1.633  -1.823  2.629   1.00 0.00 ? 196 ILE A CG2  1  
ATOM   611   C  CD1  . ILE A 1 41  ? -2.336  -3.822  4.737   1.00 0.00 ? 196 ILE A CD1  1  
ATOM   612   H  H    . ILE A 1 41  ? -3.676  0.097   4.795   1.00 0.00 ? 196 ILE A H    1  
ATOM   613   H  HA   . ILE A 1 41  ? -3.799  -0.459  1.858   1.00 0.00 ? 196 ILE A HA   1  
ATOM   614   H  HB   . ILE A 1 41  ? -3.477  -2.897  2.491   1.00 0.00 ? 196 ILE A HB   1  
ATOM   615   H  HG12 . ILE A 1 41  ? -2.588  -1.729  5.149   1.00 0.00 ? 196 ILE A HG12 1  
ATOM   616   H  HG13 . ILE A 1 41  ? -4.098  -2.608  4.903   1.00 0.00 ? 196 ILE A HG13 1  
ATOM   617   H  HG21 . ILE A 1 41  ? -0.944  -2.287  3.320   1.00 0.00 ? 196 ILE A HG21 1  
ATOM   618   H  HG22 . ILE A 1 41  ? -1.451  -0.760  2.601   1.00 0.00 ? 196 ILE A HG22 1  
ATOM   619   H  HG23 . ILE A 1 41  ? -1.484  -2.240  1.642   1.00 0.00 ? 196 ILE A HG23 1  
ATOM   620   H  HD11 . ILE A 1 41  ? -1.759  -3.796  5.649   1.00 0.00 ? 196 ILE A HD11 1  
ATOM   621   H  HD12 . ILE A 1 41  ? -1.672  -3.977  3.898   1.00 0.00 ? 196 ILE A HD12 1  
ATOM   622   H  HD13 . ILE A 1 41  ? -3.049  -4.631  4.785   1.00 0.00 ? 196 ILE A HD13 1  
ATOM   623   N  N    . CYS A 1 42  ? -6.005  -2.117  2.571   1.00 0.00 ? 197 CYS A N    1  
ATOM   624   C  CA   . CYS A 1 42  ? -7.454  -2.383  2.825   1.00 0.00 ? 197 CYS A CA   1  
ATOM   625   C  C    . CYS A 1 42  ? -7.625  -3.676  3.648   1.00 0.00 ? 197 CYS A C    1  
ATOM   626   O  O    . CYS A 1 42  ? -6.735  -4.503  3.694   1.00 0.00 ? 197 CYS A O    1  
ATOM   627   C  CB   . CYS A 1 42  ? -8.109  -2.481  1.429   1.00 0.00 ? 197 CYS A CB   1  
ATOM   628   S  SG   . CYS A 1 42  ? -7.567  -3.967  0.531   1.00 0.00 ? 197 CYS A SG   1  
ATOM   629   H  H    . CYS A 1 42  ? -5.503  -2.708  1.979   1.00 0.00 ? 197 CYS A H    1  
ATOM   630   H  HA   . CYS A 1 42  ? -7.886  -1.550  3.365   1.00 0.00 ? 197 CYS A HA   1  
ATOM   631   H  HB2  . CYS A 1 42  ? -9.181  -2.514  1.544   1.00 0.00 ? 197 CYS A HB2  1  
ATOM   632   H  HB3  . CYS A 1 42  ? -7.843  -1.604  0.856   1.00 0.00 ? 197 CYS A HB3  1  
ATOM   633   N  N    . LYS A 1 43  ? -8.752  -3.847  4.317   1.00 0.00 ? 198 LYS A N    1  
ATOM   634   C  CA   . LYS A 1 43  ? -8.961  -5.088  5.160   1.00 0.00 ? 198 LYS A CA   1  
ATOM   635   C  C    . LYS A 1 43  ? -8.598  -6.371  4.390   1.00 0.00 ? 198 LYS A C    1  
ATOM   636   O  O    . LYS A 1 43  ? -8.120  -7.325  4.978   1.00 0.00 ? 198 LYS A O    1  
ATOM   637   C  CB   . LYS A 1 43  ? -10.447 -5.103  5.551   1.00 0.00 ? 198 LYS A CB   1  
ATOM   638   C  CG   . LYS A 1 43  ? -10.726 -6.285  6.484   1.00 0.00 ? 198 LYS A CG   1  
ATOM   639   C  CD   . LYS A 1 43  ? -12.183 -6.238  6.947   1.00 0.00 ? 198 LYS A CD   1  
ATOM   640   C  CE   . LYS A 1 43  ? -12.624 -7.636  7.387   1.00 0.00 ? 198 LYS A CE   1  
ATOM   641   N  NZ   . LYS A 1 43  ? -14.032 -7.469  7.843   1.00 0.00 ? 198 LYS A NZ   1  
ATOM   642   H  H    . LYS A 1 43  ? -9.452  -3.151  4.278   1.00 0.00 ? 198 LYS A H    1  
ATOM   643   H  HA   . LYS A 1 43  ? -8.362  -5.027  6.048   1.00 0.00 ? 198 LYS A HA   1  
ATOM   644   H  HB2  . LYS A 1 43  ? -10.689 -4.180  6.059   1.00 0.00 ? 198 LYS A HB2  1  
ATOM   645   H  HB3  . LYS A 1 43  ? -11.054 -5.196  4.663   1.00 0.00 ? 198 LYS A HB3  1  
ATOM   646   H  HG2  . LYS A 1 43  ? -10.543 -7.210  5.957   1.00 0.00 ? 198 LYS A HG2  1  
ATOM   647   H  HG3  . LYS A 1 43  ? -10.075 -6.225  7.344   1.00 0.00 ? 198 LYS A HG3  1  
ATOM   648   H  HD2  . LYS A 1 43  ? -12.275 -5.553  7.777   1.00 0.00 ? 198 LYS A HD2  1  
ATOM   649   H  HD3  . LYS A 1 43  ? -12.809 -5.905  6.133   1.00 0.00 ? 198 LYS A HD3  1  
ATOM   650   H  HE2  . LYS A 1 43  ? -12.575 -8.324  6.553   1.00 0.00 ? 198 LYS A HE2  1  
ATOM   651   H  HE3  . LYS A 1 43  ? -12.011 -7.986  8.202   1.00 0.00 ? 198 LYS A HE3  1  
ATOM   652   H  HZ1  . LYS A 1 43  ? -14.575 -6.963  7.115   1.00 0.00 ? 198 LYS A HZ1  1  
ATOM   653   H  HZ2  . LYS A 1 43  ? -14.046 -6.922  8.729   1.00 0.00 ? 198 LYS A HZ2  1  
ATOM   654   H  HZ3  . LYS A 1 43  ? -14.459 -8.403  8.003   1.00 0.00 ? 198 LYS A HZ3  1  
ATOM   655   N  N    . ASN A 1 44  ? -8.805  -6.409  3.093   1.00 0.00 ? 199 ASN A N    1  
ATOM   656   C  CA   . ASN A 1 44  ? -8.444  -7.655  2.325   1.00 0.00 ? 199 ASN A CA   1  
ATOM   657   C  C    . ASN A 1 44  ? -6.915  -7.807  2.218   1.00 0.00 ? 199 ASN A C    1  
ATOM   658   O  O    . ASN A 1 44  ? -6.419  -8.912  2.108   1.00 0.00 ? 199 ASN A O    1  
ATOM   659   C  CB   . ASN A 1 44  ? -9.070  -7.517  0.928   1.00 0.00 ? 199 ASN A CB   1  
ATOM   660   C  CG   . ASN A 1 44  ? -10.525 -8.001  0.970   1.00 0.00 ? 199 ASN A CG   1  
ATOM   661   O  OD1  . ASN A 1 44  ? -11.353 -7.400  1.626   1.00 0.00 ? 199 ASN A OD1  1  
ATOM   662   N  ND2  . ASN A 1 44  ? -10.880 -9.067  0.296   1.00 0.00 ? 199 ASN A ND2  1  
ATOM   663   H  H    . ASN A 1 44  ? -9.185  -5.627  2.630   1.00 0.00 ? 199 ASN A H    1  
ATOM   664   H  HA   . ASN A 1 44  ? -8.852  -8.516  2.826   1.00 0.00 ? 199 ASN A HA   1  
ATOM   665   H  HB2  . ASN A 1 44  ? -9.043  -6.481  0.623   1.00 0.00 ? 199 ASN A HB2  1  
ATOM   666   H  HB3  . ASN A 1 44  ? -8.513  -8.116  0.224   1.00 0.00 ? 199 ASN A HB3  1  
ATOM   667   H  HD21 . ASN A 1 44  ? -10.219 -9.561  -0.237  1.00 0.00 ? 199 ASN A HD21 1  
ATOM   668   H  HD22 . ASN A 1 44  ? -11.810 -9.375  0.323   1.00 0.00 ? 199 ASN A HD22 1  
ATOM   669   N  N    . CYS A 1 45  ? -6.159  -6.727  2.269   1.00 0.00 ? 200 CYS A N    1  
ATOM   670   C  CA   . CYS A 1 45  ? -4.665  -6.863  2.192   1.00 0.00 ? 200 CYS A CA   1  
ATOM   671   C  C    . CYS A 1 45  ? -4.145  -7.289  3.566   1.00 0.00 ? 200 CYS A C    1  
ATOM   672   O  O    . CYS A 1 45  ? -3.418  -8.253  3.687   1.00 0.00 ? 200 CYS A O    1  
ATOM   673   C  CB   . CYS A 1 45  ? -4.108  -5.479  1.817   1.00 0.00 ? 200 CYS A CB   1  
ATOM   674   S  SG   . CYS A 1 45  ? -4.096  -5.289  0.019   1.00 0.00 ? 200 CYS A SG   1  
ATOM   675   H  H    . CYS A 1 45  ? -6.567  -5.843  2.379   1.00 0.00 ? 200 CYS A H    1  
ATOM   676   H  HA   . CYS A 1 45  ? -4.392  -7.592  1.446   1.00 0.00 ? 200 CYS A HA   1  
ATOM   677   H  HB2  . CYS A 1 45  ? -4.727  -4.711  2.256   1.00 0.00 ? 200 CYS A HB2  1  
ATOM   678   H  HB3  . CYS A 1 45  ? -3.100  -5.385  2.195   1.00 0.00 ? 200 CYS A HB3  1  
ATOM   679   N  N    . PHE A 1 46  ? -4.528  -6.581  4.606   1.00 0.00 ? 201 PHE A N    1  
ATOM   680   C  CA   . PHE A 1 46  ? -4.058  -6.963  5.984   1.00 0.00 ? 201 PHE A CA   1  
ATOM   681   C  C    . PHE A 1 46  ? -4.548  -8.376  6.333   1.00 0.00 ? 201 PHE A C    1  
ATOM   682   O  O    . PHE A 1 46  ? -3.838  -9.132  6.972   1.00 0.00 ? 201 PHE A O    1  
ATOM   683   C  CB   . PHE A 1 46  ? -4.655  -5.932  6.957   1.00 0.00 ? 201 PHE A CB   1  
ATOM   684   C  CG   . PHE A 1 46  ? -3.825  -5.866  8.219   1.00 0.00 ? 201 PHE A CG   1  
ATOM   685   C  CD1  . PHE A 1 46  ? -2.694  -5.039  8.275   1.00 0.00 ? 201 PHE A CD1  1  
ATOM   686   C  CD2  . PHE A 1 46  ? -4.191  -6.626  9.337   1.00 0.00 ? 201 PHE A CD2  1  
ATOM   687   C  CE1  . PHE A 1 46  ? -1.932  -4.973  9.449   1.00 0.00 ? 201 PHE A CE1  1  
ATOM   688   C  CE2  . PHE A 1 46  ? -3.429  -6.560  10.509  1.00 0.00 ? 201 PHE A CE2  1  
ATOM   689   C  CZ   . PHE A 1 46  ? -2.299  -5.734  10.565  1.00 0.00 ? 201 PHE A CZ   1  
ATOM   690   H  H    . PHE A 1 46  ? -5.130  -5.810  4.478   1.00 0.00 ? 201 PHE A H    1  
ATOM   691   H  HA   . PHE A 1 46  ? -2.980  -6.933  6.024   1.00 0.00 ? 201 PHE A HA   1  
ATOM   692   H  HB2  . PHE A 1 46  ? -4.665  -4.959  6.486   1.00 0.00 ? 201 PHE A HB2  1  
ATOM   693   H  HB3  . PHE A 1 46  ? -5.665  -6.218  7.208   1.00 0.00 ? 201 PHE A HB3  1  
ATOM   694   H  HD1  . PHE A 1 46  ? -2.411  -4.453  7.414   1.00 0.00 ? 201 PHE A HD1  1  
ATOM   695   H  HD2  . PHE A 1 46  ? -5.062  -7.262  9.293   1.00 0.00 ? 201 PHE A HD2  1  
ATOM   696   H  HE1  . PHE A 1 46  ? -1.060  -4.334  9.494   1.00 0.00 ? 201 PHE A HE1  1  
ATOM   697   H  HE2  . PHE A 1 46  ? -3.713  -7.145  11.370  1.00 0.00 ? 201 PHE A HE2  1  
ATOM   698   H  HZ   . PHE A 1 46  ? -1.712  -5.683  11.470  1.00 0.00 ? 201 PHE A HZ   1  
ATOM   699   N  N    . LYS A 1 47  ? -5.741  -8.758  5.908   1.00 0.00 ? 202 LYS A N    1  
ATOM   700   C  CA   . LYS A 1 47  ? -6.219  -10.148 6.224   1.00 0.00 ? 202 LYS A CA   1  
ATOM   701   C  C    . LYS A 1 47  ? -5.555  -11.141 5.264   1.00 0.00 ? 202 LYS A C    1  
ATOM   702   O  O    . LYS A 1 47  ? -5.191  -12.230 5.660   1.00 0.00 ? 202 LYS A O    1  
ATOM   703   C  CB   . LYS A 1 47  ? -7.744  -10.152 6.039   1.00 0.00 ? 202 LYS A CB   1  
ATOM   704   C  CG   . LYS A 1 47  ? -8.411  -9.566  7.284   1.00 0.00 ? 202 LYS A CG   1  
ATOM   705   C  CD   . LYS A 1 47  ? -9.911  -9.863  7.247   1.00 0.00 ? 202 LYS A CD   1  
ATOM   706   C  CE   . LYS A 1 47  ? -10.159 -11.305 7.697   1.00 0.00 ? 202 LYS A CE   1  
ATOM   707   N  NZ   . LYS A 1 47  ? -11.354 -11.748 6.928   1.00 0.00 ? 202 LYS A NZ   1  
ATOM   708   H  H    . LYS A 1 47  ? -6.304  -8.146  5.372   1.00 0.00 ? 202 LYS A H    1  
ATOM   709   H  HA   . LYS A 1 47  ? -5.967  -10.404 7.242   1.00 0.00 ? 202 LYS A HA   1  
ATOM   710   H  HB2  . LYS A 1 47  ? -8.003  -9.555  5.176   1.00 0.00 ? 202 LYS A HB2  1  
ATOM   711   H  HB3  . LYS A 1 47  ? -8.086  -11.164 5.892   1.00 0.00 ? 202 LYS A HB3  1  
ATOM   712   H  HG2  . LYS A 1 47  ? -7.977  -10.011 8.168   1.00 0.00 ? 202 LYS A HG2  1  
ATOM   713   H  HG3  . LYS A 1 47  ? -8.259  -8.497  7.307   1.00 0.00 ? 202 LYS A HG3  1  
ATOM   714   H  HD2  . LYS A 1 47  ? -10.429 -9.184  7.908   1.00 0.00 ? 202 LYS A HD2  1  
ATOM   715   H  HD3  . LYS A 1 47  ? -10.280 -9.735  6.240   1.00 0.00 ? 202 LYS A HD3  1  
ATOM   716   H  HE2  . LYS A 1 47  ? -9.304  -11.923 7.460   1.00 0.00 ? 202 LYS A HE2  1  
ATOM   717   H  HE3  . LYS A 1 47  ? -10.367 -11.338 8.755   1.00 0.00 ? 202 LYS A HE3  1  
ATOM   718   H  HZ1  . LYS A 1 47  ? -12.172 -11.161 7.189   1.00 0.00 ? 202 LYS A HZ1  1  
ATOM   719   H  HZ2  . LYS A 1 47  ? -11.558 -12.745 7.147   1.00 0.00 ? 202 LYS A HZ2  1  
ATOM   720   H  HZ3  . LYS A 1 47  ? -11.169 -11.647 5.910   1.00 0.00 ? 202 LYS A HZ3  1  
ATOM   721   N  N    . TYR A 1 48  ? -5.374  -10.775 4.010   1.00 0.00 ? 203 TYR A N    1  
ATOM   722   C  CA   . TYR A 1 48  ? -4.704  -11.721 3.054   1.00 0.00 ? 203 TYR A CA   1  
ATOM   723   C  C    . TYR A 1 48  ? -3.201  -11.796 3.370   1.00 0.00 ? 203 TYR A C    1  
ATOM   724   O  O    . TYR A 1 48  ? -2.603  -12.851 3.261   1.00 0.00 ? 203 TYR A O    1  
ATOM   725   C  CB   . TYR A 1 48  ? -4.940  -11.159 1.642   1.00 0.00 ? 203 TYR A CB   1  
ATOM   726   C  CG   . TYR A 1 48  ? -4.320  -12.068 0.606   1.00 0.00 ? 203 TYR A CG   1  
ATOM   727   C  CD1  . TYR A 1 48  ? -4.574  -13.445 0.631   1.00 0.00 ? 203 TYR A CD1  1  
ATOM   728   C  CD2  . TYR A 1 48  ? -3.496  -11.525 -0.386  1.00 0.00 ? 203 TYR A CD2  1  
ATOM   729   C  CE1  . TYR A 1 48  ? -4.000  -14.280 -0.336  1.00 0.00 ? 203 TYR A CE1  1  
ATOM   730   C  CE2  . TYR A 1 48  ? -2.923  -12.360 -1.353  1.00 0.00 ? 203 TYR A CE2  1  
ATOM   731   C  CZ   . TYR A 1 48  ? -3.175  -13.738 -1.328  1.00 0.00 ? 203 TYR A CZ   1  
ATOM   732   O  OH   . TYR A 1 48  ? -2.611  -14.559 -2.282  1.00 0.00 ? 203 TYR A OH   1  
ATOM   733   H  H    . TYR A 1 48  ? -5.662  -9.881  3.708   1.00 0.00 ? 203 TYR A H    1  
ATOM   734   H  HA   . TYR A 1 48  ? -5.146  -12.704 3.139   1.00 0.00 ? 203 TYR A HA   1  
ATOM   735   H  HB2  . TYR A 1 48  ? -6.002  -11.082 1.460   1.00 0.00 ? 203 TYR A HB2  1  
ATOM   736   H  HB3  . TYR A 1 48  ? -4.494  -10.177 1.568   1.00 0.00 ? 203 TYR A HB3  1  
ATOM   737   H  HD1  . TYR A 1 48  ? -5.210  -13.864 1.397   1.00 0.00 ? 203 TYR A HD1  1  
ATOM   738   H  HD2  . TYR A 1 48  ? -3.302  -10.460 -0.403  1.00 0.00 ? 203 TYR A HD2  1  
ATOM   739   H  HE1  . TYR A 1 48  ? -4.194  -15.342 -0.316  1.00 0.00 ? 203 TYR A HE1  1  
ATOM   740   H  HE2  . TYR A 1 48  ? -2.287  -11.943 -2.119  1.00 0.00 ? 203 TYR A HE2  1  
ATOM   741   H  HH   . TYR A 1 48  ? -3.225  -14.626 -3.017  1.00 0.00 ? 203 TYR A HH   1  
ATOM   742   N  N    . TYR A 1 49  ? -2.579  -10.699 3.781   1.00 0.00 ? 204 TYR A N    1  
ATOM   743   C  CA   . TYR A 1 49  ? -1.112  -10.772 4.116   1.00 0.00 ? 204 TYR A CA   1  
ATOM   744   C  C    . TYR A 1 49  ? -0.908  -11.710 5.318   1.00 0.00 ? 204 TYR A C    1  
ATOM   745   O  O    . TYR A 1 49  ? 0.081   -12.418 5.390   1.00 0.00 ? 204 TYR A O    1  
ATOM   746   C  CB   . TYR A 1 49  ? -0.650  -9.344  4.463   1.00 0.00 ? 204 TYR A CB   1  
ATOM   747   C  CG   . TYR A 1 49  ? 0.799   -9.158  4.071   1.00 0.00 ? 204 TYR A CG   1  
ATOM   748   C  CD1  . TYR A 1 49  ? 1.225   -9.497  2.779   1.00 0.00 ? 204 TYR A CD1  1  
ATOM   749   C  CD2  . TYR A 1 49  ? 1.716   -8.642  4.997   1.00 0.00 ? 204 TYR A CD2  1  
ATOM   750   C  CE1  . TYR A 1 49  ? 2.564   -9.323  2.414   1.00 0.00 ? 204 TYR A CE1  1  
ATOM   751   C  CE2  . TYR A 1 49  ? 3.056   -8.468  4.631   1.00 0.00 ? 204 TYR A CE2  1  
ATOM   752   C  CZ   . TYR A 1 49  ? 3.481   -8.808  3.339   1.00 0.00 ? 204 TYR A CZ   1  
ATOM   753   O  OH   . TYR A 1 49  ? 4.802   -8.635  2.979   1.00 0.00 ? 204 TYR A OH   1  
ATOM   754   H  H    . TYR A 1 49  ? -3.076  -9.849  3.884   1.00 0.00 ? 204 TYR A H    1  
ATOM   755   H  HA   . TYR A 1 49  ? -0.562  -11.141 3.264   1.00 0.00 ? 204 TYR A HA   1  
ATOM   756   H  HB2  . TYR A 1 49  ? -1.257  -8.631  3.929   1.00 0.00 ? 204 TYR A HB2  1  
ATOM   757   H  HB3  . TYR A 1 49  ? -0.758  -9.181  5.526   1.00 0.00 ? 204 TYR A HB3  1  
ATOM   758   H  HD1  . TYR A 1 49  ? 0.519   -9.894  2.065   1.00 0.00 ? 204 TYR A HD1  1  
ATOM   759   H  HD2  . TYR A 1 49  ? 1.391   -8.380  5.994   1.00 0.00 ? 204 TYR A HD2  1  
ATOM   760   H  HE1  . TYR A 1 49  ? 2.889   -9.586  1.419   1.00 0.00 ? 204 TYR A HE1  1  
ATOM   761   H  HE2  . TYR A 1 49  ? 3.763   -8.070  5.344   1.00 0.00 ? 204 TYR A HE2  1  
ATOM   762   H  HH   . TYR A 1 49  ? 5.269   -9.452  3.168   1.00 0.00 ? 204 TYR A HH   1  
ATOM   763   N  N    . MET A 1 50  ? -1.837  -11.740 6.257   1.00 0.00 ? 205 MET A N    1  
ATOM   764   C  CA   . MET A 1 50  ? -1.680  -12.658 7.434   1.00 0.00 ? 205 MET A CA   1  
ATOM   765   C  C    . MET A 1 50  ? -2.350  -14.006 7.126   1.00 0.00 ? 205 MET A C    1  
ATOM   766   O  O    . MET A 1 50  ? -1.812  -15.053 7.431   1.00 0.00 ? 205 MET A O    1  
ATOM   767   C  CB   . MET A 1 50  ? -2.371  -11.962 8.618   1.00 0.00 ? 205 MET A CB   1  
ATOM   768   C  CG   . MET A 1 50  ? -2.272  -12.842 9.866   1.00 0.00 ? 205 MET A CG   1  
ATOM   769   S  SD   . MET A 1 50  ? -2.834  -11.906 11.310  1.00 0.00 ? 205 MET A SD   1  
ATOM   770   C  CE   . MET A 1 50  ? -1.256  -11.110 11.694  1.00 0.00 ? 205 MET A CE   1  
ATOM   771   H  H    . MET A 1 50  ? -2.641  -11.172 6.179   1.00 0.00 ? 205 MET A H    1  
ATOM   772   H  HA   . MET A 1 50  ? -0.637  -12.805 7.652   1.00 0.00 ? 205 MET A HA   1  
ATOM   773   H  HB2  . MET A 1 50  ? -1.890  -11.013 8.807   1.00 0.00 ? 205 MET A HB2  1  
ATOM   774   H  HB3  . MET A 1 50  ? -3.411  -11.796 8.379   1.00 0.00 ? 205 MET A HB3  1  
ATOM   775   H  HG2  . MET A 1 50  ? -2.892  -13.716 9.739   1.00 0.00 ? 205 MET A HG2  1  
ATOM   776   H  HG3  . MET A 1 50  ? -1.246  -13.146 10.011  1.00 0.00 ? 205 MET A HG3  1  
ATOM   777   H  HE1  . MET A 1 50  ? -0.616  -11.813 12.212  1.00 0.00 ? 205 MET A HE1  1  
ATOM   778   H  HE2  . MET A 1 50  ? -1.427  -10.253 12.325  1.00 0.00 ? 205 MET A HE2  1  
ATOM   779   H  HE3  . MET A 1 50  ? -0.782  -10.791 10.777  1.00 0.00 ? 205 MET A HE3  1  
ATOM   780   N  N    . SER A 1 51  ? -3.519  -13.990 6.517   1.00 0.00 ? 206 SER A N    1  
ATOM   781   C  CA   . SER A 1 51  ? -4.212  -15.290 6.185   1.00 0.00 ? 206 SER A CA   1  
ATOM   782   C  C    . SER A 1 51  ? -3.299  -16.171 5.318   1.00 0.00 ? 206 SER A C    1  
ATOM   783   O  O    . SER A 1 51  ? -3.246  -17.374 5.492   1.00 0.00 ? 206 SER A O    1  
ATOM   784   C  CB   . SER A 1 51  ? -5.487  -14.933 5.406   1.00 0.00 ? 206 SER A CB   1  
ATOM   785   O  OG   . SER A 1 51  ? -6.171  -16.128 5.050   1.00 0.00 ? 206 SER A OG   1  
ATOM   786   H  H    . SER A 1 51  ? -3.933  -13.128 6.277   1.00 0.00 ? 206 SER A H    1  
ATOM   787   H  HA   . SER A 1 51  ? -4.471  -15.808 7.087   1.00 0.00 ? 206 SER A HA   1  
ATOM   788   H  HB2  . SER A 1 51  ? -6.130  -14.327 6.023   1.00 0.00 ? 206 SER A HB2  1  
ATOM   789   H  HB3  . SER A 1 51  ? -5.220  -14.379 4.515   1.00 0.00 ? 206 SER A HB3  1  
ATOM   790   H  HG   . SER A 1 51  ? -6.979  -15.882 4.594   1.00 0.00 ? 206 SER A HG   1  
ATOM   791   N  N    . ASP A 1 52  ? -2.575  -15.582 4.389   1.00 0.00 ? 207 ASP A N    1  
ATOM   792   C  CA   . ASP A 1 52  ? -1.666  -16.391 3.522   1.00 0.00 ? 207 ASP A CA   1  
ATOM   793   C  C    . ASP A 1 52  ? -0.203  -16.023 3.809   1.00 0.00 ? 207 ASP A C    1  
ATOM   794   O  O    . ASP A 1 52  ? 0.110   -14.875 4.065   1.00 0.00 ? 207 ASP A O    1  
ATOM   795   C  CB   . ASP A 1 52  ? -2.042  -16.018 2.086   1.00 0.00 ? 207 ASP A CB   1  
ATOM   796   C  CG   . ASP A 1 52  ? -1.975  -17.263 1.200   1.00 0.00 ? 207 ASP A CG   1  
ATOM   797   O  OD1  . ASP A 1 52  ? -0.915  -17.861 1.131   1.00 0.00 ? 207 ASP A OD1  1  
ATOM   798   O  OD2  . ASP A 1 52  ? -2.988  -17.597 0.605   1.00 0.00 ? 207 ASP A OD2  1  
ATOM   799   H  H    . ASP A 1 52  ? -2.626  -14.609 4.265   1.00 0.00 ? 207 ASP A H    1  
ATOM   800   H  HA   . ASP A 1 52  ? -1.828  -17.445 3.685   1.00 0.00 ? 207 ASP A HA   1  
ATOM   801   H  HB2  . ASP A 1 52  ? -3.045  -15.616 2.069   1.00 0.00 ? 207 ASP A HB2  1  
ATOM   802   H  HB3  . ASP A 1 52  ? -1.351  -15.277 1.715   1.00 0.00 ? 207 ASP A HB3  1  
ATOM   803   N  N    . ASP A 1 53  ? 0.697   -16.983 3.771   1.00 0.00 ? 208 ASP A N    1  
ATOM   804   C  CA   . ASP A 1 53  ? 2.133   -16.675 4.045   1.00 0.00 ? 208 ASP A CA   1  
ATOM   805   C  C    . ASP A 1 53  ? 2.979   -16.922 2.789   1.00 0.00 ? 208 ASP A C    1  
ATOM   806   O  O    . ASP A 1 53  ? 2.624   -17.730 1.949   1.00 0.00 ? 208 ASP A O    1  
ATOM   807   C  CB   . ASP A 1 53  ? 2.542   -17.634 5.165   1.00 0.00 ? 208 ASP A CB   1  
ATOM   808   C  CG   . ASP A 1 53  ? 2.201   -17.012 6.520   1.00 0.00 ? 208 ASP A CG   1  
ATOM   809   O  OD1  . ASP A 1 53  ? 2.684   -15.924 6.788   1.00 0.00 ? 208 ASP A OD1  1  
ATOM   810   O  OD2  . ASP A 1 53  ? 1.462   -17.633 7.266   1.00 0.00 ? 208 ASP A OD2  1  
ATOM   811   H  H    . ASP A 1 53  ? 0.430   -17.907 3.564   1.00 0.00 ? 208 ASP A H    1  
ATOM   812   H  HA   . ASP A 1 53  ? 2.247   -15.654 4.375   1.00 0.00 ? 208 ASP A HA   1  
ATOM   813   H  HB2  . ASP A 1 53  ? 2.008   -18.566 5.051   1.00 0.00 ? 208 ASP A HB2  1  
ATOM   814   H  HB3  . ASP A 1 53  ? 3.605   -17.817 5.112   1.00 0.00 ? 208 ASP A HB3  1  
ATOM   815   N  N    . ILE A 1 54  ? 4.095   -16.238 2.652   1.00 0.00 ? 209 ILE A N    1  
ATOM   816   C  CA   . ILE A 1 54  ? 4.957   -16.450 1.444   1.00 0.00 ? 209 ILE A CA   1  
ATOM   817   C  C    . ILE A 1 54  ? 6.155   -17.340 1.803   1.00 0.00 ? 209 ILE A C    1  
ATOM   818   O  O    . ILE A 1 54  ? 6.914   -17.029 2.702   1.00 0.00 ? 209 ILE A O    1  
ATOM   819   C  CB   . ILE A 1 54  ? 5.428   -15.053 1.011   1.00 0.00 ? 209 ILE A CB   1  
ATOM   820   C  CG1  . ILE A 1 54  ? 4.210   -14.165 0.706   1.00 0.00 ? 209 ILE A CG1  1  
ATOM   821   C  CG2  . ILE A 1 54  ? 6.306   -15.171 -0.240  1.00 0.00 ? 209 ILE A CG2  1  
ATOM   822   C  CD1  . ILE A 1 54  ? 3.357   -14.787 -0.410  1.00 0.00 ? 209 ILE A CD1  1  
ATOM   823   H  H    . ILE A 1 54  ? 4.368   -15.592 3.345   1.00 0.00 ? 209 ILE A H    1  
ATOM   824   H  HA   . ILE A 1 54  ? 4.381   -16.905 0.654   1.00 0.00 ? 209 ILE A HA   1  
ATOM   825   H  HB   . ILE A 1 54  ? 6.005   -14.610 1.809   1.00 0.00 ? 209 ILE A HB   1  
ATOM   826   H  HG12 . ILE A 1 54  ? 3.610   -14.063 1.598   1.00 0.00 ? 209 ILE A HG12 1  
ATOM   827   H  HG13 . ILE A 1 54  ? 4.550   -13.190 0.390   1.00 0.00 ? 209 ILE A HG13 1  
ATOM   828   H  HG21 . ILE A 1 54  ? 6.650   -14.189 -0.532  1.00 0.00 ? 209 ILE A HG21 1  
ATOM   829   H  HG22 . ILE A 1 54  ? 5.731   -15.605 -1.045  1.00 0.00 ? 209 ILE A HG22 1  
ATOM   830   H  HG23 . ILE A 1 54  ? 7.157   -15.800 -0.027  1.00 0.00 ? 209 ILE A HG23 1  
ATOM   831   H  HD11 . ILE A 1 54  ? 3.862   -15.656 -0.811  1.00 0.00 ? 209 ILE A HD11 1  
ATOM   832   H  HD12 . ILE A 1 54  ? 3.207   -14.062 -1.196  1.00 0.00 ? 209 ILE A HD12 1  
ATOM   833   H  HD13 . ILE A 1 54  ? 2.399   -15.083 -0.007  1.00 0.00 ? 209 ILE A HD13 1  
ATOM   834   N  N    . SER A 1 55  ? 6.329   -18.448 1.113   1.00 0.00 ? 210 SER A N    1  
ATOM   835   C  CA   . SER A 1 55  ? 7.485   -19.353 1.429   1.00 0.00 ? 210 SER A CA   1  
ATOM   836   C  C    . SER A 1 55  ? 7.655   -20.432 0.345   1.00 0.00 ? 210 SER A C    1  
ATOM   837   O  O    . SER A 1 55  ? 6.837   -21.322 0.220   1.00 0.00 ? 210 SER A O    1  
ATOM   838   C  CB   . SER A 1 55  ? 7.125   -19.998 2.768   1.00 0.00 ? 210 SER A CB   1  
ATOM   839   O  OG   . SER A 1 55  ? 7.635   -19.198 3.826   1.00 0.00 ? 210 SER A OG   1  
ATOM   840   H  H    . SER A 1 55  ? 5.702   -18.684 0.389   1.00 0.00 ? 210 SER A H    1  
ATOM   841   H  HA   . SER A 1 55  ? 8.391   -18.778 1.532   1.00 0.00 ? 210 SER A HA   1  
ATOM   842   H  HB2  . SER A 1 55  ? 6.054   -20.068 2.860   1.00 0.00 ? 210 SER A HB2  1  
ATOM   843   H  HB3  . SER A 1 55  ? 7.554   -20.991 2.814   1.00 0.00 ? 210 SER A HB3  1  
ATOM   844   H  HG   . SER A 1 55  ? 7.313   -19.561 4.654   1.00 0.00 ? 210 SER A HG   1  
ATOM   845   N  N    . ARG A 1 56  ? 8.716   -20.366 -0.440  1.00 0.00 ? 211 ARG A N    1  
ATOM   846   C  CA   . ARG A 1 56  ? 8.938   -21.392 -1.512  1.00 0.00 ? 211 ARG A CA   1  
ATOM   847   C  C    . ARG A 1 56  ? 7.685   -21.547 -2.395  1.00 0.00 ? 211 ARG A C    1  
ATOM   848   O  O    . ARG A 1 56  ? 6.902   -22.458 -2.204  1.00 0.00 ? 211 ARG A O    1  
ATOM   849   C  CB   . ARG A 1 56  ? 9.232   -22.697 -0.766  1.00 0.00 ? 211 ARG A CB   1  
ATOM   850   C  CG   . ARG A 1 56  ? 10.613  -22.611 -0.113  1.00 0.00 ? 211 ARG A CG   1  
ATOM   851   C  CD   . ARG A 1 56  ? 10.601  -23.377 1.213   1.00 0.00 ? 211 ARG A CD   1  
ATOM   852   N  NE   . ARG A 1 56  ? 11.909  -24.088 1.258   1.00 0.00 ? 211 ARG A NE   1  
ATOM   853   C  CZ   . ARG A 1 56  ? 12.878  -23.626 2.001   1.00 0.00 ? 211 ARG A CZ   1  
ATOM   854   N  NH1  . ARG A 1 56  ? 12.885  -23.860 3.284   1.00 0.00 ? 211 ARG A NH1  1  
ATOM   855   N  NH2  . ARG A 1 56  ? 13.840  -22.930 1.460   1.00 0.00 ? 211 ARG A NH2  1  
ATOM   856   H  H    . ARG A 1 56  ? 9.370   -19.641 -0.325  1.00 0.00 ? 211 ARG A H    1  
ATOM   857   H  HA   . ARG A 1 56  ? 9.787   -21.119 -2.115  1.00 0.00 ? 211 ARG A HA   1  
ATOM   858   H  HB2  . ARG A 1 56  ? 8.482   -22.853 -0.005  1.00 0.00 ? 211 ARG A HB2  1  
ATOM   859   H  HB3  . ARG A 1 56  ? 9.216   -23.521 -1.463  1.00 0.00 ? 211 ARG A HB3  1  
ATOM   860   H  HG2  . ARG A 1 56  ? 11.351  -23.045 -0.773  1.00 0.00 ? 211 ARG A HG2  1  
ATOM   861   H  HG3  . ARG A 1 56  ? 10.860  -21.577 0.074   1.00 0.00 ? 211 ARG A HG3  1  
ATOM   862   H  HD2  . ARG A 1 56  ? 10.515  -22.688 2.042   1.00 0.00 ? 211 ARG A HD2  1  
ATOM   863   H  HD3  . ARG A 1 56  ? 9.792   -24.091 1.229   1.00 0.00 ? 211 ARG A HD3  1  
ATOM   864   H  HE   . ARG A 1 56  ? 12.042  -24.903 0.730   1.00 0.00 ? 211 ARG A HE   1  
ATOM   865   H  HH11 . ARG A 1 56  ? 12.147  -24.394 3.699   1.00 0.00 ? 211 ARG A HH11 1  
ATOM   866   H  HH12 . ARG A 1 56  ? 13.627  -23.507 3.854   1.00 0.00 ? 211 ARG A HH12 1  
ATOM   867   H  HH21 . ARG A 1 56  ? 13.835  -22.750 0.476   1.00 0.00 ? 211 ARG A HH21 1  
ATOM   868   H  HH22 . ARG A 1 56  ? 14.582  -22.576 2.029   1.00 0.00 ? 211 ARG A HH22 1  
ATOM   869   N  N    . ASP A 1 57  ? 7.489   -20.667 -3.357  1.00 0.00 ? 212 ASP A N    1  
ATOM   870   C  CA   . ASP A 1 57  ? 6.285   -20.779 -4.237  1.00 0.00 ? 212 ASP A CA   1  
ATOM   871   C  C    . ASP A 1 57  ? 6.710   -20.968 -5.703  1.00 0.00 ? 212 ASP A C    1  
ATOM   872   O  O    . ASP A 1 57  ? 7.779   -20.550 -6.097  1.00 0.00 ? 212 ASP A O    1  
ATOM   873   C  CB   . ASP A 1 57  ? 5.543   -19.454 -4.062  1.00 0.00 ? 212 ASP A CB   1  
ATOM   874   C  CG   . ASP A 1 57  ? 4.829   -19.445 -2.709  1.00 0.00 ? 212 ASP A CG   1  
ATOM   875   O  OD1  . ASP A 1 57  ? 5.498   -19.643 -1.707  1.00 0.00 ? 212 ASP A OD1  1  
ATOM   876   O  OD2  . ASP A 1 57  ? 3.627   -19.240 -2.697  1.00 0.00 ? 212 ASP A OD2  1  
ATOM   877   H  H    . ASP A 1 57  ? 8.128   -19.934 -3.502  1.00 0.00 ? 212 ASP A H    1  
ATOM   878   H  HA   . ASP A 1 57  ? 5.660   -21.597 -3.917  1.00 0.00 ? 212 ASP A HA   1  
ATOM   879   H  HB2  . ASP A 1 57  ? 6.249   -18.637 -4.103  1.00 0.00 ? 212 ASP A HB2  1  
ATOM   880   H  HB3  . ASP A 1 57  ? 4.815   -19.342 -4.851  1.00 0.00 ? 212 ASP A HB3  1  
ATOM   881   N  N    . SER A 1 58  ? 5.875   -21.592 -6.518  1.00 0.00 ? 213 SER A N    1  
ATOM   882   C  CA   . SER A 1 58  ? 6.218   -21.815 -7.968  1.00 0.00 ? 213 SER A CA   1  
ATOM   883   C  C    . SER A 1 58  ? 7.440   -22.743 -8.109  1.00 0.00 ? 213 SER A C    1  
ATOM   884   O  O    . SER A 1 58  ? 7.306   -23.878 -8.528  1.00 0.00 ? 213 SER A O    1  
ATOM   885   C  CB   . SER A 1 58  ? 6.506   -20.427 -8.566  1.00 0.00 ? 213 SER A CB   1  
ATOM   886   O  OG   . SER A 1 58  ? 5.580   -20.169 -9.613  1.00 0.00 ? 213 SER A OG   1  
ATOM   887   H  H    . SER A 1 58  ? 5.012   -21.918 -6.180  1.00 0.00 ? 213 SER A H    1  
ATOM   888   H  HA   . SER A 1 58  ? 5.372   -22.253 -8.475  1.00 0.00 ? 213 SER A HA   1  
ATOM   889   H  HB2  . SER A 1 58  ? 6.397   -19.674 -7.805  1.00 0.00 ? 213 SER A HB2  1  
ATOM   890   H  HB3  . SER A 1 58  ? 7.517   -20.403 -8.952  1.00 0.00 ? 213 SER A HB3  1  
ATOM   891   H  HG   . SER A 1 58  ? 5.921   -19.441 -10.138 1.00 0.00 ? 213 SER A HG   1  
ATOM   892   N  N    . ASP A 1 59  ? 8.627   -22.281 -7.772  1.00 0.00 ? 214 ASP A N    1  
ATOM   893   C  CA   . ASP A 1 59  ? 9.836   -23.153 -7.900  1.00 0.00 ? 214 ASP A CA   1  
ATOM   894   C  C    . ASP A 1 59  ? 10.457  -23.410 -6.519  1.00 0.00 ? 214 ASP A C    1  
ATOM   895   O  O    . ASP A 1 59  ? 11.666  -23.423 -6.377  1.00 0.00 ? 214 ASP A O    1  
ATOM   896   C  CB   . ASP A 1 59  ? 10.804  -22.358 -8.775  1.00 0.00 ? 214 ASP A CB   1  
ATOM   897   C  CG   . ASP A 1 59  ? 11.852  -23.303 -9.366  1.00 0.00 ? 214 ASP A CG   1  
ATOM   898   O  OD1  . ASP A 1 59  ? 11.482  -24.400 -9.752  1.00 0.00 ? 214 ASP A OD1  1  
ATOM   899   O  OD2  . ASP A 1 59  ? 13.007  -22.915 -9.423  1.00 0.00 ? 214 ASP A OD2  1  
ATOM   900   H  H    . ASP A 1 59  ? 8.727   -21.363 -7.436  1.00 0.00 ? 214 ASP A H    1  
ATOM   901   H  HA   . ASP A 1 59  ? 9.582   -24.084 -8.380  1.00 0.00 ? 214 ASP A HA   1  
ATOM   902   H  HB2  . ASP A 1 59  ? 10.257  -21.879 -9.574  1.00 0.00 ? 214 ASP A HB2  1  
ATOM   903   H  HB3  . ASP A 1 59  ? 11.297  -21.608 -8.174  1.00 0.00 ? 214 ASP A HB3  1  
ATOM   904   N  N    . GLY A 1 60  ? 9.649   -23.606 -5.497  1.00 0.00 ? 215 GLY A N    1  
ATOM   905   C  CA   . GLY A 1 60  ? 10.208  -23.851 -4.132  1.00 0.00 ? 215 GLY A CA   1  
ATOM   906   C  C    . GLY A 1 60  ? 11.128  -22.687 -3.713  1.00 0.00 ? 215 GLY A C    1  
ATOM   907   O  O    . GLY A 1 60  ? 12.079  -22.886 -2.980  1.00 0.00 ? 215 GLY A O    1  
ATOM   908   H  H    . GLY A 1 60  ? 8.674   -23.587 -5.623  1.00 0.00 ? 215 GLY A H    1  
ATOM   909   H  HA2  . GLY A 1 60  ? 9.397   -23.940 -3.424  1.00 0.00 ? 215 GLY A HA2  1  
ATOM   910   H  HA3  . GLY A 1 60  ? 10.779  -24.767 -4.140  1.00 0.00 ? 215 GLY A HA3  1  
ATOM   911   N  N    . MET A 1 61  ? 10.859  -21.473 -4.163  1.00 0.00 ? 216 MET A N    1  
ATOM   912   C  CA   . MET A 1 61  ? 11.727  -20.321 -3.773  1.00 0.00 ? 216 MET A CA   1  
ATOM   913   C  C    . MET A 1 61  ? 10.855  -19.112 -3.399  1.00 0.00 ? 216 MET A C    1  
ATOM   914   O  O    . MET A 1 61  ? 9.647   -19.226 -3.300  1.00 0.00 ? 216 MET A O    1  
ATOM   915   C  CB   . MET A 1 61  ? 12.564  -20.018 -5.019  1.00 0.00 ? 216 MET A CB   1  
ATOM   916   C  CG   . MET A 1 61  ? 13.973  -20.587 -4.845  1.00 0.00 ? 216 MET A CG   1  
ATOM   917   S  SD   . MET A 1 61  ? 15.044  -19.965 -6.165  1.00 0.00 ? 216 MET A SD   1  
ATOM   918   C  CE   . MET A 1 61  ? 15.871  -21.529 -6.542  1.00 0.00 ? 216 MET A CE   1  
ATOM   919   H  H    . MET A 1 61  ? 10.090  -21.316 -4.752  1.00 0.00 ? 216 MET A H    1  
ATOM   920   H  HA   . MET A 1 61  ? 12.369  -20.593 -2.950  1.00 0.00 ? 216 MET A HA   1  
ATOM   921   H  HB2  . MET A 1 61  ? 12.097  -20.469 -5.883  1.00 0.00 ? 216 MET A HB2  1  
ATOM   922   H  HB3  . MET A 1 61  ? 12.624  -18.949 -5.161  1.00 0.00 ? 216 MET A HB3  1  
ATOM   923   H  HG2  . MET A 1 61  ? 14.369  -20.282 -3.887  1.00 0.00 ? 216 MET A HG2  1  
ATOM   924   H  HG3  . MET A 1 61  ? 13.934  -21.665 -4.891  1.00 0.00 ? 216 MET A HG3  1  
ATOM   925   H  HE1  . MET A 1 61  ? 16.728  -21.339 -7.172  1.00 0.00 ? 216 MET A HE1  1  
ATOM   926   H  HE2  . MET A 1 61  ? 15.186  -22.184 -7.058  1.00 0.00 ? 216 MET A HE2  1  
ATOM   927   H  HE3  . MET A 1 61  ? 16.190  -21.998 -5.622  1.00 0.00 ? 216 MET A HE3  1  
ATOM   928   N  N    . ASP A 1 62  ? 11.448  -17.951 -3.199  1.00 0.00 ? 217 ASP A N    1  
ATOM   929   C  CA   . ASP A 1 62  ? 10.624  -16.748 -2.841  1.00 0.00 ? 217 ASP A CA   1  
ATOM   930   C  C    . ASP A 1 62  ? 10.286  -15.953 -4.110  1.00 0.00 ? 217 ASP A C    1  
ATOM   931   O  O    . ASP A 1 62  ? 11.150  -15.339 -4.707  1.00 0.00 ? 217 ASP A O    1  
ATOM   932   C  CB   . ASP A 1 62  ? 11.488  -15.905 -1.893  1.00 0.00 ? 217 ASP A CB   1  
ATOM   933   C  CG   . ASP A 1 62  ? 10.656  -14.746 -1.339  1.00 0.00 ? 217 ASP A CG   1  
ATOM   934   O  OD1  . ASP A 1 62  ? 10.567  -13.733 -2.013  1.00 0.00 ? 217 ASP A OD1  1  
ATOM   935   O  OD2  . ASP A 1 62  ? 10.122  -14.893 -0.252  1.00 0.00 ? 217 ASP A OD2  1  
ATOM   936   H  H    . ASP A 1 62  ? 12.427  -17.872 -3.293  1.00 0.00 ? 217 ASP A H    1  
ATOM   937   H  HA   . ASP A 1 62  ? 9.719   -17.053 -2.340  1.00 0.00 ? 217 ASP A HA   1  
ATOM   938   H  HB2  . ASP A 1 62  ? 11.835  -16.523 -1.077  1.00 0.00 ? 217 ASP A HB2  1  
ATOM   939   H  HB3  . ASP A 1 62  ? 12.337  -15.511 -2.432  1.00 0.00 ? 217 ASP A HB3  1  
ATOM   940   N  N    . GLU A 1 63  ? 9.037   -15.961 -4.532  1.00 0.00 ? 218 GLU A N    1  
ATOM   941   C  CA   . GLU A 1 63  ? 8.660   -15.206 -5.765  1.00 0.00 ? 218 GLU A CA   1  
ATOM   942   C  C    . GLU A 1 63  ? 7.256   -14.601 -5.612  1.00 0.00 ? 218 GLU A C    1  
ATOM   943   O  O    . GLU A 1 63  ? 6.404   -14.781 -6.463  1.00 0.00 ? 218 GLU A O    1  
ATOM   944   C  CB   . GLU A 1 63  ? 8.678   -16.247 -6.885  1.00 0.00 ? 218 GLU A CB   1  
ATOM   945   C  CG   . GLU A 1 63  ? 8.789   -15.541 -8.238  1.00 0.00 ? 218 GLU A CG   1  
ATOM   946   C  CD   . GLU A 1 63  ? 10.265  -15.351 -8.596  1.00 0.00 ? 218 GLU A CD   1  
ATOM   947   O  OE1  . GLU A 1 63  ? 10.983  -16.337 -8.603  1.00 0.00 ? 218 GLU A OE1  1  
ATOM   948   O  OE2  . GLU A 1 63  ? 10.650  -14.224 -8.856  1.00 0.00 ? 218 GLU A OE2  1  
ATOM   949   H  H    . GLU A 1 63  ? 8.347   -16.464 -4.041  1.00 0.00 ? 218 GLU A H    1  
ATOM   950   H  HA   . GLU A 1 63  ? 9.384   -14.433 -5.969  1.00 0.00 ? 218 GLU A HA   1  
ATOM   951   H  HB2  . GLU A 1 63  ? 9.525   -16.906 -6.752  1.00 0.00 ? 218 GLU A HB2  1  
ATOM   952   H  HB3  . GLU A 1 63  ? 7.766   -16.824 -6.856  1.00 0.00 ? 218 GLU A HB3  1  
ATOM   953   H  HG2  . GLU A 1 63  ? 8.307   -16.140 -8.997  1.00 0.00 ? 218 GLU A HG2  1  
ATOM   954   H  HG3  . GLU A 1 63  ? 8.308   -14.575 -8.180  1.00 0.00 ? 218 GLU A HG3  1  
ATOM   955   N  N    . GLN A 1 64  ? 7.005   -13.881 -4.537  1.00 0.00 ? 219 GLN A N    1  
ATOM   956   C  CA   . GLN A 1 64  ? 5.656   -13.269 -4.345  1.00 0.00 ? 219 GLN A CA   1  
ATOM   957   C  C    . GLN A 1 64  ? 5.795   -11.771 -4.030  1.00 0.00 ? 219 GLN A C    1  
ATOM   958   O  O    . GLN A 1 64  ? 6.818   -11.333 -3.540  1.00 0.00 ? 219 GLN A O    1  
ATOM   959   C  CB   . GLN A 1 64  ? 5.047   -14.013 -3.157  1.00 0.00 ? 219 GLN A CB   1  
ATOM   960   C  CG   . GLN A 1 64  ? 4.894   -15.495 -3.508  1.00 0.00 ? 219 GLN A CG   1  
ATOM   961   C  CD   . GLN A 1 64  ? 3.827   -15.656 -4.598  1.00 0.00 ? 219 GLN A CD   1  
ATOM   962   O  OE1  . GLN A 1 64  ? 4.110   -16.159 -5.667  1.00 0.00 ? 219 GLN A OE1  1  
ATOM   963   N  NE2  . GLN A 1 64  ? 2.600   -15.249 -4.378  1.00 0.00 ? 219 GLN A NE2  1  
ATOM   964   H  H    . GLN A 1 64  ? 7.701   -13.741 -3.857  1.00 0.00 ? 219 GLN A H    1  
ATOM   965   H  HA   . GLN A 1 64  ? 5.048   -13.415 -5.223  1.00 0.00 ? 219 GLN A HA   1  
ATOM   966   H  HB2  . GLN A 1 64  ? 5.693   -13.910 -2.298  1.00 0.00 ? 219 GLN A HB2  1  
ATOM   967   H  HB3  . GLN A 1 64  ? 4.076   -13.598 -2.932  1.00 0.00 ? 219 GLN A HB3  1  
ATOM   968   H  HG2  . GLN A 1 64  ? 5.838   -15.879 -3.869  1.00 0.00 ? 219 GLN A HG2  1  
ATOM   969   H  HG3  . GLN A 1 64  ? 4.593   -16.044 -2.630  1.00 0.00 ? 219 GLN A HG3  1  
ATOM   970   H  HE21 . GLN A 1 64  ? 2.358   -14.841 -3.518  1.00 0.00 ? 219 GLN A HE21 1  
ATOM   971   H  HE22 . GLN A 1 64  ? 1.920   -15.354 -5.076  1.00 0.00 ? 219 GLN A HE22 1  
ATOM   972   N  N    . CYS A 1 65  ? 4.777   -10.982 -4.307  1.00 0.00 ? 220 CYS A N    1  
ATOM   973   C  CA   . CYS A 1 65  ? 4.873   -9.503  -4.017  1.00 0.00 ? 220 CYS A CA   1  
ATOM   974   C  C    . CYS A 1 65  ? 5.024   -9.256  -2.509  1.00 0.00 ? 220 CYS A C    1  
ATOM   975   O  O    . CYS A 1 65  ? 4.579   -10.051 -1.702  1.00 0.00 ? 220 CYS A O    1  
ATOM   976   C  CB   . CYS A 1 65  ? 3.551   -8.888  -4.490  1.00 0.00 ? 220 CYS A CB   1  
ATOM   977   S  SG   . CYS A 1 65  ? 3.624   -7.087  -4.367  1.00 0.00 ? 220 CYS A SG   1  
ATOM   978   H  H    . CYS A 1 65  ? 3.952   -11.364 -4.706  1.00 0.00 ? 220 CYS A H    1  
ATOM   979   H  HA   . CYS A 1 65  ? 5.696   -9.061  -4.558  1.00 0.00 ? 220 CYS A HA   1  
ATOM   980   H  HB2  . CYS A 1 65  ? 3.365   -9.173  -5.513  1.00 0.00 ? 220 CYS A HB2  1  
ATOM   981   H  HB3  . CYS A 1 65  ? 2.753   -9.251  -3.865  1.00 0.00 ? 220 CYS A HB3  1  
ATOM   982   N  N    . ARG A 1 66  ? 5.606   -8.137  -2.117  1.00 0.00 ? 221 ARG A N    1  
ATOM   983   C  CA   . ARG A 1 66  ? 5.728   -7.832  -0.656  1.00 0.00 ? 221 ARG A CA   1  
ATOM   984   C  C    . ARG A 1 66  ? 4.675   -6.772  -0.266  1.00 0.00 ? 221 ARG A C    1  
ATOM   985   O  O    . ARG A 1 66  ? 4.926   -5.917  0.561   1.00 0.00 ? 221 ARG A O    1  
ATOM   986   C  CB   . ARG A 1 66  ? 7.149   -7.290  -0.458  1.00 0.00 ? 221 ARG A CB   1  
ATOM   987   C  CG   . ARG A 1 66  ? 8.042   -8.388  0.128   1.00 0.00 ? 221 ARG A CG   1  
ATOM   988   C  CD   . ARG A 1 66  ? 7.548   -8.757  1.530   1.00 0.00 ? 221 ARG A CD   1  
ATOM   989   N  NE   . ARG A 1 66  ? 8.761   -9.211  2.265   1.00 0.00 ? 221 ARG A NE   1  
ATOM   990   C  CZ   . ARG A 1 66  ? 8.770   -10.375 2.853   1.00 0.00 ? 221 ARG A CZ   1  
ATOM   991   N  NH1  . ARG A 1 66  ? 8.560   -11.460 2.157   1.00 0.00 ? 221 ARG A NH1  1  
ATOM   992   N  NH2  . ARG A 1 66  ? 8.987   -10.456 4.137   1.00 0.00 ? 221 ARG A NH2  1  
ATOM   993   H  H    . ARG A 1 66  ? 5.933   -7.487  -2.780  1.00 0.00 ? 221 ARG A H    1  
ATOM   994   H  HA   . ARG A 1 66  ? 5.587   -8.731  -0.074  1.00 0.00 ? 221 ARG A HA   1  
ATOM   995   H  HB2  . ARG A 1 66  ? 7.548   -6.971  -1.410  1.00 0.00 ? 221 ARG A HB2  1  
ATOM   996   H  HB3  . ARG A 1 66  ? 7.122   -6.451  0.221   1.00 0.00 ? 221 ARG A HB3  1  
ATOM   997   H  HG2  . ARG A 1 66  ? 8.004   -9.260  -0.509  1.00 0.00 ? 221 ARG A HG2  1  
ATOM   998   H  HG3  . ARG A 1 66  ? 9.059   -8.031  0.189   1.00 0.00 ? 221 ARG A HG3  1  
ATOM   999   H  HD2  . ARG A 1 66  ? 7.113   -7.893  2.014   1.00 0.00 ? 221 ARG A HD2  1  
ATOM   1000  H  HD3  . ARG A 1 66  ? 6.828   -9.559  1.476   1.00 0.00 ? 221 ARG A HD3  1  
ATOM   1001  H  HE   . ARG A 1 66  ? 9.554   -8.633  2.309   1.00 0.00 ? 221 ARG A HE   1  
ATOM   1002  H  HH11 . ARG A 1 66  ? 8.393   -11.398 1.173   1.00 0.00 ? 221 ARG A HH11 1  
ATOM   1003  H  HH12 . ARG A 1 66  ? 8.567   -12.352 2.609   1.00 0.00 ? 221 ARG A HH12 1  
ATOM   1004  H  HH21 . ARG A 1 66  ? 9.146   -9.625  4.670   1.00 0.00 ? 221 ARG A HH21 1  
ATOM   1005  H  HH22 . ARG A 1 66  ? 8.994   -11.348 4.588   1.00 0.00 ? 221 ARG A HH22 1  
ATOM   1006  N  N    . TRP A 1 67  ? 3.494   -6.826  -0.858  1.00 0.00 ? 222 TRP A N    1  
ATOM   1007  C  CA   . TRP A 1 67  ? 2.423   -5.833  -0.527  1.00 0.00 ? 222 TRP A CA   1  
ATOM   1008  C  C    . TRP A 1 67  ? 1.043   -6.493  -0.707  1.00 0.00 ? 222 TRP A C    1  
ATOM   1009  O  O    . TRP A 1 67  ? 0.274   -6.606  0.229   1.00 0.00 ? 222 TRP A O    1  
ATOM   1010  C  CB   . TRP A 1 67  ? 2.596   -4.694  -1.544  1.00 0.00 ? 222 TRP A CB   1  
ATOM   1011  C  CG   . TRP A 1 67  ? 2.433   -3.375  -0.858  1.00 0.00 ? 222 TRP A CG   1  
ATOM   1012  C  CD1  . TRP A 1 67  ? 1.509   -3.095  0.092   1.00 0.00 ? 222 TRP A CD1  1  
ATOM   1013  C  CD2  . TRP A 1 67  ? 3.195   -2.154  -1.058  1.00 0.00 ? 222 TRP A CD2  1  
ATOM   1014  N  NE1  . TRP A 1 67  ? 1.678   -1.790  0.506   1.00 0.00 ? 222 TRP A NE1  1  
ATOM   1015  C  CE2  . TRP A 1 67  ? 2.701   -1.165  -0.177  1.00 0.00 ? 222 TRP A CE2  1  
ATOM   1016  C  CE3  . TRP A 1 67  ? 4.262   -1.816  -1.904  1.00 0.00 ? 222 TRP A CE3  1  
ATOM   1017  C  CZ2  . TRP A 1 67  ? 3.254   0.113   -0.136  1.00 0.00 ? 222 TRP A CZ2  1  
ATOM   1018  C  CZ3  . TRP A 1 67  ? 4.816   -0.526  -1.870  1.00 0.00 ? 222 TRP A CZ3  1  
ATOM   1019  C  CH2  . TRP A 1 67  ? 4.315   0.436   -0.985  1.00 0.00 ? 222 TRP A CH2  1  
ATOM   1020  H  H    . TRP A 1 67  ? 3.307   -7.525  -1.520  1.00 0.00 ? 222 TRP A H    1  
ATOM   1021  H  HA   . TRP A 1 67  ? 2.545   -5.460  0.479   1.00 0.00 ? 222 TRP A HA   1  
ATOM   1022  H  HB2  . TRP A 1 67  ? 3.581   -4.751  -1.981  1.00 0.00 ? 222 TRP A HB2  1  
ATOM   1023  H  HB3  . TRP A 1 67  ? 1.853   -4.786  -2.323  1.00 0.00 ? 222 TRP A HB3  1  
ATOM   1024  H  HD1  . TRP A 1 67  ? 0.773   -3.787  0.474   1.00 0.00 ? 222 TRP A HD1  1  
ATOM   1025  H  HE1  . TRP A 1 67  ? 1.143   -1.344  1.193   1.00 0.00 ? 222 TRP A HE1  1  
ATOM   1026  H  HE3  . TRP A 1 67  ? 4.654   -2.550  -2.590  1.00 0.00 ? 222 TRP A HE3  1  
ATOM   1027  H  HZ2  . TRP A 1 67  ? 2.872   0.845   0.551   1.00 0.00 ? 222 TRP A HZ2  1  
ATOM   1028  H  HZ3  . TRP A 1 67  ? 5.634   -0.276  -2.525  1.00 0.00 ? 222 TRP A HZ3  1  
ATOM   1029  H  HH2  . TRP A 1 67  ? 4.743   1.426   -0.963  1.00 0.00 ? 222 TRP A HH2  1  
ATOM   1030  N  N    . CYS A 1 68  ? 0.742   -6.950  -1.906  1.00 0.00 ? 223 CYS A N    1  
ATOM   1031  C  CA   . CYS A 1 68  ? -0.573  -7.628  -2.146  1.00 0.00 ? 223 CYS A CA   1  
ATOM   1032  C  C    . CYS A 1 68  ? -0.442  -9.174  -2.042  1.00 0.00 ? 223 CYS A C    1  
ATOM   1033  O  O    . CYS A 1 68  ? -1.428  -9.877  -2.145  1.00 0.00 ? 223 CYS A O    1  
ATOM   1034  C  CB   . CYS A 1 68  ? -1.040  -7.183  -3.554  1.00 0.00 ? 223 CYS A CB   1  
ATOM   1035  S  SG   . CYS A 1 68  ? 0.034   -7.855  -4.861  1.00 0.00 ? 223 CYS A SG   1  
ATOM   1036  H  H    . CYS A 1 68  ? 1.388   -6.863  -2.639  1.00 0.00 ? 223 CYS A H    1  
ATOM   1037  H  HA   . CYS A 1 68  ? -1.287  -7.285  -1.414  1.00 0.00 ? 223 CYS A HA   1  
ATOM   1038  H  HB2  . CYS A 1 68  ? -2.048  -7.532  -3.717  1.00 0.00 ? 223 CYS A HB2  1  
ATOM   1039  H  HB3  . CYS A 1 68  ? -1.029  -6.104  -3.603  1.00 0.00 ? 223 CYS A HB3  1  
ATOM   1040  N  N    . ALA A 1 69  ? 0.756   -9.715  -1.832  1.00 0.00 ? 224 ALA A N    1  
ATOM   1041  C  CA   . ALA A 1 69  ? 0.918   -11.200 -1.712  1.00 0.00 ? 224 ALA A CA   1  
ATOM   1042  C  C    . ALA A 1 69  ? 0.341   -11.914 -2.942  1.00 0.00 ? 224 ALA A C    1  
ATOM   1043  O  O    . ALA A 1 69  ? -0.371  -12.894 -2.823  1.00 0.00 ? 224 ALA A O    1  
ATOM   1044  C  CB   . ALA A 1 69  ? 0.168   -11.601 -0.438  1.00 0.00 ? 224 ALA A CB   1  
ATOM   1045  H  H    . ALA A 1 69  ? 1.548   -9.153  -1.749  1.00 0.00 ? 224 ALA A H    1  
ATOM   1046  H  HA   . ALA A 1 69  ? 1.964   -11.448 -1.605  1.00 0.00 ? 224 ALA A HA   1  
ATOM   1047  H  HB1  . ALA A 1 69  ? 0.191   -12.675 -0.332  1.00 0.00 ? 224 ALA A HB1  1  
ATOM   1048  H  HB2  . ALA A 1 69  ? -0.855  -11.265 -0.500  1.00 0.00 ? 224 ALA A HB2  1  
ATOM   1049  H  HB3  . ALA A 1 69  ? 0.646   -11.145 0.420   1.00 0.00 ? 224 ALA A HB3  1  
ATOM   1050  N  N    . GLU A 1 70  ? 0.659   -11.439 -4.126  1.00 0.00 ? 225 GLU A N    1  
ATOM   1051  C  CA   . GLU A 1 70  ? 0.153   -12.091 -5.367  1.00 0.00 ? 225 GLU A CA   1  
ATOM   1052  C  C    . GLU A 1 70  ? 1.349   -12.478 -6.251  1.00 0.00 ? 225 GLU A C    1  
ATOM   1053  O  O    . GLU A 1 70  ? 2.483   -12.413 -5.812  1.00 0.00 ? 225 GLU A O    1  
ATOM   1054  C  CB   . GLU A 1 70  ? -0.712  -11.030 -6.051  1.00 0.00 ? 225 GLU A CB   1  
ATOM   1055  C  CG   . GLU A 1 70  ? -1.891  -10.670 -5.142  1.00 0.00 ? 225 GLU A CG   1  
ATOM   1056  C  CD   . GLU A 1 70  ? -3.029  -10.093 -5.987  1.00 0.00 ? 225 GLU A CD   1  
ATOM   1057  O  OE1  . GLU A 1 70  ? -2.735  -9.390  -6.939  1.00 0.00 ? 225 GLU A OE1  1  
ATOM   1058  O  OE2  . GLU A 1 70  ? -4.174  -10.363 -5.666  1.00 0.00 ? 225 GLU A OE2  1  
ATOM   1059  H  H    . GLU A 1 70  ? 1.244   -10.656 -4.202  1.00 0.00 ? 225 GLU A H    1  
ATOM   1060  H  HA   . GLU A 1 70  ? -0.440  -12.959 -5.126  1.00 0.00 ? 225 GLU A HA   1  
ATOM   1061  H  HB2  . GLU A 1 70  ? -0.118  -10.148 -6.238  1.00 0.00 ? 225 GLU A HB2  1  
ATOM   1062  H  HB3  . GLU A 1 70  ? -1.087  -11.417 -6.985  1.00 0.00 ? 225 GLU A HB3  1  
ATOM   1063  H  HG2  . GLU A 1 70  ? -2.235  -11.558 -4.632  1.00 0.00 ? 225 GLU A HG2  1  
ATOM   1064  H  HG3  . GLU A 1 70  ? -1.577  -9.935  -4.415  1.00 0.00 ? 225 GLU A HG3  1  
ATOM   1065  N  N    . GLY A 1 71  ? 1.121   -12.882 -7.484  1.00 0.00 ? 226 GLY A N    1  
ATOM   1066  C  CA   . GLY A 1 71  ? 2.269   -13.264 -8.360  1.00 0.00 ? 226 GLY A CA   1  
ATOM   1067  C  C    . GLY A 1 71  ? 2.049   -12.716 -9.779  1.00 0.00 ? 226 GLY A C    1  
ATOM   1068  O  O    . GLY A 1 71  ? 1.082   -12.024 -10.035 1.00 0.00 ? 226 GLY A O    1  
ATOM   1069  H  H    . GLY A 1 71  ? 0.204   -12.933 -7.832  1.00 0.00 ? 226 GLY A H    1  
ATOM   1070  H  HA2  . GLY A 1 71  ? 3.182   -12.851 -7.950  1.00 0.00 ? 226 GLY A HA2  1  
ATOM   1071  H  HA3  . GLY A 1 71  ? 2.347   -14.339 -8.401  1.00 0.00 ? 226 GLY A HA3  1  
ATOM   1072  N  N    . GLY A 1 72  ? 2.937   -13.019 -10.706 1.00 0.00 ? 227 GLY A N    1  
ATOM   1073  C  CA   . GLY A 1 72  ? 2.770   -12.511 -12.101 1.00 0.00 ? 227 GLY A CA   1  
ATOM   1074  C  C    . GLY A 1 72  ? 3.699   -11.309 -12.325 1.00 0.00 ? 227 GLY A C    1  
ATOM   1075  O  O    . GLY A 1 72  ? 3.450   -10.230 -11.824 1.00 0.00 ? 227 GLY A O    1  
ATOM   1076  H  H    . GLY A 1 72  ? 3.714   -13.580 -10.487 1.00 0.00 ? 227 GLY A H    1  
ATOM   1077  H  HA2  . GLY A 1 72  ? 3.017   -13.296 -12.802 1.00 0.00 ? 227 GLY A HA2  1  
ATOM   1078  H  HA3  . GLY A 1 72  ? 1.747   -12.203 -12.252 1.00 0.00 ? 227 GLY A HA3  1  
ATOM   1079  N  N    . ASN A 1 73  ? 4.776   -11.479 -13.075 1.00 0.00 ? 228 ASN A N    1  
ATOM   1080  C  CA   . ASN A 1 73  ? 5.720   -10.338 -13.325 1.00 0.00 ? 228 ASN A CA   1  
ATOM   1081  C  C    . ASN A 1 73  ? 6.147   -9.690  -11.997 1.00 0.00 ? 228 ASN A C    1  
ATOM   1082  O  O    . ASN A 1 73  ? 5.481   -8.797  -11.505 1.00 0.00 ? 228 ASN A O    1  
ATOM   1083  C  CB   . ASN A 1 73  ? 4.933   -9.340  -14.180 1.00 0.00 ? 228 ASN A CB   1  
ATOM   1084  C  CG   . ASN A 1 73  ? 5.254   -9.569  -15.663 1.00 0.00 ? 228 ASN A CG   1  
ATOM   1085  O  OD1  . ASN A 1 73  ? 5.668   -8.657  -16.350 1.00 0.00 ? 228 ASN A OD1  1  
ATOM   1086  N  ND2  . ASN A 1 73  ? 5.080   -10.755 -16.194 1.00 0.00 ? 228 ASN A ND2  1  
ATOM   1087  H  H    . ASN A 1 73  ? 4.967   -12.358 -13.473 1.00 0.00 ? 228 ASN A H    1  
ATOM   1088  H  HA   . ASN A 1 73  ? 6.587   -10.680 -13.867 1.00 0.00 ? 228 ASN A HA   1  
ATOM   1089  H  HB2  . ASN A 1 73  ? 3.875   -9.479  -14.014 1.00 0.00 ? 228 ASN A HB2  1  
ATOM   1090  H  HB3  . ASN A 1 73  ? 5.211   -8.333  -13.906 1.00 0.00 ? 228 ASN A HB3  1  
ATOM   1091  H  HD21 . ASN A 1 73  ? 4.745   -11.501 -15.648 1.00 0.00 ? 228 ASN A HD21 1  
ATOM   1092  H  HD22 . ASN A 1 73  ? 5.286   -10.900 -17.141 1.00 0.00 ? 228 ASN A HD22 1  
ATOM   1093  N  N    . LEU A 1 74  ? 7.243   -10.129 -11.408 1.00 0.00 ? 229 LEU A N    1  
ATOM   1094  C  CA   . LEU A 1 74  ? 7.677   -9.524  -10.113 1.00 0.00 ? 229 LEU A CA   1  
ATOM   1095  C  C    . LEU A 1 74  ? 9.089   -8.924  -10.231 1.00 0.00 ? 229 LEU A C    1  
ATOM   1096  O  O    . LEU A 1 74  ? 9.816   -9.216  -11.161 1.00 0.00 ? 229 LEU A O    1  
ATOM   1097  C  CB   . LEU A 1 74  ? 7.681   -10.672 -9.096  1.00 0.00 ? 229 LEU A CB   1  
ATOM   1098  C  CG   . LEU A 1 74  ? 6.298   -11.328 -9.024  1.00 0.00 ? 229 LEU A CG   1  
ATOM   1099  C  CD1  . LEU A 1 74  ? 6.390   -12.609 -8.189  1.00 0.00 ? 229 LEU A CD1  1  
ATOM   1100  C  CD2  . LEU A 1 74  ? 5.306   -10.367 -8.366  1.00 0.00 ? 229 LEU A CD2  1  
ATOM   1101  H  H    . LEU A 1 74  ? 7.771   -10.854 -11.810 1.00 0.00 ? 229 LEU A H    1  
ATOM   1102  H  HA   . LEU A 1 74  ? 6.976   -8.769  -9.811  1.00 0.00 ? 229 LEU A HA   1  
ATOM   1103  H  HB2  . LEU A 1 74  ? 8.411   -11.409 -9.393  1.00 0.00 ? 229 LEU A HB2  1  
ATOM   1104  H  HB3  . LEU A 1 74  ? 7.940   -10.282 -8.124  1.00 0.00 ? 229 LEU A HB3  1  
ATOM   1105  H  HG   . LEU A 1 74  ? 5.962   -11.571 -10.022 1.00 0.00 ? 229 LEU A HG   1  
ATOM   1106  H  HD11 . LEU A 1 74  ? 7.225   -12.536 -7.506  1.00 0.00 ? 229 LEU A HD11 1  
ATOM   1107  H  HD12 . LEU A 1 74  ? 6.533   -13.455 -8.844  1.00 0.00 ? 229 LEU A HD12 1  
ATOM   1108  H  HD13 . LEU A 1 74  ? 5.476   -12.739 -7.627  1.00 0.00 ? 229 LEU A HD13 1  
ATOM   1109  H  HD21 . LEU A 1 74  ? 4.495   -10.931 -7.928  1.00 0.00 ? 229 LEU A HD21 1  
ATOM   1110  H  HD22 . LEU A 1 74  ? 4.914   -9.690  -9.109  1.00 0.00 ? 229 LEU A HD22 1  
ATOM   1111  H  HD23 . LEU A 1 74  ? 5.808   -9.804  -7.594  1.00 0.00 ? 229 LEU A HD23 1  
ATOM   1112  N  N    . ILE A 1 75  ? 9.487   -8.095  -9.283  1.00 0.00 ? 230 ILE A N    1  
ATOM   1113  C  CA   . ILE A 1 75  ? 10.852  -7.492  -9.331  1.00 0.00 ? 230 ILE A CA   1  
ATOM   1114  C  C    . ILE A 1 75  ? 11.675  -7.986  -8.132  1.00 0.00 ? 230 ILE A C    1  
ATOM   1115  O  O    . ILE A 1 75  ? 11.522  -7.490  -7.031  1.00 0.00 ? 230 ILE A O    1  
ATOM   1116  C  CB   . ILE A 1 75  ? 10.625  -5.975  -9.248  1.00 0.00 ? 230 ILE A CB   1  
ATOM   1117  C  CG1  . ILE A 1 75  ? 9.928   -5.503  -10.528 1.00 0.00 ? 230 ILE A CG1  1  
ATOM   1118  C  CG2  . ILE A 1 75  ? 11.967  -5.237  -9.098  1.00 0.00 ? 230 ILE A CG2  1  
ATOM   1119  C  CD1  . ILE A 1 75  ? 9.602   -4.013  -10.417 1.00 0.00 ? 230 ILE A CD1  1  
ATOM   1120  H  H    . ILE A 1 75  ? 8.890   -7.877  -8.532  1.00 0.00 ? 230 ILE A H    1  
ATOM   1121  H  HA   . ILE A 1 75  ? 11.345  -7.743  -10.258 1.00 0.00 ? 230 ILE A HA   1  
ATOM   1122  H  HB   . ILE A 1 75  ? 9.999   -5.753  -8.396  1.00 0.00 ? 230 ILE A HB   1  
ATOM   1123  H  HG12 . ILE A 1 75  ? 10.580  -5.666  -11.373 1.00 0.00 ? 230 ILE A HG12 1  
ATOM   1124  H  HG13 . ILE A 1 75  ? 9.014   -6.060  -10.665 1.00 0.00 ? 230 ILE A HG13 1  
ATOM   1125  H  HG21 . ILE A 1 75  ? 11.785  -4.177  -8.979  1.00 0.00 ? 230 ILE A HG21 1  
ATOM   1126  H  HG22 . ILE A 1 75  ? 12.570  -5.401  -9.978  1.00 0.00 ? 230 ILE A HG22 1  
ATOM   1127  H  HG23 . ILE A 1 75  ? 12.490  -5.609  -8.228  1.00 0.00 ? 230 ILE A HG23 1  
ATOM   1128  H  HD11 . ILE A 1 75  ? 8.636   -3.823  -10.859 1.00 0.00 ? 230 ILE A HD11 1  
ATOM   1129  H  HD12 . ILE A 1 75  ? 10.356  -3.440  -10.938 1.00 0.00 ? 230 ILE A HD12 1  
ATOM   1130  H  HD13 . ILE A 1 75  ? 9.586   -3.723  -9.375  1.00 0.00 ? 230 ILE A HD13 1  
ATOM   1131  N  N    . CYS A 1 76  ? 12.549  -8.951  -8.330  1.00 0.00 ? 231 CYS A N    1  
ATOM   1132  C  CA   . CYS A 1 76  ? 13.373  -9.449  -7.174  1.00 0.00 ? 231 CYS A CA   1  
ATOM   1133  C  C    . CYS A 1 76  ? 14.225  -8.300  -6.616  1.00 0.00 ? 231 CYS A C    1  
ATOM   1134  O  O    . CYS A 1 76  ? 14.649  -7.429  -7.353  1.00 0.00 ? 231 CYS A O    1  
ATOM   1135  C  CB   . CYS A 1 76  ? 14.277  -10.566 -7.721  1.00 0.00 ? 231 CYS A CB   1  
ATOM   1136  S  SG   . CYS A 1 76  ? 13.267  -12.006 -8.147  1.00 0.00 ? 231 CYS A SG   1  
ATOM   1137  H  H    . CYS A 1 76  ? 12.661  -9.337  -9.233  1.00 0.00 ? 231 CYS A H    1  
ATOM   1138  H  HA   . CYS A 1 76  ? 12.730  -9.841  -6.399  1.00 0.00 ? 231 CYS A HA   1  
ATOM   1139  H  HB2  . CYS A 1 76  ? 14.790  -10.211 -8.605  1.00 0.00 ? 231 CYS A HB2  1  
ATOM   1140  H  HB3  . CYS A 1 76  ? 15.002  -10.842 -6.970  1.00 0.00 ? 231 CYS A HB3  1  
ATOM   1141  H  HG   . CYS A 1 76  ? 13.633  -12.400 -8.942  1.00 0.00 ? 231 CYS A HG   1  
ATOM   1142  N  N    . CYS A 1 77  ? 14.476  -8.285  -5.324  1.00 0.00 ? 232 CYS A N    1  
ATOM   1143  C  CA   . CYS A 1 77  ? 15.298  -7.181  -4.738  1.00 0.00 ? 232 CYS A CA   1  
ATOM   1144  C  C    . CYS A 1 77  ? 16.713  -7.681  -4.421  1.00 0.00 ? 232 CYS A C    1  
ATOM   1145  O  O    . CYS A 1 77  ? 16.907  -8.837  -4.093  1.00 0.00 ? 232 CYS A O    1  
ATOM   1146  C  CB   . CYS A 1 77  ? 14.572  -6.765  -3.450  1.00 0.00 ? 232 CYS A CB   1  
ATOM   1147  S  SG   . CYS A 1 77  ? 15.451  -5.386  -2.668  1.00 0.00 ? 232 CYS A SG   1  
ATOM   1148  H  H    . CYS A 1 77  ? 14.124  -8.998  -4.743  1.00 0.00 ? 232 CYS A H    1  
ATOM   1149  H  HA   . CYS A 1 77  ? 15.341  -6.347  -5.419  1.00 0.00 ? 232 CYS A HA   1  
ATOM   1150  H  HB2  . CYS A 1 77  ? 13.564  -6.459  -3.689  1.00 0.00 ? 232 CYS A HB2  1  
ATOM   1151  H  HB3  . CYS A 1 77  ? 14.540  -7.603  -2.770  1.00 0.00 ? 232 CYS A HB3  1  
ATOM   1152  N  N    . ASP A 1 78  ? 17.704  -6.816  -4.501  1.00 0.00 ? 233 ASP A N    1  
ATOM   1153  C  CA   . ASP A 1 78  ? 19.100  -7.252  -4.185  1.00 0.00 ? 233 ASP A CA   1  
ATOM   1154  C  C    . ASP A 1 78  ? 19.523  -6.687  -2.821  1.00 0.00 ? 233 ASP A C    1  
ATOM   1155  O  O    . ASP A 1 78  ? 20.653  -6.272  -2.642  1.00 0.00 ? 233 ASP A O    1  
ATOM   1156  C  CB   . ASP A 1 78  ? 19.977  -6.679  -5.303  1.00 0.00 ? 233 ASP A CB   1  
ATOM   1157  C  CG   . ASP A 1 78  ? 20.125  -7.716  -6.418  1.00 0.00 ? 233 ASP A CG   1  
ATOM   1158  O  OD1  . ASP A 1 78  ? 19.114  -8.256  -6.836  1.00 0.00 ? 233 ASP A OD1  1  
ATOM   1159  O  OD2  . ASP A 1 78  ? 21.247  -7.951  -6.836  1.00 0.00 ? 233 ASP A OD2  1  
ATOM   1160  H  H    . ASP A 1 78  ? 17.526  -5.878  -4.757  1.00 0.00 ? 233 ASP A H    1  
ATOM   1161  H  HA   . ASP A 1 78  ? 19.164  -8.329  -4.182  1.00 0.00 ? 233 ASP A HA   1  
ATOM   1162  H  HB2  . ASP A 1 78  ? 19.516  -5.786  -5.699  1.00 0.00 ? 233 ASP A HB2  1  
ATOM   1163  H  HB3  . ASP A 1 78  ? 20.951  -6.437  -4.908  1.00 0.00 ? 233 ASP A HB3  1  
ATOM   1164  N  N    . PHE A 1 79  ? 18.627  -6.668  -1.851  1.00 0.00 ? 234 PHE A N    1  
ATOM   1165  C  CA   . PHE A 1 79  ? 18.989  -6.128  -0.506  1.00 0.00 ? 234 PHE A CA   1  
ATOM   1166  C  C    . PHE A 1 79  ? 18.215  -6.875  0.596   1.00 0.00 ? 234 PHE A C    1  
ATOM   1167  O  O    . PHE A 1 79  ? 18.812  -7.487  1.463   1.00 0.00 ? 234 PHE A O    1  
ATOM   1168  C  CB   . PHE A 1 79  ? 18.574  -4.653  -0.546  1.00 0.00 ? 234 PHE A CB   1  
ATOM   1169  C  CG   . PHE A 1 79  ? 19.628  -3.828  -1.258  1.00 0.00 ? 234 PHE A CG   1  
ATOM   1170  C  CD1  . PHE A 1 79  ? 20.984  -3.964  -0.925  1.00 0.00 ? 234 PHE A CD1  1  
ATOM   1171  C  CD2  . PHE A 1 79  ? 19.242  -2.914  -2.246  1.00 0.00 ? 234 PHE A CD2  1  
ATOM   1172  C  CE1  . PHE A 1 79  ? 21.947  -3.190  -1.583  1.00 0.00 ? 234 PHE A CE1  1  
ATOM   1173  C  CE2  . PHE A 1 79  ? 20.205  -2.141  -2.902  1.00 0.00 ? 234 PHE A CE2  1  
ATOM   1174  C  CZ   . PHE A 1 79  ? 21.557  -2.278  -2.572  1.00 0.00 ? 234 PHE A CZ   1  
ATOM   1175  H  H    . PHE A 1 79  ? 17.717  -7.006  -2.008  1.00 0.00 ? 234 PHE A H    1  
ATOM   1176  H  HA   . PHE A 1 79  ? 20.051  -6.208  -0.342  1.00 0.00 ? 234 PHE A HA   1  
ATOM   1177  H  HB2  . PHE A 1 79  ? 17.636  -4.563  -1.073  1.00 0.00 ? 234 PHE A HB2  1  
ATOM   1178  H  HB3  . PHE A 1 79  ? 18.456  -4.288  0.463   1.00 0.00 ? 234 PHE A HB3  1  
ATOM   1179  H  HD1  . PHE A 1 79  ? 21.286  -4.666  -0.163  1.00 0.00 ? 234 PHE A HD1  1  
ATOM   1180  H  HD2  . PHE A 1 79  ? 18.200  -2.807  -2.507  1.00 0.00 ? 234 PHE A HD2  1  
ATOM   1181  H  HE1  . PHE A 1 79  ? 22.991  -3.296  -1.329  1.00 0.00 ? 234 PHE A HE1  1  
ATOM   1182  H  HE2  . PHE A 1 79  ? 19.902  -1.433  -3.658  1.00 0.00 ? 234 PHE A HE2  1  
ATOM   1183  H  HZ   . PHE A 1 79  ? 22.300  -1.680  -3.078  1.00 0.00 ? 234 PHE A HZ   1  
ATOM   1184  N  N    . CYS A 1 80  ? 16.894  -6.835  0.575   1.00 0.00 ? 235 CYS A N    1  
ATOM   1185  C  CA   . CYS A 1 80  ? 16.112  -7.560  1.639   1.00 0.00 ? 235 CYS A CA   1  
ATOM   1186  C  C    . CYS A 1 80  ? 15.655  -8.964  1.172   1.00 0.00 ? 235 CYS A C    1  
ATOM   1187  O  O    . CYS A 1 80  ? 14.753  -9.536  1.753   1.00 0.00 ? 235 CYS A O    1  
ATOM   1188  C  CB   . CYS A 1 80  ? 14.896  -6.664  1.965   1.00 0.00 ? 235 CYS A CB   1  
ATOM   1189  S  SG   . CYS A 1 80  ? 13.759  -6.559  0.548   1.00 0.00 ? 235 CYS A SG   1  
ATOM   1190  H  H    . CYS A 1 80  ? 16.427  -6.338  -0.135  1.00 0.00 ? 235 CYS A H    1  
ATOM   1191  H  HA   . CYS A 1 80  ? 16.721  -7.660  2.524   1.00 0.00 ? 235 CYS A HA   1  
ATOM   1192  H  HB2  . CYS A 1 80  ? 14.367  -7.079  2.810   1.00 0.00 ? 235 CYS A HB2  1  
ATOM   1193  H  HB3  . CYS A 1 80  ? 15.243  -5.673  2.218   1.00 0.00 ? 235 CYS A HB3  1  
ATOM   1194  N  N    . HIS A 1 81  ? 16.268  -9.536  0.145   1.00 0.00 ? 236 HIS A N    1  
ATOM   1195  C  CA   . HIS A 1 81  ? 15.857  -10.903 -0.324  1.00 0.00 ? 236 HIS A CA   1  
ATOM   1196  C  C    . HIS A 1 81  ? 14.328  -11.000 -0.514  1.00 0.00 ? 236 HIS A C    1  
ATOM   1197  O  O    . HIS A 1 81  ? 13.658  -11.723 0.202   1.00 0.00 ? 236 HIS A O    1  
ATOM   1198  C  CB   . HIS A 1 81  ? 16.323  -11.854 0.782   1.00 0.00 ? 236 HIS A CB   1  
ATOM   1199  C  CG   . HIS A 1 81  ? 16.760  -13.158 0.172   1.00 0.00 ? 236 HIS A CG   1  
ATOM   1200  N  ND1  . HIS A 1 81  ? 16.138  -13.698 -0.943  1.00 0.00 ? 236 HIS A ND1  1  
ATOM   1201  C  CD2  . HIS A 1 81  ? 17.756  -14.041 0.511   1.00 0.00 ? 236 HIS A CD2  1  
ATOM   1202  C  CE1  . HIS A 1 81  ? 16.760  -14.855 -1.234  1.00 0.00 ? 236 HIS A CE1  1  
ATOM   1203  N  NE2  . HIS A 1 81  ? 17.754  -15.112 -0.379  1.00 0.00 ? 236 HIS A NE2  1  
ATOM   1204  H  H    . HIS A 1 81  ? 17.002  -9.079  -0.314  1.00 0.00 ? 236 HIS A H    1  
ATOM   1205  H  HA   . HIS A 1 81  ? 16.361  -11.145 -1.246  1.00 0.00 ? 236 HIS A HA   1  
ATOM   1206  H  HB2  . HIS A 1 81  ? 17.151  -11.410 1.313   1.00 0.00 ? 236 HIS A HB2  1  
ATOM   1207  H  HB3  . HIS A 1 81  ? 15.509  -12.034 1.469   1.00 0.00 ? 236 HIS A HB3  1  
ATOM   1208  H  HD1  . HIS A 1 81  ? 15.383  -13.307 -1.431  1.00 0.00 ? 236 HIS A HD1  1  
ATOM   1209  H  HD2  . HIS A 1 81  ? 18.436  -13.923 1.340   1.00 0.00 ? 236 HIS A HD2  1  
ATOM   1210  H  HE1  . HIS A 1 81  ? 16.489  -15.497 -2.058  1.00 0.00 ? 236 HIS A HE1  1  
ATOM   1211  N  N    . ASN A 1 82  ? 13.772  -10.287 -1.472  1.00 0.00 ? 237 ASN A N    1  
ATOM   1212  C  CA   . ASN A 1 82  ? 12.290  -10.356 -1.692  1.00 0.00 ? 237 ASN A CA   1  
ATOM   1213  C  C    . ASN A 1 82  ? 11.934  -9.922  -3.124  1.00 0.00 ? 237 ASN A C    1  
ATOM   1214  O  O    . ASN A 1 82  ? 12.809  -9.679  -3.933  1.00 0.00 ? 237 ASN A O    1  
ATOM   1215  C  CB   . ASN A 1 82  ? 11.692  -9.387  -0.673  1.00 0.00 ? 237 ASN A CB   1  
ATOM   1216  C  CG   . ASN A 1 82  ? 11.480  -10.114 0.661   1.00 0.00 ? 237 ASN A CG   1  
ATOM   1217  O  OD1  . ASN A 1 82  ? 10.692  -11.036 0.739   1.00 0.00 ? 237 ASN A OD1  1  
ATOM   1218  N  ND2  . ASN A 1 82  ? 12.151  -9.741  1.723   1.00 0.00 ? 237 ASN A ND2  1  
ATOM   1219  H  H    . ASN A 1 82  ? 14.326  -9.707  -2.045  1.00 0.00 ? 237 ASN A H    1  
ATOM   1220  H  HA   . ASN A 1 82  ? 11.930  -11.356 -1.504  1.00 0.00 ? 237 ASN A HA   1  
ATOM   1221  H  HB2  . ASN A 1 82  ? 12.366  -8.558  -0.529  1.00 0.00 ? 237 ASN A HB2  1  
ATOM   1222  H  HB3  . ASN A 1 82  ? 10.743  -9.021  -1.035  1.00 0.00 ? 237 ASN A HB3  1  
ATOM   1223  H  HD21 . ASN A 1 82  ? 12.791  -8.998  1.671   1.00 0.00 ? 237 ASN A HD21 1  
ATOM   1224  H  HD22 . ASN A 1 82  ? 12.014  -10.207 2.574   1.00 0.00 ? 237 ASN A HD22 1  
ATOM   1225  N  N    . ALA A 1 83  ? 10.660  -9.823  -3.449  1.00 0.00 ? 238 ALA A N    1  
ATOM   1226  C  CA   . ALA A 1 83  ? 10.272  -9.406  -4.834  1.00 0.00 ? 238 ALA A CA   1  
ATOM   1227  C  C    . ALA A 1 83  ? 8.876   -8.754  -4.837  1.00 0.00 ? 238 ALA A C    1  
ATOM   1228  O  O    . ALA A 1 83  ? 7.966   -9.239  -4.194  1.00 0.00 ? 238 ALA A O    1  
ATOM   1229  C  CB   . ALA A 1 83  ? 10.254  -10.704 -5.641  1.00 0.00 ? 238 ALA A CB   1  
ATOM   1230  H  H    . ALA A 1 83  ? 9.961   -10.026 -2.787  1.00 0.00 ? 238 ALA A H    1  
ATOM   1231  H  HA   . ALA A 1 83  ? 11.008  -8.731  -5.242  1.00 0.00 ? 238 ALA A HA   1  
ATOM   1232  H  HB1  . ALA A 1 83  ? 9.778   -10.529 -6.595  1.00 0.00 ? 238 ALA A HB1  1  
ATOM   1233  H  HB2  . ALA A 1 83  ? 9.703   -11.458 -5.099  1.00 0.00 ? 238 ALA A HB2  1  
ATOM   1234  H  HB3  . ALA A 1 83  ? 11.267  -11.043 -5.801  1.00 0.00 ? 238 ALA A HB3  1  
ATOM   1235  N  N    . PHE A 1 84  ? 8.692   -7.671  -5.567  1.00 0.00 ? 239 PHE A N    1  
ATOM   1236  C  CA   . PHE A 1 84  ? 7.342   -7.020  -5.613  1.00 0.00 ? 239 PHE A CA   1  
ATOM   1237  C  C    . PHE A 1 84  ? 6.675   -7.344  -6.956  1.00 0.00 ? 239 PHE A C    1  
ATOM   1238  O  O    . PHE A 1 84  ? 7.226   -8.089  -7.740  1.00 0.00 ? 239 PHE A O    1  
ATOM   1239  C  CB   . PHE A 1 84  ? 7.595   -5.515  -5.478  1.00 0.00 ? 239 PHE A CB   1  
ATOM   1240  C  CG   . PHE A 1 84  ? 7.669   -5.150  -4.014  1.00 0.00 ? 239 PHE A CG   1  
ATOM   1241  C  CD1  . PHE A 1 84  ? 6.496   -4.874  -3.299  1.00 0.00 ? 239 PHE A CD1  1  
ATOM   1242  C  CD2  . PHE A 1 84  ? 8.910   -5.094  -3.371  1.00 0.00 ? 239 PHE A CD2  1  
ATOM   1243  C  CE1  . PHE A 1 84  ? 6.566   -4.543  -1.939  1.00 0.00 ? 239 PHE A CE1  1  
ATOM   1244  C  CE2  . PHE A 1 84  ? 8.980   -4.762  -2.011  1.00 0.00 ? 239 PHE A CE2  1  
ATOM   1245  C  CZ   . PHE A 1 84  ? 7.808   -4.487  -1.295  1.00 0.00 ? 239 PHE A CZ   1  
ATOM   1246  H  H    . PHE A 1 84  ? 9.434   -7.296  -6.095  1.00 0.00 ? 239 PHE A H    1  
ATOM   1247  H  HA   . PHE A 1 84  ? 6.730   -7.369  -4.796  1.00 0.00 ? 239 PHE A HA   1  
ATOM   1248  H  HB2  . PHE A 1 84  ? 8.527   -5.261  -5.961  1.00 0.00 ? 239 PHE A HB2  1  
ATOM   1249  H  HB3  . PHE A 1 84  ? 6.788   -4.969  -5.944  1.00 0.00 ? 239 PHE A HB3  1  
ATOM   1250  H  HD1  . PHE A 1 84  ? 5.539   -4.917  -3.796  1.00 0.00 ? 239 PHE A HD1  1  
ATOM   1251  H  HD2  . PHE A 1 84  ? 9.814   -5.305  -3.925  1.00 0.00 ? 239 PHE A HD2  1  
ATOM   1252  H  HE1  . PHE A 1 84  ? 5.661   -4.329  -1.388  1.00 0.00 ? 239 PHE A HE1  1  
ATOM   1253  H  HE2  . PHE A 1 84  ? 9.937   -4.719  -1.515  1.00 0.00 ? 239 PHE A HE2  1  
ATOM   1254  H  HZ   . PHE A 1 84  ? 7.862   -4.232  -0.245  1.00 0.00 ? 239 PHE A HZ   1  
ATOM   1255  N  N    . CYS A 1 85  ? 5.506   -6.802  -7.236  1.00 0.00 ? 240 CYS A N    1  
ATOM   1256  C  CA   . CYS A 1 85  ? 4.842   -7.110  -8.540  1.00 0.00 ? 240 CYS A CA   1  
ATOM   1257  C  C    . CYS A 1 85  ? 4.624   -5.818  -9.360  1.00 0.00 ? 240 CYS A C    1  
ATOM   1258  O  O    . CYS A 1 85  ? 4.705   -4.724  -8.833  1.00 0.00 ? 240 CYS A O    1  
ATOM   1259  C  CB   . CYS A 1 85  ? 3.523   -7.842  -8.179  1.00 0.00 ? 240 CYS A CB   1  
ATOM   1260  S  SG   . CYS A 1 85  ? 2.178   -6.696  -7.742  1.00 0.00 ? 240 CYS A SG   1  
ATOM   1261  H  H    . CYS A 1 85  ? 5.072   -6.200  -6.599  1.00 0.00 ? 240 CYS A H    1  
ATOM   1262  H  HA   . CYS A 1 85  ? 5.470   -7.778  -9.104  1.00 0.00 ? 240 CYS A HA   1  
ATOM   1263  H  HB2  . CYS A 1 85  ? 3.210   -8.433  -9.025  1.00 0.00 ? 240 CYS A HB2  1  
ATOM   1264  H  HB3  . CYS A 1 85  ? 3.710   -8.503  -7.344  1.00 0.00 ? 240 CYS A HB3  1  
ATOM   1265  N  N    . LYS A 1 86  ? 4.365   -5.939  -10.647 1.00 0.00 ? 241 LYS A N    1  
ATOM   1266  C  CA   . LYS A 1 86  ? 4.164   -4.704  -11.493 1.00 0.00 ? 241 LYS A CA   1  
ATOM   1267  C  C    . LYS A 1 86  ? 2.846   -3.981  -11.134 1.00 0.00 ? 241 LYS A C    1  
ATOM   1268  O  O    . LYS A 1 86  ? 2.768   -2.769  -11.216 1.00 0.00 ? 241 LYS A O    1  
ATOM   1269  C  CB   . LYS A 1 86  ? 4.154   -5.175  -12.966 1.00 0.00 ? 241 LYS A CB   1  
ATOM   1270  C  CG   . LYS A 1 86  ? 2.908   -6.027  -13.256 1.00 0.00 ? 241 LYS A CG   1  
ATOM   1271  C  CD   . LYS A 1 86  ? 2.824   -6.310  -14.758 1.00 0.00 ? 241 LYS A CD   1  
ATOM   1272  C  CE   . LYS A 1 86  ? 1.356   -6.364  -15.186 1.00 0.00 ? 241 LYS A CE   1  
ATOM   1273  N  NZ   . LYS A 1 86  ? 1.380   -6.170  -16.663 1.00 0.00 ? 241 LYS A NZ   1  
ATOM   1274  H  H    . LYS A 1 86  ? 4.316   -6.837  -11.053 1.00 0.00 ? 241 LYS A H    1  
ATOM   1275  H  HA   . LYS A 1 86  ? 4.993   -4.030  -11.342 1.00 0.00 ? 241 LYS A HA   1  
ATOM   1276  H  HB2  . LYS A 1 86  ? 4.154   -4.314  -13.617 1.00 0.00 ? 241 LYS A HB2  1  
ATOM   1277  H  HB3  . LYS A 1 86  ? 5.040   -5.767  -13.157 1.00 0.00 ? 241 LYS A HB3  1  
ATOM   1278  H  HG2  . LYS A 1 86  ? 2.975   -6.962  -12.718 1.00 0.00 ? 241 LYS A HG2  1  
ATOM   1279  H  HG3  . LYS A 1 86  ? 2.025   -5.493  -12.943 1.00 0.00 ? 241 LYS A HG3  1  
ATOM   1280  H  HD2  . LYS A 1 86  ? 3.329   -5.524  -15.300 1.00 0.00 ? 241 LYS A HD2  1  
ATOM   1281  H  HD3  . LYS A 1 86  ? 3.295   -7.257  -14.972 1.00 0.00 ? 241 LYS A HD3  1  
ATOM   1282  H  HE2  . LYS A 1 86  ? 0.929   -7.326  -14.937 1.00 0.00 ? 241 LYS A HE2  1  
ATOM   1283  H  HE3  . LYS A 1 86  ? 0.798   -5.569  -14.718 1.00 0.00 ? 241 LYS A HE3  1  
ATOM   1284  H  HZ1  . LYS A 1 86  ? 1.901   -5.301  -16.890 1.00 0.00 ? 241 LYS A HZ1  1  
ATOM   1285  H  HZ2  . LYS A 1 86  ? 0.404   -6.094  -17.017 1.00 0.00 ? 241 LYS A HZ2  1  
ATOM   1286  H  HZ3  . LYS A 1 86  ? 1.850   -6.981  -17.111 1.00 0.00 ? 241 LYS A HZ3  1  
ATOM   1287  N  N    . LYS A 1 87  ? 1.810   -4.702  -10.752 1.00 0.00 ? 242 LYS A N    1  
ATOM   1288  C  CA   . LYS A 1 87  ? 0.506   -4.017  -10.408 1.00 0.00 ? 242 LYS A CA   1  
ATOM   1289  C  C    . LYS A 1 87  ? 0.648   -3.076  -9.190  1.00 0.00 ? 242 LYS A C    1  
ATOM   1290  O  O    . LYS A 1 87  ? -0.148  -2.170  -9.023  1.00 0.00 ? 242 LYS A O    1  
ATOM   1291  C  CB   . LYS A 1 87  ? -0.504  -5.131  -10.089 1.00 0.00 ? 242 LYS A CB   1  
ATOM   1292  C  CG   . LYS A 1 87  ? -0.889  -5.855  -11.380 1.00 0.00 ? 242 LYS A CG   1  
ATOM   1293  C  CD   . LYS A 1 87  ? -1.165  -7.329  -11.078 1.00 0.00 ? 242 LYS A CD   1  
ATOM   1294  C  CE   . LYS A 1 87  ? -0.748  -8.183  -12.278 1.00 0.00 ? 242 LYS A CE   1  
ATOM   1295  N  NZ   . LYS A 1 87  ? -1.690  -9.338  -12.271 1.00 0.00 ? 242 LYS A NZ   1  
ATOM   1296  H  H    . LYS A 1 87  ? 1.888   -5.684  -10.697 1.00 0.00 ? 242 LYS A H    1  
ATOM   1297  H  HA   . LYS A 1 87  ? 0.159   -3.455  -11.259 1.00 0.00 ? 242 LYS A HA   1  
ATOM   1298  H  HB2  . LYS A 1 87  ? -0.058  -5.835  -9.400  1.00 0.00 ? 242 LYS A HB2  1  
ATOM   1299  H  HB3  . LYS A 1 87  ? -1.388  -4.700  -9.642  1.00 0.00 ? 242 LYS A HB3  1  
ATOM   1300  H  HG2  . LYS A 1 87  ? -1.777  -5.400  -11.797 1.00 0.00 ? 242 LYS A HG2  1  
ATOM   1301  H  HG3  . LYS A 1 87  ? -0.080  -5.781  -12.091 1.00 0.00 ? 242 LYS A HG3  1  
ATOM   1302  H  HD2  . LYS A 1 87  ? -0.599  -7.629  -10.207 1.00 0.00 ? 242 LYS A HD2  1  
ATOM   1303  H  HD3  . LYS A 1 87  ? -2.218  -7.468  -10.888 1.00 0.00 ? 242 LYS A HD3  1  
ATOM   1304  H  HE2  . LYS A 1 87  ? -0.849  -7.617  -13.193 1.00 0.00 ? 242 LYS A HE2  1  
ATOM   1305  H  HE3  . LYS A 1 87  ? 0.264   -8.533  -12.158 1.00 0.00 ? 242 LYS A HE3  1  
ATOM   1306  H  HZ1  . LYS A 1 87  ? -1.450  -9.986  -13.049 1.00 0.00 ? 242 LYS A HZ1  1  
ATOM   1307  H  HZ2  . LYS A 1 87  ? -2.664  -8.991  -12.396 1.00 0.00 ? 242 LYS A HZ2  1  
ATOM   1308  H  HZ3  . LYS A 1 87  ? -1.614  -9.844  -11.367 1.00 0.00 ? 242 LYS A HZ3  1  
ATOM   1309  N  N    . CYS A 1 88  ? 1.642   -3.266  -8.342  1.00 0.00 ? 243 CYS A N    1  
ATOM   1310  C  CA   . CYS A 1 88  ? 1.787   -2.355  -7.153  1.00 0.00 ? 243 CYS A CA   1  
ATOM   1311  C  C    . CYS A 1 88  ? 2.616   -1.123  -7.534  1.00 0.00 ? 243 CYS A C    1  
ATOM   1312  O  O    . CYS A 1 88  ? 2.306   -0.019  -7.125  1.00 0.00 ? 243 CYS A O    1  
ATOM   1313  C  CB   . CYS A 1 88  ? 2.495   -3.173  -6.060  1.00 0.00 ? 243 CYS A CB   1  
ATOM   1314  S  SG   . CYS A 1 88  ? 1.286   -4.198  -5.177  1.00 0.00 ? 243 CYS A SG   1  
ATOM   1315  H  H    . CYS A 1 88  ? 2.286   -3.989  -8.486  1.00 0.00 ? 243 CYS A H    1  
ATOM   1316  H  HA   . CYS A 1 88  ? 0.813   -2.046  -6.807  1.00 0.00 ? 243 CYS A HA   1  
ATOM   1317  H  HB2  . CYS A 1 88  ? 3.241   -3.810  -6.513  1.00 0.00 ? 243 CYS A HB2  1  
ATOM   1318  H  HB3  . CYS A 1 88  ? 2.975   -2.502  -5.362  1.00 0.00 ? 243 CYS A HB3  1  
ATOM   1319  N  N    . ILE A 1 89  ? 3.655   -1.287  -8.331  1.00 0.00 ? 244 ILE A N    1  
ATOM   1320  C  CA   . ILE A 1 89  ? 4.467   -0.087  -8.738  1.00 0.00 ? 244 ILE A CA   1  
ATOM   1321  C  C    . ILE A 1 89  ? 3.641   0.764   -9.714  1.00 0.00 ? 244 ILE A C    1  
ATOM   1322  O  O    . ILE A 1 89  ? 3.651   1.979   -9.635  1.00 0.00 ? 244 ILE A O    1  
ATOM   1323  C  CB   . ILE A 1 89  ? 5.747   -0.615  -9.404  1.00 0.00 ? 244 ILE A CB   1  
ATOM   1324  C  CG1  . ILE A 1 89  ? 6.545   -1.418  -8.377  1.00 0.00 ? 244 ILE A CG1  1  
ATOM   1325  C  CG2  . ILE A 1 89  ? 6.599   0.560   -9.893  1.00 0.00 ? 244 ILE A CG2  1  
ATOM   1326  C  CD1  . ILE A 1 89  ? 7.724   -2.102  -9.067  1.00 0.00 ? 244 ILE A CD1  1  
ATOM   1327  H  H    . ILE A 1 89  ? 3.883   -2.186  -8.670  1.00 0.00 ? 244 ILE A H    1  
ATOM   1328  H  HA   . ILE A 1 89  ? 4.720   0.497   -7.865  1.00 0.00 ? 244 ILE A HA   1  
ATOM   1329  H  HB   . ILE A 1 89  ? 5.487   -1.249  -10.240 1.00 0.00 ? 244 ILE A HB   1  
ATOM   1330  H  HG12 . ILE A 1 89  ? 6.912   -0.752  -7.608  1.00 0.00 ? 244 ILE A HG12 1  
ATOM   1331  H  HG13 . ILE A 1 89  ? 5.909   -2.166  -7.930  1.00 0.00 ? 244 ILE A HG13 1  
ATOM   1332  H  HG21 . ILE A 1 89  ? 7.601   0.215   -10.103 1.00 0.00 ? 244 ILE A HG21 1  
ATOM   1333  H  HG22 . ILE A 1 89  ? 6.631   1.323   -9.130  1.00 0.00 ? 244 ILE A HG22 1  
ATOM   1334  H  HG23 . ILE A 1 89  ? 6.164   0.969   -10.793 1.00 0.00 ? 244 ILE A HG23 1  
ATOM   1335  H  HD11 . ILE A 1 89  ? 8.147   -1.433  -9.804  1.00 0.00 ? 244 ILE A HD11 1  
ATOM   1336  H  HD12 . ILE A 1 89  ? 7.382   -3.003  -9.553  1.00 0.00 ? 244 ILE A HD12 1  
ATOM   1337  H  HD13 . ILE A 1 89  ? 8.477   -2.350  -8.334  1.00 0.00 ? 244 ILE A HD13 1  
ATOM   1338  N  N    . LEU A 1 90  ? 2.903   0.145   -10.619 1.00 0.00 ? 245 LEU A N    1  
ATOM   1339  C  CA   . LEU A 1 90  ? 2.059   0.955   -11.570 1.00 0.00 ? 245 LEU A CA   1  
ATOM   1340  C  C    . LEU A 1 90  ? 1.080   1.834   -10.772 1.00 0.00 ? 245 LEU A C    1  
ATOM   1341  O  O    . LEU A 1 90  ? 0.839   2.972   -11.129 1.00 0.00 ? 245 LEU A O    1  
ATOM   1342  C  CB   . LEU A 1 90  ? 1.284   -0.044  -12.445 1.00 0.00 ? 245 LEU A CB   1  
ATOM   1343  C  CG   . LEU A 1 90  ? 0.992   0.591   -13.806 1.00 0.00 ? 245 LEU A CG   1  
ATOM   1344  C  CD1  . LEU A 1 90  ? 0.363   -0.452  -14.733 1.00 0.00 ? 245 LEU A CD1  1  
ATOM   1345  C  CD2  . LEU A 1 90  ? 0.024   1.761   -13.624 1.00 0.00 ? 245 LEU A CD2  1  
ATOM   1346  H  H    . LEU A 1 90  ? 2.894   -0.839  -10.661 1.00 0.00 ? 245 LEU A H    1  
ATOM   1347  H  HA   . LEU A 1 90  ? 2.689   1.572   -12.184 1.00 0.00 ? 245 LEU A HA   1  
ATOM   1348  H  HB2  . LEU A 1 90  ? 1.876   -0.937  -12.582 1.00 0.00 ? 245 LEU A HB2  1  
ATOM   1349  H  HB3  . LEU A 1 90  ? 0.352   -0.299  -11.962 1.00 0.00 ? 245 LEU A HB3  1  
ATOM   1350  H  HG   . LEU A 1 90  ? 1.915   0.948   -14.241 1.00 0.00 ? 245 LEU A HG   1  
ATOM   1351  H  HD11 . LEU A 1 90  ? -0.713  -0.379  -14.679 1.00 0.00 ? 245 LEU A HD11 1  
ATOM   1352  H  HD12 . LEU A 1 90  ? 0.671   -1.441  -14.424 1.00 0.00 ? 245 LEU A HD12 1  
ATOM   1353  H  HD13 . LEU A 1 90  ? 0.687   -0.274  -15.747 1.00 0.00 ? 245 LEU A HD13 1  
ATOM   1354  H  HD21 . LEU A 1 90  ? -0.695  1.517   -12.856 1.00 0.00 ? 245 LEU A HD21 1  
ATOM   1355  H  HD22 . LEU A 1 90  ? -0.491  1.950   -14.554 1.00 0.00 ? 245 LEU A HD22 1  
ATOM   1356  H  HD23 . LEU A 1 90  ? 0.576   2.643   -13.332 1.00 0.00 ? 245 LEU A HD23 1  
ATOM   1357  N  N    . ARG A 1 91  ? 0.528   1.327   -9.683  1.00 0.00 ? 246 ARG A N    1  
ATOM   1358  C  CA   . ARG A 1 91  ? -0.415  2.172   -8.869  1.00 0.00 ? 246 ARG A CA   1  
ATOM   1359  C  C    . ARG A 1 91  ? 0.356   3.095   -7.897  1.00 0.00 ? 246 ARG A C    1  
ATOM   1360  O  O    . ARG A 1 91  ? -0.200  4.052   -7.392  1.00 0.00 ? 246 ARG A O    1  
ATOM   1361  C  CB   . ARG A 1 91  ? -1.305  1.196   -8.084  1.00 0.00 ? 246 ARG A CB   1  
ATOM   1362  C  CG   . ARG A 1 91  ? -2.130  0.359   -9.064  1.00 0.00 ? 246 ARG A CG   1  
ATOM   1363  C  CD   . ARG A 1 91  ? -3.211  1.235   -9.703  1.00 0.00 ? 246 ARG A CD   1  
ATOM   1364  N  NE   . ARG A 1 91  ? -3.897  0.345   -10.681 1.00 0.00 ? 246 ARG A NE   1  
ATOM   1365  C  CZ   . ARG A 1 91  ? -3.493  0.305   -11.921 1.00 0.00 ? 246 ARG A CZ   1  
ATOM   1366  N  NH1  . ARG A 1 91  ? -3.688  1.329   -12.705 1.00 0.00 ? 246 ARG A NH1  1  
ATOM   1367  N  NH2  . ARG A 1 91  ? -2.894  -0.761  -12.376 1.00 0.00 ? 246 ARG A NH2  1  
ATOM   1368  H  H    . ARG A 1 91  ? 0.746   0.405   -9.394  1.00 0.00 ? 246 ARG A H    1  
ATOM   1369  H  HA   . ARG A 1 91  ? -1.028  2.769   -9.526  1.00 0.00 ? 246 ARG A HA   1  
ATOM   1370  H  HB2  . ARG A 1 91  ? -0.684  0.545   -7.487  1.00 0.00 ? 246 ARG A HB2  1  
ATOM   1371  H  HB3  . ARG A 1 91  ? -1.969  1.752   -7.440  1.00 0.00 ? 246 ARG A HB3  1  
ATOM   1372  H  HG2  . ARG A 1 91  ? -1.483  -0.037  -9.833  1.00 0.00 ? 246 ARG A HG2  1  
ATOM   1373  H  HG3  . ARG A 1 91  ? -2.600  -0.457  -8.533  1.00 0.00 ? 246 ARG A HG3  1  
ATOM   1374  H  HD2  . ARG A 1 91  ? -3.907  1.581   -8.951  1.00 0.00 ? 246 ARG A HD2  1  
ATOM   1375  H  HD3  . ARG A 1 91  ? -2.763  2.071   -10.217 1.00 0.00 ? 246 ARG A HD3  1  
ATOM   1376  H  HE   . ARG A 1 91  ? -4.653  -0.209  -10.392 1.00 0.00 ? 246 ARG A HE   1  
ATOM   1377  H  HH11 . ARG A 1 91  ? -4.148  2.146   -12.355 1.00 0.00 ? 246 ARG A HH11 1  
ATOM   1378  H  HH12 . ARG A 1 91  ? -3.379  1.298   -13.655 1.00 0.00 ? 246 ARG A HH12 1  
ATOM   1379  H  HH21 . ARG A 1 91  ? -2.744  -1.547  -11.776 1.00 0.00 ? 246 ARG A HH21 1  
ATOM   1380  H  HH22 . ARG A 1 91  ? -2.585  -0.793  -13.328 1.00 0.00 ? 246 ARG A HH22 1  
ATOM   1381  N  N    . ASN A 1 92  ? 1.626   2.830   -7.624  1.00 0.00 ? 247 ASN A N    1  
ATOM   1382  C  CA   . ASN A 1 92  ? 2.389   3.719   -6.686  1.00 0.00 ? 247 ASN A CA   1  
ATOM   1383  C  C    . ASN A 1 92  ? 3.206   4.754   -7.471  1.00 0.00 ? 247 ASN A C    1  
ATOM   1384  O  O    . ASN A 1 92  ? 3.268   5.909   -7.091  1.00 0.00 ? 247 ASN A O    1  
ATOM   1385  C  CB   . ASN A 1 92  ? 3.322   2.795   -5.891  1.00 0.00 ? 247 ASN A CB   1  
ATOM   1386  C  CG   . ASN A 1 92  ? 3.907   3.562   -4.697  1.00 0.00 ? 247 ASN A CG   1  
ATOM   1387  O  OD1  . ASN A 1 92  ? 4.053   4.767   -4.753  1.00 0.00 ? 247 ASN A OD1  1  
ATOM   1388  N  ND2  . ASN A 1 92  ? 4.251   2.916   -3.610  1.00 0.00 ? 247 ASN A ND2  1  
ATOM   1389  H  H    . ASN A 1 92  ? 2.074   2.062   -8.033  1.00 0.00 ? 247 ASN A H    1  
ATOM   1390  H  HA   . ASN A 1 92  ? 1.712   4.217   -6.016  1.00 0.00 ? 247 ASN A HA   1  
ATOM   1391  H  HB2  . ASN A 1 92  ? 2.765   1.942   -5.532  1.00 0.00 ? 247 ASN A HB2  1  
ATOM   1392  H  HB3  . ASN A 1 92  ? 4.126   2.459   -6.529  1.00 0.00 ? 247 ASN A HB3  1  
ATOM   1393  H  HD21 . ASN A 1 92  ? 4.138   1.942   -3.552  1.00 0.00 ? 247 ASN A HD21 1  
ATOM   1394  H  HD22 . ASN A 1 92  ? 4.625   3.409   -2.848  1.00 0.00 ? 247 ASN A HD22 1  
ATOM   1395  N  N    . LEU A 1 93  ? 3.836   4.360   -8.560  1.00 0.00 ? 248 LEU A N    1  
ATOM   1396  C  CA   . LEU A 1 93  ? 4.644   5.350   -9.345  1.00 0.00 ? 248 LEU A CA   1  
ATOM   1397  C  C    . LEU A 1 93  ? 4.660   5.043   -10.860 1.00 0.00 ? 248 LEU A C    1  
ATOM   1398  O  O    . LEU A 1 93  ? 5.582   5.434   -11.551 1.00 0.00 ? 248 LEU A O    1  
ATOM   1399  C  CB   . LEU A 1 93  ? 6.060   5.274   -8.759  1.00 0.00 ? 248 LEU A CB   1  
ATOM   1400  C  CG   . LEU A 1 93  ? 6.639   3.865   -8.924  1.00 0.00 ? 248 LEU A CG   1  
ATOM   1401  C  CD1  . LEU A 1 93  ? 7.307   3.740   -10.293 1.00 0.00 ? 248 LEU A CD1  1  
ATOM   1402  C  CD2  . LEU A 1 93  ? 7.681   3.615   -7.831  1.00 0.00 ? 248 LEU A CD2  1  
ATOM   1403  H  H    . LEU A 1 93  ? 3.778   3.427   -8.852  1.00 0.00 ? 248 LEU A H    1  
ATOM   1404  H  HA   . LEU A 1 93  ? 4.251   6.342   -9.185  1.00 0.00 ? 248 LEU A HA   1  
ATOM   1405  H  HB2  . LEU A 1 93  ? 6.695   5.982   -9.270  1.00 0.00 ? 248 LEU A HB2  1  
ATOM   1406  H  HB3  . LEU A 1 93  ? 6.024   5.522   -7.708  1.00 0.00 ? 248 LEU A HB3  1  
ATOM   1407  H  HG   . LEU A 1 93  ? 5.852   3.134   -8.844  1.00 0.00 ? 248 LEU A HG   1  
ATOM   1408  H  HD11 . LEU A 1 93  ? 6.573   3.438   -11.025 1.00 0.00 ? 248 LEU A HD11 1  
ATOM   1409  H  HD12 . LEU A 1 93  ? 8.093   3.000   -10.245 1.00 0.00 ? 248 LEU A HD12 1  
ATOM   1410  H  HD13 . LEU A 1 93  ? 7.728   4.693   -10.577 1.00 0.00 ? 248 LEU A HD13 1  
ATOM   1411  H  HD21 . LEU A 1 93  ? 7.689   2.566   -7.573  1.00 0.00 ? 248 LEU A HD21 1  
ATOM   1412  H  HD22 . LEU A 1 93  ? 7.433   4.198   -6.957  1.00 0.00 ? 248 LEU A HD22 1  
ATOM   1413  H  HD23 . LEU A 1 93  ? 8.658   3.904   -8.191  1.00 0.00 ? 248 LEU A HD23 1  
ATOM   1414  N  N    . GLY A 1 94  ? 3.648   4.382   -11.399 1.00 0.00 ? 249 GLY A N    1  
ATOM   1415  C  CA   . GLY A 1 94  ? 3.638   4.109   -12.871 1.00 0.00 ? 249 GLY A CA   1  
ATOM   1416  C  C    . GLY A 1 94  ? 4.517   2.894   -13.205 1.00 0.00 ? 249 GLY A C    1  
ATOM   1417  O  O    . GLY A 1 94  ? 5.144   2.317   -12.338 1.00 0.00 ? 249 GLY A O    1  
ATOM   1418  H  H    . GLY A 1 94  ? 2.890   4.087   -10.849 1.00 0.00 ? 249 GLY A H    1  
ATOM   1419  H  HA2  . GLY A 1 94  ? 2.624   3.914   -13.190 1.00 0.00 ? 249 GLY A HA2  1  
ATOM   1420  H  HA3  . GLY A 1 94  ? 4.018   4.971   -13.398 1.00 0.00 ? 249 GLY A HA3  1  
ATOM   1421  N  N    . ARG A 1 95  ? 4.558   2.497   -14.463 1.00 0.00 ? 250 ARG A N    1  
ATOM   1422  C  CA   . ARG A 1 95  ? 5.395   1.310   -14.854 1.00 0.00 ? 250 ARG A CA   1  
ATOM   1423  C  C    . ARG A 1 95  ? 6.740   1.736   -15.478 1.00 0.00 ? 250 ARG A C    1  
ATOM   1424  O  O    . ARG A 1 95  ? 7.701   0.993   -15.416 1.00 0.00 ? 250 ARG A O    1  
ATOM   1425  C  CB   . ARG A 1 95  ? 4.559   0.540   -15.881 1.00 0.00 ? 250 ARG A CB   1  
ATOM   1426  C  CG   . ARG A 1 95  ? 5.135   -0.869  -16.059 1.00 0.00 ? 250 ARG A CG   1  
ATOM   1427  C  CD   . ARG A 1 95  ? 6.079   -0.888  -17.263 1.00 0.00 ? 250 ARG A CD   1  
ATOM   1428  N  NE   . ARG A 1 95  ? 6.903   -2.117  -17.084 1.00 0.00 ? 250 ARG A NE   1  
ATOM   1429  C  CZ   . ARG A 1 95  ? 6.629   -3.192  -17.770 1.00 0.00 ? 250 ARG A CZ   1  
ATOM   1430  N  NH1  . ARG A 1 95  ? 5.756   -4.050  -17.318 1.00 0.00 ? 250 ARG A NH1  1  
ATOM   1431  N  NH2  . ARG A 1 95  ? 7.230   -3.411  -18.908 1.00 0.00 ? 250 ARG A NH2  1  
ATOM   1432  H  H    . ARG A 1 95  ? 4.035   2.977   -15.149 1.00 0.00 ? 250 ARG A H    1  
ATOM   1433  H  HA   . ARG A 1 95  ? 5.572   0.689   -13.994 1.00 0.00 ? 250 ARG A HA   1  
ATOM   1434  H  HB2  . ARG A 1 95  ? 3.538   0.472   -15.537 1.00 0.00 ? 250 ARG A HB2  1  
ATOM   1435  H  HB3  . ARG A 1 95  ? 4.587   1.061   -16.827 1.00 0.00 ? 250 ARG A HB3  1  
ATOM   1436  H  HG2  . ARG A 1 95  ? 5.679   -1.149  -15.170 1.00 0.00 ? 250 ARG A HG2  1  
ATOM   1437  H  HG3  . ARG A 1 95  ? 4.329   -1.568  -16.225 1.00 0.00 ? 250 ARG A HG3  1  
ATOM   1438  H  HD2  . ARG A 1 95  ? 5.513   -0.943  -18.183 1.00 0.00 ? 250 ARG A HD2  1  
ATOM   1439  H  HD3  . ARG A 1 95  ? 6.713   -0.014  -17.261 1.00 0.00 ? 250 ARG A HD3  1  
ATOM   1440  H  HE   . ARG A 1 95  ? 7.651   -2.116  -16.451 1.00 0.00 ? 250 ARG A HE   1  
ATOM   1441  H  HH11 . ARG A 1 95  ? 5.296   -3.882  -16.446 1.00 0.00 ? 250 ARG A HH11 1  
ATOM   1442  H  HH12 . ARG A 1 95  ? 5.547   -4.874  -17.844 1.00 0.00 ? 250 ARG A HH12 1  
ATOM   1443  H  HH21 . ARG A 1 95  ? 7.899   -2.754  -19.255 1.00 0.00 ? 250 ARG A HH21 1  
ATOM   1444  H  HH22 . ARG A 1 95  ? 7.021   -4.235  -19.434 1.00 0.00 ? 250 ARG A HH22 1  
ATOM   1445  N  N    . LYS A 1 96  ? 6.828   2.909   -16.089 1.00 0.00 ? 251 LYS A N    1  
ATOM   1446  C  CA   . LYS A 1 96  ? 8.139   3.338   -16.720 1.00 0.00 ? 251 LYS A CA   1  
ATOM   1447  C  C    . LYS A 1 96  ? 9.301   3.170   -15.728 1.00 0.00 ? 251 LYS A C    1  
ATOM   1448  O  O    . LYS A 1 96  ? 10.244  2.451   -16.000 1.00 0.00 ? 251 LYS A O    1  
ATOM   1449  C  CB   . LYS A 1 96  ? 7.984   4.820   -17.101 1.00 0.00 ? 251 LYS A CB   1  
ATOM   1450  C  CG   . LYS A 1 96  ? 7.362   4.926   -18.495 1.00 0.00 ? 251 LYS A CG   1  
ATOM   1451  C  CD   . LYS A 1 96  ? 8.343   4.380   -19.535 1.00 0.00 ? 251 LYS A CD   1  
ATOM   1452  C  CE   . LYS A 1 96  ? 8.199   5.170   -20.837 1.00 0.00 ? 251 LYS A CE   1  
ATOM   1453  N  NZ   . LYS A 1 96  ? 6.860   4.792   -21.371 1.00 0.00 ? 251 LYS A NZ   1  
ATOM   1454  H  H    . LYS A 1 96  ? 6.040   3.492   -16.143 1.00 0.00 ? 251 LYS A H    1  
ATOM   1455  H  HA   . LYS A 1 96  ? 8.333   2.751   -17.604 1.00 0.00 ? 251 LYS A HA   1  
ATOM   1456  H  HB2  . LYS A 1 96  ? 7.343   5.310   -16.382 1.00 0.00 ? 251 LYS A HB2  1  
ATOM   1457  H  HB3  . LYS A 1 96  ? 8.953   5.294   -17.103 1.00 0.00 ? 251 LYS A HB3  1  
ATOM   1458  H  HG2  . LYS A 1 96  ? 6.447   4.352   -18.526 1.00 0.00 ? 251 LYS A HG2  1  
ATOM   1459  H  HG3  . LYS A 1 96  ? 7.147   5.960   -18.715 1.00 0.00 ? 251 LYS A HG3  1  
ATOM   1460  H  HD2  . LYS A 1 96  ? 9.353   4.478   -19.164 1.00 0.00 ? 251 LYS A HD2  1  
ATOM   1461  H  HD3  . LYS A 1 96  ? 8.126   3.340   -19.723 1.00 0.00 ? 251 LYS A HD3  1  
ATOM   1462  H  HE2  . LYS A 1 96  ? 8.241   6.233   -20.638 1.00 0.00 ? 251 LYS A HE2  1  
ATOM   1463  H  HE3  . LYS A 1 96  ? 8.969   4.886   -21.538 1.00 0.00 ? 251 LYS A HE3  1  
ATOM   1464  H  HZ1  . LYS A 1 96  ? 6.123   5.098   -20.705 1.00 0.00 ? 251 LYS A HZ1  1  
ATOM   1465  H  HZ2  . LYS A 1 96  ? 6.814   3.759   -21.489 1.00 0.00 ? 251 LYS A HZ2  1  
ATOM   1466  H  HZ3  . LYS A 1 96  ? 6.709   5.255   -22.288 1.00 0.00 ? 251 LYS A HZ3  1  
ATOM   1467  N  N    . GLU A 1 97  ? 9.237   3.801   -14.569 1.00 0.00 ? 252 GLU A N    1  
ATOM   1468  C  CA   . GLU A 1 97  ? 10.353  3.626   -13.568 1.00 0.00 ? 252 GLU A CA   1  
ATOM   1469  C  C    . GLU A 1 97  ? 10.587  2.124   -13.298 1.00 0.00 ? 252 GLU A C    1  
ATOM   1470  O  O    . GLU A 1 97  ? 11.696  1.708   -13.020 1.00 0.00 ? 252 GLU A O    1  
ATOM   1471  C  CB   . GLU A 1 97  ? 9.913   4.331   -12.274 1.00 0.00 ? 252 GLU A CB   1  
ATOM   1472  C  CG   . GLU A 1 97  ? 11.146  4.860   -11.538 1.00 0.00 ? 252 GLU A CG   1  
ATOM   1473  C  CD   . GLU A 1 97  ? 10.722  5.940   -10.542 1.00 0.00 ? 252 GLU A CD   1  
ATOM   1474  O  OE1  . GLU A 1 97  ? 9.925   6.785   -10.918 1.00 0.00 ? 252 GLU A OE1  1  
ATOM   1475  O  OE2  . GLU A 1 97  ? 11.201  5.906   -9.421  1.00 0.00 ? 252 GLU A OE2  1  
ATOM   1476  H  H    . GLU A 1 97  ? 8.458   4.366   -14.359 1.00 0.00 ? 252 GLU A H    1  
ATOM   1477  H  HA   . GLU A 1 97  ? 11.254  4.077   -13.942 1.00 0.00 ? 252 GLU A HA   1  
ATOM   1478  H  HB2  . GLU A 1 97  ? 9.258   5.154   -12.516 1.00 0.00 ? 252 GLU A HB2  1  
ATOM   1479  H  HB3  . GLU A 1 97  ? 9.393   3.628   -11.643 1.00 0.00 ? 252 GLU A HB3  1  
ATOM   1480  H  HG2  . GLU A 1 97  ? 11.623  4.048   -11.008 1.00 0.00 ? 252 GLU A HG2  1  
ATOM   1481  H  HG3  . GLU A 1 97  ? 11.839  5.281   -12.251 1.00 0.00 ? 252 GLU A HG3  1  
ATOM   1482  N  N    . LEU A 1 98  ? 9.552   1.305   -13.391 1.00 0.00 ? 253 LEU A N    1  
ATOM   1483  C  CA   . LEU A 1 98  ? 9.735   -0.172  -13.153 1.00 0.00 ? 253 LEU A CA   1  
ATOM   1484  C  C    . LEU A 1 98  ? 10.810  -0.736  -14.101 1.00 0.00 ? 253 LEU A C    1  
ATOM   1485  O  O    . LEU A 1 98  ? 11.551  -1.626  -13.729 1.00 0.00 ? 253 LEU A O    1  
ATOM   1486  C  CB   . LEU A 1 98  ? 8.377   -0.831  -13.441 1.00 0.00 ? 253 LEU A CB   1  
ATOM   1487  C  CG   . LEU A 1 98  ? 8.264   -2.140  -12.662 1.00 0.00 ? 253 LEU A CG   1  
ATOM   1488  C  CD1  . LEU A 1 98  ? 6.798   -2.576  -12.604 1.00 0.00 ? 253 LEU A CD1  1  
ATOM   1489  C  CD2  . LEU A 1 98  ? 9.089   -3.223  -13.363 1.00 0.00 ? 253 LEU A CD2  1  
ATOM   1490  H  H    . LEU A 1 98  ? 8.664   1.657   -13.625 1.00 0.00 ? 253 LEU A H    1  
ATOM   1491  H  HA   . LEU A 1 98  ? 10.017  -0.349  -12.127 1.00 0.00 ? 253 LEU A HA   1  
ATOM   1492  H  HB2  . LEU A 1 98  ? 7.583   -0.163  -13.137 1.00 0.00 ? 253 LEU A HB2  1  
ATOM   1493  H  HB3  . LEU A 1 98  ? 8.293   -1.030  -14.498 1.00 0.00 ? 253 LEU A HB3  1  
ATOM   1494  H  HG   . LEU A 1 98  ? 8.636   -1.995  -11.658 1.00 0.00 ? 253 LEU A HG   1  
ATOM   1495  H  HD11 . LEU A 1 98  ? 6.246   -1.898  -11.968 1.00 0.00 ? 253 LEU A HD11 1  
ATOM   1496  H  HD12 . LEU A 1 98  ? 6.736   -3.576  -12.203 1.00 0.00 ? 253 LEU A HD12 1  
ATOM   1497  H  HD13 . LEU A 1 98  ? 6.378   -2.558  -13.599 1.00 0.00 ? 253 LEU A HD13 1  
ATOM   1498  H  HD21 . LEU A 1 98  ? 10.092  -3.227  -12.963 1.00 0.00 ? 253 LEU A HD21 1  
ATOM   1499  H  HD22 . LEU A 1 98  ? 9.125   -3.019  -14.423 1.00 0.00 ? 253 LEU A HD22 1  
ATOM   1500  H  HD23 . LEU A 1 98  ? 8.631   -4.187  -13.199 1.00 0.00 ? 253 LEU A HD23 1  
ATOM   1501  N  N    . SER A 1 99  ? 10.912  -0.232  -15.318 1.00 0.00 ? 254 SER A N    1  
ATOM   1502  C  CA   . SER A 1 99  ? 11.969  -0.773  -16.249 1.00 0.00 ? 254 SER A CA   1  
ATOM   1503  C  C    . SER A 1 99  ? 13.359  -0.448  -15.686 1.00 0.00 ? 254 SER A C    1  
ATOM   1504  O  O    . SER A 1 99  ? 14.193  -1.324  -15.555 1.00 0.00 ? 254 SER A O    1  
ATOM   1505  C  CB   . SER A 1 99  ? 11.766  -0.087  -17.608 1.00 0.00 ? 254 SER A CB   1  
ATOM   1506  O  OG   . SER A 1 99  ? 12.511  1.123   -17.639 1.00 0.00 ? 254 SER A OG   1  
ATOM   1507  H  H    . SER A 1 99  ? 10.305  0.495   -15.612 1.00 0.00 ? 254 SER A H    1  
ATOM   1508  H  HA   . SER A 1 99  ? 11.860  -1.842  -16.352 1.00 0.00 ? 254 SER A HA   1  
ATOM   1509  H  HB2  . SER A 1 99  ? 12.110  -0.735  -18.396 1.00 0.00 ? 254 SER A HB2  1  
ATOM   1510  H  HB3  . SER A 1 99  ? 10.714  0.122   -17.751 1.00 0.00 ? 254 SER A HB3  1  
ATOM   1511  H  HG   . SER A 1 99  ? 12.305  1.579   -18.457 1.00 0.00 ? 254 SER A HG   1  
ATOM   1512  N  N    . THR A 1 100 ? 13.614  0.797   -15.332 1.00 0.00 ? 255 THR A N    1  
ATOM   1513  C  CA   . THR A 1 100 ? 14.967  1.143   -14.755 1.00 0.00 ? 255 THR A CA   1  
ATOM   1514  C  C    . THR A 1 100 ? 15.251  0.275   -13.516 1.00 0.00 ? 255 THR A C    1  
ATOM   1515  O  O    . THR A 1 100 ? 16.387  -0.074  -13.255 1.00 0.00 ? 255 THR A O    1  
ATOM   1516  C  CB   . THR A 1 100 ? 14.918  2.630   -14.364 1.00 0.00 ? 255 THR A CB   1  
ATOM   1517  O  OG1  . THR A 1 100 ? 14.185  3.351   -15.343 1.00 0.00 ? 255 THR A OG1  1  
ATOM   1518  C  CG2  . THR A 1 100 ? 16.341  3.184   -14.278 1.00 0.00 ? 255 THR A CG2  1  
ATOM   1519  H  H    . THR A 1 100 ? 12.920  1.491   -15.434 1.00 0.00 ? 255 THR A H    1  
ATOM   1520  H  HA   . THR A 1 100 ? 15.735  0.982   -15.492 1.00 0.00 ? 255 THR A HA   1  
ATOM   1521  H  HB   . THR A 1 100 ? 14.437  2.733   -13.403 1.00 0.00 ? 255 THR A HB   1  
ATOM   1522  H  HG1  . THR A 1 100 ? 13.884  4.171   -14.944 1.00 0.00 ? 255 THR A HG1  1  
ATOM   1523  H  HG21 . THR A 1 100 ? 16.922  2.813   -15.109 1.00 0.00 ? 255 THR A HG21 1  
ATOM   1524  H  HG22 . THR A 1 100 ? 16.796  2.867   -13.350 1.00 0.00 ? 255 THR A HG22 1  
ATOM   1525  H  HG23 . THR A 1 100 ? 16.309  4.263   -14.313 1.00 0.00 ? 255 THR A HG23 1  
ATOM   1526  N  N    . ILE A 1 101 ? 14.233  -0.091  -12.757 1.00 0.00 ? 256 ILE A N    1  
ATOM   1527  C  CA   . ILE A 1 101 ? 14.479  -0.956  -11.545 1.00 0.00 ? 256 ILE A CA   1  
ATOM   1528  C  C    . ILE A 1 101 ? 15.211  -2.250  -11.959 1.00 0.00 ? 256 ILE A C    1  
ATOM   1529  O  O    . ILE A 1 101 ? 16.001  -2.778  -11.198 1.00 0.00 ? 256 ILE A O    1  
ATOM   1530  C  CB   . ILE A 1 101 ? 13.094  -1.276  -10.937 1.00 0.00 ? 256 ILE A CB   1  
ATOM   1531  C  CG1  . ILE A 1 101 ? 12.498  0.003   -10.338 1.00 0.00 ? 256 ILE A CG1  1  
ATOM   1532  C  CG2  . ILE A 1 101 ? 13.230  -2.331  -9.833  1.00 0.00 ? 256 ILE A CG2  1  
ATOM   1533  C  CD1  . ILE A 1 101 ? 11.066  -0.266  -9.865  1.00 0.00 ? 256 ILE A CD1  1  
ATOM   1534  H  H    . ILE A 1 101 ? 13.320  0.192   -12.987 1.00 0.00 ? 256 ILE A H    1  
ATOM   1535  H  HA   . ILE A 1 101 ? 15.073  -0.417  -10.830 1.00 0.00 ? 256 ILE A HA   1  
ATOM   1536  H  HB   . ILE A 1 101 ? 12.441  -1.652  -11.708 1.00 0.00 ? 256 ILE A HB   1  
ATOM   1537  H  HG12 . ILE A 1 101 ? 13.099  0.321   -9.500  1.00 0.00 ? 256 ILE A HG12 1  
ATOM   1538  H  HG13 . ILE A 1 101 ? 12.486  0.781   -11.087 1.00 0.00 ? 256 ILE A HG13 1  
ATOM   1539  H  HG21 . ILE A 1 101 ? 14.226  -2.283  -9.420  1.00 0.00 ? 256 ILE A HG21 1  
ATOM   1540  H  HG22 . ILE A 1 101 ? 13.062  -3.311  -10.250 1.00 0.00 ? 256 ILE A HG22 1  
ATOM   1541  H  HG23 . ILE A 1 101 ? 12.507  -2.139  -9.059  1.00 0.00 ? 256 ILE A HG23 1  
ATOM   1542  H  HD11 . ILE A 1 101 ? 11.070  -0.472  -8.806  1.00 0.00 ? 256 ILE A HD11 1  
ATOM   1543  H  HD12 . ILE A 1 101 ? 10.664  -1.115  -10.397 1.00 0.00 ? 256 ILE A HD12 1  
ATOM   1544  H  HD13 . ILE A 1 101 ? 10.454  0.603   -10.060 1.00 0.00 ? 256 ILE A HD13 1  
ATOM   1545  N  N    . MET A 1 102 ? 14.971  -2.761  -13.152 1.00 0.00 ? 257 MET A N    1  
ATOM   1546  C  CA   . MET A 1 102 ? 15.685  -4.014  -13.573 1.00 0.00 ? 257 MET A CA   1  
ATOM   1547  C  C    . MET A 1 102 ? 16.923  -3.693  -14.442 1.00 0.00 ? 257 MET A C    1  
ATOM   1548  O  O    . MET A 1 102 ? 17.386  -4.539  -15.185 1.00 0.00 ? 257 MET A O    1  
ATOM   1549  C  CB   . MET A 1 102 ? 14.661  -4.831  -14.370 1.00 0.00 ? 257 MET A CB   1  
ATOM   1550  C  CG   . MET A 1 102 ? 13.840  -5.694  -13.408 1.00 0.00 ? 257 MET A CG   1  
ATOM   1551  S  SD   . MET A 1 102 ? 14.875  -7.040  -12.775 1.00 0.00 ? 257 MET A SD   1  
ATOM   1552  C  CE   . MET A 1 102 ? 14.003  -7.289  -11.208 1.00 0.00 ? 257 MET A CE   1  
ATOM   1553  H  H    . MET A 1 102 ? 14.335  -2.321  -13.768 1.00 0.00 ? 257 MET A H    1  
ATOM   1554  H  HA   . MET A 1 102 ? 15.987  -4.571  -12.700 1.00 0.00 ? 257 MET A HA   1  
ATOM   1555  H  HB2  . MET A 1 102 ? 14.003  -4.160  -14.904 1.00 0.00 ? 257 MET A HB2  1  
ATOM   1556  H  HB3  . MET A 1 102 ? 15.176  -5.468  -15.073 1.00 0.00 ? 257 MET A HB3  1  
ATOM   1557  H  HG2  . MET A 1 102 ? 13.492  -5.088  -12.584 1.00 0.00 ? 257 MET A HG2  1  
ATOM   1558  H  HG3  . MET A 1 102 ? 12.991  -6.109  -13.932 1.00 0.00 ? 257 MET A HG3  1  
ATOM   1559  H  HE1  . MET A 1 102 ? 14.174  -6.439  -10.564 1.00 0.00 ? 257 MET A HE1  1  
ATOM   1560  H  HE2  . MET A 1 102 ? 14.372  -8.183  -10.727 1.00 0.00 ? 257 MET A HE2  1  
ATOM   1561  H  HE3  . MET A 1 102 ? 12.945  -7.396  -11.399 1.00 0.00 ? 257 MET A HE3  1  
ATOM   1562  N  N    . ASP A 1 103 ? 17.475  -2.491  -14.359 1.00 0.00 ? 258 ASP A N    1  
ATOM   1563  C  CA   . ASP A 1 103 ? 18.686  -2.160  -15.183 1.00 0.00 ? 258 ASP A CA   1  
ATOM   1564  C  C    . ASP A 1 103 ? 19.289  -0.812  -14.739 1.00 0.00 ? 258 ASP A C    1  
ATOM   1565  O  O    . ASP A 1 103 ? 19.214  0.169   -15.456 1.00 0.00 ? 258 ASP A O    1  
ATOM   1566  C  CB   . ASP A 1 103 ? 18.174  -2.072  -16.623 1.00 0.00 ? 258 ASP A CB   1  
ATOM   1567  C  CG   . ASP A 1 103 ? 19.347  -1.807  -17.568 1.00 0.00 ? 258 ASP A CG   1  
ATOM   1568  O  OD1  . ASP A 1 103 ? 20.353  -2.486  -17.438 1.00 0.00 ? 258 ASP A OD1  1  
ATOM   1569  O  OD2  . ASP A 1 103 ? 19.220  -0.929  -18.406 1.00 0.00 ? 258 ASP A OD2  1  
ATOM   1570  H  H    . ASP A 1 103 ? 17.103  -1.812  -13.755 1.00 0.00 ? 258 ASP A H    1  
ATOM   1571  H  HA   . ASP A 1 103 ? 19.422  -2.945  -15.101 1.00 0.00 ? 258 ASP A HA   1  
ATOM   1572  H  HB2  . ASP A 1 103 ? 17.698  -3.004  -16.893 1.00 0.00 ? 258 ASP A HB2  1  
ATOM   1573  H  HB3  . ASP A 1 103 ? 17.460  -1.266  -16.703 1.00 0.00 ? 258 ASP A HB3  1  
ATOM   1574  N  N    . GLU A 1 104 ? 19.874  -0.751  -13.557 1.00 0.00 ? 259 GLU A N    1  
ATOM   1575  C  CA   . GLU A 1 104 ? 20.458  0.540   -13.082 1.00 0.00 ? 259 GLU A CA   1  
ATOM   1576  C  C    . GLU A 1 104 ? 21.885  0.335   -12.548 1.00 0.00 ? 259 GLU A C    1  
ATOM   1577  O  O    . GLU A 1 104 ? 22.839  0.820   -13.131 1.00 0.00 ? 259 GLU A O    1  
ATOM   1578  C  CB   . GLU A 1 104 ? 19.519  1.013   -11.960 1.00 0.00 ? 259 GLU A CB   1  
ATOM   1579  C  CG   . GLU A 1 104 ? 19.005  2.422   -12.272 1.00 0.00 ? 259 GLU A CG   1  
ATOM   1580  C  CD   . GLU A 1 104 ? 20.018  3.456   -11.779 1.00 0.00 ? 259 GLU A CD   1  
ATOM   1581  O  OE1  . GLU A 1 104 ? 20.387  3.387   -10.618 1.00 0.00 ? 259 GLU A OE1  1  
ATOM   1582  O  OE2  . GLU A 1 104 ? 20.408  4.299   -12.569 1.00 0.00 ? 259 GLU A OE2  1  
ATOM   1583  H  H    . GLU A 1 104 ? 19.921  -1.547  -12.981 1.00 0.00 ? 259 GLU A H    1  
ATOM   1584  H  HA   . GLU A 1 104 ? 20.465  1.258   -13.883 1.00 0.00 ? 259 GLU A HA   1  
ATOM   1585  H  HB2  . GLU A 1 104 ? 18.679  0.335   -11.881 1.00 0.00 ? 259 GLU A HB2  1  
ATOM   1586  H  HB3  . GLU A 1 104 ? 20.054  1.030   -11.022 1.00 0.00 ? 259 GLU A HB3  1  
ATOM   1587  H  HG2  . GLU A 1 104 ? 18.872  2.528   -13.340 1.00 0.00 ? 259 GLU A HG2  1  
ATOM   1588  H  HG3  . GLU A 1 104 ? 18.061  2.579   -11.774 1.00 0.00 ? 259 GLU A HG3  1  
ATOM   1589  N  N    . ASN A 1 105 ? 22.048  -0.368  -11.445 1.00 0.00 ? 260 ASN A N    1  
ATOM   1590  C  CA   . ASN A 1 105 ? 23.421  -0.580  -10.891 1.00 0.00 ? 260 ASN A CA   1  
ATOM   1591  C  C    . ASN A 1 105 ? 23.525  -1.960  -10.227 1.00 0.00 ? 260 ASN A C    1  
ATOM   1592  O  O    . ASN A 1 105 ? 24.122  -2.103  -9.178  1.00 0.00 ? 260 ASN A O    1  
ATOM   1593  C  CB   . ASN A 1 105 ? 23.603  0.530   -9.853  1.00 0.00 ? 260 ASN A CB   1  
ATOM   1594  C  CG   . ASN A 1 105 ? 24.341  1.714   -10.491 1.00 0.00 ? 260 ASN A CG   1  
ATOM   1595  O  OD1  . ASN A 1 105 ? 23.728  2.701   -10.845 1.00 0.00 ? 260 ASN A OD1  1  
ATOM   1596  N  ND2  . ASN A 1 105 ? 25.640  1.662   -10.656 1.00 0.00 ? 260 ASN A ND2  1  
ATOM   1597  H  H    . ASN A 1 105 ? 21.272  -0.752  -10.980 1.00 0.00 ? 260 ASN A H    1  
ATOM   1598  H  HA   . ASN A 1 105 ? 24.161  -0.479  -11.670 1.00 0.00 ? 260 ASN A HA   1  
ATOM   1599  H  HB2  . ASN A 1 105 ? 22.635  0.855   -9.502  1.00 0.00 ? 260 ASN A HB2  1  
ATOM   1600  H  HB3  . ASN A 1 105 ? 24.181  0.154   -9.022  1.00 0.00 ? 260 ASN A HB3  1  
ATOM   1601  H  HD21 . ASN A 1 105 ? 26.147  0.869   -10.375 1.00 0.00 ? 260 ASN A HD21 1  
ATOM   1602  H  HD22 . ASN A 1 105 ? 26.110  2.419   -11.064 1.00 0.00 ? 260 ASN A HD22 1  
ATOM   1603  N  N    . ASN A 1 106 ? 22.946  -2.981  -10.826 1.00 0.00 ? 261 ASN A N    1  
ATOM   1604  C  CA   . ASN A 1 106 ? 23.011  -4.357  -10.224 1.00 0.00 ? 261 ASN A CA   1  
ATOM   1605  C  C    . ASN A 1 106 ? 22.545  -4.355  -8.751  1.00 0.00 ? 261 ASN A C    1  
ATOM   1606  O  O    . ASN A 1 106 ? 22.980  -5.176  -7.966  1.00 0.00 ? 261 ASN A O    1  
ATOM   1607  C  CB   . ASN A 1 106 ? 24.483  -4.769  -10.318 1.00 0.00 ? 261 ASN A CB   1  
ATOM   1608  C  CG   . ASN A 1 106 ? 24.578  -6.277  -10.580 1.00 0.00 ? 261 ASN A CG   1  
ATOM   1609  O  OD1  . ASN A 1 106 ? 24.365  -6.722  -11.690 1.00 0.00 ? 261 ASN A OD1  1  
ATOM   1610  N  ND2  . ASN A 1 106 ? 24.888  -7.093  -9.601  1.00 0.00 ? 261 ASN A ND2  1  
ATOM   1611  H  H    . ASN A 1 106 ? 22.464  -2.849  -11.676 1.00 0.00 ? 261 ASN A H    1  
ATOM   1612  H  HA   . ASN A 1 106 ? 22.409  -5.040  -10.801 1.00 0.00 ? 261 ASN A HA   1  
ATOM   1613  H  HB2  . ASN A 1 106 ? 24.957  -4.231  -11.126 1.00 0.00 ? 261 ASN A HB2  1  
ATOM   1614  H  HB3  . ASN A 1 106 ? 24.982  -4.535  -9.389  1.00 0.00 ? 261 ASN A HB3  1  
ATOM   1615  H  HD21 . ASN A 1 106 ? 25.063  -6.745  -8.699  1.00 0.00 ? 261 ASN A HD21 1  
ATOM   1616  H  HD22 . ASN A 1 106 ? 24.948  -8.056  -9.771  1.00 0.00 ? 261 ASN A HD22 1  
ATOM   1617  N  N    . GLN A 1 107 ? 21.654  -3.458  -8.370  1.00 0.00 ? 262 GLN A N    1  
ATOM   1618  C  CA   . GLN A 1 107 ? 21.163  -3.438  -6.948  1.00 0.00 ? 262 GLN A CA   1  
ATOM   1619  C  C    . GLN A 1 107 ? 19.972  -2.466  -6.810  1.00 0.00 ? 262 GLN A C    1  
ATOM   1620  O  O    . GLN A 1 107 ? 20.120  -1.267  -6.962  1.00 0.00 ? 262 GLN A O    1  
ATOM   1621  C  CB   . GLN A 1 107 ? 22.364  -2.993  -6.094  1.00 0.00 ? 262 GLN A CB   1  
ATOM   1622  C  CG   . GLN A 1 107 ? 22.763  -1.553  -6.429  1.00 0.00 ? 262 GLN A CG   1  
ATOM   1623  C  CD   . GLN A 1 107 ? 24.262  -1.361  -6.167  1.00 0.00 ? 262 GLN A CD   1  
ATOM   1624  O  OE1  . GLN A 1 107 ? 24.645  -0.516  -5.384  1.00 0.00 ? 262 GLN A OE1  1  
ATOM   1625  N  NE2  . GLN A 1 107 ? 25.138  -2.111  -6.792  1.00 0.00 ? 262 GLN A NE2  1  
ATOM   1626  H  H    . GLN A 1 107 ? 21.298  -2.807  -9.015  1.00 0.00 ? 262 GLN A H    1  
ATOM   1627  H  HA   . GLN A 1 107 ? 20.859  -4.431  -6.655  1.00 0.00 ? 262 GLN A HA   1  
ATOM   1628  H  HB2  . GLN A 1 107 ? 22.098  -3.055  -5.049  1.00 0.00 ? 262 GLN A HB2  1  
ATOM   1629  H  HB3  . GLN A 1 107 ? 23.199  -3.649  -6.288  1.00 0.00 ? 262 GLN A HB3  1  
ATOM   1630  H  HG2  . GLN A 1 107 ? 22.547  -1.353  -7.468  1.00 0.00 ? 262 GLN A HG2  1  
ATOM   1631  H  HG3  . GLN A 1 107 ? 22.201  -0.875  -5.805  1.00 0.00 ? 262 GLN A HG3  1  
ATOM   1632  H  HE21 . GLN A 1 107 ? 24.840  -2.798  -7.428  1.00 0.00 ? 262 GLN A HE21 1  
ATOM   1633  H  HE22 . GLN A 1 107 ? 26.095  -1.987  -6.623  1.00 0.00 ? 262 GLN A HE22 1  
ATOM   1634  N  N    . TRP A 1 108 ? 18.785  -2.975  -6.558  1.00 0.00 ? 263 TRP A N    1  
ATOM   1635  C  CA   . TRP A 1 108 ? 17.596  -2.080  -6.450  1.00 0.00 ? 263 TRP A CA   1  
ATOM   1636  C  C    . TRP A 1 108 ? 17.075  -1.999  -5.003  1.00 0.00 ? 263 TRP A C    1  
ATOM   1637  O  O    . TRP A 1 108 ? 16.910  -3.005  -4.340  1.00 0.00 ? 263 TRP A O    1  
ATOM   1638  C  CB   . TRP A 1 108 ? 16.550  -2.738  -7.370  1.00 0.00 ? 263 TRP A CB   1  
ATOM   1639  C  CG   . TRP A 1 108 ? 15.200  -2.099  -7.192  1.00 0.00 ? 263 TRP A CG   1  
ATOM   1640  C  CD1  . TRP A 1 108 ? 14.888  -0.822  -7.506  1.00 0.00 ? 263 TRP A CD1  1  
ATOM   1641  C  CD2  . TRP A 1 108 ? 13.983  -2.698  -6.663  1.00 0.00 ? 263 TRP A CD2  1  
ATOM   1642  N  NE1  . TRP A 1 108 ? 13.559  -0.596  -7.194  1.00 0.00 ? 263 TRP A NE1  1  
ATOM   1643  C  CE2  . TRP A 1 108 ? 12.957  -1.724  -6.671  1.00 0.00 ? 263 TRP A CE2  1  
ATOM   1644  C  CE3  . TRP A 1 108 ? 13.676  -3.980  -6.179  1.00 0.00 ? 263 TRP A CE3  1  
ATOM   1645  C  CZ2  . TRP A 1 108 ? 11.669  -2.012  -6.214  1.00 0.00 ? 263 TRP A CZ2  1  
ATOM   1646  C  CZ3  . TRP A 1 108 ? 12.382  -4.276  -5.719  1.00 0.00 ? 263 TRP A CZ3  1  
ATOM   1647  C  CH2  . TRP A 1 108 ? 11.381  -3.294  -5.735  1.00 0.00 ? 263 TRP A CH2  1  
ATOM   1648  H  H    . TRP A 1 108 ? 18.672  -3.947  -6.466  1.00 0.00 ? 263 TRP A H    1  
ATOM   1649  H  HA   . TRP A 1 108 ? 17.833  -1.096  -6.819  1.00 0.00 ? 263 TRP A HA   1  
ATOM   1650  H  HB2  . TRP A 1 108 ? 16.866  -2.635  -8.393  1.00 0.00 ? 263 TRP A HB2  1  
ATOM   1651  H  HB3  . TRP A 1 108 ? 16.479  -3.789  -7.127  1.00 0.00 ? 263 TRP A HB3  1  
ATOM   1652  H  HD1  . TRP A 1 108 ? 15.566  -0.099  -7.930  1.00 0.00 ? 263 TRP A HD1  1  
ATOM   1653  H  HE1  . TRP A 1 108 ? 13.084  0.253   -7.321  1.00 0.00 ? 263 TRP A HE1  1  
ATOM   1654  H  HE3  . TRP A 1 108 ? 14.440  -4.743  -6.167  1.00 0.00 ? 263 TRP A HE3  1  
ATOM   1655  H  HZ2  . TRP A 1 108 ? 10.901  -1.252  -6.227  1.00 0.00 ? 263 TRP A HZ2  1  
ATOM   1656  H  HZ3  . TRP A 1 108 ? 12.157  -5.266  -5.350  1.00 0.00 ? 263 TRP A HZ3  1  
ATOM   1657  H  HH2  . TRP A 1 108 ? 10.388  -3.527  -5.382  1.00 0.00 ? 263 TRP A HH2  1  
ATOM   1658  N  N    . TYR A 1 109 ? 16.748  -0.808  -4.542  1.00 0.00 ? 264 TYR A N    1  
ATOM   1659  C  CA   . TYR A 1 109 ? 16.159  -0.677  -3.174  1.00 0.00 ? 264 TYR A CA   1  
ATOM   1660  C  C    . TYR A 1 109 ? 14.645  -0.770  -3.346  1.00 0.00 ? 264 TYR A C    1  
ATOM   1661  O  O    . TYR A 1 109 ? 14.147  -0.549  -4.436  1.00 0.00 ? 264 TYR A O    1  
ATOM   1662  C  CB   . TYR A 1 109 ? 16.578  0.696   -2.633  1.00 0.00 ? 264 TYR A CB   1  
ATOM   1663  C  CG   . TYR A 1 109 ? 17.805  0.527   -1.774  1.00 0.00 ? 264 TYR A CG   1  
ATOM   1664  C  CD1  . TYR A 1 109 ? 17.672  0.203   -0.419  1.00 0.00 ? 264 TYR A CD1  1  
ATOM   1665  C  CD2  . TYR A 1 109 ? 19.076  0.681   -2.336  1.00 0.00 ? 264 TYR A CD2  1  
ATOM   1666  C  CE1  . TYR A 1 109 ? 18.811  0.037   0.376   1.00 0.00 ? 264 TYR A CE1  1  
ATOM   1667  C  CE2  . TYR A 1 109 ? 20.216  0.513   -1.544  1.00 0.00 ? 264 TYR A CE2  1  
ATOM   1668  C  CZ   . TYR A 1 109 ? 20.085  0.193   -0.186  1.00 0.00 ? 264 TYR A CZ   1  
ATOM   1669  O  OH   . TYR A 1 109 ? 21.210  0.028   0.596   1.00 0.00 ? 264 TYR A OH   1  
ATOM   1670  H  H    . TYR A 1 109 ? 16.837  -0.012  -5.119  1.00 0.00 ? 264 TYR A H    1  
ATOM   1671  H  HA   . TYR A 1 109 ? 16.517  -1.464  -2.526  1.00 0.00 ? 264 TYR A HA   1  
ATOM   1672  H  HB2  . TYR A 1 109 ? 16.799  1.359   -3.457  1.00 0.00 ? 264 TYR A HB2  1  
ATOM   1673  H  HB3  . TYR A 1 109 ? 15.777  1.111   -2.040  1.00 0.00 ? 264 TYR A HB3  1  
ATOM   1674  H  HD1  . TYR A 1 109 ? 16.689  0.081   0.013   1.00 0.00 ? 264 TYR A HD1  1  
ATOM   1675  H  HD2  . TYR A 1 109 ? 19.178  0.930   -3.382  1.00 0.00 ? 264 TYR A HD2  1  
ATOM   1676  H  HE1  . TYR A 1 109 ? 18.708  -0.211  1.422   1.00 0.00 ? 264 TYR A HE1  1  
ATOM   1677  H  HE2  . TYR A 1 109 ? 21.196  0.627   -1.981  1.00 0.00 ? 264 TYR A HE2  1  
ATOM   1678  H  HH   . TYR A 1 109 ? 21.623  0.887   0.705   1.00 0.00 ? 264 TYR A HH   1  
ATOM   1679  N  N    . CYS A 1 110 ? 13.901  -1.119  -2.324  1.00 0.00 ? 265 CYS A N    1  
ATOM   1680  C  CA   . CYS A 1 110 ? 12.431  -1.242  -2.521  1.00 0.00 ? 265 CYS A CA   1  
ATOM   1681  C  C    . CYS A 1 110 ? 11.649  -0.721  -1.289  1.00 0.00 ? 265 CYS A C    1  
ATOM   1682  O  O    . CYS A 1 110 ? 12.079  0.218   -0.643  1.00 0.00 ? 265 CYS A O    1  
ATOM   1683  C  CB   . CYS A 1 110 ? 12.224  -2.744  -2.814  1.00 0.00 ? 265 CYS A CB   1  
ATOM   1684  S  SG   . CYS A 1 110 ? 12.414  -3.739  -1.312  1.00 0.00 ? 265 CYS A SG   1  
ATOM   1685  H  H    . CYS A 1 110 ? 14.303  -1.319  -1.451  1.00 0.00 ? 265 CYS A H    1  
ATOM   1686  H  HA   . CYS A 1 110 ? 12.141  -0.671  -3.390  1.00 0.00 ? 265 CYS A HA   1  
ATOM   1687  H  HB2  . CYS A 1 110 ? 11.232  -2.893  -3.211  1.00 0.00 ? 265 CYS A HB2  1  
ATOM   1688  H  HB3  . CYS A 1 110 ? 12.950  -3.064  -3.547  1.00 0.00 ? 265 CYS A HB3  1  
ATOM   1689  N  N    . TYR A 1 111 ? 10.501  -1.290  -0.971  1.00 0.00 ? 266 TYR A N    1  
ATOM   1690  C  CA   . TYR A 1 111 ? 9.706   -0.778  0.202   1.00 0.00 ? 266 TYR A CA   1  
ATOM   1691  C  C    . TYR A 1 111 ? 10.092  -1.526  1.495   1.00 0.00 ? 266 TYR A C    1  
ATOM   1692  O  O    . TYR A 1 111 ? 10.125  -0.939  2.559   1.00 0.00 ? 266 TYR A O    1  
ATOM   1693  C  CB   . TYR A 1 111 ? 8.220   -1.016  -0.152  1.00 0.00 ? 266 TYR A CB   1  
ATOM   1694  C  CG   . TYR A 1 111 ? 7.916   -0.442  -1.525  1.00 0.00 ? 266 TYR A CG   1  
ATOM   1695  C  CD1  . TYR A 1 111 ? 7.654   0.924   -1.672  1.00 0.00 ? 266 TYR A CD1  1  
ATOM   1696  C  CD2  . TYR A 1 111 ? 7.914   -1.278  -2.651  1.00 0.00 ? 266 TYR A CD2  1  
ATOM   1697  C  CE1  . TYR A 1 111 ? 7.386   1.454   -2.941  1.00 0.00 ? 266 TYR A CE1  1  
ATOM   1698  C  CE2  . TYR A 1 111 ? 7.649   -0.748  -3.919  1.00 0.00 ? 266 TYR A CE2  1  
ATOM   1699  C  CZ   . TYR A 1 111 ? 7.384   0.619   -4.063  1.00 0.00 ? 266 TYR A CZ   1  
ATOM   1700  O  OH   . TYR A 1 111 ? 7.123   1.142   -5.313  1.00 0.00 ? 266 TYR A OH   1  
ATOM   1701  H  H    . TYR A 1 111 ? 10.150  -2.035  -1.506  1.00 0.00 ? 266 TYR A H    1  
ATOM   1702  H  HA   . TYR A 1 111 ? 9.881   0.279   0.327   1.00 0.00 ? 266 TYR A HA   1  
ATOM   1703  H  HB2  . TYR A 1 111 ? 8.018   -2.077  -0.154  1.00 0.00 ? 266 TYR A HB2  1  
ATOM   1704  H  HB3  . TYR A 1 111 ? 7.594   -0.534  0.585   1.00 0.00 ? 266 TYR A HB3  1  
ATOM   1705  H  HD1  . TYR A 1 111 ? 7.656   1.568   -0.809  1.00 0.00 ? 266 TYR A HD1  1  
ATOM   1706  H  HD2  . TYR A 1 111 ? 8.115   -2.333  -2.539  1.00 0.00 ? 266 TYR A HD2  1  
ATOM   1707  H  HE1  . TYR A 1 111 ? 7.182   2.510   -3.052  1.00 0.00 ? 266 TYR A HE1  1  
ATOM   1708  H  HE2  . TYR A 1 111 ? 7.650   -1.393  -4.786  1.00 0.00 ? 266 TYR A HE2  1  
ATOM   1709  H  HH   . TYR A 1 111 ? 7.947   1.165   -5.804  1.00 0.00 ? 266 TYR A HH   1  
ATOM   1710  N  N    . ILE A 1 112 ? 10.395  -2.808  1.417   1.00 0.00 ? 267 ILE A N    1  
ATOM   1711  C  CA   . ILE A 1 112 ? 10.789  -3.561  2.666   1.00 0.00 ? 267 ILE A CA   1  
ATOM   1712  C  C    . ILE A 1 112 ? 12.158  -3.062  3.163   1.00 0.00 ? 267 ILE A C    1  
ATOM   1713  O  O    . ILE A 1 112 ? 12.368  -2.878  4.347   1.00 0.00 ? 267 ILE A O    1  
ATOM   1714  C  CB   . ILE A 1 112 ? 10.892  -5.059  2.300   1.00 0.00 ? 267 ILE A CB   1  
ATOM   1715  C  CG1  . ILE A 1 112 ? 9.586   -5.573  1.658   1.00 0.00 ? 267 ILE A CG1  1  
ATOM   1716  C  CG2  . ILE A 1 112 ? 11.164  -5.861  3.573   1.00 0.00 ? 267 ILE A CG2  1  
ATOM   1717  C  CD1  . ILE A 1 112 ? 8.392   -5.341  2.591   1.00 0.00 ? 267 ILE A CD1  1  
ATOM   1718  H  H    . ILE A 1 112 ? 10.371  -3.262  0.551   1.00 0.00 ? 267 ILE A H    1  
ATOM   1719  H  HA   . ILE A 1 112 ? 10.049  -3.417  3.433   1.00 0.00 ? 267 ILE A HA   1  
ATOM   1720  H  HB   . ILE A 1 112 ? 11.719  -5.201  1.609   1.00 0.00 ? 267 ILE A HB   1  
ATOM   1721  H  HG12 . ILE A 1 112 ? 9.410   -5.065  0.725   1.00 0.00 ? 267 ILE A HG12 1  
ATOM   1722  H  HG13 . ILE A 1 112 ? 9.682   -6.632  1.469   1.00 0.00 ? 267 ILE A HG13 1  
ATOM   1723  H  HG21 . ILE A 1 112 ? 10.355  -5.708  4.273   1.00 0.00 ? 267 ILE A HG21 1  
ATOM   1724  H  HG22 . ILE A 1 112 ? 12.091  -5.530  4.017   1.00 0.00 ? 267 ILE A HG22 1  
ATOM   1725  H  HG23 . ILE A 1 112 ? 11.236  -6.911  3.329   1.00 0.00 ? 267 ILE A HG23 1  
ATOM   1726  H  HD11 . ILE A 1 112 ? 7.655   -4.737  2.083   1.00 0.00 ? 267 ILE A HD11 1  
ATOM   1727  H  HD12 . ILE A 1 112 ? 8.719   -4.837  3.487   1.00 0.00 ? 267 ILE A HD12 1  
ATOM   1728  H  HD13 . ILE A 1 112 ? 7.954   -6.292  2.856   1.00 0.00 ? 267 ILE A HD13 1  
ATOM   1729  N  N    . CYS A 1 113 ? 13.094  -2.843  2.262   1.00 0.00 ? 268 CYS A N    1  
ATOM   1730  C  CA   . CYS A 1 113 ? 14.462  -2.357  2.672   1.00 0.00 ? 268 CYS A CA   1  
ATOM   1731  C  C    . CYS A 1 113 ? 14.340  -1.091  3.534   1.00 0.00 ? 268 CYS A C    1  
ATOM   1732  O  O    . CYS A 1 113 ? 14.920  -1.003  4.599   1.00 0.00 ? 268 CYS A O    1  
ATOM   1733  C  CB   . CYS A 1 113 ? 15.201  -2.019  1.366   1.00 0.00 ? 268 CYS A CB   1  
ATOM   1734  S  SG   . CYS A 1 113 ? 15.830  -3.536  0.604   1.00 0.00 ? 268 CYS A SG   1  
ATOM   1735  H  H    . CYS A 1 113 ? 12.897  -3.001  1.320   1.00 0.00 ? 268 CYS A H    1  
ATOM   1736  H  HA   . CYS A 1 113 ? 14.992  -3.128  3.206   1.00 0.00 ? 268 CYS A HA   1  
ATOM   1737  H  HB2  . CYS A 1 113 ? 14.519  -1.532  0.686   1.00 0.00 ? 268 CYS A HB2  1  
ATOM   1738  H  HB3  . CYS A 1 113 ? 16.023  -1.357  1.582   1.00 0.00 ? 268 CYS A HB3  1  
ATOM   1739  N  N    . HIS A 1 114 ? 13.581  -0.113  3.081   1.00 0.00 ? 269 HIS A N    1  
ATOM   1740  C  CA   . HIS A 1 114 ? 13.414  1.148   3.879   1.00 0.00 ? 269 HIS A CA   1  
ATOM   1741  C  C    . HIS A 1 114 ? 12.406  2.096   3.207   1.00 0.00 ? 269 HIS A C    1  
ATOM   1742  O  O    . HIS A 1 114 ? 12.169  1.992   2.020   1.00 0.00 ? 269 HIS A O    1  
ATOM   1743  C  CB   . HIS A 1 114 ? 14.805  1.801   3.956   1.00 0.00 ? 269 HIS A CB   1  
ATOM   1744  C  CG   . HIS A 1 114 ? 15.392  2.034   2.581   1.00 0.00 ? 269 HIS A CG   1  
ATOM   1745  N  ND1  . HIS A 1 114 ? 16.615  2.668   2.420   1.00 0.00 ? 269 HIS A ND1  1  
ATOM   1746  C  CD2  . HIS A 1 114 ? 14.959  1.738   1.304   1.00 0.00 ? 269 HIS A CD2  1  
ATOM   1747  C  CE1  . HIS A 1 114 ? 16.874  2.733   1.103   1.00 0.00 ? 269 HIS A CE1  1  
ATOM   1748  N  NE2  . HIS A 1 114 ? 15.899  2.183   0.379   1.00 0.00 ? 269 HIS A NE2  1  
ATOM   1749  H  H    . HIS A 1 114 ? 13.111  -0.214  2.223   1.00 0.00 ? 269 HIS A H    1  
ATOM   1750  H  HA   . HIS A 1 114 ? 13.076  0.906   4.876   1.00 0.00 ? 269 HIS A HA   1  
ATOM   1751  H  HB2  . HIS A 1 114 ? 14.720  2.750   4.464   1.00 0.00 ? 269 HIS A HB2  1  
ATOM   1752  H  HB3  . HIS A 1 114 ? 15.466  1.160   4.519   1.00 0.00 ? 269 HIS A HB3  1  
ATOM   1753  H  HD1  . HIS A 1 114 ? 17.188  3.008   3.138   1.00 0.00 ? 269 HIS A HD1  1  
ATOM   1754  H  HD2  . HIS A 1 114 ? 14.044  1.233   1.051   1.00 0.00 ? 269 HIS A HD2  1  
ATOM   1755  H  HE1  . HIS A 1 114 ? 17.766  3.172   0.682   1.00 0.00 ? 269 HIS A HE1  1  
ATOM   1756  N  N    . PRO A 1 115 ? 11.834  2.991   3.985   1.00 0.00 ? 270 PRO A N    1  
ATOM   1757  C  CA   . PRO A 1 115 ? 10.842  3.943   3.427   1.00 0.00 ? 270 PRO A CA   1  
ATOM   1758  C  C    . PRO A 1 115 ? 11.537  4.964   2.512   1.00 0.00 ? 270 PRO A C    1  
ATOM   1759  O  O    . PRO A 1 115 ? 11.670  6.122   2.862   1.00 0.00 ? 270 PRO A O    1  
ATOM   1760  C  CB   . PRO A 1 115 ? 10.256  4.622   4.664   1.00 0.00 ? 270 PRO A CB   1  
ATOM   1761  C  CG   . PRO A 1 115 ? 11.312  4.489   5.712   1.00 0.00 ? 270 PRO A CG   1  
ATOM   1762  C  CD   . PRO A 1 115 ? 12.048  3.207   5.427   1.00 0.00 ? 270 PRO A CD   1  
ATOM   1763  H  HA   . PRO A 1 115 ? 10.068  3.416   2.893   1.00 0.00 ? 270 PRO A HA   1  
ATOM   1764  H  HB2  . PRO A 1 115 ? 10.054  5.664   4.459   1.00 0.00 ? 270 PRO A HB2  1  
ATOM   1765  H  HB3  . PRO A 1 115 ? 9.357   4.117   4.980   1.00 0.00 ? 270 PRO A HB3  1  
ATOM   1766  H  HG2  . PRO A 1 115 ? 11.991  5.328   5.659   1.00 0.00 ? 270 PRO A HG2  1  
ATOM   1767  H  HG3  . PRO A 1 115 ? 10.859  4.438   6.690   1.00 0.00 ? 270 PRO A HG3  1  
ATOM   1768  H  HD2  . PRO A 1 115 ? 13.102  3.320   5.646   1.00 0.00 ? 270 PRO A HD2  1  
ATOM   1769  H  HD3  . PRO A 1 115 ? 11.625  2.391   5.992   1.00 0.00 ? 270 PRO A HD3  1  
ATOM   1770  N  N    . GLU A 1 116 ? 11.988  4.546   1.345   1.00 0.00 ? 271 GLU A N    1  
ATOM   1771  C  CA   . GLU A 1 116 ? 12.675  5.509   0.427   1.00 0.00 ? 271 GLU A CA   1  
ATOM   1772  C  C    . GLU A 1 116 ? 11.758  5.923   -0.739  1.00 0.00 ? 271 GLU A C    1  
ATOM   1773  O  O    . GLU A 1 116 ? 11.499  7.100   -0.899  1.00 0.00 ? 271 GLU A O    1  
ATOM   1774  C  CB   . GLU A 1 116 ? 13.938  4.791   -0.077  1.00 0.00 ? 271 GLU A CB   1  
ATOM   1775  C  CG   . GLU A 1 116 ? 15.189  5.462   0.500   1.00 0.00 ? 271 GLU A CG   1  
ATOM   1776  C  CD   . GLU A 1 116 ? 15.288  6.898   -0.020  1.00 0.00 ? 271 GLU A CD   1  
ATOM   1777  O  OE1  . GLU A 1 116 ? 15.823  7.080   -1.102  1.00 0.00 ? 271 GLU A OE1  1  
ATOM   1778  O  OE2  . GLU A 1 116 ? 14.827  7.792   0.672   1.00 0.00 ? 271 GLU A OE2  1  
ATOM   1779  H  H    . GLU A 1 116 ? 11.877  3.611   1.079   1.00 0.00 ? 271 GLU A H    1  
ATOM   1780  H  HA   . GLU A 1 116 ? 12.962  6.389   0.984   1.00 0.00 ? 271 GLU A HA   1  
ATOM   1781  H  HB2  . GLU A 1 116 ? 13.910  3.755   0.232   1.00 0.00 ? 271 GLU A HB2  1  
ATOM   1782  H  HB3  . GLU A 1 116 ? 13.972  4.841   -1.155  1.00 0.00 ? 271 GLU A HB3  1  
ATOM   1783  H  HG2  . GLU A 1 116 ? 15.126  5.473   1.579   1.00 0.00 ? 271 GLU A HG2  1  
ATOM   1784  H  HG3  . GLU A 1 116 ? 16.066  4.911   0.196   1.00 0.00 ? 271 GLU A HG3  1  
ATOM   1785  N  N    . PRO A 1 117 ? 11.284  4.973   -1.534  1.00 0.00 ? 272 PRO A N    1  
ATOM   1786  C  CA   . PRO A 1 117 ? 10.403  5.332   -2.667  1.00 0.00 ? 272 PRO A CA   1  
ATOM   1787  C  C    . PRO A 1 117 ? 8.902   5.347   -2.289  1.00 0.00 ? 272 PRO A C    1  
ATOM   1788  O  O    . PRO A 1 117 ? 8.061   5.269   -3.166  1.00 0.00 ? 272 PRO A O    1  
ATOM   1789  C  CB   . PRO A 1 117 ? 10.668  4.222   -3.675  1.00 0.00 ? 272 PRO A CB   1  
ATOM   1790  C  CG   . PRO A 1 117 ? 11.129  3.040   -2.871  1.00 0.00 ? 272 PRO A CG   1  
ATOM   1791  C  CD   . PRO A 1 117 ? 11.510  3.522   -1.490  1.00 0.00 ? 272 PRO A CD   1  
ATOM   1792  H  HA   . PRO A 1 117 ? 10.699  6.278   -3.081  1.00 0.00 ? 272 PRO A HA   1  
ATOM   1793  H  HB2  . PRO A 1 117 ? 9.760   3.982   -4.211  1.00 0.00 ? 272 PRO A HB2  1  
ATOM   1794  H  HB3  . PRO A 1 117 ? 11.442  4.521   -4.365  1.00 0.00 ? 272 PRO A HB3  1  
ATOM   1795  H  HG2  . PRO A 1 117 ? 10.328  2.317   -2.799  1.00 0.00 ? 272 PRO A HG2  1  
ATOM   1796  H  HG3  . PRO A 1 117 ? 11.986  2.589   -3.346  1.00 0.00 ? 272 PRO A HG3  1  
ATOM   1797  H  HD2  . PRO A 1 117 ? 10.878  3.058   -0.745  1.00 0.00 ? 272 PRO A HD2  1  
ATOM   1798  H  HD3  . PRO A 1 117 ? 12.542  3.303   -1.298  1.00 0.00 ? 272 PRO A HD3  1  
ATOM   1799  N  N    . LEU A 1 118 ? 8.540   5.458   -1.022  1.00 0.00 ? 273 LEU A N    1  
ATOM   1800  C  CA   . LEU A 1 118 ? 7.083   5.486   -0.671  1.00 0.00 ? 273 LEU A CA   1  
ATOM   1801  C  C    . LEU A 1 118 ? 6.817   6.360   0.572   1.00 0.00 ? 273 LEU A C    1  
ATOM   1802  O  O    . LEU A 1 118 ? 5.899   6.092   1.324   1.00 0.00 ? 273 LEU A O    1  
ATOM   1803  C  CB   . LEU A 1 118 ? 6.678   4.013   -0.433  1.00 0.00 ? 273 LEU A CB   1  
ATOM   1804  C  CG   . LEU A 1 118 ? 7.216   3.475   0.908   1.00 0.00 ? 273 LEU A CG   1  
ATOM   1805  C  CD1  . LEU A 1 118 ? 6.459   2.195   1.289   1.00 0.00 ? 273 LEU A CD1  1  
ATOM   1806  C  CD2  . LEU A 1 118 ? 8.710   3.167   0.776   1.00 0.00 ? 273 LEU A CD2  1  
ATOM   1807  H  H    . LEU A 1 118 ? 9.208   5.533   -0.316  1.00 0.00 ? 273 LEU A H    1  
ATOM   1808  H  HA   . LEU A 1 118 ? 6.522   5.875   -1.507  1.00 0.00 ? 273 LEU A HA   1  
ATOM   1809  H  HB2  . LEU A 1 118 ? 5.600   3.942   -0.432  1.00 0.00 ? 273 LEU A HB2  1  
ATOM   1810  H  HB3  . LEU A 1 118 ? 7.069   3.409   -1.239  1.00 0.00 ? 273 LEU A HB3  1  
ATOM   1811  H  HG   . LEU A 1 118 ? 7.068   4.211   1.683   1.00 0.00 ? 273 LEU A HG   1  
ATOM   1812  H  HD11 . LEU A 1 118 ? 5.537   2.138   0.727   1.00 0.00 ? 273 LEU A HD11 1  
ATOM   1813  H  HD12 . LEU A 1 118 ? 6.233   2.213   2.345   1.00 0.00 ? 273 LEU A HD12 1  
ATOM   1814  H  HD13 . LEU A 1 118 ? 7.068   1.332   1.068   1.00 0.00 ? 273 LEU A HD13 1  
ATOM   1815  H  HD21 . LEU A 1 118 ? 9.282   3.996   1.169   1.00 0.00 ? 273 LEU A HD21 1  
ATOM   1816  H  HD22 . LEU A 1 118 ? 8.957   3.021   -0.264  1.00 0.00 ? 273 LEU A HD22 1  
ATOM   1817  H  HD23 . LEU A 1 118 ? 8.947   2.272   1.333   1.00 0.00 ? 273 LEU A HD23 1  
ATOM   1818  N  N    . LEU A 1 119 ? 7.594   7.404   0.793   1.00 0.00 ? 274 LEU A N    1  
ATOM   1819  C  CA   . LEU A 1 119 ? 7.335   8.270   1.997   1.00 0.00 ? 274 LEU A CA   1  
ATOM   1820  C  C    . LEU A 1 119 ? 5.976   8.960   1.835   1.00 0.00 ? 274 LEU A C    1  
ATOM   1821  O  O    . LEU A 1 119 ? 5.196   9.022   2.767   1.00 0.00 ? 274 LEU A O    1  
ATOM   1822  C  CB   . LEU A 1 119 ? 8.470   9.299   2.063   1.00 0.00 ? 274 LEU A CB   1  
ATOM   1823  C  CG   . LEU A 1 119 ? 9.697   8.639   2.692   1.00 0.00 ? 274 LEU A CG   1  
ATOM   1824  C  CD1  . LEU A 1 119 ? 10.918  9.538   2.499   1.00 0.00 ? 274 LEU A CD1  1  
ATOM   1825  C  CD2  . LEU A 1 119 ? 9.446   8.422   4.188   1.00 0.00 ? 274 LEU A CD2  1  
ATOM   1826  H  H    . LEU A 1 119 ? 8.327   7.618   0.171   1.00 0.00 ? 274 LEU A H    1  
ATOM   1827  H  HA   . LEU A 1 119 ? 7.333   7.667   2.887   1.00 0.00 ? 274 LEU A HA   1  
ATOM   1828  H  HB2  . LEU A 1 119 ? 8.710   9.637   1.066   1.00 0.00 ? 274 LEU A HB2  1  
ATOM   1829  H  HB3  . LEU A 1 119 ? 8.164   10.139  2.668   1.00 0.00 ? 274 LEU A HB3  1  
ATOM   1830  H  HG   . LEU A 1 119 ? 9.875   7.686   2.214   1.00 0.00 ? 274 LEU A HG   1  
ATOM   1831  H  HD11 . LEU A 1 119 ? 11.328  9.380   1.511   1.00 0.00 ? 274 LEU A HD11 1  
ATOM   1832  H  HD12 . LEU A 1 119 ? 11.665  9.296   3.241   1.00 0.00 ? 274 LEU A HD12 1  
ATOM   1833  H  HD13 . LEU A 1 119 ? 10.626  10.572  2.606   1.00 0.00 ? 274 LEU A HD13 1  
ATOM   1834  H  HD21 . LEU A 1 119 ? 9.057   7.426   4.347   1.00 0.00 ? 274 LEU A HD21 1  
ATOM   1835  H  HD22 . LEU A 1 119 ? 8.727   9.148   4.542   1.00 0.00 ? 274 LEU A HD22 1  
ATOM   1836  H  HD23 . LEU A 1 119 ? 10.372  8.538   4.730   1.00 0.00 ? 274 LEU A HD23 1  
ATOM   1837  N  N    . ASP A 1 120 ? 5.668   9.452   0.652   1.00 0.00 ? 275 ASP A N    1  
ATOM   1838  C  CA   . ASP A 1 120 ? 4.324   10.103  0.445   1.00 0.00 ? 275 ASP A CA   1  
ATOM   1839  C  C    . ASP A 1 120 ? 3.220   9.060   0.700   1.00 0.00 ? 275 ASP A C    1  
ATOM   1840  O  O    . ASP A 1 120 ? 2.196   9.366   1.282   1.00 0.00 ? 275 ASP A O    1  
ATOM   1841  C  CB   . ASP A 1 120 ? 4.278   10.583  -1.015  1.00 0.00 ? 275 ASP A CB   1  
ATOM   1842  C  CG   . ASP A 1 120 ? 3.318   11.767  -1.133  1.00 0.00 ? 275 ASP A CG   1  
ATOM   1843  O  OD1  . ASP A 1 120 ? 2.138   11.530  -1.333  1.00 0.00 ? 275 ASP A OD1  1  
ATOM   1844  O  OD2  . ASP A 1 120 ? 3.779   12.891  -1.024  1.00 0.00 ? 275 ASP A OD2  1  
ATOM   1845  H  H    . ASP A 1 120 ? 6.306   9.368   -0.095  1.00 0.00 ? 275 ASP A H    1  
ATOM   1846  H  HA   . ASP A 1 120 ? 4.210   10.941  1.115   1.00 0.00 ? 275 ASP A HA   1  
ATOM   1847  H  HB2  . ASP A 1 120 ? 5.267   10.886  -1.324  1.00 0.00 ? 275 ASP A HB2  1  
ATOM   1848  H  HB3  . ASP A 1 120 ? 3.935   9.777   -1.648  1.00 0.00 ? 275 ASP A HB3  1  
ATOM   1849  N  N    . LEU A 1 121 ? 3.427   7.823   0.284   1.00 0.00 ? 276 LEU A N    1  
ATOM   1850  C  CA   . LEU A 1 121 ? 2.384   6.765   0.532   1.00 0.00 ? 276 LEU A CA   1  
ATOM   1851  C  C    . LEU A 1 121 ? 2.221   6.566   2.045   1.00 0.00 ? 276 LEU A C    1  
ATOM   1852  O  O    . LEU A 1 121 ? 1.116   6.493   2.549   1.00 0.00 ? 276 LEU A O    1  
ATOM   1853  C  CB   . LEU A 1 121 ? 2.898   5.472   -0.126  1.00 0.00 ? 276 LEU A CB   1  
ATOM   1854  C  CG   . LEU A 1 121 ? 1.717   4.582   -0.520  1.00 0.00 ? 276 LEU A CG   1  
ATOM   1855  C  CD1  . LEU A 1 121 ? 1.207   4.995   -1.903  1.00 0.00 ? 276 LEU A CD1  1  
ATOM   1856  C  CD2  . LEU A 1 121 ? 2.171   3.116   -0.559  1.00 0.00 ? 276 LEU A CD2  1  
ATOM   1857  H  H    . LEU A 1 121 ? 4.269   7.595   -0.174  1.00 0.00 ? 276 LEU A H    1  
ATOM   1858  H  HA   . LEU A 1 121 ? 1.446   7.058   0.094   1.00 0.00 ? 276 LEU A HA   1  
ATOM   1859  H  HB2  . LEU A 1 121 ? 3.470   5.722   -1.008  1.00 0.00 ? 276 LEU A HB2  1  
ATOM   1860  H  HB3  . LEU A 1 121 ? 3.529   4.941   0.572   1.00 0.00 ? 276 LEU A HB3  1  
ATOM   1861  H  HG   . LEU A 1 121 ? 0.924   4.696   0.204   1.00 0.00 ? 276 LEU A HG   1  
ATOM   1862  H  HD11 . LEU A 1 121 ? 1.714   4.418   -2.662  1.00 0.00 ? 276 LEU A HD11 1  
ATOM   1863  H  HD12 . LEU A 1 121 ? 1.400   6.046   -2.060  1.00 0.00 ? 276 LEU A HD12 1  
ATOM   1864  H  HD13 . LEU A 1 121 ? 0.144   4.812   -1.964  1.00 0.00 ? 276 LEU A HD13 1  
ATOM   1865  H  HD21 . LEU A 1 121 ? 1.389   2.487   -0.162  1.00 0.00 ? 276 LEU A HD21 1  
ATOM   1866  H  HD22 . LEU A 1 121 ? 3.064   2.997   0.037   1.00 0.00 ? 276 LEU A HD22 1  
ATOM   1867  H  HD23 . LEU A 1 121 ? 2.381   2.828   -1.580  1.00 0.00 ? 276 LEU A HD23 1  
ATOM   1868  N  N    . VAL A 1 122 ? 3.314   6.498   2.777   1.00 0.00 ? 277 VAL A N    1  
ATOM   1869  C  CA   . VAL A 1 122 ? 3.203   6.325   4.270   1.00 0.00 ? 277 VAL A CA   1  
ATOM   1870  C  C    . VAL A 1 122 ? 2.543   7.577   4.867   1.00 0.00 ? 277 VAL A C    1  
ATOM   1871  O  O    . VAL A 1 122 ? 1.672   7.484   5.712   1.00 0.00 ? 277 VAL A O    1  
ATOM   1872  C  CB   . VAL A 1 122 ? 4.639   6.168   4.810   1.00 0.00 ? 277 VAL A CB   1  
ATOM   1873  C  CG1  . VAL A 1 122 ? 4.613   6.020   6.337   1.00 0.00 ? 277 VAL A CG1  1  
ATOM   1874  C  CG2  . VAL A 1 122 ? 5.285   4.929   4.183   1.00 0.00 ? 277 VAL A CG2  1  
ATOM   1875  H  H    . VAL A 1 122 ? 4.197   6.576   2.345   1.00 0.00 ? 277 VAL A H    1  
ATOM   1876  H  HA   . VAL A 1 122 ? 2.620   5.452   4.502   1.00 0.00 ? 277 VAL A HA   1  
ATOM   1877  H  HB   . VAL A 1 122 ? 5.214   7.045   4.547   1.00 0.00 ? 277 VAL A HB   1  
ATOM   1878  H  HG11 . VAL A 1 122 ? 4.951   6.940   6.792   1.00 0.00 ? 277 VAL A HG11 1  
ATOM   1879  H  HG12 . VAL A 1 122 ? 5.265   5.212   6.637   1.00 0.00 ? 277 VAL A HG12 1  
ATOM   1880  H  HG13 . VAL A 1 122 ? 3.606   5.809   6.664   1.00 0.00 ? 277 VAL A HG13 1  
ATOM   1881  H  HG21 . VAL A 1 122 ? 6.330   5.124   3.993   1.00 0.00 ? 277 VAL A HG21 1  
ATOM   1882  H  HG22 . VAL A 1 122 ? 4.789   4.693   3.253   1.00 0.00 ? 277 VAL A HG22 1  
ATOM   1883  H  HG23 . VAL A 1 122 ? 5.194   4.093   4.861   1.00 0.00 ? 277 VAL A HG23 1  
ATOM   1884  N  N    . THR A 1 123 ? 2.947   8.749   4.423   1.00 0.00 ? 278 THR A N    1  
ATOM   1885  C  CA   . THR A 1 123 ? 2.330   10.012  4.964   1.00 0.00 ? 278 THR A CA   1  
ATOM   1886  C  C    . THR A 1 123 ? 0.819   10.008  4.693   1.00 0.00 ? 278 THR A C    1  
ATOM   1887  O  O    . THR A 1 123 ? 0.036   10.396  5.540   1.00 0.00 ? 278 THR A O    1  
ATOM   1888  C  CB   . THR A 1 123 ? 3.008   11.170  4.218   1.00 0.00 ? 278 THR A CB   1  
ATOM   1889  O  OG1  . THR A 1 123 ? 3.259   10.769  2.888   1.00 0.00 ? 278 THR A OG1  1  
ATOM   1890  C  CG2  . THR A 1 123 ? 4.322   11.513  4.917   1.00 0.00 ? 278 THR A CG2  1  
ATOM   1891  H  H    . THR A 1 123 ? 3.651   8.793   3.733   1.00 0.00 ? 278 THR A H    1  
ATOM   1892  H  HA   . THR A 1 123 ? 2.518   10.097  6.023   1.00 0.00 ? 278 THR A HA   1  
ATOM   1893  H  HB   . THR A 1 123 ? 2.369   12.032  4.211   1.00 0.00 ? 278 THR A HB   1  
ATOM   1894  H  HG1  . THR A 1 123 ? 2.485   10.992  2.362   1.00 0.00 ? 278 THR A HG1  1  
ATOM   1895  H  HG21 . THR A 1 123 ? 5.126   10.944  4.473   1.00 0.00 ? 278 THR A HG21 1  
ATOM   1896  H  HG22 . THR A 1 123 ? 4.243   11.266  5.966   1.00 0.00 ? 278 THR A HG22 1  
ATOM   1897  H  HG23 . THR A 1 123 ? 4.523   12.569  4.809   1.00 0.00 ? 278 THR A HG23 1  
ATOM   1898  N  N    . ALA A 1 124 ? 0.394   9.552   3.527   1.00 0.00 ? 279 ALA A N    1  
ATOM   1899  C  CA   . ALA A 1 124 ? -1.085  9.512   3.242   1.00 0.00 ? 279 ALA A CA   1  
ATOM   1900  C  C    . ALA A 1 124 ? -1.789  8.616   4.277   1.00 0.00 ? 279 ALA A C    1  
ATOM   1901  O  O    . ALA A 1 124 ? -2.920  8.869   4.650   1.00 0.00 ? 279 ALA A O    1  
ATOM   1902  C  CB   . ALA A 1 124 ? -1.254  8.926   1.832   1.00 0.00 ? 279 ALA A CB   1  
ATOM   1903  H  H    . ALA A 1 124 ? 1.042   9.224   2.857   1.00 0.00 ? 279 ALA A H    1  
ATOM   1904  H  HA   . ALA A 1 124 ? -1.494  10.506  3.279   1.00 0.00 ? 279 ALA A HA   1  
ATOM   1905  H  HB1  . ALA A 1 124 ? -0.974  7.883   1.839   1.00 0.00 ? 279 ALA A HB1  1  
ATOM   1906  H  HB2  . ALA A 1 124 ? -0.622  9.463   1.140   1.00 0.00 ? 279 ALA A HB2  1  
ATOM   1907  H  HB3  . ALA A 1 124 ? -2.285  9.020   1.524   1.00 0.00 ? 279 ALA A HB3  1  
ATOM   1908  N  N    . CYS A 1 125 ? -1.133  7.571   4.750   1.00 0.00 ? 280 CYS A N    1  
ATOM   1909  C  CA   . CYS A 1 125 ? -1.785  6.674   5.769   1.00 0.00 ? 280 CYS A CA   1  
ATOM   1910  C  C    . CYS A 1 125 ? -2.173  7.487   7.012   1.00 0.00 ? 280 CYS A C    1  
ATOM   1911  O  O    . CYS A 1 125 ? -3.249  7.314   7.550   1.00 0.00 ? 280 CYS A O    1  
ATOM   1912  C  CB   . CYS A 1 125 ? -0.745  5.596   6.138   1.00 0.00 ? 280 CYS A CB   1  
ATOM   1913  S  SG   . CYS A 1 125 ? -1.450  4.433   7.337   1.00 0.00 ? 280 CYS A SG   1  
ATOM   1914  H  H    . CYS A 1 125 ? -0.219  7.382   4.439   1.00 0.00 ? 280 CYS A H    1  
ATOM   1915  H  HA   . CYS A 1 125 ? -2.660  6.210   5.343   1.00 0.00 ? 280 CYS A HA   1  
ATOM   1916  H  HB2  . CYS A 1 125 ? -0.455  5.059   5.247   1.00 0.00 ? 280 CYS A HB2  1  
ATOM   1917  H  HB3  . CYS A 1 125 ? 0.124   6.071   6.568   1.00 0.00 ? 280 CYS A HB3  1  
ATOM   1918  H  HG   . CYS A 1 125 ? -0.727  4.047   7.837   1.00 0.00 ? 280 CYS A HG   1  
ATOM   1919  N  N    . ASN A 1 126 ? -1.313  8.373   7.475   1.00 0.00 ? 281 ASN A N    1  
ATOM   1920  C  CA   . ASN A 1 126 ? -1.675  9.181   8.694   1.00 0.00 ? 281 ASN A CA   1  
ATOM   1921  C  C    . ASN A 1 126 ? -2.860  10.104  8.381   1.00 0.00 ? 281 ASN A C    1  
ATOM   1922  O  O    . ASN A 1 126 ? -3.749  10.269  9.196   1.00 0.00 ? 281 ASN A O    1  
ATOM   1923  C  CB   . ASN A 1 126 ? -0.437  10.008  9.070   1.00 0.00 ? 281 ASN A CB   1  
ATOM   1924  C  CG   . ASN A 1 126 ? 0.684   9.070   9.536   1.00 0.00 ? 281 ASN A CG   1  
ATOM   1925  O  OD1  . ASN A 1 126 ? 1.381   8.496   8.723   1.00 0.00 ? 281 ASN A OD1  1  
ATOM   1926  N  ND2  . ASN A 1 126 ? 0.891   8.885   10.817  1.00 0.00 ? 281 ASN A ND2  1  
ATOM   1927  H  H    . ASN A 1 126 ? -0.441  8.504   7.022   1.00 0.00 ? 281 ASN A H    1  
ATOM   1928  H  HA   . ASN A 1 126 ? -1.937  8.520   9.502   1.00 0.00 ? 281 ASN A HA   1  
ATOM   1929  H  HB2  . ASN A 1 126 ? -0.105  10.568  8.208   1.00 0.00 ? 281 ASN A HB2  1  
ATOM   1930  H  HB3  . ASN A 1 126 ? -0.689  10.689  9.868   1.00 0.00 ? 281 ASN A HB3  1  
ATOM   1931  H  HD21 . ASN A 1 126 ? 0.333   9.344   11.483  1.00 0.00 ? 281 ASN A HD21 1  
ATOM   1932  H  HD22 . ASN A 1 126 ? 1.607   8.286   11.112  1.00 0.00 ? 281 ASN A HD22 1  
ATOM   1933  N  N    . SER A 1 127 ? -2.892  10.696  7.207   1.00 0.00 ? 282 SER A N    1  
ATOM   1934  C  CA   . SER A 1 127 ? -4.047  11.598  6.864   1.00 0.00 ? 282 SER A CA   1  
ATOM   1935  C  C    . SER A 1 127 ? -5.318  10.764  6.640   1.00 0.00 ? 282 SER A C    1  
ATOM   1936  O  O    . SER A 1 127 ? -6.406  11.193  6.980   1.00 0.00 ? 282 SER A O    1  
ATOM   1937  C  CB   . SER A 1 127 ? -3.664  12.347  5.580   1.00 0.00 ? 282 SER A CB   1  
ATOM   1938  O  OG   . SER A 1 127 ? -2.292  12.712  5.641   1.00 0.00 ? 282 SER A OG   1  
ATOM   1939  H  H    . SER A 1 127 ? -2.167  10.541  6.557   1.00 0.00 ? 282 SER A H    1  
ATOM   1940  H  HA   . SER A 1 127 ? -4.212  12.300  7.663   1.00 0.00 ? 282 SER A HA   1  
ATOM   1941  H  HB2  . SER A 1 127 ? -3.824  11.708  4.726   1.00 0.00 ? 282 SER A HB2  1  
ATOM   1942  H  HB3  . SER A 1 127 ? -4.280  13.232  5.483   1.00 0.00 ? 282 SER A HB3  1  
ATOM   1943  H  HG   . SER A 1 127 ? -2.211  13.462  6.235   1.00 0.00 ? 282 SER A HG   1  
ATOM   1944  N  N    . VAL A 1 128 ? -5.199  9.575   6.081   1.00 0.00 ? 283 VAL A N    1  
ATOM   1945  C  CA   . VAL A 1 128 ? -6.427  8.735   5.861   1.00 0.00 ? 283 VAL A CA   1  
ATOM   1946  C  C    . VAL A 1 128 ? -6.865  8.102   7.184   1.00 0.00 ? 283 VAL A C    1  
ATOM   1947  O  O    . VAL A 1 128 ? -8.047  8.035   7.469   1.00 0.00 ? 283 VAL A O    1  
ATOM   1948  C  CB   . VAL A 1 128 ? -6.051  7.652   4.834   1.00 0.00 ? 283 VAL A CB   1  
ATOM   1949  C  CG1  . VAL A 1 128 ? -7.259  6.750   4.560   1.00 0.00 ? 283 VAL A CG1  1  
ATOM   1950  C  CG2  . VAL A 1 128 ? -5.613  8.322   3.530   1.00 0.00 ? 283 VAL A CG2  1  
ATOM   1951  H  H    . VAL A 1 128 ? -4.312  9.238   5.818   1.00 0.00 ? 283 VAL A H    1  
ATOM   1952  H  HA   . VAL A 1 128 ? -7.223  9.348   5.479   1.00 0.00 ? 283 VAL A HA   1  
ATOM   1953  H  HB   . VAL A 1 128 ? -5.239  7.056   5.223   1.00 0.00 ? 283 VAL A HB   1  
ATOM   1954  H  HG11 . VAL A 1 128 ? -7.975  7.282   3.951   1.00 0.00 ? 283 VAL A HG11 1  
ATOM   1955  H  HG12 . VAL A 1 128 ? -7.720  6.471   5.497   1.00 0.00 ? 283 VAL A HG12 1  
ATOM   1956  H  HG13 . VAL A 1 128 ? -6.934  5.860   4.040   1.00 0.00 ? 283 VAL A HG13 1  
ATOM   1957  H  HG21 . VAL A 1 128 ? -6.483  8.544   2.929   1.00 0.00 ? 283 VAL A HG21 1  
ATOM   1958  H  HG22 . VAL A 1 128 ? -4.960  7.657   2.984   1.00 0.00 ? 283 VAL A HG22 1  
ATOM   1959  H  HG23 . VAL A 1 128 ? -5.088  9.239   3.755   1.00 0.00 ? 283 VAL A HG23 1  
ATOM   1960  N  N    . PHE A 1 129 ? -5.938  7.661   8.010   1.00 0.00 ? 284 PHE A N    1  
ATOM   1961  C  CA   . PHE A 1 129 ? -6.368  7.070   9.321   1.00 0.00 ? 284 PHE A CA   1  
ATOM   1962  C  C    . PHE A 1 129 ? -6.815  8.199   10.260  1.00 0.00 ? 284 PHE A C    1  
ATOM   1963  O  O    . PHE A 1 129 ? -7.699  8.007   11.074  1.00 0.00 ? 284 PHE A O    1  
ATOM   1964  C  CB   . PHE A 1 129 ? -5.178  6.287   9.910   1.00 0.00 ? 284 PHE A CB   1  
ATOM   1965  C  CG   . PHE A 1 129 ? -5.488  4.807   9.850   1.00 0.00 ? 284 PHE A CG   1  
ATOM   1966  C  CD1  . PHE A 1 129 ? -6.596  4.300   10.541  1.00 0.00 ? 284 PHE A CD1  1  
ATOM   1967  C  CD2  . PHE A 1 129 ? -4.686  3.949   9.090   1.00 0.00 ? 284 PHE A CD2  1  
ATOM   1968  C  CE1  . PHE A 1 129 ? -6.898  2.935   10.475  1.00 0.00 ? 284 PHE A CE1  1  
ATOM   1969  C  CE2  . PHE A 1 129 ? -4.990  2.583   9.022   1.00 0.00 ? 284 PHE A CE2  1  
ATOM   1970  C  CZ   . PHE A 1 129 ? -6.096  2.076   9.715   1.00 0.00 ? 284 PHE A CZ   1  
ATOM   1971  H  H    . PHE A 1 129 ? -4.982  7.745   7.780   1.00 0.00 ? 284 PHE A H    1  
ATOM   1972  H  HA   . PHE A 1 129 ? -7.199  6.402   9.150   1.00 0.00 ? 284 PHE A HA   1  
ATOM   1973  H  HB2  . PHE A 1 129 ? -4.284  6.492   9.343   1.00 0.00 ? 284 PHE A HB2  1  
ATOM   1974  H  HB3  . PHE A 1 129 ? -5.027  6.579   10.938  1.00 0.00 ? 284 PHE A HB3  1  
ATOM   1975  H  HD1  . PHE A 1 129 ? -7.216  4.962   11.127  1.00 0.00 ? 284 PHE A HD1  1  
ATOM   1976  H  HD2  . PHE A 1 129 ? -3.832  4.339   8.556   1.00 0.00 ? 284 PHE A HD2  1  
ATOM   1977  H  HE1  . PHE A 1 129 ? -7.751  2.545   11.008  1.00 0.00 ? 284 PHE A HE1  1  
ATOM   1978  H  HE2  . PHE A 1 129 ? -4.372  1.920   8.435   1.00 0.00 ? 284 PHE A HE2  1  
ATOM   1979  H  HZ   . PHE A 1 129 ? -6.331  1.022   9.661   1.00 0.00 ? 284 PHE A HZ   1  
ATOM   1980  N  N    . GLU A 1 130 ? -6.246  9.393   10.140  1.00 0.00 ? 285 GLU A N    1  
ATOM   1981  C  CA   . GLU A 1 130 ? -6.708  10.523  11.026  1.00 0.00 ? 285 GLU A CA   1  
ATOM   1982  C  C    . GLU A 1 130 ? -8.217  10.731  10.825  1.00 0.00 ? 285 GLU A C    1  
ATOM   1983  O  O    . GLU A 1 130 ? -8.943  10.963  11.772  1.00 0.00 ? 285 GLU A O    1  
ATOM   1984  C  CB   . GLU A 1 130 ? -5.932  11.779  10.596  1.00 0.00 ? 285 GLU A CB   1  
ATOM   1985  C  CG   . GLU A 1 130 ? -6.282  12.940  11.531  1.00 0.00 ? 285 GLU A CG   1  
ATOM   1986  C  CD   . GLU A 1 130 ? -5.724  14.243  10.958  1.00 0.00 ? 285 GLU A CD   1  
ATOM   1987  O  OE1  . GLU A 1 130 ? -6.343  14.785  10.057  1.00 0.00 ? 285 GLU A OE1  1  
ATOM   1988  O  OE2  . GLU A 1 130 ? -4.687  14.678  11.431  1.00 0.00 ? 285 GLU A OE2  1  
ATOM   1989  H  H    . GLU A 1 130 ? -5.548  9.546   9.462   1.00 0.00 ? 285 GLU A H    1  
ATOM   1990  H  HA   . GLU A 1 130 ? -6.503  10.293  12.056  1.00 0.00 ? 285 GLU A HA   1  
ATOM   1991  H  HB2  . GLU A 1 130 ? -4.871  11.582  10.648  1.00 0.00 ? 285 GLU A HB2  1  
ATOM   1992  H  HB3  . GLU A 1 130 ? -6.202  12.040  9.585   1.00 0.00 ? 285 GLU A HB3  1  
ATOM   1993  H  HG2  . GLU A 1 130 ? -7.356  13.016  11.622  1.00 0.00 ? 285 GLU A HG2  1  
ATOM   1994  H  HG3  . GLU A 1 130 ? -5.850  12.762  12.504  1.00 0.00 ? 285 GLU A HG3  1  
ATOM   1995  N  N    . ASN A 1 131 ? -8.702  10.616  9.599   1.00 0.00 ? 286 ASN A N    1  
ATOM   1996  C  CA   . ASN A 1 131 ? -10.184 10.776  9.372   1.00 0.00 ? 286 ASN A CA   1  
ATOM   1997  C  C    . ASN A 1 131 ? -10.953 9.726   10.200  1.00 0.00 ? 286 ASN A C    1  
ATOM   1998  O  O    . ASN A 1 131 ? -12.060 9.973   10.641  1.00 0.00 ? 286 ASN A O    1  
ATOM   1999  C  CB   . ASN A 1 131 ? -10.434 10.554  7.872   1.00 0.00 ? 286 ASN A CB   1  
ATOM   2000  C  CG   . ASN A 1 131 ? -10.098 11.838  7.102   1.00 0.00 ? 286 ASN A CG   1  
ATOM   2001  O  OD1  . ASN A 1 131 ? -10.516 12.912  7.487   1.00 0.00 ? 286 ASN A OD1  1  
ATOM   2002  N  ND2  . ASN A 1 131 ? -9.358  11.778  6.021   1.00 0.00 ? 286 ASN A ND2  1  
ATOM   2003  H  H    . ASN A 1 131 ? -8.098  10.404  8.843   1.00 0.00 ? 286 ASN A H    1  
ATOM   2004  H  HA   . ASN A 1 131 ? -10.495 11.767  9.655   1.00 0.00 ? 286 ASN A HA   1  
ATOM   2005  H  HB2  . ASN A 1 131 ? -9.808  9.747   7.518   1.00 0.00 ? 286 ASN A HB2  1  
ATOM   2006  H  HB3  . ASN A 1 131 ? -11.471 10.302  7.713   1.00 0.00 ? 286 ASN A HB3  1  
ATOM   2007  H  HD21 . ASN A 1 131 ? -9.015  10.916  5.700   1.00 0.00 ? 286 ASN A HD21 1  
ATOM   2008  H  HD22 . ASN A 1 131 ? -9.145  12.599  5.531   1.00 0.00 ? 286 ASN A HD22 1  
ATOM   2009  N  N    . LEU A 1 132 ? -10.372 8.558   10.431  1.00 0.00 ? 287 LEU A N    1  
ATOM   2010  C  CA   . LEU A 1 132 ? -11.082 7.506   11.249  1.00 0.00 ? 287 LEU A CA   1  
ATOM   2011  C  C    . LEU A 1 132 ? -11.473 8.093   12.616  1.00 0.00 ? 287 LEU A C    1  
ATOM   2012  O  O    . LEU A 1 132 ? -12.561 7.855   13.107  1.00 0.00 ? 287 LEU A O    1  
ATOM   2013  C  CB   . LEU A 1 132 ? -10.074 6.353   11.441  1.00 0.00 ? 287 LEU A CB   1  
ATOM   2014  C  CG   . LEU A 1 132 ? -10.800 5.016   11.662  1.00 0.00 ? 287 LEU A CG   1  
ATOM   2015  C  CD1  . LEU A 1 132 ? -11.777 5.126   12.839  1.00 0.00 ? 287 LEU A CD1  1  
ATOM   2016  C  CD2  . LEU A 1 132 ? -11.563 4.635   10.391  1.00 0.00 ? 287 LEU A CD2  1  
ATOM   2017  H  H    . LEU A 1 132 ? -9.475  8.377   10.075  1.00 0.00 ? 287 LEU A H    1  
ATOM   2018  H  HA   . LEU A 1 132 ? -11.957 7.152   10.729  1.00 0.00 ? 287 LEU A HA   1  
ATOM   2019  H  HB2  . LEU A 1 132 ? -9.453  6.274   10.560  1.00 0.00 ? 287 LEU A HB2  1  
ATOM   2020  H  HB3  . LEU A 1 132 ? -9.450  6.567   12.294  1.00 0.00 ? 287 LEU A HB3  1  
ATOM   2021  H  HG   . LEU A 1 132 ? -10.069 4.251   11.882  1.00 0.00 ? 287 LEU A HG   1  
ATOM   2022  H  HD11 . LEU A 1 132 ? -12.723 5.509   12.488  1.00 0.00 ? 287 LEU A HD11 1  
ATOM   2023  H  HD12 . LEU A 1 132 ? -11.371 5.796   13.583  1.00 0.00 ? 287 LEU A HD12 1  
ATOM   2024  H  HD13 . LEU A 1 132 ? -11.923 4.151   13.279  1.00 0.00 ? 287 LEU A HD13 1  
ATOM   2025  H  HD21 . LEU A 1 132 ? -12.433 5.266   10.289  1.00 0.00 ? 287 LEU A HD21 1  
ATOM   2026  H  HD22 . LEU A 1 132 ? -11.873 3.601   10.452  1.00 0.00 ? 287 LEU A HD22 1  
ATOM   2027  H  HD23 . LEU A 1 132 ? -10.919 4.766   9.533   1.00 0.00 ? 287 LEU A HD23 1  
ATOM   2028  N  N    . GLU A 1 133 ? -10.596 8.865   13.233  1.00 0.00 ? 288 GLU A N    1  
ATOM   2029  C  CA   . GLU A 1 133 ? -10.949 9.463   14.570  1.00 0.00 ? 288 GLU A CA   1  
ATOM   2030  C  C    . GLU A 1 133 ? -12.137 10.420  14.411  1.00 0.00 ? 288 GLU A C    1  
ATOM   2031  O  O    . GLU A 1 133 ? -13.040 10.432  15.227  1.00 0.00 ? 288 GLU A O    1  
ATOM   2032  C  CB   . GLU A 1 133 ? -9.709  10.231  15.059  1.00 0.00 ? 288 GLU A CB   1  
ATOM   2033  C  CG   . GLU A 1 133 ? -8.802  9.286   15.850  1.00 0.00 ? 288 GLU A CG   1  
ATOM   2034  C  CD   . GLU A 1 133 ? -7.949  8.465   14.880  1.00 0.00 ? 288 GLU A CD   1  
ATOM   2035  O  OE1  . GLU A 1 133 ? -7.097  9.051   14.232  1.00 0.00 ? 288 GLU A OE1  1  
ATOM   2036  O  OE2  . GLU A 1 133 ? -8.162  7.267   14.803  1.00 0.00 ? 288 GLU A OE2  1  
ATOM   2037  H  H    . GLU A 1 133 ? -9.720  9.051   12.813  1.00 0.00 ? 288 GLU A H    1  
ATOM   2038  H  HA   . GLU A 1 133 ? -11.197 8.685   15.269  1.00 0.00 ? 288 GLU A HA   1  
ATOM   2039  H  HB2  . GLU A 1 133 ? -9.169  10.621  14.208  1.00 0.00 ? 288 GLU A HB2  1  
ATOM   2040  H  HB3  . GLU A 1 133 ? -10.018 11.047  15.694  1.00 0.00 ? 288 GLU A HB3  1  
ATOM   2041  H  HG2  . GLU A 1 133 ? -8.158  9.863   16.497  1.00 0.00 ? 288 GLU A HG2  1  
ATOM   2042  H  HG3  . GLU A 1 133 ? -9.408  8.620   16.446  1.00 0.00 ? 288 GLU A HG3  1  
ATOM   2043  N  N    . GLN A 1 134 ? -12.154 11.215  13.362  1.00 0.00 ? 289 GLN A N    1  
ATOM   2044  C  CA   . GLN A 1 134 ? -13.310 12.161  13.162  1.00 0.00 ? 289 GLN A CA   1  
ATOM   2045  C  C    . GLN A 1 134 ? -14.610 11.358  13.006  1.00 0.00 ? 289 GLN A C    1  
ATOM   2046  O  O    . GLN A 1 134 ? -15.636 11.725  13.547  1.00 0.00 ? 289 GLN A O    1  
ATOM   2047  C  CB   . GLN A 1 134 ? -13.020 12.956  11.879  1.00 0.00 ? 289 GLN A CB   1  
ATOM   2048  C  CG   . GLN A 1 134 ? -11.862 13.924  12.128  1.00 0.00 ? 289 GLN A CG   1  
ATOM   2049  C  CD   . GLN A 1 134 ? -12.348 15.095  12.991  1.00 0.00 ? 289 GLN A CD   1  
ATOM   2050  O  OE1  . GLN A 1 134 ? -13.345 15.715  12.679  1.00 0.00 ? 289 GLN A OE1  1  
ATOM   2051  N  NE2  . GLN A 1 134 ? -11.687 15.429  14.073  1.00 0.00 ? 289 GLN A NE2  1  
ATOM   2052  H  H    . GLN A 1 134 ? -11.415 11.183  12.709  1.00 0.00 ? 289 GLN A H    1  
ATOM   2053  H  HA   . GLN A 1 134 ? -13.387 12.834  14.003  1.00 0.00 ? 289 GLN A HA   1  
ATOM   2054  H  HB2  . GLN A 1 134 ? -12.756 12.273  11.084  1.00 0.00 ? 289 GLN A HB2  1  
ATOM   2055  H  HB3  . GLN A 1 134 ? -13.899 13.515  11.596  1.00 0.00 ? 289 GLN A HB3  1  
ATOM   2056  H  HG2  . GLN A 1 134 ? -11.064 13.405  12.640  1.00 0.00 ? 289 GLN A HG2  1  
ATOM   2057  H  HG3  . GLN A 1 134 ? -11.499 14.302  11.185  1.00 0.00 ? 289 GLN A HG3  1  
ATOM   2058  H  HE21 . GLN A 1 134 ? -10.880 14.935  14.336  1.00 0.00 ? 289 GLN A HE21 1  
ATOM   2059  H  HE22 . GLN A 1 134 ? -12.001 16.178  14.623  1.00 0.00 ? 289 GLN A HE22 1  
ATOM   2060  N  N    . LEU A 1 135 ? -14.579 10.256  12.277  1.00 0.00 ? 290 LEU A N    1  
ATOM   2061  C  CA   . LEU A 1 135 ? -15.834 9.436   12.106  1.00 0.00 ? 290 LEU A CA   1  
ATOM   2062  C  C    . LEU A 1 135 ? -16.376 9.002   13.477  1.00 0.00 ? 290 LEU A C    1  
ATOM   2063  O  O    . LEU A 1 135 ? -17.573 8.986   13.695  1.00 0.00 ? 290 LEU A O    1  
ATOM   2064  C  CB   . LEU A 1 135 ? -15.444 8.201   11.279  1.00 0.00 ? 290 LEU A CB   1  
ATOM   2065  C  CG   . LEU A 1 135 ? -16.689 7.613   10.614  1.00 0.00 ? 290 LEU A CG   1  
ATOM   2066  C  CD1  . LEU A 1 135 ? -17.063 8.457   9.394   1.00 0.00 ? 290 LEU A CD1  1  
ATOM   2067  C  CD2  . LEU A 1 135 ? -16.397 6.179   10.168  1.00 0.00 ? 290 LEU A CD2  1  
ATOM   2068  H  H    . LEU A 1 135 ? -13.735 9.971   11.851  1.00 0.00 ? 290 LEU A H    1  
ATOM   2069  H  HA   . LEU A 1 135 ? -16.579 10.008  11.582  1.00 0.00 ? 290 LEU A HA   1  
ATOM   2070  H  HB2  . LEU A 1 135 ? -14.732 8.489   10.519  1.00 0.00 ? 290 LEU A HB2  1  
ATOM   2071  H  HB3  . LEU A 1 135 ? -15.000 7.461   11.926  1.00 0.00 ? 290 LEU A HB3  1  
ATOM   2072  H  HG   . LEU A 1 135 ? -17.508 7.615   11.318  1.00 0.00 ? 290 LEU A HG   1  
ATOM   2073  H  HD11 . LEU A 1 135 ? -16.222 8.505   8.718   1.00 0.00 ? 290 LEU A HD11 1  
ATOM   2074  H  HD12 . LEU A 1 135 ? -17.324 9.455   9.714   1.00 0.00 ? 290 LEU A HD12 1  
ATOM   2075  H  HD13 . LEU A 1 135 ? -17.905 8.008   8.890   1.00 0.00 ? 290 LEU A HD13 1  
ATOM   2076  H  HD21 . LEU A 1 135 ? -15.862 5.661   10.951  1.00 0.00 ? 290 LEU A HD21 1  
ATOM   2077  H  HD22 . LEU A 1 135 ? -15.796 6.195   9.271   1.00 0.00 ? 290 LEU A HD22 1  
ATOM   2078  H  HD23 . LEU A 1 135 ? -17.327 5.667   9.969   1.00 0.00 ? 290 LEU A HD23 1  
ATOM   2079  N  N    . LEU A 1 136 ? -15.508 8.656   14.407  1.00 0.00 ? 291 LEU A N    1  
ATOM   2080  C  CA   . LEU A 1 136 ? -16.001 8.231   15.769  1.00 0.00 ? 291 LEU A CA   1  
ATOM   2081  C  C    . LEU A 1 136 ? -16.855 9.347   16.397  1.00 0.00 ? 291 LEU A C    1  
ATOM   2082  O  O    . LEU A 1 136 ? -17.826 9.074   17.078  1.00 0.00 ? 291 LEU A O    1  
ATOM   2083  C  CB   . LEU A 1 136 ? -14.755 7.972   16.632  1.00 0.00 ? 291 LEU A CB   1  
ATOM   2084  C  CG   . LEU A 1 136 ? -15.173 7.317   17.949  1.00 0.00 ? 291 LEU A CG   1  
ATOM   2085  C  CD1  . LEU A 1 136 ? -14.085 6.342   18.402  1.00 0.00 ? 291 LEU A CD1  1  
ATOM   2086  C  CD2  . LEU A 1 136 ? -15.368 8.395   19.017  1.00 0.00 ? 291 LEU A CD2  1  
ATOM   2087  H  H    . LEU A 1 136 ? -14.542 8.680   14.210  1.00 0.00 ? 291 LEU A H    1  
ATOM   2088  H  HA   . LEU A 1 136 ? -16.581 7.325   15.685  1.00 0.00 ? 291 LEU A HA   1  
ATOM   2089  H  HB2  . LEU A 1 136 ? -14.080 7.318   16.101  1.00 0.00 ? 291 LEU A HB2  1  
ATOM   2090  H  HB3  . LEU A 1 136 ? -14.260 8.909   16.839  1.00 0.00 ? 291 LEU A HB3  1  
ATOM   2091  H  HG   . LEU A 1 136 ? -16.100 6.779   17.805  1.00 0.00 ? 291 LEU A HG   1  
ATOM   2092  H  HD11 . LEU A 1 136 ? -13.131 6.660   18.010  1.00 0.00 ? 291 LEU A HD11 1  
ATOM   2093  H  HD12 . LEU A 1 136 ? -14.313 5.352   18.037  1.00 0.00 ? 291 LEU A HD12 1  
ATOM   2094  H  HD13 . LEU A 1 136 ? -14.043 6.326   19.481  1.00 0.00 ? 291 LEU A HD13 1  
ATOM   2095  H  HD21 . LEU A 1 136 ? -14.519 9.063   19.013  1.00 0.00 ? 291 LEU A HD21 1  
ATOM   2096  H  HD22 . LEU A 1 136 ? -15.455 7.929   19.988  1.00 0.00 ? 291 LEU A HD22 1  
ATOM   2097  H  HD23 . LEU A 1 136 ? -16.267 8.956   18.803  1.00 0.00 ? 291 LEU A HD23 1  
ATOM   2098  N  N    . GLN A 1 137 ? -16.507 10.602  16.176  1.00 0.00 ? 292 GLN A N    1  
ATOM   2099  C  CA   . GLN A 1 137 ? -17.315 11.714  16.766  1.00 0.00 ? 292 GLN A CA   1  
ATOM   2100  C  C    . GLN A 1 137 ? -18.014 12.525  15.660  1.00 0.00 ? 292 GLN A C    1  
ATOM   2101  O  O    . GLN A 1 137 ? -18.170 13.726  15.779  1.00 0.00 ? 292 GLN A O    1  
ATOM   2102  C  CB   . GLN A 1 137 ? -16.304 12.590  17.511  1.00 0.00 ? 292 GLN A CB   1  
ATOM   2103  C  CG   . GLN A 1 137 ? -15.640 11.773  18.622  1.00 0.00 ? 292 GLN A CG   1  
ATOM   2104  C  CD   . GLN A 1 137 ? -14.554 12.619  19.300  1.00 0.00 ? 292 GLN A CD   1  
ATOM   2105  O  OE1  . GLN A 1 137 ? -14.845 13.391  20.190  1.00 0.00 ? 292 GLN A OE1  1  
ATOM   2106  N  NE2  . GLN A 1 137 ? -13.305 12.508  18.917  1.00 0.00 ? 292 GLN A NE2  1  
ATOM   2107  H  H    . GLN A 1 137 ? -15.723 10.813  15.622  1.00 0.00 ? 292 GLN A H    1  
ATOM   2108  H  HA   . GLN A 1 137 ? -18.041 11.321  17.460  1.00 0.00 ? 292 GLN A HA   1  
ATOM   2109  H  HB2  . GLN A 1 137 ? -15.551 12.938  16.819  1.00 0.00 ? 292 GLN A HB2  1  
ATOM   2110  H  HB3  . GLN A 1 137 ? -16.813 13.437  17.945  1.00 0.00 ? 292 GLN A HB3  1  
ATOM   2111  H  HG2  . GLN A 1 137 ? -16.383 11.487  19.352  1.00 0.00 ? 292 GLN A HG2  1  
ATOM   2112  H  HG3  . GLN A 1 137 ? -15.191 10.887  18.199  1.00 0.00 ? 292 GLN A HG3  1  
ATOM   2113  H  HE21 . GLN A 1 137 ? -13.058 11.888  18.197  1.00 0.00 ? 292 GLN A HE21 1  
ATOM   2114  H  HE22 . GLN A 1 137 ? -12.614 13.050  19.351  1.00 0.00 ? 292 GLN A HE22 1  
ATOM   2115  N  N    . GLN A 1 138 ? -18.444 11.886  14.587  1.00 0.00 ? 293 GLN A N    1  
ATOM   2116  C  CA   . GLN A 1 138 ? -19.132 12.638  13.494  1.00 0.00 ? 293 GLN A CA   1  
ATOM   2117  C  C    . GLN A 1 138 ? -20.564 12.110  13.312  1.00 0.00 ? 293 GLN A C    1  
ATOM   2118  O  O    . GLN A 1 138 ? -21.520 12.855  13.422  1.00 0.00 ? 293 GLN A O    1  
ATOM   2119  C  CB   . GLN A 1 138 ? -18.297 12.378  12.239  1.00 0.00 ? 293 GLN A CB   1  
ATOM   2120  C  CG   . GLN A 1 138 ? -18.894 13.142  11.055  1.00 0.00 ? 293 GLN A CG   1  
ATOM   2121  C  CD   . GLN A 1 138 ? -18.640 14.644  11.233  1.00 0.00 ? 293 GLN A CD   1  
ATOM   2122  O  OE1  . GLN A 1 138 ? -19.239 15.273  12.083  1.00 0.00 ? 293 GLN A OE1  1  
ATOM   2123  N  NE2  . GLN A 1 138 ? -17.770 15.256  10.466  1.00 0.00 ? 293 GLN A NE2  1  
ATOM   2124  H  H    . GLN A 1 138 ? -18.317 10.916  14.499  1.00 0.00 ? 293 GLN A H    1  
ATOM   2125  H  HA   . GLN A 1 138 ? -19.148 13.688  13.716  1.00 0.00 ? 293 GLN A HA   1  
ATOM   2126  H  HB2  . GLN A 1 138 ? -17.283 12.714  12.408  1.00 0.00 ? 293 GLN A HB2  1  
ATOM   2127  H  HB3  . GLN A 1 138 ? -18.294 11.321  12.019  1.00 0.00 ? 293 GLN A HB3  1  
ATOM   2128  H  HG2  . GLN A 1 138 ? -18.434 12.804  10.139  1.00 0.00 ? 293 GLN A HG2  1  
ATOM   2129  H  HG3  . GLN A 1 138 ? -19.958 12.963  11.011  1.00 0.00 ? 293 GLN A HG3  1  
ATOM   2130  H  HE21 . GLN A 1 138 ? -17.280 14.758  9.775   1.00 0.00 ? 293 GLN A HE21 1  
ATOM   2131  H  HE22 . GLN A 1 138 ? -17.609 16.216  10.580  1.00 0.00 ? 293 GLN A HE22 1  
ATOM   2132  N  N    . ASN A 1 139 ? -20.718 10.835  13.036  1.00 0.00 ? 294 ASN A N    1  
ATOM   2133  C  CA   . ASN A 1 139 ? -22.087 10.267  12.849  1.00 0.00 ? 294 ASN A CA   1  
ATOM   2134  C  C    . ASN A 1 139 ? -22.282 9.045   13.762  1.00 0.00 ? 294 ASN A C    1  
ATOM   2135  O  O    . ASN A 1 139 ? -22.620 7.970   13.300  1.00 0.00 ? 294 ASN A O    1  
ATOM   2136  C  CB   . ASN A 1 139 ? -22.147 9.857   11.377  1.00 0.00 ? 294 ASN A CB   1  
ATOM   2137  C  CG   . ASN A 1 139 ? -22.642 11.040  10.535  1.00 0.00 ? 294 ASN A CG   1  
ATOM   2138  O  OD1  . ASN A 1 139 ? -23.670 11.617  10.832  1.00 0.00 ? 294 ASN A OD1  1  
ATOM   2139  N  ND2  . ASN A 1 139 ? -21.954 11.435  9.492   1.00 0.00 ? 294 ASN A ND2  1  
ATOM   2140  H  H    . ASN A 1 139 ? -19.936 10.249  12.952  1.00 0.00 ? 294 ASN A H    1  
ATOM   2141  H  HA   . ASN A 1 139 ? -22.836 11.016  13.054  1.00 0.00 ? 294 ASN A HA   1  
ATOM   2142  H  HB2  . ASN A 1 139 ? -21.161 9.565   11.044  1.00 0.00 ? 294 ASN A HB2  1  
ATOM   2143  H  HB3  . ASN A 1 139 ? -22.827 9.027   11.261  1.00 0.00 ? 294 ASN A HB3  1  
ATOM   2144  H  HD21 . ASN A 1 139 ? -21.122 10.976  9.242   1.00 0.00 ? 294 ASN A HD21 1  
ATOM   2145  H  HD22 . ASN A 1 139 ? -22.273 12.191  8.955   1.00 0.00 ? 294 ASN A HD22 1  
ATOM   2146  N  N    . LYS A 1 140 ? -22.074 9.197   15.055  1.00 0.00 ? 295 LYS A N    1  
ATOM   2147  C  CA   . LYS A 1 140 ? -22.250 8.039   15.983  1.00 0.00 ? 295 LYS A CA   1  
ATOM   2148  C  C    . LYS A 1 140 ? -23.391 8.321   16.975  1.00 0.00 ? 295 LYS A C    1  
ATOM   2149  O  O    . LYS A 1 140 ? -24.050 9.341   16.888  1.00 0.00 ? 295 LYS A O    1  
ATOM   2150  C  CB   . LYS A 1 140 ? -20.916 7.915   16.721  1.00 0.00 ? 295 LYS A CB   1  
ATOM   2151  C  CG   . LYS A 1 140 ? -19.937 7.103   15.872  1.00 0.00 ? 295 LYS A CG   1  
ATOM   2152  C  CD   . LYS A 1 140 ? -20.216 5.610   16.055  1.00 0.00 ? 295 LYS A CD   1  
ATOM   2153  C  CE   . LYS A 1 140 ? -18.944 4.812   15.764  1.00 0.00 ? 295 LYS A CE   1  
ATOM   2154  N  NZ   . LYS A 1 140 ? -18.692 5.011   14.309  1.00 0.00 ? 295 LYS A NZ   1  
ATOM   2155  H  H    . LYS A 1 140 ? -21.802 10.070  15.417  1.00 0.00 ? 295 LYS A H    1  
ATOM   2156  H  HA   . LYS A 1 140 ? -22.450 7.137   15.427  1.00 0.00 ? 295 LYS A HA   1  
ATOM   2157  H  HB2  . LYS A 1 140 ? -20.511 8.901   16.898  1.00 0.00 ? 295 LYS A HB2  1  
ATOM   2158  H  HB3  . LYS A 1 140 ? -21.072 7.415   17.665  1.00 0.00 ? 295 LYS A HB3  1  
ATOM   2159  H  HG2  . LYS A 1 140 ? -20.058 7.368   14.832  1.00 0.00 ? 295 LYS A HG2  1  
ATOM   2160  H  HG3  . LYS A 1 140 ? -18.926 7.319   16.184  1.00 0.00 ? 295 LYS A HG3  1  
ATOM   2161  H  HD2  . LYS A 1 140 ? -20.533 5.427   17.072  1.00 0.00 ? 295 LYS A HD2  1  
ATOM   2162  H  HD3  . LYS A 1 140 ? -20.996 5.304   15.374  1.00 0.00 ? 295 LYS A HD3  1  
ATOM   2163  H  HE2  . LYS A 1 140 ? -18.119 5.196   16.348  1.00 0.00 ? 295 LYS A HE2  1  
ATOM   2164  H  HE3  . LYS A 1 140 ? -19.100 3.765   15.972  1.00 0.00 ? 295 LYS A HE3  1  
ATOM   2165  H  HZ1  . LYS A 1 140 ? -18.434 6.002   14.134  1.00 0.00 ? 295 LYS A HZ1  1  
ATOM   2166  H  HZ2  . LYS A 1 140 ? -19.552 4.774   13.773  1.00 0.00 ? 295 LYS A HZ2  1  
ATOM   2167  H  HZ3  . LYS A 1 140 ? -17.912 4.394   14.005  1.00 0.00 ? 295 LYS A HZ3  1  
ATOM   2168  N  N    . LYS A 1 141 ? -23.631 7.430   17.915  1.00 0.00 ? 296 LYS A N    1  
ATOM   2169  C  CA   . LYS A 1 141 ? -24.729 7.661   18.901  1.00 0.00 ? 296 LYS A CA   1  
ATOM   2170  C  C    . LYS A 1 141 ? -24.222 7.413   20.325  1.00 0.00 ? 296 LYS A C    1  
ATOM   2171  O  O    . LYS A 1 141 ? -24.954 7.712   21.253  1.00 0.00 ? 296 LYS A O    1  
ATOM   2172  C  CB   . LYS A 1 141 ? -25.811 6.644   18.534  1.00 0.00 ? 296 LYS A CB   1  
ATOM   2173  C  CG   . LYS A 1 141 ? -26.557 7.121   17.286  1.00 0.00 ? 296 LYS A CG   1  
ATOM   2174  C  CD   . LYS A 1 141 ? -27.511 6.023   16.811  1.00 0.00 ? 296 LYS A CD   1  
ATOM   2175  C  CE   . LYS A 1 141 ? -28.717 6.660   16.117  1.00 0.00 ? 296 LYS A CE   1  
ATOM   2176  N  NZ   . LYS A 1 141 ? -29.766 6.746   17.172  1.00 0.00 ? 296 LYS A NZ   1  
ATOM   2177  O  OXT  . LYS A 1 141 ? -23.110 6.930   20.461  1.00 0.00 ? 296 LYS A OXT  1  
ATOM   2178  H  H    . LYS A 1 141 ? -23.092 6.610   17.974  1.00 0.00 ? 296 LYS A H    1  
ATOM   2179  H  HA   . LYS A 1 141 ? -25.118 8.662   18.807  1.00 0.00 ? 296 LYS A HA   1  
ATOM   2180  H  HB2  . LYS A 1 141 ? -25.352 5.685   18.337  1.00 0.00 ? 296 LYS A HB2  1  
ATOM   2181  H  HB3  . LYS A 1 141 ? -26.508 6.548   19.353  1.00 0.00 ? 296 LYS A HB3  1  
ATOM   2182  H  HG2  . LYS A 1 141 ? -27.119 8.012   17.522  1.00 0.00 ? 296 LYS A HG2  1  
ATOM   2183  H  HG3  . LYS A 1 141 ? -25.846 7.340   16.503  1.00 0.00 ? 296 LYS A HG3  1  
ATOM   2184  H  HD2  . LYS A 1 141 ? -26.997 5.375   16.117  1.00 0.00 ? 296 LYS A HD2  1  
ATOM   2185  H  HD3  . LYS A 1 141 ? -27.849 5.448   17.660  1.00 0.00 ? 296 LYS A HD3  1  
ATOM   2186  H  HE2  . LYS A 1 141 ? -28.463 7.646   15.755  1.00 0.00 ? 296 LYS A HE2  1  
ATOM   2187  H  HE3  . LYS A 1 141 ? -29.058 6.036   15.307  1.00 0.00 ? 296 LYS A HE3  1  
ATOM   2188  H  HZ1  . LYS A 1 141 ? -30.560 7.321   16.827  1.00 0.00 ? 296 LYS A HZ1  1  
ATOM   2189  H  HZ2  . LYS A 1 141 ? -29.364 7.185   18.025  1.00 0.00 ? 296 LYS A HZ2  1  
ATOM   2190  H  HZ3  . LYS A 1 141 ? -30.106 5.791   17.400  1.00 0.00 ? 296 LYS A HZ3  1  
HETATM 2191  ZN ZN   . ZN  B 2 .   ? -5.629  -3.726  -0.697  1.00 0.00 ? 1   ZN  A ZN   1  
HETATM 2192  ZN ZN   . ZN  C 2 .   ? 1.741   -6.434  -5.501  1.00 0.00 ? 2   ZN  A ZN   1  
HETATM 2193  ZN ZN   . ZN  D 2 .   ? 14.390  -4.751  -0.730  1.00 0.00 ? 3   ZN  A ZN   1  
ATOM   2194  N  N    . GLY A 1 1   ? -32.912 14.750  1.255   1.00 0.00 ? 156 GLY A N    2  
ATOM   2195  C  CA   . GLY A 1 1   ? -32.087 15.444  0.224   1.00 0.00 ? 156 GLY A CA   2  
ATOM   2196  C  C    . GLY A 1 1   ? -31.688 16.835  0.737   1.00 0.00 ? 156 GLY A C    2  
ATOM   2197  O  O    . GLY A 1 1   ? -30.533 17.083  1.025   1.00 0.00 ? 156 GLY A O    2  
ATOM   2198  H  H1   . GLY A 1 1   ? -32.441 14.819  2.180   1.00 0.00 ? 156 GLY A H1   2  
ATOM   2199  H  H2   . GLY A 1 1   ? -33.022 13.749  0.993   1.00 0.00 ? 156 GLY A H2   2  
ATOM   2200  H  H3   . GLY A 1 1   ? -33.847 15.200  1.311   1.00 0.00 ? 156 GLY A H3   2  
ATOM   2201  H  HA2  . GLY A 1 1   ? -31.197 14.863  0.026   1.00 0.00 ? 156 GLY A HA2  2  
ATOM   2202  H  HA3  . GLY A 1 1   ? -32.659 15.548  -0.684  1.00 0.00 ? 156 GLY A HA3  2  
ATOM   2203  N  N    . ALA A 1 2   ? -32.632 17.748  0.853   1.00 0.00 ? 157 ALA A N    2  
ATOM   2204  C  CA   . ALA A 1 2   ? -32.293 19.116  1.347   1.00 0.00 ? 157 ALA A CA   2  
ATOM   2205  C  C    . ALA A 1 2   ? -33.054 19.417  2.648   1.00 0.00 ? 157 ALA A C    2  
ATOM   2206  O  O    . ALA A 1 2   ? -33.630 20.478  2.799   1.00 0.00 ? 157 ALA A O    2  
ATOM   2207  C  CB   . ALA A 1 2   ? -32.742 20.063  0.232   1.00 0.00 ? 157 ALA A CB   2  
ATOM   2208  H  H    . ALA A 1 2   ? -33.563 17.536  0.616   1.00 0.00 ? 157 ALA A H    2  
ATOM   2209  H  HA   . ALA A 1 2   ? -31.230 19.208  1.502   1.00 0.00 ? 157 ALA A HA   2  
ATOM   2210  H  HB1  . ALA A 1 2   ? -32.074 20.909  0.187   1.00 0.00 ? 157 ALA A HB1  2  
ATOM   2211  H  HB2  . ALA A 1 2   ? -33.746 20.406  0.435   1.00 0.00 ? 157 ALA A HB2  2  
ATOM   2212  H  HB3  . ALA A 1 2   ? -32.725 19.539  -0.712  1.00 0.00 ? 157 ALA A HB3  2  
ATOM   2213  N  N    . MET A 1 3   ? -33.063 18.495  3.590   1.00 0.00 ? 158 MET A N    2  
ATOM   2214  C  CA   . MET A 1 3   ? -33.788 18.742  4.872   1.00 0.00 ? 158 MET A CA   2  
ATOM   2215  C  C    . MET A 1 3   ? -33.005 18.145  6.050   1.00 0.00 ? 158 MET A C    2  
ATOM   2216  O  O    . MET A 1 3   ? -32.610 18.853  6.957   1.00 0.00 ? 158 MET A O    2  
ATOM   2217  C  CB   . MET A 1 3   ? -35.137 18.035  4.708   1.00 0.00 ? 158 MET A CB   2  
ATOM   2218  C  CG   . MET A 1 3   ? -36.250 18.911  5.289   1.00 0.00 ? 158 MET A CG   2  
ATOM   2219  S  SD   . MET A 1 3   ? -36.365 18.635  7.074   1.00 0.00 ? 158 MET A SD   2  
ATOM   2220  C  CE   . MET A 1 3   ? -38.144 18.310  7.139   1.00 0.00 ? 158 MET A CE   2  
ATOM   2221  H  H    . MET A 1 3   ? -32.593 17.642  3.455   1.00 0.00 ? 158 MET A H    2  
ATOM   2222  H  HA   . MET A 1 3   ? -33.939 19.794  5.021   1.00 0.00 ? 158 MET A HA   2  
ATOM   2223  H  HB2  . MET A 1 3   ? -35.326 17.861  3.659   1.00 0.00 ? 158 MET A HB2  2  
ATOM   2224  H  HB3  . MET A 1 3   ? -35.115 17.091  5.231   1.00 0.00 ? 158 MET A HB3  2  
ATOM   2225  H  HG2  . MET A 1 3   ? -36.026 19.950  5.100   1.00 0.00 ? 158 MET A HG2  2  
ATOM   2226  H  HG3  . MET A 1 3   ? -37.190 18.654  4.823   1.00 0.00 ? 158 MET A HG3  2  
ATOM   2227  H  HE1  . MET A 1 3   ? -38.322 17.254  6.988   1.00 0.00 ? 158 MET A HE1  2  
ATOM   2228  H  HE2  . MET A 1 3   ? -38.642 18.870  6.364   1.00 0.00 ? 158 MET A HE2  2  
ATOM   2229  H  HE3  . MET A 1 3   ? -38.530 18.611  8.103   1.00 0.00 ? 158 MET A HE3  2  
ATOM   2230  N  N    . LYS A 1 4   ? -32.775 16.850  6.045   1.00 0.00 ? 159 LYS A N    2  
ATOM   2231  C  CA   . LYS A 1 4   ? -32.016 16.218  7.165   1.00 0.00 ? 159 LYS A CA   2  
ATOM   2232  C  C    . LYS A 1 4   ? -30.722 15.581  6.635   1.00 0.00 ? 159 LYS A C    2  
ATOM   2233  O  O    . LYS A 1 4   ? -30.735 14.887  5.636   1.00 0.00 ? 159 LYS A O    2  
ATOM   2234  C  CB   . LYS A 1 4   ? -32.952 15.145  7.722   1.00 0.00 ? 159 LYS A CB   2  
ATOM   2235  C  CG   . LYS A 1 4   ? -34.165 15.811  8.374   1.00 0.00 ? 159 LYS A CG   2  
ATOM   2236  C  CD   . LYS A 1 4   ? -33.907 15.990  9.873   1.00 0.00 ? 159 LYS A CD   2  
ATOM   2237  C  CE   . LYS A 1 4   ? -34.492 14.801  10.640  1.00 0.00 ? 159 LYS A CE   2  
ATOM   2238  N  NZ   . LYS A 1 4   ? -33.327 13.919  10.928  1.00 0.00 ? 159 LYS A NZ   2  
ATOM   2239  H  H    . LYS A 1 4   ? -33.100 16.294  5.305   1.00 0.00 ? 159 LYS A H    2  
ATOM   2240  H  HA   . LYS A 1 4   ? -31.794 16.946  7.929   1.00 0.00 ? 159 LYS A HA   2  
ATOM   2241  H  HB2  . LYS A 1 4   ? -33.282 14.502  6.917   1.00 0.00 ? 159 LYS A HB2  2  
ATOM   2242  H  HB3  . LYS A 1 4   ? -32.428 14.556  8.460   1.00 0.00 ? 159 LYS A HB3  2  
ATOM   2243  H  HG2  . LYS A 1 4   ? -34.332 16.777  7.919   1.00 0.00 ? 159 LYS A HG2  2  
ATOM   2244  H  HG3  . LYS A 1 4   ? -35.037 15.191  8.232   1.00 0.00 ? 159 LYS A HG3  2  
ATOM   2245  H  HD2  . LYS A 1 4   ? -32.843 16.045  10.051  1.00 0.00 ? 159 LYS A HD2  2  
ATOM   2246  H  HD3  . LYS A 1 4   ? -34.377 16.901  10.212  1.00 0.00 ? 159 LYS A HD3  2  
ATOM   2247  H  HE2  . LYS A 1 4   ? -34.949 15.138  11.561  1.00 0.00 ? 159 LYS A HE2  2  
ATOM   2248  H  HE3  . LYS A 1 4   ? -35.213 14.275  10.033  1.00 0.00 ? 159 LYS A HE3  2  
ATOM   2249  H  HZ1  . LYS A 1 4   ? -32.998 13.479  10.045  1.00 0.00 ? 159 LYS A HZ1  2  
ATOM   2250  H  HZ2  . LYS A 1 4   ? -33.613 13.177  11.601  1.00 0.00 ? 159 LYS A HZ2  2  
ATOM   2251  H  HZ3  . LYS A 1 4   ? -32.558 14.483  11.339  1.00 0.00 ? 159 LYS A HZ3  2  
ATOM   2252  N  N    . ARG A 1 5   ? -29.602 15.810  7.293   1.00 0.00 ? 160 ARG A N    2  
ATOM   2253  C  CA   . ARG A 1 5   ? -28.319 15.212  6.816   1.00 0.00 ? 160 ARG A CA   2  
ATOM   2254  C  C    . ARG A 1 5   ? -27.748 14.260  7.880   1.00 0.00 ? 160 ARG A C    2  
ATOM   2255  O  O    . ARG A 1 5   ? -27.020 14.678  8.760   1.00 0.00 ? 160 ARG A O    2  
ATOM   2256  C  CB   . ARG A 1 5   ? -27.382 16.403  6.606   1.00 0.00 ? 160 ARG A CB   2  
ATOM   2257  C  CG   . ARG A 1 5   ? -27.525 16.917  5.172   1.00 0.00 ? 160 ARG A CG   2  
ATOM   2258  C  CD   . ARG A 1 5   ? -26.456 17.978  4.901   1.00 0.00 ? 160 ARG A CD   2  
ATOM   2259  N  NE   . ARG A 1 5   ? -27.127 19.278  5.175   1.00 0.00 ? 160 ARG A NE   2  
ATOM   2260  C  CZ   . ARG A 1 5   ? -26.899 19.909  6.294   1.00 0.00 ? 160 ARG A CZ   2  
ATOM   2261  N  NH1  . ARG A 1 5   ? -25.814 20.621  6.433   1.00 0.00 ? 160 ARG A NH1  2  
ATOM   2262  N  NH2  . ARG A 1 5   ? -27.755 19.826  7.276   1.00 0.00 ? 160 ARG A NH2  2  
ATOM   2263  H  H    . ARG A 1 5   ? -29.604 16.372  8.099   1.00 0.00 ? 160 ARG A H    2  
ATOM   2264  H  HA   . ARG A 1 5   ? -28.468 14.691  5.884   1.00 0.00 ? 160 ARG A HA   2  
ATOM   2265  H  HB2  . ARG A 1 5   ? -27.640 17.190  7.299   1.00 0.00 ? 160 ARG A HB2  2  
ATOM   2266  H  HB3  . ARG A 1 5   ? -26.363 16.093  6.775   1.00 0.00 ? 160 ARG A HB3  2  
ATOM   2267  H  HG2  . ARG A 1 5   ? -27.402 16.095  4.481   1.00 0.00 ? 160 ARG A HG2  2  
ATOM   2268  H  HG3  . ARG A 1 5   ? -28.504 17.354  5.041   1.00 0.00 ? 160 ARG A HG3  2  
ATOM   2269  H  HD2  . ARG A 1 5   ? -25.614 17.839  5.566   1.00 0.00 ? 160 ARG A HD2  2  
ATOM   2270  H  HD3  . ARG A 1 5   ? -26.136 17.936  3.872   1.00 0.00 ? 160 ARG A HD3  2  
ATOM   2271  H  HE   . ARG A 1 5   ? -27.741 19.661  4.514   1.00 0.00 ? 160 ARG A HE   2  
ATOM   2272  H  HH11 . ARG A 1 5   ? -25.159 20.684  5.681   1.00 0.00 ? 160 ARG A HH11 2  
ATOM   2273  H  HH12 . ARG A 1 5   ? -25.640 21.104  7.291   1.00 0.00 ? 160 ARG A HH12 2  
ATOM   2274  H  HH21 . ARG A 1 5   ? -28.586 19.279  7.170   1.00 0.00 ? 160 ARG A HH21 2  
ATOM   2275  H  HH22 . ARG A 1 5   ? -27.580 20.309  8.134   1.00 0.00 ? 160 ARG A HH22 2  
ATOM   2276  N  N    . GLY A 1 6   ? -28.070 12.984  7.808   1.00 0.00 ? 161 GLY A N    2  
ATOM   2277  C  CA   . GLY A 1 6   ? -27.541 12.020  8.818   1.00 0.00 ? 161 GLY A CA   2  
ATOM   2278  C  C    . GLY A 1 6   ? -26.018 11.903  8.667   1.00 0.00 ? 161 GLY A C    2  
ATOM   2279  O  O    . GLY A 1 6   ? -25.289 12.000  9.637   1.00 0.00 ? 161 GLY A O    2  
ATOM   2280  H  H    . GLY A 1 6   ? -28.659 12.658  7.091   1.00 0.00 ? 161 GLY A H    2  
ATOM   2281  H  HA2  . GLY A 1 6   ? -27.781 12.373  9.811   1.00 0.00 ? 161 GLY A HA2  2  
ATOM   2282  H  HA3  . GLY A 1 6   ? -27.990 11.051  8.661   1.00 0.00 ? 161 GLY A HA3  2  
ATOM   2283  N  N    . GLU A 1 7   ? -25.526 11.695  7.462   1.00 0.00 ? 162 GLU A N    2  
ATOM   2284  C  CA   . GLU A 1 7   ? -24.050 11.574  7.266   1.00 0.00 ? 162 GLU A CA   2  
ATOM   2285  C  C    . GLU A 1 7   ? -23.542 12.703  6.356   1.00 0.00 ? 162 GLU A C    2  
ATOM   2286  O  O    . GLU A 1 7   ? -23.636 12.615  5.146   1.00 0.00 ? 162 GLU A O    2  
ATOM   2287  C  CB   . GLU A 1 7   ? -23.850 10.214  6.596   1.00 0.00 ? 162 GLU A CB   2  
ATOM   2288  C  CG   . GLU A 1 7   ? -22.354 9.902   6.513   1.00 0.00 ? 162 GLU A CG   2  
ATOM   2289  C  CD   . GLU A 1 7   ? -22.159 8.459   6.041   1.00 0.00 ? 162 GLU A CD   2  
ATOM   2290  O  OE1  . GLU A 1 7   ? -22.233 7.570   6.873   1.00 0.00 ? 162 GLU A OE1  2  
ATOM   2291  O  OE2  . GLU A 1 7   ? -21.940 8.269   4.856   1.00 0.00 ? 162 GLU A OE2  2  
ATOM   2292  H  H    . GLU A 1 7   ? -26.125 11.618  6.686   1.00 0.00 ? 162 GLU A H    2  
ATOM   2293  H  HA   . GLU A 1 7   ? -23.540 11.596  8.216   1.00 0.00 ? 162 GLU A HA   2  
ATOM   2294  H  HB2  . GLU A 1 7   ? -24.347 9.451   7.176   1.00 0.00 ? 162 GLU A HB2  2  
ATOM   2295  H  HB3  . GLU A 1 7   ? -24.266 10.239  5.599   1.00 0.00 ? 162 GLU A HB3  2  
ATOM   2296  H  HG2  . GLU A 1 7   ? -21.883 10.577  5.813   1.00 0.00 ? 162 GLU A HG2  2  
ATOM   2297  H  HG3  . GLU A 1 7   ? -21.907 10.023  7.488   1.00 0.00 ? 162 GLU A HG3  2  
ATOM   2298  N  N    . ASP A 1 8   ? -23.005 13.765  6.923   1.00 0.00 ? 163 ASP A N    2  
ATOM   2299  C  CA   . ASP A 1 8   ? -22.496 14.888  6.080   1.00 0.00 ? 163 ASP A CA   2  
ATOM   2300  C  C    . ASP A 1 8   ? -21.012 15.149  6.380   1.00 0.00 ? 163 ASP A C    2  
ATOM   2301  O  O    . ASP A 1 8   ? -20.529 14.822  7.449   1.00 0.00 ? 163 ASP A O    2  
ATOM   2302  C  CB   . ASP A 1 8   ? -23.345 16.095  6.478   1.00 0.00 ? 163 ASP A CB   2  
ATOM   2303  C  CG   . ASP A 1 8   ? -23.182 17.201  5.433   1.00 0.00 ? 163 ASP A CG   2  
ATOM   2304  O  OD1  . ASP A 1 8   ? -23.211 16.885  4.255   1.00 0.00 ? 163 ASP A OD1  2  
ATOM   2305  O  OD2  . ASP A 1 8   ? -23.032 18.345  5.829   1.00 0.00 ? 163 ASP A OD2  2  
ATOM   2306  H  H    . ASP A 1 8   ? -22.934 13.825  7.902   1.00 0.00 ? 163 ASP A H    2  
ATOM   2307  H  HA   . ASP A 1 8   ? -22.636 14.668  5.034   1.00 0.00 ? 163 ASP A HA   2  
ATOM   2308  H  HB2  . ASP A 1 8   ? -24.382 15.803  6.535   1.00 0.00 ? 163 ASP A HB2  2  
ATOM   2309  H  HB3  . ASP A 1 8   ? -23.020 16.462  7.441   1.00 0.00 ? 163 ASP A HB3  2  
ATOM   2310  N  N    . GLY A 1 9   ? -20.283 15.734  5.451   1.00 0.00 ? 164 GLY A N    2  
ATOM   2311  C  CA   . GLY A 1 9   ? -18.836 16.008  5.697   1.00 0.00 ? 164 GLY A CA   2  
ATOM   2312  C  C    . GLY A 1 9   ? -17.991 15.300  4.628   1.00 0.00 ? 164 GLY A C    2  
ATOM   2313  O  O    . GLY A 1 9   ? -17.864 15.780  3.518   1.00 0.00 ? 164 GLY A O    2  
ATOM   2314  H  H    . GLY A 1 9   ? -20.685 15.992  4.592   1.00 0.00 ? 164 GLY A H    2  
ATOM   2315  H  HA2  . GLY A 1 9   ? -18.659 17.073  5.652   1.00 0.00 ? 164 GLY A HA2  2  
ATOM   2316  H  HA3  . GLY A 1 9   ? -18.560 15.637  6.673   1.00 0.00 ? 164 GLY A HA3  2  
ATOM   2317  N  N    . LEU A 1 10  ? -17.406 14.158  4.948   1.00 0.00 ? 165 LEU A N    2  
ATOM   2318  C  CA   . LEU A 1 10  ? -16.568 13.422  3.944   1.00 0.00 ? 165 LEU A CA   2  
ATOM   2319  C  C    . LEU A 1 10  ? -15.496 14.349  3.344   1.00 0.00 ? 165 LEU A C    2  
ATOM   2320  O  O    . LEU A 1 10  ? -15.716 14.972  2.322   1.00 0.00 ? 165 LEU A O    2  
ATOM   2321  C  CB   . LEU A 1 10  ? -17.544 12.955  2.859   1.00 0.00 ? 165 LEU A CB   2  
ATOM   2322  C  CG   . LEU A 1 10  ? -17.994 11.524  3.156   1.00 0.00 ? 165 LEU A CG   2  
ATOM   2323  C  CD1  . LEU A 1 10  ? -19.372 11.282  2.537   1.00 0.00 ? 165 LEU A CD1  2  
ATOM   2324  C  CD2  . LEU A 1 10  ? -16.987 10.539  2.557   1.00 0.00 ? 165 LEU A CD2  2  
ATOM   2325  H  H    . LEU A 1 10  ? -17.517 13.782  5.849   1.00 0.00 ? 165 LEU A H    2  
ATOM   2326  H  HA   . LEU A 1 10  ? -16.101 12.566  4.408   1.00 0.00 ? 165 LEU A HA   2  
ATOM   2327  H  HB2  . LEU A 1 10  ? -18.404 13.608  2.843   1.00 0.00 ? 165 LEU A HB2  2  
ATOM   2328  H  HB3  . LEU A 1 10  ? -17.053 12.983  1.898   1.00 0.00 ? 165 LEU A HB3  2  
ATOM   2329  H  HG   . LEU A 1 10  ? -18.049 11.379  4.226   1.00 0.00 ? 165 LEU A HG   2  
ATOM   2330  H  HD11 . LEU A 1 10  ? -20.138 11.525  3.258   1.00 0.00 ? 165 LEU A HD11 2  
ATOM   2331  H  HD12 . LEU A 1 10  ? -19.461 10.244  2.252   1.00 0.00 ? 165 LEU A HD12 2  
ATOM   2332  H  HD13 . LEU A 1 10  ? -19.488 11.907  1.664   1.00 0.00 ? 165 LEU A HD13 2  
ATOM   2333  H  HD21 . LEU A 1 10  ? -17.223 9.538   2.886   1.00 0.00 ? 165 LEU A HD21 2  
ATOM   2334  H  HD22 . LEU A 1 10  ? -15.991 10.800  2.883   1.00 0.00 ? 165 LEU A HD22 2  
ATOM   2335  H  HD23 . LEU A 1 10  ? -17.037 10.584  1.480   1.00 0.00 ? 165 LEU A HD23 2  
ATOM   2336  N  N    . HIS A 1 11  ? -14.339 14.446  3.968   1.00 0.00 ? 166 HIS A N    2  
ATOM   2337  C  CA   . HIS A 1 11  ? -13.266 15.333  3.424   1.00 0.00 ? 166 HIS A CA   2  
ATOM   2338  C  C    . HIS A 1 11  ? -12.052 14.496  2.994   1.00 0.00 ? 166 HIS A C    2  
ATOM   2339  O  O    . HIS A 1 11  ? -11.279 14.053  3.822   1.00 0.00 ? 166 HIS A O    2  
ATOM   2340  C  CB   . HIS A 1 11  ? -12.894 16.264  4.579   1.00 0.00 ? 166 HIS A CB   2  
ATOM   2341  C  CG   . HIS A 1 11  ? -14.021 17.228  4.831   1.00 0.00 ? 166 HIS A CG   2  
ATOM   2342  N  ND1  . HIS A 1 11  ? -14.391 18.191  3.906   1.00 0.00 ? 166 HIS A ND1  2  
ATOM   2343  C  CD2  . HIS A 1 11  ? -14.868 17.388  5.899   1.00 0.00 ? 166 HIS A CD2  2  
ATOM   2344  C  CE1  . HIS A 1 11  ? -15.420 18.882  4.430   1.00 0.00 ? 166 HIS A CE1  2  
ATOM   2345  N  NE2  . HIS A 1 11  ? -15.751 18.435  5.644   1.00 0.00 ? 166 HIS A NE2  2  
ATOM   2346  H  H    . HIS A 1 11  ? -14.174 13.936  4.793   1.00 0.00 ? 166 HIS A H    2  
ATOM   2347  H  HA   . HIS A 1 11  ? -13.641 15.909  2.592   1.00 0.00 ? 166 HIS A HA   2  
ATOM   2348  H  HB2  . HIS A 1 11  ? -12.714 15.679  5.468   1.00 0.00 ? 166 HIS A HB2  2  
ATOM   2349  H  HB3  . HIS A 1 11  ? -12.001 16.816  4.323   1.00 0.00 ? 166 HIS A HB3  2  
ATOM   2350  H  HD1  . HIS A 1 11  ? -13.978 18.342  3.030   1.00 0.00 ? 166 HIS A HD1  2  
ATOM   2351  H  HD2  . HIS A 1 11  ? -14.853 16.794  6.801   1.00 0.00 ? 166 HIS A HD2  2  
ATOM   2352  H  HE1  . HIS A 1 11  ? -15.918 19.700  3.930   1.00 0.00 ? 166 HIS A HE1  2  
ATOM   2353  N  N    . GLY A 1 12  ? -11.875 14.274  1.707   1.00 0.00 ? 167 GLY A N    2  
ATOM   2354  C  CA   . GLY A 1 12  ? -10.709 13.465  1.239   1.00 0.00 ? 167 GLY A CA   2  
ATOM   2355  C  C    . GLY A 1 12  ? -11.174 12.042  0.905   1.00 0.00 ? 167 GLY A C    2  
ATOM   2356  O  O    . GLY A 1 12  ? -12.182 11.582  1.409   1.00 0.00 ? 167 GLY A O    2  
ATOM   2357  H  H    . GLY A 1 12  ? -12.506 14.637  1.046   1.00 0.00 ? 167 GLY A H    2  
ATOM   2358  H  HA2  . GLY A 1 12  ? -10.284 13.925  0.358   1.00 0.00 ? 167 GLY A HA2  2  
ATOM   2359  H  HA3  . GLY A 1 12  ? -9.964  13.423  2.019   1.00 0.00 ? 167 GLY A HA3  2  
ATOM   2360  N  N    . ILE A 1 13  ? -10.452 11.334  0.057   1.00 0.00 ? 168 ILE A N    2  
ATOM   2361  C  CA   . ILE A 1 13  ? -10.864 9.943   -0.299  1.00 0.00 ? 168 ILE A CA   2  
ATOM   2362  C  C    . ILE A 1 13  ? -9.803  8.939   0.177   1.00 0.00 ? 168 ILE A C    2  
ATOM   2363  O  O    . ILE A 1 13  ? -8.634  9.265   0.270   1.00 0.00 ? 168 ILE A O    2  
ATOM   2364  C  CB   . ILE A 1 13  ? -10.969 9.935   -1.829  1.00 0.00 ? 168 ILE A CB   2  
ATOM   2365  C  CG1  . ILE A 1 13  ? -12.014 10.961  -2.277  1.00 0.00 ? 168 ILE A CG1  2  
ATOM   2366  C  CG2  . ILE A 1 13  ? -11.392 8.542   -2.312  1.00 0.00 ? 168 ILE A CG2  2  
ATOM   2367  C  CD1  . ILE A 1 13  ? -11.326 12.297  -2.568  1.00 0.00 ? 168 ILE A CD1  2  
ATOM   2368  H  H    . ILE A 1 13  ? -9.639  11.717  -0.343  1.00 0.00 ? 168 ILE A H    2  
ATOM   2369  H  HA   . ILE A 1 13  ? -11.821 9.708   0.137   1.00 0.00 ? 168 ILE A HA   2  
ATOM   2370  H  HB   . ILE A 1 13  ? -10.009 10.186  -2.257  1.00 0.00 ? 168 ILE A HB   2  
ATOM   2371  H  HG12 . ILE A 1 13  ? -12.507 10.607  -3.171  1.00 0.00 ? 168 ILE A HG12 2  
ATOM   2372  H  HG13 . ILE A 1 13  ? -12.743 11.098  -1.493  1.00 0.00 ? 168 ILE A HG13 2  
ATOM   2373  H  HG21 . ILE A 1 13  ? -11.327 8.500   -3.389  1.00 0.00 ? 168 ILE A HG21 2  
ATOM   2374  H  HG22 . ILE A 1 13  ? -12.408 8.348   -2.005  1.00 0.00 ? 168 ILE A HG22 2  
ATOM   2375  H  HG23 . ILE A 1 13  ? -10.737 7.798   -1.883  1.00 0.00 ? 168 ILE A HG23 2  
ATOM   2376  H  HD11 . ILE A 1 13  ? -11.875 12.824  -3.335  1.00 0.00 ? 168 ILE A HD11 2  
ATOM   2377  H  HD12 . ILE A 1 13  ? -10.317 12.116  -2.907  1.00 0.00 ? 168 ILE A HD12 2  
ATOM   2378  H  HD13 . ILE A 1 13  ? -11.302 12.893  -1.668  1.00 0.00 ? 168 ILE A HD13 2  
ATOM   2379  N  N    . VAL A 1 14  ? -10.199 7.718   0.469   1.00 0.00 ? 169 VAL A N    2  
ATOM   2380  C  CA   . VAL A 1 14  ? -9.201  6.698   0.928   1.00 0.00 ? 169 VAL A CA   2  
ATOM   2381  C  C    . VAL A 1 14  ? -8.894  5.716   -0.213  1.00 0.00 ? 169 VAL A C    2  
ATOM   2382  O  O    . VAL A 1 14  ? -9.758  5.402   -1.010  1.00 0.00 ? 169 VAL A O    2  
ATOM   2383  C  CB   . VAL A 1 14  ? -9.840  5.980   2.133   1.00 0.00 ? 169 VAL A CB   2  
ATOM   2384  C  CG1  . VAL A 1 14  ? -11.098 5.203   1.714   1.00 0.00 ? 169 VAL A CG1  2  
ATOM   2385  C  CG2  . VAL A 1 14  ? -8.825  5.004   2.735   1.00 0.00 ? 169 VAL A CG2  2  
ATOM   2386  H  H    . VAL A 1 14  ? -11.147 7.473   0.378   1.00 0.00 ? 169 VAL A H    2  
ATOM   2387  H  HA   . VAL A 1 14  ? -8.292  7.189   1.240   1.00 0.00 ? 169 VAL A HA   2  
ATOM   2388  H  HB   . VAL A 1 14  ? -10.111 6.714   2.878   1.00 0.00 ? 169 VAL A HB   2  
ATOM   2389  H  HG11 . VAL A 1 14  ? -11.331 4.464   2.466   1.00 0.00 ? 169 VAL A HG11 2  
ATOM   2390  H  HG12 . VAL A 1 14  ? -10.925 4.710   0.770   1.00 0.00 ? 169 VAL A HG12 2  
ATOM   2391  H  HG13 . VAL A 1 14  ? -11.928 5.887   1.616   1.00 0.00 ? 169 VAL A HG13 2  
ATOM   2392  H  HG21 . VAL A 1 14  ? -8.921  5.003   3.810   1.00 0.00 ? 169 VAL A HG21 2  
ATOM   2393  H  HG22 . VAL A 1 14  ? -7.825  5.309   2.464   1.00 0.00 ? 169 VAL A HG22 2  
ATOM   2394  H  HG23 . VAL A 1 14  ? -9.011  4.008   2.357   1.00 0.00 ? 169 VAL A HG23 2  
ATOM   2395  N  N    . SER A 1 15  ? -7.670  5.235   -0.309  1.00 0.00 ? 170 SER A N    2  
ATOM   2396  C  CA   . SER A 1 15  ? -7.332  4.285   -1.410  1.00 0.00 ? 170 SER A CA   2  
ATOM   2397  C  C    . SER A 1 15  ? -6.253  3.288   -0.968  1.00 0.00 ? 170 SER A C    2  
ATOM   2398  O  O    . SER A 1 15  ? -5.417  3.597   -0.141  1.00 0.00 ? 170 SER A O    2  
ATOM   2399  C  CB   . SER A 1 15  ? -6.813  5.167   -2.545  1.00 0.00 ? 170 SER A CB   2  
ATOM   2400  O  OG   . SER A 1 15  ? -6.113  6.276   -1.996  1.00 0.00 ? 170 SER A OG   2  
ATOM   2401  H  H    . SER A 1 15  ? -6.977  5.501   0.336   1.00 0.00 ? 170 SER A H    2  
ATOM   2402  H  HA   . SER A 1 15  ? -8.212  3.758   -1.732  1.00 0.00 ? 170 SER A HA   2  
ATOM   2403  H  HB2  . SER A 1 15  ? -6.142  4.598   -3.167  1.00 0.00 ? 170 SER A HB2  2  
ATOM   2404  H  HB3  . SER A 1 15  ? -7.647  5.514   -3.141  1.00 0.00 ? 170 SER A HB3  2  
ATOM   2405  H  HG   . SER A 1 15  ? -5.263  5.962   -1.680  1.00 0.00 ? 170 SER A HG   2  
ATOM   2406  N  N    . CYS A 1 16  ? -6.260  2.094   -1.527  1.00 0.00 ? 171 CYS A N    2  
ATOM   2407  C  CA   . CYS A 1 16  ? -5.219  1.083   -1.142  1.00 0.00 ? 171 CYS A CA   2  
ATOM   2408  C  C    . CYS A 1 16  ? -4.056  1.129   -2.144  1.00 0.00 ? 171 CYS A C    2  
ATOM   2409  O  O    . CYS A 1 16  ? -4.269  1.276   -3.335  1.00 0.00 ? 171 CYS A O    2  
ATOM   2410  C  CB   . CYS A 1 16  ? -5.908  -0.285  -1.195  1.00 0.00 ? 171 CYS A CB   2  
ATOM   2411  S  SG   . CYS A 1 16  ? -4.786  -1.543  -0.539  1.00 0.00 ? 171 CYS A SG   2  
ATOM   2412  H  H    . CYS A 1 16  ? -6.942  1.869   -2.205  1.00 0.00 ? 171 CYS A H    2  
ATOM   2413  H  HA   . CYS A 1 16  ? -4.860  1.275   -0.141  1.00 0.00 ? 171 CYS A HA   2  
ATOM   2414  H  HB2  . CYS A 1 16  ? -6.810  -0.260  -0.603  1.00 0.00 ? 171 CYS A HB2  2  
ATOM   2415  H  HB3  . CYS A 1 16  ? -6.153  -0.521  -2.218  1.00 0.00 ? 171 CYS A HB3  2  
ATOM   2416  N  N    . THR A 1 17  ? -2.830  1.002   -1.675  1.00 0.00 ? 172 THR A N    2  
ATOM   2417  C  CA   . THR A 1 17  ? -1.660  1.041   -2.621  1.00 0.00 ? 172 THR A CA   2  
ATOM   2418  C  C    . THR A 1 17  ? -1.435  -0.342  -3.262  1.00 0.00 ? 172 THR A C    2  
ATOM   2419  O  O    . THR A 1 17  ? -1.094  -0.436  -4.426  1.00 0.00 ? 172 THR A O    2  
ATOM   2420  C  CB   . THR A 1 17  ? -0.430  1.478   -1.787  1.00 0.00 ? 172 THR A CB   2  
ATOM   2421  O  OG1  . THR A 1 17  ? 0.647   1.771   -2.666  1.00 0.00 ? 172 THR A OG1  2  
ATOM   2422  C  CG2  . THR A 1 17  ? 0.001   0.369   -0.809  1.00 0.00 ? 172 THR A CG2  2  
ATOM   2423  H  H    . THR A 1 17  ? -2.685  0.880   -0.708  1.00 0.00 ? 172 THR A H    2  
ATOM   2424  H  HA   . THR A 1 17  ? -1.845  1.771   -3.393  1.00 0.00 ? 172 THR A HA   2  
ATOM   2425  H  HB   . THR A 1 17  ? -0.680  2.366   -1.226  1.00 0.00 ? 172 THR A HB   2  
ATOM   2426  H  HG1  . THR A 1 17  ? 0.445   2.592   -3.122  1.00 0.00 ? 172 THR A HG1  2  
ATOM   2427  H  HG21 . THR A 1 17  ? 0.200   -0.537  -1.360  1.00 0.00 ? 172 THR A HG21 2  
ATOM   2428  H  HG22 . THR A 1 17  ? -0.783  0.189   -0.092  1.00 0.00 ? 172 THR A HG22 2  
ATOM   2429  H  HG23 . THR A 1 17  ? 0.896   0.674   -0.290  1.00 0.00 ? 172 THR A HG23 2  
ATOM   2430  N  N    . ALA A 1 18  ? -1.624  -1.414  -2.518  1.00 0.00 ? 173 ALA A N    2  
ATOM   2431  C  CA   . ALA A 1 18  ? -1.417  -2.781  -3.116  1.00 0.00 ? 173 ALA A CA   2  
ATOM   2432  C  C    . ALA A 1 18  ? -2.538  -3.103  -4.125  1.00 0.00 ? 173 ALA A C    2  
ATOM   2433  O  O    . ALA A 1 18  ? -2.321  -3.831  -5.077  1.00 0.00 ? 173 ALA A O    2  
ATOM   2434  C  CB   . ALA A 1 18  ? -1.430  -3.776  -1.944  1.00 0.00 ? 173 ALA A CB   2  
ATOM   2435  H  H    . ALA A 1 18  ? -1.905  -1.319  -1.578  1.00 0.00 ? 173 ALA A H    2  
ATOM   2436  H  HA   . ALA A 1 18  ? -0.462  -2.818  -3.613  1.00 0.00 ? 173 ALA A HA   2  
ATOM   2437  H  HB1  . ALA A 1 18  ? -0.446  -3.814  -1.495  1.00 0.00 ? 173 ALA A HB1  2  
ATOM   2438  H  HB2  . ALA A 1 18  ? -1.700  -4.758  -2.304  1.00 0.00 ? 173 ALA A HB2  2  
ATOM   2439  H  HB3  . ALA A 1 18  ? -2.148  -3.452  -1.206  1.00 0.00 ? 173 ALA A HB3  2  
ATOM   2440  N  N    . CYS A 1 19  ? -3.730  -2.567  -3.939  1.00 0.00 ? 174 CYS A N    2  
ATOM   2441  C  CA   . CYS A 1 19  ? -4.841  -2.847  -4.905  1.00 0.00 ? 174 CYS A CA   2  
ATOM   2442  C  C    . CYS A 1 19  ? -4.946  -1.725  -5.950  1.00 0.00 ? 174 CYS A C    2  
ATOM   2443  O  O    . CYS A 1 19  ? -5.256  -1.977  -7.100  1.00 0.00 ? 174 CYS A O    2  
ATOM   2444  C  CB   . CYS A 1 19  ? -6.123  -2.906  -4.065  1.00 0.00 ? 174 CYS A CB   2  
ATOM   2445  S  SG   . CYS A 1 19  ? -6.040  -4.303  -2.918  1.00 0.00 ? 174 CYS A SG   2  
ATOM   2446  H  H    . CYS A 1 19  ? -3.894  -1.978  -3.174  1.00 0.00 ? 174 CYS A H    2  
ATOM   2447  H  HA   . CYS A 1 19  ? -4.681  -3.789  -5.392  1.00 0.00 ? 174 CYS A HA   2  
ATOM   2448  H  HB2  . CYS A 1 19  ? -6.228  -1.990  -3.508  1.00 0.00 ? 174 CYS A HB2  2  
ATOM   2449  H  HB3  . CYS A 1 19  ? -6.970  -3.025  -4.716  1.00 0.00 ? 174 CYS A HB3  2  
ATOM   2450  N  N    . GLY A 1 20  ? -4.707  -0.488  -5.564  1.00 0.00 ? 175 GLY A N    2  
ATOM   2451  C  CA   . GLY A 1 20  ? -4.813  0.635   -6.539  1.00 0.00 ? 175 GLY A CA   2  
ATOM   2452  C  C    . GLY A 1 20  ? -6.287  1.040   -6.673  1.00 0.00 ? 175 GLY A C    2  
ATOM   2453  O  O    . GLY A 1 20  ? -6.755  1.326   -7.759  1.00 0.00 ? 175 GLY A O    2  
ATOM   2454  H  H    . GLY A 1 20  ? -4.471  -0.294  -4.635  1.00 0.00 ? 175 GLY A H    2  
ATOM   2455  H  HA2  . GLY A 1 20  ? -4.235  1.477   -6.184  1.00 0.00 ? 175 GLY A HA2  2  
ATOM   2456  H  HA3  . GLY A 1 20  ? -4.441  0.317   -7.501  1.00 0.00 ? 175 GLY A HA3  2  
ATOM   2457  N  N    . GLN A 1 21  ? -7.030  1.062   -5.580  1.00 0.00 ? 176 GLN A N    2  
ATOM   2458  C  CA   . GLN A 1 21  ? -8.478  1.443   -5.670  1.00 0.00 ? 176 GLN A CA   2  
ATOM   2459  C  C    . GLN A 1 21  ? -9.042  1.806   -4.284  1.00 0.00 ? 176 GLN A C    2  
ATOM   2460  O  O    . GLN A 1 21  ? -8.519  1.388   -3.268  1.00 0.00 ? 176 GLN A O    2  
ATOM   2461  C  CB   . GLN A 1 21  ? -9.181  0.196   -6.222  1.00 0.00 ? 176 GLN A CB   2  
ATOM   2462  C  CG   . GLN A 1 21  ? -9.580  0.427   -7.684  1.00 0.00 ? 176 GLN A CG   2  
ATOM   2463  C  CD   . GLN A 1 21  ? -11.055 0.842   -7.759  1.00 0.00 ? 176 GLN A CD   2  
ATOM   2464  O  OE1  . GLN A 1 21  ? -11.495 1.684   -7.002  1.00 0.00 ? 176 GLN A OE1  2  
ATOM   2465  N  NE2  . GLN A 1 21  ? -11.847 0.286   -8.644  1.00 0.00 ? 176 GLN A NE2  2  
ATOM   2466  H  H    . GLN A 1 21  ? -6.637  0.822   -4.706  1.00 0.00 ? 176 GLN A H    2  
ATOM   2467  H  HA   . GLN A 1 21  ? -8.609  2.270   -6.349  1.00 0.00 ? 176 GLN A HA   2  
ATOM   2468  H  HB2  . GLN A 1 21  ? -8.513  -0.650  -6.161  1.00 0.00 ? 176 GLN A HB2  2  
ATOM   2469  H  HB3  . GLN A 1 21  ? -10.068 -0.006  -5.638  1.00 0.00 ? 176 GLN A HB3  2  
ATOM   2470  H  HG2  . GLN A 1 21  ? -8.964  1.208   -8.106  1.00 0.00 ? 176 GLN A HG2  2  
ATOM   2471  H  HG3  . GLN A 1 21  ? -9.437  -0.486  -8.244  1.00 0.00 ? 176 GLN A HG3  2  
ATOM   2472  H  HE21 . GLN A 1 21  ? -11.503 -0.396  -9.261  1.00 0.00 ? 176 GLN A HE21 2  
ATOM   2473  H  HE22 . GLN A 1 21  ? -12.789 0.553   -8.689  1.00 0.00 ? 176 GLN A HE22 2  
ATOM   2474  N  N    . GLN A 1 22  ? -10.105 2.584   -4.238  1.00 0.00 ? 177 GLN A N    2  
ATOM   2475  C  CA   . GLN A 1 22  ? -10.701 2.974   -2.906  1.00 0.00 ? 177 GLN A CA   2  
ATOM   2476  C  C    . GLN A 1 22  ? -10.996 1.727   -2.056  1.00 0.00 ? 177 GLN A C    2  
ATOM   2477  O  O    . GLN A 1 22  ? -11.180 0.645   -2.580  1.00 0.00 ? 177 GLN A O    2  
ATOM   2478  C  CB   . GLN A 1 22  ? -12.010 3.720   -3.209  1.00 0.00 ? 177 GLN A CB   2  
ATOM   2479  C  CG   . GLN A 1 22  ? -12.605 4.261   -1.908  1.00 0.00 ? 177 GLN A CG   2  
ATOM   2480  C  CD   . GLN A 1 22  ? -13.919 4.991   -2.210  1.00 0.00 ? 177 GLN A CD   2  
ATOM   2481  O  OE1  . GLN A 1 22  ? -14.593 4.671   -3.170  1.00 0.00 ? 177 GLN A OE1  2  
ATOM   2482  N  NE2  . GLN A 1 22  ? -14.320 5.965   -1.429  1.00 0.00 ? 177 GLN A NE2  2  
ATOM   2483  H  H    . GLN A 1 22  ? -10.506 2.913   -5.080  1.00 0.00 ? 177 GLN A H    2  
ATOM   2484  H  HA   . GLN A 1 22  ? -10.028 3.623   -2.374  1.00 0.00 ? 177 GLN A HA   2  
ATOM   2485  H  HB2  . GLN A 1 22  ? -11.807 4.542   -3.881  1.00 0.00 ? 177 GLN A HB2  2  
ATOM   2486  H  HB3  . GLN A 1 22  ? -12.713 3.043   -3.671  1.00 0.00 ? 177 GLN A HB3  2  
ATOM   2487  H  HG2  . GLN A 1 22  ? -12.795 3.439   -1.231  1.00 0.00 ? 177 GLN A HG2  2  
ATOM   2488  H  HG3  . GLN A 1 22  ? -11.910 4.950   -1.453  1.00 0.00 ? 177 GLN A HG3  2  
ATOM   2489  H  HE21 . GLN A 1 22  ? -13.785 6.231   -0.651  1.00 0.00 ? 177 GLN A HE21 2  
ATOM   2490  H  HE22 . GLN A 1 22  ? -15.161 6.430   -1.625  1.00 0.00 ? 177 GLN A HE22 2  
ATOM   2491  N  N    . VAL A 1 23  ? -11.047 1.873   -0.747  1.00 0.00 ? 178 VAL A N    2  
ATOM   2492  C  CA   . VAL A 1 23  ? -11.338 0.684   0.126   1.00 0.00 ? 178 VAL A CA   2  
ATOM   2493  C  C    . VAL A 1 23  ? -12.858 0.537   0.312   1.00 0.00 ? 178 VAL A C    2  
ATOM   2494  O  O    . VAL A 1 23  ? -13.601 1.473   0.086   1.00 0.00 ? 178 VAL A O    2  
ATOM   2495  C  CB   . VAL A 1 23  ? -10.649 0.956   1.476   1.00 0.00 ? 178 VAL A CB   2  
ATOM   2496  C  CG1  . VAL A 1 23  ? -10.864 -0.235  2.411   1.00 0.00 ? 178 VAL A CG1  2  
ATOM   2497  C  CG2  . VAL A 1 23  ? -9.145  1.160   1.251   1.00 0.00 ? 178 VAL A CG2  2  
ATOM   2498  H  H    . VAL A 1 23  ? -10.902 2.762   -0.344  1.00 0.00 ? 178 VAL A H    2  
ATOM   2499  H  HA   . VAL A 1 23  ? -10.931 -0.210  -0.319  1.00 0.00 ? 178 VAL A HA   2  
ATOM   2500  H  HB   . VAL A 1 23  ? -11.070 1.843   1.925   1.00 0.00 ? 178 VAL A HB   2  
ATOM   2501  H  HG11 . VAL A 1 23  ? -11.856 -0.184  2.836   1.00 0.00 ? 178 VAL A HG11 2  
ATOM   2502  H  HG12 . VAL A 1 23  ? -10.131 -0.209  3.203   1.00 0.00 ? 178 VAL A HG12 2  
ATOM   2503  H  HG13 . VAL A 1 23  ? -10.759 -1.154  1.854   1.00 0.00 ? 178 VAL A HG13 2  
ATOM   2504  H  HG21 . VAL A 1 23  ? -8.620  0.238   1.455   1.00 0.00 ? 178 VAL A HG21 2  
ATOM   2505  H  HG22 . VAL A 1 23  ? -8.784  1.933   1.914   1.00 0.00 ? 178 VAL A HG22 2  
ATOM   2506  H  HG23 . VAL A 1 23  ? -8.968  1.455   0.228   1.00 0.00 ? 178 VAL A HG23 2  
ATOM   2507  N  N    . ASN A 1 24  ? -13.331 -0.632  0.706   1.00 0.00 ? 179 ASN A N    2  
ATOM   2508  C  CA   . ASN A 1 24  ? -14.821 -0.821  0.886   1.00 0.00 ? 179 ASN A CA   2  
ATOM   2509  C  C    . ASN A 1 24  ? -15.406 0.270   1.801   1.00 0.00 ? 179 ASN A C    2  
ATOM   2510  O  O    . ASN A 1 24  ? -15.408 0.134   3.009   1.00 0.00 ? 179 ASN A O    2  
ATOM   2511  C  CB   . ASN A 1 24  ? -15.014 -2.203  1.532   1.00 0.00 ? 179 ASN A CB   2  
ATOM   2512  C  CG   . ASN A 1 24  ? -16.498 -2.587  1.486   1.00 0.00 ? 179 ASN A CG   2  
ATOM   2513  O  OD1  . ASN A 1 24  ? -17.010 -2.931  0.438   1.00 0.00 ? 179 ASN A OD1  2  
ATOM   2514  N  ND2  . ASN A 1 24  ? -17.219 -2.545  2.578   1.00 0.00 ? 179 ASN A ND2  2  
ATOM   2515  H  H    . ASN A 1 24  ? -12.710 -1.381  0.870   1.00 0.00 ? 179 ASN A H    2  
ATOM   2516  H  HA   . ASN A 1 24  ? -15.313 -0.799  -0.075  1.00 0.00 ? 179 ASN A HA   2  
ATOM   2517  H  HB2  . ASN A 1 24  ? -14.433 -2.937  0.992   1.00 0.00 ? 179 ASN A HB2  2  
ATOM   2518  H  HB3  . ASN A 1 24  ? -14.686 -2.168  2.561   1.00 0.00 ? 179 ASN A HB3  2  
ATOM   2519  H  HD21 . ASN A 1 24  ? -16.817 -2.268  3.431   1.00 0.00 ? 179 ASN A HD21 2  
ATOM   2520  H  HD22 . ASN A 1 24  ? -18.168 -2.792  2.546   1.00 0.00 ? 179 ASN A HD22 2  
ATOM   2521  N  N    . HIS A 1 25  ? -15.910 1.353   1.236   1.00 0.00 ? 180 HIS A N    2  
ATOM   2522  C  CA   . HIS A 1 25  ? -16.501 2.450   2.073   1.00 0.00 ? 180 HIS A CA   2  
ATOM   2523  C  C    . HIS A 1 25  ? -15.532 2.875   3.193   1.00 0.00 ? 180 HIS A C    2  
ATOM   2524  O  O    . HIS A 1 25  ? -14.412 2.405   3.257   1.00 0.00 ? 180 HIS A O    2  
ATOM   2525  C  CB   . HIS A 1 25  ? -17.779 1.854   2.670   1.00 0.00 ? 180 HIS A CB   2  
ATOM   2526  C  CG   . HIS A 1 25  ? -18.946 2.165   1.773   1.00 0.00 ? 180 HIS A CG   2  
ATOM   2527  N  ND1  . HIS A 1 25  ? -19.611 3.380   1.819   1.00 0.00 ? 180 HIS A ND1  2  
ATOM   2528  C  CD2  . HIS A 1 25  ? -19.578 1.429   0.801   1.00 0.00 ? 180 HIS A CD2  2  
ATOM   2529  C  CE1  . HIS A 1 25  ? -20.594 3.340   0.901   1.00 0.00 ? 180 HIS A CE1  2  
ATOM   2530  N  NE2  . HIS A 1 25  ? -20.618 2.172   0.252   1.00 0.00 ? 180 HIS A NE2  2  
ATOM   2531  H  H    . HIS A 1 25  ? -15.905 1.447   0.257   1.00 0.00 ? 180 HIS A H    2  
ATOM   2532  H  HA   . HIS A 1 25  ? -16.748 3.298   1.454   1.00 0.00 ? 180 HIS A HA   2  
ATOM   2533  H  HB2  . HIS A 1 25  ? -17.669 0.783   2.759   1.00 0.00 ? 180 HIS A HB2  2  
ATOM   2534  H  HB3  . HIS A 1 25  ? -17.953 2.279   3.646   1.00 0.00 ? 180 HIS A HB3  2  
ATOM   2535  H  HD1  . HIS A 1 25  ? -19.404 4.131   2.413   1.00 0.00 ? 180 HIS A HD1  2  
ATOM   2536  H  HD2  . HIS A 1 25  ? -19.309 0.425   0.506   1.00 0.00 ? 180 HIS A HD2  2  
ATOM   2537  H  HE1  . HIS A 1 25  ? -21.280 4.151   0.712   1.00 0.00 ? 180 HIS A HE1  2  
ATOM   2538  N  N    . PHE A 1 26  ? -15.956 3.757   4.075   1.00 0.00 ? 181 PHE A N    2  
ATOM   2539  C  CA   . PHE A 1 26  ? -15.057 4.201   5.184   1.00 0.00 ? 181 PHE A CA   2  
ATOM   2540  C  C    . PHE A 1 26  ? -15.637 3.746   6.534   1.00 0.00 ? 181 PHE A C    2  
ATOM   2541  O  O    . PHE A 1 26  ? -16.545 4.361   7.061   1.00 0.00 ? 181 PHE A O    2  
ATOM   2542  C  CB   . PHE A 1 26  ? -15.029 5.732   5.083   1.00 0.00 ? 181 PHE A CB   2  
ATOM   2543  C  CG   . PHE A 1 26  ? -14.205 6.321   6.211   1.00 0.00 ? 181 PHE A CG   2  
ATOM   2544  C  CD1  . PHE A 1 26  ? -12.924 5.823   6.492   1.00 0.00 ? 181 PHE A CD1  2  
ATOM   2545  C  CD2  . PHE A 1 26  ? -14.726 7.375   6.973   1.00 0.00 ? 181 PHE A CD2  2  
ATOM   2546  C  CE1  . PHE A 1 26  ? -12.170 6.377   7.534   1.00 0.00 ? 181 PHE A CE1  2  
ATOM   2547  C  CE2  . PHE A 1 26  ? -13.972 7.928   8.013   1.00 0.00 ? 181 PHE A CE2  2  
ATOM   2548  C  CZ   . PHE A 1 26  ? -12.694 7.429   8.293   1.00 0.00 ? 181 PHE A CZ   2  
ATOM   2549  H  H    . PHE A 1 26  ? -16.865 4.126   4.012   1.00 0.00 ? 181 PHE A H    2  
ATOM   2550  H  HA   . PHE A 1 26  ? -14.065 3.802   5.046   1.00 0.00 ? 181 PHE A HA   2  
ATOM   2551  H  HB2  . PHE A 1 26  ? -14.594 6.019   4.137   1.00 0.00 ? 181 PHE A HB2  2  
ATOM   2552  H  HB3  . PHE A 1 26  ? -16.038 6.113   5.143   1.00 0.00 ? 181 PHE A HB3  2  
ATOM   2553  H  HD1  . PHE A 1 26  ? -12.518 5.010   5.908   1.00 0.00 ? 181 PHE A HD1  2  
ATOM   2554  H  HD2  . PHE A 1 26  ? -15.711 7.760   6.757   1.00 0.00 ? 181 PHE A HD2  2  
ATOM   2555  H  HE1  . PHE A 1 26  ? -11.185 5.993   7.750   1.00 0.00 ? 181 PHE A HE1  2  
ATOM   2556  H  HE2  . PHE A 1 26  ? -14.375 8.740   8.600   1.00 0.00 ? 181 PHE A HE2  2  
ATOM   2557  H  HZ   . PHE A 1 26  ? -12.113 7.857   9.096   1.00 0.00 ? 181 PHE A HZ   2  
ATOM   2558  N  N    . GLN A 1 27  ? -15.120 2.674   7.099   1.00 0.00 ? 182 GLN A N    2  
ATOM   2559  C  CA   . GLN A 1 27  ? -15.646 2.190   8.413   1.00 0.00 ? 182 GLN A CA   2  
ATOM   2560  C  C    . GLN A 1 27  ? -14.590 2.398   9.511   1.00 0.00 ? 182 GLN A C    2  
ATOM   2561  O  O    . GLN A 1 27  ? -13.405 2.403   9.242   1.00 0.00 ? 182 GLN A O    2  
ATOM   2562  C  CB   . GLN A 1 27  ? -15.932 0.701   8.206   1.00 0.00 ? 182 GLN A CB   2  
ATOM   2563  C  CG   . GLN A 1 27  ? -16.596 0.120   9.457   1.00 0.00 ? 182 GLN A CG   2  
ATOM   2564  C  CD   . GLN A 1 27  ? -17.700 -0.864  9.048   1.00 0.00 ? 182 GLN A CD   2  
ATOM   2565  O  OE1  . GLN A 1 27  ? -17.426 -2.016  8.780   1.00 0.00 ? 182 GLN A OE1  2  
ATOM   2566  N  NE2  . GLN A 1 27  ? -18.946 -0.460  8.985   1.00 0.00 ? 182 GLN A NE2  2  
ATOM   2567  H  H    . GLN A 1 27  ? -14.384 2.189   6.662   1.00 0.00 ? 182 GLN A H    2  
ATOM   2568  H  HA   . GLN A 1 27  ? -16.557 2.709   8.664   1.00 0.00 ? 182 GLN A HA   2  
ATOM   2569  H  HB2  . GLN A 1 27  ? -16.588 0.578   7.357   1.00 0.00 ? 182 GLN A HB2  2  
ATOM   2570  H  HB3  . GLN A 1 27  ? -15.006 0.182   8.022   1.00 0.00 ? 182 GLN A HB3  2  
ATOM   2571  H  HG2  . GLN A 1 27  ? -15.853 -0.398  10.046  1.00 0.00 ? 182 GLN A HG2  2  
ATOM   2572  H  HG3  . GLN A 1 27  ? -17.027 0.918   10.043  1.00 0.00 ? 182 GLN A HG3  2  
ATOM   2573  H  HE21 . GLN A 1 27  ? -19.179 0.470   9.199   1.00 0.00 ? 182 GLN A HE21 2  
ATOM   2574  H  HE22 . GLN A 1 27  ? -19.648 -1.090  8.723   1.00 0.00 ? 182 GLN A HE22 2  
ATOM   2575  N  N    . LYS A 1 28  ? -15.010 2.583   10.748  1.00 0.00 ? 183 LYS A N    2  
ATOM   2576  C  CA   . LYS A 1 28  ? -14.009 2.807   11.857  1.00 0.00 ? 183 LYS A CA   2  
ATOM   2577  C  C    . LYS A 1 28  ? -12.927 1.707   11.891  1.00 0.00 ? 183 LYS A C    2  
ATOM   2578  O  O    . LYS A 1 28  ? -11.821 1.949   12.337  1.00 0.00 ? 183 LYS A O    2  
ATOM   2579  C  CB   . LYS A 1 28  ? -14.803 2.804   13.178  1.00 0.00 ? 183 LYS A CB   2  
ATOM   2580  C  CG   . LYS A 1 28  ? -15.518 1.461   13.357  1.00 0.00 ? 183 LYS A CG   2  
ATOM   2581  C  CD   . LYS A 1 28  ? -16.855 1.685   14.066  1.00 0.00 ? 183 LYS A CD   2  
ATOM   2582  C  CE   . LYS A 1 28  ? -17.640 0.372   14.104  1.00 0.00 ? 183 LYS A CE   2  
ATOM   2583  N  NZ   . LYS A 1 28  ? -18.378 0.327   12.810  1.00 0.00 ? 183 LYS A NZ   2  
ATOM   2584  H  H    . LYS A 1 28  ? -15.978 2.589   10.941  1.00 0.00 ? 183 LYS A H    2  
ATOM   2585  H  HA   . LYS A 1 28  ? -13.542 3.766   11.729  1.00 0.00 ? 183 LYS A HA   2  
ATOM   2586  H  HB2  . LYS A 1 28  ? -14.122 2.962   14.003  1.00 0.00 ? 183 LYS A HB2  2  
ATOM   2587  H  HB3  . LYS A 1 28  ? -15.533 3.600   13.158  1.00 0.00 ? 183 LYS A HB3  2  
ATOM   2588  H  HG2  . LYS A 1 28  ? -15.694 1.014   12.390  1.00 0.00 ? 183 LYS A HG2  2  
ATOM   2589  H  HG3  . LYS A 1 28  ? -14.904 0.803   13.953  1.00 0.00 ? 183 LYS A HG3  2  
ATOM   2590  H  HD2  . LYS A 1 28  ? -16.675 2.028   15.074  1.00 0.00 ? 183 LYS A HD2  2  
ATOM   2591  H  HD3  . LYS A 1 28  ? -17.428 2.429   13.530  1.00 0.00 ? 183 LYS A HD3  2  
ATOM   2592  H  HE2  . LYS A 1 28  ? -16.962 -0.467  14.183  1.00 0.00 ? 183 LYS A HE2  2  
ATOM   2593  H  HE3  . LYS A 1 28  ? -18.337 0.374   14.927  1.00 0.00 ? 183 LYS A HE3  2  
ATOM   2594  H  HZ1  . LYS A 1 28  ? -17.706 0.426   12.024  1.00 0.00 ? 183 LYS A HZ1  2  
ATOM   2595  H  HZ2  . LYS A 1 28  ? -19.067 1.106   12.778  1.00 0.00 ? 183 LYS A HZ2  2  
ATOM   2596  H  HZ3  . LYS A 1 28  ? -18.876 -0.582  12.726  1.00 0.00 ? 183 LYS A HZ3  2  
ATOM   2597  N  N    . ASP A 1 29  ? -13.223 0.504   11.443  1.00 0.00 ? 184 ASP A N    2  
ATOM   2598  C  CA   . ASP A 1 29  ? -12.190 -0.578  11.484  1.00 0.00 ? 184 ASP A CA   2  
ATOM   2599  C  C    . ASP A 1 29  ? -12.064 -1.296  10.130  1.00 0.00 ? 184 ASP A C    2  
ATOM   2600  O  O    . ASP A 1 29  ? -11.811 -2.486  10.087  1.00 0.00 ? 184 ASP A O    2  
ATOM   2601  C  CB   . ASP A 1 29  ? -12.684 -1.550  12.556  1.00 0.00 ? 184 ASP A CB   2  
ATOM   2602  C  CG   . ASP A 1 29  ? -11.559 -2.518  12.926  1.00 0.00 ? 184 ASP A CG   2  
ATOM   2603  O  OD1  . ASP A 1 29  ? -10.550 -2.056  13.433  1.00 0.00 ? 184 ASP A OD1  2  
ATOM   2604  O  OD2  . ASP A 1 29  ? -11.725 -3.704  12.695  1.00 0.00 ? 184 ASP A OD2  2  
ATOM   2605  H  H    . ASP A 1 29  ? -14.114 0.308   11.095  1.00 0.00 ? 184 ASP A H    2  
ATOM   2606  H  HA   . ASP A 1 29  ? -11.236 -0.170  11.777  1.00 0.00 ? 184 ASP A HA   2  
ATOM   2607  H  HB2  . ASP A 1 29  ? -12.986 -0.995  13.433  1.00 0.00 ? 184 ASP A HB2  2  
ATOM   2608  H  HB3  . ASP A 1 29  ? -13.526 -2.109  12.176  1.00 0.00 ? 184 ASP A HB3  2  
ATOM   2609  N  N    . SER A 1 30  ? -12.213 -0.594  9.024   1.00 0.00 ? 185 SER A N    2  
ATOM   2610  C  CA   . SER A 1 30  ? -12.067 -1.275  7.692   1.00 0.00 ? 185 SER A CA   2  
ATOM   2611  C  C    . SER A 1 30  ? -10.618 -1.136  7.199   1.00 0.00 ? 185 SER A C    2  
ATOM   2612  O  O    . SER A 1 30  ? -9.893  -2.105  7.147   1.00 0.00 ? 185 SER A O    2  
ATOM   2613  C  CB   . SER A 1 30  ? -13.036 -0.574  6.734   1.00 0.00 ? 185 SER A CB   2  
ATOM   2614  O  OG   . SER A 1 30  ? -12.546 -0.691  5.403   1.00 0.00 ? 185 SER A OG   2  
ATOM   2615  H  H    . SER A 1 30  ? -12.400 0.372   9.069   1.00 0.00 ? 185 SER A H    2  
ATOM   2616  H  HA   . SER A 1 30  ? -12.329 -2.319  7.780   1.00 0.00 ? 185 SER A HA   2  
ATOM   2617  H  HB2  . SER A 1 30  ? -14.006 -1.037  6.795   1.00 0.00 ? 185 SER A HB2  2  
ATOM   2618  H  HB3  . SER A 1 30  ? -13.119 0.468   7.008   1.00 0.00 ? 185 SER A HB3  2  
ATOM   2619  H  HG   . SER A 1 30  ? -13.231 -0.378  4.808   1.00 0.00 ? 185 SER A HG   2  
ATOM   2620  N  N    . ILE A 1 31  ? -10.187 0.059   6.832   1.00 0.00 ? 186 ILE A N    2  
ATOM   2621  C  CA   . ILE A 1 31  ? -8.765  0.235   6.338   1.00 0.00 ? 186 ILE A CA   2  
ATOM   2622  C  C    . ILE A 1 31  ? -7.749  -0.402  7.304   1.00 0.00 ? 186 ILE A C    2  
ATOM   2623  O  O    . ILE A 1 31  ? -8.034  -0.613  8.466   1.00 0.00 ? 186 ILE A O    2  
ATOM   2624  C  CB   . ILE A 1 31  ? -8.498  1.749   6.248   1.00 0.00 ? 186 ILE A CB   2  
ATOM   2625  C  CG1  . ILE A 1 31  ? -8.751  2.409   7.611   1.00 0.00 ? 186 ILE A CG1  2  
ATOM   2626  C  CG2  . ILE A 1 31  ? -9.411  2.376   5.195   1.00 0.00 ? 186 ILE A CG2  2  
ATOM   2627  C  CD1  . ILE A 1 31  ? -8.312  3.871   7.559   1.00 0.00 ? 186 ILE A CD1  2  
ATOM   2628  H  H    . ILE A 1 31  ? -10.797 0.829   6.872   1.00 0.00 ? 186 ILE A H    2  
ATOM   2629  H  HA   . ILE A 1 31  ? -8.655  -0.208  5.361   1.00 0.00 ? 186 ILE A HA   2  
ATOM   2630  H  HB   . ILE A 1 31  ? -7.469  1.910   5.961   1.00 0.00 ? 186 ILE A HB   2  
ATOM   2631  H  HG12 . ILE A 1 31  ? -9.802  2.364   7.852   1.00 0.00 ? 186 ILE A HG12 2  
ATOM   2632  H  HG13 . ILE A 1 31  ? -8.186  1.893   8.372   1.00 0.00 ? 186 ILE A HG13 2  
ATOM   2633  H  HG21 . ILE A 1 31  ? -9.496  1.707   4.351   1.00 0.00 ? 186 ILE A HG21 2  
ATOM   2634  H  HG22 . ILE A 1 31  ? -8.990  3.317   4.870   1.00 0.00 ? 186 ILE A HG22 2  
ATOM   2635  H  HG23 . ILE A 1 31  ? -10.388 2.547   5.620   1.00 0.00 ? 186 ILE A HG23 2  
ATOM   2636  H  HD11 . ILE A 1 31  ? -8.060  4.205   8.555   1.00 0.00 ? 186 ILE A HD11 2  
ATOM   2637  H  HD12 . ILE A 1 31  ? -9.118  4.476   7.169   1.00 0.00 ? 186 ILE A HD12 2  
ATOM   2638  H  HD13 . ILE A 1 31  ? -7.448  3.964   6.918   1.00 0.00 ? 186 ILE A HD13 2  
ATOM   2639  N  N    . TYR A 1 32  ? -6.562  -0.703  6.819   1.00 0.00 ? 187 TYR A N    2  
ATOM   2640  C  CA   . TYR A 1 32  ? -5.518  -1.321  7.692   1.00 0.00 ? 187 TYR A CA   2  
ATOM   2641  C  C    . TYR A 1 32  ? -4.146  -0.722  7.380   1.00 0.00 ? 187 TYR A C    2  
ATOM   2642  O  O    . TYR A 1 32  ? -3.979  -0.008  6.408   1.00 0.00 ? 187 TYR A O    2  
ATOM   2643  C  CB   . TYR A 1 32  ? -5.530  -2.808  7.339   1.00 0.00 ? 187 TYR A CB   2  
ATOM   2644  C  CG   . TYR A 1 32  ? -6.480  -3.539  8.255   1.00 0.00 ? 187 TYR A CG   2  
ATOM   2645  C  CD1  . TYR A 1 32  ? -6.037  -4.014  9.494   1.00 0.00 ? 187 TYR A CD1  2  
ATOM   2646  C  CD2  . TYR A 1 32  ? -7.803  -3.743  7.859   1.00 0.00 ? 187 TYR A CD2  2  
ATOM   2647  C  CE1  . TYR A 1 32  ? -6.922  -4.695  10.338  1.00 0.00 ? 187 TYR A CE1  2  
ATOM   2648  C  CE2  . TYR A 1 32  ? -8.689  -4.424  8.700   1.00 0.00 ? 187 TYR A CE2  2  
ATOM   2649  C  CZ   . TYR A 1 32  ? -8.249  -4.901  9.940   1.00 0.00 ? 187 TYR A CZ   2  
ATOM   2650  O  OH   . TYR A 1 32  ? -9.122  -5.574  10.771  1.00 0.00 ? 187 TYR A OH   2  
ATOM   2651  H  H    . TYR A 1 32  ? -6.354  -0.522  5.875   1.00 0.00 ? 187 TYR A H    2  
ATOM   2652  H  HA   . TYR A 1 32  ? -5.752  -1.185  8.735   1.00 0.00 ? 187 TYR A HA   2  
ATOM   2653  H  HB2  . TYR A 1 32  ? -5.850  -2.932  6.316   1.00 0.00 ? 187 TYR A HB2  2  
ATOM   2654  H  HB3  . TYR A 1 32  ? -4.536  -3.213  7.458   1.00 0.00 ? 187 TYR A HB3  2  
ATOM   2655  H  HD1  . TYR A 1 32  ? -5.014  -3.855  9.800   1.00 0.00 ? 187 TYR A HD1  2  
ATOM   2656  H  HD2  . TYR A 1 32  ? -8.141  -3.378  6.899   1.00 0.00 ? 187 TYR A HD2  2  
ATOM   2657  H  HE1  . TYR A 1 32  ? -6.580  -5.064  11.295  1.00 0.00 ? 187 TYR A HE1  2  
ATOM   2658  H  HE2  . TYR A 1 32  ? -9.712  -4.582  8.390   1.00 0.00 ? 187 TYR A HE2  2  
ATOM   2659  H  HH   . TYR A 1 32  ? -8.977  -6.515  10.654  1.00 0.00 ? 187 TYR A HH   2  
ATOM   2660  N  N    . ARG A 1 33  ? -3.157  -1.014  8.193   1.00 0.00 ? 188 ARG A N    2  
ATOM   2661  C  CA   . ARG A 1 33  ? -1.791  -0.467  7.939   1.00 0.00 ? 188 ARG A CA   2  
ATOM   2662  C  C    . ARG A 1 33  ? -0.837  -1.609  7.568   1.00 0.00 ? 188 ARG A C    2  
ATOM   2663  O  O    . ARG A 1 33  ? -0.919  -2.686  8.128   1.00 0.00 ? 188 ARG A O    2  
ATOM   2664  C  CB   . ARG A 1 33  ? -1.359  0.179   9.259   1.00 0.00 ? 188 ARG A CB   2  
ATOM   2665  C  CG   . ARG A 1 33  ? -2.086  1.512   9.440   1.00 0.00 ? 188 ARG A CG   2  
ATOM   2666  C  CD   . ARG A 1 33  ? -1.172  2.496   10.173  1.00 0.00 ? 188 ARG A CD   2  
ATOM   2667  N  NE   . ARG A 1 33  ? -1.272  2.116   11.609  1.00 0.00 ? 188 ARG A NE   2  
ATOM   2668  C  CZ   . ARG A 1 33  ? -2.228  2.607   12.349  1.00 0.00 ? 188 ARG A CZ   2  
ATOM   2669  N  NH1  . ARG A 1 33  ? -2.060  3.749   12.958  1.00 0.00 ? 188 ARG A NH1  2  
ATOM   2670  N  NH2  . ARG A 1 33  ? -3.351  1.957   12.479  1.00 0.00 ? 188 ARG A NH2  2  
ATOM   2671  H  H    . ARG A 1 33  ? -3.314  -1.599  8.971   1.00 0.00 ? 188 ARG A H    2  
ATOM   2672  H  HA   . ARG A 1 33  ? -1.818  0.273   7.155   1.00 0.00 ? 188 ARG A HA   2  
ATOM   2673  H  HB2  . ARG A 1 33  ? -1.607  -0.480  10.079  1.00 0.00 ? 188 ARG A HB2  2  
ATOM   2674  H  HB3  . ARG A 1 33  ? -0.294  0.350   9.243   1.00 0.00 ? 188 ARG A HB3  2  
ATOM   2675  H  HG2  . ARG A 1 33  ? -2.346  1.915   8.472   1.00 0.00 ? 188 ARG A HG2  2  
ATOM   2676  H  HG3  . ARG A 1 33  ? -2.982  1.357   10.020  1.00 0.00 ? 188 ARG A HG3  2  
ATOM   2677  H  HD2  . ARG A 1 33  ? -0.154  2.394   9.824   1.00 0.00 ? 188 ARG A HD2  2  
ATOM   2678  H  HD3  . ARG A 1 33  ? -1.519  3.508   10.034  1.00 0.00 ? 188 ARG A HD3  2  
ATOM   2679  H  HE   . ARG A 1 33  ? -0.620  1.496   11.998  1.00 0.00 ? 188 ARG A HE   2  
ATOM   2680  H  HH11 . ARG A 1 33  ? -1.198  4.247   12.858  1.00 0.00 ? 188 ARG A HH11 2  
ATOM   2681  H  HH12 . ARG A 1 33  ? -2.792  4.125   13.525  1.00 0.00 ? 188 ARG A HH12 2  
ATOM   2682  H  HH21 . ARG A 1 33  ? -3.481  1.083   12.012  1.00 0.00 ? 188 ARG A HH21 2  
ATOM   2683  H  HH22 . ARG A 1 33  ? -4.084  2.334   13.046  1.00 0.00 ? 188 ARG A HH22 2  
ATOM   2684  N  N    . HIS A 1 34  ? 0.075   -1.389  6.643   1.00 0.00 ? 189 HIS A N    2  
ATOM   2685  C  CA   . HIS A 1 34  ? 1.028   -2.490  6.278   1.00 0.00 ? 189 HIS A CA   2  
ATOM   2686  C  C    . HIS A 1 34  ? 2.017   -2.678  7.440   1.00 0.00 ? 189 HIS A C    2  
ATOM   2687  O  O    . HIS A 1 34  ? 2.541   -1.707  7.950   1.00 0.00 ? 189 HIS A O    2  
ATOM   2688  C  CB   . HIS A 1 34  ? 1.755   -2.038  5.002   1.00 0.00 ? 189 HIS A CB   2  
ATOM   2689  C  CG   . HIS A 1 34  ? 2.115   -3.242  4.172   1.00 0.00 ? 189 HIS A CG   2  
ATOM   2690  N  ND1  . HIS A 1 34  ? 3.341   -3.873  4.279   1.00 0.00 ? 189 HIS A ND1  2  
ATOM   2691  C  CD2  . HIS A 1 34  ? 1.411   -3.958  3.238   1.00 0.00 ? 189 HIS A CD2  2  
ATOM   2692  C  CE1  . HIS A 1 34  ? 3.339   -4.922  3.445   1.00 0.00 ? 189 HIS A CE1  2  
ATOM   2693  N  NE2  . HIS A 1 34  ? 2.185   -5.022  2.781   1.00 0.00 ? 189 HIS A NE2  2  
ATOM   2694  H  H    . HIS A 1 34  ? 0.138   -0.504  6.208   1.00 0.00 ? 189 HIS A H    2  
ATOM   2695  H  HA   . HIS A 1 34  ? 0.483   -3.401  6.090   1.00 0.00 ? 189 HIS A HA   2  
ATOM   2696  H  HB2  . HIS A 1 34  ? 1.106   -1.389  4.431   1.00 0.00 ? 189 HIS A HB2  2  
ATOM   2697  H  HB3  . HIS A 1 34  ? 2.647   -1.501  5.275   1.00 0.00 ? 189 HIS A HB3  2  
ATOM   2698  H  HD1  . HIS A 1 34  ? 4.084   -3.589  4.834   1.00 0.00 ? 189 HIS A HD1  2  
ATOM   2699  H  HD2  . HIS A 1 34  ? 0.417   -3.721  2.895   1.00 0.00 ? 189 HIS A HD2  2  
ATOM   2700  H  HE1  . HIS A 1 34  ? 4.166   -5.609  3.338   1.00 0.00 ? 189 HIS A HE1  2  
ATOM   2701  N  N    . PRO A 1 35  ? 2.226   -3.910  7.855   1.00 0.00 ? 190 PRO A N    2  
ATOM   2702  C  CA   . PRO A 1 35  ? 3.137   -4.165  8.998   1.00 0.00 ? 190 PRO A CA   2  
ATOM   2703  C  C    . PRO A 1 35  ? 4.609   -3.960  8.601   1.00 0.00 ? 190 PRO A C    2  
ATOM   2704  O  O    . PRO A 1 35  ? 5.400   -3.478  9.392   1.00 0.00 ? 190 PRO A O    2  
ATOM   2705  C  CB   . PRO A 1 35  ? 2.864   -5.625  9.354   1.00 0.00 ? 190 PRO A CB   2  
ATOM   2706  C  CG   . PRO A 1 35  ? 2.353   -6.245  8.095   1.00 0.00 ? 190 PRO A CG   2  
ATOM   2707  C  CD   . PRO A 1 35  ? 1.657   -5.159  7.319   1.00 0.00 ? 190 PRO A CD   2  
ATOM   2708  H  HA   . PRO A 1 35  ? 2.881   -3.533  9.832   1.00 0.00 ? 190 PRO A HA   2  
ATOM   2709  H  HB2  . PRO A 1 35  ? 3.776   -6.110  9.674   1.00 0.00 ? 190 PRO A HB2  2  
ATOM   2710  H  HB3  . PRO A 1 35  ? 2.110   -5.686  10.126  1.00 0.00 ? 190 PRO A HB3  2  
ATOM   2711  H  HG2  . PRO A 1 35  ? 3.178   -6.642  7.520   1.00 0.00 ? 190 PRO A HG2  2  
ATOM   2712  H  HG3  . PRO A 1 35  ? 1.652   -7.031  8.329   1.00 0.00 ? 190 PRO A HG3  2  
ATOM   2713  H  HD2  . PRO A 1 35  ? 1.871   -5.255  6.262   1.00 0.00 ? 190 PRO A HD2  2  
ATOM   2714  H  HD3  . PRO A 1 35  ? 0.593   -5.189  7.495   1.00 0.00 ? 190 PRO A HD3  2  
ATOM   2715  N  N    . SER A 1 36  ? 4.996   -4.330  7.397   1.00 0.00 ? 191 SER A N    2  
ATOM   2716  C  CA   . SER A 1 36  ? 6.434   -4.157  6.990   1.00 0.00 ? 191 SER A CA   2  
ATOM   2717  C  C    . SER A 1 36  ? 6.653   -2.964  6.030   1.00 0.00 ? 191 SER A C    2  
ATOM   2718  O  O    . SER A 1 36  ? 7.689   -2.890  5.394   1.00 0.00 ? 191 SER A O    2  
ATOM   2719  C  CB   . SER A 1 36  ? 6.809   -5.463  6.282   1.00 0.00 ? 191 SER A CB   2  
ATOM   2720  O  OG   . SER A 1 36  ? 6.723   -6.540  7.207   1.00 0.00 ? 191 SER A OG   2  
ATOM   2721  H  H    . SER A 1 36  ? 4.350   -4.734  6.772   1.00 0.00 ? 191 SER A H    2  
ATOM   2722  H  HA   . SER A 1 36  ? 7.050   -4.040  7.866   1.00 0.00 ? 191 SER A HA   2  
ATOM   2723  H  HB2  . SER A 1 36  ? 6.127   -5.642  5.466   1.00 0.00 ? 191 SER A HB2  2  
ATOM   2724  H  HB3  . SER A 1 36  ? 7.817   -5.385  5.895   1.00 0.00 ? 191 SER A HB3  2  
ATOM   2725  H  HG   . SER A 1 36  ? 7.117   -7.314  6.798   1.00 0.00 ? 191 SER A HG   2  
ATOM   2726  N  N    . LEU A 1 37  ? 5.715   -2.039  5.894   1.00 0.00 ? 192 LEU A N    2  
ATOM   2727  C  CA   . LEU A 1 37  ? 5.948   -0.894  4.939   1.00 0.00 ? 192 LEU A CA   2  
ATOM   2728  C  C    . LEU A 1 37  ? 5.498   0.488   5.474   1.00 0.00 ? 192 LEU A C    2  
ATOM   2729  O  O    . LEU A 1 37  ? 5.570   1.456   4.740   1.00 0.00 ? 192 LEU A O    2  
ATOM   2730  C  CB   . LEU A 1 37  ? 5.110   -1.229  3.699   1.00 0.00 ? 192 LEU A CB   2  
ATOM   2731  C  CG   . LEU A 1 37  ? 5.731   -2.370  2.887   1.00 0.00 ? 192 LEU A CG   2  
ATOM   2732  C  CD1  . LEU A 1 37  ? 4.883   -2.581  1.629   1.00 0.00 ? 192 LEU A CD1  2  
ATOM   2733  C  CD2  . LEU A 1 37  ? 7.162   -2.009  2.471   1.00 0.00 ? 192 LEU A CD2  2  
ATOM   2734  H  H    . LEU A 1 37  ? 4.876   -2.104  6.390   1.00 0.00 ? 192 LEU A H    2  
ATOM   2735  H  HA   . LEU A 1 37  ? 6.987   -0.856  4.661   1.00 0.00 ? 192 LEU A HA   2  
ATOM   2736  H  HB2  . LEU A 1 37  ? 4.121   -1.520  4.011   1.00 0.00 ? 192 LEU A HB2  2  
ATOM   2737  H  HB3  . LEU A 1 37  ? 5.038   -0.350  3.076   1.00 0.00 ? 192 LEU A HB3  2  
ATOM   2738  H  HG   . LEU A 1 37  ? 5.737   -3.275  3.477   1.00 0.00 ? 192 LEU A HG   2  
ATOM   2739  H  HD11 . LEU A 1 37  ? 3.954   -3.073  1.893   1.00 0.00 ? 192 LEU A HD11 2  
ATOM   2740  H  HD12 . LEU A 1 37  ? 5.427   -3.192  0.922   1.00 0.00 ? 192 LEU A HD12 2  
ATOM   2741  H  HD13 . LEU A 1 37  ? 4.666   -1.618  1.185   1.00 0.00 ? 192 LEU A HD13 2  
ATOM   2742  H  HD21 . LEU A 1 37  ? 7.851   -2.325  3.240   1.00 0.00 ? 192 LEU A HD21 2  
ATOM   2743  H  HD22 . LEU A 1 37  ? 7.239   -0.941  2.335   1.00 0.00 ? 192 LEU A HD22 2  
ATOM   2744  H  HD23 . LEU A 1 37  ? 7.404   -2.510  1.545   1.00 0.00 ? 192 LEU A HD23 2  
ATOM   2745  N  N    . GLN A 1 38  ? 5.031   0.622   6.709   1.00 0.00 ? 193 GLN A N    2  
ATOM   2746  C  CA   . GLN A 1 38  ? 4.582   1.971   7.207   1.00 0.00 ? 193 GLN A CA   2  
ATOM   2747  C  C    . GLN A 1 38  ? 3.614   2.627   6.198   1.00 0.00 ? 193 GLN A C    2  
ATOM   2748  O  O    . GLN A 1 38  ? 3.750   3.791   5.875   1.00 0.00 ? 193 GLN A O    2  
ATOM   2749  C  CB   . GLN A 1 38  ? 5.867   2.801   7.333   1.00 0.00 ? 193 GLN A CB   2  
ATOM   2750  C  CG   . GLN A 1 38  ? 5.862   3.559   8.664   1.00 0.00 ? 193 GLN A CG   2  
ATOM   2751  C  CD   . GLN A 1 38  ? 6.759   4.798   8.550   1.00 0.00 ? 193 GLN A CD   2  
ATOM   2752  O  OE1  . GLN A 1 38  ? 6.291   5.910   8.690   1.00 0.00 ? 193 GLN A OE1  2  
ATOM   2753  N  NE2  . GLN A 1 38  ? 8.039   4.658   8.300   1.00 0.00 ? 193 GLN A NE2  2  
ATOM   2754  H  H    . GLN A 1 38  ? 4.969   -0.144  7.305   1.00 0.00 ? 193 GLN A H    2  
ATOM   2755  H  HA   . GLN A 1 38  ? 4.107   1.873   8.170   1.00 0.00 ? 193 GLN A HA   2  
ATOM   2756  H  HB2  . GLN A 1 38  ? 6.723   2.144   7.296   1.00 0.00 ? 193 GLN A HB2  2  
ATOM   2757  H  HB3  . GLN A 1 38  ? 5.922   3.510   6.519   1.00 0.00 ? 193 GLN A HB3  2  
ATOM   2758  H  HG2  . GLN A 1 38  ? 4.852   3.864   8.899   1.00 0.00 ? 193 GLN A HG2  2  
ATOM   2759  H  HG3  . GLN A 1 38  ? 6.236   2.916   9.445   1.00 0.00 ? 193 GLN A HG3  2  
ATOM   2760  H  HE21 . GLN A 1 38  ? 8.429   3.763   8.186   1.00 0.00 ? 193 GLN A HE21 2  
ATOM   2761  H  HE22 . GLN A 1 38  ? 8.610   5.451   8.229   1.00 0.00 ? 193 GLN A HE22 2  
ATOM   2762  N  N    . VAL A 1 39  ? 2.654   1.884   5.684   1.00 0.00 ? 194 VAL A N    2  
ATOM   2763  C  CA   . VAL A 1 39  ? 1.707   2.470   4.685   1.00 0.00 ? 194 VAL A CA   2  
ATOM   2764  C  C    . VAL A 1 39  ? 0.276   1.953   4.921   1.00 0.00 ? 194 VAL A C    2  
ATOM   2765  O  O    . VAL A 1 39  ? 0.074   0.980   5.621   1.00 0.00 ? 194 VAL A O    2  
ATOM   2766  C  CB   . VAL A 1 39  ? 2.260   2.020   3.324   1.00 0.00 ? 194 VAL A CB   2  
ATOM   2767  C  CG1  . VAL A 1 39  ? 2.173   0.496   3.187   1.00 0.00 ? 194 VAL A CG1  2  
ATOM   2768  C  CG2  . VAL A 1 39  ? 1.460   2.681   2.202   1.00 0.00 ? 194 VAL A CG2  2  
ATOM   2769  H  H    . VAL A 1 39  ? 2.562   0.941   5.942   1.00 0.00 ? 194 VAL A H    2  
ATOM   2770  H  HA   . VAL A 1 39  ? 1.716   3.547   4.742   1.00 0.00 ? 194 VAL A HA   2  
ATOM   2771  H  HB   . VAL A 1 39  ? 3.295   2.321   3.248   1.00 0.00 ? 194 VAL A HB   2  
ATOM   2772  H  HG11 . VAL A 1 39  ? 2.715   0.030   3.995   1.00 0.00 ? 194 VAL A HG11 2  
ATOM   2773  H  HG12 . VAL A 1 39  ? 2.605   0.195   2.246   1.00 0.00 ? 194 VAL A HG12 2  
ATOM   2774  H  HG13 . VAL A 1 39  ? 1.137   0.189   3.222   1.00 0.00 ? 194 VAL A HG13 2  
ATOM   2775  H  HG21 . VAL A 1 39  ? 1.917   2.452   1.252   1.00 0.00 ? 194 VAL A HG21 2  
ATOM   2776  H  HG22 . VAL A 1 39  ? 1.454   3.751   2.349   1.00 0.00 ? 194 VAL A HG22 2  
ATOM   2777  H  HG23 . VAL A 1 39  ? 0.446   2.309   2.213   1.00 0.00 ? 194 VAL A HG23 2  
ATOM   2778  N  N    . LEU A 1 40  ? -0.716  2.609   4.357   1.00 0.00 ? 195 LEU A N    2  
ATOM   2779  C  CA   . LEU A 1 40  ? -2.136  2.154   4.575   1.00 0.00 ? 195 LEU A CA   2  
ATOM   2780  C  C    . LEU A 1 40  ? -2.591  1.166   3.487   1.00 0.00 ? 195 LEU A C    2  
ATOM   2781  O  O    . LEU A 1 40  ? -2.234  1.293   2.332   1.00 0.00 ? 195 LEU A O    2  
ATOM   2782  C  CB   . LEU A 1 40  ? -3.002  3.418   4.518   1.00 0.00 ? 195 LEU A CB   2  
ATOM   2783  C  CG   . LEU A 1 40  ? -4.348  3.145   5.196   1.00 0.00 ? 195 LEU A CG   2  
ATOM   2784  C  CD1  . LEU A 1 40  ? -4.813  4.403   5.933   1.00 0.00 ? 195 LEU A CD1  2  
ATOM   2785  C  CD2  . LEU A 1 40  ? -5.384  2.761   4.138   1.00 0.00 ? 195 LEU A CD2  2  
ATOM   2786  H  H    . LEU A 1 40  ? -0.528  3.405   3.806   1.00 0.00 ? 195 LEU A H    2  
ATOM   2787  H  HA   . LEU A 1 40  ? -2.230  1.698   5.548   1.00 0.00 ? 195 LEU A HA   2  
ATOM   2788  H  HB2  . LEU A 1 40  ? -2.496  4.222   5.026   1.00 0.00 ? 195 LEU A HB2  2  
ATOM   2789  H  HB3  . LEU A 1 40  ? -3.170  3.692   3.487   1.00 0.00 ? 195 LEU A HB3  2  
ATOM   2790  H  HG   . LEU A 1 40  ? -4.236  2.336   5.904   1.00 0.00 ? 195 LEU A HG   2  
ATOM   2791  H  HD11 . LEU A 1 40  ? -5.480  4.122   6.735   1.00 0.00 ? 195 LEU A HD11 2  
ATOM   2792  H  HD12 . LEU A 1 40  ? -5.332  5.051   5.244   1.00 0.00 ? 195 LEU A HD12 2  
ATOM   2793  H  HD13 . LEU A 1 40  ? -3.957  4.919   6.341   1.00 0.00 ? 195 LEU A HD13 2  
ATOM   2794  H  HD21 . LEU A 1 40  ? -6.064  2.028   4.549   1.00 0.00 ? 195 LEU A HD21 2  
ATOM   2795  H  HD22 . LEU A 1 40  ? -4.884  2.343   3.277   1.00 0.00 ? 195 LEU A HD22 2  
ATOM   2796  H  HD23 . LEU A 1 40  ? -5.939  3.639   3.840   1.00 0.00 ? 195 LEU A HD23 2  
ATOM   2797  N  N    . ILE A 1 41  ? -3.401  0.191   3.852   1.00 0.00 ? 196 ILE A N    2  
ATOM   2798  C  CA   . ILE A 1 41  ? -3.912  -0.801  2.853   1.00 0.00 ? 196 ILE A CA   2  
ATOM   2799  C  C    . ILE A 1 41  ? -5.412  -1.041  3.119   1.00 0.00 ? 196 ILE A C    2  
ATOM   2800  O  O    . ILE A 1 41  ? -6.026  -0.294  3.860   1.00 0.00 ? 196 ILE A O    2  
ATOM   2801  C  CB   . ILE A 1 41  ? -3.086  -2.087  3.069   1.00 0.00 ? 196 ILE A CB   2  
ATOM   2802  C  CG1  . ILE A 1 41  ? -3.102  -2.487  4.553   1.00 0.00 ? 196 ILE A CG1  2  
ATOM   2803  C  CG2  . ILE A 1 41  ? -1.639  -1.858  2.609   1.00 0.00 ? 196 ILE A CG2  2  
ATOM   2804  C  CD1  . ILE A 1 41  ? -2.382  -3.827  4.734   1.00 0.00 ? 196 ILE A CD1  2  
ATOM   2805  H  H    . ILE A 1 41  ? -3.691  0.117   4.790   1.00 0.00 ? 196 ILE A H    2  
ATOM   2806  H  HA   . ILE A 1 41  ? -3.768  -0.430  1.848   1.00 0.00 ? 196 ILE A HA   2  
ATOM   2807  H  HB   . ILE A 1 41  ? -3.510  -2.886  2.481   1.00 0.00 ? 196 ILE A HB   2  
ATOM   2808  H  HG12 . ILE A 1 41  ? -2.600  -1.728  5.136   1.00 0.00 ? 196 ILE A HG12 2  
ATOM   2809  H  HG13 . ILE A 1 41  ? -4.124  -2.581  4.889   1.00 0.00 ? 196 ILE A HG13 2  
ATOM   2810  H  HG21 . ILE A 1 41  ? -1.447  -0.800  2.522   1.00 0.00 ? 196 ILE A HG21 2  
ATOM   2811  H  HG22 . ILE A 1 41  ? -1.490  -2.330  1.648   1.00 0.00 ? 196 ILE A HG22 2  
ATOM   2812  H  HG23 . ILE A 1 41  ? -0.957  -2.289  3.329   1.00 0.00 ? 196 ILE A HG23 2  
ATOM   2813  H  HD11 . ILE A 1 41  ? -1.843  -3.822  5.670   1.00 0.00 ? 196 ILE A HD11 2  
ATOM   2814  H  HD12 . ILE A 1 41  ? -1.688  -3.978  3.920   1.00 0.00 ? 196 ILE A HD12 2  
ATOM   2815  H  HD13 . ILE A 1 41  ? -3.108  -4.627  4.741   1.00 0.00 ? 196 ILE A HD13 2  
ATOM   2816  N  N    . CYS A 1 42  ? -6.014  -2.056  2.532   1.00 0.00 ? 197 CYS A N    2  
ATOM   2817  C  CA   . CYS A 1 42  ? -7.470  -2.297  2.778   1.00 0.00 ? 197 CYS A CA   2  
ATOM   2818  C  C    . CYS A 1 42  ? -7.670  -3.606  3.570   1.00 0.00 ? 197 CYS A C    2  
ATOM   2819  O  O    . CYS A 1 42  ? -6.782  -4.435  3.632   1.00 0.00 ? 197 CYS A O    2  
ATOM   2820  C  CB   . CYS A 1 42  ? -8.119  -2.351  1.377   1.00 0.00 ? 197 CYS A CB   2  
ATOM   2821  S  SG   . CYS A 1 42  ? -7.625  -3.843  0.462   1.00 0.00 ? 197 CYS A SG   2  
ATOM   2822  H  H    . CYS A 1 42  ? -5.520  -2.652  1.939   1.00 0.00 ? 197 CYS A H    2  
ATOM   2823  H  HA   . CYS A 1 42  ? -7.886  -1.468  3.334   1.00 0.00 ? 197 CYS A HA   2  
ATOM   2824  H  HB2  . CYS A 1 42  ? -9.193  -2.346  1.486   1.00 0.00 ? 197 CYS A HB2  2  
ATOM   2825  H  HB3  . CYS A 1 42  ? -7.819  -1.476  0.818   1.00 0.00 ? 197 CYS A HB3  2  
ATOM   2826  N  N    . LYS A 1 43  ? -8.823  -3.795  4.187   1.00 0.00 ? 198 LYS A N    2  
ATOM   2827  C  CA   . LYS A 1 43  ? -9.057  -5.058  4.991   1.00 0.00 ? 198 LYS A CA   2  
ATOM   2828  C  C    . LYS A 1 43  ? -8.709  -6.311  4.172   1.00 0.00 ? 198 LYS A C    2  
ATOM   2829  O  O    . LYS A 1 43  ? -8.170  -7.265  4.703   1.00 0.00 ? 198 LYS A O    2  
ATOM   2830  C  CB   . LYS A 1 43  ? -10.544 -5.064  5.374   1.00 0.00 ? 198 LYS A CB   2  
ATOM   2831  C  CG   . LYS A 1 43  ? -10.841 -6.273  6.264   1.00 0.00 ? 198 LYS A CG   2  
ATOM   2832  C  CD   . LYS A 1 43  ? -12.043 -5.965  7.159   1.00 0.00 ? 198 LYS A CD   2  
ATOM   2833  C  CE   . LYS A 1 43  ? -12.784 -7.264  7.483   1.00 0.00 ? 198 LYS A CE   2  
ATOM   2834  N  NZ   . LYS A 1 43  ? -14.215 -6.869  7.601   1.00 0.00 ? 198 LYS A NZ   2  
ATOM   2835  H  H    . LYS A 1 43  ? -9.524  -3.102  4.133   1.00 0.00 ? 198 LYS A H    2  
ATOM   2836  H  HA   . LYS A 1 43  ? -8.459  -5.039  5.880   1.00 0.00 ? 198 LYS A HA   2  
ATOM   2837  H  HB2  . LYS A 1 43  ? -10.775 -4.155  5.912   1.00 0.00 ? 198 LYS A HB2  2  
ATOM   2838  H  HB3  . LYS A 1 43  ? -11.147 -5.119  4.480   1.00 0.00 ? 198 LYS A HB3  2  
ATOM   2839  H  HG2  . LYS A 1 43  ? -11.063 -7.130  5.645   1.00 0.00 ? 198 LYS A HG2  2  
ATOM   2840  H  HG3  . LYS A 1 43  ? -9.980  -6.486  6.880   1.00 0.00 ? 198 LYS A HG3  2  
ATOM   2841  H  HD2  . LYS A 1 43  ? -11.699 -5.508  8.076   1.00 0.00 ? 198 LYS A HD2  2  
ATOM   2842  H  HD3  . LYS A 1 43  ? -12.710 -5.290  6.647   1.00 0.00 ? 198 LYS A HD3  2  
ATOM   2843  H  HE2  . LYS A 1 43  ? -12.653 -7.980  6.684   1.00 0.00 ? 198 LYS A HE2  2  
ATOM   2844  H  HE3  . LYS A 1 43  ? -12.436 -7.673  8.419   1.00 0.00 ? 198 LYS A HE3  2  
ATOM   2845  H  HZ1  . LYS A 1 43  ? -14.329 -6.210  8.396   1.00 0.00 ? 198 LYS A HZ1  2  
ATOM   2846  H  HZ2  . LYS A 1 43  ? -14.796 -7.716  7.766   1.00 0.00 ? 198 LYS A HZ2  2  
ATOM   2847  H  HZ3  . LYS A 1 43  ? -14.520 -6.404  6.723   1.00 0.00 ? 198 LYS A HZ3  2  
ATOM   2848  N  N    . ASN A 1 44  ? -8.995  -6.319  2.890   1.00 0.00 ? 199 ASN A N    2  
ATOM   2849  C  CA   . ASN A 1 44  ? -8.650  -7.533  2.064   1.00 0.00 ? 199 ASN A CA   2  
ATOM   2850  C  C    . ASN A 1 44  ? -7.124  -7.726  1.991   1.00 0.00 ? 199 ASN A C    2  
ATOM   2851  O  O    . ASN A 1 44  ? -6.656  -8.835  1.827   1.00 0.00 ? 199 ASN A O    2  
ATOM   2852  C  CB   . ASN A 1 44  ? -9.227  -7.300  0.660   1.00 0.00 ? 199 ASN A CB   2  
ATOM   2853  C  CG   . ASN A 1 44  ? -10.739 -7.558  0.677   1.00 0.00 ? 199 ASN A CG   2  
ATOM   2854  O  OD1  . ASN A 1 44  ? -11.414 -7.197  1.621   1.00 0.00 ? 199 ASN A OD1  2  
ATOM   2855  N  ND2  . ASN A 1 44  ? -11.310 -8.171  -0.332  1.00 0.00 ? 199 ASN A ND2  2  
ATOM   2856  H  H    . ASN A 1 44  ? -9.422  -5.533  2.475   1.00 0.00 ? 199 ASN A H    2  
ATOM   2857  H  HA   . ASN A 1 44  ? -9.099  -8.406  2.505   1.00 0.00 ? 199 ASN A HA   2  
ATOM   2858  H  HB2  . ASN A 1 44  ? -9.039  -6.279  0.358   1.00 0.00 ? 199 ASN A HB2  2  
ATOM   2859  H  HB3  . ASN A 1 44  ? -8.757  -7.975  -0.040  1.00 0.00 ? 199 ASN A HB3  2  
ATOM   2860  H  HD21 . ASN A 1 44  ? -10.776 -8.466  -1.101  1.00 0.00 ? 199 ASN A HD21 2  
ATOM   2861  H  HD22 . ASN A 1 44  ? -12.276 -8.334  -0.319  1.00 0.00 ? 199 ASN A HD22 2  
ATOM   2862  N  N    . CYS A 1 45  ? -6.340  -6.673  2.135   1.00 0.00 ? 200 CYS A N    2  
ATOM   2863  C  CA   . CYS A 1 45  ? -4.849  -6.850  2.092   1.00 0.00 ? 200 CYS A CA   2  
ATOM   2864  C  C    . CYS A 1 45  ? -4.386  -7.354  3.459   1.00 0.00 ? 200 CYS A C    2  
ATOM   2865  O  O    . CYS A 1 45  ? -3.706  -8.354  3.559   1.00 0.00 ? 200 CYS A O    2  
ATOM   2866  C  CB   . CYS A 1 45  ? -4.241  -5.467  1.800   1.00 0.00 ? 200 CYS A CB   2  
ATOM   2867  S  SG   . CYS A 1 45  ? -4.134  -5.213  0.013   1.00 0.00 ? 200 CYS A SG   2  
ATOM   2868  H  H    . CYS A 1 45  ? -6.725  -5.786  2.290   1.00 0.00 ? 200 CYS A H    2  
ATOM   2869  H  HA   . CYS A 1 45  ? -4.574  -7.551  1.321   1.00 0.00 ? 200 CYS A HA   2  
ATOM   2870  H  HB2  . CYS A 1 45  ? -4.863  -4.700  2.236   1.00 0.00 ? 200 CYS A HB2  2  
ATOM   2871  H  HB3  . CYS A 1 45  ? -3.252  -5.413  2.231   1.00 0.00 ? 200 CYS A HB3  2  
ATOM   2872  N  N    . PHE A 1 46  ? -4.770  -6.674  4.518   1.00 0.00 ? 201 PHE A N    2  
ATOM   2873  C  CA   . PHE A 1 46  ? -4.358  -7.135  5.890   1.00 0.00 ? 201 PHE A CA   2  
ATOM   2874  C  C    . PHE A 1 46  ? -4.925  -8.537  6.163   1.00 0.00 ? 201 PHE A C    2  
ATOM   2875  O  O    . PHE A 1 46  ? -4.275  -9.347  6.798   1.00 0.00 ? 201 PHE A O    2  
ATOM   2876  C  CB   . PHE A 1 46  ? -4.937  -6.118  6.889   1.00 0.00 ? 201 PHE A CB   2  
ATOM   2877  C  CG   . PHE A 1 46  ? -4.070  -6.060  8.126   1.00 0.00 ? 201 PHE A CG   2  
ATOM   2878  C  CD1  . PHE A 1 46  ? -2.941  -5.230  8.156   1.00 0.00 ? 201 PHE A CD1  2  
ATOM   2879  C  CD2  . PHE A 1 46  ? -4.401  -6.831  9.246   1.00 0.00 ? 201 PHE A CD2  2  
ATOM   2880  C  CE1  . PHE A 1 46  ? -2.143  -5.175  9.306   1.00 0.00 ? 201 PHE A CE1  2  
ATOM   2881  C  CE2  . PHE A 1 46  ? -3.605  -6.775  10.395  1.00 0.00 ? 201 PHE A CE2  2  
ATOM   2882  C  CZ   . PHE A 1 46  ? -2.476  -5.947  10.426  1.00 0.00 ? 201 PHE A CZ   2  
ATOM   2883  H  H    . PHE A 1 46  ? -5.336  -5.874  4.407   1.00 0.00 ? 201 PHE A H    2  
ATOM   2884  H  HA   . PHE A 1 46  ? -3.283  -7.156  5.962   1.00 0.00 ? 201 PHE A HA   2  
ATOM   2885  H  HB2  . PHE A 1 46  ? -4.968  -5.141  6.428   1.00 0.00 ? 201 PHE A HB2  2  
ATOM   2886  H  HB3  . PHE A 1 46  ? -5.936  -6.416  7.166   1.00 0.00 ? 201 PHE A HB3  2  
ATOM   2887  H  HD1  . PHE A 1 46  ? -2.685  -4.635  7.292   1.00 0.00 ? 201 PHE A HD1  2  
ATOM   2888  H  HD2  . PHE A 1 46  ? -5.272  -7.471  9.223   1.00 0.00 ? 201 PHE A HD2  2  
ATOM   2889  H  HE1  . PHE A 1 46  ? -1.272  -4.535  9.331   1.00 0.00 ? 201 PHE A HE1  2  
ATOM   2890  H  HE2  . PHE A 1 46  ? -3.863  -7.370  11.259  1.00 0.00 ? 201 PHE A HE2  2  
ATOM   2891  H  HZ   . PHE A 1 46  ? -1.862  -5.904  11.313  1.00 0.00 ? 201 PHE A HZ   2  
ATOM   2892  N  N    . LYS A 1 47  ? -6.116  -8.848  5.679   1.00 0.00 ? 202 LYS A N    2  
ATOM   2893  C  CA   . LYS A 1 47  ? -6.667  -10.225 5.921   1.00 0.00 ? 202 LYS A CA   2  
ATOM   2894  C  C    . LYS A 1 47  ? -6.005  -11.211 4.953   1.00 0.00 ? 202 LYS A C    2  
ATOM   2895  O  O    . LYS A 1 47  ? -5.696  -12.324 5.326   1.00 0.00 ? 202 LYS A O    2  
ATOM   2896  C  CB   . LYS A 1 47  ? -8.182  -10.150 5.670   1.00 0.00 ? 202 LYS A CB   2  
ATOM   2897  C  CG   . LYS A 1 47  ? -8.901  -11.137 6.593   1.00 0.00 ? 202 LYS A CG   2  
ATOM   2898  C  CD   . LYS A 1 47  ? -10.352 -11.299 6.136   1.00 0.00 ? 202 LYS A CD   2  
ATOM   2899  C  CE   . LYS A 1 47  ? -11.054 -12.333 7.020   1.00 0.00 ? 202 LYS A CE   2  
ATOM   2900  N  NZ   . LYS A 1 47  ? -12.446 -11.826 7.172   1.00 0.00 ? 202 LYS A NZ   2  
ATOM   2901  H  H    . LYS A 1 47  ? -6.630  -8.190  5.147   1.00 0.00 ? 202 LYS A H    2  
ATOM   2902  H  HA   . LYS A 1 47  ? -6.473  -10.527 6.938   1.00 0.00 ? 202 LYS A HA   2  
ATOM   2903  H  HB2  . LYS A 1 47  ? -8.531  -9.148  5.871   1.00 0.00 ? 202 LYS A HB2  2  
ATOM   2904  H  HB3  . LYS A 1 47  ? -8.390  -10.407 4.643   1.00 0.00 ? 202 LYS A HB3  2  
ATOM   2905  H  HG2  . LYS A 1 47  ? -8.401  -12.094 6.557   1.00 0.00 ? 202 LYS A HG2  2  
ATOM   2906  H  HG3  . LYS A 1 47  ? -8.885  -10.760 7.606   1.00 0.00 ? 202 LYS A HG3  2  
ATOM   2907  H  HD2  . LYS A 1 47  ? -10.862 -10.350 6.215   1.00 0.00 ? 202 LYS A HD2  2  
ATOM   2908  H  HD3  . LYS A 1 47  ? -10.371 -11.633 5.110   1.00 0.00 ? 202 LYS A HD3  2  
ATOM   2909  H  HE2  . LYS A 1 47  ? -11.054 -13.300 6.537   1.00 0.00 ? 202 LYS A HE2  2  
ATOM   2910  H  HE3  . LYS A 1 47  ? -10.575 -12.392 7.984   1.00 0.00 ? 202 LYS A HE3  2  
ATOM   2911  H  HZ1  . LYS A 1 47  ? -12.426 -10.876 7.593   1.00 0.00 ? 202 LYS A HZ1  2  
ATOM   2912  H  HZ2  . LYS A 1 47  ? -12.983 -12.469 7.790   1.00 0.00 ? 202 LYS A HZ2  2  
ATOM   2913  H  HZ3  . LYS A 1 47  ? -12.903 -11.779 6.240   1.00 0.00 ? 202 LYS A HZ3  2  
ATOM   2914  N  N    . TYR A 1 48  ? -5.763  -10.812 3.719   1.00 0.00 ? 203 TYR A N    2  
ATOM   2915  C  CA   . TYR A 1 48  ? -5.091  -11.751 2.758   1.00 0.00 ? 203 TYR A CA   2  
ATOM   2916  C  C    . TYR A 1 48  ? -3.606  -11.895 3.134   1.00 0.00 ? 203 TYR A C    2  
ATOM   2917  O  O    . TYR A 1 48  ? -3.047  -12.970 3.024   1.00 0.00 ? 203 TYR A O    2  
ATOM   2918  C  CB   . TYR A 1 48  ? -5.246  -11.131 1.357   1.00 0.00 ? 203 TYR A CB   2  
ATOM   2919  C  CG   . TYR A 1 48  ? -4.579  -12.004 0.320   1.00 0.00 ? 203 TYR A CG   2  
ATOM   2920  C  CD1  . TYR A 1 48  ? -4.859  -13.376 0.264   1.00 0.00 ? 203 TYR A CD1  2  
ATOM   2921  C  CD2  . TYR A 1 48  ? -3.681  -11.436 -0.590  1.00 0.00 ? 203 TYR A CD2  2  
ATOM   2922  C  CE1  . TYR A 1 48  ? -4.240  -14.178 -0.702  1.00 0.00 ? 203 TYR A CE1  2  
ATOM   2923  C  CE2  . TYR A 1 48  ? -3.062  -12.239 -1.556  1.00 0.00 ? 203 TYR A CE2  2  
ATOM   2924  C  CZ   . TYR A 1 48  ? -3.342  -13.610 -1.612  1.00 0.00 ? 203 TYR A CZ   2  
ATOM   2925  O  OH   . TYR A 1 48  ? -2.731  -14.400 -2.564  1.00 0.00 ? 203 TYR A OH   2  
ATOM   2926  H  H    . TYR A 1 48  ? -6.006  -9.898  3.437   1.00 0.00 ? 203 TYR A H    2  
ATOM   2927  H  HA   . TYR A 1 48  ? -5.573  -12.718 2.790   1.00 0.00 ? 203 TYR A HA   2  
ATOM   2928  H  HB2  . TYR A 1 48  ? -6.296  -11.036 1.122   1.00 0.00 ? 203 TYR A HB2  2  
ATOM   2929  H  HB3  . TYR A 1 48  ? -4.790  -10.152 1.347   1.00 0.00 ? 203 TYR A HB3  2  
ATOM   2930  H  HD1  . TYR A 1 48  ? -5.552  -13.814 0.967   1.00 0.00 ? 203 TYR A HD1  2  
ATOM   2931  H  HD2  . TYR A 1 48  ? -3.467  -10.377 -0.547  1.00 0.00 ? 203 TYR A HD2  2  
ATOM   2932  H  HE1  . TYR A 1 48  ? -4.456  -15.236 -0.744  1.00 0.00 ? 203 TYR A HE1  2  
ATOM   2933  H  HE2  . TYR A 1 48  ? -2.369  -11.801 -2.259  1.00 0.00 ? 203 TYR A HE2  2  
ATOM   2934  H  HH   . TYR A 1 48  ? -3.379  -14.602 -3.242  1.00 0.00 ? 203 TYR A HH   2  
ATOM   2935  N  N    . TYR A 1 49  ? -2.961  -10.835 3.597   1.00 0.00 ? 204 TYR A N    2  
ATOM   2936  C  CA   . TYR A 1 49  ? -1.513  -10.972 3.990   1.00 0.00 ? 204 TYR A CA   2  
ATOM   2937  C  C    . TYR A 1 49  ? -1.389  -11.957 5.164   1.00 0.00 ? 204 TYR A C    2  
ATOM   2938  O  O    . TYR A 1 49  ? -0.428  -12.699 5.250   1.00 0.00 ? 204 TYR A O    2  
ATOM   2939  C  CB   . TYR A 1 49  ? -1.022  -9.573  4.407   1.00 0.00 ? 204 TYR A CB   2  
ATOM   2940  C  CG   . TYR A 1 49  ? 0.453   -9.431  4.102   1.00 0.00 ? 204 TYR A CG   2  
ATOM   2941  C  CD1  . TYR A 1 49  ? 0.941   -9.735  2.823   1.00 0.00 ? 204 TYR A CD1  2  
ATOM   2942  C  CD2  . TYR A 1 49  ? 1.331   -8.989  5.097   1.00 0.00 ? 204 TYR A CD2  2  
ATOM   2943  C  CE1  . TYR A 1 49  ? 2.305   -9.597  2.542   1.00 0.00 ? 204 TYR A CE1  2  
ATOM   2944  C  CE2  . TYR A 1 49  ? 2.696   -8.851  4.816   1.00 0.00 ? 204 TYR A CE2  2  
ATOM   2945  C  CZ   . TYR A 1 49  ? 3.183   -9.155  3.539   1.00 0.00 ? 204 TYR A CZ   2  
ATOM   2946  O  OH   . TYR A 1 49  ? 4.529   -9.019  3.262   1.00 0.00 ? 204 TYR A OH   2  
ATOM   2947  H  H    . TYR A 1 49  ? -3.429  -9.968  3.699   1.00 0.00 ? 204 TYR A H    2  
ATOM   2948  H  HA   . TYR A 1 49  ? -0.939  -11.328 3.150   1.00 0.00 ? 204 TYR A HA   2  
ATOM   2949  H  HB2  . TYR A 1 49  ? -1.570  -8.823  3.861   1.00 0.00 ? 204 TYR A HB2  2  
ATOM   2950  H  HB3  . TYR A 1 49  ? -1.182  -9.437  5.465   1.00 0.00 ? 204 TYR A HB3  2  
ATOM   2951  H  HD1  . TYR A 1 49  ? 0.263   -10.076 2.054   1.00 0.00 ? 204 TYR A HD1  2  
ATOM   2952  H  HD2  . TYR A 1 49  ? 0.957   -8.754  6.082   1.00 0.00 ? 204 TYR A HD2  2  
ATOM   2953  H  HE1  . TYR A 1 49  ? 2.679   -9.831  1.557   1.00 0.00 ? 204 TYR A HE1  2  
ATOM   2954  H  HE2  . TYR A 1 49  ? 3.374   -8.510  5.585   1.00 0.00 ? 204 TYR A HE2  2  
ATOM   2955  H  HH   . TYR A 1 49  ? 4.961   -9.846  3.483   1.00 0.00 ? 204 TYR A HH   2  
ATOM   2956  N  N    . MET A 1 50  ? -2.357  -11.987 6.064   1.00 0.00 ? 205 MET A N    2  
ATOM   2957  C  CA   . MET A 1 50  ? -2.277  -12.951 7.213   1.00 0.00 ? 205 MET A CA   2  
ATOM   2958  C  C    . MET A 1 50  ? -2.990  -14.260 6.838   1.00 0.00 ? 205 MET A C    2  
ATOM   2959  O  O    . MET A 1 50  ? -2.506  -15.338 7.129   1.00 0.00 ? 205 MET A O    2  
ATOM   2960  C  CB   . MET A 1 50  ? -2.979  -12.266 8.397   1.00 0.00 ? 205 MET A CB   2  
ATOM   2961  C  CG   . MET A 1 50  ? -2.954  -13.191 9.617   1.00 0.00 ? 205 MET A CG   2  
ATOM   2962  S  SD   . MET A 1 50  ? -3.274  -12.223 11.113  1.00 0.00 ? 205 MET A SD   2  
ATOM   2963  C  CE   . MET A 1 50  ? -5.076  -12.378 11.101  1.00 0.00 ? 205 MET A CE   2  
ATOM   2964  H  H    . MET A 1 50  ? -3.137  -11.390 5.976   1.00 0.00 ? 205 MET A H    2  
ATOM   2965  H  HA   . MET A 1 50  ? -1.249  -13.149 7.460   1.00 0.00 ? 205 MET A HA   2  
ATOM   2966  H  HB2  . MET A 1 50  ? -2.468  -11.344 8.633   1.00 0.00 ? 205 MET A HB2  2  
ATOM   2967  H  HB3  . MET A 1 50  ? -4.004  -12.053 8.132   1.00 0.00 ? 205 MET A HB3  2  
ATOM   2968  H  HG2  . MET A 1 50  ? -3.715  -13.949 9.507   1.00 0.00 ? 205 MET A HG2  2  
ATOM   2969  H  HG3  . MET A 1 50  ? -1.985  -13.660 9.692   1.00 0.00 ? 205 MET A HG3  2  
ATOM   2970  H  HE1  . MET A 1 50  ? -5.458  -12.212 12.100  1.00 0.00 ? 205 MET A HE1  2  
ATOM   2971  H  HE2  . MET A 1 50  ? -5.353  -13.366 10.772  1.00 0.00 ? 205 MET A HE2  2  
ATOM   2972  H  HE3  . MET A 1 50  ? -5.495  -11.646 10.424  1.00 0.00 ? 205 MET A HE3  2  
ATOM   2973  N  N    . SER A 1 51  ? -4.134  -14.177 6.189   1.00 0.00 ? 206 SER A N    2  
ATOM   2974  C  CA   . SER A 1 51  ? -4.868  -15.437 5.792   1.00 0.00 ? 206 SER A CA   2  
ATOM   2975  C  C    . SER A 1 51  ? -3.958  -16.337 4.941   1.00 0.00 ? 206 SER A C    2  
ATOM   2976  O  O    . SER A 1 51  ? -3.975  -17.546 5.076   1.00 0.00 ? 206 SER A O    2  
ATOM   2977  C  CB   . SER A 1 51  ? -6.090  -15.002 4.970   1.00 0.00 ? 206 SER A CB   2  
ATOM   2978  O  OG   . SER A 1 51  ? -6.753  -16.156 4.467   1.00 0.00 ? 206 SER A OG   2  
ATOM   2979  H  H    . SER A 1 51  ? -4.503  -13.292 5.963   1.00 0.00 ? 206 SER A H    2  
ATOM   2980  H  HA   . SER A 1 51  ? -5.190  -15.965 6.668   1.00 0.00 ? 206 SER A HA   2  
ATOM   2981  H  HB2  . SER A 1 51  ? -6.770  -14.448 5.595   1.00 0.00 ? 206 SER A HB2  2  
ATOM   2982  H  HB3  . SER A 1 51  ? -5.766  -14.375 4.149   1.00 0.00 ? 206 SER A HB3  2  
ATOM   2983  H  HG   . SER A 1 51  ? -7.268  -16.536 5.182   1.00 0.00 ? 206 SER A HG   2  
ATOM   2984  N  N    . ASP A 1 52  ? -3.159  -15.758 4.069   1.00 0.00 ? 207 ASP A N    2  
ATOM   2985  C  CA   . ASP A 1 52  ? -2.249  -16.587 3.221   1.00 0.00 ? 207 ASP A CA   2  
ATOM   2986  C  C    . ASP A 1 52  ? -0.788  -16.343 3.624   1.00 0.00 ? 207 ASP A C    2  
ATOM   2987  O  O    . ASP A 1 52  ? -0.422  -15.244 3.998   1.00 0.00 ? 207 ASP A O    2  
ATOM   2988  C  CB   . ASP A 1 52  ? -2.496  -16.119 1.784   1.00 0.00 ? 207 ASP A CB   2  
ATOM   2989  C  CG   . ASP A 1 52  ? -3.561  -17.005 1.134   1.00 0.00 ? 207 ASP A CG   2  
ATOM   2990  O  OD1  . ASP A 1 52  ? -4.541  -17.302 1.795   1.00 0.00 ? 207 ASP A OD1  2  
ATOM   2991  O  OD2  . ASP A 1 52  ? -3.377  -17.371 -0.015  1.00 0.00 ? 207 ASP A OD2  2  
ATOM   2992  H  H    . ASP A 1 52  ? -3.154  -14.779 3.975   1.00 0.00 ? 207 ASP A H    2  
ATOM   2993  H  HA   . ASP A 1 52  ? -2.495  -17.633 3.315   1.00 0.00 ? 207 ASP A HA   2  
ATOM   2994  H  HB2  . ASP A 1 52  ? -2.836  -15.094 1.793   1.00 0.00 ? 207 ASP A HB2  2  
ATOM   2995  H  HB3  . ASP A 1 52  ? -1.578  -16.189 1.220   1.00 0.00 ? 207 ASP A HB3  2  
ATOM   2996  N  N    . ASP A 1 53  ? 0.052   -17.355 3.553   1.00 0.00 ? 208 ASP A N    2  
ATOM   2997  C  CA   . ASP A 1 53  ? 1.486   -17.166 3.935   1.00 0.00 ? 208 ASP A CA   2  
ATOM   2998  C  C    . ASP A 1 53  ? 2.384   -17.274 2.697   1.00 0.00 ? 208 ASP A C    2  
ATOM   2999  O  O    . ASP A 1 53  ? 2.032   -17.920 1.728   1.00 0.00 ? 208 ASP A O    2  
ATOM   3000  C  CB   . ASP A 1 53  ? 1.794   -18.294 4.923   1.00 0.00 ? 208 ASP A CB   2  
ATOM   3001  C  CG   . ASP A 1 53  ? 1.595   -17.787 6.353   1.00 0.00 ? 208 ASP A CG   2  
ATOM   3002  O  OD1  . ASP A 1 53  ? 0.493   -17.368 6.664   1.00 0.00 ? 208 ASP A OD1  2  
ATOM   3003  O  OD2  . ASP A 1 53  ? 2.549   -17.829 7.113   1.00 0.00 ? 208 ASP A OD2  2  
ATOM   3004  H  H    . ASP A 1 53  ? -0.258  -18.237 3.247   1.00 0.00 ? 208 ASP A H    2  
ATOM   3005  H  HA   . ASP A 1 53  ? 1.627   -16.209 4.413   1.00 0.00 ? 208 ASP A HA   2  
ATOM   3006  H  HB2  . ASP A 1 53  ? 1.129   -19.124 4.739   1.00 0.00 ? 208 ASP A HB2  2  
ATOM   3007  H  HB3  . ASP A 1 53  ? 2.816   -18.614 4.796   1.00 0.00 ? 208 ASP A HB3  2  
ATOM   3008  N  N    . ILE A 1 54  ? 3.542   -16.647 2.718   1.00 0.00 ? 209 ILE A N    2  
ATOM   3009  C  CA   . ILE A 1 54  ? 4.454   -16.724 1.532   1.00 0.00 ? 209 ILE A CA   2  
ATOM   3010  C  C    . ILE A 1 54  ? 5.606   -17.699 1.815   1.00 0.00 ? 209 ILE A C    2  
ATOM   3011  O  O    . ILE A 1 54  ? 6.082   -17.791 2.931   1.00 0.00 ? 209 ILE A O    2  
ATOM   3012  C  CB   . ILE A 1 54  ? 4.994   -15.301 1.322   1.00 0.00 ? 209 ILE A CB   2  
ATOM   3013  C  CG1  . ILE A 1 54  ? 3.826   -14.316 1.134   1.00 0.00 ? 209 ILE A CG1  2  
ATOM   3014  C  CG2  . ILE A 1 54  ? 5.894   -15.271 0.081   1.00 0.00 ? 209 ILE A CG2  2  
ATOM   3015  C  CD1  . ILE A 1 54  ? 2.970   -14.722 -0.073  1.00 0.00 ? 209 ILE A CD1  2  
ATOM   3016  H  H    . ILE A 1 54  ? 3.810   -16.130 3.513   1.00 0.00 ? 209 ILE A H    2  
ATOM   3017  H  HA   . ILE A 1 54  ? 3.904   -17.040 0.659   1.00 0.00 ? 209 ILE A HA   2  
ATOM   3018  H  HB   . ILE A 1 54  ? 5.573   -15.010 2.187   1.00 0.00 ? 209 ILE A HB   2  
ATOM   3019  H  HG12 . ILE A 1 54  ? 3.212   -14.318 2.024   1.00 0.00 ? 209 ILE A HG12 2  
ATOM   3020  H  HG13 . ILE A 1 54  ? 4.218   -13.323 0.974   1.00 0.00 ? 209 ILE A HG13 2  
ATOM   3021  H  HG21 . ILE A 1 54  ? 5.537   -15.991 -0.640  1.00 0.00 ? 209 ILE A HG21 2  
ATOM   3022  H  HG22 . ILE A 1 54  ? 6.908   -15.518 0.365   1.00 0.00 ? 209 ILE A HG22 2  
ATOM   3023  H  HG23 . ILE A 1 54  ? 5.873   -14.283 -0.355  1.00 0.00 ? 209 ILE A HG23 2  
ATOM   3024  H  HD11 . ILE A 1 54  ? 2.743   -13.847 -0.665  1.00 0.00 ? 209 ILE A HD11 2  
ATOM   3025  H  HD12 . ILE A 1 54  ? 2.051   -15.171 0.272   1.00 0.00 ? 209 ILE A HD12 2  
ATOM   3026  H  HD13 . ILE A 1 54  ? 3.514   -15.435 -0.677  1.00 0.00 ? 209 ILE A HD13 2  
ATOM   3027  N  N    . SER A 1 55  ? 6.062   -18.425 0.815   1.00 0.00 ? 210 SER A N    2  
ATOM   3028  C  CA   . SER A 1 55  ? 7.186   -19.384 1.040   1.00 0.00 ? 210 SER A CA   2  
ATOM   3029  C  C    . SER A 1 55  ? 8.438   -18.907 0.292   1.00 0.00 ? 210 SER A C    2  
ATOM   3030  O  O    . SER A 1 55  ? 8.493   -17.782 -0.170  1.00 0.00 ? 210 SER A O    2  
ATOM   3031  C  CB   . SER A 1 55  ? 6.696   -20.719 0.473   1.00 0.00 ? 210 SER A CB   2  
ATOM   3032  O  OG   . SER A 1 55  ? 7.580   -21.755 0.883   1.00 0.00 ? 210 SER A OG   2  
ATOM   3033  H  H    . SER A 1 55  ? 5.670   -18.336 -0.084  1.00 0.00 ? 210 SER A H    2  
ATOM   3034  H  HA   . SER A 1 55  ? 7.391   -19.484 2.094   1.00 0.00 ? 210 SER A HA   2  
ATOM   3035  H  HB2  . SER A 1 55  ? 5.707   -20.929 0.845   1.00 0.00 ? 210 SER A HB2  2  
ATOM   3036  H  HB3  . SER A 1 55  ? 6.668   -20.661 -0.606  1.00 0.00 ? 210 SER A HB3  2  
ATOM   3037  H  HG   . SER A 1 55  ? 7.348   -22.005 1.781   1.00 0.00 ? 210 SER A HG   2  
ATOM   3038  N  N    . ARG A 1 56  ? 9.447   -19.745 0.167   1.00 0.00 ? 211 ARG A N    2  
ATOM   3039  C  CA   . ARG A 1 56  ? 10.684  -19.319 -0.553  1.00 0.00 ? 211 ARG A CA   2  
ATOM   3040  C  C    . ARG A 1 56  ? 10.908  -20.203 -1.791  1.00 0.00 ? 211 ARG A C    2  
ATOM   3041  O  O    . ARG A 1 56  ? 10.743  -21.408 -1.733  1.00 0.00 ? 211 ARG A O    2  
ATOM   3042  C  CB   . ARG A 1 56  ? 11.818  -19.501 0.457   1.00 0.00 ? 211 ARG A CB   2  
ATOM   3043  C  CG   . ARG A 1 56  ? 11.568  -18.608 1.676   1.00 0.00 ? 211 ARG A CG   2  
ATOM   3044  C  CD   . ARG A 1 56  ? 10.883  -19.421 2.780   1.00 0.00 ? 211 ARG A CD   2  
ATOM   3045  N  NE   . ARG A 1 56  ? 11.954  -19.693 3.780   1.00 0.00 ? 211 ARG A NE   2  
ATOM   3046  C  CZ   . ARG A 1 56  ? 12.222  -20.922 4.129   1.00 0.00 ? 211 ARG A CZ   2  
ATOM   3047  N  NH1  . ARG A 1 56  ? 11.270  -21.696 4.574   1.00 0.00 ? 211 ARG A NH1  2  
ATOM   3048  N  NH2  . ARG A 1 56  ? 13.442  -21.375 4.035   1.00 0.00 ? 211 ARG A NH2  2  
ATOM   3049  H  H    . ARG A 1 56  ? 9.393   -20.651 0.543   1.00 0.00 ? 211 ARG A H    2  
ATOM   3050  H  HA   . ARG A 1 56  ? 10.611  -18.282 -0.842  1.00 0.00 ? 211 ARG A HA   2  
ATOM   3051  H  HB2  . ARG A 1 56  ? 11.860  -20.535 0.768   1.00 0.00 ? 211 ARG A HB2  2  
ATOM   3052  H  HB3  . ARG A 1 56  ? 12.753  -19.224 -0.002  1.00 0.00 ? 211 ARG A HB3  2  
ATOM   3053  H  HG2  . ARG A 1 56  ? 12.512  -18.228 2.041   1.00 0.00 ? 211 ARG A HG2  2  
ATOM   3054  H  HG3  . ARG A 1 56  ? 10.934  -17.782 1.394   1.00 0.00 ? 211 ARG A HG3  2  
ATOM   3055  H  HD2  . ARG A 1 56  ? 10.086  -18.843 3.229   1.00 0.00 ? 211 ARG A HD2  2  
ATOM   3056  H  HD3  . ARG A 1 56  ? 10.501  -20.349 2.386   1.00 0.00 ? 211 ARG A HD3  2  
ATOM   3057  H  HE   . ARG A 1 56  ? 12.456  -18.951 4.174   1.00 0.00 ? 211 ARG A HE   2  
ATOM   3058  H  HH11 . ARG A 1 56  ? 10.335  -21.348 4.647   1.00 0.00 ? 211 ARG A HH11 2  
ATOM   3059  H  HH12 . ARG A 1 56  ? 11.475  -22.637 4.842   1.00 0.00 ? 211 ARG A HH12 2  
ATOM   3060  H  HH21 . ARG A 1 56  ? 14.171  -20.782 3.695   1.00 0.00 ? 211 ARG A HH21 2  
ATOM   3061  H  HH22 . ARG A 1 56  ? 13.647  -22.316 4.303   1.00 0.00 ? 211 ARG A HH22 2  
ATOM   3062  N  N    . ASP A 1 57  ? 11.274  -19.617 -2.915  1.00 0.00 ? 212 ASP A N    2  
ATOM   3063  C  CA   . ASP A 1 57  ? 11.495  -20.446 -4.160  1.00 0.00 ? 212 ASP A CA   2  
ATOM   3064  C  C    . ASP A 1 57  ? 12.483  -21.597 -3.888  1.00 0.00 ? 212 ASP A C    2  
ATOM   3065  O  O    . ASP A 1 57  ? 12.992  -21.736 -2.793  1.00 0.00 ? 212 ASP A O    2  
ATOM   3066  C  CB   . ASP A 1 57  ? 12.073  -19.503 -5.233  1.00 0.00 ? 212 ASP A CB   2  
ATOM   3067  C  CG   . ASP A 1 57  ? 11.536  -19.903 -6.609  1.00 0.00 ? 212 ASP A CG   2  
ATOM   3068  O  OD1  . ASP A 1 57  ? 10.381  -20.286 -6.685  1.00 0.00 ? 212 ASP A OD1  2  
ATOM   3069  O  OD2  . ASP A 1 57  ? 12.291  -19.818 -7.564  1.00 0.00 ? 212 ASP A OD2  2  
ATOM   3070  H  H    . ASP A 1 57  ? 11.392  -18.638 -2.939  1.00 0.00 ? 212 ASP A H    2  
ATOM   3071  H  HA   . ASP A 1 57  ? 10.556  -20.849 -4.501  1.00 0.00 ? 212 ASP A HA   2  
ATOM   3072  H  HB2  . ASP A 1 57  ? 11.780  -18.485 -5.019  1.00 0.00 ? 212 ASP A HB2  2  
ATOM   3073  H  HB3  . ASP A 1 57  ? 13.150  -19.576 -5.235  1.00 0.00 ? 212 ASP A HB3  2  
ATOM   3074  N  N    . SER A 1 58  ? 12.753  -22.428 -4.880  1.00 0.00 ? 213 SER A N    2  
ATOM   3075  C  CA   . SER A 1 58  ? 13.712  -23.580 -4.668  1.00 0.00 ? 213 SER A CA   2  
ATOM   3076  C  C    . SER A 1 58  ? 15.043  -23.104 -4.050  1.00 0.00 ? 213 SER A C    2  
ATOM   3077  O  O    . SER A 1 58  ? 15.693  -23.854 -3.347  1.00 0.00 ? 213 SER A O    2  
ATOM   3078  C  CB   . SER A 1 58  ? 13.974  -24.190 -6.052  1.00 0.00 ? 213 SER A CB   2  
ATOM   3079  O  OG   . SER A 1 58  ? 14.832  -25.316 -5.914  1.00 0.00 ? 213 SER A OG   2  
ATOM   3080  H  H    . SER A 1 58  ? 12.322  -22.299 -5.757  1.00 0.00 ? 213 SER A H    2  
ATOM   3081  H  HA   . SER A 1 58  ? 13.257  -24.320 -4.029  1.00 0.00 ? 213 SER A HA   2  
ATOM   3082  H  HB2  . SER A 1 58  ? 13.043  -24.507 -6.491  1.00 0.00 ? 213 SER A HB2  2  
ATOM   3083  H  HB3  . SER A 1 58  ? 14.436  -23.448 -6.690  1.00 0.00 ? 213 SER A HB3  2  
ATOM   3084  H  HG   . SER A 1 58  ? 15.731  -24.993 -5.815  1.00 0.00 ? 213 SER A HG   2  
ATOM   3085  N  N    . ASP A 1 59  ? 15.460  -21.874 -4.297  1.00 0.00 ? 214 ASP A N    2  
ATOM   3086  C  CA   . ASP A 1 59  ? 16.755  -21.396 -3.703  1.00 0.00 ? 214 ASP A CA   2  
ATOM   3087  C  C    . ASP A 1 59  ? 16.515  -20.563 -2.429  1.00 0.00 ? 214 ASP A C    2  
ATOM   3088  O  O    . ASP A 1 59  ? 17.283  -19.669 -2.126  1.00 0.00 ? 214 ASP A O    2  
ATOM   3089  C  CB   . ASP A 1 59  ? 17.411  -20.526 -4.781  1.00 0.00 ? 214 ASP A CB   2  
ATOM   3090  C  CG   . ASP A 1 59  ? 18.916  -20.437 -4.523  1.00 0.00 ? 214 ASP A CG   2  
ATOM   3091  O  OD1  . ASP A 1 59  ? 19.523  -21.474 -4.311  1.00 0.00 ? 214 ASP A OD1  2  
ATOM   3092  O  OD2  . ASP A 1 59  ? 19.437  -19.334 -4.542  1.00 0.00 ? 214 ASP A OD2  2  
ATOM   3093  H  H    . ASP A 1 59  ? 14.930  -21.272 -4.866  1.00 0.00 ? 214 ASP A H    2  
ATOM   3094  H  HA   . ASP A 1 59  ? 17.393  -22.236 -3.480  1.00 0.00 ? 214 ASP A HA   2  
ATOM   3095  H  HB2  . ASP A 1 59  ? 17.236  -20.964 -5.753  1.00 0.00 ? 214 ASP A HB2  2  
ATOM   3096  H  HB3  . ASP A 1 59  ? 16.984  -19.534 -4.750  1.00 0.00 ? 214 ASP A HB3  2  
ATOM   3097  N  N    . GLY A 1 60  ? 15.468  -20.841 -1.673  1.00 0.00 ? 215 GLY A N    2  
ATOM   3098  C  CA   . GLY A 1 60  ? 15.214  -20.054 -0.429  1.00 0.00 ? 215 GLY A CA   2  
ATOM   3099  C  C    . GLY A 1 60  ? 15.046  -18.562 -0.764  1.00 0.00 ? 215 GLY A C    2  
ATOM   3100  O  O    . GLY A 1 60  ? 15.427  -17.708 0.017   1.00 0.00 ? 215 GLY A O    2  
ATOM   3101  H  H    . GLY A 1 60  ? 14.851  -21.564 -1.916  1.00 0.00 ? 215 GLY A H    2  
ATOM   3102  H  HA2  . GLY A 1 60  ? 14.318  -20.421 0.049   1.00 0.00 ? 215 GLY A HA2  2  
ATOM   3103  H  HA3  . GLY A 1 60  ? 16.050  -20.173 0.245   1.00 0.00 ? 215 GLY A HA3  2  
ATOM   3104  N  N    . MET A 1 61  ? 14.478  -18.229 -1.909  1.00 0.00 ? 216 MET A N    2  
ATOM   3105  C  CA   . MET A 1 61  ? 14.298  -16.789 -2.261  1.00 0.00 ? 216 MET A CA   2  
ATOM   3106  C  C    . MET A 1 61  ? 12.801  -16.450 -2.347  1.00 0.00 ? 216 MET A C    2  
ATOM   3107  O  O    . MET A 1 61  ? 12.057  -17.104 -3.055  1.00 0.00 ? 216 MET A O    2  
ATOM   3108  C  CB   . MET A 1 61  ? 14.965  -16.624 -3.627  1.00 0.00 ? 216 MET A CB   2  
ATOM   3109  C  CG   . MET A 1 61  ? 15.332  -15.155 -3.842  1.00 0.00 ? 216 MET A CG   2  
ATOM   3110  S  SD   . MET A 1 61  ? 15.861  -14.910 -5.556  1.00 0.00 ? 216 MET A SD   2  
ATOM   3111  C  CE   . MET A 1 61  ? 17.574  -14.446 -5.201  1.00 0.00 ? 216 MET A CE   2  
ATOM   3112  H  H    . MET A 1 61  ? 14.170  -18.922 -2.534  1.00 0.00 ? 216 MET A H    2  
ATOM   3113  H  HA   . MET A 1 61  ? 14.785  -16.159 -1.533  1.00 0.00 ? 216 MET A HA   2  
ATOM   3114  H  HB2  . MET A 1 61  ? 15.859  -17.229 -3.665  1.00 0.00 ? 216 MET A HB2  2  
ATOM   3115  H  HB3  . MET A 1 61  ? 14.283  -16.941 -4.402  1.00 0.00 ? 216 MET A HB3  2  
ATOM   3116  H  HG2  . MET A 1 61  ? 14.471  -14.536 -3.640  1.00 0.00 ? 216 MET A HG2  2  
ATOM   3117  H  HG3  . MET A 1 61  ? 16.136  -14.883 -3.175  1.00 0.00 ? 216 MET A HG3  2  
ATOM   3118  H  HE1  . MET A 1 61  ? 18.161  -14.523 -6.105  1.00 0.00 ? 216 MET A HE1  2  
ATOM   3119  H  HE2  . MET A 1 61  ? 17.980  -15.108 -4.453  1.00 0.00 ? 216 MET A HE2  2  
ATOM   3120  H  HE3  . MET A 1 61  ? 17.601  -13.430 -4.832  1.00 0.00 ? 216 MET A HE3  2  
ATOM   3121  N  N    . ASP A 1 62  ? 12.346  -15.438 -1.632  1.00 0.00 ? 217 ASP A N    2  
ATOM   3122  C  CA   . ASP A 1 62  ? 10.880  -15.078 -1.689  1.00 0.00 ? 217 ASP A CA   2  
ATOM   3123  C  C    . ASP A 1 62  ? 10.461  -14.787 -3.140  1.00 0.00 ? 217 ASP A C    2  
ATOM   3124  O  O    . ASP A 1 62  ? 11.066  -13.972 -3.809  1.00 0.00 ? 217 ASP A O    2  
ATOM   3125  C  CB   . ASP A 1 62  ? 10.700  -13.817 -0.828  1.00 0.00 ? 217 ASP A CB   2  
ATOM   3126  C  CG   . ASP A 1 62  ? 10.402  -14.224 0.616   1.00 0.00 ? 217 ASP A CG   2  
ATOM   3127  O  OD1  . ASP A 1 62  ? 9.470   -14.985 0.817   1.00 0.00 ? 217 ASP A OD1  2  
ATOM   3128  O  OD2  . ASP A 1 62  ? 11.112  -13.767 1.497   1.00 0.00 ? 217 ASP A OD2  2  
ATOM   3129  H  H    . ASP A 1 62  ? 12.967  -14.922 -1.062  1.00 0.00 ? 217 ASP A H    2  
ATOM   3130  H  HA   . ASP A 1 62  ? 10.284  -15.883 -1.286  1.00 0.00 ? 217 ASP A HA   2  
ATOM   3131  H  HB2  . ASP A 1 62  ? 11.605  -13.228 -0.858  1.00 0.00 ? 217 ASP A HB2  2  
ATOM   3132  H  HB3  . ASP A 1 62  ? 9.877   -13.234 -1.212  1.00 0.00 ? 217 ASP A HB3  2  
ATOM   3133  N  N    . GLU A 1 63  ? 9.427   -15.442 -3.631  1.00 0.00 ? 218 GLU A N    2  
ATOM   3134  C  CA   . GLU A 1 63  ? 8.978   -15.189 -5.032  1.00 0.00 ? 218 GLU A CA   2  
ATOM   3135  C  C    . GLU A 1 63  ? 7.544   -14.642 -5.032  1.00 0.00 ? 218 GLU A C    2  
ATOM   3136  O  O    . GLU A 1 63  ? 6.728   -15.025 -5.849  1.00 0.00 ? 218 GLU A O    2  
ATOM   3137  C  CB   . GLU A 1 63  ? 9.039   -16.550 -5.727  1.00 0.00 ? 218 GLU A CB   2  
ATOM   3138  C  CG   . GLU A 1 63  ? 9.299   -16.349 -7.222  1.00 0.00 ? 218 GLU A CG   2  
ATOM   3139  C  CD   . GLU A 1 63  ? 10.163  -17.496 -7.751  1.00 0.00 ? 218 GLU A CD   2  
ATOM   3140  O  OE1  . GLU A 1 63  ? 11.376  -17.376 -7.688  1.00 0.00 ? 218 GLU A OE1  2  
ATOM   3141  O  OE2  . GLU A 1 63  ? 9.597   -18.476 -8.206  1.00 0.00 ? 218 GLU A OE2  2  
ATOM   3142  H  H    . GLU A 1 63  ? 8.943   -16.093 -3.078  1.00 0.00 ? 218 GLU A H    2  
ATOM   3143  H  HA   . GLU A 1 63  ? 9.641   -14.494 -5.517  1.00 0.00 ? 218 GLU A HA   2  
ATOM   3144  H  HB2  . GLU A 1 63  ? 9.838   -17.138 -5.297  1.00 0.00 ? 218 GLU A HB2  2  
ATOM   3145  H  HB3  . GLU A 1 63  ? 8.100   -17.066 -5.593  1.00 0.00 ? 218 GLU A HB3  2  
ATOM   3146  H  HG2  . GLU A 1 63  ? 8.357   -16.334 -7.752  1.00 0.00 ? 218 GLU A HG2  2  
ATOM   3147  H  HG3  . GLU A 1 63  ? 9.814   -15.413 -7.375  1.00 0.00 ? 218 GLU A HG3  2  
ATOM   3148  N  N    . GLN A 1 64  ? 7.233   -13.746 -4.121  1.00 0.00 ? 219 GLN A N    2  
ATOM   3149  C  CA   . GLN A 1 64  ? 5.856   -13.171 -4.069  1.00 0.00 ? 219 GLN A CA   2  
ATOM   3150  C  C    . GLN A 1 64  ? 5.931   -11.663 -3.772  1.00 0.00 ? 219 GLN A C    2  
ATOM   3151  O  O    . GLN A 1 64  ? 6.946   -11.175 -3.315  1.00 0.00 ? 219 GLN A O    2  
ATOM   3152  C  CB   . GLN A 1 64  ? 5.153   -13.916 -2.929  1.00 0.00 ? 219 GLN A CB   2  
ATOM   3153  C  CG   . GLN A 1 64  ? 3.754   -14.350 -3.380  1.00 0.00 ? 219 GLN A CG   2  
ATOM   3154  C  CD   . GLN A 1 64  ? 3.872   -15.361 -4.528  1.00 0.00 ? 219 GLN A CD   2  
ATOM   3155  O  OE1  . GLN A 1 64  ? 3.862   -14.983 -5.683  1.00 0.00 ? 219 GLN A OE1  2  
ATOM   3156  N  NE2  . GLN A 1 64  ? 3.987   -16.641 -4.264  1.00 0.00 ? 219 GLN A NE2  2  
ATOM   3157  H  H    . GLN A 1 64  ? 7.907   -13.448 -3.471  1.00 0.00 ? 219 GLN A H    2  
ATOM   3158  H  HA   . GLN A 1 64  ? 5.341   -13.345 -5.001  1.00 0.00 ? 219 GLN A HA   2  
ATOM   3159  H  HB2  . GLN A 1 64  ? 5.731   -14.790 -2.661  1.00 0.00 ? 219 GLN A HB2  2  
ATOM   3160  H  HB3  . GLN A 1 64  ? 5.066   -13.266 -2.071  1.00 0.00 ? 219 GLN A HB3  2  
ATOM   3161  H  HG2  . GLN A 1 64  ? 3.235   -14.807 -2.551  1.00 0.00 ? 219 GLN A HG2  2  
ATOM   3162  H  HG3  . GLN A 1 64  ? 3.202   -13.487 -3.719  1.00 0.00 ? 219 GLN A HG3  2  
ATOM   3163  H  HE21 . GLN A 1 64  ? 3.997   -16.958 -3.335  1.00 0.00 ? 219 GLN A HE21 2  
ATOM   3164  H  HE22 . GLN A 1 64  ? 4.061   -17.284 -4.999  1.00 0.00 ? 219 GLN A HE22 2  
ATOM   3165  N  N    . CYS A 1 65  ? 4.872   -10.922 -4.029  1.00 0.00 ? 220 CYS A N    2  
ATOM   3166  C  CA   . CYS A 1 65  ? 4.918   -9.435  -3.756  1.00 0.00 ? 220 CYS A CA   2  
ATOM   3167  C  C    . CYS A 1 65  ? 5.001   -9.159  -2.248  1.00 0.00 ? 220 CYS A C    2  
ATOM   3168  O  O    . CYS A 1 65  ? 4.536   -9.946  -1.445  1.00 0.00 ? 220 CYS A O    2  
ATOM   3169  C  CB   . CYS A 1 65  ? 3.606   -8.853  -4.290  1.00 0.00 ? 220 CYS A CB   2  
ATOM   3170  S  SG   . CYS A 1 65  ? 3.671   -7.047  -4.245  1.00 0.00 ? 220 CYS A SG   2  
ATOM   3171  H  H    . CYS A 1 65  ? 4.053   -11.339 -4.405  1.00 0.00 ? 220 CYS A H    2  
ATOM   3172  H  HA   . CYS A 1 65  ? 5.752   -8.981  -4.269  1.00 0.00 ? 220 CYS A HA   2  
ATOM   3173  H  HB2  . CYS A 1 65  ? 3.446   -9.185  -5.303  1.00 0.00 ? 220 CYS A HB2  2  
ATOM   3174  H  HB3  . CYS A 1 65  ? 2.794   -9.190  -3.667  1.00 0.00 ? 220 CYS A HB3  2  
ATOM   3175  N  N    . ARG A 1 66  ? 5.549   -8.024  -1.857  1.00 0.00 ? 221 ARG A N    2  
ATOM   3176  C  CA   . ARG A 1 66  ? 5.605   -7.685  -0.400  1.00 0.00 ? 221 ARG A CA   2  
ATOM   3177  C  C    . ARG A 1 66  ? 4.527   -6.626  -0.082  1.00 0.00 ? 221 ARG A C    2  
ATOM   3178  O  O    . ARG A 1 66  ? 4.731   -5.756  0.742   1.00 0.00 ? 221 ARG A O    2  
ATOM   3179  C  CB   . ARG A 1 66  ? 7.009   -7.117  -0.158  1.00 0.00 ? 221 ARG A CB   2  
ATOM   3180  C  CG   . ARG A 1 66  ? 7.904   -8.205  0.440   1.00 0.00 ? 221 ARG A CG   2  
ATOM   3181  C  CD   . ARG A 1 66  ? 7.422   -8.544  1.853   1.00 0.00 ? 221 ARG A CD   2  
ATOM   3182  N  NE   . ARG A 1 66  ? 8.655   -8.909  2.603   1.00 0.00 ? 221 ARG A NE   2  
ATOM   3183  C  CZ   . ARG A 1 66  ? 8.736   -10.066 3.201   1.00 0.00 ? 221 ARG A CZ   2  
ATOM   3184  N  NH1  . ARG A 1 66  ? 8.355   -11.150 2.582   1.00 0.00 ? 221 ARG A NH1  2  
ATOM   3185  N  NH2  . ARG A 1 66  ? 9.198   -10.139 4.420   1.00 0.00 ? 221 ARG A NH2  2  
ATOM   3186  H  H    . ARG A 1 66  ? 5.891   -7.381  -2.520  1.00 0.00 ? 221 ARG A H    2  
ATOM   3187  H  HA   . ARG A 1 66  ? 5.452   -8.570  0.197   1.00 0.00 ? 221 ARG A HA   2  
ATOM   3188  H  HB2  . ARG A 1 66  ? 7.428   -6.781  -1.096  1.00 0.00 ? 221 ARG A HB2  2  
ATOM   3189  H  HB3  . ARG A 1 66  ? 6.949   -6.287  0.529   1.00 0.00 ? 221 ARG A HB3  2  
ATOM   3190  H  HG2  . ARG A 1 66  ? 7.859   -9.090  -0.179  1.00 0.00 ? 221 ARG A HG2  2  
ATOM   3191  H  HG3  . ARG A 1 66  ? 8.923   -7.850  0.485   1.00 0.00 ? 221 ARG A HG3  2  
ATOM   3192  H  HD2  . ARG A 1 66  ? 6.946   -7.683  2.302   1.00 0.00 ? 221 ARG A HD2  2  
ATOM   3193  H  HD3  . ARG A 1 66  ? 6.743   -9.381  1.828   1.00 0.00 ? 221 ARG A HD3  2  
ATOM   3194  H  HE   . ARG A 1 66  ? 9.406   -8.280  2.649   1.00 0.00 ? 221 ARG A HE   2  
ATOM   3195  H  HH11 . ARG A 1 66  ? 8.001   -11.094 1.649   1.00 0.00 ? 221 ARG A HH11 2  
ATOM   3196  H  HH12 . ARG A 1 66  ? 8.418   -12.036 3.041   1.00 0.00 ? 221 ARG A HH12 2  
ATOM   3197  H  HH21 . ARG A 1 66  ? 9.490   -9.309  4.894   1.00 0.00 ? 221 ARG A HH21 2  
ATOM   3198  H  HH22 . ARG A 1 66  ? 9.260   -11.026 4.879   1.00 0.00 ? 221 ARG A HH22 2  
ATOM   3199  N  N    . TRP A 1 67  ? 3.377   -6.696  -0.734  1.00 0.00 ? 222 TRP A N    2  
ATOM   3200  C  CA   . TRP A 1 67  ? 2.290   -5.701  -0.474  1.00 0.00 ? 222 TRP A CA   2  
ATOM   3201  C  C    . TRP A 1 67  ? 0.918   -6.359  -0.712  1.00 0.00 ? 222 TRP A C    2  
ATOM   3202  O  O    . TRP A 1 67  ? 0.103   -6.456  0.184   1.00 0.00 ? 222 TRP A O    2  
ATOM   3203  C  CB   . TRP A 1 67  ? 2.517   -4.580  -1.501  1.00 0.00 ? 222 TRP A CB   2  
ATOM   3204  C  CG   . TRP A 1 67  ? 2.412   -3.244  -0.834  1.00 0.00 ? 222 TRP A CG   2  
ATOM   3205  C  CD1  . TRP A 1 67  ? 1.526   -2.919  0.139   1.00 0.00 ? 222 TRP A CD1  2  
ATOM   3206  C  CD2  . TRP A 1 67  ? 3.203   -2.050  -1.080  1.00 0.00 ? 222 TRP A CD2  2  
ATOM   3207  N  NE1  . TRP A 1 67  ? 1.743   -1.609  0.521   1.00 0.00 ? 222 TRP A NE1  2  
ATOM   3208  C  CE2  . TRP A 1 67  ? 2.764   -1.030  -0.206  1.00 0.00 ? 222 TRP A CE2  2  
ATOM   3209  C  CE3  . TRP A 1 67  ? 4.255   -1.757  -1.965  1.00 0.00 ? 222 TRP A CE3  2  
ATOM   3210  C  CZ2  . TRP A 1 67  ? 3.353   0.232   -0.208  1.00 0.00 ? 222 TRP A CZ2  2  
ATOM   3211  C  CZ3  . TRP A 1 67  ? 4.843   -0.483  -1.973  1.00 0.00 ? 222 TRP A CZ3  2  
ATOM   3212  C  CH2  . TRP A 1 67  ? 4.395   0.508   -1.093  1.00 0.00 ? 222 TRP A CH2  2  
ATOM   3213  H  H    . TRP A 1 67  ? 3.225   -7.405  -1.394  1.00 0.00 ? 222 TRP A H    2  
ATOM   3214  H  HA   . TRP A 1 67  ? 2.362   -5.309  0.531   1.00 0.00 ? 222 TRP A HA   2  
ATOM   3215  H  HB2  . TRP A 1 67  ? 3.500   -4.686  -1.933  1.00 0.00 ? 222 TRP A HB2  2  
ATOM   3216  H  HB3  . TRP A 1 67  ? 1.775   -4.649  -2.283  1.00 0.00 ? 222 TRP A HB3  2  
ATOM   3217  H  HD1  . TRP A 1 67  ? 0.781   -3.581  0.557   1.00 0.00 ? 222 TRP A HD1  2  
ATOM   3218  H  HE1  . TRP A 1 67  ? 1.242   -1.131  1.213   1.00 0.00 ? 222 TRP A HE1  2  
ATOM   3219  H  HE3  . TRP A 1 67  ? 4.606   -2.515  -2.649  1.00 0.00 ? 222 TRP A HE3  2  
ATOM   3220  H  HZ2  . TRP A 1 67  ? 3.013   0.984   0.478   1.00 0.00 ? 222 TRP A HZ2  2  
ATOM   3221  H  HZ3  . TRP A 1 67  ? 5.647   -0.267  -2.657  1.00 0.00 ? 222 TRP A HZ3  2  
ATOM   3222  H  HH2  . TRP A 1 67  ? 4.850   1.486   -1.105  1.00 0.00 ? 222 TRP A HH2  2  
ATOM   3223  N  N    . CYS A 1 68  ? 0.672   -6.826  -1.921  1.00 0.00 ? 223 CYS A N    2  
ATOM   3224  C  CA   . CYS A 1 68  ? -0.638  -7.496  -2.218  1.00 0.00 ? 223 CYS A CA   2  
ATOM   3225  C  C    . CYS A 1 68  ? -0.532  -9.042  -2.103  1.00 0.00 ? 223 CYS A C    2  
ATOM   3226  O  O    . CYS A 1 68  ? -1.521  -9.732  -2.259  1.00 0.00 ? 223 CYS A O    2  
ATOM   3227  C  CB   . CYS A 1 68  ? -1.036  -7.054  -3.646  1.00 0.00 ? 223 CYS A CB   2  
ATOM   3228  S  SG   . CYS A 1 68  ? 0.083   -7.751  -4.898  1.00 0.00 ? 223 CYS A SG   2  
ATOM   3229  H  H    . CYS A 1 68  ? 1.354   -6.747  -2.625  1.00 0.00 ? 223 CYS A H    2  
ATOM   3230  H  HA   . CYS A 1 68  ? -1.381  -7.140  -1.521  1.00 0.00 ? 223 CYS A HA   2  
ATOM   3231  H  HB2  . CYS A 1 68  ? -2.041  -7.387  -3.852  1.00 0.00 ? 223 CYS A HB2  2  
ATOM   3232  H  HB3  . CYS A 1 68  ? -1.004  -5.976  -3.704  1.00 0.00 ? 223 CYS A HB3  2  
ATOM   3233  N  N    . ALA A 1 69  ? 0.642   -9.598  -1.825  1.00 0.00 ? 224 ALA A N    2  
ATOM   3234  C  CA   . ALA A 1 69  ? 0.777   -11.086 -1.693  1.00 0.00 ? 224 ALA A CA   2  
ATOM   3235  C  C    . ALA A 1 69  ? 0.285   -11.793 -2.964  1.00 0.00 ? 224 ALA A C    2  
ATOM   3236  O  O    . ALA A 1 69  ? -0.449  -12.760 -2.897  1.00 0.00 ? 224 ALA A O    2  
ATOM   3237  C  CB   . ALA A 1 69  ? -0.071  -11.481 -0.481  1.00 0.00 ? 224 ALA A CB   2  
ATOM   3238  H  H    . ALA A 1 69  ? 1.438   -9.046  -1.698  1.00 0.00 ? 224 ALA A H    2  
ATOM   3239  H  HA   . ALA A 1 69  ? 1.809   -11.344 -1.510  1.00 0.00 ? 224 ALA A HA   2  
ATOM   3240  H  HB1  . ALA A 1 69  ? -0.932  -10.834 -0.414  1.00 0.00 ? 224 ALA A HB1  2  
ATOM   3241  H  HB2  . ALA A 1 69  ? 0.520   -11.386 0.419   1.00 0.00 ? 224 ALA A HB2  2  
ATOM   3242  H  HB3  . ALA A 1 69  ? -0.398  -12.505 -0.590  1.00 0.00 ? 224 ALA A HB3  2  
ATOM   3243  N  N    . GLU A 1 70  ? 0.703   -11.330 -4.121  1.00 0.00 ? 225 GLU A N    2  
ATOM   3244  C  CA   . GLU A 1 70  ? 0.284   -11.983 -5.392  1.00 0.00 ? 225 GLU A CA   2  
ATOM   3245  C  C    . GLU A 1 70  ? 1.535   -12.475 -6.133  1.00 0.00 ? 225 GLU A C    2  
ATOM   3246  O  O    . GLU A 1 70  ? 2.627   -12.416 -5.597  1.00 0.00 ? 225 GLU A O    2  
ATOM   3247  C  CB   . GLU A 1 70  ? -0.427  -10.887 -6.189  1.00 0.00 ? 225 GLU A CB   2  
ATOM   3248  C  CG   . GLU A 1 70  ? -1.704  -10.466 -5.457  1.00 0.00 ? 225 GLU A CG   2  
ATOM   3249  C  CD   . GLU A 1 70  ? -2.555  -9.591  -6.378  1.00 0.00 ? 225 GLU A CD   2  
ATOM   3250  O  OE1  . GLU A 1 70  ? -1.994  -8.715  -7.016  1.00 0.00 ? 225 GLU A OE1  2  
ATOM   3251  O  OE2  . GLU A 1 70  ? -3.754  -9.810  -6.432  1.00 0.00 ? 225 GLU A OE2  2  
ATOM   3252  H  H    . GLU A 1 70  ? 1.309   -10.560 -4.155  1.00 0.00 ? 225 GLU A H    2  
ATOM   3253  H  HA   . GLU A 1 70  ? -0.391  -12.801 -5.196  1.00 0.00 ? 225 GLU A HA   2  
ATOM   3254  H  HB2  . GLU A 1 70  ? 0.229   -10.034 -6.292  1.00 0.00 ? 225 GLU A HB2  2  
ATOM   3255  H  HB3  . GLU A 1 70  ? -0.683  -11.262 -7.169  1.00 0.00 ? 225 GLU A HB3  2  
ATOM   3256  H  HG2  . GLU A 1 70  ? -2.265  -11.348 -5.178  1.00 0.00 ? 225 GLU A HG2  2  
ATOM   3257  H  HG3  . GLU A 1 70  ? -1.446  -9.907  -4.569  1.00 0.00 ? 225 GLU A HG3  2  
ATOM   3258  N  N    . GLY A 1 71  ? 1.403   -12.961 -7.349  1.00 0.00 ? 226 GLY A N    2  
ATOM   3259  C  CA   . GLY A 1 71  ? 2.608   -13.448 -8.083  1.00 0.00 ? 226 GLY A CA   2  
ATOM   3260  C  C    . GLY A 1 71  ? 2.651   -12.834 -9.491  1.00 0.00 ? 226 GLY A C    2  
ATOM   3261  O  O    . GLY A 1 71  ? 2.233   -11.709 -9.691  1.00 0.00 ? 226 GLY A O    2  
ATOM   3262  H  H    . GLY A 1 71  ? 0.518   -13.007 -7.776  1.00 0.00 ? 226 GLY A H    2  
ATOM   3263  H  HA2  . GLY A 1 71  ? 3.496   -13.158 -7.535  1.00 0.00 ? 226 GLY A HA2  2  
ATOM   3264  H  HA3  . GLY A 1 71  ? 2.570   -14.524 -8.164  1.00 0.00 ? 226 GLY A HA3  2  
ATOM   3265  N  N    . GLY A 1 72  ? 3.159   -13.559 -10.469 1.00 0.00 ? 227 GLY A N    2  
ATOM   3266  C  CA   . GLY A 1 72  ? 3.230   -13.007 -11.855 1.00 0.00 ? 227 GLY A CA   2  
ATOM   3267  C  C    . GLY A 1 72  ? 4.587   -12.319 -12.058 1.00 0.00 ? 227 GLY A C    2  
ATOM   3268  O  O    . GLY A 1 72  ? 5.583   -12.740 -11.499 1.00 0.00 ? 227 GLY A O    2  
ATOM   3269  H  H    . GLY A 1 72  ? 3.497   -14.466 -10.293 1.00 0.00 ? 227 GLY A H    2  
ATOM   3270  H  HA2  . GLY A 1 72  ? 3.120   -13.811 -12.570 1.00 0.00 ? 227 GLY A HA2  2  
ATOM   3271  H  HA3  . GLY A 1 72  ? 2.440   -12.286 -11.997 1.00 0.00 ? 227 GLY A HA3  2  
ATOM   3272  N  N    . ASN A 1 73  ? 4.642   -11.261 -12.844 1.00 0.00 ? 228 ASN A N    2  
ATOM   3273  C  CA   . ASN A 1 73  ? 5.960   -10.559 -13.052 1.00 0.00 ? 228 ASN A CA   2  
ATOM   3274  C  C    . ASN A 1 73  ? 6.368   -9.852  -11.754 1.00 0.00 ? 228 ASN A C    2  
ATOM   3275  O  O    . ASN A 1 73  ? 5.667   -8.976  -11.281 1.00 0.00 ? 228 ASN A O    2  
ATOM   3276  C  CB   . ASN A 1 73  ? 5.743   -9.531  -14.175 1.00 0.00 ? 228 ASN A CB   2  
ATOM   3277  C  CG   . ASN A 1 73  ? 7.040   -9.370  -14.978 1.00 0.00 ? 228 ASN A CG   2  
ATOM   3278  O  OD1  . ASN A 1 73  ? 7.819   -8.476  -14.715 1.00 0.00 ? 228 ASN A OD1  2  
ATOM   3279  N  ND2  . ASN A 1 73  ? 7.311   -10.202 -15.955 1.00 0.00 ? 228 ASN A ND2  2  
ATOM   3280  H  H    . ASN A 1 73  ? 3.822   -10.929 -13.282 1.00 0.00 ? 228 ASN A H    2  
ATOM   3281  H  HA   . ASN A 1 73  ? 6.717   -11.269 -13.344 1.00 0.00 ? 228 ASN A HA   2  
ATOM   3282  H  HB2  . ASN A 1 73  ? 4.954   -9.872  -14.827 1.00 0.00 ? 228 ASN A HB2  2  
ATOM   3283  H  HB3  . ASN A 1 73  ? 5.469   -8.579  -13.743 1.00 0.00 ? 228 ASN A HB3  2  
ATOM   3284  H  HD21 . ASN A 1 73  ? 6.688   -10.929 -16.176 1.00 0.00 ? 228 ASN A HD21 2  
ATOM   3285  H  HD22 . ASN A 1 73  ? 8.140   -10.097 -16.468 1.00 0.00 ? 228 ASN A HD22 2  
ATOM   3286  N  N    . LEU A 1 74  ? 7.486   -10.226 -11.161 1.00 0.00 ? 229 LEU A N    2  
ATOM   3287  C  CA   . LEU A 1 74  ? 7.902   -9.565  -9.886  1.00 0.00 ? 229 LEU A CA   2  
ATOM   3288  C  C    . LEU A 1 74  ? 9.300   -8.939  -10.020 1.00 0.00 ? 229 LEU A C    2  
ATOM   3289  O  O    . LEU A 1 74  ? 10.036  -9.242  -10.940 1.00 0.00 ? 229 LEU A O    2  
ATOM   3290  C  CB   . LEU A 1 74  ? 7.931   -10.682 -8.836  1.00 0.00 ? 229 LEU A CB   2  
ATOM   3291  C  CG   . LEU A 1 74  ? 6.556   -11.351 -8.731  1.00 0.00 ? 229 LEU A CG   2  
ATOM   3292  C  CD1  . LEU A 1 74  ? 6.706   -12.710 -8.042  1.00 0.00 ? 229 LEU A CD1  2  
ATOM   3293  C  CD2  . LEU A 1 74  ? 5.619   -10.470 -7.905  1.00 0.00 ? 229 LEU A CD2  2  
ATOM   3294  H  H    . LEU A 1 74  ? 8.042   -10.940 -11.543 1.00 0.00 ? 229 LEU A H    2  
ATOM   3295  H  HA   . LEU A 1 74  ? 7.181   -8.817  -9.608  1.00 0.00 ? 229 LEU A HA   2  
ATOM   3296  H  HB2  . LEU A 1 74  ? 8.666   -11.421 -9.121  1.00 0.00 ? 229 LEU A HB2  2  
ATOM   3297  H  HB3  . LEU A 1 74  ? 8.198   -10.264 -7.878  1.00 0.00 ? 229 LEU A HB3  2  
ATOM   3298  H  HG   . LEU A 1 74  ? 6.146   -11.492 -9.720  1.00 0.00 ? 229 LEU A HG   2  
ATOM   3299  H  HD11 . LEU A 1 74  ? 5.732   -13.073 -7.750  1.00 0.00 ? 229 LEU A HD11 2  
ATOM   3300  H  HD12 . LEU A 1 74  ? 7.328   -12.602 -7.166  1.00 0.00 ? 229 LEU A HD12 2  
ATOM   3301  H  HD13 . LEU A 1 74  ? 7.162   -13.411 -8.725  1.00 0.00 ? 229 LEU A HD13 2  
ATOM   3302  H  HD21 . LEU A 1 74  ? 6.196   -9.899  -7.193  1.00 0.00 ? 229 LEU A HD21 2  
ATOM   3303  H  HD22 . LEU A 1 74  ? 4.910   -11.092 -7.377  1.00 0.00 ? 229 LEU A HD22 2  
ATOM   3304  H  HD23 . LEU A 1 74  ? 5.090   -9.797  -8.561  1.00 0.00 ? 229 LEU A HD23 2  
ATOM   3305  N  N    . ILE A 1 75  ? 9.679   -8.076  -9.096  1.00 0.00 ? 230 ILE A N    2  
ATOM   3306  C  CA   . ILE A 1 75  ? 11.032  -7.445  -9.158  1.00 0.00 ? 230 ILE A CA   2  
ATOM   3307  C  C    . ILE A 1 75  ? 11.862  -7.894  -7.947  1.00 0.00 ? 230 ILE A C    2  
ATOM   3308  O  O    . ILE A 1 75  ? 11.708  -7.362  -6.863  1.00 0.00 ? 230 ILE A O    2  
ATOM   3309  C  CB   . ILE A 1 75  ? 10.780  -5.933  -9.109  1.00 0.00 ? 230 ILE A CB   2  
ATOM   3310  C  CG1  . ILE A 1 75  ? 10.016  -5.508  -10.365 1.00 0.00 ? 230 ILE A CG1  2  
ATOM   3311  C  CG2  . ILE A 1 75  ? 12.116  -5.174  -9.041  1.00 0.00 ? 230 ILE A CG2  2  
ATOM   3312  C  CD1  . ILE A 1 75  ? 9.672   -4.017  -10.281 1.00 0.00 ? 230 ILE A CD1  2  
ATOM   3313  H  H    . ILE A 1 75  ? 9.077   -7.849  -8.352  1.00 0.00 ? 230 ILE A H    2  
ATOM   3314  H  HA   . ILE A 1 75  ? 11.531  -7.711  -10.078 1.00 0.00 ? 230 ILE A HA   2  
ATOM   3315  H  HB   . ILE A 1 75  ? 10.192  -5.699  -8.233  1.00 0.00 ? 230 ILE A HB   2  
ATOM   3316  H  HG12 . ILE A 1 75  ? 10.629  -5.685  -11.237 1.00 0.00 ? 230 ILE A HG12 2  
ATOM   3317  H  HG13 . ILE A 1 75  ? 9.104   -6.080  -10.444 1.00 0.00 ? 230 ILE A HG13 2  
ATOM   3318  H  HG21 . ILE A 1 75  ? 12.772  -5.525  -9.824  1.00 0.00 ? 230 ILE A HG21 2  
ATOM   3319  H  HG22 . ILE A 1 75  ? 12.581  -5.342  -8.079  1.00 0.00 ? 230 ILE A HG22 2  
ATOM   3320  H  HG23 . ILE A 1 75  ? 11.935  -4.116  -9.171  1.00 0.00 ? 230 ILE A HG23 2  
ATOM   3321  H  HD11 . ILE A 1 75  ? 9.761   -3.685  -9.255  1.00 0.00 ? 230 ILE A HD11 2  
ATOM   3322  H  HD12 . ILE A 1 75  ? 8.661   -3.860  -10.624 1.00 0.00 ? 230 ILE A HD12 2  
ATOM   3323  H  HD13 . ILE A 1 75  ? 10.356  -3.456  -10.900 1.00 0.00 ? 230 ILE A HD13 2  
ATOM   3324  N  N    . CYS A 1 76  ? 12.742  -8.859  -8.115  1.00 0.00 ? 231 CYS A N    2  
ATOM   3325  C  CA   . CYS A 1 76  ? 13.573  -9.314  -6.944  1.00 0.00 ? 231 CYS A CA   2  
ATOM   3326  C  C    . CYS A 1 76  ? 14.386  -8.134  -6.393  1.00 0.00 ? 231 CYS A C    2  
ATOM   3327  O  O    . CYS A 1 76  ? 14.785  -7.255  -7.134  1.00 0.00 ? 231 CYS A O    2  
ATOM   3328  C  CB   . CYS A 1 76  ? 14.516  -10.409 -7.467  1.00 0.00 ? 231 CYS A CB   2  
ATOM   3329  S  SG   . CYS A 1 76  ? 13.675  -12.010 -7.408  1.00 0.00 ? 231 CYS A SG   2  
ATOM   3330  H  H    . CYS A 1 76  ? 12.853  -9.274  -9.004  1.00 0.00 ? 231 CYS A H    2  
ATOM   3331  H  HA   . CYS A 1 76  ? 12.935  -9.714  -6.169  1.00 0.00 ? 231 CYS A HA   2  
ATOM   3332  H  HB2  . CYS A 1 76  ? 14.793  -10.186 -8.487  1.00 0.00 ? 231 CYS A HB2  2  
ATOM   3333  H  HB3  . CYS A 1 76  ? 15.404  -10.445 -6.853  1.00 0.00 ? 231 CYS A HB3  2  
ATOM   3334  H  HG   . CYS A 1 76  ? 12.838  -11.890 -6.953  1.00 0.00 ? 231 CYS A HG   2  
ATOM   3335  N  N    . CYS A 1 77  ? 14.633  -8.103  -5.101  1.00 0.00 ? 232 CYS A N    2  
ATOM   3336  C  CA   . CYS A 1 77  ? 15.417  -6.969  -4.519  1.00 0.00 ? 232 CYS A CA   2  
ATOM   3337  C  C    . CYS A 1 77  ? 16.845  -7.424  -4.188  1.00 0.00 ? 232 CYS A C    2  
ATOM   3338  O  O    . CYS A 1 77  ? 17.079  -8.582  -3.900  1.00 0.00 ? 232 CYS A O    2  
ATOM   3339  C  CB   . CYS A 1 77  ? 14.669  -6.564  -3.242  1.00 0.00 ? 232 CYS A CB   2  
ATOM   3340  S  SG   . CYS A 1 77  ? 15.505  -5.160  -2.457  1.00 0.00 ? 232 CYS A SG   2  
ATOM   3341  H  H    . CYS A 1 77  ? 14.303  -8.823  -4.515  1.00 0.00 ? 232 CYS A H    2  
ATOM   3342  H  HA   . CYS A 1 77  ? 15.440  -6.140  -5.209  1.00 0.00 ? 232 CYS A HA   2  
ATOM   3343  H  HB2  . CYS A 1 77  ? 13.657  -6.284  -3.492  1.00 0.00 ? 232 CYS A HB2  2  
ATOM   3344  H  HB3  . CYS A 1 77  ? 14.650  -7.399  -2.557  1.00 0.00 ? 232 CYS A HB3  2  
ATOM   3345  N  N    . ASP A 1 78  ? 17.799  -6.517  -4.213  1.00 0.00 ? 233 ASP A N    2  
ATOM   3346  C  CA   . ASP A 1 78  ? 19.206  -6.904  -3.882  1.00 0.00 ? 233 ASP A CA   2  
ATOM   3347  C  C    . ASP A 1 78  ? 19.584  -6.348  -2.501  1.00 0.00 ? 233 ASP A C    2  
ATOM   3348  O  O    . ASP A 1 78  ? 20.685  -5.867  -2.307  1.00 0.00 ? 233 ASP A O    2  
ATOM   3349  C  CB   . ASP A 1 78  ? 20.075  -6.275  -4.975  1.00 0.00 ? 233 ASP A CB   2  
ATOM   3350  C  CG   . ASP A 1 78  ? 20.218  -7.254  -6.142  1.00 0.00 ? 233 ASP A CG   2  
ATOM   3351  O  OD1  . ASP A 1 78  ? 19.241  -7.909  -6.463  1.00 0.00 ? 233 ASP A OD1  2  
ATOM   3352  O  OD2  . ASP A 1 78  ? 21.304  -7.333  -6.693  1.00 0.00 ? 233 ASP A OD2  2  
ATOM   3353  H  H    . ASP A 1 78  ? 17.589  -5.578  -4.438  1.00 0.00 ? 233 ASP A H    2  
ATOM   3354  H  HA   . ASP A 1 78  ? 19.312  -7.978  -3.897  1.00 0.00 ? 233 ASP A HA   2  
ATOM   3355  H  HB2  . ASP A 1 78  ? 19.611  -5.364  -5.323  1.00 0.00 ? 233 ASP A HB2  2  
ATOM   3356  H  HB3  . ASP A 1 78  ? 21.052  -6.051  -4.573  1.00 0.00 ? 233 ASP A HB3  2  
ATOM   3357  N  N    . PHE A 1 79  ? 18.680  -6.402  -1.541  1.00 0.00 ? 234 PHE A N    2  
ATOM   3358  C  CA   . PHE A 1 79  ? 19.000  -5.866  -0.184  1.00 0.00 ? 234 PHE A CA   2  
ATOM   3359  C  C    . PHE A 1 79  ? 18.205  -6.617  0.902   1.00 0.00 ? 234 PHE A C    2  
ATOM   3360  O  O    . PHE A 1 79  ? 18.784  -7.196  1.802   1.00 0.00 ? 234 PHE A O    2  
ATOM   3361  C  CB   . PHE A 1 79  ? 18.578  -4.396  -0.234  1.00 0.00 ? 234 PHE A CB   2  
ATOM   3362  C  CG   . PHE A 1 79  ? 19.648  -3.562  -0.907  1.00 0.00 ? 234 PHE A CG   2  
ATOM   3363  C  CD1  . PHE A 1 79  ? 20.991  -3.684  -0.525  1.00 0.00 ? 234 PHE A CD1  2  
ATOM   3364  C  CD2  . PHE A 1 79  ? 19.289  -2.656  -1.913  1.00 0.00 ? 234 PHE A CD2  2  
ATOM   3365  C  CE1  . PHE A 1 79  ? 21.971  -2.902  -1.149  1.00 0.00 ? 234 PHE A CE1  2  
ATOM   3366  C  CE2  . PHE A 1 79  ? 20.267  -1.875  -2.536  1.00 0.00 ? 234 PHE A CE2  2  
ATOM   3367  C  CZ   . PHE A 1 79  ? 21.609  -1.998  -2.153  1.00 0.00 ? 234 PHE A CZ   2  
ATOM   3368  H  H    . PHE A 1 79  ? 17.793  -6.789  -1.714  1.00 0.00 ? 234 PHE A H    2  
ATOM   3369  H  HA   . PHE A 1 79  ? 20.058  -5.938  0.008   1.00 0.00 ? 234 PHE A HA   2  
ATOM   3370  H  HB2  . PHE A 1 79  ? 17.659  -4.310  -0.792  1.00 0.00 ? 234 PHE A HB2  2  
ATOM   3371  H  HB3  . PHE A 1 79  ? 18.421  -4.034  0.772   1.00 0.00 ? 234 PHE A HB3  2  
ATOM   3372  H  HD1  . PHE A 1 79  ? 21.272  -4.381  0.251   1.00 0.00 ? 234 PHE A HD1  2  
ATOM   3373  H  HD2  . PHE A 1 79  ? 18.256  -2.561  -2.210  1.00 0.00 ? 234 PHE A HD2  2  
ATOM   3374  H  HE1  . PHE A 1 79  ? 23.006  -2.996  -0.855  1.00 0.00 ? 234 PHE A HE1  2  
ATOM   3375  H  HE2  . PHE A 1 79  ? 19.987  -1.174  -3.307  1.00 0.00 ? 234 PHE A HE2  2  
ATOM   3376  H  HZ   . PHE A 1 79  ? 22.365  -1.394  -2.636  1.00 0.00 ? 234 PHE A HZ   2  
ATOM   3377  N  N    . CYS A 1 80  ? 16.885  -6.610  0.835   1.00 0.00 ? 235 CYS A N    2  
ATOM   3378  C  CA   . CYS A 1 80  ? 16.083  -7.333  1.886   1.00 0.00 ? 235 CYS A CA   2  
ATOM   3379  C  C    . CYS A 1 80  ? 15.645  -8.745  1.425   1.00 0.00 ? 235 CYS A C    2  
ATOM   3380  O  O    . CYS A 1 80  ? 14.723  -9.310  1.981   1.00 0.00 ? 235 CYS A O    2  
ATOM   3381  C  CB   . CYS A 1 80  ? 14.857  -6.442  2.183   1.00 0.00 ? 235 CYS A CB   2  
ATOM   3382  S  SG   . CYS A 1 80  ? 13.752  -6.346  0.742   1.00 0.00 ? 235 CYS A SG   2  
ATOM   3383  H  H    . CYS A 1 80  ? 16.430  -6.136  0.102   1.00 0.00 ? 235 CYS A H    2  
ATOM   3384  H  HA   . CYS A 1 80  ? 16.675  -7.422  2.785   1.00 0.00 ? 235 CYS A HA   2  
ATOM   3385  H  HB2  . CYS A 1 80  ? 14.312  -6.854  3.017   1.00 0.00 ? 235 CYS A HB2  2  
ATOM   3386  H  HB3  . CYS A 1 80  ? 15.195  -5.448  2.439   1.00 0.00 ? 235 CYS A HB3  2  
ATOM   3387  N  N    . HIS A 1 81  ? 16.299  -9.333  0.437   1.00 0.00 ? 236 HIS A N    2  
ATOM   3388  C  CA   . HIS A 1 81  ? 15.913  -10.712 -0.021  1.00 0.00 ? 236 HIS A CA   2  
ATOM   3389  C  C    . HIS A 1 81  ? 14.394  -10.829 -0.273  1.00 0.00 ? 236 HIS A C    2  
ATOM   3390  O  O    . HIS A 1 81  ? 13.736  -11.685 0.290   1.00 0.00 ? 236 HIS A O    2  
ATOM   3391  C  CB   . HIS A 1 81  ? 16.338  -11.637 1.122   1.00 0.00 ? 236 HIS A CB   2  
ATOM   3392  C  CG   . HIS A 1 81  ? 17.833  -11.805 1.104   1.00 0.00 ? 236 HIS A CG   2  
ATOM   3393  N  ND1  . HIS A 1 81  ? 18.645  -11.302 2.109   1.00 0.00 ? 236 HIS A ND1  2  
ATOM   3394  C  CD2  . HIS A 1 81  ? 18.676  -12.420 0.212   1.00 0.00 ? 236 HIS A CD2  2  
ATOM   3395  C  CE1  . HIS A 1 81  ? 19.916  -11.622 1.801   1.00 0.00 ? 236 HIS A CE1  2  
ATOM   3396  N  NE2  . HIS A 1 81  ? 19.990  -12.303 0.654   1.00 0.00 ? 236 HIS A NE2  2  
ATOM   3397  H  H    . HIS A 1 81  ? 17.052  -8.882  0.001   1.00 0.00 ? 236 HIS A H    2  
ATOM   3398  H  HA   . HIS A 1 81  ? 16.458  -10.970 -0.915  1.00 0.00 ? 236 HIS A HA   2  
ATOM   3399  H  HB2  . HIS A 1 81  ? 16.035  -11.206 2.065   1.00 0.00 ? 236 HIS A HB2  2  
ATOM   3400  H  HB3  . HIS A 1 81  ? 15.867  -12.601 1.000   1.00 0.00 ? 236 HIS A HB3  2  
ATOM   3401  H  HD1  . HIS A 1 81  ? 18.348  -10.805 2.899   1.00 0.00 ? 236 HIS A HD1  2  
ATOM   3402  H  HD2  . HIS A 1 81  ? 18.367  -12.920 -0.694  1.00 0.00 ? 236 HIS A HD2  2  
ATOM   3403  H  HE1  . HIS A 1 81  ? 20.769  -11.359 2.407   1.00 0.00 ? 236 HIS A HE1  2  
ATOM   3404  N  N    . ASN A 1 82  ? 13.833  -9.991  -1.121  1.00 0.00 ? 237 ASN A N    2  
ATOM   3405  C  CA   . ASN A 1 82  ? 12.361  -10.081 -1.403  1.00 0.00 ? 237 ASN A CA   2  
ATOM   3406  C  C    . ASN A 1 82  ? 12.045  -9.497  -2.790  1.00 0.00 ? 237 ASN A C    2  
ATOM   3407  O  O    . ASN A 1 82  ? 12.856  -8.797  -3.364  1.00 0.00 ? 237 ASN A O    2  
ATOM   3408  C  CB   . ASN A 1 82  ? 11.687  -9.255  -0.308  1.00 0.00 ? 237 ASN A CB   2  
ATOM   3409  C  CG   . ASN A 1 82  ? 11.616  -10.076 0.986   1.00 0.00 ? 237 ASN A CG   2  
ATOM   3410  O  OD1  . ASN A 1 82  ? 12.273  -9.752  1.955   1.00 0.00 ? 237 ASN A OD1  2  
ATOM   3411  N  ND2  . ASN A 1 82  ? 10.842  -11.132 1.049   1.00 0.00 ? 237 ASN A ND2  2  
ATOM   3412  H  H    . ASN A 1 82  ? 14.377  -9.310  -1.575  1.00 0.00 ? 237 ASN A H    2  
ATOM   3413  H  HA   . ASN A 1 82  ? 12.032  -11.107 -1.345  1.00 0.00 ? 237 ASN A HA   2  
ATOM   3414  H  HB2  . ASN A 1 82  ? 12.255  -8.357  -0.135  1.00 0.00 ? 237 ASN A HB2  2  
ATOM   3415  H  HB3  . ASN A 1 82  ? 10.687  -8.993  -0.620  1.00 0.00 ? 237 ASN A HB3  2  
ATOM   3416  H  HD21 . ASN A 1 82  ? 10.306  -11.404 0.272   1.00 0.00 ? 237 ASN A HD21 2  
ATOM   3417  H  HD22 . ASN A 1 82  ? 10.798  -11.654 1.878   1.00 0.00 ? 237 ASN A HD22 2  
ATOM   3418  N  N    . ALA A 1 83  ? 10.880  -9.778  -3.337  1.00 0.00 ? 238 ALA A N    2  
ATOM   3419  C  CA   . ALA A 1 83  ? 10.538  -9.234  -4.687  1.00 0.00 ? 238 ALA A CA   2  
ATOM   3420  C  C    . ALA A 1 83  ? 9.117   -8.643  -4.690  1.00 0.00 ? 238 ALA A C    2  
ATOM   3421  O  O    . ALA A 1 83  ? 8.217   -9.188  -4.081  1.00 0.00 ? 238 ALA A O    2  
ATOM   3422  C  CB   . ALA A 1 83  ? 10.611  -10.441 -5.623  1.00 0.00 ? 238 ALA A CB   2  
ATOM   3423  H  H    . ALA A 1 83  ? 10.233  -10.348 -2.866  1.00 0.00 ? 238 ALA A H    2  
ATOM   3424  H  HA   . ALA A 1 83  ? 11.261  -8.494  -4.989  1.00 0.00 ? 238 ALA A HA   2  
ATOM   3425  H  HB1  . ALA A 1 83  ? 11.021  -10.135 -6.573  1.00 0.00 ? 238 ALA A HB1  2  
ATOM   3426  H  HB2  . ALA A 1 83  ? 9.619   -10.843 -5.772  1.00 0.00 ? 238 ALA A HB2  2  
ATOM   3427  H  HB3  . ALA A 1 83  ? 11.245  -11.199 -5.184  1.00 0.00 ? 238 ALA A HB3  2  
ATOM   3428  N  N    . PHE A 1 84  ? 8.899   -7.543  -5.387  1.00 0.00 ? 239 PHE A N    2  
ATOM   3429  C  CA   . PHE A 1 84  ? 7.521   -6.947  -5.437  1.00 0.00 ? 239 PHE A CA   2  
ATOM   3430  C  C    . PHE A 1 84  ? 6.862   -7.325  -6.770  1.00 0.00 ? 239 PHE A C    2  
ATOM   3431  O  O    . PHE A 1 84  ? 7.432   -8.073  -7.539  1.00 0.00 ? 239 PHE A O    2  
ATOM   3432  C  CB   . PHE A 1 84  ? 7.710   -5.427  -5.341  1.00 0.00 ? 239 PHE A CB   2  
ATOM   3433  C  CG   . PHE A 1 84  ? 7.729   -5.007  -3.889  1.00 0.00 ? 239 PHE A CG   2  
ATOM   3434  C  CD1  . PHE A 1 84  ? 6.533   -4.689  -3.232  1.00 0.00 ? 239 PHE A CD1  2  
ATOM   3435  C  CD2  . PHE A 1 84  ? 8.944   -4.936  -3.201  1.00 0.00 ? 239 PHE A CD2  2  
ATOM   3436  C  CE1  . PHE A 1 84  ? 6.553   -4.301  -1.885  1.00 0.00 ? 239 PHE A CE1  2  
ATOM   3437  C  CE2  . PHE A 1 84  ? 8.964   -4.549  -1.853  1.00 0.00 ? 239 PHE A CE2  2  
ATOM   3438  C  CZ   . PHE A 1 84  ? 7.771   -4.231  -1.196  1.00 0.00 ? 239 PHE A CZ   2  
ATOM   3439  H  H    . PHE A 1 84  ? 9.634   -7.122  -5.891  1.00 0.00 ? 239 PHE A H    2  
ATOM   3440  H  HA   . PHE A 1 84  ? 6.927   -7.302  -4.608  1.00 0.00 ? 239 PHE A HA   2  
ATOM   3441  H  HB2  . PHE A 1 84  ? 8.645   -5.151  -5.807  1.00 0.00 ? 239 PHE A HB2  2  
ATOM   3442  H  HB3  . PHE A 1 84  ? 6.895   -4.931  -5.846  1.00 0.00 ? 239 PHE A HB3  2  
ATOM   3443  H  HD1  . PHE A 1 84  ? 5.595   -4.743  -3.765  1.00 0.00 ? 239 PHE A HD1  2  
ATOM   3444  H  HD2  . PHE A 1 84  ? 9.867   -5.180  -3.709  1.00 0.00 ? 239 PHE A HD2  2  
ATOM   3445  H  HE1  . PHE A 1 84  ? 5.631   -4.055  -1.377  1.00 0.00 ? 239 PHE A HE1  2  
ATOM   3446  H  HE2  . PHE A 1 84  ? 9.903   -4.496  -1.322  1.00 0.00 ? 239 PHE A HE2  2  
ATOM   3447  H  HZ   . PHE A 1 84  ? 7.787   -3.932  -0.156  1.00 0.00 ? 239 PHE A HZ   2  
ATOM   3448  N  N    . CYS A 1 85  ? 5.677   -6.823  -7.062  1.00 0.00 ? 240 CYS A N    2  
ATOM   3449  C  CA   . CYS A 1 85  ? 5.023   -7.180  -8.360  1.00 0.00 ? 240 CYS A CA   2  
ATOM   3450  C  C    . CYS A 1 85  ? 4.866   -5.930  -9.252  1.00 0.00 ? 240 CYS A C    2  
ATOM   3451  O  O    . CYS A 1 85  ? 5.067   -4.816  -8.806  1.00 0.00 ? 240 CYS A O    2  
ATOM   3452  C  CB   . CYS A 1 85  ? 3.672   -7.844  -7.984  1.00 0.00 ? 240 CYS A CB   2  
ATOM   3453  S  SG   . CYS A 1 85  ? 2.357   -6.631  -7.659  1.00 0.00 ? 240 CYS A SG   2  
ATOM   3454  H  H    . CYS A 1 85  ? 5.227   -6.216  -6.440  1.00 0.00 ? 240 CYS A H    2  
ATOM   3455  H  HA   . CYS A 1 85  ? 5.635   -7.901  -8.874  1.00 0.00 ? 240 CYS A HA   2  
ATOM   3456  H  HB2  . CYS A 1 85  ? 3.359   -8.481  -8.796  1.00 0.00 ? 240 CYS A HB2  2  
ATOM   3457  H  HB3  . CYS A 1 85  ? 3.818   -8.452  -7.103  1.00 0.00 ? 240 CYS A HB3  2  
ATOM   3458  N  N    . LYS A 1 86  ? 4.524   -6.110  -10.512 1.00 0.00 ? 241 LYS A N    2  
ATOM   3459  C  CA   . LYS A 1 86  ? 4.376   -4.919  -11.429 1.00 0.00 ? 241 LYS A CA   2  
ATOM   3460  C  C    . LYS A 1 86  ? 3.081   -4.133  -11.134 1.00 0.00 ? 241 LYS A C    2  
ATOM   3461  O  O    . LYS A 1 86  ? 3.043   -2.928  -11.301 1.00 0.00 ? 241 LYS A O    2  
ATOM   3462  C  CB   . LYS A 1 86  ? 4.334   -5.480  -12.861 1.00 0.00 ? 241 LYS A CB   2  
ATOM   3463  C  CG   . LYS A 1 86  ? 4.989   -4.485  -13.820 1.00 0.00 ? 241 LYS A CG   2  
ATOM   3464  C  CD   . LYS A 1 86  ? 4.558   -4.799  -15.254 1.00 0.00 ? 241 LYS A CD   2  
ATOM   3465  C  CE   . LYS A 1 86  ? 5.563   -5.762  -15.890 1.00 0.00 ? 241 LYS A CE   2  
ATOM   3466  N  NZ   . LYS A 1 86  ? 4.752   -6.623  -16.794 1.00 0.00 ? 241 LYS A NZ   2  
ATOM   3467  H  H    . LYS A 1 86  ? 4.378   -7.025  -10.852 1.00 0.00 ? 241 LYS A H    2  
ATOM   3468  H  HA   . LYS A 1 86  ? 5.229   -4.268  -11.324 1.00 0.00 ? 241 LYS A HA   2  
ATOM   3469  H  HB2  . LYS A 1 86  ? 4.869   -6.419  -12.894 1.00 0.00 ? 241 LYS A HB2  2  
ATOM   3470  H  HB3  . LYS A 1 86  ? 3.309   -5.639  -13.155 1.00 0.00 ? 241 LYS A HB3  2  
ATOM   3471  H  HG2  . LYS A 1 86  ? 4.684   -3.482  -13.562 1.00 0.00 ? 241 LYS A HG2  2  
ATOM   3472  H  HG3  . LYS A 1 86  ? 6.063   -4.566  -13.744 1.00 0.00 ? 241 LYS A HG3  2  
ATOM   3473  H  HD2  . LYS A 1 86  ? 3.578   -5.254  -15.243 1.00 0.00 ? 241 LYS A HD2  2  
ATOM   3474  H  HD3  . LYS A 1 86  ? 4.526   -3.886  -15.828 1.00 0.00 ? 241 LYS A HD3  2  
ATOM   3475  H  HE2  . LYS A 1 86  ? 6.304   -5.212  -16.454 1.00 0.00 ? 241 LYS A HE2  2  
ATOM   3476  H  HE3  . LYS A 1 86  ? 6.037   -6.367  -15.132 1.00 0.00 ? 241 LYS A HE3  2  
ATOM   3477  H  HZ1  . LYS A 1 86  ? 4.023   -7.118  -16.242 1.00 0.00 ? 241 LYS A HZ1  2  
ATOM   3478  H  HZ2  . LYS A 1 86  ? 5.371   -7.321  -17.256 1.00 0.00 ? 241 LYS A HZ2  2  
ATOM   3479  H  HZ3  . LYS A 1 86  ? 4.294   -6.034  -17.517 1.00 0.00 ? 241 LYS A HZ3  2  
ATOM   3480  N  N    . LYS A 1 87  ? 2.019   -4.792  -10.714 1.00 0.00 ? 242 LYS A N    2  
ATOM   3481  C  CA   . LYS A 1 87  ? 0.732   -4.043  -10.436 1.00 0.00 ? 242 LYS A CA   2  
ATOM   3482  C  C    . LYS A 1 87  ? 0.847   -3.101  -9.213  1.00 0.00 ? 242 LYS A C    2  
ATOM   3483  O  O    . LYS A 1 87  ? 0.022   -2.219  -9.047  1.00 0.00 ? 242 LYS A O    2  
ATOM   3484  C  CB   . LYS A 1 87  ? -0.343  -5.108  -10.172 1.00 0.00 ? 242 LYS A CB   2  
ATOM   3485  C  CG   . LYS A 1 87  ? -0.490  -6.004  -11.403 1.00 0.00 ? 242 LYS A CG   2  
ATOM   3486  C  CD   . LYS A 1 87  ? -1.910  -6.569  -11.459 1.00 0.00 ? 242 LYS A CD   2  
ATOM   3487  C  CE   . LYS A 1 87  ? -2.795  -5.644  -12.298 1.00 0.00 ? 242 LYS A CE   2  
ATOM   3488  N  NZ   . LYS A 1 87  ? -3.754  -6.552  -12.988 1.00 0.00 ? 242 LYS A NZ   2  
ATOM   3489  H  H    . LYS A 1 87  ? 2.062   -5.770  -10.593 1.00 0.00 ? 242 LYS A H    2  
ATOM   3490  H  HA   . LYS A 1 87  ? 0.455   -3.469  -11.307 1.00 0.00 ? 242 LYS A HA   2  
ATOM   3491  H  HB2  . LYS A 1 87  ? -0.054  -5.708  -9.322  1.00 0.00 ? 242 LYS A HB2  2  
ATOM   3492  H  HB3  . LYS A 1 87  ? -1.286  -4.625  -9.968  1.00 0.00 ? 242 LYS A HB3  2  
ATOM   3493  H  HG2  . LYS A 1 87  ? -0.296  -5.425  -12.295 1.00 0.00 ? 242 LYS A HG2  2  
ATOM   3494  H  HG3  . LYS A 1 87  ? 0.217   -6.819  -11.343 1.00 0.00 ? 242 LYS A HG3  2  
ATOM   3495  H  HD2  . LYS A 1 87  ? -1.889  -7.553  -11.905 1.00 0.00 ? 242 LYS A HD2  2  
ATOM   3496  H  HD3  . LYS A 1 87  ? -2.310  -6.636  -10.459 1.00 0.00 ? 242 LYS A HD3  2  
ATOM   3497  H  HE2  . LYS A 1 87  ? -3.324  -4.950  -11.658 1.00 0.00 ? 242 LYS A HE2  2  
ATOM   3498  H  HE3  . LYS A 1 87  ? -2.202  -5.112  -13.025 1.00 0.00 ? 242 LYS A HE3  2  
ATOM   3499  H  HZ1  . LYS A 1 87  ? -4.396  -6.975  -12.288 1.00 0.00 ? 242 LYS A HZ1  2  
ATOM   3500  H  HZ2  . LYS A 1 87  ? -3.227  -7.306  -13.476 1.00 0.00 ? 242 LYS A HZ2  2  
ATOM   3501  H  HZ3  . LYS A 1 87  ? -4.308  -6.010  -13.680 1.00 0.00 ? 242 LYS A HZ3  2  
ATOM   3502  N  N    . CYS A 1 88  ? 1.843   -3.259  -8.359  1.00 0.00 ? 243 CYS A N    2  
ATOM   3503  C  CA   . CYS A 1 88  ? 1.950   -2.343  -7.171  1.00 0.00 ? 243 CYS A CA   2  
ATOM   3504  C  C    . CYS A 1 88  ? 2.768   -1.100  -7.543  1.00 0.00 ? 243 CYS A C    2  
ATOM   3505  O  O    . CYS A 1 88  ? 2.418   0.004   -7.170  1.00 0.00 ? 243 CYS A O    2  
ATOM   3506  C  CB   . CYS A 1 88  ? 2.649   -3.145  -6.060  1.00 0.00 ? 243 CYS A CB   2  
ATOM   3507  S  SG   . CYS A 1 88  ? 1.422   -4.114  -5.140  1.00 0.00 ? 243 CYS A SG   2  
ATOM   3508  H  H    . CYS A 1 88  ? 2.512   -3.958  -8.500  1.00 0.00 ? 243 CYS A H    2  
ATOM   3509  H  HA   . CYS A 1 88  ? 0.964   -2.047  -6.846  1.00 0.00 ? 243 CYS A HA   2  
ATOM   3510  H  HB2  . CYS A 1 88  ? 3.375   -3.811  -6.502  1.00 0.00 ? 243 CYS A HB2  2  
ATOM   3511  H  HB3  . CYS A 1 88  ? 3.150   -2.465  -5.387  1.00 0.00 ? 243 CYS A HB3  2  
ATOM   3512  N  N    . ILE A 1 89  ? 3.839   -1.261  -8.296  1.00 0.00 ? 244 ILE A N    2  
ATOM   3513  C  CA   . ILE A 1 89  ? 4.641   -0.053  -8.698  1.00 0.00 ? 244 ILE A CA   2  
ATOM   3514  C  C    . ILE A 1 89  ? 3.826   0.768   -9.709  1.00 0.00 ? 244 ILE A C    2  
ATOM   3515  O  O    . ILE A 1 89  ? 3.823   1.983   -9.658  1.00 0.00 ? 244 ILE A O    2  
ATOM   3516  C  CB   . ILE A 1 89  ? 5.949   -0.569  -9.315  1.00 0.00 ? 244 ILE A CB   2  
ATOM   3517  C  CG1  . ILE A 1 89  ? 6.731   -1.335  -8.248  1.00 0.00 ? 244 ILE A CG1  2  
ATOM   3518  C  CG2  . ILE A 1 89  ? 6.793   0.612   -9.806  1.00 0.00 ? 244 ILE A CG2  2  
ATOM   3519  C  CD1  . ILE A 1 89  ? 7.948   -2.007  -8.885  1.00 0.00 ? 244 ILE A CD1  2  
ATOM   3520  H  H    . ILE A 1 89  ? 4.095   -2.162  -8.608  1.00 0.00 ? 244 ILE A H    2  
ATOM   3521  H  HA   . ILE A 1 89  ? 4.858   0.549   -7.828  1.00 0.00 ? 244 ILE A HA   2  
ATOM   3522  H  HB   . ILE A 1 89  ? 5.725   -1.224  -10.143 1.00 0.00 ? 244 ILE A HB   2  
ATOM   3523  H  HG12 . ILE A 1 89  ? 7.059   -0.647  -7.482  1.00 0.00 ? 244 ILE A HG12 2  
ATOM   3524  H  HG13 . ILE A 1 89  ? 6.096   -2.087  -7.807  1.00 0.00 ? 244 ILE A HG13 2  
ATOM   3525  H  HG21 . ILE A 1 89  ? 6.299   1.084   -10.643 1.00 0.00 ? 244 ILE A HG21 2  
ATOM   3526  H  HG22 . ILE A 1 89  ? 7.764   0.257   -10.115 1.00 0.00 ? 244 ILE A HG22 2  
ATOM   3527  H  HG23 . ILE A 1 89  ? 6.907   1.328   -9.005  1.00 0.00 ? 244 ILE A HG23 2  
ATOM   3528  H  HD11 . ILE A 1 89  ? 7.761   -2.168  -9.937  1.00 0.00 ? 244 ILE A HD11 2  
ATOM   3529  H  HD12 . ILE A 1 89  ? 8.126   -2.956  -8.400  1.00 0.00 ? 244 ILE A HD12 2  
ATOM   3530  H  HD13 . ILE A 1 89  ? 8.813   -1.373  -8.765  1.00 0.00 ? 244 ILE A HD13 2  
ATOM   3531  N  N    . LEU A 1 90  ? 3.107   0.121   -10.614 1.00 0.00 ? 245 LEU A N    2  
ATOM   3532  C  CA   . LEU A 1 90  ? 2.270   0.902   -11.595 1.00 0.00 ? 245 LEU A CA   2  
ATOM   3533  C  C    . LEU A 1 90  ? 1.277   1.793   -10.822 1.00 0.00 ? 245 LEU A C    2  
ATOM   3534  O  O    . LEU A 1 90  ? 1.048   2.930   -11.189 1.00 0.00 ? 245 LEU A O    2  
ATOM   3535  C  CB   . LEU A 1 90  ? 1.513   -0.129  -12.455 1.00 0.00 ? 245 LEU A CB   2  
ATOM   3536  C  CG   . LEU A 1 90  ? 0.579   0.588   -13.437 1.00 0.00 ? 245 LEU A CG   2  
ATOM   3537  C  CD1  . LEU A 1 90  ? 1.406   1.397   -14.438 1.00 0.00 ? 245 LEU A CD1  2  
ATOM   3538  C  CD2  . LEU A 1 90  ? -0.259  -0.447  -14.191 1.00 0.00 ? 245 LEU A CD2  2  
ATOM   3539  H  H    . LEU A 1 90  ? 3.105   -0.863  -10.633 1.00 0.00 ? 245 LEU A H    2  
ATOM   3540  H  HA   . LEU A 1 90  ? 2.905   1.509   -12.217 1.00 0.00 ? 245 LEU A HA   2  
ATOM   3541  H  HB2  . LEU A 1 90  ? 2.224   -0.726  -13.008 1.00 0.00 ? 245 LEU A HB2  2  
ATOM   3542  H  HB3  . LEU A 1 90  ? 0.930   -0.771  -11.813 1.00 0.00 ? 245 LEU A HB3  2  
ATOM   3543  H  HG   . LEU A 1 90  ? -0.074  1.253   -12.892 1.00 0.00 ? 245 LEU A HG   2  
ATOM   3544  H  HD11 . LEU A 1 90  ? 2.017   0.727   -15.025 1.00 0.00 ? 245 LEU A HD11 2  
ATOM   3545  H  HD12 . LEU A 1 90  ? 2.040   2.089   -13.906 1.00 0.00 ? 245 LEU A HD12 2  
ATOM   3546  H  HD13 . LEU A 1 90  ? 0.744   1.946   -15.092 1.00 0.00 ? 245 LEU A HD13 2  
ATOM   3547  H  HD21 . LEU A 1 90  ? -0.803  0.040   -14.986 1.00 0.00 ? 245 LEU A HD21 2  
ATOM   3548  H  HD22 . LEU A 1 90  ? -0.957  -0.911  -13.509 1.00 0.00 ? 245 LEU A HD22 2  
ATOM   3549  H  HD23 . LEU A 1 90  ? 0.391   -1.201  -14.609 1.00 0.00 ? 245 LEU A HD23 2  
ATOM   3550  N  N    . ARG A 1 91  ? 0.700   1.292   -9.743  1.00 0.00 ? 246 ARG A N    2  
ATOM   3551  C  CA   . ARG A 1 91  ? -0.261  2.142   -8.952  1.00 0.00 ? 246 ARG A CA   2  
ATOM   3552  C  C    . ARG A 1 91  ? 0.492   3.114   -8.014  1.00 0.00 ? 246 ARG A C    2  
ATOM   3553  O  O    . ARG A 1 91  ? -0.085  4.079   -7.545  1.00 0.00 ? 246 ARG A O    2  
ATOM   3554  C  CB   . ARG A 1 91  ? -1.123  1.173   -8.130  1.00 0.00 ? 246 ARG A CB   2  
ATOM   3555  C  CG   . ARG A 1 91  ? -1.964  0.310   -9.072  1.00 0.00 ? 246 ARG A CG   2  
ATOM   3556  C  CD   . ARG A 1 91  ? -3.067  1.165   -9.701  1.00 0.00 ? 246 ARG A CD   2  
ATOM   3557  N  NE   . ARG A 1 91  ? -3.802  0.239   -10.607 1.00 0.00 ? 246 ARG A NE   2  
ATOM   3558  C  CZ   . ARG A 1 91  ? -4.640  -0.629  -10.110 1.00 0.00 ? 246 ARG A CZ   2  
ATOM   3559  N  NH1  . ARG A 1 91  ? -5.838  -0.252  -9.755  1.00 0.00 ? 246 ARG A NH1  2  
ATOM   3560  N  NH2  . ARG A 1 91  ? -4.281  -1.876  -9.971  1.00 0.00 ? 246 ARG A NH2  2  
ATOM   3561  H  H    . ARG A 1 91  ? 0.907   0.368   -9.450  1.00 0.00 ? 246 ARG A H    2  
ATOM   3562  H  HA   . ARG A 1 91  ? -0.891  2.702   -9.626  1.00 0.00 ? 246 ARG A HA   2  
ATOM   3563  H  HB2  . ARG A 1 91  ? -0.482  0.538   -7.535  1.00 0.00 ? 246 ARG A HB2  2  
ATOM   3564  H  HB3  . ARG A 1 91  ? -1.777  1.736   -7.480  1.00 0.00 ? 246 ARG A HB3  2  
ATOM   3565  H  HG2  . ARG A 1 91  ? -1.332  -0.094  -9.850  1.00 0.00 ? 246 ARG A HG2  2  
ATOM   3566  H  HG3  . ARG A 1 91  ? -2.413  -0.499  -8.516  1.00 0.00 ? 246 ARG A HG3  2  
ATOM   3567  H  HD2  . ARG A 1 91  ? -3.727  1.549   -8.935  1.00 0.00 ? 246 ARG A HD2  2  
ATOM   3568  H  HD3  . ARG A 1 91  ? -2.638  1.974   -10.270 1.00 0.00 ? 246 ARG A HD3  2  
ATOM   3569  H  HE   . ARG A 1 91  ? -3.657  0.282   -11.575 1.00 0.00 ? 246 ARG A HE   2  
ATOM   3570  H  HH11 . ARG A 1 91  ? -6.113  0.703   -9.861  1.00 0.00 ? 246 ARG A HH11 2  
ATOM   3571  H  HH12 . ARG A 1 91  ? -6.480  -0.917  -9.374  1.00 0.00 ? 246 ARG A HH12 2  
ATOM   3572  H  HH21 . ARG A 1 91  ? -3.364  -2.166  -10.243 1.00 0.00 ? 246 ARG A HH21 2  
ATOM   3573  H  HH22 . ARG A 1 91  ? -4.923  -2.542  -9.590  1.00 0.00 ? 246 ARG A HH22 2  
ATOM   3574  N  N    . ASN A 1 92  ? 1.764   2.883   -7.727  1.00 0.00 ? 247 ASN A N    2  
ATOM   3575  C  CA   . ASN A 1 92  ? 2.507   3.816   -6.816  1.00 0.00 ? 247 ASN A CA   2  
ATOM   3576  C  C    . ASN A 1 92  ? 3.338   4.822   -7.628  1.00 0.00 ? 247 ASN A C    2  
ATOM   3577  O  O    . ASN A 1 92  ? 3.384   5.992   -7.297  1.00 0.00 ? 247 ASN A O    2  
ATOM   3578  C  CB   . ASN A 1 92  ? 3.427   2.930   -5.964  1.00 0.00 ? 247 ASN A CB   2  
ATOM   3579  C  CG   . ASN A 1 92  ? 2.583   1.924   -5.173  1.00 0.00 ? 247 ASN A CG   2  
ATOM   3580  O  OD1  . ASN A 1 92  ? 1.426   2.175   -4.896  1.00 0.00 ? 247 ASN A OD1  2  
ATOM   3581  N  ND2  . ASN A 1 92  ? 3.109   0.784   -4.792  1.00 0.00 ? 247 ASN A ND2  2  
ATOM   3582  H  H    . ASN A 1 92  ? 2.225   2.107   -8.104  1.00 0.00 ? 247 ASN A H    2  
ATOM   3583  H  HA   . ASN A 1 92  ? 1.816   4.339   -6.182  1.00 0.00 ? 247 ASN A HA   2  
ATOM   3584  H  HB2  . ASN A 1 92  ? 4.114   2.399   -6.609  1.00 0.00 ? 247 ASN A HB2  2  
ATOM   3585  H  HB3  . ASN A 1 92  ? 3.985   3.549   -5.277  1.00 0.00 ? 247 ASN A HB3  2  
ATOM   3586  H  HD21 . ASN A 1 92  ? 4.043   0.570   -5.010  1.00 0.00 ? 247 ASN A HD21 2  
ATOM   3587  H  HD22 . ASN A 1 92  ? 2.568   0.143   -4.287  1.00 0.00 ? 247 ASN A HD22 2  
ATOM   3588  N  N    . LEU A 1 93  ? 4.002   4.384   -8.679  1.00 0.00 ? 248 LEU A N    2  
ATOM   3589  C  CA   . LEU A 1 93  ? 4.828   5.345   -9.483  1.00 0.00 ? 248 LEU A CA   2  
ATOM   3590  C  C    . LEU A 1 93  ? 4.844   5.008   -10.993 1.00 0.00 ? 248 LEU A C    2  
ATOM   3591  O  O    . LEU A 1 93  ? 5.763   5.395   -11.691 1.00 0.00 ? 248 LEU A O    2  
ATOM   3592  C  CB   . LEU A 1 93  ? 6.243   5.255   -8.892  1.00 0.00 ? 248 LEU A CB   2  
ATOM   3593  C  CG   . LEU A 1 93  ? 6.819   3.844   -9.073  1.00 0.00 ? 248 LEU A CG   2  
ATOM   3594  C  CD1  . LEU A 1 93  ? 7.527   3.747   -10.424 1.00 0.00 ? 248 LEU A CD1  2  
ATOM   3595  C  CD2  . LEU A 1 93  ? 7.824   3.562   -7.955  1.00 0.00 ? 248 LEU A CD2  2  
ATOM   3596  H  H    . LEU A 1 93  ? 3.959   3.438   -8.930  1.00 0.00 ? 248 LEU A H    2  
ATOM   3597  H  HA   . LEU A 1 93  ? 4.453   6.346   -9.343  1.00 0.00 ? 248 LEU A HA   2  
ATOM   3598  H  HB2  . LEU A 1 93  ? 6.882   5.967   -9.390  1.00 0.00 ? 248 LEU A HB2  2  
ATOM   3599  H  HB3  . LEU A 1 93  ? 6.202   5.488   -7.838  1.00 0.00 ? 248 LEU A HB3  2  
ATOM   3600  H  HG   . LEU A 1 93  ? 6.025   3.117   -9.034  1.00 0.00 ? 248 LEU A HG   2  
ATOM   3601  H  HD11 . LEU A 1 93  ? 7.968   4.701   -10.669 1.00 0.00 ? 248 LEU A HD11 2  
ATOM   3602  H  HD12 . LEU A 1 93  ? 6.811   3.476   -11.187 1.00 0.00 ? 248 LEU A HD12 2  
ATOM   3603  H  HD13 . LEU A 1 93  ? 8.300   2.995   -10.372 1.00 0.00 ? 248 LEU A HD13 2  
ATOM   3604  H  HD21 . LEU A 1 93  ? 8.234   2.571   -8.081  1.00 0.00 ? 248 LEU A HD21 2  
ATOM   3605  H  HD22 . LEU A 1 93  ? 7.327   3.627   -6.998  1.00 0.00 ? 248 LEU A HD22 2  
ATOM   3606  H  HD23 . LEU A 1 93  ? 8.621   4.289   -7.996  1.00 0.00 ? 248 LEU A HD23 2  
ATOM   3607  N  N    . GLY A 1 94  ? 3.841   4.327   -11.517 1.00 0.00 ? 249 GLY A N    2  
ATOM   3608  C  CA   . GLY A 1 94  ? 3.835   4.022   -12.981 1.00 0.00 ? 249 GLY A CA   2  
ATOM   3609  C  C    . GLY A 1 94  ? 4.733   2.813   -13.284 1.00 0.00 ? 249 GLY A C    2  
ATOM   3610  O  O    . GLY A 1 94  ? 5.365   2.266   -12.401 1.00 0.00 ? 249 GLY A O    2  
ATOM   3611  H  H    . GLY A 1 94  ? 3.088   4.034   -10.961 1.00 0.00 ? 249 GLY A H    2  
ATOM   3612  H  HA2  . GLY A 1 94  ? 2.825   3.806   -13.296 1.00 0.00 ? 249 GLY A HA2  2  
ATOM   3613  H  HA3  . GLY A 1 94  ? 4.203   4.879   -13.527 1.00 0.00 ? 249 GLY A HA3  2  
ATOM   3614  N  N    . ARG A 1 95  ? 4.790   2.389   -14.532 1.00 0.00 ? 250 ARG A N    2  
ATOM   3615  C  CA   . ARG A 1 95  ? 5.649   1.208   -14.889 1.00 0.00 ? 250 ARG A CA   2  
ATOM   3616  C  C    . ARG A 1 95  ? 6.996   1.642   -15.507 1.00 0.00 ? 250 ARG A C    2  
ATOM   3617  O  O    . ARG A 1 95  ? 7.967   0.915   -15.420 1.00 0.00 ? 250 ARG A O    2  
ATOM   3618  C  CB   . ARG A 1 95  ? 4.841   0.404   -15.912 1.00 0.00 ? 250 ARG A CB   2  
ATOM   3619  C  CG   . ARG A 1 95  ? 5.572   -0.900  -16.235 1.00 0.00 ? 250 ARG A CG   2  
ATOM   3620  C  CD   . ARG A 1 95  ? 5.292   -1.297  -17.686 1.00 0.00 ? 250 ARG A CD   2  
ATOM   3621  N  NE   . ARG A 1 95  ? 6.189   -2.456  -17.947 1.00 0.00 ? 250 ARG A NE   2  
ATOM   3622  C  CZ   . ARG A 1 95  ? 7.399   -2.258  -18.392 1.00 0.00 ? 250 ARG A CZ   2  
ATOM   3623  N  NH1  . ARG A 1 95  ? 8.376   -2.044  -17.554 1.00 0.00 ? 250 ARG A NH1  2  
ATOM   3624  N  NH2  . ARG A 1 95  ? 7.633   -2.274  -19.676 1.00 0.00 ? 250 ARG A NH2  2  
ATOM   3625  H  H    . ARG A 1 95  ? 4.266   2.845   -15.232 1.00 0.00 ? 250 ARG A H    2  
ATOM   3626  H  HA   . ARG A 1 95  ? 5.826   0.605   -14.017 1.00 0.00 ? 250 ARG A HA   2  
ATOM   3627  H  HB2  . ARG A 1 95  ? 3.866   0.179   -15.503 1.00 0.00 ? 250 ARG A HB2  2  
ATOM   3628  H  HB3  . ARG A 1 95  ? 4.727   0.986   -16.815 1.00 0.00 ? 250 ARG A HB3  2  
ATOM   3629  H  HG2  . ARG A 1 95  ? 6.635   -0.758  -16.100 1.00 0.00 ? 250 ARG A HG2  2  
ATOM   3630  H  HG3  . ARG A 1 95  ? 5.226   -1.681  -15.576 1.00 0.00 ? 250 ARG A HG3  2  
ATOM   3631  H  HD2  . ARG A 1 95  ? 4.255   -1.585  -17.802 1.00 0.00 ? 250 ARG A HD2  2  
ATOM   3632  H  HD3  . ARG A 1 95  ? 5.535   -0.485  -18.354 1.00 0.00 ? 250 ARG A HD3  2  
ATOM   3633  H  HE   . ARG A 1 95  ? 5.871   -3.369  -17.783 1.00 0.00 ? 250 ARG A HE   2  
ATOM   3634  H  HH11 . ARG A 1 95  ? 8.197   -2.032  -16.570 1.00 0.00 ? 250 ARG A HH11 2  
ATOM   3635  H  HH12 . ARG A 1 95  ? 9.304   -1.892  -17.896 1.00 0.00 ? 250 ARG A HH12 2  
ATOM   3636  H  HH21 . ARG A 1 95  ? 6.884   -2.438  -20.318 1.00 0.00 ? 250 ARG A HH21 2  
ATOM   3637  H  HH22 . ARG A 1 95  ? 8.560   -2.122  -20.017 1.00 0.00 ? 250 ARG A HH22 2  
ATOM   3638  N  N    . LYS A 1 96  ? 7.071   2.803   -16.142 1.00 0.00 ? 251 LYS A N    2  
ATOM   3639  C  CA   . LYS A 1 96  ? 8.381   3.244   -16.770 1.00 0.00 ? 251 LYS A CA   2  
ATOM   3640  C  C    . LYS A 1 96  ? 9.543   3.096   -15.775 1.00 0.00 ? 251 LYS A C    2  
ATOM   3641  O  O    . LYS A 1 96  ? 10.487  2.372   -16.033 1.00 0.00 ? 251 LYS A O    2  
ATOM   3642  C  CB   . LYS A 1 96  ? 8.208   4.719   -17.160 1.00 0.00 ? 251 LYS A CB   2  
ATOM   3643  C  CG   . LYS A 1 96  ? 7.784   4.814   -18.626 1.00 0.00 ? 251 LYS A CG   2  
ATOM   3644  C  CD   . LYS A 1 96  ? 8.335   6.104   -19.236 1.00 0.00 ? 251 LYS A CD   2  
ATOM   3645  C  CE   . LYS A 1 96  ? 7.809   6.259   -20.665 1.00 0.00 ? 251 LYS A CE   2  
ATOM   3646  N  NZ   . LYS A 1 96  ? 6.587   7.100   -20.535 1.00 0.00 ? 251 LYS A NZ   2  
ATOM   3647  H  H    . LYS A 1 96  ? 6.273   3.371   -16.218 1.00 0.00 ? 251 LYS A H    2  
ATOM   3648  H  HA   . LYS A 1 96  ? 8.581   2.654   -17.651 1.00 0.00 ? 251 LYS A HA   2  
ATOM   3649  H  HB2  . LYS A 1 96  ? 7.451   5.170   -16.535 1.00 0.00 ? 251 LYS A HB2  2  
ATOM   3650  H  HB3  . LYS A 1 96  ? 9.145   5.240   -17.024 1.00 0.00 ? 251 LYS A HB3  2  
ATOM   3651  H  HG2  . LYS A 1 96  ? 8.173   3.964   -19.169 1.00 0.00 ? 251 LYS A HG2  2  
ATOM   3652  H  HG3  . LYS A 1 96  ? 6.706   4.819   -18.690 1.00 0.00 ? 251 LYS A HG3  2  
ATOM   3653  H  HD2  . LYS A 1 96  ? 8.017   6.947   -18.641 1.00 0.00 ? 251 LYS A HD2  2  
ATOM   3654  H  HD3  . LYS A 1 96  ? 9.413   6.063   -19.254 1.00 0.00 ? 251 LYS A HD3  2  
ATOM   3655  H  HE2  . LYS A 1 96  ? 8.545   6.753   -21.284 1.00 0.00 ? 251 LYS A HE2  2  
ATOM   3656  H  HE3  . LYS A 1 96  ? 7.553   5.296   -21.078 1.00 0.00 ? 251 LYS A HE3  2  
ATOM   3657  H  HZ1  . LYS A 1 96  ? 6.810   7.956   -19.988 1.00 0.00 ? 251 LYS A HZ1  2  
ATOM   3658  H  HZ2  . LYS A 1 96  ? 5.844   6.559   -20.047 1.00 0.00 ? 251 LYS A HZ2  2  
ATOM   3659  H  HZ3  . LYS A 1 96  ? 6.252   7.374   -21.481 1.00 0.00 ? 251 LYS A HZ3  2  
ATOM   3660  N  N    . GLU A 1 97  ? 9.481   3.753   -14.632 1.00 0.00 ? 252 GLU A N    2  
ATOM   3661  C  CA   . GLU A 1 97  ? 10.600  3.607   -13.626 1.00 0.00 ? 252 GLU A CA   2  
ATOM   3662  C  C    . GLU A 1 97  ? 10.850  2.114   -13.327 1.00 0.00 ? 252 GLU A C    2  
ATOM   3663  O  O    . GLU A 1 97  ? 11.966  1.713   -13.055 1.00 0.00 ? 252 GLU A O    2  
ATOM   3664  C  CB   . GLU A 1 97  ? 10.149  4.332   -12.348 1.00 0.00 ? 252 GLU A CB   2  
ATOM   3665  C  CG   . GLU A 1 97  ? 10.666  5.772   -12.369 1.00 0.00 ? 252 GLU A CG   2  
ATOM   3666  C  CD   . GLU A 1 97  ? 10.006  6.569   -11.242 1.00 0.00 ? 252 GLU A CD   2  
ATOM   3667  O  OE1  . GLU A 1 97  ? 10.319  6.303   -10.094 1.00 0.00 ? 252 GLU A OE1  2  
ATOM   3668  O  OE2  . GLU A 1 97  ? 9.200   7.432   -11.548 1.00 0.00 ? 252 GLU A OE2  2  
ATOM   3669  H  H    . GLU A 1 97  ? 8.703   4.324   -14.435 1.00 0.00 ? 252 GLU A H    2  
ATOM   3670  H  HA   . GLU A 1 97  ? 11.496  4.061   -14.008 1.00 0.00 ? 252 GLU A HA   2  
ATOM   3671  H  HB2  . GLU A 1 97  ? 9.071   4.336   -12.297 1.00 0.00 ? 252 GLU A HB2  2  
ATOM   3672  H  HB3  . GLU A 1 97  ? 10.548  3.822   -11.485 1.00 0.00 ? 252 GLU A HB3  2  
ATOM   3673  H  HG2  . GLU A 1 97  ? 11.737  5.771   -12.231 1.00 0.00 ? 252 GLU A HG2  2  
ATOM   3674  H  HG3  . GLU A 1 97  ? 10.425  6.227   -13.318 1.00 0.00 ? 252 GLU A HG3  2  
ATOM   3675  N  N    . LEU A 1 98  ? 9.821   1.287   -13.387 1.00 0.00 ? 253 LEU A N    2  
ATOM   3676  C  CA   . LEU A 1 98  ? 10.020  -0.180  -13.115 1.00 0.00 ? 253 LEU A CA   2  
ATOM   3677  C  C    . LEU A 1 98  ? 11.048  -0.775  -14.096 1.00 0.00 ? 253 LEU A C    2  
ATOM   3678  O  O    . LEU A 1 98  ? 11.801  -1.658  -13.736 1.00 0.00 ? 253 LEU A O    2  
ATOM   3679  C  CB   . LEU A 1 98  ? 8.649   -0.848  -13.318 1.00 0.00 ? 253 LEU A CB   2  
ATOM   3680  C  CG   . LEU A 1 98  ? 8.573   -2.131  -12.491 1.00 0.00 ? 253 LEU A CG   2  
ATOM   3681  C  CD1  . LEU A 1 98  ? 7.111   -2.562  -12.360 1.00 0.00 ? 253 LEU A CD1  2  
ATOM   3682  C  CD2  . LEU A 1 98  ? 9.370   -3.236  -13.188 1.00 0.00 ? 253 LEU A CD2  2  
ATOM   3683  H  H    . LEU A 1 98  ? 8.926   1.629   -13.615 1.00 0.00 ? 253 LEU A H    2  
ATOM   3684  H  HA   . LEU A 1 98  ? 10.351  -0.327  -12.098 1.00 0.00 ? 253 LEU A HA   2  
ATOM   3685  H  HB2  . LEU A 1 98  ? 7.871   -0.169  -13.001 1.00 0.00 ? 253 LEU A HB2  2  
ATOM   3686  H  HB3  . LEU A 1 98  ? 8.517   -1.084  -14.361 1.00 0.00 ? 253 LEU A HB3  2  
ATOM   3687  H  HG   . LEU A 1 98  ? 8.984   -1.951  -11.508 1.00 0.00 ? 253 LEU A HG   2  
ATOM   3688  H  HD11 . LEU A 1 98  ? 6.551   -1.791  -11.854 1.00 0.00 ? 253 LEU A HD11 2  
ATOM   3689  H  HD12 . LEU A 1 98  ? 7.055   -3.479  -11.791 1.00 0.00 ? 253 LEU A HD12 2  
ATOM   3690  H  HD13 . LEU A 1 98  ? 6.694   -2.723  -13.343 1.00 0.00 ? 253 LEU A HD13 2  
ATOM   3691  H  HD21 . LEU A 1 98  ? 9.310   -3.100  -14.259 1.00 0.00 ? 253 LEU A HD21 2  
ATOM   3692  H  HD22 . LEU A 1 98  ? 8.957   -4.198  -12.926 1.00 0.00 ? 253 LEU A HD22 2  
ATOM   3693  H  HD23 . LEU A 1 98  ? 10.401  -3.188  -12.876 1.00 0.00 ? 253 LEU A HD23 2  
ATOM   3694  N  N    . SER A 1 99  ? 11.093  -0.306  -15.332 1.00 0.00 ? 254 SER A N    2  
ATOM   3695  C  CA   . SER A 1 99  ? 12.099  -0.882  -16.299 1.00 0.00 ? 254 SER A CA   2  
ATOM   3696  C  C    . SER A 1 99  ? 13.517  -0.593  -15.794 1.00 0.00 ? 254 SER A C    2  
ATOM   3697  O  O    . SER A 1 99  ? 14.337  -1.487  -15.706 1.00 0.00 ? 254 SER A O    2  
ATOM   3698  C  CB   . SER A 1 99  ? 11.863  -0.198  -17.655 1.00 0.00 ? 254 SER A CB   2  
ATOM   3699  O  OG   . SER A 1 99  ? 10.761  -0.814  -18.306 1.00 0.00 ? 254 SER A OG   2  
ATOM   3700  H  H    . SER A 1 99  ? 10.476  0.412   -15.617 1.00 0.00 ? 254 SER A H    2  
ATOM   3701  H  HA   . SER A 1 99  ? 11.956  -1.947  -16.391 1.00 0.00 ? 254 SER A HA   2  
ATOM   3702  H  HB2  . SER A 1 99  ? 11.644  0.846   -17.501 1.00 0.00 ? 254 SER A HB2  2  
ATOM   3703  H  HB3  . SER A 1 99  ? 12.754  -0.290  -18.263 1.00 0.00 ? 254 SER A HB3  2  
ATOM   3704  H  HG   . SER A 1 99  ? 10.687  -0.436  -19.186 1.00 0.00 ? 254 SER A HG   2  
ATOM   3705  N  N    . THR A 1 100 ? 13.817  0.644   -15.447 1.00 0.00 ? 255 THR A N    2  
ATOM   3706  C  CA   . THR A 1 100 ? 15.202  0.956   -14.929 1.00 0.00 ? 255 THR A CA   2  
ATOM   3707  C  C    . THR A 1 100 ? 15.513  0.090   -13.695 1.00 0.00 ? 255 THR A C    2  
ATOM   3708  O  O    . THR A 1 100 ? 16.649  -0.287  -13.477 1.00 0.00 ? 255 THR A O    2  
ATOM   3709  C  CB   . THR A 1 100 ? 15.212  2.445   -14.548 1.00 0.00 ? 255 THR A CB   2  
ATOM   3710  O  OG1  . THR A 1 100 ? 14.736  3.215   -15.643 1.00 0.00 ? 255 THR A OG1  2  
ATOM   3711  C  CG2  . THR A 1 100 ? 16.638  2.874   -14.201 1.00 0.00 ? 255 THR A CG2  2  
ATOM   3712  H  H    . THR A 1 100 ? 13.135  1.355   -15.515 1.00 0.00 ? 255 THR A H    2  
ATOM   3713  H  HA   . THR A 1 100 ? 15.931  0.768   -15.696 1.00 0.00 ? 255 THR A HA   2  
ATOM   3714  H  HB   . THR A 1 100 ? 14.575  2.602   -13.691 1.00 0.00 ? 255 THR A HB   2  
ATOM   3715  H  HG1  . THR A 1 100 ? 14.531  4.096   -15.319 1.00 0.00 ? 255 THR A HG1  2  
ATOM   3716  H  HG21 . THR A 1 100 ? 16.790  2.792   -13.135 1.00 0.00 ? 255 THR A HG21 2  
ATOM   3717  H  HG22 . THR A 1 100 ? 16.791  3.898   -14.509 1.00 0.00 ? 255 THR A HG22 2  
ATOM   3718  H  HG23 . THR A 1 100 ? 17.341  2.235   -14.715 1.00 0.00 ? 255 THR A HG23 2  
ATOM   3719  N  N    . ILE A 1 101 ? 14.519  -0.240  -12.890 1.00 0.00 ? 256 ILE A N    2  
ATOM   3720  C  CA   . ILE A 1 101 ? 14.791  -1.098  -11.681 1.00 0.00 ? 256 ILE A CA   2  
ATOM   3721  C  C    . ILE A 1 101 ? 15.445  -2.427  -12.111 1.00 0.00 ? 256 ILE A C    2  
ATOM   3722  O  O    . ILE A 1 101 ? 16.268  -2.967  -11.394 1.00 0.00 ? 256 ILE A O    2  
ATOM   3723  C  CB   . ILE A 1 101 ? 13.430  -1.355  -10.998 1.00 0.00 ? 256 ILE A CB   2  
ATOM   3724  C  CG1  . ILE A 1 101 ? 12.902  -0.044  -10.403 1.00 0.00 ? 256 ILE A CG1  2  
ATOM   3725  C  CG2  . ILE A 1 101 ? 13.589  -2.385  -9.874  1.00 0.00 ? 256 ILE A CG2  2  
ATOM   3726  C  CD1  . ILE A 1 101 ? 11.482  -0.256  -9.872  1.00 0.00 ? 256 ILE A CD1  2  
ATOM   3727  H  H    . ILE A 1 101 ? 13.606  0.068   -13.085 1.00 0.00 ? 256 ILE A H    2  
ATOM   3728  H  HA   . ILE A 1 101 ? 15.445  -0.576  -11.004 1.00 0.00 ? 256 ILE A HA   2  
ATOM   3729  H  HB   . ILE A 1 101 ? 12.728  -1.729  -11.726 1.00 0.00 ? 256 ILE A HB   2  
ATOM   3730  H  HG12 . ILE A 1 101 ? 13.546  0.267   -9.594  1.00 0.00 ? 256 ILE A HG12 2  
ATOM   3731  H  HG13 . ILE A 1 101 ? 12.888  0.719   -11.165 1.00 0.00 ? 256 ILE A HG13 2  
ATOM   3732  H  HG21 . ILE A 1 101 ? 12.866  -2.187  -9.100  1.00 0.00 ? 256 ILE A HG21 2  
ATOM   3733  H  HG22 . ILE A 1 101 ? 14.586  -2.314  -9.467  1.00 0.00 ? 256 ILE A HG22 2  
ATOM   3734  H  HG23 . ILE A 1 101 ? 13.432  -3.377  -10.270 1.00 0.00 ? 256 ILE A HG23 2  
ATOM   3735  H  HD11 . ILE A 1 101 ? 10.897  0.635   -10.046 1.00 0.00 ? 256 ILE A HD11 2  
ATOM   3736  H  HD12 . ILE A 1 101 ? 11.521  -0.460  -8.812  1.00 0.00 ? 256 ILE A HD12 2  
ATOM   3737  H  HD13 . ILE A 1 101 ? 11.027  -1.092  -10.381 1.00 0.00 ? 256 ILE A HD13 2  
ATOM   3738  N  N    . MET A 1 102 ? 15.096  -2.959  -13.267 1.00 0.00 ? 257 MET A N    2  
ATOM   3739  C  CA   . MET A 1 102 ? 15.725  -4.252  -13.702 1.00 0.00 ? 257 MET A CA   2  
ATOM   3740  C  C    . MET A 1 102 ? 16.898  -4.009  -14.677 1.00 0.00 ? 257 MET A C    2  
ATOM   3741  O  O    . MET A 1 102 ? 17.262  -4.895  -15.427 1.00 0.00 ? 257 MET A O    2  
ATOM   3742  C  CB   . MET A 1 102 ? 14.608  -5.048  -14.387 1.00 0.00 ? 257 MET A CB   2  
ATOM   3743  C  CG   . MET A 1 102 ? 13.752  -5.745  -13.325 1.00 0.00 ? 257 MET A CG   2  
ATOM   3744  S  SD   . MET A 1 102 ? 14.446  -7.380  -12.968 1.00 0.00 ? 257 MET A SD   2  
ATOM   3745  C  CE   . MET A 1 102 ? 14.283  -7.313  -11.167 1.00 0.00 ? 257 MET A CE   2  
ATOM   3746  H  H    . MET A 1 102 ? 14.430  -2.512  -13.843 1.00 0.00 ? 257 MET A H    2  
ATOM   3747  H  HA   . MET A 1 102 ? 16.075  -4.796  -12.839 1.00 0.00 ? 257 MET A HA   2  
ATOM   3748  H  HB2  . MET A 1 102 ? 13.990  -4.377  -14.966 1.00 0.00 ? 257 MET A HB2  2  
ATOM   3749  H  HB3  . MET A 1 102 ? 15.043  -5.791  -15.039 1.00 0.00 ? 257 MET A HB3  2  
ATOM   3750  H  HG2  . MET A 1 102 ? 13.744  -5.152  -12.422 1.00 0.00 ? 257 MET A HG2  2  
ATOM   3751  H  HG3  . MET A 1 102 ? 12.742  -5.855  -13.691 1.00 0.00 ? 257 MET A HG3  2  
ATOM   3752  H  HE1  . MET A 1 102 ? 13.250  -7.132  -10.906 1.00 0.00 ? 257 MET A HE1  2  
ATOM   3753  H  HE2  . MET A 1 102 ? 14.894  -6.515  -10.778 1.00 0.00 ? 257 MET A HE2  2  
ATOM   3754  H  HE3  . MET A 1 102 ? 14.608  -8.254  -10.740 1.00 0.00 ? 257 MET A HE3  2  
ATOM   3755  N  N    . ASP A 1 103 ? 17.504  -2.831  -14.676 1.00 0.00 ? 258 ASP A N    2  
ATOM   3756  C  CA   . ASP A 1 103 ? 18.656  -2.579  -15.607 1.00 0.00 ? 258 ASP A CA   2  
ATOM   3757  C  C    . ASP A 1 103 ? 19.340  -1.239  -15.273 1.00 0.00 ? 258 ASP A C    2  
ATOM   3758  O  O    . ASP A 1 103 ? 19.381  -0.339  -16.092 1.00 0.00 ? 258 ASP A O    2  
ATOM   3759  C  CB   . ASP A 1 103 ? 18.036  -2.534  -17.006 1.00 0.00 ? 258 ASP A CB   2  
ATOM   3760  C  CG   . ASP A 1 103 ? 19.118  -2.800  -18.054 1.00 0.00 ? 258 ASP A CG   2  
ATOM   3761  O  OD1  . ASP A 1 103 ? 19.881  -3.734  -17.865 1.00 0.00 ? 258 ASP A OD1  2  
ATOM   3762  O  OD2  . ASP A 1 103 ? 19.168  -2.066  -19.027 1.00 0.00 ? 258 ASP A OD2  2  
ATOM   3763  H  H    . ASP A 1 103 ? 17.212  -2.120  -14.065 1.00 0.00 ? 258 ASP A H    2  
ATOM   3764  H  HA   . ASP A 1 103 ? 19.369  -3.386  -15.545 1.00 0.00 ? 258 ASP A HA   2  
ATOM   3765  H  HB2  . ASP A 1 103 ? 17.265  -3.287  -17.084 1.00 0.00 ? 258 ASP A HB2  2  
ATOM   3766  H  HB3  . ASP A 1 103 ? 17.605  -1.559  -17.178 1.00 0.00 ? 258 ASP A HB3  2  
ATOM   3767  N  N    . GLU A 1 104 ? 19.875  -1.095  -14.074 1.00 0.00 ? 259 GLU A N    2  
ATOM   3768  C  CA   . GLU A 1 104 ? 20.540  0.189   -13.707 1.00 0.00 ? 259 GLU A CA   2  
ATOM   3769  C  C    . GLU A 1 104 ? 21.951  -0.066  -13.149 1.00 0.00 ? 259 GLU A C    2  
ATOM   3770  O  O    . GLU A 1 104 ? 22.933  0.321   -13.755 1.00 0.00 ? 259 GLU A O    2  
ATOM   3771  C  CB   . GLU A 1 104 ? 19.622  0.822   -12.649 1.00 0.00 ? 259 GLU A CB   2  
ATOM   3772  C  CG   . GLU A 1 104 ? 20.220  2.150   -12.157 1.00 0.00 ? 259 GLU A CG   2  
ATOM   3773  C  CD   . GLU A 1 104 ? 20.635  2.022   -10.688 1.00 0.00 ? 259 GLU A CD   2  
ATOM   3774  O  OE1  . GLU A 1 104 ? 21.020  0.934   -10.293 1.00 0.00 ? 259 GLU A OE1  2  
ATOM   3775  O  OE2  . GLU A 1 104 ? 20.561  3.017   -9.984  1.00 0.00 ? 259 GLU A OE2  2  
ATOM   3776  H  H    . GLU A 1 104 ? 19.832  -1.826  -13.419 1.00 0.00 ? 259 GLU A H    2  
ATOM   3777  H  HA   . GLU A 1 104 ? 20.600  0.829   -14.567 1.00 0.00 ? 259 GLU A HA   2  
ATOM   3778  H  HB2  . GLU A 1 104 ? 18.652  1.009   -13.090 1.00 0.00 ? 259 GLU A HB2  2  
ATOM   3779  H  HB3  . GLU A 1 104 ? 19.508  0.144   -11.817 1.00 0.00 ? 259 GLU A HB3  2  
ATOM   3780  H  HG2  . GLU A 1 104 ? 21.085  2.403   -12.753 1.00 0.00 ? 259 GLU A HG2  2  
ATOM   3781  H  HG3  . GLU A 1 104 ? 19.479  2.931   -12.251 1.00 0.00 ? 259 GLU A HG3  2  
ATOM   3782  N  N    . ASN A 1 105 ? 22.068  -0.711  -12.007 1.00 0.00 ? 260 ASN A N    2  
ATOM   3783  C  CA   . ASN A 1 105 ? 23.427  -0.976  -11.436 1.00 0.00 ? 260 ASN A CA   2  
ATOM   3784  C  C    . ASN A 1 105 ? 23.413  -2.242  -10.564 1.00 0.00 ? 260 ASN A C    2  
ATOM   3785  O  O    . ASN A 1 105 ? 24.088  -2.307  -9.554  1.00 0.00 ? 260 ASN A O    2  
ATOM   3786  C  CB   . ASN A 1 105 ? 23.744  0.255   -10.585 1.00 0.00 ? 260 ASN A CB   2  
ATOM   3787  C  CG   . ASN A 1 105 ? 25.253  0.524   -10.616 1.00 0.00 ? 260 ASN A CG   2  
ATOM   3788  O  OD1  . ASN A 1 105 ? 26.043  -0.392  -10.497 1.00 0.00 ? 260 ASN A OD1  2  
ATOM   3789  N  ND2  . ASN A 1 105 ? 25.696  1.748   -10.768 1.00 0.00 ? 260 ASN A ND2  2  
ATOM   3790  H  H    . ASN A 1 105 ? 21.269  -1.021  -11.527 1.00 0.00 ? 260 ASN A H    2  
ATOM   3791  H  HA   . ASN A 1 105 ? 24.154  -1.072  -12.227 1.00 0.00 ? 260 ASN A HA   2  
ATOM   3792  H  HB2  . ASN A 1 105 ? 23.216  1.110   -10.981 1.00 0.00 ? 260 ASN A HB2  2  
ATOM   3793  H  HB3  . ASN A 1 105 ? 23.432  0.078   -9.567  1.00 0.00 ? 260 ASN A HB3  2  
ATOM   3794  H  HD21 . ASN A 1 105 ? 25.067  2.497   -10.864 1.00 0.00 ? 260 ASN A HD21 2  
ATOM   3795  H  HD22 . ASN A 1 105 ? 26.661  1.918   -10.787 1.00 0.00 ? 260 ASN A HD22 2  
ATOM   3796  N  N    . ASN A 1 106 ? 22.649  -3.252  -10.940 1.00 0.00 ? 261 ASN A N    2  
ATOM   3797  C  CA   . ASN A 1 106 ? 22.596  -4.511  -10.122 1.00 0.00 ? 261 ASN A CA   2  
ATOM   3798  C  C    . ASN A 1 106 ? 22.335  -4.208  -8.628  1.00 0.00 ? 261 ASN A C    2  
ATOM   3799  O  O    . ASN A 1 106 ? 22.776  -4.942  -7.764  1.00 0.00 ? 261 ASN A O    2  
ATOM   3800  C  CB   . ASN A 1 106 ? 23.972  -5.160  -10.299 1.00 0.00 ? 261 ASN A CB   2  
ATOM   3801  C  CG   . ASN A 1 106 ? 24.025  -5.886  -11.649 1.00 0.00 ? 261 ASN A CG   2  
ATOM   3802  O  OD1  . ASN A 1 106 ? 23.826  -5.277  -12.682 1.00 0.00 ? 261 ASN A OD1  2  
ATOM   3803  N  ND2  . ASN A 1 106 ? 24.286  -7.170  -11.692 1.00 0.00 ? 261 ASN A ND2  2  
ATOM   3804  H  H    . ASN A 1 106 ? 22.107  -3.186  -11.761 1.00 0.00 ? 261 ASN A H    2  
ATOM   3805  H  HA   . ASN A 1 106 ? 21.834  -5.171  -10.505 1.00 0.00 ? 261 ASN A HA   2  
ATOM   3806  H  HB2  . ASN A 1 106 ? 24.735  -4.396  -10.270 1.00 0.00 ? 261 ASN A HB2  2  
ATOM   3807  H  HB3  . ASN A 1 106 ? 24.141  -5.870  -9.504  1.00 0.00 ? 261 ASN A HB3  2  
ATOM   3808  H  HD21 . ASN A 1 106 ? 24.449  -7.672  -10.862 1.00 0.00 ? 261 ASN A HD21 2  
ATOM   3809  H  HD22 . ASN A 1 106 ? 24.320  -7.632  -12.555 1.00 0.00 ? 261 ASN A HD22 2  
ATOM   3810  N  N    . GLN A 1 107 ? 21.617  -3.145  -8.315  1.00 0.00 ? 262 GLN A N    2  
ATOM   3811  C  CA   . GLN A 1 107 ? 21.334  -2.822  -6.877  1.00 0.00 ? 262 GLN A CA   2  
ATOM   3812  C  C    . GLN A 1 107 ? 20.064  -1.961  -6.772  1.00 0.00 ? 262 GLN A C    2  
ATOM   3813  O  O    . GLN A 1 107 ? 20.109  -0.763  -6.980  1.00 0.00 ? 262 GLN A O    2  
ATOM   3814  C  CB   . GLN A 1 107 ? 22.552  -2.035  -6.390  1.00 0.00 ? 262 GLN A CB   2  
ATOM   3815  C  CG   . GLN A 1 107 ? 23.533  -2.981  -5.688  1.00 0.00 ? 262 GLN A CG   2  
ATOM   3816  C  CD   . GLN A 1 107 ? 24.686  -3.330  -6.638  1.00 0.00 ? 262 GLN A CD   2  
ATOM   3817  O  OE1  . GLN A 1 107 ? 25.197  -2.469  -7.327  1.00 0.00 ? 262 GLN A OE1  2  
ATOM   3818  N  NE2  . GLN A 1 107 ? 25.125  -4.563  -6.709  1.00 0.00 ? 262 GLN A NE2  2  
ATOM   3819  H  H    . GLN A 1 107 ? 21.259  -2.563  -9.023  1.00 0.00 ? 262 GLN A H    2  
ATOM   3820  H  HA   . GLN A 1 107 ? 21.224  -3.728  -6.302  1.00 0.00 ? 262 GLN A HA   2  
ATOM   3821  H  HB2  . GLN A 1 107 ? 23.038  -1.567  -7.233  1.00 0.00 ? 262 GLN A HB2  2  
ATOM   3822  H  HB3  . GLN A 1 107 ? 22.230  -1.275  -5.693  1.00 0.00 ? 262 GLN A HB3  2  
ATOM   3823  H  HG2  . GLN A 1 107 ? 23.927  -2.497  -4.806  1.00 0.00 ? 262 GLN A HG2  2  
ATOM   3824  H  HG3  . GLN A 1 107 ? 23.020  -3.887  -5.400  1.00 0.00 ? 262 GLN A HG3  2  
ATOM   3825  H  HE21 . GLN A 1 107 ? 24.720  -5.268  -6.156  1.00 0.00 ? 262 GLN A HE21 2  
ATOM   3826  H  HE22 . GLN A 1 107 ? 25.861  -4.785  -7.316  1.00 0.00 ? 262 GLN A HE22 2  
ATOM   3827  N  N    . TRP A 1 108 ? 18.931  -2.561  -6.477  1.00 0.00 ? 263 TRP A N    2  
ATOM   3828  C  CA   . TRP A 1 108 ? 17.669  -1.767  -6.392  1.00 0.00 ? 263 TRP A CA   2  
ATOM   3829  C  C    . TRP A 1 108 ? 17.158  -1.668  -4.942  1.00 0.00 ? 263 TRP A C    2  
ATOM   3830  O  O    . TRP A 1 108 ? 17.092  -2.653  -4.232  1.00 0.00 ? 263 TRP A O    2  
ATOM   3831  C  CB   . TRP A 1 108 ? 16.667  -2.546  -7.262  1.00 0.00 ? 263 TRP A CB   2  
ATOM   3832  C  CG   . TRP A 1 108 ? 15.297  -1.940  -7.155  1.00 0.00 ? 263 TRP A CG   2  
ATOM   3833  C  CD1  . TRP A 1 108 ? 14.966  -0.686  -7.536  1.00 0.00 ? 263 TRP A CD1  2  
ATOM   3834  C  CD2  . TRP A 1 108 ? 14.078  -2.544  -6.635  1.00 0.00 ? 263 TRP A CD2  2  
ATOM   3835  N  NE1  . TRP A 1 108 ? 13.624  -0.478  -7.274  1.00 0.00 ? 263 TRP A NE1  2  
ATOM   3836  C  CE2  . TRP A 1 108 ? 13.032  -1.594  -6.718  1.00 0.00 ? 263 TRP A CE2  2  
ATOM   3837  C  CE3  . TRP A 1 108 ? 13.783  -3.810  -6.101  1.00 0.00 ? 263 TRP A CE3  2  
ATOM   3838  C  CZ2  . TRP A 1 108 ? 11.738  -1.891  -6.288  1.00 0.00 ? 263 TRP A CZ2  2  
ATOM   3839  C  CZ3  . TRP A 1 108 ? 12.482  -4.114  -5.667  1.00 0.00 ? 263 TRP A CZ3  2  
ATOM   3840  C  CH2  . TRP A 1 108 ? 11.461  -3.155  -5.759  1.00 0.00 ? 263 TRP A CH2  2  
ATOM   3841  H  H    . TRP A 1 108 ? 18.905  -3.533  -6.330  1.00 0.00 ? 263 TRP A H    2  
ATOM   3842  H  HA   . TRP A 1 108 ? 17.818  -0.784  -6.804  1.00 0.00 ? 263 TRP A HA   2  
ATOM   3843  H  HB2  . TRP A 1 108 ? 16.996  -2.520  -8.287  1.00 0.00 ? 263 TRP A HB2  2  
ATOM   3844  H  HB3  . TRP A 1 108 ? 16.629  -3.572  -6.928  1.00 0.00 ? 263 TRP A HB3  2  
ATOM   3845  H  HD1  . TRP A 1 108 ? 15.639  0.034   -7.972  1.00 0.00 ? 263 TRP A HD1  2  
ATOM   3846  H  HE1  . TRP A 1 108 ? 13.134  0.352   -7.454  1.00 0.00 ? 263 TRP A HE1  2  
ATOM   3847  H  HE3  . TRP A 1 108 ? 14.562  -4.555  -6.029  1.00 0.00 ? 263 TRP A HE3  2  
ATOM   3848  H  HZ2  . TRP A 1 108 ? 10.956  -1.150  -6.361  1.00 0.00 ? 263 TRP A HZ2  2  
ATOM   3849  H  HZ3  . TRP A 1 108 ? 12.266  -5.090  -5.259  1.00 0.00 ? 263 TRP A HZ3  2  
ATOM   3850  H  HH2  . TRP A 1 108 ? 10.462  -3.395  -5.425  1.00 0.00 ? 263 TRP A HH2  2  
ATOM   3851  N  N    . TYR A 1 109 ? 16.734  -0.491  -4.528  1.00 0.00 ? 264 TYR A N    2  
ATOM   3852  C  CA   . TYR A 1 109 ? 16.155  -0.344  -3.159  1.00 0.00 ? 264 TYR A CA   2  
ATOM   3853  C  C    . TYR A 1 109 ? 14.636  -0.431  -3.315  1.00 0.00 ? 264 TYR A C    2  
ATOM   3854  O  O    . TYR A 1 109 ? 14.098  0.037   -4.303  1.00 0.00 ? 264 TYR A O    2  
ATOM   3855  C  CB   . TYR A 1 109 ? 16.588  1.033   -2.644  1.00 0.00 ? 264 TYR A CB   2  
ATOM   3856  C  CG   . TYR A 1 109 ? 17.803  0.865   -1.765  1.00 0.00 ? 264 TYR A CG   2  
ATOM   3857  C  CD1  . TYR A 1 109 ? 17.650  0.482   -0.428  1.00 0.00 ? 264 TYR A CD1  2  
ATOM   3858  C  CD2  . TYR A 1 109 ? 19.081  1.081   -2.290  1.00 0.00 ? 264 TYR A CD2  2  
ATOM   3859  C  CE1  . TYR A 1 109 ? 18.776  0.316   0.386   1.00 0.00 ? 264 TYR A CE1  2  
ATOM   3860  C  CE2  . TYR A 1 109 ? 20.207  0.916   -1.478  1.00 0.00 ? 264 TYR A CE2  2  
ATOM   3861  C  CZ   . TYR A 1 109 ? 20.056  0.532   -0.140  1.00 0.00 ? 264 TYR A CZ   2  
ATOM   3862  O  OH   . TYR A 1 109 ? 21.168  0.369   0.662   1.00 0.00 ? 264 TYR A OH   2  
ATOM   3863  H  H    . TYR A 1 109 ? 16.747  0.283   -5.140  1.00 0.00 ? 264 TYR A H    2  
ATOM   3864  H  HA   . TYR A 1 109 ? 16.515  -1.125  -2.505  1.00 0.00 ? 264 TYR A HA   2  
ATOM   3865  H  HB2  . TYR A 1 109 ? 16.831  1.673   -3.480  1.00 0.00 ? 264 TYR A HB2  2  
ATOM   3866  H  HB3  . TYR A 1 109 ? 15.787  1.474   -2.070  1.00 0.00 ? 264 TYR A HB3  2  
ATOM   3867  H  HD1  . TYR A 1 109 ? 16.662  0.314   -0.023  1.00 0.00 ? 264 TYR A HD1  2  
ATOM   3868  H  HD2  . TYR A 1 109 ? 19.198  1.376   -3.323  1.00 0.00 ? 264 TYR A HD2  2  
ATOM   3869  H  HE1  . TYR A 1 109 ? 18.658  0.021   1.418   1.00 0.00 ? 264 TYR A HE1  2  
ATOM   3870  H  HE2  . TYR A 1 109 ? 21.193  1.079   -1.886  1.00 0.00 ? 264 TYR A HE2  2  
ATOM   3871  H  HH   . TYR A 1 109 ? 21.386  1.223   1.044   1.00 0.00 ? 264 TYR A HH   2  
ATOM   3872  N  N    . CYS A 1 110 ? 13.935  -1.055  -2.395  1.00 0.00 ? 265 CYS A N    2  
ATOM   3873  C  CA   . CYS A 1 110 ? 12.461  -1.189  -2.570  1.00 0.00 ? 265 CYS A CA   2  
ATOM   3874  C  C    . CYS A 1 110 ? 11.689  -0.588  -1.369  1.00 0.00 ? 265 CYS A C    2  
ATOM   3875  O  O    . CYS A 1 110 ? 12.137  0.374   -0.772  1.00 0.00 ? 265 CYS A O    2  
ATOM   3876  C  CB   . CYS A 1 110 ? 12.251  -2.708  -2.759  1.00 0.00 ? 265 CYS A CB   2  
ATOM   3877  S  SG   . CYS A 1 110 ? 12.413  -3.597  -1.188  1.00 0.00 ? 265 CYS A SG   2  
ATOM   3878  H  H    . CYS A 1 110 ? 14.375  -1.459  -1.616  1.00 0.00 ? 265 CYS A H    2  
ATOM   3879  H  HA   . CYS A 1 110 ? 12.159  -0.680  -3.473  1.00 0.00 ? 265 CYS A HA   2  
ATOM   3880  H  HB2  . CYS A 1 110 ? 11.265  -2.882  -3.161  1.00 0.00 ? 265 CYS A HB2  2  
ATOM   3881  H  HB3  . CYS A 1 110 ? 12.988  -3.080  -3.456  1.00 0.00 ? 265 CYS A HB3  2  
ATOM   3882  N  N    . TYR A 1 111 ? 10.531  -1.123  -1.022  1.00 0.00 ? 266 TYR A N    2  
ATOM   3883  C  CA   . TYR A 1 111 ? 9.749   -0.541  0.125   1.00 0.00 ? 266 TYR A CA   2  
ATOM   3884  C  C    . TYR A 1 111 ? 10.119  -1.244  1.446   1.00 0.00 ? 266 TYR A C    2  
ATOM   3885  O  O    . TYR A 1 111 ? 10.194  -0.611  2.483   1.00 0.00 ? 266 TYR A O    2  
ATOM   3886  C  CB   . TYR A 1 111 ? 8.259   -0.762  -0.216  1.00 0.00 ? 266 TYR A CB   2  
ATOM   3887  C  CG   . TYR A 1 111 ? 7.951   -0.211  -1.597  1.00 0.00 ? 266 TYR A CG   2  
ATOM   3888  C  CD1  . TYR A 1 111 ? 7.618   1.138   -1.755  1.00 0.00 ? 266 TYR A CD1  2  
ATOM   3889  C  CD2  . TYR A 1 111 ? 8.004   -1.052  -2.717  1.00 0.00 ? 266 TYR A CD2  2  
ATOM   3890  C  CE1  . TYR A 1 111 ? 7.338   1.648   -3.029  1.00 0.00 ? 266 TYR A CE1  2  
ATOM   3891  C  CE2  . TYR A 1 111 ? 7.725   -0.544  -3.991  1.00 0.00 ? 266 TYR A CE2  2  
ATOM   3892  C  CZ   . TYR A 1 111 ? 7.392   0.805   -4.148  1.00 0.00 ? 266 TYR A CZ   2  
ATOM   3893  O  OH   . TYR A 1 111 ? 7.116   1.308   -5.403  1.00 0.00 ? 266 TYR A OH   2  
ATOM   3894  H  H    . TYR A 1 111 ? 10.171  -1.891  -1.515  1.00 0.00 ? 266 TYR A H    2  
ATOM   3895  H  HA   . TYR A 1 111 ? 9.948   0.517   0.205   1.00 0.00 ? 266 TYR A HA   2  
ATOM   3896  H  HB2  . TYR A 1 111 ? 8.042   -1.819  -0.199  1.00 0.00 ? 266 TYR A HB2  2  
ATOM   3897  H  HB3  . TYR A 1 111 ? 7.646   -0.258  0.515   1.00 0.00 ? 266 TYR A HB3  2  
ATOM   3898  H  HD1  . TYR A 1 111 ? 7.577   1.787   -0.895  1.00 0.00 ? 266 TYR A HD1  2  
ATOM   3899  H  HD2  . TYR A 1 111 ? 8.262   -2.095  -2.597  1.00 0.00 ? 266 TYR A HD2  2  
ATOM   3900  H  HE1  . TYR A 1 111 ? 7.081   2.689   -3.150  1.00 0.00 ? 266 TYR A HE1  2  
ATOM   3901  H  HE2  . TYR A 1 111 ? 7.769   -1.195  -4.854  1.00 0.00 ? 266 TYR A HE2  2  
ATOM   3902  H  HH   . TYR A 1 111 ? 7.906   1.743   -5.729  1.00 0.00 ? 266 TYR A HH   2  
ATOM   3903  N  N    . ILE A 1 112 ? 10.357  -2.542  1.424   1.00 0.00 ? 267 ILE A N    2  
ATOM   3904  C  CA   . ILE A 1 112 ? 10.731  -3.256  2.702   1.00 0.00 ? 267 ILE A CA   2  
ATOM   3905  C  C    . ILE A 1 112 ? 12.080  -2.720  3.218   1.00 0.00 ? 267 ILE A C    2  
ATOM   3906  O  O    . ILE A 1 112 ? 12.257  -2.505  4.402   1.00 0.00 ? 267 ILE A O    2  
ATOM   3907  C  CB   . ILE A 1 112 ? 10.867  -4.764  2.378   1.00 0.00 ? 267 ILE A CB   2  
ATOM   3908  C  CG1  . ILE A 1 112 ? 9.571   -5.322  1.754   1.00 0.00 ? 267 ILE A CG1  2  
ATOM   3909  C  CG2  . ILE A 1 112 ? 11.154  -5.526  3.673   1.00 0.00 ? 267 ILE A CG2  2  
ATOM   3910  C  CD1  . ILE A 1 112 ? 8.371   -5.071  2.675   1.00 0.00 ? 267 ILE A CD1  2  
ATOM   3911  H  H    . ILE A 1 112 ? 10.298  -3.033  0.578   1.00 0.00 ? 267 ILE A H    2  
ATOM   3912  H  HA   . ILE A 1 112 ? 9.969   -3.105  3.445   1.00 0.00 ? 267 ILE A HA   2  
ATOM   3913  H  HB   . ILE A 1 112 ? 11.696  -4.910  1.691   1.00 0.00 ? 267 ILE A HB   2  
ATOM   3914  H  HG12 . ILE A 1 112 ? 9.389   -4.855  0.801   1.00 0.00 ? 267 ILE A HG12 2  
ATOM   3915  H  HG13 . ILE A 1 112 ? 9.682   -6.386  1.607   1.00 0.00 ? 267 ILE A HG13 2  
ATOM   3916  H  HG21 . ILE A 1 112 ? 12.041  -5.124  4.139   1.00 0.00 ? 267 ILE A HG21 2  
ATOM   3917  H  HG22 . ILE A 1 112 ? 11.307  -6.572  3.449   1.00 0.00 ? 267 ILE A HG22 2  
ATOM   3918  H  HG23 . ILE A 1 112 ? 10.314  -5.420  4.346   1.00 0.00 ? 267 ILE A HG23 2  
ATOM   3919  H  HD11 . ILE A 1 112 ? 7.667   -4.423  2.175   1.00 0.00 ? 267 ILE A HD11 2  
ATOM   3920  H  HD12 . ILE A 1 112 ? 8.705   -4.605  3.590   1.00 0.00 ? 267 ILE A HD12 2  
ATOM   3921  H  HD13 . ILE A 1 112 ? 7.892   -6.011  2.905   1.00 0.00 ? 267 ILE A HD13 2  
ATOM   3922  N  N    . CYS A 1 113 ? 13.032  -2.509  2.335   1.00 0.00 ? 268 CYS A N    2  
ATOM   3923  C  CA   . CYS A 1 113 ? 14.379  -1.989  2.764   1.00 0.00 ? 268 CYS A CA   2  
ATOM   3924  C  C    . CYS A 1 113 ? 14.216  -0.682  3.553   1.00 0.00 ? 268 CYS A C    2  
ATOM   3925  O  O    . CYS A 1 113 ? 14.769  -0.527  4.625   1.00 0.00 ? 268 CYS A O    2  
ATOM   3926  C  CB   . CYS A 1 113 ? 15.161  -1.718  1.468   1.00 0.00 ? 268 CYS A CB   2  
ATOM   3927  S  SG   . CYS A 1 113 ? 15.789  -3.279  0.799   1.00 0.00 ? 268 CYS A SG   2  
ATOM   3928  H  H    . CYS A 1 113 ? 12.860  -2.693  1.392   1.00 0.00 ? 268 CYS A H    2  
ATOM   3929  H  HA   . CYS A 1 113 ? 14.895  -2.726  3.358   1.00 0.00 ? 268 CYS A HA   2  
ATOM   3930  H  HB2  . CYS A 1 113 ? 14.508  -1.255  0.744   1.00 0.00 ? 268 CYS A HB2  2  
ATOM   3931  H  HB3  . CYS A 1 113 ? 15.988  -1.060  1.679   1.00 0.00 ? 268 CYS A HB3  2  
ATOM   3932  N  N    . HIS A 1 114 ? 13.454  0.258   3.032   1.00 0.00 ? 269 HIS A N    2  
ATOM   3933  C  CA   . HIS A 1 114 ? 13.250  1.556   3.759   1.00 0.00 ? 269 HIS A CA   2  
ATOM   3934  C  C    . HIS A 1 114 ? 12.237  2.448   3.019   1.00 0.00 ? 269 HIS A C    2  
ATOM   3935  O  O    . HIS A 1 114 ? 11.977  2.238   1.851   1.00 0.00 ? 269 HIS A O    2  
ATOM   3936  C  CB   . HIS A 1 114 ? 14.628  2.237   3.825   1.00 0.00 ? 269 HIS A CB   2  
ATOM   3937  C  CG   . HIS A 1 114 ? 15.245  2.390   2.453   1.00 0.00 ? 269 HIS A CG   2  
ATOM   3938  N  ND1  . HIS A 1 114 ? 16.486  2.985   2.284   1.00 0.00 ? 269 HIS A ND1  2  
ATOM   3939  C  CD2  . HIS A 1 114 ? 14.825  2.045   1.185   1.00 0.00 ? 269 HIS A CD2  2  
ATOM   3940  C  CE1  . HIS A 1 114 ? 16.767  2.982   0.970   1.00 0.00 ? 269 HIS A CE1  2  
ATOM   3941  N  NE2  . HIS A 1 114 ? 15.789  2.422   0.256   1.00 0.00 ? 269 HIS A NE2  2  
ATOM   3942  H  H    . HIS A 1 114 ? 13.007  0.105   2.168   1.00 0.00 ? 269 HIS A H    2  
ATOM   3943  H  HA   . HIS A 1 114 ? 12.898  1.360   4.760   1.00 0.00 ? 269 HIS A HA   2  
ATOM   3944  H  HB2  . HIS A 1 114 ? 14.520  3.213   4.269   1.00 0.00 ? 269 HIS A HB2  2  
ATOM   3945  H  HB3  . HIS A 1 114 ? 15.286  1.642   4.443   1.00 0.00 ? 269 HIS A HB3  2  
ATOM   3946  H  HD1  . HIS A 1 114 ? 17.056  3.344   2.996   1.00 0.00 ? 269 HIS A HD1  2  
ATOM   3947  H  HD2  . HIS A 1 114 ? 13.899  1.554   0.942   1.00 0.00 ? 269 HIS A HD2  2  
ATOM   3948  H  HE1  . HIS A 1 114 ? 17.677  3.379   0.544   1.00 0.00 ? 269 HIS A HE1  2  
ATOM   3949  N  N    . PRO A 1 115 ? 11.685  3.414   3.720   1.00 0.00 ? 270 PRO A N    2  
ATOM   3950  C  CA   . PRO A 1 115 ? 10.692  4.318   3.091   1.00 0.00 ? 270 PRO A CA   2  
ATOM   3951  C  C    . PRO A 1 115 ? 11.375  5.212   2.047   1.00 0.00 ? 270 PRO A C    2  
ATOM   3952  O  O    . PRO A 1 115 ? 11.580  6.389   2.275   1.00 0.00 ? 270 PRO A O    2  
ATOM   3953  C  CB   . PRO A 1 115 ? 10.158  5.142   4.262   1.00 0.00 ? 270 PRO A CB   2  
ATOM   3954  C  CG   . PRO A 1 115 ? 11.243  5.097   5.287   1.00 0.00 ? 270 PRO A CG   2  
ATOM   3955  C  CD   . PRO A 1 115 ? 11.923  3.763   5.132   1.00 0.00 ? 270 PRO A CD   2  
ATOM   3956  H  HA   . PRO A 1 115 ? 9.893   3.752   2.643   1.00 0.00 ? 270 PRO A HA   2  
ATOM   3957  H  HB2  . PRO A 1 115 ? 9.972   6.161   3.950   1.00 0.00 ? 270 PRO A HB2  2  
ATOM   3958  H  HB3  . PRO A 1 115 ? 9.258   4.697   4.657   1.00 0.00 ? 270 PRO A HB3  2  
ATOM   3959  H  HG2  . PRO A 1 115 ? 11.948  5.899   5.113   1.00 0.00 ? 270 PRO A HG2  2  
ATOM   3960  H  HG3  . PRO A 1 115 ? 10.823  5.179   6.277   1.00 0.00 ? 270 PRO A HG3  2  
ATOM   3961  H  HD2  . PRO A 1 115 ? 12.981  3.855   5.334   1.00 0.00 ? 270 PRO A HD2  2  
ATOM   3962  H  HD3  . PRO A 1 115 ? 11.471  3.028   5.779   1.00 0.00 ? 270 PRO A HD3  2  
ATOM   3963  N  N    . GLU A 1 116 ? 11.732  4.665   0.901   1.00 0.00 ? 271 GLU A N    2  
ATOM   3964  C  CA   . GLU A 1 116 ? 12.400  5.502   -0.144  1.00 0.00 ? 271 GLU A CA   2  
ATOM   3965  C  C    . GLU A 1 116 ? 11.426  5.833   -1.290  1.00 0.00 ? 271 GLU A C    2  
ATOM   3966  O  O    . GLU A 1 116 ? 11.174  6.997   -1.535  1.00 0.00 ? 271 GLU A O    2  
ATOM   3967  C  CB   . GLU A 1 116 ? 13.605  4.686   -0.640  1.00 0.00 ? 271 GLU A CB   2  
ATOM   3968  C  CG   . GLU A 1 116 ? 14.910  5.353   -0.194  1.00 0.00 ? 271 GLU A CG   2  
ATOM   3969  C  CD   . GLU A 1 116 ? 15.039  6.723   -0.861  1.00 0.00 ? 271 GLU A CD   2  
ATOM   3970  O  OE1  . GLU A 1 116 ? 15.409  6.763   -2.022  1.00 0.00 ? 271 GLU A OE1  2  
ATOM   3971  O  OE2  . GLU A 1 116 ? 14.765  7.712   -0.198  1.00 0.00 ? 271 GLU A OE2  2  
ATOM   3972  H  H    . GLU A 1 116 ? 11.563  3.714   0.733   1.00 0.00 ? 271 GLU A H    2  
ATOM   3973  H  HA   . GLU A 1 116 ? 12.748  6.420   0.304   1.00 0.00 ? 271 GLU A HA   2  
ATOM   3974  H  HB2  . GLU A 1 116 ? 13.554  3.685   -0.232  1.00 0.00 ? 271 GLU A HB2  2  
ATOM   3975  H  HB3  . GLU A 1 116 ? 13.582  4.633   -1.718  1.00 0.00 ? 271 GLU A HB3  2  
ATOM   3976  H  HG2  . GLU A 1 116 ? 14.903  5.473   0.880   1.00 0.00 ? 271 GLU A HG2  2  
ATOM   3977  H  HG3  . GLU A 1 116 ? 15.747  4.735   -0.481  1.00 0.00 ? 271 GLU A HG3  2  
ATOM   3978  N  N    . PRO A 1 117 ? 10.892  4.827   -1.973  1.00 0.00 ? 272 PRO A N    2  
ATOM   3979  C  CA   . PRO A 1 117 ? 9.950   5.107   -3.082  1.00 0.00 ? 272 PRO A CA   2  
ATOM   3980  C  C    . PRO A 1 117 ? 8.473   5.173   -2.624  1.00 0.00 ? 272 PRO A C    2  
ATOM   3981  O  O    . PRO A 1 117 ? 7.587   4.879   -3.405  1.00 0.00 ? 272 PRO A O    2  
ATOM   3982  C  CB   . PRO A 1 117 ? 10.140  3.910   -4.005  1.00 0.00 ? 272 PRO A CB   2  
ATOM   3983  C  CG   . PRO A 1 117 ? 10.624  2.790   -3.128  1.00 0.00 ? 272 PRO A CG   2  
ATOM   3984  C  CD   . PRO A 1 117 ? 11.107  3.380   -1.822  1.00 0.00 ? 272 PRO A CD   2  
ATOM   3985  H  HA   . PRO A 1 117 ? 10.229  6.008   -3.594  1.00 0.00 ? 272 PRO A HA   2  
ATOM   3986  H  HB2  . PRO A 1 117 ? 9.198   3.644   -4.468  1.00 0.00 ? 272 PRO A HB2  2  
ATOM   3987  H  HB3  . PRO A 1 117 ? 10.879  4.131   -4.758  1.00 0.00 ? 272 PRO A HB3  2  
ATOM   3988  H  HG2  . PRO A 1 117 ? 9.814   2.100   -2.940  1.00 0.00 ? 272 PRO A HG2  2  
ATOM   3989  H  HG3  . PRO A 1 117 ? 11.438  2.274   -3.613  1.00 0.00 ? 272 PRO A HG3  2  
ATOM   3990  H  HD2  . PRO A 1 117 ? 10.528  2.988   -0.999  1.00 0.00 ? 272 PRO A HD2  2  
ATOM   3991  H  HD3  . PRO A 1 117 ? 12.147  3.162   -1.689  1.00 0.00 ? 272 PRO A HD3  2  
ATOM   3992  N  N    . LEU A 1 118 ? 8.180   5.557   -1.393  1.00 0.00 ? 273 LEU A N    2  
ATOM   3993  C  CA   . LEU A 1 118 ? 6.742   5.628   -0.966  1.00 0.00 ? 273 LEU A CA   2  
ATOM   3994  C  C    . LEU A 1 118 ? 6.541   6.618   0.200   1.00 0.00 ? 273 LEU A C    2  
ATOM   3995  O  O    . LEU A 1 118 ? 5.704   6.396   1.056   1.00 0.00 ? 273 LEU A O    2  
ATOM   3996  C  CB   . LEU A 1 118 ? 6.350   4.188   -0.565  1.00 0.00 ? 273 LEU A CB   2  
ATOM   3997  C  CG   . LEU A 1 118 ? 6.987   3.771   0.775   1.00 0.00 ? 273 LEU A CG   2  
ATOM   3998  C  CD1  . LEU A 1 118 ? 6.343   2.467   1.256   1.00 0.00 ? 273 LEU A CD1  2  
ATOM   3999  C  CD2  . LEU A 1 118 ? 8.490   3.558   0.590   1.00 0.00 ? 273 LEU A CD2  2  
ATOM   4000  H  H    . LEU A 1 118 ? 8.887   5.801   -0.766  1.00 0.00 ? 273 LEU A H    2  
ATOM   4001  H  HA   . LEU A 1 118 ? 6.136   5.937   -1.803  1.00 0.00 ? 273 LEU A HA   2  
ATOM   4002  H  HB2  . LEU A 1 118 ? 5.276   4.128   -0.477  1.00 0.00 ? 273 LEU A HB2  2  
ATOM   4003  H  HB3  . LEU A 1 118 ? 6.678   3.508   -1.338  1.00 0.00 ? 273 LEU A HB3  2  
ATOM   4004  H  HG   . LEU A 1 118 ? 6.819   4.540   1.512   1.00 0.00 ? 273 LEU A HG   2  
ATOM   4005  H  HD11 . LEU A 1 118 ? 5.453   2.694   1.826   1.00 0.00 ? 273 LEU A HD11 2  
ATOM   4006  H  HD12 . LEU A 1 118 ? 7.041   1.928   1.880   1.00 0.00 ? 273 LEU A HD12 2  
ATOM   4007  H  HD13 . LEU A 1 118 ? 6.078   1.859   0.405   1.00 0.00 ? 273 LEU A HD13 2  
ATOM   4008  H  HD21 . LEU A 1 118 ? 8.698   3.373   -0.452  1.00 0.00 ? 273 LEU A HD21 2  
ATOM   4009  H  HD22 . LEU A 1 118 ? 8.812   2.711   1.178   1.00 0.00 ? 273 LEU A HD22 2  
ATOM   4010  H  HD23 . LEU A 1 118 ? 9.020   4.442   0.911   1.00 0.00 ? 273 LEU A HD23 2  
ATOM   4011  N  N    . LEU A 1 119 ? 7.279   7.711   0.241   1.00 0.00 ? 274 LEU A N    2  
ATOM   4012  C  CA   . LEU A 1 119 ? 7.078   8.690   1.373   1.00 0.00 ? 274 LEU A CA   2  
ATOM   4013  C  C    . LEU A 1 119 ? 5.650   9.244   1.312   1.00 0.00 ? 274 LEU A C    2  
ATOM   4014  O  O    . LEU A 1 119 ? 4.920   9.189   2.282   1.00 0.00 ? 274 LEU A O    2  
ATOM   4015  C  CB   . LEU A 1 119 ? 8.110   9.830   1.206   1.00 0.00 ? 274 LEU A CB   2  
ATOM   4016  C  CG   . LEU A 1 119 ? 9.092   9.829   2.388   1.00 0.00 ? 274 LEU A CG   2  
ATOM   4017  C  CD1  . LEU A 1 119 ? 8.332   10.056  3.704   1.00 0.00 ? 274 LEU A CD1  2  
ATOM   4018  C  CD2  . LEU A 1 119 ? 9.832   8.486   2.443   1.00 0.00 ? 274 LEU A CD2  2  
ATOM   4019  H  H    . LEU A 1 119 ? 7.940   7.885   -0.465  1.00 0.00 ? 274 LEU A H    2  
ATOM   4020  H  HA   . LEU A 1 119 ? 7.230   8.192   2.314   1.00 0.00 ? 274 LEU A HA   2  
ATOM   4021  H  HB2  . LEU A 1 119 ? 8.659   9.696   0.287   1.00 0.00 ? 274 LEU A HB2  2  
ATOM   4022  H  HB3  . LEU A 1 119 ? 7.595   10.779  1.175   1.00 0.00 ? 274 LEU A HB3  2  
ATOM   4023  H  HG   . LEU A 1 119 ? 9.809   10.627  2.252   1.00 0.00 ? 274 LEU A HG   2  
ATOM   4024  H  HD11 . LEU A 1 119 ? 8.471   11.077  4.027   1.00 0.00 ? 274 LEU A HD11 2  
ATOM   4025  H  HD12 . LEU A 1 119 ? 8.710   9.385   4.462   1.00 0.00 ? 274 LEU A HD12 2  
ATOM   4026  H  HD13 . LEU A 1 119 ? 7.279   9.869   3.552   1.00 0.00 ? 274 LEU A HD13 2  
ATOM   4027  H  HD21 . LEU A 1 119 ? 9.252   7.781   3.023   1.00 0.00 ? 274 LEU A HD21 2  
ATOM   4028  H  HD22 . LEU A 1 119 ? 10.796  8.625   2.907   1.00 0.00 ? 274 LEU A HD22 2  
ATOM   4029  H  HD23 . LEU A 1 119 ? 9.963   8.106   1.441   1.00 0.00 ? 274 LEU A HD23 2  
ATOM   4030  N  N    . ASP A 1 120 ? 5.235   9.756   0.172   1.00 0.00 ? 275 ASP A N    2  
ATOM   4031  C  CA   . ASP A 1 120 ? 3.826   10.291  0.061   1.00 0.00 ? 275 ASP A CA   2  
ATOM   4032  C  C    . ASP A 1 120 ? 2.820   9.182   0.419   1.00 0.00 ? 275 ASP A C    2  
ATOM   4033  O  O    . ASP A 1 120 ? 1.809   9.437   1.046   1.00 0.00 ? 275 ASP A O    2  
ATOM   4034  C  CB   . ASP A 1 120 ? 3.632   10.731  -1.399  1.00 0.00 ? 275 ASP A CB   2  
ATOM   4035  C  CG   . ASP A 1 120 ? 4.262   12.109  -1.607  1.00 0.00 ? 275 ASP A CG   2  
ATOM   4036  O  OD1  . ASP A 1 120 ? 4.158   12.928  -0.708  1.00 0.00 ? 275 ASP A OD1  2  
ATOM   4037  O  OD2  . ASP A 1 120 ? 4.837   12.323  -2.662  1.00 0.00 ? 275 ASP A OD2  2  
ATOM   4038  H  H    . ASP A 1 120 ? 5.842   9.773   -0.606  1.00 0.00 ? 275 ASP A H    2  
ATOM   4039  H  HA   . ASP A 1 120 ? 3.698   11.133  0.718   1.00 0.00 ? 275 ASP A HA   2  
ATOM   4040  H  HB2  . ASP A 1 120 ? 4.103   10.015  -2.057  1.00 0.00 ? 275 ASP A HB2  2  
ATOM   4041  H  HB3  . ASP A 1 120 ? 2.576   10.783  -1.621  1.00 0.00 ? 275 ASP A HB3  2  
ATOM   4042  N  N    . LEU A 1 121 ? 3.096   7.953   0.033   1.00 0.00 ? 276 LEU A N    2  
ATOM   4043  C  CA   . LEU A 1 121 ? 2.150   6.829   0.366   1.00 0.00 ? 276 LEU A CA   2  
ATOM   4044  C  C    . LEU A 1 121 ? 2.090   6.624   1.887   1.00 0.00 ? 276 LEU A C    2  
ATOM   4045  O  O    . LEU A 1 121 ? 1.032   6.392   2.440   1.00 0.00 ? 276 LEU A O    2  
ATOM   4046  C  CB   . LEU A 1 121 ? 2.720   5.573   -0.319  1.00 0.00 ? 276 LEU A CB   2  
ATOM   4047  C  CG   . LEU A 1 121 ? 1.598   4.587   -0.645  1.00 0.00 ? 276 LEU A CG   2  
ATOM   4048  C  CD1  . LEU A 1 121 ? 0.734   5.146   -1.779  1.00 0.00 ? 276 LEU A CD1  2  
ATOM   4049  C  CD2  . LEU A 1 121 ? 2.214   3.254   -1.084  1.00 0.00 ? 276 LEU A CD2  2  
ATOM   4050  H  H    . LEU A 1 121 ? 3.924   7.772   -0.469  1.00 0.00 ? 276 LEU A H    2  
ATOM   4051  H  HA   . LEU A 1 121 ? 1.168   7.047   -0.012  1.00 0.00 ? 276 LEU A HA   2  
ATOM   4052  H  HB2  . LEU A 1 121 ? 3.219   5.861   -1.232  1.00 0.00 ? 276 LEU A HB2  2  
ATOM   4053  H  HB3  . LEU A 1 121 ? 3.430   5.098   0.342   1.00 0.00 ? 276 LEU A HB3  2  
ATOM   4054  H  HG   . LEU A 1 121 ? 0.987   4.432   0.232   1.00 0.00 ? 276 LEU A HG   2  
ATOM   4055  H  HD11 . LEU A 1 121 ? 0.809   6.223   -1.792  1.00 0.00 ? 276 LEU A HD11 2  
ATOM   4056  H  HD12 . LEU A 1 121 ? -0.296  4.859   -1.620  1.00 0.00 ? 276 LEU A HD12 2  
ATOM   4057  H  HD13 . LEU A 1 121 ? 1.076   4.749   -2.723  1.00 0.00 ? 276 LEU A HD13 2  
ATOM   4058  H  HD21 . LEU A 1 121 ? 2.276   3.221   -2.162  1.00 0.00 ? 276 LEU A HD21 2  
ATOM   4059  H  HD22 . LEU A 1 121 ? 1.598   2.441   -0.735  1.00 0.00 ? 276 LEU A HD22 2  
ATOM   4060  H  HD23 . LEU A 1 121 ? 3.205   3.157   -0.665  1.00 0.00 ? 276 LEU A HD23 2  
ATOM   4061  N  N    . VAL A 1 122 ? 3.212   6.718   2.571   1.00 0.00 ? 277 VAL A N    2  
ATOM   4062  C  CA   . VAL A 1 122 ? 3.188   6.533   4.066   1.00 0.00 ? 277 VAL A CA   2  
ATOM   4063  C  C    . VAL A 1 122 ? 2.508   7.746   4.719   1.00 0.00 ? 277 VAL A C    2  
ATOM   4064  O  O    . VAL A 1 122 ? 1.705   7.597   5.623   1.00 0.00 ? 277 VAL A O    2  
ATOM   4065  C  CB   . VAL A 1 122 ? 4.656   6.403   4.520   1.00 0.00 ? 277 VAL A CB   2  
ATOM   4066  C  CG1  . VAL A 1 122 ? 4.734   6.335   6.051   1.00 0.00 ? 277 VAL A CG1  2  
ATOM   4067  C  CG2  . VAL A 1 122 ? 5.255   5.123   3.923   1.00 0.00 ? 277 VAL A CG2  2  
ATOM   4068  H  H    . VAL A 1 122 ? 4.057   6.915   2.104   1.00 0.00 ? 277 VAL A H    2  
ATOM   4069  H  HA   . VAL A 1 122 ? 2.648   5.636   4.314   1.00 0.00 ? 277 VAL A HA   2  
ATOM   4070  H  HB   . VAL A 1 122 ? 5.217   7.260   4.170   1.00 0.00 ? 277 VAL A HB   2  
ATOM   4071  H  HG11 . VAL A 1 122 ? 5.535   5.672   6.342   1.00 0.00 ? 277 VAL A HG11 2  
ATOM   4072  H  HG12 . VAL A 1 122 ? 3.799   5.963   6.441   1.00 0.00 ? 277 VAL A HG12 2  
ATOM   4073  H  HG13 . VAL A 1 122 ? 4.922   7.322   6.446   1.00 0.00 ? 277 VAL A HG13 2  
ATOM   4074  H  HG21 . VAL A 1 122 ? 5.825   5.370   3.040   1.00 0.00 ? 277 VAL A HG21 2  
ATOM   4075  H  HG22 . VAL A 1 122 ? 4.459   4.441   3.656   1.00 0.00 ? 277 VAL A HG22 2  
ATOM   4076  H  HG23 . VAL A 1 122 ? 5.903   4.653   4.648   1.00 0.00 ? 277 VAL A HG23 2  
ATOM   4077  N  N    . THR A 1 123 ? 2.805   8.943   4.261   1.00 0.00 ? 278 THR A N    2  
ATOM   4078  C  CA   . THR A 1 123 ? 2.140   10.151  4.866   1.00 0.00 ? 278 THR A CA   2  
ATOM   4079  C  C    . THR A 1 123 ? 0.623   10.068  4.629   1.00 0.00 ? 278 THR A C    2  
ATOM   4080  O  O    . THR A 1 123 ? -0.157  10.432  5.491   1.00 0.00 ? 278 THR A O    2  
ATOM   4081  C  CB   . THR A 1 123 ? 2.732   11.398  4.175   1.00 0.00 ? 278 THR A CB   2  
ATOM   4082  O  OG1  . THR A 1 123 ? 3.784   11.006  3.302   1.00 0.00 ? 278 THR A OG1  2  
ATOM   4083  C  CG2  . THR A 1 123 ? 3.279   12.363  5.232   1.00 0.00 ? 278 THR A CG2  2  
ATOM   4084  H  H    . THR A 1 123 ? 3.447   9.041   3.519   1.00 0.00 ? 278 THR A H    2  
ATOM   4085  H  HA   . THR A 1 123 ? 2.343   10.186  5.926   1.00 0.00 ? 278 THR A HA   2  
ATOM   4086  H  HB   . THR A 1 123 ? 1.961   11.896  3.606   1.00 0.00 ? 278 THR A HB   2  
ATOM   4087  H  HG1  . THR A 1 123 ? 4.013   11.761  2.754   1.00 0.00 ? 278 THR A HG1  2  
ATOM   4088  H  HG21 . THR A 1 123 ? 2.785   12.182  6.175   1.00 0.00 ? 278 THR A HG21 2  
ATOM   4089  H  HG22 . THR A 1 123 ? 3.097   13.381  4.919   1.00 0.00 ? 278 THR A HG22 2  
ATOM   4090  H  HG23 . THR A 1 123 ? 4.342   12.205  5.346   1.00 0.00 ? 278 THR A HG23 2  
ATOM   4091  N  N    . ALA A 1 124 ? 0.189   9.577   3.479   1.00 0.00 ? 279 ALA A N    2  
ATOM   4092  C  CA   . ALA A 1 124 ? -1.295  9.468   3.235   1.00 0.00 ? 279 ALA A CA   2  
ATOM   4093  C  C    . ALA A 1 124 ? -1.943  8.547   4.288   1.00 0.00 ? 279 ALA A C    2  
ATOM   4094  O  O    . ALA A 1 124 ? -3.087  8.739   4.654   1.00 0.00 ? 279 ALA A O    2  
ATOM   4095  C  CB   . ALA A 1 124 ? -1.473  8.871   1.830   1.00 0.00 ? 279 ALA A CB   2  
ATOM   4096  H  H    . ALA A 1 124 ? 0.834   9.273   2.791   1.00 0.00 ? 279 ALA A H    2  
ATOM   4097  H  HA   . ALA A 1 124 ? -1.745  10.444  3.276   1.00 0.00 ? 279 ALA A HA   2  
ATOM   4098  H  HB1  . ALA A 1 124 ? -2.465  8.455   1.739   1.00 0.00 ? 279 ALA A HB1  2  
ATOM   4099  H  HB2  . ALA A 1 124 ? -0.741  8.091   1.675   1.00 0.00 ? 279 ALA A HB2  2  
ATOM   4100  H  HB3  . ALA A 1 124 ? -1.336  9.644   1.090   1.00 0.00 ? 279 ALA A HB3  2  
ATOM   4101  N  N    . CYS A 1 125 ? -1.228  7.551   4.781   1.00 0.00 ? 280 CYS A N    2  
ATOM   4102  C  CA   . CYS A 1 125 ? -1.833  6.634   5.812   1.00 0.00 ? 280 CYS A CA   2  
ATOM   4103  C  C    . CYS A 1 125 ? -2.229  7.442   7.056   1.00 0.00 ? 280 CYS A C    2  
ATOM   4104  O  O    . CYS A 1 125 ? -3.345  7.342   7.531   1.00 0.00 ? 280 CYS A O    2  
ATOM   4105  C  CB   . CYS A 1 125 ? -0.747  5.596   6.169   1.00 0.00 ? 280 CYS A CB   2  
ATOM   4106  S  SG   . CYS A 1 125 ? -1.367  4.439   7.423   1.00 0.00 ? 280 CYS A SG   2  
ATOM   4107  H  H    . CYS A 1 125 ? -0.304  7.411   4.476   1.00 0.00 ? 280 CYS A H    2  
ATOM   4108  H  HA   . CYS A 1 125 ? -2.698  6.138   5.403   1.00 0.00 ? 280 CYS A HA   2  
ATOM   4109  H  HB2  . CYS A 1 125 ? -0.474  5.045   5.282   1.00 0.00 ? 280 CYS A HB2  2  
ATOM   4110  H  HB3  . CYS A 1 125 ? 0.123   6.108   6.553   1.00 0.00 ? 280 CYS A HB3  2  
ATOM   4111  H  HG   . CYS A 1 125 ? -1.264  3.548   7.080   1.00 0.00 ? 280 CYS A HG   2  
ATOM   4112  N  N    . ASN A 1 126 ? -1.327  8.238   7.590   1.00 0.00 ? 281 ASN A N    2  
ATOM   4113  C  CA   . ASN A 1 126 ? -1.683  9.039   8.816   1.00 0.00 ? 281 ASN A CA   2  
ATOM   4114  C  C    . ASN A 1 126 ? -2.850  9.987   8.508   1.00 0.00 ? 281 ASN A C    2  
ATOM   4115  O  O    . ASN A 1 126 ? -3.741  10.158  9.321   1.00 0.00 ? 281 ASN A O    2  
ATOM   4116  C  CB   . ASN A 1 126 ? -0.433  9.842   9.207   1.00 0.00 ? 281 ASN A CB   2  
ATOM   4117  C  CG   . ASN A 1 126 ? 0.534   8.939   9.985   1.00 0.00 ? 281 ASN A CG   2  
ATOM   4118  O  OD1  . ASN A 1 126 ? 1.487   8.436   9.426   1.00 0.00 ? 281 ASN A OD1  2  
ATOM   4119  N  ND2  . ASN A 1 126 ? 0.330   8.707   11.259  1.00 0.00 ? 281 ASN A ND2  2  
ATOM   4120  H  H    . ASN A 1 126 ? -0.424  8.302   7.189   1.00 0.00 ? 281 ASN A H    2  
ATOM   4121  H  HA   . ASN A 1 126 ? -1.960  8.377   9.616   1.00 0.00 ? 281 ASN A HA   2  
ATOM   4122  H  HB2  . ASN A 1 126 ? 0.054   10.207  8.314   1.00 0.00 ? 281 ASN A HB2  2  
ATOM   4123  H  HB3  . ASN A 1 126 ? -0.720  10.677  9.829   1.00 0.00 ? 281 ASN A HB3  2  
ATOM   4124  H  HD21 . ASN A 1 126 ? -0.438  9.108   11.722  1.00 0.00 ? 281 ASN A HD21 2  
ATOM   4125  H  HD22 . ASN A 1 126 ? 0.949   8.129   11.753  1.00 0.00 ? 281 ASN A HD22 2  
ATOM   4126  N  N    . SER A 1 127 ? -2.865  10.596  7.343   1.00 0.00 ? 282 SER A N    2  
ATOM   4127  C  CA   . SER A 1 127 ? -4.002  11.524  7.006   1.00 0.00 ? 282 SER A CA   2  
ATOM   4128  C  C    . SER A 1 127 ? -5.288  10.714  6.780   1.00 0.00 ? 282 SER A C    2  
ATOM   4129  O  O    . SER A 1 127 ? -6.363  11.146  7.155   1.00 0.00 ? 282 SER A O    2  
ATOM   4130  C  CB   . SER A 1 127 ? -3.606  12.271  5.724   1.00 0.00 ? 282 SER A CB   2  
ATOM   4131  O  OG   . SER A 1 127 ? -4.332  13.492  5.648   1.00 0.00 ? 282 SER A OG   2  
ATOM   4132  H  H    . SER A 1 127 ? -2.139  10.437  6.696   1.00 0.00 ? 282 SER A H    2  
ATOM   4133  H  HA   . SER A 1 127 ? -4.151  12.223  7.808   1.00 0.00 ? 282 SER A HA   2  
ATOM   4134  H  HB2  . SER A 1 127 ? -2.551  12.486  5.742   1.00 0.00 ? 282 SER A HB2  2  
ATOM   4135  H  HB3  . SER A 1 127 ? -3.830  11.652  4.865   1.00 0.00 ? 282 SER A HB3  2  
ATOM   4136  H  HG   . SER A 1 127 ? -3.901  14.053  5.001   1.00 0.00 ? 282 SER A HG   2  
ATOM   4137  N  N    . VAL A 1 128 ? -5.194  9.543   6.184   1.00 0.00 ? 283 VAL A N    2  
ATOM   4138  C  CA   . VAL A 1 128 ? -6.435  8.723   5.965   1.00 0.00 ? 283 VAL A CA   2  
ATOM   4139  C  C    . VAL A 1 128 ? -6.856  8.066   7.280   1.00 0.00 ? 283 VAL A C    2  
ATOM   4140  O  O    . VAL A 1 128 ? -8.033  8.013   7.591   1.00 0.00 ? 283 VAL A O    2  
ATOM   4141  C  CB   . VAL A 1 128 ? -6.087  7.659   4.908   1.00 0.00 ? 283 VAL A CB   2  
ATOM   4142  C  CG1  . VAL A 1 128 ? -7.306  6.770   4.634   1.00 0.00 ? 283 VAL A CG1  2  
ATOM   4143  C  CG2  . VAL A 1 128 ? -5.665  8.353   3.611   1.00 0.00 ? 283 VAL A CG2  2  
ATOM   4144  H  H    . VAL A 1 128 ? -4.315  9.205   5.897   1.00 0.00 ? 283 VAL A H    2  
ATOM   4145  H  HA   . VAL A 1 128 ? -7.230  9.353   5.610   1.00 0.00 ? 283 VAL A HA   2  
ATOM   4146  H  HB   . VAL A 1 128 ? -5.272  7.048   5.271   1.00 0.00 ? 283 VAL A HB   2  
ATOM   4147  H  HG11 . VAL A 1 128 ? -6.979  5.841   4.189   1.00 0.00 ? 283 VAL A HG11 2  
ATOM   4148  H  HG12 . VAL A 1 128 ? -7.976  7.277   3.956   1.00 0.00 ? 283 VAL A HG12 2  
ATOM   4149  H  HG13 . VAL A 1 128 ? -7.819  6.563   5.561   1.00 0.00 ? 283 VAL A HG13 2  
ATOM   4150  H  HG21 . VAL A 1 128 ? -4.910  7.761   3.115   1.00 0.00 ? 283 VAL A HG21 2  
ATOM   4151  H  HG22 . VAL A 1 128 ? -5.264  9.330   3.838   1.00 0.00 ? 283 VAL A HG22 2  
ATOM   4152  H  HG23 . VAL A 1 128 ? -6.523  8.458   2.963   1.00 0.00 ? 283 VAL A HG23 2  
ATOM   4153  N  N    . PHE A 1 129 ? -5.919  7.586   8.071   1.00 0.00 ? 284 PHE A N    2  
ATOM   4154  C  CA   . PHE A 1 129 ? -6.328  6.967   9.375   1.00 0.00 ? 284 PHE A CA   2  
ATOM   4155  C  C    . PHE A 1 129 ? -6.759  8.074   10.349  1.00 0.00 ? 284 PHE A C    2  
ATOM   4156  O  O    . PHE A 1 129 ? -7.627  7.860   11.175  1.00 0.00 ? 284 PHE A O    2  
ATOM   4157  C  CB   . PHE A 1 129 ? -5.128  6.170   9.926   1.00 0.00 ? 284 PHE A CB   2  
ATOM   4158  C  CG   . PHE A 1 129 ? -5.443  4.693   9.845   1.00 0.00 ? 284 PHE A CG   2  
ATOM   4159  C  CD1  . PHE A 1 129 ? -6.551  4.179   10.531  1.00 0.00 ? 284 PHE A CD1  2  
ATOM   4160  C  CD2  . PHE A 1 129 ? -4.645  3.844   9.071   1.00 0.00 ? 284 PHE A CD2  2  
ATOM   4161  C  CE1  . PHE A 1 129 ? -6.858  2.818   10.443  1.00 0.00 ? 284 PHE A CE1  2  
ATOM   4162  C  CE2  . PHE A 1 129 ? -4.952  2.480   8.987   1.00 0.00 ? 284 PHE A CE2  2  
ATOM   4163  C  CZ   . PHE A 1 129 ? -6.059  1.967   9.673   1.00 0.00 ? 284 PHE A CZ   2  
ATOM   4164  H  H    . PHE A 1 129 ? -4.968  7.656   7.818   1.00 0.00 ? 284 PHE A H    2  
ATOM   4165  H  HA   . PHE A 1 129 ? -7.162  6.302   9.202   1.00 0.00 ? 284 PHE A HA   2  
ATOM   4166  H  HB2  . PHE A 1 129 ? -4.245  6.384   9.344   1.00 0.00 ? 284 PHE A HB2  2  
ATOM   4167  H  HB3  . PHE A 1 129 ? -4.958  6.443   10.957  1.00 0.00 ? 284 PHE A HB3  2  
ATOM   4168  H  HD1  . PHE A 1 129 ? -7.170  4.835   11.128  1.00 0.00 ? 284 PHE A HD1  2  
ATOM   4169  H  HD2  . PHE A 1 129 ? -3.790  4.239   8.543   1.00 0.00 ? 284 PHE A HD2  2  
ATOM   4170  H  HE1  . PHE A 1 129 ? -7.713  2.423   10.972  1.00 0.00 ? 284 PHE A HE1  2  
ATOM   4171  H  HE2  . PHE A 1 129 ? -4.335  1.824   8.391   1.00 0.00 ? 284 PHE A HE2  2  
ATOM   4172  H  HZ   . PHE A 1 129 ? -6.299  0.916   9.603   1.00 0.00 ? 284 PHE A HZ   2  
ATOM   4173  N  N    . GLU A 1 130 ? -6.196  9.271   10.246  1.00 0.00 ? 285 GLU A N    2  
ATOM   4174  C  CA   . GLU A 1 130 ? -6.641  10.378  11.168  1.00 0.00 ? 285 GLU A CA   2  
ATOM   4175  C  C    . GLU A 1 130 ? -8.153  10.591  11.002  1.00 0.00 ? 285 GLU A C    2  
ATOM   4176  O  O    . GLU A 1 130 ? -8.860  10.801  11.970  1.00 0.00 ? 285 GLU A O    2  
ATOM   4177  C  CB   . GLU A 1 130 ? -5.875  11.646  10.756  1.00 0.00 ? 285 GLU A CB   2  
ATOM   4178  C  CG   . GLU A 1 130 ? -6.238  12.791  11.703  1.00 0.00 ? 285 GLU A CG   2  
ATOM   4179  C  CD   . GLU A 1 130 ? -5.020  13.695  11.903  1.00 0.00 ? 285 GLU A CD   2  
ATOM   4180  O  OE1  . GLU A 1 130 ? -4.744  14.488  11.019  1.00 0.00 ? 285 GLU A OE1  2  
ATOM   4181  O  OE2  . GLU A 1 130 ? -4.385  13.578  12.938  1.00 0.00 ? 285 GLU A OE2  2  
ATOM   4182  H  H    . GLU A 1 130 ? -5.511  9.442   9.559   1.00 0.00 ? 285 GLU A H    2  
ATOM   4183  H  HA   . GLU A 1 130 ? -6.416  10.122  12.188  1.00 0.00 ? 285 GLU A HA   2  
ATOM   4184  H  HB2  . GLU A 1 130 ? -4.812  11.457  10.808  1.00 0.00 ? 285 GLU A HB2  2  
ATOM   4185  H  HB3  . GLU A 1 130 ? -6.144  11.917  9.746   1.00 0.00 ? 285 GLU A HB3  2  
ATOM   4186  H  HG2  . GLU A 1 130 ? -7.048  13.366  11.278  1.00 0.00 ? 285 GLU A HG2  2  
ATOM   4187  H  HG3  . GLU A 1 130 ? -6.544  12.387  12.655  1.00 0.00 ? 285 GLU A HG3  2  
ATOM   4188  N  N    . ASN A 1 131 ? -8.664  10.503  9.785   1.00 0.00 ? 286 ASN A N    2  
ATOM   4189  C  CA   . ASN A 1 131 ? -10.150 10.668  9.594   1.00 0.00 ? 286 ASN A CA   2  
ATOM   4190  C  C    . ASN A 1 131 ? -10.903 9.596   10.409  1.00 0.00 ? 286 ASN A C    2  
ATOM   4191  O  O    . ASN A 1 131 ? -12.001 9.831   10.876  1.00 0.00 ? 286 ASN A O    2  
ATOM   4192  C  CB   . ASN A 1 131 ? -10.430 10.489  8.092   1.00 0.00 ? 286 ASN A CB   2  
ATOM   4193  C  CG   . ASN A 1 131 ? -10.193 11.817  7.364   1.00 0.00 ? 286 ASN A CG   2  
ATOM   4194  O  OD1  . ASN A 1 131 ? -11.093 12.625  7.252   1.00 0.00 ? 286 ASN A OD1  2  
ATOM   4195  N  ND2  . ASN A 1 131 ? -9.014  12.085  6.858   1.00 0.00 ? 286 ASN A ND2  2  
ATOM   4196  H  H    . ASN A 1 131 ? -8.076  10.308  9.012   1.00 0.00 ? 286 ASN A H    2  
ATOM   4197  H  HA   . ASN A 1 131 ? -10.455 11.651  9.909   1.00 0.00 ? 286 ASN A HA   2  
ATOM   4198  H  HB2  . ASN A 1 131 ? -9.767  9.734   7.692   1.00 0.00 ? 286 ASN A HB2  2  
ATOM   4199  H  HB3  . ASN A 1 131 ? -11.455 10.180  7.952   1.00 0.00 ? 286 ASN A HB3  2  
ATOM   4200  H  HD21 . ASN A 1 131 ? -8.279  11.439  6.942   1.00 0.00 ? 286 ASN A HD21 2  
ATOM   4201  H  HD22 . ASN A 1 131 ? -8.865  12.934  6.393   1.00 0.00 ? 286 ASN A HD22 2  
ATOM   4202  N  N    . LEU A 1 132 ? -10.319 8.422   10.594  1.00 0.00 ? 287 LEU A N    2  
ATOM   4203  C  CA   . LEU A 1 132 ? -11.015 7.348   11.395  1.00 0.00 ? 287 LEU A CA   2  
ATOM   4204  C  C    . LEU A 1 132 ? -11.374 7.892   12.788  1.00 0.00 ? 287 LEU A C    2  
ATOM   4205  O  O    . LEU A 1 132 ? -12.450 7.635   13.297  1.00 0.00 ? 287 LEU A O    2  
ATOM   4206  C  CB   . LEU A 1 132 ? -10.008 6.186   11.530  1.00 0.00 ? 287 LEU A CB   2  
ATOM   4207  C  CG   . LEU A 1 132 ? -10.735 4.845   11.728  1.00 0.00 ? 287 LEU A CG   2  
ATOM   4208  C  CD1  . LEU A 1 132 ? -11.685 4.921   12.929  1.00 0.00 ? 287 LEU A CD1  2  
ATOM   4209  C  CD2  . LEU A 1 132 ? -11.529 4.504   10.464  1.00 0.00 ? 287 LEU A CD2  2  
ATOM   4210  H  H    . LEU A 1 132 ? -9.429  8.251   10.216  1.00 0.00 ? 287 LEU A H    2  
ATOM   4211  H  HA   . LEU A 1 132 ? -11.902 7.013   10.883  1.00 0.00 ? 287 LEU A HA   2  
ATOM   4212  H  HB2  . LEU A 1 132 ? -9.407  6.131   10.634  1.00 0.00 ? 287 LEU A HB2  2  
ATOM   4213  H  HB3  . LEU A 1 132 ? -9.365  6.372   12.375  1.00 0.00 ? 287 LEU A HB3  2  
ATOM   4214  H  HG   . LEU A 1 132 ? -10.002 4.071   11.907  1.00 0.00 ? 287 LEU A HG   2  
ATOM   4215  H  HD11 . LEU A 1 132 ? -11.258 5.565   13.685  1.00 0.00 ? 287 LEU A HD11 2  
ATOM   4216  H  HD12 . LEU A 1 132 ? -11.828 3.933   13.340  1.00 0.00 ? 287 LEU A HD12 2  
ATOM   4217  H  HD13 . LEU A 1 132 ? -12.636 5.320   12.612  1.00 0.00 ? 287 LEU A HD13 2  
ATOM   4218  H  HD21 . LEU A 1 132 ? -12.399 5.141   10.401  1.00 0.00 ? 287 LEU A HD21 2  
ATOM   4219  H  HD22 . LEU A 1 132 ? -11.840 3.470   10.501  1.00 0.00 ? 287 LEU A HD22 2  
ATOM   4220  H  HD23 . LEU A 1 132 ? -10.904 4.660   9.595   1.00 0.00 ? 287 LEU A HD23 2  
ATOM   4221  N  N    . GLU A 1 133 ? -10.486 8.646   13.409  1.00 0.00 ? 288 GLU A N    2  
ATOM   4222  C  CA   . GLU A 1 133 ? -10.809 9.199   14.773  1.00 0.00 ? 288 GLU A CA   2  
ATOM   4223  C  C    . GLU A 1 133 ? -12.002 10.158  14.673  1.00 0.00 ? 288 GLU A C    2  
ATOM   4224  O  O    . GLU A 1 133 ? -12.885 10.143  15.511  1.00 0.00 ? 288 GLU A O    2  
ATOM   4225  C  CB   . GLU A 1 133 ? -9.560  9.953   15.259  1.00 0.00 ? 288 GLU A CB   2  
ATOM   4226  C  CG   . GLU A 1 133 ? -8.634  8.984   15.998  1.00 0.00 ? 288 GLU A CG   2  
ATOM   4227  C  CD   . GLU A 1 133 ? -9.288  8.551   17.311  1.00 0.00 ? 288 GLU A CD   2  
ATOM   4228  O  OE1  . GLU A 1 133 ? -9.540  9.413   18.137  1.00 0.00 ? 288 GLU A OE1  2  
ATOM   4229  O  OE2  . GLU A 1 133 ? -9.527  7.365   17.469  1.00 0.00 ? 288 GLU A OE2  2  
ATOM   4230  H  H    . GLU A 1 133 ? -9.619  8.847   12.976  1.00 0.00 ? 288 GLU A H    2  
ATOM   4231  H  HA   . GLU A 1 133 ? -11.041 8.397   15.451  1.00 0.00 ? 288 GLU A HA   2  
ATOM   4232  H  HB2  . GLU A 1 133 ? -9.040  10.373  14.410  1.00 0.00 ? 288 GLU A HB2  2  
ATOM   4233  H  HB3  . GLU A 1 133 ? -9.856  10.746  15.930  1.00 0.00 ? 288 GLU A HB3  2  
ATOM   4234  H  HG2  . GLU A 1 133 ? -8.455  8.116   15.380  1.00 0.00 ? 288 GLU A HG2  2  
ATOM   4235  H  HG3  . GLU A 1 133 ? -7.696  9.474   16.211  1.00 0.00 ? 288 GLU A HG3  2  
ATOM   4236  N  N    . GLN A 1 134 ? -12.046 10.987  13.651  1.00 0.00 ? 289 GLN A N    2  
ATOM   4237  C  CA   . GLN A 1 134 ? -13.207 11.938  13.511  1.00 0.00 ? 289 GLN A CA   2  
ATOM   4238  C  C    . GLN A 1 134 ? -14.516 11.144  13.376  1.00 0.00 ? 289 GLN A C    2  
ATOM   4239  O  O    . GLN A 1 134 ? -15.531 11.526  13.926  1.00 0.00 ? 289 GLN A O    2  
ATOM   4240  C  CB   . GLN A 1 134 ? -12.957 12.763  12.238  1.00 0.00 ? 289 GLN A CB   2  
ATOM   4241  C  CG   . GLN A 1 134 ? -12.136 14.006  12.588  1.00 0.00 ? 289 GLN A CG   2  
ATOM   4242  C  CD   . GLN A 1 134 ? -11.237 14.377  11.402  1.00 0.00 ? 289 GLN A CD   2  
ATOM   4243  O  OE1  . GLN A 1 134 ? -11.597 14.149  10.264  1.00 0.00 ? 289 GLN A OE1  2  
ATOM   4244  N  NE2  . GLN A 1 134 ? -10.074 14.943  11.614  1.00 0.00 ? 289 GLN A NE2  2  
ATOM   4245  H  H    . GLN A 1 134 ? -11.322 10.976  12.981  1.00 0.00 ? 289 GLN A H    2  
ATOM   4246  H  HA   . GLN A 1 134 ? -13.256 12.591  14.368  1.00 0.00 ? 289 GLN A HA   2  
ATOM   4247  H  HB2  . GLN A 1 134 ? -12.416 12.163  11.520  1.00 0.00 ? 289 GLN A HB2  2  
ATOM   4248  H  HB3  . GLN A 1 134 ? -13.902 13.066  11.814  1.00 0.00 ? 289 GLN A HB3  2  
ATOM   4249  H  HG2  . GLN A 1 134 ? -12.803 14.828  12.806  1.00 0.00 ? 289 GLN A HG2  2  
ATOM   4250  H  HG3  . GLN A 1 134 ? -11.522 13.800  13.451  1.00 0.00 ? 289 GLN A HG3  2  
ATOM   4251  H  HE21 . GLN A 1 134 ? -9.773  15.133  12.529  1.00 0.00 ? 289 GLN A HE21 2  
ATOM   4252  H  HE22 . GLN A 1 134 ? -9.502  15.180  10.855  1.00 0.00 ? 289 GLN A HE22 2  
ATOM   4253  N  N    . LEU A 1 135 ? -14.507 10.039  12.652  1.00 0.00 ? 290 LEU A N    2  
ATOM   4254  C  CA   . LEU A 1 135 ? -15.775 9.234   12.502  1.00 0.00 ? 290 LEU A CA   2  
ATOM   4255  C  C    . LEU A 1 135 ? -16.290 8.787   13.880  1.00 0.00 ? 290 LEU A C    2  
ATOM   4256  O  O    . LEU A 1 135 ? -17.483 8.775   14.122  1.00 0.00 ? 290 LEU A O    2  
ATOM   4257  C  CB   . LEU A 1 135 ? -15.417 8.006   11.648  1.00 0.00 ? 290 LEU A CB   2  
ATOM   4258  C  CG   . LEU A 1 135 ? -16.684 7.434   11.012  1.00 0.00 ? 290 LEU A CG   2  
ATOM   4259  C  CD1  . LEU A 1 135 ? -17.061 8.267   9.785   1.00 0.00 ? 290 LEU A CD1  2  
ATOM   4260  C  CD2  . LEU A 1 135 ? -16.429 5.988   10.583  1.00 0.00 ? 290 LEU A CD2  2  
ATOM   4261  H  H    . LEU A 1 135 ? -13.673 9.744   12.213  1.00 0.00 ? 290 LEU A H    2  
ATOM   4262  H  HA   . LEU A 1 135 ? -16.526 9.820   12.003  1.00 0.00 ? 290 LEU A HA   2  
ATOM   4263  H  HB2  . LEU A 1 135 ? -14.724 8.298   10.872  1.00 0.00 ? 290 LEU A HB2  2  
ATOM   4264  H  HB3  . LEU A 1 135 ? -14.960 7.255   12.275  1.00 0.00 ? 290 LEU A HB3  2  
ATOM   4265  H  HG   . LEU A 1 135 ? -17.492 7.462   11.728  1.00 0.00 ? 290 LEU A HG   2  
ATOM   4266  H  HD11 . LEU A 1 135 ? -17.952 7.860   9.332   1.00 0.00 ? 290 LEU A HD11 2  
ATOM   4267  H  HD12 . LEU A 1 135 ? -16.251 8.244   9.071   1.00 0.00 ? 290 LEU A HD12 2  
ATOM   4268  H  HD13 . LEU A 1 135 ? -17.245 9.288   10.087  1.00 0.00 ? 290 LEU A HD13 2  
ATOM   4269  H  HD21 . LEU A 1 135 ? -15.937 5.456   11.385  1.00 0.00 ? 290 LEU A HD21 2  
ATOM   4270  H  HD22 . LEU A 1 135 ? -15.797 5.979   9.706   1.00 0.00 ? 290 LEU A HD22 2  
ATOM   4271  H  HD23 . LEU A 1 135 ? -17.368 5.507   10.356  1.00 0.00 ? 290 LEU A HD23 2  
ATOM   4272  N  N    . LEU A 1 136 ? -15.407 8.420   14.786  1.00 0.00 ? 291 LEU A N    2  
ATOM   4273  C  CA   . LEU A 1 136 ? -15.876 7.976   16.150  1.00 0.00 ? 291 LEU A CA   2  
ATOM   4274  C  C    . LEU A 1 136 ? -16.462 9.162   16.939  1.00 0.00 ? 291 LEU A C    2  
ATOM   4275  O  O    . LEU A 1 136 ? -17.364 8.984   17.737  1.00 0.00 ? 291 LEU A O    2  
ATOM   4276  C  CB   . LEU A 1 136 ? -14.645 7.415   16.880  1.00 0.00 ? 291 LEU A CB   2  
ATOM   4277  C  CG   . LEU A 1 136 ? -15.084 6.315   17.847  1.00 0.00 ? 291 LEU A CG   2  
ATOM   4278  C  CD1  . LEU A 1 136 ? -15.074 4.966   17.126  1.00 0.00 ? 291 LEU A CD1  2  
ATOM   4279  C  CD2  . LEU A 1 136 ? -14.116 6.264   19.032  1.00 0.00 ? 291 LEU A CD2  2  
ATOM   4280  H  H    . LEU A 1 136 ? -14.445 8.439   14.569  1.00 0.00 ? 291 LEU A H    2  
ATOM   4281  H  HA   . LEU A 1 136 ? -16.620 7.201   16.047  1.00 0.00 ? 291 LEU A HA   2  
ATOM   4282  H  HB2  . LEU A 1 136 ? -13.953 7.007   16.158  1.00 0.00 ? 291 LEU A HB2  2  
ATOM   4283  H  HB3  . LEU A 1 136 ? -14.162 8.207   17.434  1.00 0.00 ? 291 LEU A HB3  2  
ATOM   4284  H  HG   . LEU A 1 136 ? -16.082 6.525   18.203  1.00 0.00 ? 291 LEU A HG   2  
ATOM   4285  H  HD11 . LEU A 1 136 ? -14.089 4.779   16.726  1.00 0.00 ? 291 LEU A HD11 2  
ATOM   4286  H  HD12 . LEU A 1 136 ? -15.793 4.984   16.320  1.00 0.00 ? 291 LEU A HD12 2  
ATOM   4287  H  HD13 . LEU A 1 136 ? -15.335 4.184   17.822  1.00 0.00 ? 291 LEU A HD13 2  
ATOM   4288  H  HD21 . LEU A 1 136 ? -13.303 5.591   18.806  1.00 0.00 ? 291 LEU A HD21 2  
ATOM   4289  H  HD22 . LEU A 1 136 ? -14.640 5.914   19.909  1.00 0.00 ? 291 LEU A HD22 2  
ATOM   4290  H  HD23 . LEU A 1 136 ? -13.724 7.253   19.219  1.00 0.00 ? 291 LEU A HD23 2  
ATOM   4291  N  N    . GLN A 1 137 ? -15.967 10.369  16.735  1.00 0.00 ? 292 GLN A N    2  
ATOM   4292  C  CA   . GLN A 1 137 ? -16.520 11.543  17.495  1.00 0.00 ? 292 GLN A CA   2  
ATOM   4293  C  C    . GLN A 1 137 ? -17.609 12.274  16.685  1.00 0.00 ? 292 GLN A C    2  
ATOM   4294  O  O    . GLN A 1 137 ? -18.506 12.864  17.258  1.00 0.00 ? 292 GLN A O    2  
ATOM   4295  C  CB   . GLN A 1 137 ? -15.331 12.478  17.754  1.00 0.00 ? 292 GLN A CB   2  
ATOM   4296  C  CG   . GLN A 1 137 ? -14.610 12.045  19.031  1.00 0.00 ? 292 GLN A CG   2  
ATOM   4297  C  CD   . GLN A 1 137 ? -13.984 13.271  19.708  1.00 0.00 ? 292 GLN A CD   2  
ATOM   4298  O  OE1  . GLN A 1 137 ? -14.518 14.359  19.621  1.00 0.00 ? 292 GLN A OE1  2  
ATOM   4299  N  NE2  . GLN A 1 137 ? -12.868 13.147  20.384  1.00 0.00 ? 292 GLN A NE2  2  
ATOM   4300  H  H    . GLN A 1 137 ? -15.237 10.504  16.088  1.00 0.00 ? 292 GLN A H    2  
ATOM   4301  H  HA   . GLN A 1 137 ? -16.928 11.210  18.438  1.00 0.00 ? 292 GLN A HA   2  
ATOM   4302  H  HB2  . GLN A 1 137 ? -14.647 12.430  16.919  1.00 0.00 ? 292 GLN A HB2  2  
ATOM   4303  H  HB3  . GLN A 1 137 ? -15.688 13.490  17.870  1.00 0.00 ? 292 GLN A HB3  2  
ATOM   4304  H  HG2  . GLN A 1 137 ? -15.316 11.582  19.705  1.00 0.00 ? 292 GLN A HG2  2  
ATOM   4305  H  HG3  . GLN A 1 137 ? -13.832 11.337  18.784  1.00 0.00 ? 292 GLN A HG3  2  
ATOM   4306  H  HE21 . GLN A 1 137 ? -12.428 12.273  20.461  1.00 0.00 ? 292 GLN A HE21 2  
ATOM   4307  H  HE22 . GLN A 1 137 ? -12.470 13.932  20.815  1.00 0.00 ? 292 GLN A HE22 2  
ATOM   4308  N  N    . GLN A 1 138 ? -17.549 12.250  15.364  1.00 0.00 ? 293 GLN A N    2  
ATOM   4309  C  CA   . GLN A 1 138 ? -18.600 12.959  14.561  1.00 0.00 ? 293 GLN A CA   2  
ATOM   4310  C  C    . GLN A 1 138 ? -19.625 11.953  14.014  1.00 0.00 ? 293 GLN A C    2  
ATOM   4311  O  O    . GLN A 1 138 ? -19.975 11.995  12.848  1.00 0.00 ? 293 GLN A O    2  
ATOM   4312  C  CB   . GLN A 1 138 ? -17.854 13.646  13.410  1.00 0.00 ? 293 GLN A CB   2  
ATOM   4313  C  CG   . GLN A 1 138 ? -18.750 14.718  12.788  1.00 0.00 ? 293 GLN A CG   2  
ATOM   4314  C  CD   . GLN A 1 138 ? -17.886 15.722  12.015  1.00 0.00 ? 293 GLN A CD   2  
ATOM   4315  O  OE1  . GLN A 1 138 ? -16.939 16.260  12.553  1.00 0.00 ? 293 GLN A OE1  2  
ATOM   4316  N  NE2  . GLN A 1 138 ? -18.169 16.003  10.766  1.00 0.00 ? 293 GLN A NE2  2  
ATOM   4317  H  H    . GLN A 1 138 ? -16.822 11.771  14.906  1.00 0.00 ? 293 GLN A H    2  
ATOM   4318  H  HA   . GLN A 1 138 ? -19.096 13.700  15.169  1.00 0.00 ? 293 GLN A HA   2  
ATOM   4319  H  HB2  . GLN A 1 138 ? -16.952 14.104  13.790  1.00 0.00 ? 293 GLN A HB2  2  
ATOM   4320  H  HB3  . GLN A 1 138 ? -17.596 12.913  12.660  1.00 0.00 ? 293 GLN A HB3  2  
ATOM   4321  H  HG2  . GLN A 1 138 ? -19.452 14.251  12.113  1.00 0.00 ? 293 GLN A HG2  2  
ATOM   4322  H  HG3  . GLN A 1 138 ? -19.288 15.235  13.568  1.00 0.00 ? 293 GLN A HG3  2  
ATOM   4323  H  HE21 . GLN A 1 138 ? -18.931 15.574  10.320  1.00 0.00 ? 293 GLN A HE21 2  
ATOM   4324  H  HE22 . GLN A 1 138 ? -17.615 16.645  10.273  1.00 0.00 ? 293 GLN A HE22 2  
ATOM   4325  N  N    . ASN A 1 139 ? -20.113 11.050  14.841  1.00 0.00 ? 294 ASN A N    2  
ATOM   4326  C  CA   . ASN A 1 139 ? -21.116 10.052  14.353  1.00 0.00 ? 294 ASN A CA   2  
ATOM   4327  C  C    . ASN A 1 139 ? -22.007 9.571   15.513  1.00 0.00 ? 294 ASN A C    2  
ATOM   4328  O  O    . ASN A 1 139 ? -21.761 8.531   16.094  1.00 0.00 ? 294 ASN A O    2  
ATOM   4329  C  CB   . ASN A 1 139 ? -20.286 8.893   13.799  1.00 0.00 ? 294 ASN A CB   2  
ATOM   4330  C  CG   . ASN A 1 139 ? -21.170 8.008   12.911  1.00 0.00 ? 294 ASN A CG   2  
ATOM   4331  O  OD1  . ASN A 1 139 ? -21.078 8.069   11.700  1.00 0.00 ? 294 ASN A OD1  2  
ATOM   4332  N  ND2  . ASN A 1 139 ? -22.030 7.184   13.458  1.00 0.00 ? 294 ASN A ND2  2  
ATOM   4333  H  H    . ASN A 1 139 ? -19.820 11.029  15.780  1.00 0.00 ? 294 ASN A H    2  
ATOM   4334  H  HA   . ASN A 1 139 ? -21.719 10.479  13.568  1.00 0.00 ? 294 ASN A HA   2  
ATOM   4335  H  HB2  . ASN A 1 139 ? -19.466 9.286   13.216  1.00 0.00 ? 294 ASN A HB2  2  
ATOM   4336  H  HB3  . ASN A 1 139 ? -19.898 8.305   14.617  1.00 0.00 ? 294 ASN A HB3  2  
ATOM   4337  H  HD21 . ASN A 1 139 ? -22.113 7.126   14.434  1.00 0.00 ? 294 ASN A HD21 2  
ATOM   4338  H  HD22 . ASN A 1 139 ? -22.594 6.619   12.887  1.00 0.00 ? 294 ASN A HD22 2  
ATOM   4339  N  N    . LYS A 1 140 ? -23.037 10.320  15.856  1.00 0.00 ? 295 LYS A N    2  
ATOM   4340  C  CA   . LYS A 1 140 ? -23.929 9.896   16.976  1.00 0.00 ? 295 LYS A CA   2  
ATOM   4341  C  C    . LYS A 1 140 ? -25.359 9.667   16.460  1.00 0.00 ? 295 LYS A C    2  
ATOM   4342  O  O    . LYS A 1 140 ? -25.987 10.575  15.949  1.00 0.00 ? 295 LYS A O    2  
ATOM   4343  C  CB   . LYS A 1 140 ? -23.898 11.061  17.967  1.00 0.00 ? 295 LYS A CB   2  
ATOM   4344  C  CG   . LYS A 1 140 ? -22.805 10.817  19.010  1.00 0.00 ? 295 LYS A CG   2  
ATOM   4345  C  CD   . LYS A 1 140 ? -23.414 10.148  20.245  1.00 0.00 ? 295 LYS A CD   2  
ATOM   4346  C  CE   . LYS A 1 140 ? -24.292 11.155  20.990  1.00 0.00 ? 295 LYS A CE   2  
ATOM   4347  N  NZ   . LYS A 1 140 ? -24.048 10.884  22.434  1.00 0.00 ? 295 LYS A NZ   2  
ATOM   4348  H  H    . LYS A 1 140 ? -23.224 11.159  15.380  1.00 0.00 ? 295 LYS A H    2  
ATOM   4349  H  HA   . LYS A 1 140 ? -23.549 9.003   17.445  1.00 0.00 ? 295 LYS A HA   2  
ATOM   4350  H  HB2  . LYS A 1 140 ? -23.691 11.979  17.436  1.00 0.00 ? 295 LYS A HB2  2  
ATOM   4351  H  HB3  . LYS A 1 140 ? -24.854 11.139  18.463  1.00 0.00 ? 295 LYS A HB3  2  
ATOM   4352  H  HG2  . LYS A 1 140 ? -22.043 10.174  18.590  1.00 0.00 ? 295 LYS A HG2  2  
ATOM   4353  H  HG3  . LYS A 1 140 ? -22.362 11.759  19.295  1.00 0.00 ? 295 LYS A HG3  2  
ATOM   4354  H  HD2  . LYS A 1 140 ? -24.014 9.303   19.937  1.00 0.00 ? 295 LYS A HD2  2  
ATOM   4355  H  HD3  . LYS A 1 140 ? -22.623 9.811   20.898  1.00 0.00 ? 295 LYS A HD3  2  
ATOM   4356  H  HE2  . LYS A 1 140 ? -24.000 12.166  20.740  1.00 0.00 ? 295 LYS A HE2  2  
ATOM   4357  H  HE3  . LYS A 1 140 ? -25.333 10.994  20.755  1.00 0.00 ? 295 LYS A HE3  2  
ATOM   4358  H  HZ1  . LYS A 1 140 ? -24.190 9.873   22.626  1.00 0.00 ? 295 LYS A HZ1  2  
ATOM   4359  H  HZ2  . LYS A 1 140 ? -24.710 11.444  23.008  1.00 0.00 ? 295 LYS A HZ2  2  
ATOM   4360  H  HZ3  . LYS A 1 140 ? -23.071 11.145  22.676  1.00 0.00 ? 295 LYS A HZ3  2  
ATOM   4361  N  N    . LYS A 1 141 ? -25.881 8.464   16.588  1.00 0.00 ? 296 LYS A N    2  
ATOM   4362  C  CA   . LYS A 1 141 ? -27.267 8.193   16.103  1.00 0.00 ? 296 LYS A CA   2  
ATOM   4363  C  C    . LYS A 1 141 ? -27.991 7.245   17.063  1.00 0.00 ? 296 LYS A C    2  
ATOM   4364  O  O    . LYS A 1 141 ? -27.688 6.063   17.037  1.00 0.00 ? 296 LYS A O    2  
ATOM   4365  C  CB   . LYS A 1 141 ? -27.085 7.535   14.734  1.00 0.00 ? 296 LYS A CB   2  
ATOM   4366  C  CG   . LYS A 1 141 ? -28.296 7.845   13.853  1.00 0.00 ? 296 LYS A CG   2  
ATOM   4367  C  CD   . LYS A 1 141 ? -28.109 7.196   12.479  1.00 0.00 ? 296 LYS A CD   2  
ATOM   4368  C  CE   . LYS A 1 141 ? -28.754 8.076   11.407  1.00 0.00 ? 296 LYS A CE   2  
ATOM   4369  N  NZ   . LYS A 1 141 ? -28.039 7.732   10.146  1.00 0.00 ? 296 LYS A NZ   2  
ATOM   4370  O  OXT  . LYS A 1 141 ? -28.834 7.717   17.807  1.00 0.00 ? 296 LYS A OXT  2  
ATOM   4371  H  H    . LYS A 1 141 ? -25.364 7.738   17.004  1.00 0.00 ? 296 LYS A H    2  
ATOM   4372  H  HA   . LYS A 1 141 ? -27.817 9.115   15.997  1.00 0.00 ? 296 LYS A HA   2  
ATOM   4373  H  HB2  . LYS A 1 141 ? -26.190 7.920   14.267  1.00 0.00 ? 296 LYS A HB2  2  
ATOM   4374  H  HB3  . LYS A 1 141 ? -26.997 6.466   14.858  1.00 0.00 ? 296 LYS A HB3  2  
ATOM   4375  H  HG2  . LYS A 1 141 ? -29.190 7.454   14.318  1.00 0.00 ? 296 LYS A HG2  2  
ATOM   4376  H  HG3  . LYS A 1 141 ? -28.391 8.914   13.733  1.00 0.00 ? 296 LYS A HG3  2  
ATOM   4377  H  HD2  . LYS A 1 141 ? -27.053 7.091   12.274  1.00 0.00 ? 296 LYS A HD2  2  
ATOM   4378  H  HD3  . LYS A 1 141 ? -28.576 6.224   12.475  1.00 0.00 ? 296 LYS A HD3  2  
ATOM   4379  H  HE2  . LYS A 1 141 ? -29.808 7.848   11.320  1.00 0.00 ? 296 LYS A HE2  2  
ATOM   4380  H  HE3  . LYS A 1 141 ? -28.612 9.120   11.640  1.00 0.00 ? 296 LYS A HE3  2  
ATOM   4381  H  HZ1  . LYS A 1 141 ? -28.391 8.330   9.373   1.00 0.00 ? 296 LYS A HZ1  2  
ATOM   4382  H  HZ2  . LYS A 1 141 ? -28.206 6.731   9.916   1.00 0.00 ? 296 LYS A HZ2  2  
ATOM   4383  H  HZ3  . LYS A 1 141 ? -27.019 7.894   10.270  1.00 0.00 ? 296 LYS A HZ3  2  
HETATM 4384  ZN ZN   . ZN  B 2 .   ? -5.665  -3.665  -0.736  1.00 0.00 ? 1   ZN  A ZN   2  
HETATM 4385  ZN ZN   . ZN  C 2 .   ? 1.841   -6.359  -5.440  1.00 0.00 ? 2   ZN  A ZN   2  
HETATM 4386  ZN ZN   . ZN  D 2 .   ? 14.398  -4.545  -0.539  1.00 0.00 ? 3   ZN  A ZN   2  
ATOM   4387  N  N    . GLY A 1 1   ? -0.930  39.912  3.102   1.00 0.00 ? 156 GLY A N    3  
ATOM   4388  C  CA   . GLY A 1 1   ? 0.043   38.829  2.782   1.00 0.00 ? 156 GLY A CA   3  
ATOM   4389  C  C    . GLY A 1 1   ? -0.717  37.540  2.438   1.00 0.00 ? 156 GLY A C    3  
ATOM   4390  O  O    . GLY A 1 1   ? -1.876  37.583  2.071   1.00 0.00 ? 156 GLY A O    3  
ATOM   4391  H  H1   . GLY A 1 1   ? -1.443  40.183  2.241   1.00 0.00 ? 156 GLY A H1   3  
ATOM   4392  H  H2   . GLY A 1 1   ? -0.420  40.737  3.477   1.00 0.00 ? 156 GLY A H2   3  
ATOM   4393  H  H3   . GLY A 1 1   ? -1.608  39.570  3.813   1.00 0.00 ? 156 GLY A H3   3  
ATOM   4394  H  HA2  . GLY A 1 1   ? 0.649   39.129  1.938   1.00 0.00 ? 156 GLY A HA2  3  
ATOM   4395  H  HA3  . GLY A 1 1   ? 0.678   38.651  3.637   1.00 0.00 ? 156 GLY A HA3  3  
ATOM   4396  N  N    . ALA A 1 2   ? -0.078  36.393  2.550   1.00 0.00 ? 157 ALA A N    3  
ATOM   4397  C  CA   . ALA A 1 2   ? -0.776  35.113  2.226   1.00 0.00 ? 157 ALA A CA   3  
ATOM   4398  C  C    . ALA A 1 2   ? -0.416  34.035  3.262   1.00 0.00 ? 157 ALA A C    3  
ATOM   4399  O  O    . ALA A 1 2   ? 0.309   34.298  4.203   1.00 0.00 ? 157 ALA A O    3  
ATOM   4400  C  CB   . ALA A 1 2   ? -0.259  34.719  0.842   1.00 0.00 ? 157 ALA A CB   3  
ATOM   4401  H  H    . ALA A 1 2   ? 0.859   36.371  2.847   1.00 0.00 ? 157 ALA A H    3  
ATOM   4402  H  HA   . ALA A 1 2   ? -1.843  35.263  2.192   1.00 0.00 ? 157 ALA A HA   3  
ATOM   4403  H  HB1  . ALA A 1 2   ? -0.937  35.087  0.086   1.00 0.00 ? 157 ALA A HB1  3  
ATOM   4404  H  HB2  . ALA A 1 2   ? -0.194  33.643  0.774   1.00 0.00 ? 157 ALA A HB2  3  
ATOM   4405  H  HB3  . ALA A 1 2   ? 0.720   35.149  0.687   1.00 0.00 ? 157 ALA A HB3  3  
ATOM   4406  N  N    . MET A 1 3   ? -0.915  32.826  3.100   1.00 0.00 ? 158 MET A N    3  
ATOM   4407  C  CA   . MET A 1 3   ? -0.593  31.746  4.081   1.00 0.00 ? 158 MET A CA   3  
ATOM   4408  C  C    . MET A 1 3   ? -0.328  30.423  3.347   1.00 0.00 ? 158 MET A C    3  
ATOM   4409  O  O    . MET A 1 3   ? -0.812  30.213  2.251   1.00 0.00 ? 158 MET A O    3  
ATOM   4410  C  CB   . MET A 1 3   ? -1.837  31.630  4.963   1.00 0.00 ? 158 MET A CB   3  
ATOM   4411  C  CG   . MET A 1 3   ? -1.430  31.164  6.362   1.00 0.00 ? 158 MET A CG   3  
ATOM   4412  S  SD   . MET A 1 3   ? -2.915  30.809  7.335   1.00 0.00 ? 158 MET A SD   3  
ATOM   4413  C  CE   . MET A 1 3   ? -2.178  31.052  8.970   1.00 0.00 ? 158 MET A CE   3  
ATOM   4414  H  H    . MET A 1 3   ? -1.499  32.626  2.335   1.00 0.00 ? 158 MET A H    3  
ATOM   4415  H  HA   . MET A 1 3   ? 0.259   32.024  4.681   1.00 0.00 ? 158 MET A HA   3  
ATOM   4416  H  HB2  . MET A 1 3   ? -2.323  32.594  5.029   1.00 0.00 ? 158 MET A HB2  3  
ATOM   4417  H  HB3  . MET A 1 3   ? -2.519  30.913  4.531   1.00 0.00 ? 158 MET A HB3  3  
ATOM   4418  H  HG2  . MET A 1 3   ? -0.829  30.272  6.284   1.00 0.00 ? 158 MET A HG2  3  
ATOM   4419  H  HG3  . MET A 1 3   ? -0.859  31.942  6.848   1.00 0.00 ? 158 MET A HG3  3  
ATOM   4420  H  HE1  . MET A 1 3   ? -2.365  30.181  9.582   1.00 0.00 ? 158 MET A HE1  3  
ATOM   4421  H  HE2  . MET A 1 3   ? -2.617  31.919  9.438   1.00 0.00 ? 158 MET A HE2  3  
ATOM   4422  H  HE3  . MET A 1 3   ? -1.112  31.204  8.865   1.00 0.00 ? 158 MET A HE3  3  
ATOM   4423  N  N    . LYS A 1 4   ? 0.436   29.525  3.939   1.00 0.00 ? 159 LYS A N    3  
ATOM   4424  C  CA   . LYS A 1 4   ? 0.722   28.224  3.265   1.00 0.00 ? 159 LYS A CA   3  
ATOM   4425  C  C    . LYS A 1 4   ? 0.196   27.058  4.118   1.00 0.00 ? 159 LYS A C    3  
ATOM   4426  O  O    . LYS A 1 4   ? 0.395   27.029  5.318   1.00 0.00 ? 159 LYS A O    3  
ATOM   4427  C  CB   . LYS A 1 4   ? 2.247   28.162  3.156   1.00 0.00 ? 159 LYS A CB   3  
ATOM   4428  C  CG   . LYS A 1 4   ? 2.680   28.612  1.759   1.00 0.00 ? 159 LYS A CG   3  
ATOM   4429  C  CD   . LYS A 1 4   ? 2.441   27.479  0.760   1.00 0.00 ? 159 LYS A CD   3  
ATOM   4430  C  CE   . LYS A 1 4   ? 3.321   27.690  -0.474  1.00 0.00 ? 159 LYS A CE   3  
ATOM   4431  N  NZ   . LYS A 1 4   ? 3.782   26.327  -0.855  1.00 0.00 ? 159 LYS A NZ   3  
ATOM   4432  H  H    . LYS A 1 4   ? 0.821   29.707  4.825   1.00 0.00 ? 159 LYS A H    3  
ATOM   4433  H  HA   . LYS A 1 4   ? 0.279   28.202  2.283   1.00 0.00 ? 159 LYS A HA   3  
ATOM   4434  H  HB2  . LYS A 1 4   ? 2.687   28.811  3.898   1.00 0.00 ? 159 LYS A HB2  3  
ATOM   4435  H  HB3  . LYS A 1 4   ? 2.579   27.147  3.323   1.00 0.00 ? 159 LYS A HB3  3  
ATOM   4436  H  HG2  . LYS A 1 4   ? 2.106   29.479  1.466   1.00 0.00 ? 159 LYS A HG2  3  
ATOM   4437  H  HG3  . LYS A 1 4   ? 3.731   28.863  1.771   1.00 0.00 ? 159 LYS A HG3  3  
ATOM   4438  H  HD2  . LYS A 1 4   ? 2.689   26.534  1.222   1.00 0.00 ? 159 LYS A HD2  3  
ATOM   4439  H  HD3  . LYS A 1 4   ? 1.404   27.473  0.462   1.00 0.00 ? 159 LYS A HD3  3  
ATOM   4440  H  HE2  . LYS A 1 4   ? 2.745   28.134  -1.275  1.00 0.00 ? 159 LYS A HE2  3  
ATOM   4441  H  HE3  . LYS A 1 4   ? 4.169   28.312  -0.230  1.00 0.00 ? 159 LYS A HE3  3  
ATOM   4442  H  HZ1  . LYS A 1 4   ? 4.248   26.365  -1.785  1.00 0.00 ? 159 LYS A HZ1  3  
ATOM   4443  H  HZ2  . LYS A 1 4   ? 2.963   25.686  -0.904  1.00 0.00 ? 159 LYS A HZ2  3  
ATOM   4444  H  HZ3  . LYS A 1 4   ? 4.456   25.976  -0.147  1.00 0.00 ? 159 LYS A HZ3  3  
ATOM   4445  N  N    . ARG A 1 5   ? -0.473  26.097  3.512   1.00 0.00 ? 160 ARG A N    3  
ATOM   4446  C  CA   . ARG A 1 5   ? -1.003  24.944  4.298   1.00 0.00 ? 160 ARG A CA   3  
ATOM   4447  C  C    . ARG A 1 5   ? -0.787  23.632  3.527   1.00 0.00 ? 160 ARG A C    3  
ATOM   4448  O  O    . ARG A 1 5   ? -0.160  23.622  2.484   1.00 0.00 ? 160 ARG A O    3  
ATOM   4449  C  CB   . ARG A 1 5   ? -2.497  25.229  4.462   1.00 0.00 ? 160 ARG A CB   3  
ATOM   4450  C  CG   . ARG A 1 5   ? -2.741  25.918  5.807   1.00 0.00 ? 160 ARG A CG   3  
ATOM   4451  C  CD   . ARG A 1 5   ? -3.017  24.861  6.879   1.00 0.00 ? 160 ARG A CD   3  
ATOM   4452  N  NE   . ARG A 1 5   ? -2.315  25.357  8.095   1.00 0.00 ? 160 ARG A NE   3  
ATOM   4453  C  CZ   . ARG A 1 5   ? -2.995  25.622  9.178   1.00 0.00 ? 160 ARG A CZ   3  
ATOM   4454  N  NH1  . ARG A 1 5   ? -3.760  24.709  9.709   1.00 0.00 ? 160 ARG A NH1  3  
ATOM   4455  N  NH2  . ARG A 1 5   ? -2.910  26.802  9.728   1.00 0.00 ? 160 ARG A NH2  3  
ATOM   4456  H  H    . ARG A 1 5   ? -0.627  26.133  2.542   1.00 0.00 ? 160 ARG A H    3  
ATOM   4457  H  HA   . ARG A 1 5   ? -0.528  24.896  5.265   1.00 0.00 ? 160 ARG A HA   3  
ATOM   4458  H  HB2  . ARG A 1 5   ? -2.830  25.874  3.661   1.00 0.00 ? 160 ARG A HB2  3  
ATOM   4459  H  HB3  . ARG A 1 5   ? -3.046  24.301  4.430   1.00 0.00 ? 160 ARG A HB3  3  
ATOM   4460  H  HG2  . ARG A 1 5   ? -1.868  26.492  6.081   1.00 0.00 ? 160 ARG A HG2  3  
ATOM   4461  H  HG3  . ARG A 1 5   ? -3.595  26.574  5.724   1.00 0.00 ? 160 ARG A HG3  3  
ATOM   4462  H  HD2  . ARG A 1 5   ? -4.079  24.779  7.061   1.00 0.00 ? 160 ARG A HD2  3  
ATOM   4463  H  HD3  . ARG A 1 5   ? -2.609  23.908  6.581   1.00 0.00 ? 160 ARG A HD3  3  
ATOM   4464  H  HE   . ARG A 1 5   ? -1.344  25.484  8.084   1.00 0.00 ? 160 ARG A HE   3  
ATOM   4465  H  HH11 . ARG A 1 5   ? -3.825  23.804  9.287   1.00 0.00 ? 160 ARG A HH11 3  
ATOM   4466  H  HH12 . ARG A 1 5   ? -4.280  24.912  10.538  1.00 0.00 ? 160 ARG A HH12 3  
ATOM   4467  H  HH21 . ARG A 1 5   ? -2.324  27.504  9.321   1.00 0.00 ? 160 ARG A HH21 3  
ATOM   4468  H  HH22 . ARG A 1 5   ? -3.429  27.006  10.557  1.00 0.00 ? 160 ARG A HH22 3  
ATOM   4469  N  N    . GLY A 1 6   ? -1.298  22.525  4.029   1.00 0.00 ? 161 GLY A N    3  
ATOM   4470  C  CA   . GLY A 1 6   ? -1.114  21.226  3.316   1.00 0.00 ? 161 GLY A CA   3  
ATOM   4471  C  C    . GLY A 1 6   ? -2.486  20.611  3.005   1.00 0.00 ? 161 GLY A C    3  
ATOM   4472  O  O    . GLY A 1 6   ? -2.838  20.429  1.855   1.00 0.00 ? 161 GLY A O    3  
ATOM   4473  H  H    . GLY A 1 6   ? -1.802  22.546  4.871   1.00 0.00 ? 161 GLY A H    3  
ATOM   4474  H  HA2  . GLY A 1 6   ? -0.575  21.395  2.393   1.00 0.00 ? 161 GLY A HA2  3  
ATOM   4475  H  HA3  . GLY A 1 6   ? -0.553  20.548  3.941   1.00 0.00 ? 161 GLY A HA3  3  
ATOM   4476  N  N    . GLU A 1 7   ? -3.266  20.288  4.018   1.00 0.00 ? 162 GLU A N    3  
ATOM   4477  C  CA   . GLU A 1 7   ? -4.610  19.686  3.765   1.00 0.00 ? 162 GLU A CA   3  
ATOM   4478  C  C    . GLU A 1 7   ? -5.706  20.539  4.423   1.00 0.00 ? 162 GLU A C    3  
ATOM   4479  O  O    . GLU A 1 7   ? -5.876  20.510  5.628   1.00 0.00 ? 162 GLU A O    3  
ATOM   4480  C  CB   . GLU A 1 7   ? -4.551  18.301  4.409   1.00 0.00 ? 162 GLU A CB   3  
ATOM   4481  C  CG   . GLU A 1 7   ? -5.834  17.533  4.088   1.00 0.00 ? 162 GLU A CG   3  
ATOM   4482  C  CD   . GLU A 1 7   ? -5.722  16.913  2.693   1.00 0.00 ? 162 GLU A CD   3  
ATOM   4483  O  OE1  . GLU A 1 7   ? -4.734  16.245  2.441   1.00 0.00 ? 162 GLU A OE1  3  
ATOM   4484  O  OE2  . GLU A 1 7   ? -6.627  17.118  1.901   1.00 0.00 ? 162 GLU A OE2  3  
ATOM   4485  H  H    . GLU A 1 7   ? -2.969  20.439  4.943   1.00 0.00 ? 162 GLU A H    3  
ATOM   4486  H  HA   . GLU A 1 7   ? -4.788  19.593  2.705   1.00 0.00 ? 162 GLU A HA   3  
ATOM   4487  H  HB2  . GLU A 1 7   ? -3.699  17.760  4.021   1.00 0.00 ? 162 GLU A HB2  3  
ATOM   4488  H  HB3  . GLU A 1 7   ? -4.454  18.405  5.479   1.00 0.00 ? 162 GLU A HB3  3  
ATOM   4489  H  HG2  . GLU A 1 7   ? -5.979  16.751  4.820   1.00 0.00 ? 162 GLU A HG2  3  
ATOM   4490  H  HG3  . GLU A 1 7   ? -6.675  18.209  4.112   1.00 0.00 ? 162 GLU A HG3  3  
ATOM   4491  N  N    . ASP A 1 8   ? -6.452  21.300  3.646   1.00 0.00 ? 163 ASP A N    3  
ATOM   4492  C  CA   . ASP A 1 8   ? -7.531  22.147  4.240   1.00 0.00 ? 163 ASP A CA   3  
ATOM   4493  C  C    . ASP A 1 8   ? -8.749  22.194  3.303   1.00 0.00 ? 163 ASP A C    3  
ATOM   4494  O  O    . ASP A 1 8   ? -8.603  22.348  2.104   1.00 0.00 ? 163 ASP A O    3  
ATOM   4495  C  CB   . ASP A 1 8   ? -6.909  23.540  4.396   1.00 0.00 ? 163 ASP A CB   3  
ATOM   4496  C  CG   . ASP A 1 8   ? -6.441  24.063  3.034   1.00 0.00 ? 163 ASP A CG   3  
ATOM   4497  O  OD1  . ASP A 1 8   ? -5.505  23.496  2.494   1.00 0.00 ? 163 ASP A OD1  3  
ATOM   4498  O  OD2  . ASP A 1 8   ? -7.026  25.020  2.555   1.00 0.00 ? 163 ASP A OD2  3  
ATOM   4499  H  H    . ASP A 1 8   ? -6.305  21.314  2.674   1.00 0.00 ? 163 ASP A H    3  
ATOM   4500  H  HA   . ASP A 1 8   ? -7.818  21.764  5.207   1.00 0.00 ? 163 ASP A HA   3  
ATOM   4501  H  HB2  . ASP A 1 8   ? -7.645  24.217  4.806   1.00 0.00 ? 163 ASP A HB2  3  
ATOM   4502  H  HB3  . ASP A 1 8   ? -6.064  23.482  5.066   1.00 0.00 ? 163 ASP A HB3  3  
ATOM   4503  N  N    . GLY A 1 9   ? -9.948  22.065  3.833   1.00 0.00 ? 164 GLY A N    3  
ATOM   4504  C  CA   . GLY A 1 9   ? -11.160 22.104  2.963   1.00 0.00 ? 164 GLY A CA   3  
ATOM   4505  C  C    . GLY A 1 9   ? -12.043 20.882  3.254   1.00 0.00 ? 164 GLY A C    3  
ATOM   4506  O  O    . GLY A 1 9   ? -11.885 20.230  4.269   1.00 0.00 ? 164 GLY A O    3  
ATOM   4507  H  H    . GLY A 1 9   ? -10.053 21.940  4.802   1.00 0.00 ? 164 GLY A H    3  
ATOM   4508  H  HA2  . GLY A 1 9   ? -11.717 23.008  3.163   1.00 0.00 ? 164 GLY A HA2  3  
ATOM   4509  H  HA3  . GLY A 1 9   ? -10.860 22.088  1.926   1.00 0.00 ? 164 GLY A HA3  3  
ATOM   4510  N  N    . LEU A 1 10  ? -12.971 20.561  2.374   1.00 0.00 ? 165 LEU A N    3  
ATOM   4511  C  CA   . LEU A 1 10  ? -13.854 19.380  2.615   1.00 0.00 ? 165 LEU A CA   3  
ATOM   4512  C  C    . LEU A 1 10  ? -13.626 18.316  1.530   1.00 0.00 ? 165 LEU A C    3  
ATOM   4513  O  O    . LEU A 1 10  ? -14.567 17.732  1.025   1.00 0.00 ? 165 LEU A O    3  
ATOM   4514  C  CB   . LEU A 1 10  ? -15.281 19.926  2.537   1.00 0.00 ? 165 LEU A CB   3  
ATOM   4515  C  CG   . LEU A 1 10  ? -15.785 20.243  3.946   1.00 0.00 ? 165 LEU A CG   3  
ATOM   4516  C  CD1  . LEU A 1 10  ? -16.933 21.250  3.863   1.00 0.00 ? 165 LEU A CD1  3  
ATOM   4517  C  CD2  . LEU A 1 10  ? -16.284 18.956  4.609   1.00 0.00 ? 165 LEU A CD2  3  
ATOM   4518  H  H    . LEU A 1 10  ? -13.089 21.095  1.557   1.00 0.00 ? 165 LEU A H    3  
ATOM   4519  H  HA   . LEU A 1 10  ? -13.671 18.966  3.593   1.00 0.00 ? 165 LEU A HA   3  
ATOM   4520  H  HB2  . LEU A 1 10  ? -15.289 20.827  1.941   1.00 0.00 ? 165 LEU A HB2  3  
ATOM   4521  H  HB3  . LEU A 1 10  ? -15.926 19.188  2.084   1.00 0.00 ? 165 LEU A HB3  3  
ATOM   4522  H  HG   . LEU A 1 10  ? -14.980 20.663  4.530   1.00 0.00 ? 165 LEU A HG   3  
ATOM   4523  H  HD11 . LEU A 1 10  ? -17.424 21.316  4.823   1.00 0.00 ? 165 LEU A HD11 3  
ATOM   4524  H  HD12 . LEU A 1 10  ? -17.644 20.926  3.117   1.00 0.00 ? 165 LEU A HD12 3  
ATOM   4525  H  HD13 . LEU A 1 10  ? -16.542 22.220  3.591   1.00 0.00 ? 165 LEU A HD13 3  
ATOM   4526  H  HD21 . LEU A 1 10  ? -16.370 19.110  5.674   1.00 0.00 ? 165 LEU A HD21 3  
ATOM   4527  H  HD22 . LEU A 1 10  ? -15.584 18.157  4.416   1.00 0.00 ? 165 LEU A HD22 3  
ATOM   4528  H  HD23 . LEU A 1 10  ? -17.250 18.694  4.203   1.00 0.00 ? 165 LEU A HD23 3  
ATOM   4529  N  N    . HIS A 1 11  ? -12.387 18.054  1.167   1.00 0.00 ? 166 HIS A N    3  
ATOM   4530  C  CA   . HIS A 1 11  ? -12.116 17.026  0.117   1.00 0.00 ? 166 HIS A CA   3  
ATOM   4531  C  C    . HIS A 1 11  ? -11.155 15.958  0.660   1.00 0.00 ? 166 HIS A C    3  
ATOM   4532  O  O    . HIS A 1 11  ? -10.602 16.108  1.735   1.00 0.00 ? 166 HIS A O    3  
ATOM   4533  C  CB   . HIS A 1 11  ? -11.466 17.795  -1.033  1.00 0.00 ? 166 HIS A CB   3  
ATOM   4534  C  CG   . HIS A 1 11  ? -12.538 18.373  -1.918  1.00 0.00 ? 166 HIS A CG   3  
ATOM   4535  N  ND1  . HIS A 1 11  ? -12.880 19.716  -1.883  1.00 0.00 ? 166 HIS A ND1  3  
ATOM   4536  C  CD2  . HIS A 1 11  ? -13.350 17.803  -2.867  1.00 0.00 ? 166 HIS A CD2  3  
ATOM   4537  C  CE1  . HIS A 1 11  ? -13.860 19.908  -2.785  1.00 0.00 ? 166 HIS A CE1  3  
ATOM   4538  N  NE2  . HIS A 1 11  ? -14.184 18.776  -3.413  1.00 0.00 ? 166 HIS A NE2  3  
ATOM   4539  H  H    . HIS A 1 11  ? -11.635 18.530  1.582   1.00 0.00 ? 166 HIS A H    3  
ATOM   4540  H  HA   . HIS A 1 11  ? -13.036 16.572  -0.214  1.00 0.00 ? 166 HIS A HA   3  
ATOM   4541  H  HB2  . HIS A 1 11  ? -10.858 18.594  -0.636  1.00 0.00 ? 166 HIS A HB2  3  
ATOM   4542  H  HB3  . HIS A 1 11  ? -10.848 17.125  -1.611  1.00 0.00 ? 166 HIS A HB3  3  
ATOM   4543  H  HD1  . HIS A 1 11  ? -12.482 20.401  -1.306  1.00 0.00 ? 166 HIS A HD1  3  
ATOM   4544  H  HD2  . HIS A 1 11  ? -13.343 16.761  -3.148  1.00 0.00 ? 166 HIS A HD2  3  
ATOM   4545  H  HE1  . HIS A 1 11  ? -14.326 20.863  -2.978  1.00 0.00 ? 166 HIS A HE1  3  
ATOM   4546  N  N    . GLY A 1 12  ? -10.947 14.879  -0.068  1.00 0.00 ? 167 GLY A N    3  
ATOM   4547  C  CA   . GLY A 1 12  ? -10.020 13.815  0.420   1.00 0.00 ? 167 GLY A CA   3  
ATOM   4548  C  C    . GLY A 1 12  ? -10.650 12.434  0.183   1.00 0.00 ? 167 GLY A C    3  
ATOM   4549  O  O    . GLY A 1 12  ? -11.805 12.217  0.498   1.00 0.00 ? 167 GLY A O    3  
ATOM   4550  H  H    . GLY A 1 12  ? -11.398 14.768  -0.934  1.00 0.00 ? 167 GLY A H    3  
ATOM   4551  H  HA2  . GLY A 1 12  ? -9.084  13.881  -0.115  1.00 0.00 ? 167 GLY A HA2  3  
ATOM   4552  H  HA3  . GLY A 1 12  ? -9.842  13.949  1.476   1.00 0.00 ? 167 GLY A HA3  3  
ATOM   4553  N  N    . ILE A 1 13  ? -9.904  11.498  -0.365  1.00 0.00 ? 168 ILE A N    3  
ATOM   4554  C  CA   . ILE A 1 13  ? -10.469 10.138  -0.615  1.00 0.00 ? 168 ILE A CA   3  
ATOM   4555  C  C    . ILE A 1 13  ? -9.515  9.066   -0.072  1.00 0.00 ? 168 ILE A C    3  
ATOM   4556  O  O    . ILE A 1 13  ? -8.317  9.276   -0.002  1.00 0.00 ? 168 ILE A O    3  
ATOM   4557  C  CB   . ILE A 1 13  ? -10.595 10.027  -2.140  1.00 0.00 ? 168 ILE A CB   3  
ATOM   4558  C  CG1  . ILE A 1 13  ? -11.530 11.124  -2.659  1.00 0.00 ? 168 ILE A CG1  3  
ATOM   4559  C  CG2  . ILE A 1 13  ? -11.168 8.655   -2.516  1.00 0.00 ? 168 ILE A CG2  3  
ATOM   4560  C  CD1  . ILE A 1 13  ? -10.705 12.338  -3.090  1.00 0.00 ? 168 ILE A CD1  3  
ATOM   4561  H  H    . ILE A 1 13  ? -8.972  11.686  -0.614  1.00 0.00 ? 168 ILE A H    3  
ATOM   4562  H  HA   . ILE A 1 13  ? -11.441 10.040  -0.156  1.00 0.00 ? 168 ILE A HA   3  
ATOM   4563  H  HB   . ILE A 1 13  ? -9.619  10.143  -2.589  1.00 0.00 ? 168 ILE A HB   3  
ATOM   4564  H  HG12 . ILE A 1 13  ? -12.091 10.750  -3.505  1.00 0.00 ? 168 ILE A HG12 3  
ATOM   4565  H  HG13 . ILE A 1 13  ? -12.213 11.415  -1.875  1.00 0.00 ? 168 ILE A HG13 3  
ATOM   4566  H  HG21 . ILE A 1 13  ? -10.454 7.884   -2.262  1.00 0.00 ? 168 ILE A HG21 3  
ATOM   4567  H  HG22 . ILE A 1 13  ? -11.365 8.625   -3.576  1.00 0.00 ? 168 ILE A HG22 3  
ATOM   4568  H  HG23 . ILE A 1 13  ? -12.086 8.488   -1.973  1.00 0.00 ? 168 ILE A HG23 3  
ATOM   4569  H  HD11 . ILE A 1 13  ? -10.509 12.282  -4.150  1.00 0.00 ? 168 ILE A HD11 3  
ATOM   4570  H  HD12 . ILE A 1 13  ? -9.770  12.348  -2.551  1.00 0.00 ? 168 ILE A HD12 3  
ATOM   4571  H  HD13 . ILE A 1 13  ? -11.255 13.242  -2.874  1.00 0.00 ? 168 ILE A HD13 3  
ATOM   4572  N  N    . VAL A 1 14  ? -10.029 7.913   0.303   1.00 0.00 ? 169 VAL A N    3  
ATOM   4573  C  CA   . VAL A 1 14  ? -9.134  6.832   0.826   1.00 0.00 ? 169 VAL A CA   3  
ATOM   4574  C  C    . VAL A 1 14  ? -8.907  5.776   -0.265  1.00 0.00 ? 169 VAL A C    3  
ATOM   4575  O  O    . VAL A 1 14  ? -9.798  5.487   -1.043  1.00 0.00 ? 169 VAL A O    3  
ATOM   4576  C  CB   . VAL A 1 14  ? -9.845  6.231   2.056   1.00 0.00 ? 169 VAL A CB   3  
ATOM   4577  C  CG1  . VAL A 1 14  ? -11.166 5.554   1.658   1.00 0.00 ? 169 VAL A CG1  3  
ATOM   4578  C  CG2  . VAL A 1 14  ? -8.928  5.193   2.708   1.00 0.00 ? 169 VAL A CG2  3  
ATOM   4579  H  H    . VAL A 1 14  ? -10.997 7.759   0.226   1.00 0.00 ? 169 VAL A H    3  
ATOM   4580  H  HA   . VAL A 1 14  ? -8.187  7.255   1.126   1.00 0.00 ? 169 VAL A HA   3  
ATOM   4581  H  HB   . VAL A 1 14  ? -10.051 7.019   2.766   1.00 0.00 ? 169 VAL A HB   3  
ATOM   4582  H  HG11 . VAL A 1 14  ? -11.030 4.997   0.744   1.00 0.00 ? 169 VAL A HG11 3  
ATOM   4583  H  HG12 . VAL A 1 14  ? -11.927 6.305   1.513   1.00 0.00 ? 169 VAL A HG12 3  
ATOM   4584  H  HG13 . VAL A 1 14  ? -11.474 4.881   2.445   1.00 0.00 ? 169 VAL A HG13 3  
ATOM   4585  H  HG21 . VAL A 1 14  ? -9.056  5.222   3.780   1.00 0.00 ? 169 VAL A HG21 3  
ATOM   4586  H  HG22 . VAL A 1 14  ? -7.899  5.414   2.462   1.00 0.00 ? 169 VAL A HG22 3  
ATOM   4587  H  HG23 . VAL A 1 14  ? -9.181  4.208   2.342   1.00 0.00 ? 169 VAL A HG23 3  
ATOM   4588  N  N    . SER A 1 15  ? -7.722  5.206   -0.345  1.00 0.00 ? 170 SER A N    3  
ATOM   4589  C  CA   . SER A 1 15  ? -7.466  4.186   -1.405  1.00 0.00 ? 170 SER A CA   3  
ATOM   4590  C  C    . SER A 1 15  ? -6.352  3.216   -0.993  1.00 0.00 ? 170 SER A C    3  
ATOM   4591  O  O    . SER A 1 15  ? -5.497  3.545   -0.192  1.00 0.00 ? 170 SER A O    3  
ATOM   4592  C  CB   . SER A 1 15  ? -7.047  4.990   -2.634  1.00 0.00 ? 170 SER A CB   3  
ATOM   4593  O  OG   . SER A 1 15  ? -6.242  6.088   -2.226  1.00 0.00 ? 170 SER A OG   3  
ATOM   4594  H  H    . SER A 1 15  ? -7.003  5.456   0.280   1.00 0.00 ? 170 SER A H    3  
ATOM   4595  H  HA   . SER A 1 15  ? -8.364  3.637   -1.618  1.00 0.00 ? 170 SER A HA   3  
ATOM   4596  H  HB2  . SER A 1 15  ? -6.479  4.363   -3.301  1.00 0.00 ? 170 SER A HB2  3  
ATOM   4597  H  HB3  . SER A 1 15  ? -7.931  5.349   -3.146  1.00 0.00 ? 170 SER A HB3  3  
ATOM   4598  H  HG   . SER A 1 15  ? -5.884  6.503   -3.014  1.00 0.00 ? 170 SER A HG   3  
ATOM   4599  N  N    . CYS A 1 16  ? -6.353  2.023   -1.548  1.00 0.00 ? 171 CYS A N    3  
ATOM   4600  C  CA   . CYS A 1 16  ? -5.284  1.030   -1.198  1.00 0.00 ? 171 CYS A CA   3  
ATOM   4601  C  C    . CYS A 1 16  ? -4.183  1.064   -2.267  1.00 0.00 ? 171 CYS A C    3  
ATOM   4602  O  O    . CYS A 1 16  ? -4.472  1.095   -3.451  1.00 0.00 ? 171 CYS A O    3  
ATOM   4603  C  CB   . CYS A 1 16  ? -5.973  -0.340  -1.186  1.00 0.00 ? 171 CYS A CB   3  
ATOM   4604  S  SG   . CYS A 1 16  ? -4.834  -1.591  -0.545  1.00 0.00 ? 171 CYS A SG   3  
ATOM   4605  H  H    . CYS A 1 16  ? -7.054  1.784   -2.203  1.00 0.00 ? 171 CYS A H    3  
ATOM   4606  H  HA   . CYS A 1 16  ? -4.873  1.248   -0.224  1.00 0.00 ? 171 CYS A HA   3  
ATOM   4607  H  HB2  . CYS A 1 16  ? -6.851  -0.297  -0.559  1.00 0.00 ? 171 CYS A HB2  3  
ATOM   4608  H  HB3  . CYS A 1 16  ? -6.262  -0.600  -2.191  1.00 0.00 ? 171 CYS A HB3  3  
ATOM   4609  N  N    . THR A 1 17  ? -2.924  1.058   -1.869  1.00 0.00 ? 172 THR A N    3  
ATOM   4610  C  CA   . THR A 1 17  ? -1.822  1.090   -2.894  1.00 0.00 ? 172 THR A CA   3  
ATOM   4611  C  C    . THR A 1 17  ? -1.591  -0.317  -3.476  1.00 0.00 ? 172 THR A C    3  
ATOM   4612  O  O    . THR A 1 17  ? -1.336  -0.463  -4.658  1.00 0.00 ? 172 THR A O    3  
ATOM   4613  C  CB   . THR A 1 17  ? -0.554  1.618   -2.183  1.00 0.00 ? 172 THR A CB   3  
ATOM   4614  O  OG1  . THR A 1 17  ? 0.444   1.883   -3.157  1.00 0.00 ? 172 THR A OG1  3  
ATOM   4615  C  CG2  . THR A 1 17  ? -0.013  0.591   -1.172  1.00 0.00 ? 172 THR A CG2  3  
ATOM   4616  H  H    . THR A 1 17  ? -2.711  1.027   -0.907  1.00 0.00 ? 172 THR A H    3  
ATOM   4617  H  HA   . THR A 1 17  ? -2.093  1.767   -3.690  1.00 0.00 ? 172 THR A HA   3  
ATOM   4618  H  HB   . THR A 1 17  ? -0.795  2.533   -1.662  1.00 0.00 ? 172 THR A HB   3  
ATOM   4619  H  HG1  . THR A 1 17  ? 0.218   2.706   -3.597  1.00 0.00 ? 172 THR A HG1  3  
ATOM   4620  H  HG21 . THR A 1 17  ? -0.724  0.457   -0.371  1.00 0.00 ? 172 THR A HG21 3  
ATOM   4621  H  HG22 . THR A 1 17  ? 0.921   0.947   -0.765  1.00 0.00 ? 172 THR A HG22 3  
ATOM   4622  H  HG23 . THR A 1 17  ? 0.153   -0.353  -1.668  1.00 0.00 ? 172 THR A HG23 3  
ATOM   4623  N  N    . ALA A 1 18  ? -1.684  -1.351  -2.665  1.00 0.00 ? 173 ALA A N    3  
ATOM   4624  C  CA   . ALA A 1 18  ? -1.472  -2.739  -3.207  1.00 0.00 ? 173 ALA A CA   3  
ATOM   4625  C  C    . ALA A 1 18  ? -2.620  -3.119  -4.165  1.00 0.00 ? 173 ALA A C    3  
ATOM   4626  O  O    . ALA A 1 18  ? -2.416  -3.866  -5.104  1.00 0.00 ? 173 ALA A O    3  
ATOM   4627  C  CB   . ALA A 1 18  ? -1.426  -3.684  -1.993  1.00 0.00 ? 173 ALA A CB   3  
ATOM   4628  H  H    . ALA A 1 18  ? -1.898  -1.215  -1.711  1.00 0.00 ? 173 ALA A H    3  
ATOM   4629  H  HA   . ALA A 1 18  ? -0.533  -2.781  -3.734  1.00 0.00 ? 173 ALA A HA   3  
ATOM   4630  H  HB1  . ALA A 1 18  ? -2.430  -3.872  -1.644  1.00 0.00 ? 173 ALA A HB1  3  
ATOM   4631  H  HB2  . ALA A 1 18  ? -0.847  -3.224  -1.200  1.00 0.00 ? 173 ALA A HB2  3  
ATOM   4632  H  HB3  . ALA A 1 18  ? -0.962  -4.616  -2.281  1.00 0.00 ? 173 ALA A HB3  3  
ATOM   4633  N  N    . CYS A 1 19  ? -3.819  -2.604  -3.955  1.00 0.00 ? 174 CYS A N    3  
ATOM   4634  C  CA   . CYS A 1 19  ? -4.952  -2.936  -4.879  1.00 0.00 ? 174 CYS A CA   3  
ATOM   4635  C  C    . CYS A 1 19  ? -5.107  -1.840  -5.944  1.00 0.00 ? 174 CYS A C    3  
ATOM   4636  O  O    . CYS A 1 19  ? -5.373  -2.126  -7.097  1.00 0.00 ? 174 CYS A O    3  
ATOM   4637  C  CB   . CYS A 1 19  ? -6.210  -2.994  -4.003  1.00 0.00 ? 174 CYS A CB   3  
ATOM   4638  S  SG   . CYS A 1 19  ? -6.094  -4.381  -2.850  1.00 0.00 ? 174 CYS A SG   3  
ATOM   4639  H  H    . CYS A 1 19  ? -3.971  -1.994  -3.202  1.00 0.00 ? 174 CYS A H    3  
ATOM   4640  H  HA   . CYS A 1 19  ? -4.787  -3.886  -5.347  1.00 0.00 ? 174 CYS A HA   3  
ATOM   4641  H  HB2  . CYS A 1 19  ? -6.303  -2.076  -3.451  1.00 0.00 ? 174 CYS A HB2  3  
ATOM   4642  H  HB3  . CYS A 1 19  ? -7.074  -3.121  -4.631  1.00 0.00 ? 174 CYS A HB3  3  
ATOM   4643  N  N    . GLY A 1 20  ? -4.955  -0.587  -5.569  1.00 0.00 ? 175 GLY A N    3  
ATOM   4644  C  CA   . GLY A 1 20  ? -5.108  0.518   -6.557  1.00 0.00 ? 175 GLY A CA   3  
ATOM   4645  C  C    . GLY A 1 20  ? -6.592  0.902   -6.659  1.00 0.00 ? 175 GLY A C    3  
ATOM   4646  O  O    . GLY A 1 20  ? -7.083  1.194   -7.733  1.00 0.00 ? 175 GLY A O    3  
ATOM   4647  H  H    . GLY A 1 20  ? -4.752  -0.371  -4.636  1.00 0.00 ? 175 GLY A H    3  
ATOM   4648  H  HA2  . GLY A 1 20  ? -4.533  1.374   -6.233  1.00 0.00 ? 175 GLY A HA2  3  
ATOM   4649  H  HA3  . GLY A 1 20  ? -4.757  0.191   -7.524  1.00 0.00 ? 175 GLY A HA3  3  
ATOM   4650  N  N    . GLN A 1 21  ? -7.317  0.899   -5.553  1.00 0.00 ? 176 GLN A N    3  
ATOM   4651  C  CA   . GLN A 1 21  ? -8.772  1.260   -5.615  1.00 0.00 ? 176 GLN A CA   3  
ATOM   4652  C  C    . GLN A 1 21  ? -9.301  1.668   -4.227  1.00 0.00 ? 176 GLN A C    3  
ATOM   4653  O  O    . GLN A 1 21  ? -8.787  1.237   -3.212  1.00 0.00 ? 176 GLN A O    3  
ATOM   4654  C  CB   . GLN A 1 21  ? -9.475  -0.016  -6.099  1.00 0.00 ? 176 GLN A CB   3  
ATOM   4655  C  CG   . GLN A 1 21  ? -9.915  0.152   -7.556  1.00 0.00 ? 176 GLN A CG   3  
ATOM   4656  C  CD   . GLN A 1 21  ? -10.751 -1.063  -7.980  1.00 0.00 ? 176 GLN A CD   3  
ATOM   4657  O  OE1  . GLN A 1 21  ? -10.216 -2.132  -8.190  1.00 0.00 ? 176 GLN A OE1  3  
ATOM   4658  N  NE2  . GLN A 1 21  ? -12.050 -0.948  -8.117  1.00 0.00 ? 176 GLN A NE2  3  
ATOM   4659  H  H    . GLN A 1 21  ? -6.908  0.656   -4.689  1.00 0.00 ? 176 GLN A H    3  
ATOM   4660  H  HA   . GLN A 1 21  ? -8.933  2.059   -6.322  1.00 0.00 ? 176 GLN A HA   3  
ATOM   4661  H  HB2  . GLN A 1 21  ? -8.793  -0.852  -6.025  1.00 0.00 ? 176 GLN A HB2  3  
ATOM   4662  H  HB3  . GLN A 1 21  ? -10.342 -0.206  -5.484  1.00 0.00 ? 176 GLN A HB3  3  
ATOM   4663  H  HG2  . GLN A 1 21  ? -10.509 1.050   -7.650  1.00 0.00 ? 176 GLN A HG2  3  
ATOM   4664  H  HG3  . GLN A 1 21  ? -9.046  0.226   -8.190  1.00 0.00 ? 176 GLN A HG3  3  
ATOM   4665  H  HE21 . GLN A 1 21  ? -12.494 -0.088  -7.949  1.00 0.00 ? 176 GLN A HE21 3  
ATOM   4666  H  HE22 . GLN A 1 21  ? -12.582 -1.724  -8.388  1.00 0.00 ? 176 GLN A HE22 3  
ATOM   4667  N  N    . GLN A 1 22  ? -10.327 2.497   -4.177  1.00 0.00 ? 177 GLN A N    3  
ATOM   4668  C  CA   . GLN A 1 22  ? -10.885 2.924   -2.840  1.00 0.00 ? 177 GLN A CA   3  
ATOM   4669  C  C    . GLN A 1 22  ? -11.288 1.695   -2.009  1.00 0.00 ? 177 GLN A C    3  
ATOM   4670  O  O    . GLN A 1 22  ? -11.682 0.681   -2.553  1.00 0.00 ? 177 GLN A O    3  
ATOM   4671  C  CB   . GLN A 1 22  ? -12.122 3.788   -3.134  1.00 0.00 ? 177 GLN A CB   3  
ATOM   4672  C  CG   . GLN A 1 22  ? -12.386 4.727   -1.954  1.00 0.00 ? 177 GLN A CG   3  
ATOM   4673  C  CD   . GLN A 1 22  ? -13.874 5.096   -1.917  1.00 0.00 ? 177 GLN A CD   3  
ATOM   4674  O  OE1  . GLN A 1 22  ? -14.720 4.266   -2.181  1.00 0.00 ? 177 GLN A OE1  3  
ATOM   4675  N  NE2  . GLN A 1 22  ? -14.237 6.315   -1.598  1.00 0.00 ? 177 GLN A NE2  3  
ATOM   4676  H  H    . GLN A 1 22  ? -10.725 2.834   -5.015  1.00 0.00 ? 177 GLN A H    3  
ATOM   4677  H  HA   . GLN A 1 22  ? -10.155 3.507   -2.302  1.00 0.00 ? 177 GLN A HA   3  
ATOM   4678  H  HB2  . GLN A 1 22  ? -11.950 4.372   -4.027  1.00 0.00 ? 177 GLN A HB2  3  
ATOM   4679  H  HB3  . GLN A 1 22  ? -12.980 3.149   -3.281  1.00 0.00 ? 177 GLN A HB3  3  
ATOM   4680  H  HG2  . GLN A 1 22  ? -12.114 4.232   -1.033  1.00 0.00 ? 177 GLN A HG2  3  
ATOM   4681  H  HG3  . GLN A 1 22  ? -11.796 5.623   -2.069  1.00 0.00 ? 177 GLN A HG3  3  
ATOM   4682  H  HE21 . GLN A 1 22  ? -13.562 6.996   -1.382  1.00 0.00 ? 177 GLN A HE21 3  
ATOM   4683  H  HE22 . GLN A 1 22  ? -15.188 6.551   -1.575  1.00 0.00 ? 177 GLN A HE22 3  
ATOM   4684  N  N    . VAL A 1 23  ? -11.203 1.778   -0.696  1.00 0.00 ? 178 VAL A N    3  
ATOM   4685  C  CA   . VAL A 1 23  ? -11.598 0.598   0.153   1.00 0.00 ? 178 VAL A CA   3  
ATOM   4686  C  C    . VAL A 1 23  ? -13.125 0.567   0.319   1.00 0.00 ? 178 VAL A C    3  
ATOM   4687  O  O    . VAL A 1 23  ? -13.790 1.566   0.114   1.00 0.00 ? 178 VAL A O    3  
ATOM   4688  C  CB   . VAL A 1 23  ? -10.908 0.783   1.515   1.00 0.00 ? 178 VAL A CB   3  
ATOM   4689  C  CG1  . VAL A 1 23  ? -11.218 -0.415  2.414   1.00 0.00 ? 178 VAL A CG1  3  
ATOM   4690  C  CG2  . VAL A 1 23  ? -9.394  0.884   1.310   1.00 0.00 ? 178 VAL A CG2  3  
ATOM   4691  H  H    . VAL A 1 23  ? -10.890 2.613   -0.274  1.00 0.00 ? 178 VAL A H    3  
ATOM   4692  H  HA   . VAL A 1 23  ? -11.258 -0.317  -0.307  1.00 0.00 ? 178 VAL A HA   3  
ATOM   4693  H  HB   . VAL A 1 23  ? -11.270 1.687   1.986   1.00 0.00 ? 178 VAL A HB   3  
ATOM   4694  H  HG11 . VAL A 1 23  ? -11.138 -1.326  1.839   1.00 0.00 ? 178 VAL A HG11 3  
ATOM   4695  H  HG12 . VAL A 1 23  ? -12.221 -0.323  2.805   1.00 0.00 ? 178 VAL A HG12 3  
ATOM   4696  H  HG13 . VAL A 1 23  ? -10.514 -0.443  3.232   1.00 0.00 ? 178 VAL A HG13 3  
ATOM   4697  H  HG21 . VAL A 1 23  ? -9.082  0.153   0.580   1.00 0.00 ? 178 VAL A HG21 3  
ATOM   4698  H  HG22 . VAL A 1 23  ? -8.891  0.694   2.247   1.00 0.00 ? 178 VAL A HG22 3  
ATOM   4699  H  HG23 . VAL A 1 23  ? -9.143  1.874   0.960   1.00 0.00 ? 178 VAL A HG23 3  
ATOM   4700  N  N    . ASN A 1 24  ? -13.695 -0.569  0.677   1.00 0.00 ? 179 ASN A N    3  
ATOM   4701  C  CA   . ASN A 1 24  ? -15.198 -0.642  0.839   1.00 0.00 ? 179 ASN A CA   3  
ATOM   4702  C  C    . ASN A 1 24  ? -15.700 0.464   1.784   1.00 0.00 ? 179 ASN A C    3  
ATOM   4703  O  O    . ASN A 1 24  ? -15.717 0.293   2.988   1.00 0.00 ? 179 ASN A O    3  
ATOM   4704  C  CB   . ASN A 1 24  ? -15.510 -2.022  1.440   1.00 0.00 ? 179 ASN A CB   3  
ATOM   4705  C  CG   . ASN A 1 24  ? -16.995 -2.347  1.233   1.00 0.00 ? 179 ASN A CG   3  
ATOM   4706  O  OD1  . ASN A 1 24  ? -17.341 -3.090  0.335   1.00 0.00 ? 179 ASN A OD1  3  
ATOM   4707  N  ND2  . ASN A 1 24  ? -17.897 -1.818  2.024   1.00 0.00 ? 179 ASN A ND2  3  
ATOM   4708  H  H    . ASN A 1 24  ? -13.138 -1.370  0.828   1.00 0.00 ? 179 ASN A H    3  
ATOM   4709  H  HA   . ASN A 1 24  ? -15.676 -0.549  -0.124  1.00 0.00 ? 179 ASN A HA   3  
ATOM   4710  H  HB2  . ASN A 1 24  ? -14.904 -2.772  0.952   1.00 0.00 ? 179 ASN A HB2  3  
ATOM   4711  H  HB3  . ASN A 1 24  ? -15.290 -2.012  2.497   1.00 0.00 ? 179 ASN A HB3  3  
ATOM   4712  H  HD21 . ASN A 1 24  ? -17.629 -1.216  2.752   1.00 0.00 ? 179 ASN A HD21 3  
ATOM   4713  H  HD22 . ASN A 1 24  ? -18.845 -2.028  1.890   1.00 0.00 ? 179 ASN A HD22 3  
ATOM   4714  N  N    . HIS A 1 25  ? -16.113 1.601   1.250   1.00 0.00 ? 180 HIS A N    3  
ATOM   4715  C  CA   . HIS A 1 25  ? -16.618 2.714   2.120   1.00 0.00 ? 180 HIS A CA   3  
ATOM   4716  C  C    . HIS A 1 25  ? -15.612 3.033   3.242   1.00 0.00 ? 180 HIS A C    3  
ATOM   4717  O  O    . HIS A 1 25  ? -14.525 2.489   3.275   1.00 0.00 ? 180 HIS A O    3  
ATOM   4718  C  CB   . HIS A 1 25  ? -17.935 2.202   2.708   1.00 0.00 ? 180 HIS A CB   3  
ATOM   4719  C  CG   . HIS A 1 25  ? -19.089 2.704   1.883   1.00 0.00 ? 180 HIS A CG   3  
ATOM   4720  N  ND1  . HIS A 1 25  ? -19.001 2.864   0.510   1.00 0.00 ? 180 HIS A ND1  3  
ATOM   4721  C  CD2  . HIS A 1 25  ? -20.363 3.087   2.224   1.00 0.00 ? 180 HIS A CD2  3  
ATOM   4722  C  CE1  . HIS A 1 25  ? -20.189 3.325   0.078   1.00 0.00 ? 180 HIS A CE1  3  
ATOM   4723  N  NE2  . HIS A 1 25  ? -21.056 3.479   1.082   1.00 0.00 ? 180 HIS A NE2  3  
ATOM   4724  H  H    . HIS A 1 25  ? -16.095 1.723   0.275   1.00 0.00 ? 180 HIS A H    3  
ATOM   4725  H  HA   . HIS A 1 25  ? -16.800 3.597   1.525   1.00 0.00 ? 180 HIS A HA   3  
ATOM   4726  H  HB2  . HIS A 1 25  ? -17.934 1.121   2.704   1.00 0.00 ? 180 HIS A HB2  3  
ATOM   4727  H  HB3  . HIS A 1 25  ? -18.038 2.557   3.724   1.00 0.00 ? 180 HIS A HB3  3  
ATOM   4728  H  HD1  . HIS A 1 25  ? -18.216 2.677   -0.047  1.00 0.00 ? 180 HIS A HD1  3  
ATOM   4729  H  HD2  . HIS A 1 25  ? -20.765 3.085   3.226   1.00 0.00 ? 180 HIS A HD2  3  
ATOM   4730  H  HE1  . HIS A 1 25  ? -20.414 3.544   -0.956  1.00 0.00 ? 180 HIS A HE1  3  
ATOM   4731  N  N    . PHE A 1 26  ? -15.968 3.905   4.164   1.00 0.00 ? 181 PHE A N    3  
ATOM   4732  C  CA   . PHE A 1 26  ? -15.030 4.244   5.275   1.00 0.00 ? 181 PHE A CA   3  
ATOM   4733  C  C    . PHE A 1 26  ? -15.630 3.814   6.623   1.00 0.00 ? 181 PHE A C    3  
ATOM   4734  O  O    . PHE A 1 26  ? -16.551 4.433   7.121   1.00 0.00 ? 181 PHE A O    3  
ATOM   4735  C  CB   . PHE A 1 26  ? -14.870 5.768   5.207   1.00 0.00 ? 181 PHE A CB   3  
ATOM   4736  C  CG   . PHE A 1 26  ? -13.940 6.247   6.303   1.00 0.00 ? 181 PHE A CG   3  
ATOM   4737  C  CD1  . PHE A 1 26  ? -12.699 5.623   6.506   1.00 0.00 ? 181 PHE A CD1  3  
ATOM   4738  C  CD2  . PHE A 1 26  ? -14.321 7.322   7.114   1.00 0.00 ? 181 PHE A CD2  3  
ATOM   4739  C  CE1  . PHE A 1 26  ? -11.847 6.074   7.518   1.00 0.00 ? 181 PHE A CE1  3  
ATOM   4740  C  CE2  . PHE A 1 26  ? -13.466 7.772   8.127   1.00 0.00 ? 181 PHE A CE2  3  
ATOM   4741  C  CZ   . PHE A 1 26  ? -12.230 7.149   8.328   1.00 0.00 ? 181 PHE A CZ   3  
ATOM   4742  H  H    . PHE A 1 26  ? -16.851 4.336   4.128   1.00 0.00 ? 181 PHE A H    3  
ATOM   4743  H  HA   . PHE A 1 26  ? -14.075 3.768   5.118   1.00 0.00 ? 181 PHE A HA   3  
ATOM   4744  H  HB2  . PHE A 1 26  ? -14.461 6.041   4.246   1.00 0.00 ? 181 PHE A HB2  3  
ATOM   4745  H  HB3  . PHE A 1 26  ? -15.837 6.234   5.329   1.00 0.00 ? 181 PHE A HB3  3  
ATOM   4746  H  HD1  . PHE A 1 26  ? -12.402 4.793   5.883   1.00 0.00 ? 181 PHE A HD1  3  
ATOM   4747  H  HD2  . PHE A 1 26  ? -15.275 7.803   6.960   1.00 0.00 ? 181 PHE A HD2  3  
ATOM   4748  H  HE1  . PHE A 1 26  ? -10.892 5.595   7.674   1.00 0.00 ? 181 PHE A HE1  3  
ATOM   4749  H  HE2  . PHE A 1 26  ? -13.761 8.601   8.753   1.00 0.00 ? 181 PHE A HE2  3  
ATOM   4750  H  HZ   . PHE A 1 26  ? -11.572 7.497   9.107   1.00 0.00 ? 181 PHE A HZ   3  
ATOM   4751  N  N    . GLN A 1 27  ? -15.113 2.760   7.220   1.00 0.00 ? 182 GLN A N    3  
ATOM   4752  C  CA   . GLN A 1 27  ? -15.655 2.298   8.534   1.00 0.00 ? 182 GLN A CA   3  
ATOM   4753  C  C    . GLN A 1 27  ? -14.610 2.514   9.641   1.00 0.00 ? 182 GLN A C    3  
ATOM   4754  O  O    . GLN A 1 27  ? -13.422 2.533   9.377   1.00 0.00 ? 182 GLN A O    3  
ATOM   4755  C  CB   . GLN A 1 27  ? -15.947 0.808   8.346   1.00 0.00 ? 182 GLN A CB   3  
ATOM   4756  C  CG   . GLN A 1 27  ? -16.629 0.250   9.597   1.00 0.00 ? 182 GLN A CG   3  
ATOM   4757  C  CD   . GLN A 1 27  ? -17.703 -0.766  9.190   1.00 0.00 ? 182 GLN A CD   3  
ATOM   4758  O  OE1  . GLN A 1 27  ? -17.439 -1.951  9.136   1.00 0.00 ? 182 GLN A OE1  3  
ATOM   4759  N  NE2  . GLN A 1 27  ? -18.913 -0.355  8.899   1.00 0.00 ? 182 GLN A NE2  3  
ATOM   4760  H  H    . GLN A 1 27  ? -14.367 2.272   6.806   1.00 0.00 ? 182 GLN A H    3  
ATOM   4761  H  HA   . GLN A 1 27  ? -16.567 2.826   8.770   1.00 0.00 ? 182 GLN A HA   3  
ATOM   4762  H  HB2  . GLN A 1 27  ? -16.592 0.674   7.491   1.00 0.00 ? 182 GLN A HB2  3  
ATOM   4763  H  HB3  . GLN A 1 27  ? -15.021 0.282   8.182   1.00 0.00 ? 182 GLN A HB3  3  
ATOM   4764  H  HG2  . GLN A 1 27  ? -15.891 -0.236  10.218  1.00 0.00 ? 182 GLN A HG2  3  
ATOM   4765  H  HG3  . GLN A 1 27  ? -17.089 1.056   10.148  1.00 0.00 ? 182 GLN A HG3  3  
ATOM   4766  H  HE21 . GLN A 1 27  ? -19.139 0.600   8.938   1.00 0.00 ? 182 GLN A HE21 3  
ATOM   4767  H  HE22 . GLN A 1 27  ? -19.598 -1.006  8.637   1.00 0.00 ? 182 GLN A HE22 3  
ATOM   4768  N  N    . LYS A 1 28  ? -15.039 2.692   10.875  1.00 0.00 ? 183 LYS A N    3  
ATOM   4769  C  CA   . LYS A 1 28  ? -14.048 2.923   11.993  1.00 0.00 ? 183 LYS A CA   3  
ATOM   4770  C  C    . LYS A 1 28  ? -12.944 1.844   12.024  1.00 0.00 ? 183 LYS A C    3  
ATOM   4771  O  O    . LYS A 1 28  ? -11.845 2.107   12.476  1.00 0.00 ? 183 LYS A O    3  
ATOM   4772  C  CB   . LYS A 1 28  ? -14.851 2.890   13.306  1.00 0.00 ? 183 LYS A CB   3  
ATOM   4773  C  CG   . LYS A 1 28  ? -15.530 1.526   13.468  1.00 0.00 ? 183 LYS A CG   3  
ATOM   4774  C  CD   . LYS A 1 28  ? -16.857 1.697   14.210  1.00 0.00 ? 183 LYS A CD   3  
ATOM   4775  C  CE   . LYS A 1 28  ? -17.592 0.354   14.259  1.00 0.00 ? 183 LYS A CE   3  
ATOM   4776  N  NZ   . LYS A 1 28  ? -18.182 0.289   15.625  1.00 0.00 ? 183 LYS A NZ   3  
ATOM   4777  H  H    . LYS A 1 28  ? -16.007 2.687   11.062  1.00 0.00 ? 183 LYS A H    3  
ATOM   4778  H  HA   . LYS A 1 28  ? -13.598 3.894   11.877  1.00 0.00 ? 183 LYS A HA   3  
ATOM   4779  H  HB2  . LYS A 1 28  ? -14.183 3.061   14.138  1.00 0.00 ? 183 LYS A HB2  3  
ATOM   4780  H  HB3  . LYS A 1 28  ? -15.604 3.663   13.286  1.00 0.00 ? 183 LYS A HB3  3  
ATOM   4781  H  HG2  . LYS A 1 28  ? -15.715 1.097   12.495  1.00 0.00 ? 183 LYS A HG2  3  
ATOM   4782  H  HG3  . LYS A 1 28  ? -14.887 0.869   14.034  1.00 0.00 ? 183 LYS A HG3  3  
ATOM   4783  H  HD2  . LYS A 1 28  ? -16.666 2.041   15.216  1.00 0.00 ? 183 LYS A HD2  3  
ATOM   4784  H  HD3  . LYS A 1 28  ? -17.469 2.421   13.692  1.00 0.00 ? 183 LYS A HD3  3  
ATOM   4785  H  HE2  . LYS A 1 28  ? -18.369 0.325   13.508  1.00 0.00 ? 183 LYS A HE2  3  
ATOM   4786  H  HE3  . LYS A 1 28  ? -16.899 -0.460  14.116  1.00 0.00 ? 183 LYS A HE3  3  
ATOM   4787  H  HZ1  . LYS A 1 28  ? -17.421 0.206   16.327  1.00 0.00 ? 183 LYS A HZ1  3  
ATOM   4788  H  HZ2  . LYS A 1 28  ? -18.809 -0.539  15.691  1.00 0.00 ? 183 LYS A HZ2  3  
ATOM   4789  H  HZ3  . LYS A 1 28  ? -18.728 1.154   15.808  1.00 0.00 ? 183 LYS A HZ3  3  
ATOM   4790  N  N    . ASP A 1 29  ? -13.216 0.637   11.571  1.00 0.00 ? 184 ASP A N    3  
ATOM   4791  C  CA   . ASP A 1 29  ? -12.163 -0.424  11.614  1.00 0.00 ? 184 ASP A CA   3  
ATOM   4792  C  C    . ASP A 1 29  ? -12.048 -1.167  10.272  1.00 0.00 ? 184 ASP A C    3  
ATOM   4793  O  O    . ASP A 1 29  ? -11.771 -2.352  10.249  1.00 0.00 ? 184 ASP A O    3  
ATOM   4794  C  CB   . ASP A 1 29  ? -12.619 -1.383  12.715  1.00 0.00 ? 184 ASP A CB   3  
ATOM   4795  C  CG   . ASP A 1 29  ? -12.009 -0.954  14.050  1.00 0.00 ? 184 ASP A CG   3  
ATOM   4796  O  OD1  . ASP A 1 29  ? -10.792 -0.929  14.143  1.00 0.00 ? 184 ASP A OD1  3  
ATOM   4797  O  OD2  . ASP A 1 29  ? -12.768 -0.660  14.958  1.00 0.00 ? 184 ASP A OD2  3  
ATOM   4798  H  H    . ASP A 1 29  ? -14.103 0.426   11.221  1.00 0.00 ? 184 ASP A H    3  
ATOM   4799  H  HA   . ASP A 1 29  ? -11.211 0.008   11.881  1.00 0.00 ? 184 ASP A HA   3  
ATOM   4800  H  HB2  . ASP A 1 29  ? -13.696 -1.361  12.786  1.00 0.00 ? 184 ASP A HB2  3  
ATOM   4801  H  HB3  . ASP A 1 29  ? -12.293 -2.384  12.476  1.00 0.00 ? 184 ASP A HB3  3  
ATOM   4802  N  N    . SER A 1 30  ? -12.233 -0.492  9.154   1.00 0.00 ? 185 SER A N    3  
ATOM   4803  C  CA   . SER A 1 30  ? -12.101 -1.199  7.835   1.00 0.00 ? 185 SER A CA   3  
ATOM   4804  C  C    . SER A 1 30  ? -10.661 -1.058  7.316   1.00 0.00 ? 185 SER A C    3  
ATOM   4805  O  O    . SER A 1 30  ? -9.931  -2.025  7.267   1.00 0.00 ? 185 SER A O    3  
ATOM   4806  C  CB   . SER A 1 30  ? -13.087 -0.526  6.876   1.00 0.00 ? 185 SER A CB   3  
ATOM   4807  O  OG   . SER A 1 30  ? -12.629 -0.688  5.540   1.00 0.00 ? 185 SER A OG   3  
ATOM   4808  H  H    . SER A 1 30  ? -12.441 0.471   9.185   1.00 0.00 ? 185 SER A H    3  
ATOM   4809  H  HA   . SER A 1 30  ? -12.351 -2.242  7.948   1.00 0.00 ? 185 SER A HA   3  
ATOM   4810  H  HB2  . SER A 1 30  ? -14.057 -0.982  6.976   1.00 0.00 ? 185 SER A HB2  3  
ATOM   4811  H  HB3  . SER A 1 30  ? -13.159 0.524   7.118   1.00 0.00 ? 185 SER A HB3  3  
ATOM   4812  H  HG   . SER A 1 30  ? -13.212 -0.188  4.963   1.00 0.00 ? 185 SER A HG   3  
ATOM   4813  N  N    . ILE A 1 31  ? -10.243 0.132   6.921   1.00 0.00 ? 186 ILE A N    3  
ATOM   4814  C  CA   . ILE A 1 31  ? -8.830  0.305   6.401   1.00 0.00 ? 186 ILE A CA   3  
ATOM   4815  C  C    . ILE A 1 31  ? -7.800  -0.309  7.365   1.00 0.00 ? 186 ILE A C    3  
ATOM   4816  O  O    . ILE A 1 31  ? -8.042  -0.422  8.552   1.00 0.00 ? 186 ILE A O    3  
ATOM   4817  C  CB   . ILE A 1 31  ? -8.567  1.818   6.273   1.00 0.00 ? 186 ILE A CB   3  
ATOM   4818  C  CG1  . ILE A 1 31  ? -8.834  2.514   7.615   1.00 0.00 ? 186 ILE A CG1  3  
ATOM   4819  C  CG2  . ILE A 1 31  ? -9.473  2.415   5.197   1.00 0.00 ? 186 ILE A CG2  3  
ATOM   4820  C  CD1  . ILE A 1 31  ? -8.254  3.928   7.579   1.00 0.00 ? 186 ILE A CD1  3  
ATOM   4821  H  H    . ILE A 1 31  ? -10.855 0.902   6.959   1.00 0.00 ? 186 ILE A H    3  
ATOM   4822  H  HA   . ILE A 1 31  ? -8.735  -0.162  5.433   1.00 0.00 ? 186 ILE A HA   3  
ATOM   4823  H  HB   . ILE A 1 31  ? -7.535  1.973   5.990   1.00 0.00 ? 186 ILE A HB   3  
ATOM   4824  H  HG12 . ILE A 1 31  ? -9.896  2.570   7.792   1.00 0.00 ? 186 ILE A HG12 3  
ATOM   4825  H  HG13 . ILE A 1 31  ? -8.364  1.955   8.411   1.00 0.00 ? 186 ILE A HG13 3  
ATOM   4826  H  HG21 . ILE A 1 31  ? -9.496  1.754   4.341   1.00 0.00 ? 186 ILE A HG21 3  
ATOM   4827  H  HG22 . ILE A 1 31  ? -9.087  3.380   4.899   1.00 0.00 ? 186 ILE A HG22 3  
ATOM   4828  H  HG23 . ILE A 1 31  ? -10.471 2.532   5.590   1.00 0.00 ? 186 ILE A HG23 3  
ATOM   4829  H  HD11 . ILE A 1 31  ? -7.281  3.908   7.113   1.00 0.00 ? 186 ILE A HD11 3  
ATOM   4830  H  HD12 . ILE A 1 31  ? -8.162  4.304   8.588   1.00 0.00 ? 186 ILE A HD12 3  
ATOM   4831  H  HD13 . ILE A 1 31  ? -8.912  4.572   7.014   1.00 0.00 ? 186 ILE A HD13 3  
ATOM   4832  N  N    . TYR A 1 32  ? -6.650  -0.701  6.858   1.00 0.00 ? 187 TYR A N    3  
ATOM   4833  C  CA   . TYR A 1 32  ? -5.603  -1.302  7.733   1.00 0.00 ? 187 TYR A CA   3  
ATOM   4834  C  C    . TYR A 1 32  ? -4.241  -0.672  7.436   1.00 0.00 ? 187 TYR A C    3  
ATOM   4835  O  O    . TYR A 1 32  ? -4.081  0.041   6.463   1.00 0.00 ? 187 TYR A O    3  
ATOM   4836  C  CB   . TYR A 1 32  ? -5.584  -2.787  7.376   1.00 0.00 ? 187 TYR A CB   3  
ATOM   4837  C  CG   . TYR A 1 32  ? -6.521  -3.537  8.288   1.00 0.00 ? 187 TYR A CG   3  
ATOM   4838  C  CD1  . TYR A 1 32  ? -6.060  -4.042  9.509   1.00 0.00 ? 187 TYR A CD1  3  
ATOM   4839  C  CD2  . TYR A 1 32  ? -7.853  -3.727  7.911   1.00 0.00 ? 187 TYR A CD2  3  
ATOM   4840  C  CE1  . TYR A 1 32  ? -6.931  -4.740  10.352  1.00 0.00 ? 187 TYR A CE1  3  
ATOM   4841  C  CE2  . TYR A 1 32  ? -8.727  -4.424  8.752   1.00 0.00 ? 187 TYR A CE2  3  
ATOM   4842  C  CZ   . TYR A 1 32  ? -8.266  -4.931  9.973   1.00 0.00 ? 187 TYR A CZ   3  
ATOM   4843  O  OH   . TYR A 1 32  ? -9.128  -5.619  10.804  1.00 0.00 ? 187 TYR A OH   3  
ATOM   4844  H  H    . TYR A 1 32  ? -6.474  -0.600  5.895   1.00 0.00 ? 187 TYR A H    3  
ATOM   4845  H  HA   . TYR A 1 32  ? -5.848  -1.175  8.776   1.00 0.00 ? 187 TYR A HA   3  
ATOM   4846  H  HB2  . TYR A 1 32  ? -5.901  -2.914  6.351   1.00 0.00 ? 187 TYR A HB2  3  
ATOM   4847  H  HB3  . TYR A 1 32  ? -4.583  -3.173  7.494   1.00 0.00 ? 187 TYR A HB3  3  
ATOM   4848  H  HD1  . TYR A 1 32  ? -5.029  -3.894  9.799   1.00 0.00 ? 187 TYR A HD1  3  
ATOM   4849  H  HD2  . TYR A 1 32  ? -8.207  -3.339  6.965   1.00 0.00 ? 187 TYR A HD2  3  
ATOM   4850  H  HE1  . TYR A 1 32  ? -6.575  -5.133  11.293  1.00 0.00 ? 187 TYR A HE1  3  
ATOM   4851  H  HE2  . TYR A 1 32  ? -9.756  -4.570  8.458   1.00 0.00 ? 187 TYR A HE2  3  
ATOM   4852  H  HH   . TYR A 1 32  ? -9.347  -5.049  11.543  1.00 0.00 ? 187 TYR A HH   3  
ATOM   4853  N  N    . ARG A 1 33  ? -3.259  -0.936  8.265   1.00 0.00 ? 188 ARG A N    3  
ATOM   4854  C  CA   . ARG A 1 33  ? -1.904  -0.354  8.025   1.00 0.00 ? 188 ARG A CA   3  
ATOM   4855  C  C    . ARG A 1 33  ? -0.922  -1.467  7.631   1.00 0.00 ? 188 ARG A C    3  
ATOM   4856  O  O    . ARG A 1 33  ? -0.933  -2.537  8.210   1.00 0.00 ? 188 ARG A O    3  
ATOM   4857  C  CB   . ARG A 1 33  ? -1.487  0.272   9.359   1.00 0.00 ? 188 ARG A CB   3  
ATOM   4858  C  CG   . ARG A 1 33  ? -2.269  1.566   9.587   1.00 0.00 ? 188 ARG A CG   3  
ATOM   4859  C  CD   . ARG A 1 33  ? -1.400  2.564   10.356  1.00 0.00 ? 188 ARG A CD   3  
ATOM   4860  N  NE   . ARG A 1 33  ? -1.850  2.454   11.771  1.00 0.00 ? 188 ARG A NE   3  
ATOM   4861  C  CZ   . ARG A 1 33  ? -1.003  2.104   12.701  1.00 0.00 ? 188 ARG A CZ   3  
ATOM   4862  N  NH1  . ARG A 1 33  ? -0.326  0.995   12.583  1.00 0.00 ? 188 ARG A NH1  3  
ATOM   4863  N  NH2  . ARG A 1 33  ? -0.833  2.864   13.748  1.00 0.00 ? 188 ARG A NH2  3  
ATOM   4864  H  H    . ARG A 1 33  ? -3.412  -1.521  9.042   1.00 0.00 ? 188 ARG A H    3  
ATOM   4865  H  HA   . ARG A 1 33  ? -1.948  0.404   7.256   1.00 0.00 ? 188 ARG A HA   3  
ATOM   4866  H  HB2  . ARG A 1 33  ? -1.695  -0.420  10.161  1.00 0.00 ? 188 ARG A HB2  3  
ATOM   4867  H  HB3  . ARG A 1 33  ? -0.431  0.493   9.339   1.00 0.00 ? 188 ARG A HB3  3  
ATOM   4868  H  HG2  . ARG A 1 33  ? -2.548  1.991   8.634   1.00 0.00 ? 188 ARG A HG2  3  
ATOM   4869  H  HG3  . ARG A 1 33  ? -3.159  1.352   10.160  1.00 0.00 ? 188 ARG A HG3  3  
ATOM   4870  H  HD2  . ARG A 1 33  ? -0.355  2.297   10.269  1.00 0.00 ? 188 ARG A HD2  3  
ATOM   4871  H  HD3  . ARG A 1 33  ? -1.565  3.567   9.994   1.00 0.00 ? 188 ARG A HD3  3  
ATOM   4872  H  HE   . ARG A 1 33  ? -2.783  2.643   12.005  1.00 0.00 ? 188 ARG A HE   3  
ATOM   4873  H  HH11 . ARG A 1 33  ? -0.457  0.412   11.781  1.00 0.00 ? 188 ARG A HH11 3  
ATOM   4874  H  HH12 . ARG A 1 33  ? 0.322   0.726   13.296  1.00 0.00 ? 188 ARG A HH12 3  
ATOM   4875  H  HH21 . ARG A 1 33  ? -1.352  3.714   13.839  1.00 0.00 ? 188 ARG A HH21 3  
ATOM   4876  H  HH22 . ARG A 1 33  ? -0.185  2.595   14.461  1.00 0.00 ? 188 ARG A HH22 3  
ATOM   4877  N  N    . HIS A 1 34  ? -0.063  -1.223  6.663   1.00 0.00 ? 189 HIS A N    3  
ATOM   4878  C  CA   . HIS A 1 34  ? 0.923   -2.281  6.263   1.00 0.00 ? 189 HIS A CA   3  
ATOM   4879  C  C    . HIS A 1 34  ? 1.928   -2.465  7.412   1.00 0.00 ? 189 HIS A C    3  
ATOM   4880  O  O    . HIS A 1 34  ? 2.492   -1.496  7.882   1.00 0.00 ? 189 HIS A O    3  
ATOM   4881  C  CB   . HIS A 1 34  ? 1.626   -1.767  4.996   1.00 0.00 ? 189 HIS A CB   3  
ATOM   4882  C  CG   . HIS A 1 34  ? 1.980   -2.929  4.116   1.00 0.00 ? 189 HIS A CG   3  
ATOM   4883  N  ND1  . HIS A 1 34  ? 3.080   -3.724  4.363   1.00 0.00 ? 189 HIS A ND1  3  
ATOM   4884  C  CD2  . HIS A 1 34  ? 1.376   -3.457  3.005   1.00 0.00 ? 189 HIS A CD2  3  
ATOM   4885  C  CE1  . HIS A 1 34  ? 3.109   -4.689  3.435   1.00 0.00 ? 189 HIS A CE1  3  
ATOM   4886  N  NE2  . HIS A 1 34  ? 2.090   -4.576  2.574   1.00 0.00 ? 189 HIS A NE2  3  
ATOM   4887  H  H    . HIS A 1 34  ? -0.059  -0.342  6.215   1.00 0.00 ? 189 HIS A H    3  
ATOM   4888  H  HA   . HIS A 1 34  ? 0.408   -3.204  6.053   1.00 0.00 ? 189 HIS A HA   3  
ATOM   4889  H  HB2  . HIS A 1 34  ? 0.964   -1.100  4.462   1.00 0.00 ? 189 HIS A HB2  3  
ATOM   4890  H  HB3  . HIS A 1 34  ? 2.520   -1.237  5.274   1.00 0.00 ? 189 HIS A HB3  3  
ATOM   4891  H  HD1  . HIS A 1 34  ? 3.737   -3.589  5.065   1.00 0.00 ? 189 HIS A HD1  3  
ATOM   4892  H  HD2  . HIS A 1 34  ? 0.497   -3.052  2.523   1.00 0.00 ? 189 HIS A HD2  3  
ATOM   4893  H  HE1  . HIS A 1 34  ? 3.861   -5.467  3.396   1.00 0.00 ? 189 HIS A HE1  3  
ATOM   4894  N  N    . PRO A 1 35  ? 2.110   -3.690  7.860   1.00 0.00 ? 190 PRO A N    3  
ATOM   4895  C  CA   . PRO A 1 35  ? 3.040   -3.938  8.991   1.00 0.00 ? 190 PRO A CA   3  
ATOM   4896  C  C    . PRO A 1 35  ? 4.503   -3.766  8.551   1.00 0.00 ? 190 PRO A C    3  
ATOM   4897  O  O    . PRO A 1 35  ? 5.288   -3.148  9.247   1.00 0.00 ? 190 PRO A O    3  
ATOM   4898  C  CB   . PRO A 1 35  ? 2.747   -5.382  9.388   1.00 0.00 ? 190 PRO A CB   3  
ATOM   4899  C  CG   . PRO A 1 35  ? 2.190   -6.021  8.159   1.00 0.00 ? 190 PRO A CG   3  
ATOM   4900  C  CD   . PRO A 1 35  ? 1.494   -4.940  7.375   1.00 0.00 ? 190 PRO A CD   3  
ATOM   4901  H  HA   . PRO A 1 35  ? 2.814   -3.279  9.815   1.00 0.00 ? 190 PRO A HA   3  
ATOM   4902  H  HB2  . PRO A 1 35  ? 3.658   -5.879  9.696   1.00 0.00 ? 190 PRO A HB2  3  
ATOM   4903  H  HB3  . PRO A 1 35  ? 2.014   -5.411  10.181  1.00 0.00 ? 190 PRO A HB3  3  
ATOM   4904  H  HG2  . PRO A 1 35  ? 2.990   -6.451  7.572   1.00 0.00 ? 190 PRO A HG2  3  
ATOM   4905  H  HG3  . PRO A 1 35  ? 1.479   -6.787  8.430   1.00 0.00 ? 190 PRO A HG3  3  
ATOM   4906  H  HD2  . PRO A 1 35  ? 1.674   -5.069  6.316   1.00 0.00 ? 190 PRO A HD2  3  
ATOM   4907  H  HD3  . PRO A 1 35  ? 0.436   -4.940  7.586   1.00 0.00 ? 190 PRO A HD3  3  
ATOM   4908  N  N    . SER A 1 36  ? 4.884   -4.312  7.416   1.00 0.00 ? 191 SER A N    3  
ATOM   4909  C  CA   . SER A 1 36  ? 6.315   -4.175  6.966   1.00 0.00 ? 191 SER A CA   3  
ATOM   4910  C  C    . SER A 1 36  ? 6.533   -2.988  6.000   1.00 0.00 ? 191 SER A C    3  
ATOM   4911  O  O    . SER A 1 36  ? 7.546   -2.948  5.326   1.00 0.00 ? 191 SER A O    3  
ATOM   4912  C  CB   . SER A 1 36  ? 6.644   -5.488  6.244   1.00 0.00 ? 191 SER A CB   3  
ATOM   4913  O  OG   . SER A 1 36  ? 6.563   -6.565  7.168   1.00 0.00 ? 191 SER A OG   3  
ATOM   4914  H  H    . SER A 1 36  ? 4.239   -4.821  6.871   1.00 0.00 ? 191 SER A H    3  
ATOM   4915  H  HA   . SER A 1 36  ? 6.960   -4.071  7.823   1.00 0.00 ? 191 SER A HA   3  
ATOM   4916  H  HB2  . SER A 1 36  ? 5.935   -5.650  5.445   1.00 0.00 ? 191 SER A HB2  3  
ATOM   4917  H  HB3  . SER A 1 36  ? 7.643   -5.429  5.829   1.00 0.00 ? 191 SER A HB3  3  
ATOM   4918  H  HG   . SER A 1 36  ? 6.662   -7.385  6.678   1.00 0.00 ? 191 SER A HG   3  
ATOM   4919  N  N    . LEU A 1 37  ? 5.620   -2.032  5.896   1.00 0.00 ? 192 LEU A N    3  
ATOM   4920  C  CA   . LEU A 1 37  ? 5.864   -0.900  4.927   1.00 0.00 ? 192 LEU A CA   3  
ATOM   4921  C  C    . LEU A 1 37  ? 5.369   0.490   5.400   1.00 0.00 ? 192 LEU A C    3  
ATOM   4922  O  O    . LEU A 1 37  ? 5.423   1.426   4.624   1.00 0.00 ? 192 LEU A O    3  
ATOM   4923  C  CB   . LEU A 1 37  ? 5.079   -1.281  3.666   1.00 0.00 ? 192 LEU A CB   3  
ATOM   4924  C  CG   . LEU A 1 37  ? 5.804   -2.356  2.844   1.00 0.00 ? 192 LEU A CG   3  
ATOM   4925  C  CD1  . LEU A 1 37  ? 5.018   -2.590  1.552   1.00 0.00 ? 192 LEU A CD1  3  
ATOM   4926  C  CD2  . LEU A 1 37  ? 7.220   -1.889  2.481   1.00 0.00 ? 192 LEU A CD2  3  
ATOM   4927  H  H    . LEU A 1 37  ? 4.798   -2.069  6.421   1.00 0.00 ? 192 LEU A H    3  
ATOM   4928  H  HA   . LEU A 1 37  ? 6.911   -0.846  4.686   1.00 0.00 ? 192 LEU A HA   3  
ATOM   4929  H  HB2  . LEU A 1 37  ? 4.110   -1.656  3.957   1.00 0.00 ? 192 LEU A HB2  3  
ATOM   4930  H  HB3  . LEU A 1 37  ? 4.947   -0.401  3.055   1.00 0.00 ? 192 LEU A HB3  3  
ATOM   4931  H  HG   . LEU A 1 37  ? 5.854   -3.275  3.411   1.00 0.00 ? 192 LEU A HG   3  
ATOM   4932  H  HD11 . LEU A 1 37  ? 4.126   -3.164  1.764   1.00 0.00 ? 192 LEU A HD11 3  
ATOM   4933  H  HD12 . LEU A 1 37  ? 5.633   -3.127  0.845   1.00 0.00 ? 192 LEU A HD12 3  
ATOM   4934  H  HD13 . LEU A 1 37  ? 4.738   -1.632  1.132   1.00 0.00 ? 192 LEU A HD13 3  
ATOM   4935  H  HD21 . LEU A 1 37  ? 7.213   -0.824  2.306   1.00 0.00 ? 192 LEU A HD21 3  
ATOM   4936  H  HD22 . LEU A 1 37  ? 7.549   -2.401  1.588   1.00 0.00 ? 192 LEU A HD22 3  
ATOM   4937  H  HD23 . LEU A 1 37  ? 7.895   -2.117  3.292   1.00 0.00 ? 192 LEU A HD23 3  
ATOM   4938  N  N    . GLN A 1 38  ? 4.883   0.668   6.623   1.00 0.00 ? 193 GLN A N    3  
ATOM   4939  C  CA   . GLN A 1 38  ? 4.391   2.031   7.049   1.00 0.00 ? 193 GLN A CA   3  
ATOM   4940  C  C    . GLN A 1 38  ? 3.420   2.603   5.991   1.00 0.00 ? 193 GLN A C    3  
ATOM   4941  O  O    . GLN A 1 38  ? 3.511   3.756   5.616   1.00 0.00 ? 193 GLN A O    3  
ATOM   4942  C  CB   . GLN A 1 38  ? 5.648   2.900   7.144   1.00 0.00 ? 193 GLN A CB   3  
ATOM   4943  C  CG   . GLN A 1 38  ? 6.362   2.626   8.469   1.00 0.00 ? 193 GLN A CG   3  
ATOM   4944  C  CD   . GLN A 1 38  ? 7.093   3.893   8.929   1.00 0.00 ? 193 GLN A CD   3  
ATOM   4945  O  OE1  . GLN A 1 38  ? 6.739   4.475   9.935   1.00 0.00 ? 193 GLN A OE1  3  
ATOM   4946  N  NE2  . GLN A 1 38  ? 8.105   4.352   8.235   1.00 0.00 ? 193 GLN A NE2  3  
ATOM   4947  H  H    . GLN A 1 38  ? 4.835   -0.072  7.251   1.00 0.00 ? 193 GLN A H    3  
ATOM   4948  H  HA   . GLN A 1 38  ? 3.908   1.973   8.012   1.00 0.00 ? 193 GLN A HA   3  
ATOM   4949  H  HB2  . GLN A 1 38  ? 6.310   2.667   6.322   1.00 0.00 ? 193 GLN A HB2  3  
ATOM   4950  H  HB3  . GLN A 1 38  ? 5.371   3.944   7.096   1.00 0.00 ? 193 GLN A HB3  3  
ATOM   4951  H  HG2  . GLN A 1 38  ? 5.635   2.336   9.215   1.00 0.00 ? 193 GLN A HG2  3  
ATOM   4952  H  HG3  . GLN A 1 38  ? 7.077   1.829   8.334   1.00 0.00 ? 193 GLN A HG3  3  
ATOM   4953  H  HE21 . GLN A 1 38  ? 8.400   3.891   7.420   1.00 0.00 ? 193 GLN A HE21 3  
ATOM   4954  H  HE22 . GLN A 1 38  ? 8.571   5.163   8.531   1.00 0.00 ? 193 GLN A HE22 3  
ATOM   4955  N  N    . VAL A 1 39  ? 2.517   1.788   5.482   1.00 0.00 ? 194 VAL A N    3  
ATOM   4956  C  CA   . VAL A 1 39  ? 1.574   2.261   4.422   1.00 0.00 ? 194 VAL A CA   3  
ATOM   4957  C  C    . VAL A 1 39  ? 0.121   1.920   4.797   1.00 0.00 ? 194 VAL A C    3  
ATOM   4958  O  O    . VAL A 1 39  ? -0.128  1.111   5.664   1.00 0.00 ? 194 VAL A O    3  
ATOM   4959  C  CB   . VAL A 1 39  ? 2.029   1.481   3.168   1.00 0.00 ? 194 VAL A CB   3  
ATOM   4960  C  CG1  . VAL A 1 39  ? 0.960   1.522   2.062   1.00 0.00 ? 194 VAL A CG1  3  
ATOM   4961  C  CG2  . VAL A 1 39  ? 3.337   2.089   2.638   1.00 0.00 ? 194 VAL A CG2  3  
ATOM   4962  H  H    . VAL A 1 39  ? 2.476   0.853   5.777   1.00 0.00 ? 194 VAL A H    3  
ATOM   4963  H  HA   . VAL A 1 39  ? 1.676   3.320   4.254   1.00 0.00 ? 194 VAL A HA   3  
ATOM   4964  H  HB   . VAL A 1 39  ? 2.206   0.452   3.444   1.00 0.00 ? 194 VAL A HB   3  
ATOM   4965  H  HG11 . VAL A 1 39  ? 0.726   2.549   1.824   1.00 0.00 ? 194 VAL A HG11 3  
ATOM   4966  H  HG12 . VAL A 1 39  ? 0.068   1.018   2.407   1.00 0.00 ? 194 VAL A HG12 3  
ATOM   4967  H  HG13 . VAL A 1 39  ? 1.332   1.024   1.182   1.00 0.00 ? 194 VAL A HG13 3  
ATOM   4968  H  HG21 . VAL A 1 39  ? 3.692   2.847   3.321   1.00 0.00 ? 194 VAL A HG21 3  
ATOM   4969  H  HG22 . VAL A 1 39  ? 3.168   2.532   1.668   1.00 0.00 ? 194 VAL A HG22 3  
ATOM   4970  H  HG23 . VAL A 1 39  ? 4.081   1.312   2.549   1.00 0.00 ? 194 VAL A HG23 3  
ATOM   4971  N  N    . LEU A 1 40  ? -0.836  2.523   4.125   1.00 0.00 ? 195 LEU A N    3  
ATOM   4972  C  CA   . LEU A 1 40  ? -2.269  2.211   4.421   1.00 0.00 ? 195 LEU A CA   3  
ATOM   4973  C  C    . LEU A 1 40  ? -2.804  1.230   3.368   1.00 0.00 ? 195 LEU A C    3  
ATOM   4974  O  O    . LEU A 1 40  ? -2.528  1.372   2.191   1.00 0.00 ? 195 LEU A O    3  
ATOM   4975  C  CB   . LEU A 1 40  ? -3.023  3.544   4.329   1.00 0.00 ? 195 LEU A CB   3  
ATOM   4976  C  CG   . LEU A 1 40  ? -4.514  3.323   4.639   1.00 0.00 ? 195 LEU A CG   3  
ATOM   4977  C  CD1  . LEU A 1 40  ? -4.846  3.890   6.024   1.00 0.00 ? 195 LEU A CD1  3  
ATOM   4978  C  CD2  . LEU A 1 40  ? -5.371  4.026   3.580   1.00 0.00 ? 195 LEU A CD2  3  
ATOM   4979  H  H    . LEU A 1 40  ? -0.608  3.169   3.415   1.00 0.00 ? 195 LEU A H    3  
ATOM   4980  H  HA   . LEU A 1 40  ? -2.368  1.794   5.414   1.00 0.00 ? 195 LEU A HA   3  
ATOM   4981  H  HB2  . LEU A 1 40  ? -2.603  4.240   5.036   1.00 0.00 ? 195 LEU A HB2  3  
ATOM   4982  H  HB3  . LEU A 1 40  ? -2.918  3.944   3.330   1.00 0.00 ? 195 LEU A HB3  3  
ATOM   4983  H  HG   . LEU A 1 40  ? -4.730  2.264   4.629   1.00 0.00 ? 195 LEU A HG   3  
ATOM   4984  H  HD11 . LEU A 1 40  ? -5.505  3.210   6.541   1.00 0.00 ? 195 LEU A HD11 3  
ATOM   4985  H  HD12 . LEU A 1 40  ? -5.331  4.850   5.918   1.00 0.00 ? 195 LEU A HD12 3  
ATOM   4986  H  HD13 . LEU A 1 40  ? -3.936  4.010   6.593   1.00 0.00 ? 195 LEU A HD13 3  
ATOM   4987  H  HD21 . LEU A 1 40  ? -6.407  4.006   3.884   1.00 0.00 ? 195 LEU A HD21 3  
ATOM   4988  H  HD22 . LEU A 1 40  ? -5.263  3.516   2.633   1.00 0.00 ? 195 LEU A HD22 3  
ATOM   4989  H  HD23 . LEU A 1 40  ? -5.046  5.051   3.475   1.00 0.00 ? 195 LEU A HD23 3  
ATOM   4990  N  N    . ILE A 1 41  ? -3.570  0.240   3.772   1.00 0.00 ? 196 ILE A N    3  
ATOM   4991  C  CA   . ILE A 1 41  ? -4.118  -0.735  2.783   1.00 0.00 ? 196 ILE A CA   3  
ATOM   4992  C  C    . ILE A 1 41  ? -5.594  -1.026  3.110   1.00 0.00 ? 196 ILE A C    3  
ATOM   4993  O  O    . ILE A 1 41  ? -6.206  -0.302  3.873   1.00 0.00 ? 196 ILE A O    3  
ATOM   4994  C  CB   . ILE A 1 41  ? -3.231  -1.989  2.901   1.00 0.00 ? 196 ILE A CB   3  
ATOM   4995  C  CG1  . ILE A 1 41  ? -3.204  -2.489  4.356   1.00 0.00 ? 196 ILE A CG1  3  
ATOM   4996  C  CG2  . ILE A 1 41  ? -1.805  -1.647  2.446   1.00 0.00 ? 196 ILE A CG2  3  
ATOM   4997  C  CD1  . ILE A 1 41  ? -2.367  -3.770  4.450   1.00 0.00 ? 196 ILE A CD1  3  
ATOM   4998  H  H    . ILE A 1 41  ? -3.792  0.139   4.725   1.00 0.00 ? 196 ILE A H    3  
ATOM   4999  H  HA   . ILE A 1 41  ? -4.041  -0.329  1.785   1.00 0.00 ? 196 ILE A HA   3  
ATOM   5000  H  HB   . ILE A 1 41  ? -3.620  -2.765  2.262   1.00 0.00 ? 196 ILE A HB   3  
ATOM   5001  H  HG12 . ILE A 1 41  ? -2.767  -1.731  4.988   1.00 0.00 ? 196 ILE A HG12 3  
ATOM   5002  H  HG13 . ILE A 1 41  ? -4.211  -2.694  4.685   1.00 0.00 ? 196 ILE A HG13 3  
ATOM   5003  H  HG21 . ILE A 1 41  ? -1.816  -0.730  1.874   1.00 0.00 ? 196 ILE A HG21 3  
ATOM   5004  H  HG22 . ILE A 1 41  ? -1.423  -2.448  1.829   1.00 0.00 ? 196 ILE A HG22 3  
ATOM   5005  H  HG23 . ILE A 1 41  ? -1.168  -1.524  3.310   1.00 0.00 ? 196 ILE A HG23 3  
ATOM   5006  H  HD11 . ILE A 1 41  ? -2.279  -4.217  3.471   1.00 0.00 ? 196 ILE A HD11 3  
ATOM   5007  H  HD12 . ILE A 1 41  ? -2.847  -4.466  5.121   1.00 0.00 ? 196 ILE A HD12 3  
ATOM   5008  H  HD13 . ILE A 1 41  ? -1.382  -3.529  4.824   1.00 0.00 ? 196 ILE A HD13 3  
ATOM   5009  N  N    . CYS A 1 42  ? -6.180  -2.058  2.538   1.00 0.00 ? 197 CYS A N    3  
ATOM   5010  C  CA   . CYS A 1 42  ? -7.618  -2.350  2.823   1.00 0.00 ? 197 CYS A CA   3  
ATOM   5011  C  C    . CYS A 1 42  ? -7.758  -3.657  3.629   1.00 0.00 ? 197 CYS A C    3  
ATOM   5012  O  O    . CYS A 1 42  ? -6.841  -4.454  3.683   1.00 0.00 ? 197 CYS A O    3  
ATOM   5013  C  CB   . CYS A 1 42  ? -8.301  -2.435  1.440   1.00 0.00 ? 197 CYS A CB   3  
ATOM   5014  S  SG   . CYS A 1 42  ? -7.748  -3.895  0.503   1.00 0.00 ? 197 CYS A SG   3  
ATOM   5015  H  H    . CYS A 1 42  ? -5.684  -2.628  1.922   1.00 0.00 ? 197 CYS A H    3  
ATOM   5016  H  HA   . CYS A 1 42  ? -8.049  -1.529  3.384   1.00 0.00 ? 197 CYS A HA   3  
ATOM   5017  H  HB2  . CYS A 1 42  ? -9.369  -2.493  1.577   1.00 0.00 ? 197 CYS A HB2  3  
ATOM   5018  H  HB3  . CYS A 1 42  ? -8.065  -1.543  0.877   1.00 0.00 ? 197 CYS A HB3  3  
ATOM   5019  N  N    . LYS A 1 43  ? -8.892  -3.873  4.272   1.00 0.00 ? 198 LYS A N    3  
ATOM   5020  C  CA   . LYS A 1 43  ? -9.071  -5.131  5.095   1.00 0.00 ? 198 LYS A CA   3  
ATOM   5021  C  C    . LYS A 1 43  ? -8.691  -6.383  4.292   1.00 0.00 ? 198 LYS A C    3  
ATOM   5022  O  O    . LYS A 1 43  ? -8.024  -7.265  4.802   1.00 0.00 ? 198 LYS A O    3  
ATOM   5023  C  CB   . LYS A 1 43  ? -10.552 -5.182  5.500   1.00 0.00 ? 198 LYS A CB   3  
ATOM   5024  C  CG   . LYS A 1 43  ? -10.792 -6.381  6.420   1.00 0.00 ? 198 LYS A CG   3  
ATOM   5025  C  CD   . LYS A 1 43  ? -12.038 -6.131  7.273   1.00 0.00 ? 198 LYS A CD   3  
ATOM   5026  C  CE   . LYS A 1 43  ? -13.284 -6.177  6.385   1.00 0.00 ? 198 LYS A CE   3  
ATOM   5027  N  NZ   . LYS A 1 43  ? -13.786 -7.574  6.501   1.00 0.00 ? 198 LYS A NZ   3  
ATOM   5028  H  H    . LYS A 1 43  ? -9.615  -3.203  4.226   1.00 0.00 ? 198 LYS A H    3  
ATOM   5029  H  HA   . LYS A 1 43  ? -8.463  -5.078  5.976   1.00 0.00 ? 198 LYS A HA   3  
ATOM   5030  H  HB2  . LYS A 1 43  ? -10.808 -4.271  6.022   1.00 0.00 ? 198 LYS A HB2  3  
ATOM   5031  H  HB3  . LYS A 1 43  ? -11.164 -5.277  4.617   1.00 0.00 ? 198 LYS A HB3  3  
ATOM   5032  H  HG2  . LYS A 1 43  ? -10.937 -7.270  5.822   1.00 0.00 ? 198 LYS A HG2  3  
ATOM   5033  H  HG3  . LYS A 1 43  ? -9.938  -6.517  7.065   1.00 0.00 ? 198 LYS A HG3  3  
ATOM   5034  H  HD2  . LYS A 1 43  ? -12.110 -6.891  8.036   1.00 0.00 ? 198 LYS A HD2  3  
ATOM   5035  H  HD3  . LYS A 1 43  ? -11.965 -5.158  7.738   1.00 0.00 ? 198 LYS A HD3  3  
ATOM   5036  H  HE2  . LYS A 1 43  ? -14.025 -5.476  6.745   1.00 0.00 ? 198 LYS A HE2  3  
ATOM   5037  H  HE3  . LYS A 1 43  ? -13.026 -5.961  5.360   1.00 0.00 ? 198 LYS A HE3  3  
ATOM   5038  H  HZ1  . LYS A 1 43  ? -14.542 -7.730  5.806   1.00 0.00 ? 198 LYS A HZ1  3  
ATOM   5039  H  HZ2  . LYS A 1 43  ? -14.160 -7.729  7.461   1.00 0.00 ? 198 LYS A HZ2  3  
ATOM   5040  H  HZ3  . LYS A 1 43  ? -13.008 -8.239  6.321   1.00 0.00 ? 198 LYS A HZ3  3  
ATOM   5041  N  N    . ASN A 1 44  ? -9.094  -6.472  3.045   1.00 0.00 ? 199 ASN A N    3  
ATOM   5042  C  CA   . ASN A 1 44  ? -8.723  -7.688  2.233   1.00 0.00 ? 199 ASN A CA   3  
ATOM   5043  C  C    . ASN A 1 44  ? -7.192  -7.845  2.164   1.00 0.00 ? 199 ASN A C    3  
ATOM   5044  O  O    . ASN A 1 44  ? -6.691  -8.949  2.085   1.00 0.00 ? 199 ASN A O    3  
ATOM   5045  C  CB   . ASN A 1 44  ? -9.303  -7.482  0.825   1.00 0.00 ? 199 ASN A CB   3  
ATOM   5046  C  CG   . ASN A 1 44  ? -10.829 -7.621  0.874   1.00 0.00 ? 199 ASN A CG   3  
ATOM   5047  O  OD1  . ASN A 1 44  ? -11.351 -8.397  1.650   1.00 0.00 ? 199 ASN A OD1  3  
ATOM   5048  N  ND2  . ASN A 1 44  ? -11.578 -6.901  0.074   1.00 0.00 ? 199 ASN A ND2  3  
ATOM   5049  H  H    . ASN A 1 44  ? -9.626  -5.743  2.648   1.00 0.00 ? 199 ASN A H    3  
ATOM   5050  H  HA   . ASN A 1 44  ? -9.152  -8.567  2.683   1.00 0.00 ? 199 ASN A HA   3  
ATOM   5051  H  HB2  . ASN A 1 44  ? -9.041  -6.496  0.469   1.00 0.00 ? 199 ASN A HB2  3  
ATOM   5052  H  HB3  . ASN A 1 44  ? -8.897  -8.226  0.156   1.00 0.00 ? 199 ASN A HB3  3  
ATOM   5053  H  HD21 . ASN A 1 44  ? -11.167 -6.270  -0.557  1.00 0.00 ? 199 ASN A HD21 3  
ATOM   5054  H  HD22 . ASN A 1 44  ? -12.553 -6.990  0.107   1.00 0.00 ? 199 ASN A HD22 3  
ATOM   5055  N  N    . CYS A 1 45  ? -6.443  -6.760  2.213   1.00 0.00 ? 200 CYS A N    3  
ATOM   5056  C  CA   . CYS A 1 45  ? -4.947  -6.890  2.171   1.00 0.00 ? 200 CYS A CA   3  
ATOM   5057  C  C    . CYS A 1 45  ? -4.458  -7.381  3.534   1.00 0.00 ? 200 CYS A C    3  
ATOM   5058  O  O    . CYS A 1 45  ? -3.742  -8.356  3.625   1.00 0.00 ? 200 CYS A O    3  
ATOM   5059  C  CB   . CYS A 1 45  ? -4.379  -5.490  1.882   1.00 0.00 ? 200 CYS A CB   3  
ATOM   5060  S  SG   . CYS A 1 45  ? -4.242  -5.245  0.097   1.00 0.00 ? 200 CYS A SG   3  
ATOM   5061  H  H    . CYS A 1 45  ? -6.860  -5.877  2.297   1.00 0.00 ? 200 CYS A H    3  
ATOM   5062  H  HA   . CYS A 1 45  ? -4.651  -7.580  1.398   1.00 0.00 ? 200 CYS A HA   3  
ATOM   5063  H  HB2  . CYS A 1 45  ? -5.034  -4.740  2.299   1.00 0.00 ? 200 CYS A HB2  3  
ATOM   5064  H  HB3  . CYS A 1 45  ? -3.402  -5.400  2.332   1.00 0.00 ? 200 CYS A HB3  3  
ATOM   5065  N  N    . PHE A 1 46  ? -4.852  -6.717  4.599   1.00 0.00 ? 201 PHE A N    3  
ATOM   5066  C  CA   . PHE A 1 46  ? -4.406  -7.167  5.965   1.00 0.00 ? 201 PHE A CA   3  
ATOM   5067  C  C    . PHE A 1 46  ? -4.896  -8.598  6.236   1.00 0.00 ? 201 PHE A C    3  
ATOM   5068  O  O    . PHE A 1 46  ? -4.195  -9.378  6.854   1.00 0.00 ? 201 PHE A O    3  
ATOM   5069  C  CB   . PHE A 1 46  ? -5.021  -6.185  6.979   1.00 0.00 ? 201 PHE A CB   3  
ATOM   5070  C  CG   . PHE A 1 46  ? -4.134  -6.082  8.199   1.00 0.00 ? 201 PHE A CG   3  
ATOM   5071  C  CD1  . PHE A 1 46  ? -3.048  -5.195  8.206   1.00 0.00 ? 201 PHE A CD1  3  
ATOM   5072  C  CD2  . PHE A 1 46  ? -4.402  -6.869  9.324   1.00 0.00 ? 201 PHE A CD2  3  
ATOM   5073  C  CE1  . PHE A 1 46  ? -2.230  -5.101  9.340   1.00 0.00 ? 201 PHE A CE1  3  
ATOM   5074  C  CE2  . PHE A 1 46  ? -3.585  -6.773  10.457  1.00 0.00 ? 201 PHE A CE2  3  
ATOM   5075  C  CZ   . PHE A 1 46  ? -2.499  -5.890  10.465  1.00 0.00 ? 201 PHE A CZ   3  
ATOM   5076  H  H    . PHE A 1 46  ? -5.442  -5.934  4.496   1.00 0.00 ? 201 PHE A H    3  
ATOM   5077  H  HA   . PHE A 1 46  ? -3.330  -7.136  6.025   1.00 0.00 ? 201 PHE A HA   3  
ATOM   5078  H  HB2  . PHE A 1 46  ? -5.117  -5.211  6.522   1.00 0.00 ? 201 PHE A HB2  3  
ATOM   5079  H  HB3  . PHE A 1 46  ? -5.997  -6.540  7.275   1.00 0.00 ? 201 PHE A HB3  3  
ATOM   5080  H  HD1  . PHE A 1 46  ? -2.841  -4.585  7.340   1.00 0.00 ? 201 PHE A HD1  3  
ATOM   5081  H  HD2  . PHE A 1 46  ? -5.238  -7.552  9.318   1.00 0.00 ? 201 PHE A HD2  3  
ATOM   5082  H  HE1  . PHE A 1 46  ? -1.390  -4.418  9.347   1.00 0.00 ? 201 PHE A HE1  3  
ATOM   5083  H  HE2  . PHE A 1 46  ? -3.794  -7.379  11.325  1.00 0.00 ? 201 PHE A HE2  3  
ATOM   5084  H  HZ   . PHE A 1 46  ? -1.870  -5.816  11.340  1.00 0.00 ? 201 PHE A HZ   3  
ATOM   5085  N  N    . LYS A 1 47  ? -6.077  -8.966  5.768   1.00 0.00 ? 202 LYS A N    3  
ATOM   5086  C  CA   . LYS A 1 47  ? -6.555  -10.372 6.007   1.00 0.00 ? 202 LYS A CA   3  
ATOM   5087  C  C    . LYS A 1 47  ? -5.880  -11.314 5.004   1.00 0.00 ? 202 LYS A C    3  
ATOM   5088  O  O    . LYS A 1 47  ? -5.515  -12.421 5.348   1.00 0.00 ? 202 LYS A O    3  
ATOM   5089  C  CB   . LYS A 1 47  ? -8.078  -10.365 5.806   1.00 0.00 ? 202 LYS A CB   3  
ATOM   5090  C  CG   . LYS A 1 47  ? -8.729  -11.325 6.804   1.00 0.00 ? 202 LYS A CG   3  
ATOM   5091  C  CD   . LYS A 1 47  ? -10.116 -10.804 7.184   1.00 0.00 ? 202 LYS A CD   3  
ATOM   5092  C  CE   . LYS A 1 47  ? -10.702 -11.677 8.296   1.00 0.00 ? 202 LYS A CE   3  
ATOM   5093  N  NZ   . LYS A 1 47  ? -12.166 -11.718 8.020   1.00 0.00 ? 202 LYS A NZ   3  
ATOM   5094  H  H    . LYS A 1 47  ? -6.630  -8.331  5.249   1.00 0.00 ? 202 LYS A H    3  
ATOM   5095  H  HA   . LYS A 1 47  ? -6.313  -10.680 7.013   1.00 0.00 ? 202 LYS A HA   3  
ATOM   5096  H  HB2  . LYS A 1 47  ? -8.457  -9.366  5.967   1.00 0.00 ? 202 LYS A HB2  3  
ATOM   5097  H  HB3  . LYS A 1 47  ? -8.310  -10.681 4.801   1.00 0.00 ? 202 LYS A HB3  3  
ATOM   5098  H  HG2  . LYS A 1 47  ? -8.820  -12.303 6.354   1.00 0.00 ? 202 LYS A HG2  3  
ATOM   5099  H  HG3  . LYS A 1 47  ? -8.117  -11.393 7.690   1.00 0.00 ? 202 LYS A HG3  3  
ATOM   5100  H  HD2  . LYS A 1 47  ? -10.034 -9.784  7.531   1.00 0.00 ? 202 LYS A HD2  3  
ATOM   5101  H  HD3  . LYS A 1 47  ? -10.763 -10.841 6.320   1.00 0.00 ? 202 LYS A HD3  3  
ATOM   5102  H  HE2  . LYS A 1 47  ? -10.280 -12.672 8.252   1.00 0.00 ? 202 LYS A HE2  3  
ATOM   5103  H  HE3  . LYS A 1 47  ? -10.520 -11.231 9.261   1.00 0.00 ? 202 LYS A HE3  3  
ATOM   5104  H  HZ1  . LYS A 1 47  ? -12.635 -12.320 8.726   1.00 0.00 ? 202 LYS A HZ1  3  
ATOM   5105  H  HZ2  . LYS A 1 47  ? -12.327 -12.107 7.068   1.00 0.00 ? 202 LYS A HZ2  3  
ATOM   5106  H  HZ3  . LYS A 1 47  ? -12.556 -10.757 8.074   1.00 0.00 ? 202 LYS A HZ3  3  
ATOM   5107  N  N    . TYR A 1 48  ? -5.687  -10.884 3.771   1.00 0.00 ? 203 TYR A N    3  
ATOM   5108  C  CA   . TYR A 1 48  ? -5.003  -11.779 2.776   1.00 0.00 ? 203 TYR A CA   3  
ATOM   5109  C  C    . TYR A 1 48  ? -3.503  -11.862 3.107   1.00 0.00 ? 203 TYR A C    3  
ATOM   5110  O  O    . TYR A 1 48  ? -2.895  -12.903 2.941   1.00 0.00 ? 203 TYR A O    3  
ATOM   5111  C  CB   . TYR A 1 48  ? -5.226  -11.148 1.391   1.00 0.00 ? 203 TYR A CB   3  
ATOM   5112  C  CG   . TYR A 1 48  ? -4.592  -12.004 0.320   1.00 0.00 ? 203 TYR A CG   3  
ATOM   5113  C  CD1  . TYR A 1 48  ? -4.850  -13.381 0.270   1.00 0.00 ? 203 TYR A CD1  3  
ATOM   5114  C  CD2  . TYR A 1 48  ? -3.749  -11.416 -0.629  1.00 0.00 ? 203 TYR A CD2  3  
ATOM   5115  C  CE1  . TYR A 1 48  ? -4.263  -14.167 -0.728  1.00 0.00 ? 203 TYR A CE1  3  
ATOM   5116  C  CE2  . TYR A 1 48  ? -3.163  -12.203 -1.628  1.00 0.00 ? 203 TYR A CE2  3  
ATOM   5117  C  CZ   . TYR A 1 48  ? -3.419  -13.578 -1.677  1.00 0.00 ? 203 TYR A CZ   3  
ATOM   5118  O  OH   . TYR A 1 48  ? -2.841  -14.354 -2.662  1.00 0.00 ? 203 TYR A OH   3  
ATOM   5119  H  H    . TYR A 1 48  ? -5.974  -9.977  3.511   1.00 0.00 ? 203 TYR A H    3  
ATOM   5120  H  HA   . TYR A 1 48  ? -5.441  -12.767 2.807   1.00 0.00 ? 203 TYR A HA   3  
ATOM   5121  H  HB2  . TYR A 1 48  ? -6.286  -11.065 1.202   1.00 0.00 ? 203 TYR A HB2  3  
ATOM   5122  H  HB3  . TYR A 1 48  ? -4.781  -10.163 1.372   1.00 0.00 ? 203 TYR A HB3  3  
ATOM   5123  H  HD1  . TYR A 1 48  ? -5.501  -13.834 1.003   1.00 0.00 ? 203 TYR A HD1  3  
ATOM   5124  H  HD2  . TYR A 1 48  ? -3.552  -10.352 -0.589  1.00 0.00 ? 203 TYR A HD2  3  
ATOM   5125  H  HE1  . TYR A 1 48  ? -4.461  -15.229 -0.765  1.00 0.00 ? 203 TYR A HE1  3  
ATOM   5126  H  HE2  . TYR A 1 48  ? -2.512  -11.750 -2.361  1.00 0.00 ? 203 TYR A HE2  3  
ATOM   5127  H  HH   . TYR A 1 48  ? -2.040  -14.740 -2.303  1.00 0.00 ? 203 TYR A HH   3  
ATOM   5128  N  N    . TYR A 1 49  ? -2.896  -10.788 3.591   1.00 0.00 ? 204 TYR A N    3  
ATOM   5129  C  CA   . TYR A 1 49  ? -1.433  -10.865 3.941   1.00 0.00 ? 204 TYR A CA   3  
ATOM   5130  C  C    . TYR A 1 49  ? -1.244  -11.834 5.120   1.00 0.00 ? 204 TYR A C    3  
ATOM   5131  O  O    . TYR A 1 49  ? -0.279  -12.572 5.166   1.00 0.00 ? 204 TYR A O    3  
ATOM   5132  C  CB   . TYR A 1 49  ? -0.987  -9.444  4.335   1.00 0.00 ? 204 TYR A CB   3  
ATOM   5133  C  CG   . TYR A 1 49  ? 0.475   -9.249  4.005   1.00 0.00 ? 204 TYR A CG   3  
ATOM   5134  C  CD1  . TYR A 1 49  ? 0.957   -9.562  2.728   1.00 0.00 ? 204 TYR A CD1  3  
ATOM   5135  C  CD2  . TYR A 1 49  ? 1.348   -8.743  4.976   1.00 0.00 ? 204 TYR A CD2  3  
ATOM   5136  C  CE1  . TYR A 1 49  ? 2.310   -9.375  2.423   1.00 0.00 ? 204 TYR A CE1  3  
ATOM   5137  C  CE2  . TYR A 1 49  ? 2.701   -8.554  4.671   1.00 0.00 ? 204 TYR A CE2  3  
ATOM   5138  C  CZ   . TYR A 1 49  ? 3.182   -8.870  3.395   1.00 0.00 ? 204 TYR A CZ   3  
ATOM   5139  O  OH   . TYR A 1 49  ? 4.515   -8.683  3.095   1.00 0.00 ? 204 TYR A OH   3  
ATOM   5140  H  H    . TYR A 1 49  ? -3.403  -9.950  3.739   1.00 0.00 ? 204 TYR A H    3  
ATOM   5141  H  HA   . TYR A 1 49  ? -0.869  -11.207 3.087   1.00 0.00 ? 204 TYR A HA   3  
ATOM   5142  H  HB2  . TYR A 1 49  ? -1.572  -8.721  3.790   1.00 0.00 ? 204 TYR A HB2  3  
ATOM   5143  H  HB3  . TYR A 1 49  ? -1.138  -9.302  5.394   1.00 0.00 ? 204 TYR A HB3  3  
ATOM   5144  H  HD1  . TYR A 1 49  ? 0.284   -9.952  1.979   1.00 0.00 ? 204 TYR A HD1  3  
ATOM   5145  H  HD2  . TYR A 1 49  ? 0.977   -8.500  5.961   1.00 0.00 ? 204 TYR A HD2  3  
ATOM   5146  H  HE1  . TYR A 1 49  ? 2.679   -9.620  1.438   1.00 0.00 ? 204 TYR A HE1  3  
ATOM   5147  H  HE2  . TYR A 1 49  ? 3.373   -8.162  5.421   1.00 0.00 ? 204 TYR A HE2  3  
ATOM   5148  H  HH   . TYR A 1 49  ? 4.972   -9.515  3.241   1.00 0.00 ? 204 TYR A HH   3  
ATOM   5149  N  N    . MET A 1 50  ? -2.167  -11.853 6.067   1.00 0.00 ? 205 MET A N    3  
ATOM   5150  C  CA   . MET A 1 50  ? -2.026  -12.801 7.223   1.00 0.00 ? 205 MET A CA   3  
ATOM   5151  C  C    . MET A 1 50  ? -2.672  -14.155 6.871   1.00 0.00 ? 205 MET A C    3  
ATOM   5152  O  O    . MET A 1 50  ? -2.160  -15.199 7.229   1.00 0.00 ? 205 MET A O    3  
ATOM   5153  C  CB   . MET A 1 50  ? -2.716  -12.132 8.436   1.00 0.00 ? 205 MET A CB   3  
ATOM   5154  C  CG   . MET A 1 50  ? -4.246  -12.126 8.274   1.00 0.00 ? 205 MET A CG   3  
ATOM   5155  S  SD   . MET A 1 50  ? -5.006  -11.461 9.776   1.00 0.00 ? 205 MET A SD   3  
ATOM   5156  C  CE   . MET A 1 50  ? -4.389  -12.720 10.920  1.00 0.00 ? 205 MET A CE   3  
ATOM   5157  H  H    . MET A 1 50  ? -2.950  -11.260 6.007   1.00 0.00 ? 205 MET A H    3  
ATOM   5158  H  HA   . MET A 1 50  ? -0.983  -12.950 7.439   1.00 0.00 ? 205 MET A HA   3  
ATOM   5159  H  HB2  . MET A 1 50  ? -2.458  -12.675 9.333   1.00 0.00 ? 205 MET A HB2  3  
ATOM   5160  H  HB3  . MET A 1 50  ? -2.366  -11.115 8.525   1.00 0.00 ? 205 MET A HB3  3  
ATOM   5161  H  HG2  . MET A 1 50  ? -4.520  -11.513 7.431   1.00 0.00 ? 205 MET A HG2  3  
ATOM   5162  H  HG3  . MET A 1 50  ? -4.593  -13.136 8.112   1.00 0.00 ? 205 MET A HG3  3  
ATOM   5163  H  HE1  . MET A 1 50  ? -3.353  -12.518 11.151  1.00 0.00 ? 205 MET A HE1  3  
ATOM   5164  H  HE2  . MET A 1 50  ? -4.471  -13.694 10.464  1.00 0.00 ? 205 MET A HE2  3  
ATOM   5165  H  HE3  . MET A 1 50  ? -4.977  -12.699 11.827  1.00 0.00 ? 205 MET A HE3  3  
ATOM   5166  N  N    . SER A 1 51  ? -3.787  -14.151 6.161   1.00 0.00 ? 206 SER A N    3  
ATOM   5167  C  CA   . SER A 1 51  ? -4.442  -15.459 5.786   1.00 0.00 ? 206 SER A CA   3  
ATOM   5168  C  C    . SER A 1 51  ? -3.451  -16.337 5.009   1.00 0.00 ? 206 SER A C    3  
ATOM   5169  O  O    . SER A 1 51  ? -3.379  -17.534 5.218   1.00 0.00 ? 206 SER A O    3  
ATOM   5170  C  CB   . SER A 1 51  ? -5.647  -15.116 4.896   1.00 0.00 ? 206 SER A CB   3  
ATOM   5171  O  OG   . SER A 1 51  ? -6.216  -16.318 4.393   1.00 0.00 ? 206 SER A OG   3  
ATOM   5172  H  H    . SER A 1 51  ? -4.183  -13.293 5.876   1.00 0.00 ? 206 SER A H    3  
ATOM   5173  H  HA   . SER A 1 51  ? -4.775  -15.970 6.668   1.00 0.00 ? 206 SER A HA   3  
ATOM   5174  H  HB2  . SER A 1 51  ? -6.387  -14.588 5.474   1.00 0.00 ? 206 SER A HB2  3  
ATOM   5175  H  HB3  . SER A 1 51  ? -5.320  -14.489 4.076   1.00 0.00 ? 206 SER A HB3  3  
ATOM   5176  H  HG   . SER A 1 51  ? -6.742  -16.713 5.093   1.00 0.00 ? 206 SER A HG   3  
ATOM   5177  N  N    . ASP A 1 52  ? -2.677  -15.750 4.122   1.00 0.00 ? 207 ASP A N    3  
ATOM   5178  C  CA   . ASP A 1 52  ? -1.686  -16.548 3.343   1.00 0.00 ? 207 ASP A CA   3  
ATOM   5179  C  C    . ASP A 1 52  ? -0.262  -16.074 3.674   1.00 0.00 ? 207 ASP A C    3  
ATOM   5180  O  O    . ASP A 1 52  ? -0.025  -14.892 3.836   1.00 0.00 ? 207 ASP A O    3  
ATOM   5181  C  CB   . ASP A 1 52  ? -2.017  -16.272 1.875   1.00 0.00 ? 207 ASP A CB   3  
ATOM   5182  C  CG   . ASP A 1 52  ? -3.328  -16.969 1.507   1.00 0.00 ? 207 ASP A CG   3  
ATOM   5183  O  OD1  . ASP A 1 52  ? -4.245  -16.923 2.310   1.00 0.00 ? 207 ASP A OD1  3  
ATOM   5184  O  OD2  . ASP A 1 52  ? -3.392  -17.536 0.429   1.00 0.00 ? 207 ASP A OD2  3  
ATOM   5185  H  H    . ASP A 1 52  ? -2.743  -14.782 3.971   1.00 0.00 ? 207 ASP A H    3  
ATOM   5186  H  HA   . ASP A 1 52  ? -1.795  -17.600 3.555   1.00 0.00 ? 207 ASP A HA   3  
ATOM   5187  H  HB2  . ASP A 1 52  ? -2.119  -15.207 1.724   1.00 0.00 ? 207 ASP A HB2  3  
ATOM   5188  H  HB3  . ASP A 1 52  ? -1.223  -16.651 1.249   1.00 0.00 ? 207 ASP A HB3  3  
ATOM   5189  N  N    . ASP A 1 53  ? 0.687   -16.981 3.779   1.00 0.00 ? 208 ASP A N    3  
ATOM   5190  C  CA   . ASP A 1 53  ? 2.087   -16.562 4.103   1.00 0.00 ? 208 ASP A CA   3  
ATOM   5191  C  C    . ASP A 1 53  ? 2.998   -16.775 2.888   1.00 0.00 ? 208 ASP A C    3  
ATOM   5192  O  O    . ASP A 1 53  ? 2.746   -17.636 2.064   1.00 0.00 ? 208 ASP A O    3  
ATOM   5193  C  CB   . ASP A 1 53  ? 2.522   -17.460 5.264   1.00 0.00 ? 208 ASP A CB   3  
ATOM   5194  C  CG   . ASP A 1 53  ? 1.885   -16.958 6.563   1.00 0.00 ? 208 ASP A CG   3  
ATOM   5195  O  OD1  . ASP A 1 53  ? 0.722   -16.591 6.526   1.00 0.00 ? 208 ASP A OD1  3  
ATOM   5196  O  OD2  . ASP A 1 53  ? 2.572   -16.950 7.571   1.00 0.00 ? 208 ASP A OD2  3  
ATOM   5197  H  H    . ASP A 1 53  ? 0.483   -17.935 3.644   1.00 0.00 ? 208 ASP A H    3  
ATOM   5198  H  HA   . ASP A 1 53  ? 2.111   -15.528 4.408   1.00 0.00 ? 208 ASP A HA   3  
ATOM   5199  H  HB2  . ASP A 1 53  ? 2.202   -18.474 5.075   1.00 0.00 ? 208 ASP A HB2  3  
ATOM   5200  H  HB3  . ASP A 1 53  ? 3.596   -17.432 5.360   1.00 0.00 ? 208 ASP A HB3  3  
ATOM   5201  N  N    . ILE A 1 54  ? 4.058   -16.002 2.768   1.00 0.00 ? 209 ILE A N    3  
ATOM   5202  C  CA   . ILE A 1 54  ? 4.979   -16.178 1.599   1.00 0.00 ? 209 ILE A CA   3  
ATOM   5203  C  C    . ILE A 1 54  ? 6.203   -17.004 2.014   1.00 0.00 ? 209 ILE A C    3  
ATOM   5204  O  O    . ILE A 1 54  ? 6.943   -16.621 2.902   1.00 0.00 ? 209 ILE A O    3  
ATOM   5205  C  CB   . ILE A 1 54  ? 5.398   -14.764 1.168   1.00 0.00 ? 209 ILE A CB   3  
ATOM   5206  C  CG1  . ILE A 1 54  ? 4.151   -13.943 0.801   1.00 0.00 ? 209 ILE A CG1  3  
ATOM   5207  C  CG2  . ILE A 1 54  ? 6.333   -14.848 -0.046  1.00 0.00 ? 209 ILE A CG2  3  
ATOM   5208  C  CD1  . ILE A 1 54  ? 3.373   -14.626 -0.335  1.00 0.00 ? 209 ILE A CD1  3  
ATOM   5209  H  H    . ILE A 1 54  ? 4.249   -15.314 3.448   1.00 0.00 ? 209 ILE A H    3  
ATOM   5210  H  HA   . ILE A 1 54  ? 4.461   -16.669 0.790   1.00 0.00 ? 209 ILE A HA   3  
ATOM   5211  H  HB   . ILE A 1 54  ? 5.918   -14.283 1.984   1.00 0.00 ? 209 ILE A HB   3  
ATOM   5212  H  HG12 . ILE A 1 54  ? 3.513   -13.857 1.668   1.00 0.00 ? 209 ILE A HG12 3  
ATOM   5213  H  HG13 . ILE A 1 54  ? 4.454   -12.957 0.482   1.00 0.00 ? 209 ILE A HG13 3  
ATOM   5214  H  HG21 . ILE A 1 54  ? 6.340   -13.899 -0.561  1.00 0.00 ? 209 ILE A HG21 3  
ATOM   5215  H  HG22 . ILE A 1 54  ? 5.985   -15.620 -0.717  1.00 0.00 ? 209 ILE A HG22 3  
ATOM   5216  H  HG23 . ILE A 1 54  ? 7.333   -15.085 0.286   1.00 0.00 ? 209 ILE A HG23 3  
ATOM   5217  H  HD11 . ILE A 1 54  ? 3.942   -15.468 -0.709  1.00 0.00 ? 209 ILE A HD11 3  
ATOM   5218  H  HD12 . ILE A 1 54  ? 3.209   -13.917 -1.134  1.00 0.00 ? 209 ILE A HD12 3  
ATOM   5219  H  HD13 . ILE A 1 54  ? 2.422   -14.971 0.040   1.00 0.00 ? 209 ILE A HD13 3  
ATOM   5220  N  N    . SER A 1 55  ? 6.423   -18.139 1.383   1.00 0.00 ? 210 SER A N    3  
ATOM   5221  C  CA   . SER A 1 55  ? 7.605   -18.986 1.753   1.00 0.00 ? 210 SER A CA   3  
ATOM   5222  C  C    . SER A 1 55  ? 7.804   -20.130 0.742   1.00 0.00 ? 210 SER A C    3  
ATOM   5223  O  O    . SER A 1 55  ? 7.030   -21.066 0.703   1.00 0.00 ? 210 SER A O    3  
ATOM   5224  C  CB   . SER A 1 55  ? 7.271   -19.554 3.132   1.00 0.00 ? 210 SER A CB   3  
ATOM   5225  O  OG   . SER A 1 55  ? 8.353   -20.357 3.585   1.00 0.00 ? 210 SER A OG   3  
ATOM   5226  H  H    . SER A 1 55  ? 5.811   -18.432 0.666   1.00 0.00 ? 210 SER A H    3  
ATOM   5227  H  HA   . SER A 1 55  ? 8.496   -18.380 1.814   1.00 0.00 ? 210 SER A HA   3  
ATOM   5228  H  HB2  . SER A 1 55  ? 7.113   -18.747 3.829   1.00 0.00 ? 210 SER A HB2  3  
ATOM   5229  H  HB3  . SER A 1 55  ? 6.370   -20.151 3.066   1.00 0.00 ? 210 SER A HB3  3  
ATOM   5230  H  HG   . SER A 1 55  ? 8.291   -21.212 3.150   1.00 0.00 ? 210 SER A HG   3  
ATOM   5231  N  N    . ARG A 1 56  ? 8.840   -20.066 -0.077  1.00 0.00 ? 211 ARG A N    3  
ATOM   5232  C  CA   . ARG A 1 56  ? 9.086   -21.155 -1.080  1.00 0.00 ? 211 ARG A CA   3  
ATOM   5233  C  C    . ARG A 1 56  ? 7.826   -21.419 -1.926  1.00 0.00 ? 211 ARG A C    3  
ATOM   5234  O  O    . ARG A 1 56  ? 7.119   -22.383 -1.699  1.00 0.00 ? 211 ARG A O    3  
ATOM   5235  C  CB   . ARG A 1 56  ? 9.447   -22.392 -0.251  1.00 0.00 ? 211 ARG A CB   3  
ATOM   5236  C  CG   . ARG A 1 56  ? 10.716  -22.115 0.560   1.00 0.00 ? 211 ARG A CG   3  
ATOM   5237  C  CD   . ARG A 1 56  ? 10.613  -22.801 1.924   1.00 0.00 ? 211 ARG A CD   3  
ATOM   5238  N  NE   . ARG A 1 56  ? 11.978  -23.336 2.193   1.00 0.00 ? 211 ARG A NE   3  
ATOM   5239  C  CZ   . ARG A 1 56  ? 12.141  -24.604 2.453   1.00 0.00 ? 211 ARG A CZ   3  
ATOM   5240  N  NH1  . ARG A 1 56  ? 11.894  -25.496 1.533   1.00 0.00 ? 211 ARG A NH1  3  
ATOM   5241  N  NH2  . ARG A 1 56  ? 12.553  -24.979 3.633   1.00 0.00 ? 211 ARG A NH2  3  
ATOM   5242  H  H    . ARG A 1 56  ? 9.459   -19.304 -0.033  1.00 0.00 ? 211 ARG A H    3  
ATOM   5243  H  HA   . ARG A 1 56  ? 9.915   -20.891 -1.717  1.00 0.00 ? 211 ARG A HA   3  
ATOM   5244  H  HB2  . ARG A 1 56  ? 8.632   -22.624 0.420   1.00 0.00 ? 211 ARG A HB2  3  
ATOM   5245  H  HB3  . ARG A 1 56  ? 9.620   -23.230 -0.910  1.00 0.00 ? 211 ARG A HB3  3  
ATOM   5246  H  HG2  . ARG A 1 56  ? 11.574  -22.498 0.027   1.00 0.00 ? 211 ARG A HG2  3  
ATOM   5247  H  HG3  . ARG A 1 56  ? 10.827  -21.050 0.703   1.00 0.00 ? 211 ARG A HG3  3  
ATOM   5248  H  HD2  . ARG A 1 56  ? 10.331  -22.085 2.684   1.00 0.00 ? 211 ARG A HD2  3  
ATOM   5249  H  HD3  . ARG A 1 56  ? 9.900   -23.610 1.885   1.00 0.00 ? 211 ARG A HD3  3  
ATOM   5250  H  HE   . ARG A 1 56  ? 12.751  -22.736 2.173   1.00 0.00 ? 211 ARG A HE   3  
ATOM   5251  H  HH11 . ARG A 1 56  ? 11.579  -25.208 0.629   1.00 0.00 ? 211 ARG A HH11 3  
ATOM   5252  H  HH12 . ARG A 1 56  ? 12.020  -26.468 1.733   1.00 0.00 ? 211 ARG A HH12 3  
ATOM   5253  H  HH21 . ARG A 1 56  ? 12.742  -24.296 4.337   1.00 0.00 ? 211 ARG A HH21 3  
ATOM   5254  H  HH22 . ARG A 1 56  ? 12.678  -25.951 3.833   1.00 0.00 ? 211 ARG A HH22 3  
ATOM   5255  N  N    . ASP A 1 57  ? 7.537   -20.575 -2.898  1.00 0.00 ? 212 ASP A N    3  
ATOM   5256  C  CA   . ASP A 1 57  ? 6.324   -20.797 -3.743  1.00 0.00 ? 212 ASP A CA   3  
ATOM   5257  C  C    . ASP A 1 57  ? 6.732   -21.125 -5.189  1.00 0.00 ? 212 ASP A C    3  
ATOM   5258  O  O    . ASP A 1 57  ? 7.813   -20.786 -5.617  1.00 0.00 ? 212 ASP A O    3  
ATOM   5259  C  CB   . ASP A 1 57  ? 5.549   -19.478 -3.690  1.00 0.00 ? 212 ASP A CB   3  
ATOM   5260  C  CG   . ASP A 1 57  ? 4.749   -19.407 -2.389  1.00 0.00 ? 212 ASP A CG   3  
ATOM   5261  O  OD1  . ASP A 1 57  ? 3.828   -20.192 -2.240  1.00 0.00 ? 212 ASP A OD1  3  
ATOM   5262  O  OD2  . ASP A 1 57  ? 5.071   -18.568 -1.564  1.00 0.00 ? 212 ASP A OD2  3  
ATOM   5263  H  H    . ASP A 1 57  ? 8.117   -19.798 -3.073  1.00 0.00 ? 212 ASP A H    3  
ATOM   5264  H  HA   . ASP A 1 57  ? 5.721   -21.592 -3.333  1.00 0.00 ? 212 ASP A HA   3  
ATOM   5265  H  HB2  . ASP A 1 57  ? 6.244   -18.652 -3.732  1.00 0.00 ? 212 ASP A HB2  3  
ATOM   5266  H  HB3  . ASP A 1 57  ? 4.873   -19.423 -4.530  1.00 0.00 ? 212 ASP A HB3  3  
ATOM   5267  N  N    . SER A 1 58  ? 5.866   -21.780 -5.946  1.00 0.00 ? 213 SER A N    3  
ATOM   5268  C  CA   . SER A 1 58  ? 6.186   -22.138 -7.372  1.00 0.00 ? 213 SER A CA   3  
ATOM   5269  C  C    . SER A 1 58  ? 7.417   -23.066 -7.452  1.00 0.00 ? 213 SER A C    3  
ATOM   5270  O  O    . SER A 1 58  ? 7.277   -24.250 -7.694  1.00 0.00 ? 213 SER A O    3  
ATOM   5271  C  CB   . SER A 1 58  ? 6.433   -20.812 -8.111  1.00 0.00 ? 213 SER A CB   3  
ATOM   5272  O  OG   . SER A 1 58  ? 7.486   -20.983 -9.052  1.00 0.00 ? 213 SER A OG   3  
ATOM   5273  H  H    . SER A 1 58  ? 4.992   -22.040 -5.578  1.00 0.00 ? 213 SER A H    3  
ATOM   5274  H  HA   . SER A 1 58  ? 5.336   -22.637 -7.814  1.00 0.00 ? 213 SER A HA   3  
ATOM   5275  H  HB2  . SER A 1 58  ? 5.538   -20.520 -8.635  1.00 0.00 ? 213 SER A HB2  3  
ATOM   5276  H  HB3  . SER A 1 58  ? 6.695   -20.040 -7.401  1.00 0.00 ? 213 SER A HB3  3  
ATOM   5277  H  HG   . SER A 1 58  ? 7.412   -20.289 -9.711  1.00 0.00 ? 213 SER A HG   3  
ATOM   5278  N  N    . ASP A 1 59  ? 8.616   -22.553 -7.256  1.00 0.00 ? 214 ASP A N    3  
ATOM   5279  C  CA   . ASP A 1 59  ? 9.828   -23.430 -7.329  1.00 0.00 ? 214 ASP A CA   3  
ATOM   5280  C  C    . ASP A 1 59  ? 10.473  -23.564 -5.942  1.00 0.00 ? 214 ASP A C    3  
ATOM   5281  O  O    . ASP A 1 59  ? 11.684  -23.555 -5.818  1.00 0.00 ? 214 ASP A O    3  
ATOM   5282  C  CB   . ASP A 1 59  ? 10.782  -22.717 -8.289  1.00 0.00 ? 214 ASP A CB   3  
ATOM   5283  C  CG   . ASP A 1 59  ? 11.824  -23.711 -8.806  1.00 0.00 ? 214 ASP A CG   3  
ATOM   5284  O  OD1  . ASP A 1 59  ? 11.449  -24.837 -9.089  1.00 0.00 ? 214 ASP A OD1  3  
ATOM   5285  O  OD2  . ASP A 1 59  ? 12.977  -23.328 -8.911  1.00 0.00 ? 214 ASP A OD2  3  
ATOM   5286  H  H    . ASP A 1 59  ? 8.722   -21.596 -7.058  1.00 0.00 ? 214 ASP A H    3  
ATOM   5287  H  HA   . ASP A 1 59  ? 9.568   -24.401 -7.720  1.00 0.00 ? 214 ASP A HA   3  
ATOM   5288  H  HB2  . ASP A 1 59  ? 10.221  -22.314 -9.119  1.00 0.00 ? 214 ASP A HB2  3  
ATOM   5289  H  HB3  . ASP A 1 59  ? 11.281  -21.914 -7.766  1.00 0.00 ? 214 ASP A HB3  3  
ATOM   5290  N  N    . GLY A 1 60  ? 9.682   -23.681 -4.895  1.00 0.00 ? 215 GLY A N    3  
ATOM   5291  C  CA   . GLY A 1 60  ? 10.263  -23.807 -3.523  1.00 0.00 ? 215 GLY A CA   3  
ATOM   5292  C  C    . GLY A 1 60  ? 11.181  -22.607 -3.214  1.00 0.00 ? 215 GLY A C    3  
ATOM   5293  O  O    . GLY A 1 60  ? 12.138  -22.739 -2.473  1.00 0.00 ? 215 GLY A O    3  
ATOM   5294  H  H    . GLY A 1 60  ? 8.705   -23.683 -5.007  1.00 0.00 ? 215 GLY A H    3  
ATOM   5295  H  HA2  . GLY A 1 60  ? 9.462   -23.841 -2.799  1.00 0.00 ? 215 GLY A HA2  3  
ATOM   5296  H  HA3  . GLY A 1 60  ? 10.839  -24.718 -3.462  1.00 0.00 ? 215 GLY A HA3  3  
ATOM   5297  N  N    . MET A 1 61  ? 10.904  -21.438 -3.766  1.00 0.00 ? 216 MET A N    3  
ATOM   5298  C  CA   . MET A 1 61  ? 11.771  -20.256 -3.482  1.00 0.00 ? 216 MET A CA   3  
ATOM   5299  C  C    . MET A 1 61  ? 10.901  -19.039 -3.128  1.00 0.00 ? 216 MET A C    3  
ATOM   5300  O  O    . MET A 1 61  ? 9.689   -19.137 -3.080  1.00 0.00 ? 216 MET A O    3  
ATOM   5301  C  CB   . MET A 1 61  ? 12.540  -20.006 -4.781  1.00 0.00 ? 216 MET A CB   3  
ATOM   5302  C  CG   . MET A 1 61  ? 13.866  -20.769 -4.743  1.00 0.00 ? 216 MET A CG   3  
ATOM   5303  S  SD   . MET A 1 61  ? 15.007  -20.055 -5.954  1.00 0.00 ? 216 MET A SD   3  
ATOM   5304  C  CE   . MET A 1 61  ? 15.713  -18.783 -4.878  1.00 0.00 ? 216 MET A CE   3  
ATOM   5305  H  H    . MET A 1 61  ? 10.130  -21.334 -4.359  1.00 0.00 ? 216 MET A H    3  
ATOM   5306  H  HA   . MET A 1 61  ? 12.459  -20.474 -2.681  1.00 0.00 ? 216 MET A HA   3  
ATOM   5307  H  HB2  . MET A 1 61  ? 11.951  -20.350 -5.619  1.00 0.00 ? 216 MET A HB2  3  
ATOM   5308  H  HB3  . MET A 1 61  ? 12.736  -18.951 -4.887  1.00 0.00 ? 216 MET A HB3  3  
ATOM   5309  H  HG2  . MET A 1 61  ? 14.296  -20.693 -3.755  1.00 0.00 ? 216 MET A HG2  3  
ATOM   5310  H  HG3  . MET A 1 61  ? 13.692  -21.807 -4.982  1.00 0.00 ? 216 MET A HG3  3  
ATOM   5311  H  HE1  . MET A 1 61  ? 16.489  -19.221 -4.265  1.00 0.00 ? 216 MET A HE1  3  
ATOM   5312  H  HE2  . MET A 1 61  ? 14.943  -18.378 -4.242  1.00 0.00 ? 216 MET A HE2  3  
ATOM   5313  H  HE3  . MET A 1 61  ? 16.130  -17.991 -5.485  1.00 0.00 ? 216 MET A HE3  3  
ATOM   5314  N  N    . ASP A 1 62  ? 11.501  -17.889 -2.889  1.00 0.00 ? 217 ASP A N    3  
ATOM   5315  C  CA   . ASP A 1 62  ? 10.679  -16.679 -2.547  1.00 0.00 ? 217 ASP A CA   3  
ATOM   5316  C  C    . ASP A 1 62  ? 10.377  -15.879 -3.822  1.00 0.00 ? 217 ASP A C    3  
ATOM   5317  O  O    . ASP A 1 62  ? 11.265  -15.287 -4.409  1.00 0.00 ? 217 ASP A O    3  
ATOM   5318  C  CB   . ASP A 1 62  ? 11.528  -15.845 -1.577  1.00 0.00 ? 217 ASP A CB   3  
ATOM   5319  C  CG   . ASP A 1 62  ? 10.620  -15.207 -0.524  1.00 0.00 ? 217 ASP A CG   3  
ATOM   5320  O  OD1  . ASP A 1 62  ? 10.129  -14.118 -0.773  1.00 0.00 ? 217 ASP A OD1  3  
ATOM   5321  O  OD2  . ASP A 1 62  ? 10.431  -15.818 0.516   1.00 0.00 ? 217 ASP A OD2  3  
ATOM   5322  H  H    . ASP A 1 62  ? 12.484  -17.822 -2.943  1.00 0.00 ? 217 ASP A H    3  
ATOM   5323  H  HA   . ASP A 1 62  ? 9.760   -16.976 -2.069  1.00 0.00 ? 217 ASP A HA   3  
ATOM   5324  H  HB2  . ASP A 1 62  ? 12.252  -16.484 -1.091  1.00 0.00 ? 217 ASP A HB2  3  
ATOM   5325  H  HB3  . ASP A 1 62  ? 12.042  -15.068 -2.124  1.00 0.00 ? 217 ASP A HB3  3  
ATOM   5326  N  N    . GLU A 1 63  ? 9.135   -15.858 -4.264  1.00 0.00 ? 218 GLU A N    3  
ATOM   5327  C  CA   . GLU A 1 63  ? 8.797   -15.098 -5.505  1.00 0.00 ? 218 GLU A CA   3  
ATOM   5328  C  C    . GLU A 1 63  ? 7.386   -14.495 -5.399  1.00 0.00 ? 218 GLU A C    3  
ATOM   5329  O  O    . GLU A 1 63  ? 6.559   -14.691 -6.270  1.00 0.00 ? 218 GLU A O    3  
ATOM   5330  C  CB   . GLU A 1 63  ? 8.857   -16.133 -6.630  1.00 0.00 ? 218 GLU A CB   3  
ATOM   5331  C  CG   . GLU A 1 63  ? 9.207   -15.437 -7.947  1.00 0.00 ? 218 GLU A CG   3  
ATOM   5332  C  CD   . GLU A 1 63  ? 8.978   -16.404 -9.112  1.00 0.00 ? 218 GLU A CD   3  
ATOM   5333  O  OE1  . GLU A 1 63  ? 7.875   -16.910 -9.227  1.00 0.00 ? 218 GLU A OE1  3  
ATOM   5334  O  OE2  . GLU A 1 63  ? 9.912   -16.621 -9.866  1.00 0.00 ? 218 GLU A OE2  3  
ATOM   5335  H  H    . GLU A 1 63  ? 8.426   -16.345 -3.782  1.00 0.00 ? 218 GLU A H    3  
ATOM   5336  H  HA   . GLU A 1 63  ? 9.525   -14.321 -5.681  1.00 0.00 ? 218 GLU A HA   3  
ATOM   5337  H  HB2  . GLU A 1 63  ? 9.613   -16.870 -6.399  1.00 0.00 ? 218 GLU A HB2  3  
ATOM   5338  H  HB3  . GLU A 1 63  ? 7.897   -16.618 -6.725  1.00 0.00 ? 218 GLU A HB3  3  
ATOM   5339  H  HG2  . GLU A 1 63  ? 8.579   -14.566 -8.072  1.00 0.00 ? 218 GLU A HG2  3  
ATOM   5340  H  HG3  . GLU A 1 63  ? 10.243  -15.135 -7.930  1.00 0.00 ? 218 GLU A HG3  3  
ATOM   5341  N  N    . GLN A 1 64  ? 7.102   -13.762 -4.341  1.00 0.00 ? 219 GLN A N    3  
ATOM   5342  C  CA   . GLN A 1 64  ? 5.744   -13.156 -4.196  1.00 0.00 ? 219 GLN A CA   3  
ATOM   5343  C  C    . GLN A 1 64  ? 5.863   -11.653 -3.890  1.00 0.00 ? 219 GLN A C    3  
ATOM   5344  O  O    . GLN A 1 64  ? 6.870   -11.200 -3.381  1.00 0.00 ? 219 GLN A O    3  
ATOM   5345  C  CB   . GLN A 1 64  ? 5.102   -13.897 -3.021  1.00 0.00 ? 219 GLN A CB   3  
ATOM   5346  C  CG   . GLN A 1 64  ? 4.106   -14.934 -3.548  1.00 0.00 ? 219 GLN A CG   3  
ATOM   5347  C  CD   . GLN A 1 64  ? 4.872   -16.099 -4.186  1.00 0.00 ? 219 GLN A CD   3  
ATOM   5348  O  OE1  . GLN A 1 64  ? 5.968   -16.418 -3.768  1.00 0.00 ? 219 GLN A OE1  3  
ATOM   5349  N  NE2  . GLN A 1 64  ? 4.343   -16.759 -5.189  1.00 0.00 ? 219 GLN A NE2  3  
ATOM   5350  H  H    . GLN A 1 64  ? 7.778   -13.610 -3.644  1.00 0.00 ? 219 GLN A H    3  
ATOM   5351  H  HA   . GLN A 1 64  ? 5.167   -13.311 -5.093  1.00 0.00 ? 219 GLN A HA   3  
ATOM   5352  H  HB2  . GLN A 1 64  ? 5.869   -14.394 -2.448  1.00 0.00 ? 219 GLN A HB2  3  
ATOM   5353  H  HB3  . GLN A 1 64  ? 4.582   -13.190 -2.391  1.00 0.00 ? 219 GLN A HB3  3  
ATOM   5354  H  HG2  . GLN A 1 64  ? 3.503   -15.302 -2.732  1.00 0.00 ? 219 GLN A HG2  3  
ATOM   5355  H  HG3  . GLN A 1 64  ? 3.469   -14.477 -4.290  1.00 0.00 ? 219 GLN A HG3  3  
ATOM   5356  H  HE21 . GLN A 1 64  ? 3.458   -16.511 -5.535  1.00 0.00 ? 219 GLN A HE21 3  
ATOM   5357  H  HE22 . GLN A 1 64  ? 4.835   -17.503 -5.595  1.00 0.00 ? 219 GLN A HE22 3  
ATOM   5358  N  N    . CYS A 1 65  ? 4.845   -10.877 -4.202  1.00 0.00 ? 220 CYS A N    3  
ATOM   5359  C  CA   . CYS A 1 65  ? 4.917   -9.390  -3.928  1.00 0.00 ? 220 CYS A CA   3  
ATOM   5360  C  C    . CYS A 1 65  ? 5.028   -9.117  -2.421  1.00 0.00 ? 220 CYS A C    3  
ATOM   5361  O  O    . CYS A 1 65  ? 4.577   -9.906  -1.612  1.00 0.00 ? 220 CYS A O    3  
ATOM   5362  C  CB   . CYS A 1 65  ? 3.598   -8.800  -4.437  1.00 0.00 ? 220 CYS A CB   3  
ATOM   5363  S  SG   . CYS A 1 65  ? 3.649   -6.995  -4.351  1.00 0.00 ? 220 CYS A SG   3  
ATOM   5364  H  H    . CYS A 1 65  ? 4.035   -11.271 -4.620  1.00 0.00 ? 220 CYS A H    3  
ATOM   5365  H  HA   . CYS A 1 65  ? 5.746   -8.945  -4.458  1.00 0.00 ? 220 CYS A HA   3  
ATOM   5366  H  HB2  . CYS A 1 65  ? 3.432   -9.108  -5.457  1.00 0.00 ? 220 CYS A HB2  3  
ATOM   5367  H  HB3  . CYS A 1 65  ? 2.792   -9.158  -3.819  1.00 0.00 ? 220 CYS A HB3  3  
ATOM   5368  N  N    . ARG A 1 66  ? 5.582   -7.982  -2.035  1.00 0.00 ? 221 ARG A N    3  
ATOM   5369  C  CA   . ARG A 1 66  ? 5.664   -7.648  -0.578  1.00 0.00 ? 221 ARG A CA   3  
ATOM   5370  C  C    . ARG A 1 66  ? 4.582   -6.602  -0.231  1.00 0.00 ? 221 ARG A C    3  
ATOM   5371  O  O    . ARG A 1 66  ? 4.796   -5.732  0.592   1.00 0.00 ? 221 ARG A O    3  
ATOM   5372  C  CB   . ARG A 1 66  ? 7.069   -7.071  -0.358  1.00 0.00 ? 221 ARG A CB   3  
ATOM   5373  C  CG   . ARG A 1 66  ? 7.944   -8.101  0.362   1.00 0.00 ? 221 ARG A CG   3  
ATOM   5374  C  CD   . ARG A 1 66  ? 7.478   -8.247  1.816   1.00 0.00 ? 221 ARG A CD   3  
ATOM   5375  N  NE   . ARG A 1 66  ? 7.361   -9.715  2.042   1.00 0.00 ? 221 ARG A NE   3  
ATOM   5376  C  CZ   . ARG A 1 66  ? 7.992   -10.275 3.037   1.00 0.00 ? 221 ARG A CZ   3  
ATOM   5377  N  NH1  . ARG A 1 66  ? 9.224   -9.938  3.303   1.00 0.00 ? 221 ARG A NH1  3  
ATOM   5378  N  NH2  . ARG A 1 66  ? 7.389   -11.171 3.770   1.00 0.00 ? 221 ARG A NH2  3  
ATOM   5379  H  H    . ARG A 1 66  ? 5.914   -7.338  -2.701  1.00 0.00 ? 221 ARG A H    3  
ATOM   5380  H  HA   . ARG A 1 66  ? 5.528   -8.538  0.019   1.00 0.00 ? 221 ARG A HA   3  
ATOM   5381  H  HB2  . ARG A 1 66  ? 7.510   -6.829  -1.315  1.00 0.00 ? 221 ARG A HB2  3  
ATOM   5382  H  HB3  . ARG A 1 66  ? 7.000   -6.177  0.242   1.00 0.00 ? 221 ARG A HB3  3  
ATOM   5383  H  HG2  . ARG A 1 66  ? 7.864   -9.053  -0.141  1.00 0.00 ? 221 ARG A HG2  3  
ATOM   5384  H  HG3  . ARG A 1 66  ? 8.972   -7.771  0.347   1.00 0.00 ? 221 ARG A HG3  3  
ATOM   5385  H  HD2  . ARG A 1 66  ? 8.210   -7.819  2.487   1.00 0.00 ? 221 ARG A HD2  3  
ATOM   5386  H  HD3  . ARG A 1 66  ? 6.518   -7.774  1.957   1.00 0.00 ? 221 ARG A HD3  3  
ATOM   5387  H  HE   . ARG A 1 66  ? 6.808   -10.261 1.443   1.00 0.00 ? 221 ARG A HE   3  
ATOM   5388  H  HH11 . ARG A 1 66  ? 9.687   -9.251  2.741   1.00 0.00 ? 221 ARG A HH11 3  
ATOM   5389  H  HH12 . ARG A 1 66  ? 9.707   -10.368 4.066   1.00 0.00 ? 221 ARG A HH12 3  
ATOM   5390  H  HH21 . ARG A 1 66  ? 6.444   -11.429 3.568   1.00 0.00 ? 221 ARG A HH21 3  
ATOM   5391  H  HH22 . ARG A 1 66  ? 7.871   -11.600 4.533   1.00 0.00 ? 221 ARG A HH22 3  
ATOM   5392  N  N    . TRP A 1 67  ? 3.418   -6.680  -0.854  1.00 0.00 ? 222 TRP A N    3  
ATOM   5393  C  CA   . TRP A 1 67  ? 2.324   -5.697  -0.565  1.00 0.00 ? 222 TRP A CA   3  
ATOM   5394  C  C    . TRP A 1 67  ? 0.957   -6.378  -0.772  1.00 0.00 ? 222 TRP A C    3  
ATOM   5395  O  O    . TRP A 1 67  ? 0.164   -6.489  0.141   1.00 0.00 ? 222 TRP A O    3  
ATOM   5396  C  CB   . TRP A 1 67  ? 2.507   -4.571  -1.595  1.00 0.00 ? 222 TRP A CB   3  
ATOM   5397  C  CG   . TRP A 1 67  ? 2.433   -3.240  -0.916  1.00 0.00 ? 222 TRP A CG   3  
ATOM   5398  C  CD1  . TRP A 1 67  ? 1.569   -2.908  0.072   1.00 0.00 ? 222 TRP A CD1  3  
ATOM   5399  C  CD2  . TRP A 1 67  ? 3.238   -2.055  -1.167  1.00 0.00 ? 222 TRP A CD2  3  
ATOM   5400  N  NE1  . TRP A 1 67  ? 1.817   -1.609  0.465   1.00 0.00 ? 222 TRP A NE1  3  
ATOM   5401  C  CE2  . TRP A 1 67  ? 2.833   -1.039  -0.275  1.00 0.00 ? 222 TRP A CE2  3  
ATOM   5402  C  CE3  . TRP A 1 67  ? 4.276   -1.771  -2.068  1.00 0.00 ? 222 TRP A CE3  3  
ATOM   5403  C  CZ2  . TRP A 1 67  ? 3.443   0.214   -0.274  1.00 0.00 ? 222 TRP A CZ2  3  
ATOM   5404  C  CZ3  . TRP A 1 67  ? 4.886   -0.507  -2.074  1.00 0.00 ? 222 TRP A CZ3  3  
ATOM   5405  C  CH2  . TRP A 1 67  ? 4.472   0.481   -1.177  1.00 0.00 ? 222 TRP A CH2  3  
ATOM   5406  H  H    . TRP A 1 67  ? 3.259   -7.389  -1.513  1.00 0.00 ? 222 TRP A H    3  
ATOM   5407  H  HA   . TRP A 1 67  ? 2.416   -5.308  0.439   1.00 0.00 ? 222 TRP A HA   3  
ATOM   5408  H  HB2  . TRP A 1 67  ? 3.470   -4.676  -2.071  1.00 0.00 ? 222 TRP A HB2  3  
ATOM   5409  H  HB3  . TRP A 1 67  ? 1.731   -4.635  -2.345  1.00 0.00 ? 222 TRP A HB3  3  
ATOM   5410  H  HD1  . TRP A 1 67  ? 0.820   -3.560  0.497   1.00 0.00 ? 222 TRP A HD1  3  
ATOM   5411  H  HE1  . TRP A 1 67  ? 1.338   -1.131  1.173   1.00 0.00 ? 222 TRP A HE1  3  
ATOM   5412  H  HE3  . TRP A 1 67  ? 4.598   -2.527  -2.765  1.00 0.00 ? 222 TRP A HE3  3  
ATOM   5413  H  HZ2  . TRP A 1 67  ? 3.131   0.966   0.425   1.00 0.00 ? 222 TRP A HZ2  3  
ATOM   5414  H  HZ3  . TRP A 1 67  ? 5.681   -0.296  -2.770  1.00 0.00 ? 222 TRP A HZ3  3  
ATOM   5415  H  HH2  . TRP A 1 67  ? 4.942   1.453   -1.189  1.00 0.00 ? 222 TRP A HH2  3  
ATOM   5416  N  N    . CYS A 1 68  ? 0.692   -6.843  -1.979  1.00 0.00 ? 223 CYS A N    3  
ATOM   5417  C  CA   . CYS A 1 68  ? -0.613  -7.532  -2.253  1.00 0.00 ? 223 CYS A CA   3  
ATOM   5418  C  C    . CYS A 1 68  ? -0.483  -9.078  -2.157  1.00 0.00 ? 223 CYS A C    3  
ATOM   5419  O  O    . CYS A 1 68  ? -1.467  -9.778  -2.288  1.00 0.00 ? 223 CYS A O    3  
ATOM   5420  C  CB   . CYS A 1 68  ? -1.047  -7.082  -3.669  1.00 0.00 ? 223 CYS A CB   3  
ATOM   5421  S  SG   . CYS A 1 68  ? 0.058   -7.752  -4.952  1.00 0.00 ? 223 CYS A SG   3  
ATOM   5422  H  H    . CYS A 1 68  ? 1.357   -6.750  -2.695  1.00 0.00 ? 223 CYS A H    3  
ATOM   5423  H  HA   . CYS A 1 68  ? -1.348  -7.195  -1.538  1.00 0.00 ? 223 CYS A HA   3  
ATOM   5424  H  HB2  . CYS A 1 68  ? -2.051  -7.429  -3.856  1.00 0.00 ? 223 CYS A HB2  3  
ATOM   5425  H  HB3  . CYS A 1 68  ? -1.032  -6.002  -3.716  1.00 0.00 ? 223 CYS A HB3  3  
ATOM   5426  N  N    . ALA A 1 69  ? 0.707   -9.622  -1.922  1.00 0.00 ? 224 ALA A N    3  
ATOM   5427  C  CA   . ALA A 1 69  ? 0.863   -11.111 -1.814  1.00 0.00 ? 224 ALA A CA   3  
ATOM   5428  C  C    . ALA A 1 69  ? 0.348   -11.809 -3.082  1.00 0.00 ? 224 ALA A C    3  
ATOM   5429  O  O    . ALA A 1 69  ? -0.365  -12.792 -3.011  1.00 0.00 ? 224 ALA A O    3  
ATOM   5430  C  CB   . ALA A 1 69  ? 0.049   -11.533 -0.586  1.00 0.00 ? 224 ALA A CB   3  
ATOM   5431  H  H    . ALA A 1 69  ? 1.498   -9.061  -1.817  1.00 0.00 ? 224 ALA A H    3  
ATOM   5432  H  HA   . ALA A 1 69  ? 1.902   -11.359 -1.659  1.00 0.00 ? 224 ALA A HA   3  
ATOM   5433  H  HB1  . ALA A 1 69  ? 0.186   -12.589 -0.412  1.00 0.00 ? 224 ALA A HB1  3  
ATOM   5434  H  HB2  . ALA A 1 69  ? -0.996  -11.328 -0.756  1.00 0.00 ? 224 ALA A HB2  3  
ATOM   5435  H  HB3  . ALA A 1 69  ? 0.389   -10.981 0.280   1.00 0.00 ? 224 ALA A HB3  3  
ATOM   5436  N  N    . GLU A 1 70  ? 0.723   -11.320 -4.245  1.00 0.00 ? 225 GLU A N    3  
ATOM   5437  C  CA   . GLU A 1 70  ? 0.281   -11.961 -5.517  1.00 0.00 ? 225 GLU A CA   3  
ATOM   5438  C  C    . GLU A 1 70  ? 1.519   -12.464 -6.277  1.00 0.00 ? 225 GLU A C    3  
ATOM   5439  O  O    . GLU A 1 70  ? 2.606   -12.488 -5.729  1.00 0.00 ? 225 GLU A O    3  
ATOM   5440  C  CB   . GLU A 1 70  ? -0.426  -10.851 -6.299  1.00 0.00 ? 225 GLU A CB   3  
ATOM   5441  C  CG   . GLU A 1 70  ? -1.650  -10.375 -5.515  1.00 0.00 ? 225 GLU A CG   3  
ATOM   5442  C  CD   . GLU A 1 70  ? -2.746  -11.439 -5.583  1.00 0.00 ? 225 GLU A CD   3  
ATOM   5443  O  OE1  . GLU A 1 70  ? -3.188  -11.736 -6.680  1.00 0.00 ? 225 GLU A OE1  3  
ATOM   5444  O  OE2  . GLU A 1 70  ? -3.125  -11.938 -4.536  1.00 0.00 ? 225 GLU A OE2  3  
ATOM   5445  H  H    . GLU A 1 70  ? 1.310   -10.537 -4.283  1.00 0.00 ? 225 GLU A H    3  
ATOM   5446  H  HA   . GLU A 1 70  ? -0.400  -12.773 -5.318  1.00 0.00 ? 225 GLU A HA   3  
ATOM   5447  H  HB2  . GLU A 1 70  ? 0.255   -10.025 -6.444  1.00 0.00 ? 225 GLU A HB2  3  
ATOM   5448  H  HB3  . GLU A 1 70  ? -0.742  -11.230 -7.258  1.00 0.00 ? 225 GLU A HB3  3  
ATOM   5449  H  HG2  . GLU A 1 70  ? -1.373  -10.206 -4.485  1.00 0.00 ? 225 GLU A HG2  3  
ATOM   5450  H  HG3  . GLU A 1 70  ? -2.017  -9.456  -5.944  1.00 0.00 ? 225 GLU A HG3  3  
ATOM   5451  N  N    . GLY A 1 71  ? 1.379   -12.866 -7.524  1.00 0.00 ? 226 GLY A N    3  
ATOM   5452  C  CA   . GLY A 1 71  ? 2.569   -13.357 -8.280  1.00 0.00 ? 226 GLY A CA   3  
ATOM   5453  C  C    . GLY A 1 71  ? 2.592   -12.733 -9.685  1.00 0.00 ? 226 GLY A C    3  
ATOM   5454  O  O    . GLY A 1 71  ? 2.083   -11.647 -9.890  1.00 0.00 ? 226 GLY A O    3  
ATOM   5455  H  H    . GLY A 1 71  ? 0.499   -12.843 -7.960  1.00 0.00 ? 226 GLY A H    3  
ATOM   5456  H  HA2  . GLY A 1 71  ? 3.469   -13.079 -7.745  1.00 0.00 ? 226 GLY A HA2  3  
ATOM   5457  H  HA3  . GLY A 1 71  ? 2.520   -14.432 -8.368  1.00 0.00 ? 226 GLY A HA3  3  
ATOM   5458  N  N    . GLY A 1 72  ? 3.183   -13.406 -10.654 1.00 0.00 ? 227 GLY A N    3  
ATOM   5459  C  CA   . GLY A 1 72  ? 3.237   -12.841 -12.036 1.00 0.00 ? 227 GLY A CA   3  
ATOM   5460  C  C    . GLY A 1 72  ? 4.592   -12.150 -12.251 1.00 0.00 ? 227 GLY A C    3  
ATOM   5461  O  O    . GLY A 1 72  ? 5.606   -12.613 -11.761 1.00 0.00 ? 227 GLY A O    3  
ATOM   5462  H  H    . GLY A 1 72  ? 3.593   -14.281 -10.474 1.00 0.00 ? 227 GLY A H    3  
ATOM   5463  H  HA2  . GLY A 1 72  ? 3.118   -13.639 -12.756 1.00 0.00 ? 227 GLY A HA2  3  
ATOM   5464  H  HA3  . GLY A 1 72  ? 2.445   -12.118 -12.163 1.00 0.00 ? 227 GLY A HA3  3  
ATOM   5465  N  N    . ASN A 1 73  ? 4.624   -11.043 -12.968 1.00 0.00 ? 228 ASN A N    3  
ATOM   5466  C  CA   . ASN A 1 73  ? 5.938   -10.337 -13.183 1.00 0.00 ? 228 ASN A CA   3  
ATOM   5467  C  C    . ASN A 1 73  ? 6.375   -9.673  -11.872 1.00 0.00 ? 228 ASN A C    3  
ATOM   5468  O  O    . ASN A 1 73  ? 5.737   -8.745  -11.408 1.00 0.00 ? 228 ASN A O    3  
ATOM   5469  C  CB   . ASN A 1 73  ? 5.700   -9.274  -14.267 1.00 0.00 ? 228 ASN A CB   3  
ATOM   5470  C  CG   . ASN A 1 73  ? 7.008   -9.020  -15.029 1.00 0.00 ? 228 ASN A CG   3  
ATOM   5471  O  OD1  . ASN A 1 73  ? 7.797   -8.187  -14.632 1.00 0.00 ? 228 ASN A OD1  3  
ATOM   5472  N  ND2  . ASN A 1 73  ? 7.275   -9.705  -16.115 1.00 0.00 ? 228 ASN A ND2  3  
ATOM   5473  H  H    . ASN A 1 73  ? 3.790   -10.678 -13.348 1.00 0.00 ? 228 ASN A H    3  
ATOM   5474  H  HA   . ASN A 1 73  ? 6.688   -11.037 -13.513 1.00 0.00 ? 228 ASN A HA   3  
ATOM   5475  H  HB2  . ASN A 1 73  ? 4.944   -9.625  -14.955 1.00 0.00 ? 228 ASN A HB2  3  
ATOM   5476  H  HB3  . ASN A 1 73  ? 5.370   -8.356  -13.806 1.00 0.00 ? 228 ASN A HB3  3  
ATOM   5477  H  HD21 . ASN A 1 73  ? 6.644   -10.381 -16.445 1.00 0.00 ? 228 ASN A HD21 3  
ATOM   5478  H  HD22 . ASN A 1 73  ? 8.111   -9.540  -16.600 1.00 0.00 ? 228 ASN A HD22 3  
ATOM   5479  N  N    . LEU A 1 74  ? 7.444   -10.140 -11.257 1.00 0.00 ? 229 LEU A N    3  
ATOM   5480  C  CA   . LEU A 1 74  ? 7.881   -9.524  -9.968  1.00 0.00 ? 229 LEU A CA   3  
ATOM   5481  C  C    . LEU A 1 74  ? 9.292   -8.924  -10.087 1.00 0.00 ? 229 LEU A C    3  
ATOM   5482  O  O    . LEU A 1 74  ? 10.026  -9.229  -11.007 1.00 0.00 ? 229 LEU A O    3  
ATOM   5483  C  CB   . LEU A 1 74  ? 7.886   -10.664 -8.941  1.00 0.00 ? 229 LEU A CB   3  
ATOM   5484  C  CG   . LEU A 1 74  ? 6.511   -11.338 -8.877  1.00 0.00 ? 229 LEU A CG   3  
ATOM   5485  C  CD1  . LEU A 1 74  ? 6.636   -12.669 -8.132  1.00 0.00 ? 229 LEU A CD1  3  
ATOM   5486  C  CD2  . LEU A 1 74  ? 5.528   -10.433 -8.132  1.00 0.00 ? 229 LEU A CD2  3  
ATOM   5487  H  H    . LEU A 1 74  ? 7.947   -10.897 -11.632 1.00 0.00 ? 229 LEU A H    3  
ATOM   5488  H  HA   . LEU A 1 74  ? 7.180   -8.767  -9.670  1.00 0.00 ? 229 LEU A HA   3  
ATOM   5489  H  HB2  . LEU A 1 74  ? 8.629   -11.395 -9.224  1.00 0.00 ? 229 LEU A HB2  3  
ATOM   5490  H  HB3  . LEU A 1 74  ? 8.130   -10.264 -7.968  1.00 0.00 ? 229 LEU A HB3  3  
ATOM   5491  H  HG   . LEU A 1 74  ? 6.150   -11.521 -9.879  1.00 0.00 ? 229 LEU A HG   3  
ATOM   5492  H  HD11 . LEU A 1 74  ? 7.000   -13.428 -8.807  1.00 0.00 ? 229 LEU A HD11 3  
ATOM   5493  H  HD12 . LEU A 1 74  ? 5.668   -12.960 -7.750  1.00 0.00 ? 229 LEU A HD12 3  
ATOM   5494  H  HD13 . LEU A 1 74  ? 7.328   -12.556 -7.309  1.00 0.00 ? 229 LEU A HD13 3  
ATOM   5495  H  HD21 . LEU A 1 74  ? 4.779   -11.041 -7.644  1.00 0.00 ? 229 LEU A HD21 3  
ATOM   5496  H  HD22 . LEU A 1 74  ? 5.050   -9.768  -8.835  1.00 0.00 ? 229 LEU A HD22 3  
ATOM   5497  H  HD23 . LEU A 1 74  ? 6.060   -9.856  -7.392  1.00 0.00 ? 229 LEU A HD23 3  
ATOM   5498  N  N    . ILE A 1 75  ? 9.682   -8.084  -9.147  1.00 0.00 ? 230 ILE A N    3  
ATOM   5499  C  CA   . ILE A 1 75  ? 11.047  -7.479  -9.190  1.00 0.00 ? 230 ILE A CA   3  
ATOM   5500  C  C    . ILE A 1 75  ? 11.837  -7.918  -7.951  1.00 0.00 ? 230 ILE A C    3  
ATOM   5501  O  O    . ILE A 1 75  ? 11.701  -7.334  -6.892  1.00 0.00 ? 230 ILE A O    3  
ATOM   5502  C  CB   . ILE A 1 75  ? 10.816  -5.964  -9.175  1.00 0.00 ? 230 ILE A CB   3  
ATOM   5503  C  CG1  . ILE A 1 75  ? 10.091  -5.553  -10.457 1.00 0.00 ? 230 ILE A CG1  3  
ATOM   5504  C  CG2  . ILE A 1 75  ? 12.159  -5.221  -9.090  1.00 0.00 ? 230 ILE A CG2  3  
ATOM   5505  C  CD1  . ILE A 1 75  ? 9.738   -4.066  -10.395 1.00 0.00 ? 230 ILE A CD1  3  
ATOM   5506  H  H    . ILE A 1 75  ? 9.081   -7.858  -8.403  1.00 0.00 ? 230 ILE A H    3  
ATOM   5507  H  HA   . ILE A 1 75  ? 11.563  -7.770  -10.092 1.00 0.00 ? 230 ILE A HA   3  
ATOM   5508  H  HB   . ILE A 1 75  ? 10.210  -5.703  -8.320  1.00 0.00 ? 230 ILE A HB   3  
ATOM   5509  H  HG12 . ILE A 1 75  ? 10.732  -5.735  -11.308 1.00 0.00 ? 230 ILE A HG12 3  
ATOM   5510  H  HG13 . ILE A 1 75  ? 9.184   -6.131  -10.559 1.00 0.00 ? 230 ILE A HG13 3  
ATOM   5511  H  HG21 . ILE A 1 75  ? 12.753  -5.448  -9.963  1.00 0.00 ? 230 ILE A HG21 3  
ATOM   5512  H  HG22 . ILE A 1 75  ? 12.691  -5.532  -8.200  1.00 0.00 ? 230 ILE A HG22 3  
ATOM   5513  H  HG23 . ILE A 1 75  ? 11.979  -4.156  -9.045  1.00 0.00 ? 230 ILE A HG23 3  
ATOM   5514  H  HD11 . ILE A 1 75  ? 9.741   -3.735  -9.365  1.00 0.00 ? 230 ILE A HD11 3  
ATOM   5515  H  HD12 . ILE A 1 75  ? 8.757   -3.913  -10.818 1.00 0.00 ? 230 ILE A HD12 3  
ATOM   5516  H  HD13 . ILE A 1 75  ? 10.466  -3.500  -10.956 1.00 0.00 ? 230 ILE A HD13 3  
ATOM   5517  N  N    . CYS A 1 76  ? 12.665  -8.935  -8.067  1.00 0.00 ? 231 CYS A N    3  
ATOM   5518  C  CA   . CYS A 1 76  ? 13.458  -9.387  -6.867  1.00 0.00 ? 231 CYS A CA   3  
ATOM   5519  C  C    . CYS A 1 76  ? 14.298  -8.220  -6.325  1.00 0.00 ? 231 CYS A C    3  
ATOM   5520  O  O    . CYS A 1 76  ? 14.704  -7.348  -7.070  1.00 0.00 ? 231 CYS A O    3  
ATOM   5521  C  CB   . CYS A 1 76  ? 14.376  -10.524 -7.342  1.00 0.00 ? 231 CYS A CB   3  
ATOM   5522  S  SG   . CYS A 1 76  ? 13.532  -12.111 -7.123  1.00 0.00 ? 231 CYS A SG   3  
ATOM   5523  H  H    . CYS A 1 76  ? 12.763  -9.394  -8.936  1.00 0.00 ? 231 CYS A H    3  
ATOM   5524  H  HA   . CYS A 1 76  ? 12.791  -9.747  -6.095  1.00 0.00 ? 231 CYS A HA   3  
ATOM   5525  H  HB2  . CYS A 1 76  ? 14.613  -10.384 -8.386  1.00 0.00 ? 231 CYS A HB2  3  
ATOM   5526  H  HB3  . CYS A 1 76  ? 15.287  -10.518 -6.762  1.00 0.00 ? 231 CYS A HB3  3  
ATOM   5527  H  HG   . CYS A 1 76  ? 12.962  -12.251 -7.883  1.00 0.00 ? 231 CYS A HG   3  
ATOM   5528  N  N    . CYS A 1 77  ? 14.554  -8.192  -5.036  1.00 0.00 ? 232 CYS A N    3  
ATOM   5529  C  CA   . CYS A 1 77  ? 15.359  -7.069  -4.460  1.00 0.00 ? 232 CYS A CA   3  
ATOM   5530  C  C    . CYS A 1 77  ? 16.786  -7.541  -4.144  1.00 0.00 ? 232 CYS A C    3  
ATOM   5531  O  O    . CYS A 1 77  ? 17.012  -8.703  -3.863  1.00 0.00 ? 232 CYS A O    3  
ATOM   5532  C  CB   . CYS A 1 77  ? 14.629  -6.659  -3.173  1.00 0.00 ? 232 CYS A CB   3  
ATOM   5533  S  SG   . CYS A 1 77  ? 15.496  -5.275  -2.387  1.00 0.00 ? 232 CYS A SG   3  
ATOM   5534  H  H    . CYS A 1 77  ? 14.213  -8.905  -4.447  1.00 0.00 ? 232 CYS A H    3  
ATOM   5535  H  HA   . CYS A 1 77  ? 15.385  -6.238  -5.147  1.00 0.00 ? 232 CYS A HA   3  
ATOM   5536  H  HB2  . CYS A 1 77  ? 13.620  -6.360  -3.414  1.00 0.00 ? 232 CYS A HB2  3  
ATOM   5537  H  HB3  . CYS A 1 77  ? 14.601  -7.498  -2.494  1.00 0.00 ? 232 CYS A HB3  3  
ATOM   5538  N  N    . ASP A 1 78  ? 17.748  -6.641  -4.170  1.00 0.00 ? 233 ASP A N    3  
ATOM   5539  C  CA   . ASP A 1 78  ? 19.153  -7.041  -3.851  1.00 0.00 ? 233 ASP A CA   3  
ATOM   5540  C  C    . ASP A 1 78  ? 19.547  -6.480  -2.474  1.00 0.00 ? 233 ASP A C    3  
ATOM   5541  O  O    . ASP A 1 78  ? 20.657  -6.018  -2.285  1.00 0.00 ? 233 ASP A O    3  
ATOM   5542  C  CB   . ASP A 1 78  ? 20.018  -6.424  -4.953  1.00 0.00 ? 233 ASP A CB   3  
ATOM   5543  C  CG   . ASP A 1 78  ? 21.303  -7.238  -5.111  1.00 0.00 ? 233 ASP A CG   3  
ATOM   5544  O  OD1  . ASP A 1 78  ? 22.176  -7.102  -4.269  1.00 0.00 ? 233 ASP A OD1  3  
ATOM   5545  O  OD2  . ASP A 1 78  ? 21.393  -7.985  -6.072  1.00 0.00 ? 233 ASP A OD2  3  
ATOM   5546  H  H    . ASP A 1 78  ? 17.544  -5.700  -4.386  1.00 0.00 ? 233 ASP A H    3  
ATOM   5547  H  HA   . ASP A 1 78  ? 19.250  -8.115  -3.861  1.00 0.00 ? 233 ASP A HA   3  
ATOM   5548  H  HB2  . ASP A 1 78  ? 19.471  -6.428  -5.884  1.00 0.00 ? 233 ASP A HB2  3  
ATOM   5549  H  HB3  . ASP A 1 78  ? 20.269  -5.408  -4.688  1.00 0.00 ? 233 ASP A HB3  3  
ATOM   5550  N  N    . PHE A 1 79  ? 18.644  -6.509  -1.511  1.00 0.00 ? 234 PHE A N    3  
ATOM   5551  C  CA   . PHE A 1 79  ? 18.975  -5.969  -0.157  1.00 0.00 ? 234 PHE A CA   3  
ATOM   5552  C  C    . PHE A 1 79  ? 18.182  -6.717  0.932   1.00 0.00 ? 234 PHE A C    3  
ATOM   5553  O  O    . PHE A 1 79  ? 18.764  -7.334  1.805   1.00 0.00 ? 234 PHE A O    3  
ATOM   5554  C  CB   . PHE A 1 79  ? 18.556  -4.498  -0.209  1.00 0.00 ? 234 PHE A CB   3  
ATOM   5555  C  CG   . PHE A 1 79  ? 19.632  -3.670  -0.880  1.00 0.00 ? 234 PHE A CG   3  
ATOM   5556  C  CD1  . PHE A 1 79  ? 20.971  -3.787  -0.477  1.00 0.00 ? 234 PHE A CD1  3  
ATOM   5557  C  CD2  . PHE A 1 79  ? 19.287  -2.777  -1.901  1.00 0.00 ? 234 PHE A CD2  3  
ATOM   5558  C  CE1  . PHE A 1 79  ? 21.958  -3.012  -1.098  1.00 0.00 ? 234 PHE A CE1  3  
ATOM   5559  C  CE2  . PHE A 1 79  ? 20.273  -2.003  -2.519  1.00 0.00 ? 234 PHE A CE2  3  
ATOM   5560  C  CZ   . PHE A 1 79  ? 21.609  -2.120  -2.119  1.00 0.00 ? 234 PHE A CZ   3  
ATOM   5561  H  H    . PHE A 1 79  ? 17.749  -6.881  -1.679  1.00 0.00 ? 234 PHE A H    3  
ATOM   5562  H  HA   . PHE A 1 79  ? 20.034  -6.044  0.029   1.00 0.00 ? 234 PHE A HA   3  
ATOM   5563  H  HB2  . PHE A 1 79  ? 17.638  -4.409  -0.770  1.00 0.00 ? 234 PHE A HB2  3  
ATOM   5564  H  HB3  . PHE A 1 79  ? 18.399  -4.135  0.796   1.00 0.00 ? 234 PHE A HB3  3  
ATOM   5565  H  HD1  . PHE A 1 79  ? 21.240  -4.475  0.310   1.00 0.00 ? 234 PHE A HD1  3  
ATOM   5566  H  HD2  . PHE A 1 79  ? 18.258  -2.686  -2.213  1.00 0.00 ? 234 PHE A HD2  3  
ATOM   5567  H  HE1  . PHE A 1 79  ? 22.989  -3.103  -0.789  1.00 0.00 ? 234 PHE A HE1  3  
ATOM   5568  H  HE2  . PHE A 1 79  ? 20.002  -1.311  -3.303  1.00 0.00 ? 234 PHE A HE2  3  
ATOM   5569  H  HZ   . PHE A 1 79  ? 22.371  -1.522  -2.596  1.00 0.00 ? 234 PHE A HZ   3  
ATOM   5570  N  N    . CYS A 1 80  ? 16.862  -6.669  0.892   1.00 0.00 ? 235 CYS A N    3  
ATOM   5571  C  CA   . CYS A 1 80  ? 16.062  -7.391  1.944   1.00 0.00 ? 235 CYS A CA   3  
ATOM   5572  C  C    . CYS A 1 80  ? 15.607  -8.793  1.468   1.00 0.00 ? 235 CYS A C    3  
ATOM   5573  O  O    . CYS A 1 80  ? 14.690  -9.360  2.032   1.00 0.00 ? 235 CYS A O    3  
ATOM   5574  C  CB   . CYS A 1 80  ? 14.844  -6.491  2.255   1.00 0.00 ? 235 CYS A CB   3  
ATOM   5575  S  SG   . CYS A 1 80  ? 13.722  -6.387  0.826   1.00 0.00 ? 235 CYS A SG   3  
ATOM   5576  H  H    . CYS A 1 80  ? 16.406  -6.166  0.179   1.00 0.00 ? 235 CYS A H    3  
ATOM   5577  H  HA   . CYS A 1 80  ? 16.658  -7.495  2.837   1.00 0.00 ? 235 CYS A HA   3  
ATOM   5578  H  HB2  . CYS A 1 80  ? 14.306  -6.900  3.096   1.00 0.00 ? 235 CYS A HB2  3  
ATOM   5579  H  HB3  . CYS A 1 80  ? 15.193  -5.499  2.506   1.00 0.00 ? 235 CYS A HB3  3  
ATOM   5580  N  N    . HIS A 1 81  ? 16.235  -9.369  0.453   1.00 0.00 ? 236 HIS A N    3  
ATOM   5581  C  CA   . HIS A 1 81  ? 15.822  -10.733 -0.025  1.00 0.00 ? 236 HIS A CA   3  
ATOM   5582  C  C    . HIS A 1 81  ? 14.298  -10.813 -0.247  1.00 0.00 ? 236 HIS A C    3  
ATOM   5583  O  O    . HIS A 1 81  ? 13.598  -11.488 0.487   1.00 0.00 ? 236 HIS A O    3  
ATOM   5584  C  CB   . HIS A 1 81  ? 16.255  -11.687 1.090   1.00 0.00 ? 236 HIS A CB   3  
ATOM   5585  C  CG   . HIS A 1 81  ? 17.754  -11.673 1.210   1.00 0.00 ? 236 HIS A CG   3  
ATOM   5586  N  ND1  . HIS A 1 81  ? 18.515  -12.828 1.109   1.00 0.00 ? 236 HIS A ND1  3  
ATOM   5587  C  CD2  . HIS A 1 81  ? 18.648  -10.653 1.422   1.00 0.00 ? 236 HIS A CD2  3  
ATOM   5588  C  CE1  . HIS A 1 81  ? 19.805  -12.478 1.260   1.00 0.00 ? 236 HIS A CE1  3  
ATOM   5589  N  NE2  . HIS A 1 81  ? 19.942  -11.163 1.454   1.00 0.00 ? 236 HIS A NE2  3  
ATOM   5590  H  H    . HIS A 1 81  ? 16.979  -8.915  0.006   1.00 0.00 ? 236 HIS A H    3  
ATOM   5591  H  HA   . HIS A 1 81  ? 16.344  -10.979 -0.936  1.00 0.00 ? 236 HIS A HA   3  
ATOM   5592  H  HB2  . HIS A 1 81  ? 15.816  -11.371 2.025   1.00 0.00 ? 236 HIS A HB2  3  
ATOM   5593  H  HB3  . HIS A 1 81  ? 15.923  -12.688 0.857   1.00 0.00 ? 236 HIS A HB3  3  
ATOM   5594  H  HD1  . HIS A 1 81  ? 18.174  -13.734 0.956   1.00 0.00 ? 236 HIS A HD1  3  
ATOM   5595  H  HD2  . HIS A 1 81  ? 18.386  -9.612  1.545   1.00 0.00 ? 236 HIS A HD2  3  
ATOM   5596  H  HE1  . HIS A 1 81  ? 20.629  -13.175 1.229   1.00 0.00 ? 236 HIS A HE1  3  
ATOM   5597  N  N    . ASN A 1 82  ? 13.777  -10.134 -1.248  1.00 0.00 ? 237 ASN A N    3  
ATOM   5598  C  CA   . ASN A 1 82  ? 12.299  -10.185 -1.498  1.00 0.00 ? 237 ASN A CA   3  
ATOM   5599  C  C    . ASN A 1 82  ? 11.978  -9.784  -2.950  1.00 0.00 ? 237 ASN A C    3  
ATOM   5600  O  O    . ASN A 1 82  ? 12.867  -9.680  -3.772  1.00 0.00 ? 237 ASN A O    3  
ATOM   5601  C  CB   . ASN A 1 82  ? 11.696  -9.175  -0.513  1.00 0.00 ? 237 ASN A CB   3  
ATOM   5602  C  CG   . ASN A 1 82  ? 10.977  -9.918  0.620   1.00 0.00 ? 237 ASN A CG   3  
ATOM   5603  O  OD1  . ASN A 1 82  ? 11.314  -9.750  1.775   1.00 0.00 ? 237 ASN A OD1  3  
ATOM   5604  N  ND2  . ASN A 1 82  ? 9.995   -10.742 0.342   1.00 0.00 ? 237 ASN A ND2  3  
ATOM   5605  H  H    . ASN A 1 82  ? 14.354  -9.591  -1.833  1.00 0.00 ? 237 ASN A H    3  
ATOM   5606  H  HA   . ASN A 1 82  ? 11.919  -11.174 -1.291  1.00 0.00 ? 237 ASN A HA   3  
ATOM   5607  H  HB2  . ASN A 1 82  ? 12.485  -8.566  -0.098  1.00 0.00 ? 237 ASN A HB2  3  
ATOM   5608  H  HB3  . ASN A 1 82  ? 10.990  -8.543  -1.030  1.00 0.00 ? 237 ASN A HB3  3  
ATOM   5609  H  HD21 . ASN A 1 82  ? 9.715   -10.886 -0.587  1.00 0.00 ? 237 ASN A HD21 3  
ATOM   5610  H  HD22 . ASN A 1 82  ? 9.538   -11.215 1.068   1.00 0.00 ? 237 ASN A HD22 3  
ATOM   5611  N  N    . ALA A 1 83  ? 10.720  -9.563  -3.274  1.00 0.00 ? 238 ALA A N    3  
ATOM   5612  C  CA   . ALA A 1 83  ? 10.368  -9.172  -4.679  1.00 0.00 ? 238 ALA A CA   3  
ATOM   5613  C  C    . ALA A 1 83  ? 8.942   -8.590  -4.747  1.00 0.00 ? 238 ALA A C    3  
ATOM   5614  O  O    . ALA A 1 83  ? 8.015   -9.162  -4.207  1.00 0.00 ? 238 ALA A O    3  
ATOM   5615  C  CB   . ALA A 1 83  ? 10.450  -10.473 -5.478  1.00 0.00 ? 238 ALA A CB   3  
ATOM   5616  H  H    . ALA A 1 83  ? 10.009  -9.656  -2.599  1.00 0.00 ? 238 ALA A H    3  
ATOM   5617  H  HA   . ALA A 1 83  ? 11.086  -8.464  -5.062  1.00 0.00 ? 238 ALA A HA   3  
ATOM   5618  H  HB1  . ALA A 1 83  ? 9.456   -10.874 -5.620  1.00 0.00 ? 238 ALA A HB1  3  
ATOM   5619  H  HB2  . ALA A 1 83  ? 11.054  -11.189 -4.939  1.00 0.00 ? 238 ALA A HB2  3  
ATOM   5620  H  HB3  . ALA A 1 83  ? 10.899  -10.277 -6.440  1.00 0.00 ? 238 ALA A HB3  3  
ATOM   5621  N  N    . PHE A 1 84  ? 8.751   -7.469  -5.416  1.00 0.00 ? 239 PHE A N    3  
ATOM   5622  C  CA   . PHE A 1 84  ? 7.370   -6.884  -5.516  1.00 0.00 ? 239 PHE A CA   3  
ATOM   5623  C  C    . PHE A 1 84  ? 6.752   -7.279  -6.864  1.00 0.00 ? 239 PHE A C    3  
ATOM   5624  O  O    . PHE A 1 84  ? 7.342   -8.040  -7.603  1.00 0.00 ? 239 PHE A O    3  
ATOM   5625  C  CB   . PHE A 1 84  ? 7.543   -5.363  -5.417  1.00 0.00 ? 239 PHE A CB   3  
ATOM   5626  C  CG   . PHE A 1 84  ? 7.605   -4.960  -3.963  1.00 0.00 ? 239 PHE A CG   3  
ATOM   5627  C  CD1  . PHE A 1 84  ? 6.424   -4.730  -3.247  1.00 0.00 ? 239 PHE A CD1  3  
ATOM   5628  C  CD2  . PHE A 1 84  ? 8.845   -4.822  -3.330  1.00 0.00 ? 239 PHE A CD2  3  
ATOM   5629  C  CE1  . PHE A 1 84  ? 6.483   -4.362  -1.897  1.00 0.00 ? 239 PHE A CE1  3  
ATOM   5630  C  CE2  . PHE A 1 84  ? 8.904   -4.454  -1.980  1.00 0.00 ? 239 PHE A CE2  3  
ATOM   5631  C  CZ   . PHE A 1 84  ? 7.723   -4.224  -1.262  1.00 0.00 ? 239 PHE A CZ   3  
ATOM   5632  H  H    . PHE A 1 84  ? 9.509   -7.023  -5.861  1.00 0.00 ? 239 PHE A H    3  
ATOM   5633  H  HA   . PHE A 1 84  ? 6.754   -7.239  -4.705  1.00 0.00 ? 239 PHE A HA   3  
ATOM   5634  H  HB2  . PHE A 1 84  ? 8.458   -5.071  -5.913  1.00 0.00 ? 239 PHE A HB2  3  
ATOM   5635  H  HB3  . PHE A 1 84  ? 6.705   -4.873  -5.891  1.00 0.00 ? 239 PHE A HB3  3  
ATOM   5636  H  HD1  . PHE A 1 84  ? 5.467   -4.836  -3.736  1.00 0.00 ? 239 PHE A HD1  3  
ATOM   5637  H  HD2  . PHE A 1 84  ? 9.756   -4.998  -3.884  1.00 0.00 ? 239 PHE A HD2  3  
ATOM   5638  H  HE1  . PHE A 1 84  ? 5.572   -4.183  -1.343  1.00 0.00 ? 239 PHE A HE1  3  
ATOM   5639  H  HE2  . PHE A 1 84  ? 9.860   -4.349  -1.491  1.00 0.00 ? 239 PHE A HE2  3  
ATOM   5640  H  HZ   . PHE A 1 84  ? 7.769   -3.942  -0.219  1.00 0.00 ? 239 PHE A HZ   3  
ATOM   5641  N  N    . CYS A 1 85  ? 5.576   -6.778  -7.198  1.00 0.00 ? 240 CYS A N    3  
ATOM   5642  C  CA   . CYS A 1 85  ? 4.959   -7.152  -8.507  1.00 0.00 ? 240 CYS A CA   3  
ATOM   5643  C  C    . CYS A 1 85  ? 4.790   -5.909  -9.408  1.00 0.00 ? 240 CYS A C    3  
ATOM   5644  O  O    . CYS A 1 85  ? 4.918   -4.788  -8.954  1.00 0.00 ? 240 CYS A O    3  
ATOM   5645  C  CB   . CYS A 1 85  ? 3.615   -7.842  -8.157  1.00 0.00 ? 240 CYS A CB   3  
ATOM   5646  S  SG   . CYS A 1 85  ? 2.299   -6.647  -7.767  1.00 0.00 ? 240 CYS A SG   3  
ATOM   5647  H  H    . CYS A 1 85  ? 5.109   -6.163  -6.598  1.00 0.00 ? 240 CYS A H    3  
ATOM   5648  H  HA   . CYS A 1 85  ? 5.597   -7.863  -9.005  1.00 0.00 ? 240 CYS A HA   3  
ATOM   5649  H  HB2  . CYS A 1 85  ? 3.300   -8.440  -8.997  1.00 0.00 ? 240 CYS A HB2  3  
ATOM   5650  H  HB3  . CYS A 1 85  ? 3.768   -8.490  -7.307  1.00 0.00 ? 240 CYS A HB3  3  
ATOM   5651  N  N    . LYS A 1 86  ? 4.524   -6.103  -10.685 1.00 0.00 ? 241 LYS A N    3  
ATOM   5652  C  CA   . LYS A 1 86  ? 4.372   -4.917  -11.611 1.00 0.00 ? 241 LYS A CA   3  
ATOM   5653  C  C    . LYS A 1 86  ? 3.065   -4.129  -11.355 1.00 0.00 ? 241 LYS A C    3  
ATOM   5654  O  O    . LYS A 1 86  ? 2.968   -2.974  -11.728 1.00 0.00 ? 241 LYS A O    3  
ATOM   5655  C  CB   . LYS A 1 86  ? 4.389   -5.478  -13.049 1.00 0.00 ? 241 LYS A CB   3  
ATOM   5656  C  CG   . LYS A 1 86  ? 3.181   -6.399  -13.280 1.00 0.00 ? 241 LYS A CG   3  
ATOM   5657  C  CD   . LYS A 1 86  ? 2.559   -6.105  -14.648 1.00 0.00 ? 241 LYS A CD   3  
ATOM   5658  C  CE   . LYS A 1 86  ? 1.872   -7.366  -15.179 1.00 0.00 ? 241 LYS A CE   3  
ATOM   5659  N  NZ   . LYS A 1 86  ? 0.857   -6.871  -16.150 1.00 0.00 ? 241 LYS A NZ   3  
ATOM   5660  H  H    . LYS A 1 86  ? 4.439   -7.023  -11.031 1.00 0.00 ? 241 LYS A H    3  
ATOM   5661  H  HA   . LYS A 1 86  ? 5.216   -4.256  -11.484 1.00 0.00 ? 241 LYS A HA   3  
ATOM   5662  H  HB2  . LYS A 1 86  ? 4.357   -4.658  -13.752 1.00 0.00 ? 241 LYS A HB2  3  
ATOM   5663  H  HB3  . LYS A 1 86  ? 5.300   -6.042  -13.202 1.00 0.00 ? 241 LYS A HB3  3  
ATOM   5664  H  HG2  . LYS A 1 86  ? 3.506   -7.429  -13.247 1.00 0.00 ? 241 LYS A HG2  3  
ATOM   5665  H  HG3  . LYS A 1 86  ? 2.445   -6.232  -12.509 1.00 0.00 ? 241 LYS A HG3  3  
ATOM   5666  H  HD2  . LYS A 1 86  ? 1.832   -5.312  -14.550 1.00 0.00 ? 241 LYS A HD2  3  
ATOM   5667  H  HD3  . LYS A 1 86  ? 3.332   -5.802  -15.338 1.00 0.00 ? 241 LYS A HD3  3  
ATOM   5668  H  HE2  . LYS A 1 86  ? 2.591   -8.005  -15.673 1.00 0.00 ? 241 LYS A HE2  3  
ATOM   5669  H  HE3  . LYS A 1 86  ? 1.386   -7.897  -14.374 1.00 0.00 ? 241 LYS A HE3  3  
ATOM   5670  H  HZ1  . LYS A 1 86  ? 0.444   -7.676  -16.661 1.00 0.00 ? 241 LYS A HZ1  3  
ATOM   5671  H  HZ2  . LYS A 1 86  ? 1.313   -6.225  -16.827 1.00 0.00 ? 241 LYS A HZ2  3  
ATOM   5672  H  HZ3  . LYS A 1 86  ? 0.106   -6.366  -15.639 1.00 0.00 ? 241 LYS A HZ3  3  
ATOM   5673  N  N    . LYS A 1 87  ? 2.060   -4.723  -10.738 1.00 0.00 ? 242 LYS A N    3  
ATOM   5674  C  CA   . LYS A 1 87  ? 0.778   -3.958  -10.495 1.00 0.00 ? 242 LYS A CA   3  
ATOM   5675  C  C    . LYS A 1 87  ? 0.890   -3.003  -9.283  1.00 0.00 ? 242 LYS A C    3  
ATOM   5676  O  O    . LYS A 1 87  ? 0.114   -2.071  -9.168  1.00 0.00 ? 242 LYS A O    3  
ATOM   5677  C  CB   . LYS A 1 87  ? -0.311  -5.011  -10.235 1.00 0.00 ? 242 LYS A CB   3  
ATOM   5678  C  CG   . LYS A 1 87  ? -1.676  -4.443  -10.635 1.00 0.00 ? 242 LYS A CG   3  
ATOM   5679  C  CD   . LYS A 1 87  ? -2.784  -5.307  -10.032 1.00 0.00 ? 242 LYS A CD   3  
ATOM   5680  C  CE   . LYS A 1 87  ? -3.053  -4.861  -8.593  1.00 0.00 ? 242 LYS A CE   3  
ATOM   5681  N  NZ   . LYS A 1 87  ? -4.531  -4.948  -8.433  1.00 0.00 ? 242 LYS A NZ   3  
ATOM   5682  H  H    . LYS A 1 87  ? 2.142   -5.658  -10.441 1.00 0.00 ? 242 LYS A H    3  
ATOM   5683  H  HA   . LYS A 1 87  ? 0.523   -3.393  -11.376 1.00 0.00 ? 242 LYS A HA   3  
ATOM   5684  H  HB2  . LYS A 1 87  ? -0.103  -5.895  -10.820 1.00 0.00 ? 242 LYS A HB2  3  
ATOM   5685  H  HB3  . LYS A 1 87  ? -0.323  -5.266  -9.186  1.00 0.00 ? 242 LYS A HB3  3  
ATOM   5686  H  HG2  . LYS A 1 87  ? -1.765  -3.431  -10.268 1.00 0.00 ? 242 LYS A HG2  3  
ATOM   5687  H  HG3  . LYS A 1 87  ? -1.765  -4.446  -11.711 1.00 0.00 ? 242 LYS A HG3  3  
ATOM   5688  H  HD2  . LYS A 1 87  ? -3.685  -5.197  -10.618 1.00 0.00 ? 242 LYS A HD2  3  
ATOM   5689  H  HD3  . LYS A 1 87  ? -2.476  -6.342  -10.033 1.00 0.00 ? 242 LYS A HD3  3  
ATOM   5690  H  HE2  . LYS A 1 87  ? -2.556  -5.523  -7.896  1.00 0.00 ? 242 LYS A HE2  3  
ATOM   5691  H  HE3  . LYS A 1 87  ? -2.726  -3.844  -8.446  1.00 0.00 ? 242 LYS A HE3  3  
ATOM   5692  H  HZ1  . LYS A 1 87  ? -4.834  -5.937  -8.547  1.00 0.00 ? 242 LYS A HZ1  3  
ATOM   5693  H  HZ2  . LYS A 1 87  ? -4.993  -4.357  -9.155  1.00 0.00 ? 242 LYS A HZ2  3  
ATOM   5694  H  HZ3  . LYS A 1 87  ? -4.799  -4.613  -7.487  1.00 0.00 ? 242 LYS A HZ3  3  
ATOM   5695  N  N    . CYS A 1 88  ? 1.838   -3.205  -8.385  1.00 0.00 ? 243 CYS A N    3  
ATOM   5696  C  CA   . CYS A 1 88  ? 1.954   -2.278  -7.208  1.00 0.00 ? 243 CYS A CA   3  
ATOM   5697  C  C    . CYS A 1 88  ? 2.812   -1.064  -7.592  1.00 0.00 ? 243 CYS A C    3  
ATOM   5698  O  O    . CYS A 1 88  ? 2.494   0.055   -7.233  1.00 0.00 ? 243 CYS A O    3  
ATOM   5699  C  CB   . CYS A 1 88  ? 2.617   -3.086  -6.078  1.00 0.00 ? 243 CYS A CB   3  
ATOM   5700  S  SG   . CYS A 1 88  ? 1.368   -4.104  -5.243  1.00 0.00 ? 243 CYS A SG   3  
ATOM   5701  H  H    . CYS A 1 88  ? 2.469   -3.945  -8.490  1.00 0.00 ? 243 CYS A H    3  
ATOM   5702  H  HA   . CYS A 1 88  ? 0.973   -1.950  -6.899  1.00 0.00 ? 243 CYS A HA   3  
ATOM   5703  H  HB2  . CYS A 1 88  ? 3.381   -3.726  -6.495  1.00 0.00 ? 243 CYS A HB2  3  
ATOM   5704  H  HB3  . CYS A 1 88  ? 3.064   -2.409  -5.366  1.00 0.00 ? 243 CYS A HB3  3  
ATOM   5705  N  N    . ILE A 1 89  ? 3.882   -1.265  -8.339  1.00 0.00 ? 244 ILE A N    3  
ATOM   5706  C  CA   . ILE A 1 89  ? 4.723   -0.088  -8.754  1.00 0.00 ? 244 ILE A CA   3  
ATOM   5707  C  C    . ILE A 1 89  ? 3.926   0.770   -9.745  1.00 0.00 ? 244 ILE A C    3  
ATOM   5708  O  O    . ILE A 1 89  ? 3.961   1.984   -9.679  1.00 0.00 ? 244 ILE A O    3  
ATOM   5709  C  CB   . ILE A 1 89  ? 5.989   -0.654  -9.411  1.00 0.00 ? 244 ILE A CB   3  
ATOM   5710  C  CG1  . ILE A 1 89  ? 6.737   -1.512  -8.390  1.00 0.00 ? 244 ILE A CG1  3  
ATOM   5711  C  CG2  . ILE A 1 89  ? 6.893   0.495   -9.868  1.00 0.00 ? 244 ILE A CG2  3  
ATOM   5712  C  CD1  . ILE A 1 89  ? 7.418   -2.679  -9.105  1.00 0.00 ? 244 ILE A CD1  3  
ATOM   5713  H  H    . ILE A 1 89  ? 4.113   -2.177  -8.636  1.00 0.00 ? 244 ILE A H    3  
ATOM   5714  H  HA   . ILE A 1 89  ? 4.989   0.500   -7.887  1.00 0.00 ? 244 ILE A HA   3  
ATOM   5715  H  HB   . ILE A 1 89  ? 5.716   -1.260  -10.263 1.00 0.00 ? 244 ILE A HB   3  
ATOM   5716  H  HG12 . ILE A 1 89  ? 7.482   -0.910  -7.891  1.00 0.00 ? 244 ILE A HG12 3  
ATOM   5717  H  HG13 . ILE A 1 89  ? 6.038   -1.896  -7.663  1.00 0.00 ? 244 ILE A HG13 3  
ATOM   5718  H  HG21 . ILE A 1 89  ? 6.954   1.237   -9.085  1.00 0.00 ? 244 ILE A HG21 3  
ATOM   5719  H  HG22 . ILE A 1 89  ? 6.480   0.944   -10.760 1.00 0.00 ? 244 ILE A HG22 3  
ATOM   5720  H  HG23 . ILE A 1 89  ? 7.881   0.113   -10.083 1.00 0.00 ? 244 ILE A HG23 3  
ATOM   5721  H  HD11 . ILE A 1 89  ? 8.026   -3.229  -8.401  1.00 0.00 ? 244 ILE A HD11 3  
ATOM   5722  H  HD12 . ILE A 1 89  ? 8.043   -2.298  -9.899  1.00 0.00 ? 244 ILE A HD12 3  
ATOM   5723  H  HD13 . ILE A 1 89  ? 6.666   -3.335  -9.521  1.00 0.00 ? 244 ILE A HD13 3  
ATOM   5724  N  N    . LEU A 1 90  ? 3.184   0.155   -10.652 1.00 0.00 ? 245 LEU A N    3  
ATOM   5725  C  CA   . LEU A 1 90  ? 2.368   0.971   -11.622 1.00 0.00 ? 245 LEU A CA   3  
ATOM   5726  C  C    . LEU A 1 90  ? 1.417   1.899   -10.846 1.00 0.00 ? 245 LEU A C    3  
ATOM   5727  O  O    . LEU A 1 90  ? 1.209   3.035   -11.231 1.00 0.00 ? 245 LEU A O    3  
ATOM   5728  C  CB   . LEU A 1 90  ? 1.559   -0.022  -12.474 1.00 0.00 ? 245 LEU A CB   3  
ATOM   5729  C  CG   . LEU A 1 90  ? 1.294   0.585   -13.853 1.00 0.00 ? 245 LEU A CG   3  
ATOM   5730  C  CD1  . LEU A 1 90  ? 0.624   -0.457  -14.750 1.00 0.00 ? 245 LEU A CD1  3  
ATOM   5731  C  CD2  . LEU A 1 90  ? 0.374   1.799   -13.707 1.00 0.00 ? 245 LEU A CD2  3  
ATOM   5732  H  H    . LEU A 1 90  ? 3.157   -0.828  -10.683 1.00 0.00 ? 245 LEU A H    3  
ATOM   5733  H  HA   . LEU A 1 90  ? 3.017   1.551   -12.252 1.00 0.00 ? 245 LEU A HA   3  
ATOM   5734  H  HB2  . LEU A 1 90  ? 2.118   -0.940  -12.585 1.00 0.00 ? 245 LEU A HB2  3  
ATOM   5735  H  HB3  . LEU A 1 90  ? 0.618   -0.230  -11.988 1.00 0.00 ? 245 LEU A HB3  3  
ATOM   5736  H  HG   . LEU A 1 90  ? 2.231   0.892   -14.296 1.00 0.00 ? 245 LEU A HG   3  
ATOM   5737  H  HD11 . LEU A 1 90  ? 0.101   0.043   -15.552 1.00 0.00 ? 245 LEU A HD11 3  
ATOM   5738  H  HD12 . LEU A 1 90  ? -0.079  -1.033  -14.168 1.00 0.00 ? 245 LEU A HD12 3  
ATOM   5739  H  HD13 . LEU A 1 90  ? 1.375   -1.113  -15.163 1.00 0.00 ? 245 LEU A HD13 3  
ATOM   5740  H  HD21 . LEU A 1 90  ? -0.195  1.930   -14.615 1.00 0.00 ? 245 LEU A HD21 3  
ATOM   5741  H  HD22 . LEU A 1 90  ? 0.969   2.682   -13.525 1.00 0.00 ? 245 LEU A HD22 3  
ATOM   5742  H  HD23 . LEU A 1 90  ? -0.300  1.643   -12.878 1.00 0.00 ? 245 LEU A HD23 3  
ATOM   5743  N  N    . ARG A 1 91  ? 0.850   1.435   -9.747  1.00 0.00 ? 246 ARG A N    3  
ATOM   5744  C  CA   . ARG A 1 91  ? -0.070  2.324   -8.953  1.00 0.00 ? 246 ARG A CA   3  
ATOM   5745  C  C    . ARG A 1 91  ? 0.725   3.285   -8.041  1.00 0.00 ? 246 ARG A C    3  
ATOM   5746  O  O    . ARG A 1 91  ? 0.188   4.280   -7.588  1.00 0.00 ? 246 ARG A O    3  
ATOM   5747  C  CB   . ARG A 1 91  ? -0.948  1.394   -8.104  1.00 0.00 ? 246 ARG A CB   3  
ATOM   5748  C  CG   . ARG A 1 91  ? -2.359  1.977   -8.000  1.00 0.00 ? 246 ARG A CG   3  
ATOM   5749  C  CD   . ARG A 1 91  ? -2.476  2.809   -6.721  1.00 0.00 ? 246 ARG A CD   3  
ATOM   5750  N  NE   . ARG A 1 91  ? -3.580  3.773   -6.991  1.00 0.00 ? 246 ARG A NE   3  
ATOM   5751  C  CZ   . ARG A 1 91  ? -3.333  5.053   -7.030  1.00 0.00 ? 246 ARG A CZ   3  
ATOM   5752  N  NH1  . ARG A 1 91  ? -2.558  5.539   -7.960  1.00 0.00 ? 246 ARG A NH1  3  
ATOM   5753  N  NH2  . ARG A 1 91  ? -3.862  5.847   -6.140  1.00 0.00 ? 246 ARG A NH2  3  
ATOM   5754  H  H    . ARG A 1 91  ? 1.038   0.512   -9.440  1.00 0.00 ? 246 ARG A H    3  
ATOM   5755  H  HA   . ARG A 1 91  ? -0.693  2.893   -9.623  1.00 0.00 ? 246 ARG A HA   3  
ATOM   5756  H  HB2  . ARG A 1 91  ? -0.994  0.419   -8.567  1.00 0.00 ? 246 ARG A HB2  3  
ATOM   5757  H  HB3  . ARG A 1 91  ? -0.525  1.302   -7.114  1.00 0.00 ? 246 ARG A HB3  3  
ATOM   5758  H  HG2  . ARG A 1 91  ? -2.552  2.604   -8.858  1.00 0.00 ? 246 ARG A HG2  3  
ATOM   5759  H  HG3  . ARG A 1 91  ? -3.079  1.174   -7.971  1.00 0.00 ? 246 ARG A HG3  3  
ATOM   5760  H  HD2  . ARG A 1 91  ? -2.724  2.174   -5.882  1.00 0.00 ? 246 ARG A HD2  3  
ATOM   5761  H  HD3  . ARG A 1 91  ? -1.558  3.343   -6.534  1.00 0.00 ? 246 ARG A HD3  3  
ATOM   5762  H  HE   . ARG A 1 91  ? -4.492  3.444   -7.138  1.00 0.00 ? 246 ARG A HE   3  
ATOM   5763  H  HH11 . ARG A 1 91  ? -2.152  4.931   -8.642  1.00 0.00 ? 246 ARG A HH11 3  
ATOM   5764  H  HH12 . ARG A 1 91  ? -2.369  6.521   -7.990  1.00 0.00 ? 246 ARG A HH12 3  
ATOM   5765  H  HH21 . ARG A 1 91  ? -4.457  5.474   -5.427  1.00 0.00 ? 246 ARG A HH21 3  
ATOM   5766  H  HH22 . ARG A 1 91  ? -3.673  6.829   -6.170  1.00 0.00 ? 246 ARG A HH22 3  
ATOM   5767  N  N    . ASN A 1 92  ? 1.990   3.014   -7.757  1.00 0.00 ? 247 ASN A N    3  
ATOM   5768  C  CA   . ASN A 1 92  ? 2.770   3.941   -6.870  1.00 0.00 ? 247 ASN A CA   3  
ATOM   5769  C  C    . ASN A 1 92  ? 3.620   4.909   -7.706  1.00 0.00 ? 247 ASN A C    3  
ATOM   5770  O  O    . ASN A 1 92  ? 3.705   6.082   -7.394  1.00 0.00 ? 247 ASN A O    3  
ATOM   5771  C  CB   . ASN A 1 92  ? 3.674   3.045   -6.012  1.00 0.00 ? 247 ASN A CB   3  
ATOM   5772  C  CG   . ASN A 1 92  ? 4.451   3.910   -5.011  1.00 0.00 ? 247 ASN A CG   3  
ATOM   5773  O  OD1  . ASN A 1 92  ? 3.867   4.717   -4.315  1.00 0.00 ? 247 ASN A OD1  3  
ATOM   5774  N  ND2  . ASN A 1 92  ? 5.751   3.785   -4.905  1.00 0.00 ? 247 ASN A ND2  3  
ATOM   5775  H  H    . ASN A 1 92  ? 2.423   2.214   -8.120  1.00 0.00 ? 247 ASN A H    3  
ATOM   5776  H  HA   . ASN A 1 92  ? 2.101   4.494   -6.237  1.00 0.00 ? 247 ASN A HA   3  
ATOM   5777  H  HB2  . ASN A 1 92  ? 3.068   2.329   -5.476  1.00 0.00 ? 247 ASN A HB2  3  
ATOM   5778  H  HB3  . ASN A 1 92  ? 4.373   2.522   -6.649  1.00 0.00 ? 247 ASN A HB3  3  
ATOM   5779  H  HD21 . ASN A 1 92  ? 6.235   3.136   -5.463  1.00 0.00 ? 247 ASN A HD21 3  
ATOM   5780  H  HD22 . ASN A 1 92  ? 6.244   4.340   -4.267  1.00 0.00 ? 247 ASN A HD22 3  
ATOM   5781  N  N    . LEU A 1 93  ? 4.255   4.436   -8.760  1.00 0.00 ? 248 LEU A N    3  
ATOM   5782  C  CA   . LEU A 1 93  ? 5.099   5.360   -9.588  1.00 0.00 ? 248 LEU A CA   3  
ATOM   5783  C  C    . LEU A 1 93  ? 5.072   5.013   -11.095 1.00 0.00 ? 248 LEU A C    3  
ATOM   5784  O  O    . LEU A 1 93  ? 5.986   5.367   -11.818 1.00 0.00 ? 248 LEU A O    3  
ATOM   5785  C  CB   . LEU A 1 93  ? 6.521   5.224   -9.022  1.00 0.00 ? 248 LEU A CB   3  
ATOM   5786  C  CG   . LEU A 1 93  ? 7.047   3.796   -9.211  1.00 0.00 ? 248 LEU A CG   3  
ATOM   5787  C  CD1  . LEU A 1 93  ? 7.732   3.678   -10.571 1.00 0.00 ? 248 LEU A CD1  3  
ATOM   5788  C  CD2  . LEU A 1 93  ? 8.059   3.481   -8.107  1.00 0.00 ? 248 LEU A CD2  3  
ATOM   5789  H  H    . LEU A 1 93  ? 4.181   3.487   -8.995  1.00 0.00 ? 248 LEU A H    3  
ATOM   5790  H  HA   . LEU A 1 93  ? 4.763   6.375   -9.449  1.00 0.00 ? 248 LEU A HA   3  
ATOM   5791  H  HB2  . LEU A 1 93  ? 7.174   5.915   -9.533  1.00 0.00 ? 248 LEU A HB2  3  
ATOM   5792  H  HB3  . LEU A 1 93  ? 6.507   5.460   -7.968  1.00 0.00 ? 248 LEU A HB3  3  
ATOM   5793  H  HG   . LEU A 1 93  ? 6.231   3.095   -9.161  1.00 0.00 ? 248 LEU A HG   3  
ATOM   5794  H  HD11 . LEU A 1 93  ? 8.483   2.902   -10.531 1.00 0.00 ? 248 LEU A HD11 3  
ATOM   5795  H  HD12 . LEU A 1 93  ? 8.200   4.619   -10.821 1.00 0.00 ? 248 LEU A HD12 3  
ATOM   5796  H  HD13 . LEU A 1 93  ? 6.998   3.429   -11.323 1.00 0.00 ? 248 LEU A HD13 3  
ATOM   5797  H  HD21 . LEU A 1 93  ? 7.696   3.865   -7.165  1.00 0.00 ? 248 LEU A HD21 3  
ATOM   5798  H  HD22 . LEU A 1 93  ? 9.005   3.942   -8.343  1.00 0.00 ? 248 LEU A HD22 3  
ATOM   5799  H  HD23 . LEU A 1 93  ? 8.189   2.412   -8.032  1.00 0.00 ? 248 LEU A HD23 3  
ATOM   5800  N  N    . GLY A 1 94  ? 4.037   4.358   -11.592 1.00 0.00 ? 249 GLY A N    3  
ATOM   5801  C  CA   . GLY A 1 94  ? 3.989   4.044   -13.054 1.00 0.00 ? 249 GLY A CA   3  
ATOM   5802  C  C    . GLY A 1 94  ? 4.834   2.801   -13.367 1.00 0.00 ? 249 GLY A C    3  
ATOM   5803  O  O    . GLY A 1 94  ? 5.493   2.258   -12.500 1.00 0.00 ? 249 GLY A O    3  
ATOM   5804  H  H    . GLY A 1 94  ? 3.289   4.092   -11.017 1.00 0.00 ? 249 GLY A H    3  
ATOM   5805  H  HA2  . GLY A 1 94  ? 2.965   3.861   -13.346 1.00 0.00 ? 249 GLY A HA2  3  
ATOM   5806  H  HA3  . GLY A 1 94  ? 4.375   4.881   -13.615 1.00 0.00 ? 249 GLY A HA3  3  
ATOM   5807  N  N    . ARG A 1 95  ? 4.816   2.342   -14.603 1.00 0.00 ? 250 ARG A N    3  
ATOM   5808  C  CA   . ARG A 1 95  ? 5.619   1.126   -14.967 1.00 0.00 ? 250 ARG A CA   3  
ATOM   5809  C  C    . ARG A 1 95  ? 6.953   1.504   -15.644 1.00 0.00 ? 250 ARG A C    3  
ATOM   5810  O  O    . ARG A 1 95  ? 7.909   0.755   -15.564 1.00 0.00 ? 250 ARG A O    3  
ATOM   5811  C  CB   . ARG A 1 95  ? 4.744   0.326   -15.939 1.00 0.00 ? 250 ARG A CB   3  
ATOM   5812  C  CG   . ARG A 1 95  ? 5.382   -1.041  -16.194 1.00 0.00 ? 250 ARG A CG   3  
ATOM   5813  C  CD   . ARG A 1 95  ? 4.338   -1.991  -16.789 1.00 0.00 ? 250 ARG A CD   3  
ATOM   5814  N  NE   . ARG A 1 95  ? 5.062   -2.739  -17.852 1.00 0.00 ? 250 ARG A NE   3  
ATOM   5815  C  CZ   . ARG A 1 95  ? 5.206   -2.211  -19.037 1.00 0.00 ? 250 ARG A CZ   3  
ATOM   5816  N  NH1  . ARG A 1 95  ? 4.181   -2.119  -19.840 1.00 0.00 ? 250 ARG A NH1  3  
ATOM   5817  N  NH2  . ARG A 1 95  ? 6.375   -1.775  -19.421 1.00 0.00 ? 250 ARG A NH2  3  
ATOM   5818  H  H    . ARG A 1 95  ? 4.271   2.795   -15.290 1.00 0.00 ? 250 ARG A H    3  
ATOM   5819  H  HA   . ARG A 1 95  ? 5.810   0.538   -14.087 1.00 0.00 ? 250 ARG A HA   3  
ATOM   5820  H  HB2  . ARG A 1 95  ? 3.761   0.193   -15.511 1.00 0.00 ? 250 ARG A HB2  3  
ATOM   5821  H  HB3  . ARG A 1 95  ? 4.662   0.863   -16.872 1.00 0.00 ? 250 ARG A HB3  3  
ATOM   5822  H  HG2  . ARG A 1 95  ? 6.205   -0.931  -16.885 1.00 0.00 ? 250 ARG A HG2  3  
ATOM   5823  H  HG3  . ARG A 1 95  ? 5.746   -1.448  -15.263 1.00 0.00 ? 250 ARG A HG3  3  
ATOM   5824  H  HD2  . ARG A 1 95  ? 3.974   -2.669  -16.029 1.00 0.00 ? 250 ARG A HD2  3  
ATOM   5825  H  HD3  . ARG A 1 95  ? 3.522   -1.432  -17.219 1.00 0.00 ? 250 ARG A HD3  3  
ATOM   5826  H  HE   . ARG A 1 95  ? 5.431   -3.627  -17.663 1.00 0.00 ? 250 ARG A HE   3  
ATOM   5827  H  HH11 . ARG A 1 95  ? 3.284   -2.452  -19.545 1.00 0.00 ? 250 ARG A HH11 3  
ATOM   5828  H  HH12 . ARG A 1 95  ? 4.290   -1.714  -20.747 1.00 0.00 ? 250 ARG A HH12 3  
ATOM   5829  H  HH21 . ARG A 1 95  ? 7.161   -1.847  -18.806 1.00 0.00 ? 250 ARG A HH21 3  
ATOM   5830  H  HH22 . ARG A 1 95  ? 6.485   -1.371  -20.329 1.00 0.00 ? 250 ARG A HH22 3  
ATOM   5831  N  N    . LYS A 1 96  ? 7.037   2.643   -16.314 1.00 0.00 ? 251 LYS A N    3  
ATOM   5832  C  CA   . LYS A 1 96  ? 8.339   3.026   -16.994 1.00 0.00 ? 251 LYS A CA   3  
ATOM   5833  C  C    . LYS A 1 96  ? 9.512   2.915   -16.009 1.00 0.00 ? 251 LYS A C    3  
ATOM   5834  O  O    . LYS A 1 96  ? 10.449  2.176   -16.247 1.00 0.00 ? 251 LYS A O    3  
ATOM   5835  C  CB   . LYS A 1 96  ? 8.183   4.479   -17.465 1.00 0.00 ? 251 LYS A CB   3  
ATOM   5836  C  CG   . LYS A 1 96  ? 9.396   4.875   -18.311 1.00 0.00 ? 251 LYS A CG   3  
ATOM   5837  C  CD   . LYS A 1 96  ? 9.257   6.332   -18.754 1.00 0.00 ? 251 LYS A CD   3  
ATOM   5838  C  CE   . LYS A 1 96  ? 10.642  6.980   -18.824 1.00 0.00 ? 251 LYS A CE   3  
ATOM   5839  N  NZ   . LYS A 1 96  ? 11.350  6.253   -19.915 1.00 0.00 ? 251 LYS A NZ   3  
ATOM   5840  H  H    . LYS A 1 96  ? 6.253   3.233   -16.380 1.00 0.00 ? 251 LYS A H    3  
ATOM   5841  H  HA   . LYS A 1 96  ? 8.515   2.382   -17.842 1.00 0.00 ? 251 LYS A HA   3  
ATOM   5842  H  HB2  . LYS A 1 96  ? 7.285   4.572   -18.059 1.00 0.00 ? 251 LYS A HB2  3  
ATOM   5843  H  HB3  . LYS A 1 96  ? 8.116   5.131   -16.608 1.00 0.00 ? 251 LYS A HB3  3  
ATOM   5844  H  HG2  . LYS A 1 96  ? 10.295  4.760   -17.723 1.00 0.00 ? 251 LYS A HG2  3  
ATOM   5845  H  HG3  . LYS A 1 96  ? 9.450   4.239   -19.182 1.00 0.00 ? 251 LYS A HG3  3  
ATOM   5846  H  HD2  . LYS A 1 96  ? 8.792   6.369   -19.728 1.00 0.00 ? 251 LYS A HD2  3  
ATOM   5847  H  HD3  . LYS A 1 96  ? 8.648   6.869   -18.043 1.00 0.00 ? 251 LYS A HD3  3  
ATOM   5848  H  HE2  . LYS A 1 96  ? 10.554  8.030   -19.063 1.00 0.00 ? 251 LYS A HE2  3  
ATOM   5849  H  HE3  . LYS A 1 96  ? 11.167  6.847   -17.891 1.00 0.00 ? 251 LYS A HE3  3  
ATOM   5850  H  HZ1  . LYS A 1 96  ? 12.245  6.736   -20.131 1.00 0.00 ? 251 LYS A HZ1  3  
ATOM   5851  H  HZ2  . LYS A 1 96  ? 10.750  6.236   -20.765 1.00 0.00 ? 251 LYS A HZ2  3  
ATOM   5852  H  HZ3  . LYS A 1 96  ? 11.550  5.279   -19.612 1.00 0.00 ? 251 LYS A HZ3  3  
ATOM   5853  N  N    . GLU A 1 97  ? 9.464   3.618   -14.893 1.00 0.00 ? 252 GLU A N    3  
ATOM   5854  C  CA   . GLU A 1 97  ? 10.590  3.505   -13.892 1.00 0.00 ? 252 GLU A CA   3  
ATOM   5855  C  C    . GLU A 1 97  ? 10.834  2.022   -13.538 1.00 0.00 ? 252 GLU A C    3  
ATOM   5856  O  O    . GLU A 1 97  ? 11.948  1.624   -13.257 1.00 0.00 ? 252 GLU A O    3  
ATOM   5857  C  CB   . GLU A 1 97  ? 10.153  4.282   -12.640 1.00 0.00 ? 252 GLU A CB   3  
ATOM   5858  C  CG   . GLU A 1 97  ? 10.677  5.717   -12.720 1.00 0.00 ? 252 GLU A CG   3  
ATOM   5859  C  CD   . GLU A 1 97  ? 9.722   6.653   -11.977 1.00 0.00 ? 252 GLU A CD   3  
ATOM   5860  O  OE1  . GLU A 1 97  ? 9.693   6.593   -10.759 1.00 0.00 ? 252 GLU A OE1  3  
ATOM   5861  O  OE2  . GLU A 1 97  ? 9.036   7.415   -12.639 1.00 0.00 ? 252 GLU A OE2  3  
ATOM   5862  H  H    . GLU A 1 97  ? 8.689   4.196   -14.710 1.00 0.00 ? 252 GLU A H    3  
ATOM   5863  H  HA   . GLU A 1 97  ? 11.486  3.938   -14.298 1.00 0.00 ? 252 GLU A HA   3  
ATOM   5864  H  HB2  . GLU A 1 97  ? 9.075   4.295   -12.583 1.00 0.00 ? 252 GLU A HB2  3  
ATOM   5865  H  HB3  . GLU A 1 97  ? 10.554  3.802   -11.760 1.00 0.00 ? 252 GLU A HB3  3  
ATOM   5866  H  HG2  . GLU A 1 97  ? 11.658  5.768   -12.267 1.00 0.00 ? 252 GLU A HG2  3  
ATOM   5867  H  HG3  . GLU A 1 97  ? 10.742  6.019   -13.754 1.00 0.00 ? 252 GLU A HG3  3  
ATOM   5868  N  N    . LEU A 1 98  ? 9.799   1.198   -13.564 1.00 0.00 ? 253 LEU A N    3  
ATOM   5869  C  CA   . LEU A 1 98  ? 9.989   -0.261  -13.243 1.00 0.00 ? 253 LEU A CA   3  
ATOM   5870  C  C    . LEU A 1 98  ? 11.038  -0.887  -14.181 1.00 0.00 ? 253 LEU A C    3  
ATOM   5871  O  O    . LEU A 1 98  ? 11.779  -1.763  -13.776 1.00 0.00 ? 253 LEU A O    3  
ATOM   5872  C  CB   . LEU A 1 98  ? 8.623   -0.934  -13.455 1.00 0.00 ? 253 LEU A CB   3  
ATOM   5873  C  CG   . LEU A 1 98  ? 8.545   -2.212  -12.624 1.00 0.00 ? 253 LEU A CG   3  
ATOM   5874  C  CD1  . LEU A 1 98  ? 7.079   -2.611  -12.437 1.00 0.00 ? 253 LEU A CD1  3  
ATOM   5875  C  CD2  . LEU A 1 98  ? 9.289   -3.336  -13.348 1.00 0.00 ? 253 LEU A CD2  3  
ATOM   5876  H  H    . LEU A 1 98  ? 8.906   1.537   -13.801 1.00 0.00 ? 253 LEU A H    3  
ATOM   5877  H  HA   . LEU A 1 98  ? 10.296  -0.376  -12.214 1.00 0.00 ? 253 LEU A HA   3  
ATOM   5878  H  HB2  . LEU A 1 98  ? 7.838   -0.256  -13.148 1.00 0.00 ? 253 LEU A HB2  3  
ATOM   5879  H  HB3  . LEU A 1 98  ? 8.500   -1.175  -14.499 1.00 0.00 ? 253 LEU A HB3  3  
ATOM   5880  H  HG   . LEU A 1 98  ? 8.996   -2.042  -11.657 1.00 0.00 ? 253 LEU A HG   3  
ATOM   5881  H  HD11 . LEU A 1 98  ? 6.695   -3.016  -13.361 1.00 0.00 ? 253 LEU A HD11 3  
ATOM   5882  H  HD12 . LEU A 1 98  ? 6.502   -1.742  -12.157 1.00 0.00 ? 253 LEU A HD12 3  
ATOM   5883  H  HD13 . LEU A 1 98  ? 7.005   -3.357  -11.659 1.00 0.00 ? 253 LEU A HD13 3  
ATOM   5884  H  HD21 . LEU A 1 98  ? 10.329  -3.329  -13.052 1.00 0.00 ? 253 LEU A HD21 3  
ATOM   5885  H  HD22 . LEU A 1 98  ? 9.220   -3.184  -14.415 1.00 0.00 ? 253 LEU A HD22 3  
ATOM   5886  H  HD23 . LEU A 1 98  ? 8.848   -4.287  -13.090 1.00 0.00 ? 253 LEU A HD23 3  
ATOM   5887  N  N    . SER A 1 99  ? 11.115  -0.454  -15.428 1.00 0.00 ? 254 SER A N    3  
ATOM   5888  C  CA   . SER A 1 99  ? 12.142  -1.061  -16.353 1.00 0.00 ? 254 SER A CA   3  
ATOM   5889  C  C    . SER A 1 99  ? 13.551  -0.751  -15.830 1.00 0.00 ? 254 SER A C    3  
ATOM   5890  O  O    . SER A 1 99  ? 14.369  -1.642  -15.695 1.00 0.00 ? 254 SER A O    3  
ATOM   5891  C  CB   . SER A 1 99  ? 11.933  -0.426  -17.736 1.00 0.00 ? 254 SER A CB   3  
ATOM   5892  O  OG   . SER A 1 99  ? 10.982  -1.190  -18.465 1.00 0.00 ? 254 SER A OG   3  
ATOM   5893  H  H    . SER A 1 99  ? 10.507  0.259   -15.749 1.00 0.00 ? 254 SER A H    3  
ATOM   5894  H  HA   . SER A 1 99  ? 12.003  -2.129  -16.411 1.00 0.00 ? 254 SER A HA   3  
ATOM   5895  H  HB2  . SER A 1 99  ? 11.566  0.580   -17.620 1.00 0.00 ? 254 SER A HB2  3  
ATOM   5896  H  HB3  . SER A 1 99  ? 12.877  -0.403  -18.267 1.00 0.00 ? 254 SER A HB3  3  
ATOM   5897  H  HG   . SER A 1 99  ? 10.106  -0.948  -18.154 1.00 0.00 ? 254 SER A HG   3  
ATOM   5898  N  N    . THR A 1 100 ? 13.843  0.496   -15.518 1.00 0.00 ? 255 THR A N    3  
ATOM   5899  C  CA   . THR A 1 100 ? 15.216  0.828   -14.984 1.00 0.00 ? 255 THR A CA   3  
ATOM   5900  C  C    . THR A 1 100 ? 15.511  -0.005  -13.723 1.00 0.00 ? 255 THR A C    3  
ATOM   5901  O  O    . THR A 1 100 ? 16.645  -0.370  -13.476 1.00 0.00 ? 255 THR A O    3  
ATOM   5902  C  CB   . THR A 1 100 ? 15.212  2.331   -14.639 1.00 0.00 ? 255 THR A CB   3  
ATOM   5903  O  OG1  . THR A 1 100 ? 14.707  3.087   -15.747 1.00 0.00 ? 255 THR A OG1  3  
ATOM   5904  C  CG2  . THR A 1 100 ? 16.637  2.782   -14.296 1.00 0.00 ? 255 THR A CG2  3  
ATOM   5905  H  H    . THR A 1 100 ? 13.161  1.203   -15.625 1.00 0.00 ? 255 THR A H    3  
ATOM   5906  H  HA   . THR A 1 100 ? 15.962  0.625   -15.733 1.00 0.00 ? 255 THR A HA   3  
ATOM   5907  H  HB   . THR A 1 100 ? 14.576  2.494   -13.783 1.00 0.00 ? 255 THR A HB   3  
ATOM   5908  H  HG1  . THR A 1 100 ? 15.273  2.942   -16.515 1.00 0.00 ? 255 THR A HG1  3  
ATOM   5909  H  HG21 . THR A 1 100 ? 16.595  3.627   -13.625 1.00 0.00 ? 255 THR A HG21 3  
ATOM   5910  H  HG22 . THR A 1 100 ? 17.153  3.067   -15.201 1.00 0.00 ? 255 THR A HG22 3  
ATOM   5911  H  HG23 . THR A 1 100 ? 17.167  1.971   -13.819 1.00 0.00 ? 255 THR A HG23 3  
ATOM   5912  N  N    . ILE A 1 101 ? 14.504  -0.323  -12.929 1.00 0.00 ? 256 ILE A N    3  
ATOM   5913  C  CA   . ILE A 1 101 ? 14.760  -1.149  -11.695 1.00 0.00 ? 256 ILE A CA   3  
ATOM   5914  C  C    . ILE A 1 101 ? 15.434  -2.483  -12.081 1.00 0.00 ? 256 ILE A C    3  
ATOM   5915  O  O    . ILE A 1 101 ? 16.240  -3.003  -11.332 1.00 0.00 ? 256 ILE A O    3  
ATOM   5916  C  CB   . ILE A 1 101 ? 13.387  -1.402  -11.031 1.00 0.00 ? 256 ILE A CB   3  
ATOM   5917  C  CG1  . ILE A 1 101 ? 12.838  -0.081  -10.480 1.00 0.00 ? 256 ILE A CG1  3  
ATOM   5918  C  CG2  . ILE A 1 101 ? 13.533  -2.398  -9.878  1.00 0.00 ? 256 ILE A CG2  3  
ATOM   5919  C  CD1  . ILE A 1 101 ? 11.408  -0.289  -9.978  1.00 0.00 ? 256 ILE A CD1  3  
ATOM   5920  H  H    . ILE A 1 101 ? 13.592  -0.026  -13.149 1.00 0.00 ? 256 ILE A H    3  
ATOM   5921  H  HA   . ILE A 1 101 ? 15.396  -0.606  -11.019 1.00 0.00 ? 256 ILE A HA   3  
ATOM   5922  H  HB   . ILE A 1 101 ? 12.702  -1.799  -11.763 1.00 0.00 ? 256 ILE A HB   3  
ATOM   5923  H  HG12 . ILE A 1 101 ? 13.461  0.254   -9.663  1.00 0.00 ? 256 ILE A HG12 3  
ATOM   5924  H  HG13 . ILE A 1 101 ? 12.838  0.665   -11.259 1.00 0.00 ? 256 ILE A HG13 3  
ATOM   5925  H  HG21 . ILE A 1 101 ? 14.514  -2.296  -9.442  1.00 0.00 ? 256 ILE A HG21 3  
ATOM   5926  H  HG22 . ILE A 1 101 ? 13.412  -3.403  -10.255 1.00 0.00 ? 256 ILE A HG22 3  
ATOM   5927  H  HG23 . ILE A 1 101 ? 12.781  -2.201  -9.132  1.00 0.00 ? 256 ILE A HG23 3  
ATOM   5928  H  HD11 . ILE A 1 101 ? 10.824  0.598   -10.174 1.00 0.00 ? 256 ILE A HD11 3  
ATOM   5929  H  HD12 . ILE A 1 101 ? 11.423  -0.482  -8.915  1.00 0.00 ? 256 ILE A HD12 3  
ATOM   5930  H  HD13 . ILE A 1 101 ? 10.965  -1.133  -10.489 1.00 0.00 ? 256 ILE A HD13 3  
ATOM   5931  N  N    . MET A 1 102 ? 15.122  -3.038  -13.238 1.00 0.00 ? 257 MET A N    3  
ATOM   5932  C  CA   . MET A 1 102 ? 15.775  -4.332  -13.631 1.00 0.00 ? 257 MET A CA   3  
ATOM   5933  C  C    . MET A 1 102 ? 16.971  -4.095  -14.582 1.00 0.00 ? 257 MET A C    3  
ATOM   5934  O  O    . MET A 1 102 ? 17.358  -4.988  -15.313 1.00 0.00 ? 257 MET A O    3  
ATOM   5935  C  CB   . MET A 1 102 ? 14.684  -5.152  -14.331 1.00 0.00 ? 257 MET A CB   3  
ATOM   5936  C  CG   . MET A 1 102 ? 13.905  -5.958  -13.286 1.00 0.00 ? 257 MET A CG   3  
ATOM   5937  S  SD   . MET A 1 102 ? 14.962  -7.277  -12.634 1.00 0.00 ? 257 MET A SD   3  
ATOM   5938  C  CE   . MET A 1 102 ? 13.915  -7.743  -11.232 1.00 0.00 ? 257 MET A CE   3  
ATOM   5939  H  H    . MET A 1 102 ? 14.473  -2.606  -13.842 1.00 0.00 ? 257 MET A H    3  
ATOM   5940  H  HA   . MET A 1 102 ? 16.109  -4.856  -12.750 1.00 0.00 ? 257 MET A HA   3  
ATOM   5941  H  HB2  . MET A 1 102 ? 14.010  -4.487  -14.850 1.00 0.00 ? 257 MET A HB2  3  
ATOM   5942  H  HB3  . MET A 1 102 ? 15.139  -5.829  -15.038 1.00 0.00 ? 257 MET A HB3  3  
ATOM   5943  H  HG2  . MET A 1 102 ? 13.601  -5.307  -12.480 1.00 0.00 ? 257 MET A HG2  3  
ATOM   5944  H  HG3  . MET A 1 102 ? 13.029  -6.392  -13.747 1.00 0.00 ? 257 MET A HG3  3  
ATOM   5945  H  HE1  . MET A 1 102 ? 13.946  -6.961  -10.487 1.00 0.00 ? 257 MET A HE1  3  
ATOM   5946  H  HE2  . MET A 1 102 ? 14.277  -8.662  -10.800 1.00 0.00 ? 257 MET A HE2  3  
ATOM   5947  H  HE3  . MET A 1 102 ? 12.898  -7.882  -11.574 1.00 0.00 ? 257 MET A HE3  3  
ATOM   5948  N  N    . ASP A 1 103 ? 17.570  -2.913  -14.580 1.00 0.00 ? 258 ASP A N    3  
ATOM   5949  C  CA   . ASP A 1 103 ? 18.741  -2.665  -15.485 1.00 0.00 ? 258 ASP A CA   3  
ATOM   5950  C  C    . ASP A 1 103 ? 19.429  -1.332  -15.131 1.00 0.00 ? 258 ASP A C    3  
ATOM   5951  O  O    . ASP A 1 103 ? 19.469  -0.419  -15.935 1.00 0.00 ? 258 ASP A O    3  
ATOM   5952  C  CB   . ASP A 1 103 ? 18.148  -2.607  -16.895 1.00 0.00 ? 258 ASP A CB   3  
ATOM   5953  C  CG   . ASP A 1 103 ? 19.121  -3.246  -17.886 1.00 0.00 ? 258 ASP A CG   3  
ATOM   5954  O  OD1  . ASP A 1 103 ? 19.551  -4.359  -17.630 1.00 0.00 ? 258 ASP A OD1  3  
ATOM   5955  O  OD2  . ASP A 1 103 ? 19.422  -2.612  -18.884 1.00 0.00 ? 258 ASP A OD2  3  
ATOM   5956  H  H    . ASP A 1 103 ? 17.259  -2.196  -13.985 1.00 0.00 ? 258 ASP A H    3  
ATOM   5957  H  HA   . ASP A 1 103 ? 19.446  -3.478  -15.416 1.00 0.00 ? 258 ASP A HA   3  
ATOM   5958  H  HB2  . ASP A 1 103 ? 17.210  -3.145  -16.913 1.00 0.00 ? 258 ASP A HB2  3  
ATOM   5959  H  HB3  . ASP A 1 103 ? 17.978  -1.578  -17.172 1.00 0.00 ? 258 ASP A HB3  3  
ATOM   5960  N  N    . GLU A 1 104 ? 19.964  -1.207  -13.930 1.00 0.00 ? 259 GLU A N    3  
ATOM   5961  C  CA   . GLU A 1 104 ? 20.630  0.071   -13.543 1.00 0.00 ? 259 GLU A CA   3  
ATOM   5962  C  C    . GLU A 1 104 ? 22.045  -0.192  -12.996 1.00 0.00 ? 259 GLU A C    3  
ATOM   5963  O  O    . GLU A 1 104 ? 23.023  0.210   -13.601 1.00 0.00 ? 259 GLU A O    3  
ATOM   5964  C  CB   . GLU A 1 104 ? 19.717  0.682   -12.472 1.00 0.00 ? 259 GLU A CB   3  
ATOM   5965  C  CG   . GLU A 1 104 ? 20.312  2.004   -11.974 1.00 0.00 ? 259 GLU A CG   3  
ATOM   5966  C  CD   . GLU A 1 104 ? 20.243  3.049   -13.090 1.00 0.00 ? 259 GLU A CD   3  
ATOM   5967  O  OE1  . GLU A 1 104 ? 21.100  3.016   -13.958 1.00 0.00 ? 259 GLU A OE1  3  
ATOM   5968  O  OE2  . GLU A 1 104 ? 19.335  3.862   -13.057 1.00 0.00 ? 259 GLU A OE2  3  
ATOM   5969  H  H    . GLU A 1 104 ? 19.920  -1.948  -13.286 1.00 0.00 ? 259 GLU A H    3  
ATOM   5970  H  HA   . GLU A 1 104 ? 20.685  0.725   -14.392 1.00 0.00 ? 259 GLU A HA   3  
ATOM   5971  H  HB2  . GLU A 1 104 ? 18.742  0.868   -12.898 1.00 0.00 ? 259 GLU A HB2  3  
ATOM   5972  H  HB3  . GLU A 1 104 ? 19.619  -0.001  -11.643 1.00 0.00 ? 259 GLU A HB3  3  
ATOM   5973  H  HG2  . GLU A 1 104 ? 19.749  2.351   -11.119 1.00 0.00 ? 259 GLU A HG2  3  
ATOM   5974  H  HG3  . GLU A 1 104 ? 21.342  1.850   -11.690 1.00 0.00 ? 259 GLU A HG3  3  
ATOM   5975  N  N    . ASN A 1 105 ? 22.171  -0.854  -11.866 1.00 0.00 ? 260 ASN A N    3  
ATOM   5976  C  CA   . ASN A 1 105 ? 23.534  -1.124  -11.307 1.00 0.00 ? 260 ASN A CA   3  
ATOM   5977  C  C    . ASN A 1 105 ? 23.527  -2.401  -10.452 1.00 0.00 ? 260 ASN A C    3  
ATOM   5978  O  O    . ASN A 1 105 ? 24.198  -2.476  -9.441  1.00 0.00 ? 260 ASN A O    3  
ATOM   5979  C  CB   . ASN A 1 105 ? 23.853  0.097   -10.442 1.00 0.00 ? 260 ASN A CB   3  
ATOM   5980  C  CG   . ASN A 1 105 ? 24.658  1.112   -11.263 1.00 0.00 ? 260 ASN A CG   3  
ATOM   5981  O  OD1  . ASN A 1 105 ? 25.462  0.732   -12.091 1.00 0.00 ? 260 ASN A OD1  3  
ATOM   5982  N  ND2  . ASN A 1 105 ? 24.480  2.396   -11.072 1.00 0.00 ? 260 ASN A ND2  3  
ATOM   5983  H  H    . ASN A 1 105 ? 21.376  -1.174  -11.386 1.00 0.00 ? 260 ASN A H    3  
ATOM   5984  H  HA   . ASN A 1 105 ? 24.257  -1.208  -12.103 1.00 0.00 ? 260 ASN A HA   3  
ATOM   5985  H  HB2  . ASN A 1 105 ? 22.932  0.552   -10.108 1.00 0.00 ? 260 ASN A HB2  3  
ATOM   5986  H  HB3  . ASN A 1 105 ? 24.433  -0.211  -9.585  1.00 0.00 ? 260 ASN A HB3  3  
ATOM   5987  H  HD21 . ASN A 1 105 ? 23.832  2.715   -10.406 1.00 0.00 ? 260 ASN A HD21 3  
ATOM   5988  H  HD22 . ASN A 1 105 ? 24.995  3.043   -11.598 1.00 0.00 ? 260 ASN A HD22 3  
ATOM   5989  N  N    . ASN A 1 106 ? 22.773  -3.410  -10.847 1.00 0.00 ? 261 ASN A N    3  
ATOM   5990  C  CA   . ASN A 1 106 ? 22.726  -4.683  -10.048 1.00 0.00 ? 261 ASN A CA   3  
ATOM   5991  C  C    . ASN A 1 106 ? 22.439  -4.405  -8.555  1.00 0.00 ? 261 ASN A C    3  
ATOM   5992  O  O    . ASN A 1 106 ? 22.875  -5.148  -7.696  1.00 0.00 ? 261 ASN A O    3  
ATOM   5993  C  CB   . ASN A 1 106 ? 24.112  -5.311  -10.216 1.00 0.00 ? 261 ASN A CB   3  
ATOM   5994  C  CG   . ASN A 1 106 ? 24.081  -6.326  -11.365 1.00 0.00 ? 261 ASN A CG   3  
ATOM   5995  O  OD1  . ASN A 1 106 ? 24.362  -7.491  -11.163 1.00 0.00 ? 261 ASN A OD1  3  
ATOM   5996  N  ND2  . ASN A 1 106 ? 23.749  -5.938  -12.572 1.00 0.00 ? 261 ASN A ND2  3  
ATOM   5997  H  H    . ASN A 1 106 ? 22.233  -3.336  -11.670 1.00 0.00 ? 261 ASN A H    3  
ATOM   5998  H  HA   . ASN A 1 106 ? 21.977  -5.346  -10.452 1.00 0.00 ? 261 ASN A HA   3  
ATOM   5999  H  HB2  . ASN A 1 106 ? 24.833  -4.537  -10.438 1.00 0.00 ? 261 ASN A HB2  3  
ATOM   6000  H  HB3  . ASN A 1 106 ? 24.392  -5.814  -9.302  1.00 0.00 ? 261 ASN A HB3  3  
ATOM   6001  H  HD21 . ASN A 1 106 ? 23.520  -5.000  -12.748 1.00 0.00 ? 261 ASN A HD21 3  
ATOM   6002  H  HD22 . ASN A 1 106 ? 23.730  -6.589  -13.304 1.00 0.00 ? 261 ASN A HD22 3  
ATOM   6003  N  N    . GLN A 1 107 ? 21.707  -3.354  -8.238  1.00 0.00 ? 262 GLN A N    3  
ATOM   6004  C  CA   . GLN A 1 107 ? 21.399  -3.054  -6.798  1.00 0.00 ? 262 GLN A CA   3  
ATOM   6005  C  C    . GLN A 1 107 ? 20.146  -2.166  -6.705  1.00 0.00 ? 262 GLN A C    3  
ATOM   6006  O  O    . GLN A 1 107 ? 20.223  -0.965  -6.884  1.00 0.00 ? 262 GLN A O    3  
ATOM   6007  C  CB   . GLN A 1 107 ? 22.625  -2.306  -6.268  1.00 0.00 ? 262 GLN A CB   3  
ATOM   6008  C  CG   . GLN A 1 107 ? 23.484  -3.249  -5.417  1.00 0.00 ? 262 GLN A CG   3  
ATOM   6009  C  CD   . GLN A 1 107 ? 24.970  -2.977  -5.684  1.00 0.00 ? 262 GLN A CD   3  
ATOM   6010  O  OE1  . GLN A 1 107 ? 25.350  -1.855  -5.954  1.00 0.00 ? 262 GLN A OE1  3  
ATOM   6011  N  NE2  . GLN A 1 107 ? 25.836  -3.958  -5.622  1.00 0.00 ? 262 GLN A NE2  3  
ATOM   6012  H  H    . GLN A 1 107 ? 21.355  -2.764  -8.941  1.00 0.00 ? 262 GLN A H    3  
ATOM   6013  H  HA   . GLN A 1 107 ? 21.254  -3.969  -6.245  1.00 0.00 ? 262 GLN A HA   3  
ATOM   6014  H  HB2  . GLN A 1 107 ? 23.208  -1.936  -7.099  1.00 0.00 ? 262 GLN A HB2  3  
ATOM   6015  H  HB3  . GLN A 1 107 ? 22.302  -1.475  -5.658  1.00 0.00 ? 262 GLN A HB3  3  
ATOM   6016  H  HG2  . GLN A 1 107 ? 23.269  -3.084  -4.371  1.00 0.00 ? 262 GLN A HG2  3  
ATOM   6017  H  HG3  . GLN A 1 107 ? 23.257  -4.274  -5.674  1.00 0.00 ? 262 GLN A HG3  3  
ATOM   6018  H  HE21 . GLN A 1 107 ? 25.541  -4.870  -5.405  1.00 0.00 ? 262 GLN A HE21 3  
ATOM   6019  H  HE22 . GLN A 1 107 ? 26.785  -3.782  -5.792  1.00 0.00 ? 262 GLN A HE22 3  
ATOM   6020  N  N    . TRP A 1 108 ? 18.992  -2.747  -6.451  1.00 0.00 ? 263 TRP A N    3  
ATOM   6021  C  CA   . TRP A 1 108 ? 17.747  -1.925  -6.381  1.00 0.00 ? 263 TRP A CA   3  
ATOM   6022  C  C    . TRP A 1 108 ? 17.219  -1.815  -4.938  1.00 0.00 ? 263 TRP A C    3  
ATOM   6023  O  O    . TRP A 1 108 ? 17.153  -2.793  -4.217  1.00 0.00 ? 263 TRP A O    3  
ATOM   6024  C  CB   . TRP A 1 108 ? 16.738  -2.677  -7.268  1.00 0.00 ? 263 TRP A CB   3  
ATOM   6025  C  CG   . TRP A 1 108 ? 15.377  -2.050  -7.165  1.00 0.00 ? 263 TRP A CG   3  
ATOM   6026  C  CD1  . TRP A 1 108 ? 15.070  -0.786  -7.532  1.00 0.00 ? 263 TRP A CD1  3  
ATOM   6027  C  CD2  . TRP A 1 108 ? 14.144  -2.641  -6.664  1.00 0.00 ? 263 TRP A CD2  3  
ATOM   6028  N  NE1  . TRP A 1 108 ? 13.728  -0.560  -7.278  1.00 0.00 ? 263 TRP A NE1  3  
ATOM   6029  C  CE2  . TRP A 1 108 ? 13.114  -1.675  -6.745  1.00 0.00 ? 263 TRP A CE2  3  
ATOM   6030  C  CE3  . TRP A 1 108 ? 13.823  -3.911  -6.154  1.00 0.00 ? 263 TRP A CE3  3  
ATOM   6031  C  CZ2  . TRP A 1 108 ? 11.811  -1.958  -6.329  1.00 0.00 ? 263 TRP A CZ2  3  
ATOM   6032  C  CZ3  . TRP A 1 108 ? 12.514  -4.200  -5.735  1.00 0.00 ? 263 TRP A CZ3  3  
ATOM   6033  C  CH2  . TRP A 1 108 ? 11.510  -3.224  -5.821  1.00 0.00 ? 263 TRP A CH2  3  
ATOM   6034  H  H    . TRP A 1 108 ? 18.941  -3.720  -6.327  1.00 0.00 ? 263 TRP A H    3  
ATOM   6035  H  HA   . TRP A 1 108 ? 17.925  -0.942  -6.788  1.00 0.00 ? 263 TRP A HA   3  
ATOM   6036  H  HB2  . TRP A 1 108 ? 17.076  -2.646  -8.290  1.00 0.00 ? 263 TRP A HB2  3  
ATOM   6037  H  HB3  . TRP A 1 108 ? 16.682  -3.707  -6.946  1.00 0.00 ? 263 TRP A HB3  3  
ATOM   6038  H  HD1  . TRP A 1 108 ? 15.757  -0.071  -7.951  1.00 0.00 ? 263 TRP A HD1  3  
ATOM   6039  H  HE1  . TRP A 1 108 ? 13.253  0.279   -7.452  1.00 0.00 ? 263 TRP A HE1  3  
ATOM   6040  H  HE3  . TRP A 1 108 ? 14.589  -4.669  -6.086  1.00 0.00 ? 263 TRP A HE3  3  
ATOM   6041  H  HZ2  . TRP A 1 108 ? 11.042  -1.202  -6.398  1.00 0.00 ? 263 TRP A HZ2  3  
ATOM   6042  H  HZ3  . TRP A 1 108 ? 12.279  -5.178  -5.343  1.00 0.00 ? 263 TRP A HZ3  3  
ATOM   6043  H  HH2  . TRP A 1 108 ? 10.505  -3.451  -5.498  1.00 0.00 ? 263 TRP A HH2  3  
ATOM   6044  N  N    . TYR A 1 109 ? 16.780  -0.636  -4.542  1.00 0.00 ? 264 TYR A N    3  
ATOM   6045  C  CA   . TYR A 1 109 ? 16.184  -0.476  -3.181  1.00 0.00 ? 264 TYR A CA   3  
ATOM   6046  C  C    . TYR A 1 109 ? 14.668  -0.573  -3.352  1.00 0.00 ? 264 TYR A C    3  
ATOM   6047  O  O    . TYR A 1 109 ? 14.148  -0.177  -4.381  1.00 0.00 ? 264 TYR A O    3  
ATOM   6048  C  CB   . TYR A 1 109 ? 16.605  0.910   -2.679  1.00 0.00 ? 264 TYR A CB   3  
ATOM   6049  C  CG   . TYR A 1 109 ? 17.811  0.760   -1.783  1.00 0.00 ? 264 TYR A CG   3  
ATOM   6050  C  CD1  . TYR A 1 109 ? 17.643  0.430   -0.434  1.00 0.00 ? 264 TYR A CD1  3  
ATOM   6051  C  CD2  . TYR A 1 109 ? 19.097  0.942   -2.304  1.00 0.00 ? 264 TYR A CD2  3  
ATOM   6052  C  CE1  . TYR A 1 109 ? 18.759  0.283   0.396   1.00 0.00 ? 264 TYR A CE1  3  
ATOM   6053  C  CE2  . TYR A 1 109 ? 20.214  0.796   -1.476  1.00 0.00 ? 264 TYR A CE2  3  
ATOM   6054  C  CZ   . TYR A 1 109 ? 20.046  0.465   -0.126  1.00 0.00 ? 264 TYR A CZ   3  
ATOM   6055  O  OH   . TYR A 1 109 ? 21.149  0.321   0.692   1.00 0.00 ? 264 TYR A OH   3  
ATOM   6056  H  H    . TYR A 1 109 ? 16.795  0.130   -5.162  1.00 0.00 ? 264 TYR A H    3  
ATOM   6057  H  HA   . TYR A 1 109 ? 16.540  -1.247  -2.512  1.00 0.00 ? 264 TYR A HA   3  
ATOM   6058  H  HB2  . TYR A 1 109 ? 16.854  1.540   -3.520  1.00 0.00 ? 264 TYR A HB2  3  
ATOM   6059  H  HB3  . TYR A 1 109 ? 15.796  1.354   -2.120  1.00 0.00 ? 264 TYR A HB3  3  
ATOM   6060  H  HD1  . TYR A 1 109 ? 16.650  0.288   -0.032  1.00 0.00 ? 264 TYR A HD1  3  
ATOM   6061  H  HD2  . TYR A 1 109 ? 19.225  1.197   -3.346  1.00 0.00 ? 264 TYR A HD2  3  
ATOM   6062  H  HE1  . TYR A 1 109 ? 18.627  0.029   1.438   1.00 0.00 ? 264 TYR A HE1  3  
ATOM   6063  H  HE2  . TYR A 1 109 ? 21.205  0.933   -1.880  1.00 0.00 ? 264 TYR A HE2  3  
ATOM   6064  H  HH   . TYR A 1 109 ? 21.290  1.153   1.151   1.00 0.00 ? 264 TYR A HH   3  
ATOM   6065  N  N    . CYS A 1 110 ? 13.952  -1.122  -2.399  1.00 0.00 ? 265 CYS A N    3  
ATOM   6066  C  CA   . CYS A 1 110 ? 12.478  -1.261  -2.587  1.00 0.00 ? 265 CYS A CA   3  
ATOM   6067  C  C    . CYS A 1 110 ? 11.699  -0.643  -1.399  1.00 0.00 ? 265 CYS A C    3  
ATOM   6068  O  O    . CYS A 1 110 ? 12.140  0.329   -0.815  1.00 0.00 ? 265 CYS A O    3  
ATOM   6069  C  CB   . CYS A 1 110 ? 12.270  -2.782  -2.759  1.00 0.00 ? 265 CYS A CB   3  
ATOM   6070  S  SG   . CYS A 1 110 ? 12.419  -3.653  -1.175  1.00 0.00 ? 265 CYS A SG   3  
ATOM   6071  H  H    . CYS A 1 110 ? 14.377  -1.464  -1.583  1.00 0.00 ? 265 CYS A H    3  
ATOM   6072  H  HA   . CYS A 1 110 ? 12.186  -0.762  -3.498  1.00 0.00 ? 265 CYS A HA   3  
ATOM   6073  H  HB2  . CYS A 1 110 ? 11.286  -2.959  -3.165  1.00 0.00 ? 265 CYS A HB2  3  
ATOM   6074  H  HB3  . CYS A 1 110 ? 13.010  -3.164  -3.447  1.00 0.00 ? 265 CYS A HB3  3  
ATOM   6075  N  N    . TYR A 1 111 ? 10.539  -1.172  -1.052  1.00 0.00 ? 266 TYR A N    3  
ATOM   6076  C  CA   . TYR A 1 111 ? 9.748   -0.571  0.080   1.00 0.00 ? 266 TYR A CA   3  
ATOM   6077  C  C    . TYR A 1 111 ? 10.100  -1.257  1.415   1.00 0.00 ? 266 TYR A C    3  
ATOM   6078  O  O    . TYR A 1 111 ? 10.161  -0.610  2.444   1.00 0.00 ? 266 TYR A O    3  
ATOM   6079  C  CB   . TYR A 1 111 ? 8.262   -0.788  -0.276  1.00 0.00 ? 266 TYR A CB   3  
ATOM   6080  C  CG   . TYR A 1 111 ? 7.976   -0.239  -1.662  1.00 0.00 ? 266 TYR A CG   3  
ATOM   6081  C  CD1  . TYR A 1 111 ? 7.653   1.111   -1.829  1.00 0.00 ? 266 TYR A CD1  3  
ATOM   6082  C  CD2  . TYR A 1 111 ? 8.041   -1.084  -2.780  1.00 0.00 ? 266 TYR A CD2  3  
ATOM   6083  C  CE1  . TYR A 1 111 ? 7.397   1.619   -3.108  1.00 0.00 ? 266 TYR A CE1  3  
ATOM   6084  C  CE2  . TYR A 1 111 ? 7.785   -0.577  -4.059  1.00 0.00 ? 266 TYR A CE2  3  
ATOM   6085  C  CZ   . TYR A 1 111 ? 7.463   0.775   -4.224  1.00 0.00 ? 266 TYR A CZ   3  
ATOM   6086  O  OH   . TYR A 1 111 ? 7.210   1.276   -5.485  1.00 0.00 ? 266 TYR A OH   3  
ATOM   6087  H  H    . TYR A 1 111 ? 10.181  -1.948  -1.536  1.00 0.00 ? 266 TYR A H    3  
ATOM   6088  H  HA   . TYR A 1 111 ? 9.953   0.487   0.147   1.00 0.00 ? 266 TYR A HA   3  
ATOM   6089  H  HB2  . TYR A 1 111 ? 8.039   -1.844  -0.257  1.00 0.00 ? 266 TYR A HB2  3  
ATOM   6090  H  HB3  . TYR A 1 111 ? 7.642   -0.277  0.445   1.00 0.00 ? 266 TYR A HB3  3  
ATOM   6091  H  HD1  . TYR A 1 111 ? 7.603   1.762   -0.972  1.00 0.00 ? 266 TYR A HD1  3  
ATOM   6092  H  HD2  . TYR A 1 111 ? 8.290   -2.127  -2.654  1.00 0.00 ? 266 TYR A HD2  3  
ATOM   6093  H  HE1  . TYR A 1 111 ? 7.148   2.662   -3.235  1.00 0.00 ? 266 TYR A HE1  3  
ATOM   6094  H  HE2  . TYR A 1 111 ? 7.838   -1.229  -4.920  1.00 0.00 ? 266 TYR A HE2  3  
ATOM   6095  H  HH   . TYR A 1 111 ? 8.041   1.306   -5.965  1.00 0.00 ? 266 TYR A HH   3  
ATOM   6096  N  N    . ILE A 1 112 ? 10.345  -2.554  1.414   1.00 0.00 ? 267 ILE A N    3  
ATOM   6097  C  CA   . ILE A 1 112 ? 10.706  -3.248  2.706   1.00 0.00 ? 267 ILE A CA   3  
ATOM   6098  C  C    . ILE A 1 112 ? 12.062  -2.726  3.217   1.00 0.00 ? 267 ILE A C    3  
ATOM   6099  O  O    . ILE A 1 112 ? 12.246  -2.515  4.401   1.00 0.00 ? 267 ILE A O    3  
ATOM   6100  C  CB   . ILE A 1 112 ? 10.814  -4.764  2.412   1.00 0.00 ? 267 ILE A CB   3  
ATOM   6101  C  CG1  . ILE A 1 112 ? 9.517   -5.309  1.775   1.00 0.00 ? 267 ILE A CG1  3  
ATOM   6102  C  CG2  . ILE A 1 112 ? 11.061  -5.506  3.727   1.00 0.00 ? 267 ILE A CG2  3  
ATOM   6103  C  CD1  . ILE A 1 112 ? 8.305   -4.994  2.660   1.00 0.00 ? 267 ILE A CD1  3  
ATOM   6104  H  H    . ILE A 1 112 ? 10.300  -3.055  0.574   1.00 0.00 ? 267 ILE A H    3  
ATOM   6105  H  HA   . ILE A 1 112 ? 9.944   -3.071  3.445   1.00 0.00 ? 267 ILE A HA   3  
ATOM   6106  H  HB   . ILE A 1 112 ? 11.654  -4.941  1.743   1.00 0.00 ? 267 ILE A HB   3  
ATOM   6107  H  HG12 . ILE A 1 112 ? 9.371   -4.867  0.804   1.00 0.00 ? 267 ILE A HG12 3  
ATOM   6108  H  HG13 . ILE A 1 112 ? 9.603   -6.379  1.665   1.00 0.00 ? 267 ILE A HG13 3  
ATOM   6109  H  HG21 . ILE A 1 112 ? 11.227  -6.554  3.524   1.00 0.00 ? 267 ILE A HG21 3  
ATOM   6110  H  HG22 . ILE A 1 112 ? 10.197  -5.396  4.368   1.00 0.00 ? 267 ILE A HG22 3  
ATOM   6111  H  HG23 . ILE A 1 112 ? 11.928  -5.091  4.218   1.00 0.00 ? 267 ILE A HG23 3  
ATOM   6112  H  HD11 . ILE A 1 112 ? 7.646   -4.318  2.135   1.00 0.00 ? 267 ILE A HD11 3  
ATOM   6113  H  HD12 . ILE A 1 112 ? 8.634   -4.537  3.581   1.00 0.00 ? 267 ILE A HD12 3  
ATOM   6114  H  HD13 . ILE A 1 112 ? 7.777   -5.909  2.882   1.00 0.00 ? 267 ILE A HD13 3  
ATOM   6115  N  N    . CYS A 1 113 ? 13.012  -2.517  2.330   1.00 0.00 ? 268 CYS A N    3  
ATOM   6116  C  CA   . CYS A 1 113 ? 14.363  -2.008  2.757   1.00 0.00 ? 268 CYS A CA   3  
ATOM   6117  C  C    . CYS A 1 113 ? 14.212  -0.689  3.527   1.00 0.00 ? 268 CYS A C    3  
ATOM   6118  O  O    . CYS A 1 113 ? 14.765  -0.524  4.598   1.00 0.00 ? 268 CYS A O    3  
ATOM   6119  C  CB   . CYS A 1 113 ? 15.153  -1.762  1.460   1.00 0.00 ? 268 CYS A CB   3  
ATOM   6120  S  SG   . CYS A 1 113 ? 15.786  -3.334  0.823   1.00 0.00 ? 268 CYS A SG   3  
ATOM   6121  H  H    . CYS A 1 113 ? 12.835  -2.695  1.388   1.00 0.00 ? 268 CYS A H    3  
ATOM   6122  H  HA   . CYS A 1 113 ? 14.871  -2.742  3.363   1.00 0.00 ? 268 CYS A HA   3  
ATOM   6123  H  HB2  . CYS A 1 113 ? 14.503  -1.313  0.723   1.00 0.00 ? 268 CYS A HB2  3  
ATOM   6124  H  HB3  . CYS A 1 113 ? 15.978  -1.098  1.662   1.00 0.00 ? 268 CYS A HB3  3  
ATOM   6125  N  N    . HIS A 1 114 ? 13.456  0.250   2.993   1.00 0.00 ? 269 HIS A N    3  
ATOM   6126  C  CA   . HIS A 1 114 ? 13.261  1.559   3.703   1.00 0.00 ? 269 HIS A CA   3  
ATOM   6127  C  C    . HIS A 1 114 ? 12.251  2.446   2.953   1.00 0.00 ? 269 HIS A C    3  
ATOM   6128  O  O    . HIS A 1 114 ? 11.991  2.226   1.787   1.00 0.00 ? 269 HIS A O    3  
ATOM   6129  C  CB   . HIS A 1 114 ? 14.643  2.232   3.755   1.00 0.00 ? 269 HIS A CB   3  
ATOM   6130  C  CG   . HIS A 1 114 ? 15.249  2.376   2.377   1.00 0.00 ? 269 HIS A CG   3  
ATOM   6131  N  ND1  . HIS A 1 114 ? 16.482  2.983   2.195   1.00 0.00 ? 269 HIS A ND1  3  
ATOM   6132  C  CD2  . HIS A 1 114 ? 14.827  2.012   1.115   1.00 0.00 ? 269 HIS A CD2  3  
ATOM   6133  C  CE1  . HIS A 1 114 ? 16.757  2.968   0.879   1.00 0.00 ? 269 HIS A CE1  3  
ATOM   6134  N  NE2  . HIS A 1 114 ? 15.782  2.389   0.177   1.00 0.00 ? 269 HIS A NE2  3  
ATOM   6135  H  H    . HIS A 1 114 ? 13.007  0.088   2.133   1.00 0.00 ? 269 HIS A H    3  
ATOM   6136  H  HA   . HIS A 1 114 ? 12.911  1.379   4.707   1.00 0.00 ? 269 HIS A HA   3  
ATOM   6137  H  HB2  . HIS A 1 114 ? 14.542  3.212   4.197   1.00 0.00 ? 269 HIS A HB2  3  
ATOM   6138  H  HB3  . HIS A 1 114 ? 15.301  1.637   4.370   1.00 0.00 ? 269 HIS A HB3  3  
ATOM   6139  H  HD1  . HIS A 1 114 ? 17.052  3.357   2.899   1.00 0.00 ? 269 HIS A HD1  3  
ATOM   6140  H  HD2  . HIS A 1 114 ? 13.906  1.506   0.883   1.00 0.00 ? 269 HIS A HD2  3  
ATOM   6141  H  HE1  . HIS A 1 114 ? 17.661  3.367   0.445   1.00 0.00 ? 269 HIS A HE1  3  
ATOM   6142  N  N    . PRO A 1 115 ? 11.700  3.420   3.646   1.00 0.00 ? 270 PRO A N    3  
ATOM   6143  C  CA   . PRO A 1 115 ? 10.707  4.320   3.011   1.00 0.00 ? 270 PRO A CA   3  
ATOM   6144  C  C    . PRO A 1 115 ? 11.389  5.221   1.971   1.00 0.00 ? 270 PRO A C    3  
ATOM   6145  O  O    . PRO A 1 115 ? 11.556  6.407   2.188   1.00 0.00 ? 270 PRO A O    3  
ATOM   6146  C  CB   . PRO A 1 115 ? 10.162  5.141   4.179   1.00 0.00 ? 270 PRO A CB   3  
ATOM   6147  C  CG   . PRO A 1 115 ? 11.242  5.104   5.210   1.00 0.00 ? 270 PRO A CG   3  
ATOM   6148  C  CD   . PRO A 1 115 ? 11.939  3.780   5.056   1.00 0.00 ? 270 PRO A CD   3  
ATOM   6149  H  HA   . PRO A 1 115 ? 9.913   3.750   2.559   1.00 0.00 ? 270 PRO A HA   3  
ATOM   6150  H  HB2  . PRO A 1 115 ? 9.972   6.159   3.865   1.00 0.00 ? 270 PRO A HB2  3  
ATOM   6151  H  HB3  . PRO A 1 115 ? 9.262   4.691   4.569   1.00 0.00 ? 270 PRO A HB3  3  
ATOM   6152  H  HG2  . PRO A 1 115 ? 11.937  5.915   5.046   1.00 0.00 ? 270 PRO A HG2  3  
ATOM   6153  H  HG3  . PRO A 1 115 ? 10.813  5.176   6.198   1.00 0.00 ? 270 PRO A HG3  3  
ATOM   6154  H  HD2  . PRO A 1 115 ? 12.998  3.887   5.251   1.00 0.00 ? 270 PRO A HD2  3  
ATOM   6155  H  HD3  . PRO A 1 115 ? 11.503  3.040   5.708   1.00 0.00 ? 270 PRO A HD3  3  
ATOM   6156  N  N    . GLU A 1 116 ? 11.786  4.671   0.838   1.00 0.00 ? 271 GLU A N    3  
ATOM   6157  C  CA   . GLU A 1 116 ? 12.454  5.514   -0.201  1.00 0.00 ? 271 GLU A CA   3  
ATOM   6158  C  C    . GLU A 1 116 ? 11.479  5.840   -1.350  1.00 0.00 ? 271 GLU A C    3  
ATOM   6159  O  O    . GLU A 1 116 ? 11.217  7.003   -1.592  1.00 0.00 ? 271 GLU A O    3  
ATOM   6160  C  CB   . GLU A 1 116 ? 13.667  4.711   -0.695  1.00 0.00 ? 271 GLU A CB   3  
ATOM   6161  C  CG   . GLU A 1 116 ? 14.965  5.402   -0.263  1.00 0.00 ? 271 GLU A CG   3  
ATOM   6162  C  CD   . GLU A 1 116 ? 15.076  6.760   -0.955  1.00 0.00 ? 271 GLU A CD   3  
ATOM   6163  O  OE1  . GLU A 1 116 ? 15.555  6.794   -2.077  1.00 0.00 ? 271 GLU A OE1  3  
ATOM   6164  O  OE2  . GLU A 1 116 ? 14.681  7.745   -0.352  1.00 0.00 ? 271 GLU A OE2  3  
ATOM   6165  H  H    . GLU A 1 116 ? 11.645  3.714   0.677   1.00 0.00 ? 271 GLU A H    3  
ATOM   6166  H  HA   . GLU A 1 116 ? 12.791  6.435   0.250   1.00 0.00 ? 271 GLU A HA   3  
ATOM   6167  H  HB2  . GLU A 1 116 ? 13.633  3.713   -0.275  1.00 0.00 ? 271 GLU A HB2  3  
ATOM   6168  H  HB3  . GLU A 1 116 ? 13.640  4.645   -1.772  1.00 0.00 ? 271 GLU A HB3  3  
ATOM   6169  H  HG2  . GLU A 1 116 ? 14.957  5.541   0.809   1.00 0.00 ? 271 GLU A HG2  3  
ATOM   6170  H  HG3  . GLU A 1 116 ? 15.809  4.788   -0.540  1.00 0.00 ? 271 GLU A HG3  3  
ATOM   6171  N  N    . PRO A 1 117 ? 10.954  4.832   -2.034  1.00 0.00 ? 272 PRO A N    3  
ATOM   6172  C  CA   . PRO A 1 117 ? 10.009  5.104   -3.143  1.00 0.00 ? 272 PRO A CA   3  
ATOM   6173  C  C    . PRO A 1 117 ? 8.532   5.162   -2.682  1.00 0.00 ? 272 PRO A C    3  
ATOM   6174  O  O    . PRO A 1 117 ? 7.647   4.844   -3.456  1.00 0.00 ? 272 PRO A O    3  
ATOM   6175  C  CB   . PRO A 1 117 ? 10.203  3.907   -4.063  1.00 0.00 ? 272 PRO A CB   3  
ATOM   6176  C  CG   . PRO A 1 117 ? 10.694  2.792   -3.186  1.00 0.00 ? 272 PRO A CG   3  
ATOM   6177  C  CD   . PRO A 1 117 ? 11.184  3.386   -1.885  1.00 0.00 ? 272 PRO A CD   3  
ATOM   6178  H  HA   . PRO A 1 117 ? 10.284  6.006   -3.655  1.00 0.00 ? 272 PRO A HA   3  
ATOM   6179  H  HB2  . PRO A 1 117 ? 9.264   3.637   -4.525  1.00 0.00 ? 272 PRO A HB2  3  
ATOM   6180  H  HB3  . PRO A 1 117 ? 10.941  4.132   -4.819  1.00 0.00 ? 272 PRO A HB3  3  
ATOM   6181  H  HG2  . PRO A 1 117 ? 9.887   2.100   -2.992  1.00 0.00 ? 272 PRO A HG2  3  
ATOM   6182  H  HG3  . PRO A 1 117 ? 11.507  2.275   -3.673  1.00 0.00 ? 272 PRO A HG3  3  
ATOM   6183  H  HD2  . PRO A 1 117 ? 10.617  2.988   -1.056  1.00 0.00 ? 272 PRO A HD2  3  
ATOM   6184  H  HD3  . PRO A 1 117 ? 12.228  3.177   -1.762  1.00 0.00 ? 272 PRO A HD3  3  
ATOM   6185  N  N    . LEU A 1 118 ? 8.238   5.560   -1.457  1.00 0.00 ? 273 LEU A N    3  
ATOM   6186  C  CA   . LEU A 1 118 ? 6.800   5.619   -1.024  1.00 0.00 ? 273 LEU A CA   3  
ATOM   6187  C  C    . LEU A 1 118 ? 6.596   6.595   0.155   1.00 0.00 ? 273 LEU A C    3  
ATOM   6188  O  O    . LEU A 1 118 ? 5.772   6.352   1.017   1.00 0.00 ? 273 LEU A O    3  
ATOM   6189  C  CB   . LEU A 1 118 ? 6.424   4.173   -0.632  1.00 0.00 ? 273 LEU A CB   3  
ATOM   6190  C  CG   . LEU A 1 118 ? 7.093   3.747   0.689   1.00 0.00 ? 273 LEU A CG   3  
ATOM   6191  C  CD1  . LEU A 1 118 ? 6.455   2.447   1.182   1.00 0.00 ? 273 LEU A CD1  3  
ATOM   6192  C  CD2  . LEU A 1 118 ? 8.589   3.524   0.463   1.00 0.00 ? 273 LEU A CD2  3  
ATOM   6193  H  H    . LEU A 1 118 ? 8.944   5.818   -0.835  1.00 0.00 ? 273 LEU A H    3  
ATOM   6194  H  HA   . LEU A 1 118 ? 6.187   5.929   -1.856  1.00 0.00 ? 273 LEU A HA   3  
ATOM   6195  H  HB2  . LEU A 1 118 ? 5.353   4.105   -0.522  1.00 0.00 ? 273 LEU A HB2  3  
ATOM   6196  H  HB3  . LEU A 1 118 ? 6.739   3.504   -1.420  1.00 0.00 ? 273 LEU A HB3  3  
ATOM   6197  H  HG   . LEU A 1 118 ? 6.949   4.515   1.433   1.00 0.00 ? 273 LEU A HG   3  
ATOM   6198  H  HD11 . LEU A 1 118 ? 5.613   2.679   1.817   1.00 0.00 ? 273 LEU A HD11 3  
ATOM   6199  H  HD12 . LEU A 1 118 ? 7.182   1.878   1.741   1.00 0.00 ? 273 LEU A HD12 3  
ATOM   6200  H  HD13 . LEU A 1 118 ? 6.117   1.865   0.336   1.00 0.00 ? 273 LEU A HD13 3  
ATOM   6201  H  HD21 . LEU A 1 118 ? 8.768   3.347   -0.586  1.00 0.00 ? 273 LEU A HD21 3  
ATOM   6202  H  HD22 . LEU A 1 118 ? 8.921   2.671   1.036   1.00 0.00 ? 273 LEU A HD22 3  
ATOM   6203  H  HD23 . LEU A 1 118 ? 9.134   4.403   0.777   1.00 0.00 ? 273 LEU A HD23 3  
ATOM   6204  N  N    . LEU A 1 119 ? 7.323   7.696   0.201   1.00 0.00 ? 274 LEU A N    3  
ATOM   6205  C  CA   . LEU A 1 119 ? 7.124   8.662   1.346   1.00 0.00 ? 274 LEU A CA   3  
ATOM   6206  C  C    . LEU A 1 119 ? 5.670   9.158   1.362   1.00 0.00 ? 274 LEU A C    3  
ATOM   6207  O  O    . LEU A 1 119 ? 5.066   9.279   2.412   1.00 0.00 ? 274 LEU A O    3  
ATOM   6208  C  CB   . LEU A 1 119 ? 8.095   9.850   1.136   1.00 0.00 ? 274 LEU A CB   3  
ATOM   6209  C  CG   . LEU A 1 119 ? 9.116   9.908   2.284   1.00 0.00 ? 274 LEU A CG   3  
ATOM   6210  C  CD1  . LEU A 1 119 ? 8.389   10.081  3.623   1.00 0.00 ? 274 LEU A CD1  3  
ATOM   6211  C  CD2  . LEU A 1 119 ? 9.935   8.614   2.313   1.00 0.00 ? 274 LEU A CD2  3  
ATOM   6212  H  H    . LEU A 1 119 ? 7.978   7.881   -0.508  1.00 0.00 ? 274 LEU A H    3  
ATOM   6213  H  HA   . LEU A 1 119 ? 7.347   8.170   2.277   1.00 0.00 ? 274 LEU A HA   3  
ATOM   6214  H  HB2  . LEU A 1 119 ? 8.619   9.734   0.201   1.00 0.00 ? 274 LEU A HB2  3  
ATOM   6215  H  HB3  . LEU A 1 119 ? 7.534   10.772  1.116   1.00 0.00 ? 274 LEU A HB3  3  
ATOM   6216  H  HG   . LEU A 1 119 ? 9.777   10.749  2.129   1.00 0.00 ? 274 LEU A HG   3  
ATOM   6217  H  HD11 . LEU A 1 119 ? 7.538   10.734  3.490   1.00 0.00 ? 274 LEU A HD11 3  
ATOM   6218  H  HD12 . LEU A 1 119 ? 9.063   10.513  4.346   1.00 0.00 ? 274 LEU A HD12 3  
ATOM   6219  H  HD13 . LEU A 1 119 ? 8.050   9.117   3.976   1.00 0.00 ? 274 LEU A HD13 3  
ATOM   6220  H  HD21 . LEU A 1 119 ? 10.946  8.835   2.619   1.00 0.00 ? 274 LEU A HD21 3  
ATOM   6221  H  HD22 . LEU A 1 119 ? 9.945   8.172   1.327   1.00 0.00 ? 274 LEU A HD22 3  
ATOM   6222  H  HD23 . LEU A 1 119 ? 9.489   7.921   3.012   1.00 0.00 ? 274 LEU A HD23 3  
ATOM   6223  N  N    . ASP A 1 120 ? 5.097   9.435   0.208   1.00 0.00 ? 275 ASP A N    3  
ATOM   6224  C  CA   . ASP A 1 120 ? 3.666   9.911   0.183   1.00 0.00 ? 275 ASP A CA   3  
ATOM   6225  C  C    . ASP A 1 120 ? 2.749   8.832   0.783   1.00 0.00 ? 275 ASP A C    3  
ATOM   6226  O  O    . ASP A 1 120 ? 1.815   9.140   1.498   1.00 0.00 ? 275 ASP A O    3  
ATOM   6227  C  CB   . ASP A 1 120 ? 3.303   10.156  -1.291  1.00 0.00 ? 275 ASP A CB   3  
ATOM   6228  C  CG   . ASP A 1 120 ? 3.919   11.476  -1.756  1.00 0.00 ? 275 ASP A CG   3  
ATOM   6229  O  OD1  . ASP A 1 120 ? 5.128   11.522  -1.908  1.00 0.00 ? 275 ASP A OD1  3  
ATOM   6230  O  OD2  . ASP A 1 120 ? 3.171   12.420  -1.951  1.00 0.00 ? 275 ASP A OD2  3  
ATOM   6231  H  H    . ASP A 1 120 ? 5.603   9.321   -0.630  1.00 0.00 ? 275 ASP A H    3  
ATOM   6232  H  HA   . ASP A 1 120 ? 3.572   10.825  0.741   1.00 0.00 ? 275 ASP A HA   3  
ATOM   6233  H  HB2  . ASP A 1 120 ? 3.686   9.346   -1.896  1.00 0.00 ? 275 ASP A HB2  3  
ATOM   6234  H  HB3  . ASP A 1 120 ? 2.230   10.205  -1.394  1.00 0.00 ? 275 ASP A HB3  3  
ATOM   6235  N  N    . LEU A 1 121 ? 3.007   7.571   0.498   1.00 0.00 ? 276 LEU A N    3  
ATOM   6236  C  CA   . LEU A 1 121 ? 2.132   6.482   1.068   1.00 0.00 ? 276 LEU A CA   3  
ATOM   6237  C  C    . LEU A 1 121 ? 2.154   6.534   2.603   1.00 0.00 ? 276 LEU A C    3  
ATOM   6238  O  O    . LEU A 1 121 ? 1.132   6.377   3.245   1.00 0.00 ? 276 LEU A O    3  
ATOM   6239  C  CB   . LEU A 1 121 ? 2.711   5.140   0.585   1.00 0.00 ? 276 LEU A CB   3  
ATOM   6240  C  CG   . LEU A 1 121 ? 2.004   4.702   -0.699  1.00 0.00 ? 276 LEU A CG   3  
ATOM   6241  C  CD1  . LEU A 1 121 ? 2.699   5.329   -1.909  1.00 0.00 ? 276 LEU A CD1  3  
ATOM   6242  C  CD2  . LEU A 1 121 ? 2.065   3.176   -0.815  1.00 0.00 ? 276 LEU A CD2  3  
ATOM   6243  H  H    . LEU A 1 121 ? 3.769   7.347   -0.084  1.00 0.00 ? 276 LEU A H    3  
ATOM   6244  H  HA   . LEU A 1 121 ? 1.124   6.597   0.714   1.00 0.00 ? 276 LEU A HA   3  
ATOM   6245  H  HB2  . LEU A 1 121 ? 3.768   5.249   0.395   1.00 0.00 ? 276 LEU A HB2  3  
ATOM   6246  H  HB3  . LEU A 1 121 ? 2.559   4.392   1.348   1.00 0.00 ? 276 LEU A HB3  3  
ATOM   6247  H  HG   . LEU A 1 121 ? 0.973   5.021   -0.670  1.00 0.00 ? 276 LEU A HG   3  
ATOM   6248  H  HD11 . LEU A 1 121 ? 2.217   4.993   -2.817  1.00 0.00 ? 276 LEU A HD11 3  
ATOM   6249  H  HD12 . LEU A 1 121 ? 3.737   5.030   -1.924  1.00 0.00 ? 276 LEU A HD12 3  
ATOM   6250  H  HD13 . LEU A 1 121 ? 2.634   6.405   -1.845  1.00 0.00 ? 276 LEU A HD13 3  
ATOM   6251  H  HD21 . LEU A 1 121 ? 1.747   2.876   -1.802  1.00 0.00 ? 276 LEU A HD21 3  
ATOM   6252  H  HD22 . LEU A 1 121 ? 1.413   2.735   -0.076  1.00 0.00 ? 276 LEU A HD22 3  
ATOM   6253  H  HD23 . LEU A 1 121 ? 3.079   2.841   -0.646  1.00 0.00 ? 276 LEU A HD23 3  
ATOM   6254  N  N    . VAL A 1 122 ? 3.307   6.756   3.197   1.00 0.00 ? 277 VAL A N    3  
ATOM   6255  C  CA   . VAL A 1 122 ? 3.368   6.819   4.702   1.00 0.00 ? 277 VAL A CA   3  
ATOM   6256  C  C    . VAL A 1 122 ? 2.649   8.082   5.192   1.00 0.00 ? 277 VAL A C    3  
ATOM   6257  O  O    . VAL A 1 122 ? 1.916   8.043   6.164   1.00 0.00 ? 277 VAL A O    3  
ATOM   6258  C  CB   . VAL A 1 122 ? 4.856   6.859   5.090   1.00 0.00 ? 277 VAL A CB   3  
ATOM   6259  C  CG1  . VAL A 1 122 ? 4.992   6.901   6.615   1.00 0.00 ? 277 VAL A CG1  3  
ATOM   6260  C  CG2  . VAL A 1 122 ? 5.559   5.609   4.551   1.00 0.00 ? 277 VAL A CG2  3  
ATOM   6261  H  H    . VAL A 1 122 ? 4.121   6.885   2.656   1.00 0.00 ? 277 VAL A H    3  
ATOM   6262  H  HA   . VAL A 1 122 ? 2.901   5.947   5.124   1.00 0.00 ? 277 VAL A HA   3  
ATOM   6263  H  HB   . VAL A 1 122 ? 5.313   7.741   4.665   1.00 0.00 ? 277 VAL A HB   3  
ATOM   6264  H  HG11 . VAL A 1 122 ? 4.907   7.922   6.956   1.00 0.00 ? 277 VAL A HG11 3  
ATOM   6265  H  HG12 . VAL A 1 122 ? 5.955   6.505   6.901   1.00 0.00 ? 277 VAL A HG12 3  
ATOM   6266  H  HG13 . VAL A 1 122 ? 4.210   6.305   7.062   1.00 0.00 ? 277 VAL A HG13 3  
ATOM   6267  H  HG21 . VAL A 1 122 ? 6.556   5.867   4.226   1.00 0.00 ? 277 VAL A HG21 3  
ATOM   6268  H  HG22 . VAL A 1 122 ? 5.001   5.212   3.715   1.00 0.00 ? 277 VAL A HG22 3  
ATOM   6269  H  HG23 . VAL A 1 122 ? 5.617   4.862   5.329   1.00 0.00 ? 277 VAL A HG23 3  
ATOM   6270  N  N    . THR A 1 123 ? 2.838   9.199   4.524   1.00 0.00 ? 278 THR A N    3  
ATOM   6271  C  CA   . THR A 1 123 ? 2.137   10.455  4.966   1.00 0.00 ? 278 THR A CA   3  
ATOM   6272  C  C    . THR A 1 123 ? 0.628   10.324  4.696   1.00 0.00 ? 278 THR A C    3  
ATOM   6273  O  O    . THR A 1 123 ? -0.181  10.774  5.486   1.00 0.00 ? 278 THR A O    3  
ATOM   6274  C  CB   . THR A 1 123 ? 2.735   11.621  4.149   1.00 0.00 ? 278 THR A CB   3  
ATOM   6275  O  OG1  . THR A 1 123 ? 3.733   11.124  3.266   1.00 0.00 ? 278 THR A OG1  3  
ATOM   6276  C  CG2  . THR A 1 123 ? 3.361   12.646  5.099   1.00 0.00 ? 278 THR A CG2  3  
ATOM   6277  H  H    . THR A 1 123 ? 3.426   9.206   3.734   1.00 0.00 ? 278 THR A H    3  
ATOM   6278  H  HA   . THR A 1 123 ? 2.307   10.617  6.019   1.00 0.00 ? 278 THR A HA   3  
ATOM   6279  H  HB   . THR A 1 123 ? 1.956   12.099  3.576   1.00 0.00 ? 278 THR A HB   3  
ATOM   6280  H  HG1  . THR A 1 123 ? 3.941   11.815  2.633   1.00 0.00 ? 278 THR A HG1  3  
ATOM   6281  H  HG21 . THR A 1 123 ? 3.235   13.638  4.692   1.00 0.00 ? 278 THR A HG21 3  
ATOM   6282  H  HG22 . THR A 1 123 ? 4.414   12.432  5.215   1.00 0.00 ? 278 THR A HG22 3  
ATOM   6283  H  HG23 . THR A 1 123 ? 2.873   12.586  6.061   1.00 0.00 ? 278 THR A HG23 3  
ATOM   6284  N  N    . ALA A 1 124 ? 0.236   9.701   3.598   1.00 0.00 ? 279 ALA A N    3  
ATOM   6285  C  CA   . ALA A 1 124 ? -1.237  9.546   3.320   1.00 0.00 ? 279 ALA A CA   3  
ATOM   6286  C  C    . ALA A 1 124 ? -1.878  8.597   4.349   1.00 0.00 ? 279 ALA A C    3  
ATOM   6287  O  O    . ALA A 1 124 ? -3.026  8.769   4.716   1.00 0.00 ? 279 ALA A O    3  
ATOM   6288  C  CB   . ALA A 1 124 ? -1.364  8.956   1.906   1.00 0.00 ? 279 ALA A CB   3  
ATOM   6289  H  H    . ALA A 1 124 ? 0.905   9.331   2.971   1.00 0.00 ? 279 ALA A H    3  
ATOM   6290  H  HA   . ALA A 1 124 ? -1.720  10.506  3.359   1.00 0.00 ? 279 ALA A HA   3  
ATOM   6291  H  HB1  . ALA A 1 124 ? -0.923  7.970   1.886   1.00 0.00 ? 279 ALA A HB1  3  
ATOM   6292  H  HB2  . ALA A 1 124 ? -0.850  9.595   1.202   1.00 0.00 ? 279 ALA A HB2  3  
ATOM   6293  H  HB3  . ALA A 1 124 ? -2.408  8.889   1.636   1.00 0.00 ? 279 ALA A HB3  3  
ATOM   6294  N  N    . CYS A 1 125 ? -1.154  7.599   4.823   1.00 0.00 ? 280 CYS A N    3  
ATOM   6295  C  CA   . CYS A 1 125 ? -1.757  6.654   5.831   1.00 0.00 ? 280 CYS A CA   3  
ATOM   6296  C  C    . CYS A 1 125 ? -2.165  7.428   7.094   1.00 0.00 ? 280 CYS A C    3  
ATOM   6297  O  O    . CYS A 1 125 ? -3.254  7.242   7.605   1.00 0.00 ? 280 CYS A O    3  
ATOM   6298  C  CB   . CYS A 1 125 ? -0.670  5.615   6.168   1.00 0.00 ? 280 CYS A CB   3  
ATOM   6299  S  SG   . CYS A 1 125 ? -1.310  4.404   7.358   1.00 0.00 ? 280 CYS A SG   3  
ATOM   6300  H  H    . CYS A 1 125 ? -0.227  7.473   4.515   1.00 0.00 ? 280 CYS A H    3  
ATOM   6301  H  HA   . CYS A 1 125 ? -2.618  6.164   5.407   1.00 0.00 ? 280 CYS A HA   3  
ATOM   6302  H  HB2  . CYS A 1 125 ? -0.371  5.104   5.266   1.00 0.00 ? 280 CYS A HB2  3  
ATOM   6303  H  HB3  . CYS A 1 125 ? 0.186   6.117   6.594   1.00 0.00 ? 280 CYS A HB3  3  
ATOM   6304  H  HG   . CYS A 1 125 ? -0.878  3.563   7.188   1.00 0.00 ? 280 CYS A HG   3  
ATOM   6305  N  N    . ASN A 1 126 ? -1.310  8.290   7.601   1.00 0.00 ? 281 ASN A N    3  
ATOM   6306  C  CA   . ASN A 1 126 ? -1.688  9.058   8.841   1.00 0.00 ? 281 ASN A CA   3  
ATOM   6307  C  C    . ASN A 1 126 ? -2.868  9.989   8.541   1.00 0.00 ? 281 ASN A C    3  
ATOM   6308  O  O    . ASN A 1 126 ? -3.768  10.126  9.347   1.00 0.00 ? 281 ASN A O    3  
ATOM   6309  C  CB   . ASN A 1 126 ? -0.455  9.873   9.258   1.00 0.00 ? 281 ASN A CB   3  
ATOM   6310  C  CG   . ASN A 1 126 ? 0.666   8.921   9.692   1.00 0.00 ? 281 ASN A CG   3  
ATOM   6311  O  OD1  . ASN A 1 126 ? 0.750   7.810   9.207   1.00 0.00 ? 281 ASN A OD1  3  
ATOM   6312  N  ND2  . ASN A 1 126 ? 1.540   9.305   10.591  1.00 0.00 ? 281 ASN A ND2  3  
ATOM   6313  H  H    . ASN A 1 126 ? -0.430  8.429   7.170   1.00 0.00 ? 281 ASN A H    3  
ATOM   6314  H  HA   . ASN A 1 126 ? -1.959  8.372   9.625   1.00 0.00 ? 281 ASN A HA   3  
ATOM   6315  H  HB2  . ASN A 1 126 ? -0.120  10.470  8.422   1.00 0.00 ? 281 ASN A HB2  3  
ATOM   6316  H  HB3  . ASN A 1 126 ? -0.714  10.520  10.083  1.00 0.00 ? 281 ASN A HB3  3  
ATOM   6317  H  HD21 . ASN A 1 126 ? 1.483   10.201  10.990  1.00 0.00 ? 281 ASN A HD21 3  
ATOM   6318  H  HD22 . ASN A 1 126 ? 2.256   8.695   10.866  1.00 0.00 ? 281 ASN A HD22 3  
ATOM   6319  N  N    . SER A 1 127 ? -2.882  10.623  7.388   1.00 0.00 ? 282 SER A N    3  
ATOM   6320  C  CA   . SER A 1 127 ? -4.031  11.538  7.060   1.00 0.00 ? 282 SER A CA   3  
ATOM   6321  C  C    . SER A 1 127 ? -5.311  10.723  6.829   1.00 0.00 ? 282 SER A C    3  
ATOM   6322  O  O    . SER A 1 127 ? -6.392  11.162  7.179   1.00 0.00 ? 282 SER A O    3  
ATOM   6323  C  CB   . SER A 1 127 ? -3.646  12.302  5.784   1.00 0.00 ? 282 SER A CB   3  
ATOM   6324  O  OG   . SER A 1 127 ? -2.724  13.332  6.115   1.00 0.00 ? 282 SER A OG   3  
ATOM   6325  H  H    . SER A 1 127 ? -2.147  10.491  6.745   1.00 0.00 ? 282 SER A H    3  
ATOM   6326  H  HA   . SER A 1 127 ? -4.186  12.230  7.868   1.00 0.00 ? 282 SER A HA   3  
ATOM   6327  H  HB2  . SER A 1 127 ? -3.187  11.627  5.082   1.00 0.00 ? 282 SER A HB2  3  
ATOM   6328  H  HB3  . SER A 1 127 ? -4.535  12.729  5.339   1.00 0.00 ? 282 SER A HB3  3  
ATOM   6329  H  HG   . SER A 1 127 ? -1.856  12.935  6.209   1.00 0.00 ? 282 SER A HG   3  
ATOM   6330  N  N    . VAL A 1 128 ? -5.210  9.538   6.257   1.00 0.00 ? 283 VAL A N    3  
ATOM   6331  C  CA   . VAL A 1 128 ? -6.452  8.720   6.033   1.00 0.00 ? 283 VAL A CA   3  
ATOM   6332  C  C    . VAL A 1 128 ? -6.871  8.053   7.344   1.00 0.00 ? 283 VAL A C    3  
ATOM   6333  O  O    . VAL A 1 128 ? -8.047  7.997   7.655   1.00 0.00 ? 283 VAL A O    3  
ATOM   6334  C  CB   . VAL A 1 128 ? -6.108  7.666   4.968   1.00 0.00 ? 283 VAL A CB   3  
ATOM   6335  C  CG1  . VAL A 1 128 ? -7.334  6.790   4.684   1.00 0.00 ? 283 VAL A CG1  3  
ATOM   6336  C  CG2  . VAL A 1 128 ? -5.679  8.368   3.677   1.00 0.00 ? 283 VAL A CG2  3  
ATOM   6337  H  H    . VAL A 1 128 ? -4.328  9.191   5.988   1.00 0.00 ? 283 VAL A H    3  
ATOM   6338  H  HA   . VAL A 1 128 ? -7.248  9.354   5.687   1.00 0.00 ? 283 VAL A HA   3  
ATOM   6339  H  HB   . VAL A 1 128 ? -5.300  7.044   5.326   1.00 0.00 ? 283 VAL A HB   3  
ATOM   6340  H  HG11 . VAL A 1 128 ? -7.821  6.539   5.616   1.00 0.00 ? 283 VAL A HG11 3  
ATOM   6341  H  HG12 . VAL A 1 128 ? -7.022  5.883   4.188   1.00 0.00 ? 283 VAL A HG12 3  
ATOM   6342  H  HG13 . VAL A 1 128 ? -8.023  7.330   4.051   1.00 0.00 ? 283 VAL A HG13 3  
ATOM   6343  H  HG21 . VAL A 1 128 ? -6.545  8.536   3.054   1.00 0.00 ? 283 VAL A HG21 3  
ATOM   6344  H  HG22 . VAL A 1 128 ? -4.969  7.749   3.149   1.00 0.00 ? 283 VAL A HG22 3  
ATOM   6345  H  HG23 . VAL A 1 128 ? -5.221  9.316   3.920   1.00 0.00 ? 283 VAL A HG23 3  
ATOM   6346  N  N    . PHE A 1 129 ? -5.933  7.569   8.130   1.00 0.00 ? 284 PHE A N    3  
ATOM   6347  C  CA   . PHE A 1 129 ? -6.340  6.942   9.430   1.00 0.00 ? 284 PHE A CA   3  
ATOM   6348  C  C    . PHE A 1 129 ? -6.725  8.046   10.426  1.00 0.00 ? 284 PHE A C    3  
ATOM   6349  O  O    . PHE A 1 129 ? -7.579  7.841   11.269  1.00 0.00 ? 284 PHE A O    3  
ATOM   6350  C  CB   . PHE A 1 129 ? -5.155  6.104   9.950   1.00 0.00 ? 284 PHE A CB   3  
ATOM   6351  C  CG   . PHE A 1 129 ? -5.521  4.638   9.875   1.00 0.00 ? 284 PHE A CG   3  
ATOM   6352  C  CD1  . PHE A 1 129 ? -6.646  4.165   10.563  1.00 0.00 ? 284 PHE A CD1  3  
ATOM   6353  C  CD2  . PHE A 1 129 ? -4.751  3.757   9.106   1.00 0.00 ? 284 PHE A CD2  3  
ATOM   6354  C  CE1  . PHE A 1 129 ? -6.999  2.813   10.484  1.00 0.00 ? 284 PHE A CE1  3  
ATOM   6355  C  CE2  . PHE A 1 129 ? -5.107  2.405   9.025   1.00 0.00 ? 284 PHE A CE2  3  
ATOM   6356  C  CZ   . PHE A 1 129 ? -6.230  1.933   9.714   1.00 0.00 ? 284 PHE A CZ   3  
ATOM   6357  H  H    . PHE A 1 129 ? -4.982  7.643   7.878   1.00 0.00 ? 284 PHE A H    3  
ATOM   6358  H  HA   . PHE A 1 129 ? -7.195  6.303   9.258   1.00 0.00 ? 284 PHE A HA   3  
ATOM   6359  H  HB2  . PHE A 1 129 ? -4.280  6.289   9.347   1.00 0.00 ? 284 PHE A HB2  3  
ATOM   6360  H  HB3  . PHE A 1 129 ? -4.949  6.369   10.976  1.00 0.00 ? 284 PHE A HB3  3  
ATOM   6361  H  HD1  . PHE A 1 129 ? -7.240  4.844   11.156  1.00 0.00 ? 284 PHE A HD1  3  
ATOM   6362  H  HD2  . PHE A 1 129 ? -3.883  4.121   8.577   1.00 0.00 ? 284 PHE A HD2  3  
ATOM   6363  H  HE1  . PHE A 1 129 ? -7.866  2.450   11.015  1.00 0.00 ? 284 PHE A HE1  3  
ATOM   6364  H  HE2  . PHE A 1 129 ? -4.514  1.726   8.431   1.00 0.00 ? 284 PHE A HE2  3  
ATOM   6365  H  HZ   . PHE A 1 129 ? -6.506  0.890   9.650   1.00 0.00 ? 284 PHE A HZ   3  
ATOM   6366  N  N    . GLU A 1 130 ? -6.138  9.233   10.327  1.00 0.00 ? 285 GLU A N    3  
ATOM   6367  C  CA   . GLU A 1 130 ? -6.540  10.337  11.272  1.00 0.00 ? 285 GLU A CA   3  
ATOM   6368  C  C    . GLU A 1 130 ? -8.046  10.598  11.117  1.00 0.00 ? 285 GLU A C    3  
ATOM   6369  O  O    . GLU A 1 130 ? -8.742  10.811  12.093  1.00 0.00 ? 285 GLU A O    3  
ATOM   6370  C  CB   . GLU A 1 130 ? -5.735  11.589  10.879  1.00 0.00 ? 285 GLU A CB   3  
ATOM   6371  C  CG   . GLU A 1 130 ? -6.090  12.745  11.816  1.00 0.00 ? 285 GLU A CG   3  
ATOM   6372  C  CD   . GLU A 1 130 ? -5.557  14.057  11.234  1.00 0.00 ? 285 GLU A CD   3  
ATOM   6373  O  OE1  . GLU A 1 130 ? -5.746  14.277  10.049  1.00 0.00 ? 285 GLU A OE1  3  
ATOM   6374  O  OE2  . GLU A 1 130 ? -4.968  14.818  11.984  1.00 0.00 ? 285 GLU A OE2  3  
ATOM   6375  H  H    . GLU A 1 130 ? -5.464  9.400   9.626   1.00 0.00 ? 285 GLU A H    3  
ATOM   6376  H  HA   . GLU A 1 130 ? -6.319  10.055  12.285  1.00 0.00 ? 285 GLU A HA   3  
ATOM   6377  H  HB2  . GLU A 1 130 ? -4.679  11.375  10.958  1.00 0.00 ? 285 GLU A HB2  3  
ATOM   6378  H  HB3  . GLU A 1 130 ? -5.970  11.865  9.862   1.00 0.00 ? 285 GLU A HB3  3  
ATOM   6379  H  HG2  . GLU A 1 130 ? -7.164  12.807  11.919  1.00 0.00 ? 285 GLU A HG2  3  
ATOM   6380  H  HG3  . GLU A 1 130 ? -5.643  12.577  12.784  1.00 0.00 ? 285 GLU A HG3  3  
ATOM   6381  N  N    . ASN A 1 131 ? -8.566  10.550  9.902   1.00 0.00 ? 286 ASN A N    3  
ATOM   6382  C  CA   . ASN A 1 131 ? -10.048 10.764  9.724   1.00 0.00 ? 286 ASN A CA   3  
ATOM   6383  C  C    . ASN A 1 131 ? -10.830 9.715   10.541  1.00 0.00 ? 286 ASN A C    3  
ATOM   6384  O  O    . ASN A 1 131 ? -11.930 9.975   10.993  1.00 0.00 ? 286 ASN A O    3  
ATOM   6385  C  CB   . ASN A 1 131 ? -10.346 10.598  8.224   1.00 0.00 ? 286 ASN A CB   3  
ATOM   6386  C  CG   . ASN A 1 131 ? -10.166 11.944  7.514   1.00 0.00 ? 286 ASN A CG   3  
ATOM   6387  O  OD1  . ASN A 1 131 ? -9.264  12.693  7.838   1.00 0.00 ? 286 ASN A OD1  3  
ATOM   6388  N  ND2  . ASN A 1 131 ? -10.988 12.295  6.555   1.00 0.00 ? 286 ASN A ND2  3  
ATOM   6389  H  H    . ASN A 1 131 ? -7.989  10.352  9.120   1.00 0.00 ? 286 ASN A H    3  
ATOM   6390  H  HA   . ASN A 1 131 ? -10.318 11.755  10.044  1.00 0.00 ? 286 ASN A HA   3  
ATOM   6391  H  HB2  . ASN A 1 131 ? -9.667  9.872   7.801   1.00 0.00 ? 286 ASN A HB2  3  
ATOM   6392  H  HB3  . ASN A 1 131 ? -11.363 10.259  8.096   1.00 0.00 ? 286 ASN A HB3  3  
ATOM   6393  H  HD21 . ASN A 1 131 ? -11.720 11.699  6.285   1.00 0.00 ? 286 ASN A HD21 3  
ATOM   6394  H  HD22 . ASN A 1 131 ? -10.870 13.156  6.102   1.00 0.00 ? 286 ASN A HD22 3  
ATOM   6395  N  N    . LEU A 1 132 ? -10.272 8.530   10.747  1.00 0.00 ? 287 LEU A N    3  
ATOM   6396  C  CA   . LEU A 1 132 ? -10.999 7.482   11.550  1.00 0.00 ? 287 LEU A CA   3  
ATOM   6397  C  C    . LEU A 1 132 ? -11.347 8.040   12.940  1.00 0.00 ? 287 LEU A C    3  
ATOM   6398  O  O    . LEU A 1 132 ? -12.421 7.793   13.456  1.00 0.00 ? 287 LEU A O    3  
ATOM   6399  C  CB   . LEU A 1 132 ? -10.029 6.289   11.689  1.00 0.00 ? 287 LEU A CB   3  
ATOM   6400  C  CG   . LEU A 1 132 ? -10.802 4.973   11.875  1.00 0.00 ? 287 LEU A CG   3  
ATOM   6401  C  CD1  . LEU A 1 132 ? -11.757 5.076   13.071  1.00 0.00 ? 287 LEU A CD1  3  
ATOM   6402  C  CD2  . LEU A 1 132 ? -11.598 4.666   10.603  1.00 0.00 ? 287 LEU A CD2  3  
ATOM   6403  H  H    . LEU A 1 132 ? -9.382  8.337   10.380  1.00 0.00 ? 287 LEU A H    3  
ATOM   6404  H  HA   . LEU A 1 132 ? -11.896 7.171   11.037  1.00 0.00 ? 287 LEU A HA   3  
ATOM   6405  H  HB2  . LEU A 1 132 ? -9.423  6.219   10.798  1.00 0.00 ? 287 LEU A HB2  3  
ATOM   6406  H  HB3  . LEU A 1 132 ? -9.389  6.452   12.541  1.00 0.00 ? 287 LEU A HB3  3  
ATOM   6407  H  HG   . LEU A 1 132 ? -10.097 4.174   12.055  1.00 0.00 ? 287 LEU A HG   3  
ATOM   6408  H  HD11 . LEU A 1 132 ? -11.934 4.091   13.478  1.00 0.00 ? 287 LEU A HD11 3  
ATOM   6409  H  HD12 . LEU A 1 132 ? -12.694 5.504   12.747  1.00 0.00 ? 287 LEU A HD12 3  
ATOM   6410  H  HD13 . LEU A 1 132 ? -11.316 5.706   13.830  1.00 0.00 ? 287 LEU A HD13 3  
ATOM   6411  H  HD21 . LEU A 1 132 ? -11.927 3.636   10.625  1.00 0.00 ? 287 LEU A HD21 3  
ATOM   6412  H  HD22 . LEU A 1 132 ? -10.970 4.823   9.737   1.00 0.00 ? 287 LEU A HD22 3  
ATOM   6413  H  HD23 . LEU A 1 132 ? -12.457 5.317   10.548  1.00 0.00 ? 287 LEU A HD23 3  
ATOM   6414  N  N    . GLU A 1 133 ? -10.451 8.795   13.553  1.00 0.00 ? 288 GLU A N    3  
ATOM   6415  C  CA   . GLU A 1 133 ? -10.763 9.361   14.916  1.00 0.00 ? 288 GLU A CA   3  
ATOM   6416  C  C    . GLU A 1 133 ? -12.011 10.250  14.835  1.00 0.00 ? 288 GLU A C    3  
ATOM   6417  O  O    . GLU A 1 133 ? -12.874 10.192  15.691  1.00 0.00 ? 288 GLU A O    3  
ATOM   6418  C  CB   . GLU A 1 133 ? -9.545  10.194  15.345  1.00 0.00 ? 288 GLU A CB   3  
ATOM   6419  C  CG   . GLU A 1 133 ? -8.556  9.303   16.100  1.00 0.00 ? 288 GLU A CG   3  
ATOM   6420  C  CD   . GLU A 1 133 ? -7.742  10.156  17.076  1.00 0.00 ? 288 GLU A CD   3  
ATOM   6421  O  OE1  . GLU A 1 133 ? -6.848  10.850  16.621  1.00 0.00 ? 288 GLU A OE1  3  
ATOM   6422  O  OE2  . GLU A 1 133 ? -8.026  10.099  18.261  1.00 0.00 ? 288 GLU A OE2  3  
ATOM   6423  H  H    . GLU A 1 133 ? -9.584  8.986   13.117  1.00 0.00 ? 288 GLU A H    3  
ATOM   6424  H  HA   . GLU A 1 133 ? -10.929 8.563   15.618  1.00 0.00 ? 288 GLU A HA   3  
ATOM   6425  H  HB2  . GLU A 1 133 ? -9.064  10.605  14.470  1.00 0.00 ? 288 GLU A HB2  3  
ATOM   6426  H  HB3  . GLU A 1 133 ? -9.867  10.997  15.990  1.00 0.00 ? 288 GLU A HB3  3  
ATOM   6427  H  HG2  . GLU A 1 133 ? -9.099  8.547   16.647  1.00 0.00 ? 288 GLU A HG2  3  
ATOM   6428  H  HG3  . GLU A 1 133 ? -7.888  8.830   15.396  1.00 0.00 ? 288 GLU A HG3  3  
ATOM   6429  N  N    . GLN A 1 134 ? -12.123 11.061  13.804  1.00 0.00 ? 289 GLN A N    3  
ATOM   6430  C  CA   . GLN A 1 134 ? -13.342 11.938  13.679  1.00 0.00 ? 289 GLN A CA   3  
ATOM   6431  C  C    . GLN A 1 134 ? -14.587 11.055  13.500  1.00 0.00 ? 289 GLN A C    3  
ATOM   6432  O  O    . GLN A 1 134 ? -15.625 11.322  14.074  1.00 0.00 ? 289 GLN A O    3  
ATOM   6433  C  CB   . GLN A 1 134 ? -13.133 12.821  12.438  1.00 0.00 ? 289 GLN A CB   3  
ATOM   6434  C  CG   . GLN A 1 134 ? -12.307 14.051  12.820  1.00 0.00 ? 289 GLN A CG   3  
ATOM   6435  C  CD   . GLN A 1 134 ? -10.821 13.676  12.868  1.00 0.00 ? 289 GLN A CD   3  
ATOM   6436  O  OE1  . GLN A 1 134 ? -10.389 12.790  12.158  1.00 0.00 ? 289 GLN A OE1  3  
ATOM   6437  N  NE2  . GLN A 1 134 ? -10.011 14.312  13.678  1.00 0.00 ? 289 GLN A NE2  3  
ATOM   6438  H  H    . GLN A 1 134 ? -11.418 11.082  13.117  1.00 0.00 ? 289 GLN A H    3  
ATOM   6439  H  HA   . GLN A 1 134 ? -13.448 12.555  14.559  1.00 0.00 ? 289 GLN A HA   3  
ATOM   6440  H  HB2  . GLN A 1 134 ? -12.610 12.257  11.680  1.00 0.00 ? 289 GLN A HB2  3  
ATOM   6441  H  HB3  . GLN A 1 134 ? -14.091 13.138  12.055  1.00 0.00 ? 289 GLN A HB3  3  
ATOM   6442  H  HG2  . GLN A 1 134 ? -12.460 14.829  12.085  1.00 0.00 ? 289 GLN A HG2  3  
ATOM   6443  H  HG3  . GLN A 1 134 ? -12.617 14.406  13.791  1.00 0.00 ? 289 GLN A HG3  3  
ATOM   6444  H  HE21 . GLN A 1 134 ? -10.349 15.030  14.257  1.00 0.00 ? 289 GLN A HE21 3  
ATOM   6445  H  HE22 . GLN A 1 134 ? -9.062  14.070  13.707  1.00 0.00 ? 289 GLN A HE22 3  
ATOM   6446  N  N    . LEU A 1 135 ? -14.490 9.996   12.716  1.00 0.00 ? 290 LEU A N    3  
ATOM   6447  C  CA   . LEU A 1 135 ? -15.686 9.097   12.522  1.00 0.00 ? 290 LEU A CA   3  
ATOM   6448  C  C    . LEU A 1 135 ? -16.158 8.542   13.877  1.00 0.00 ? 290 LEU A C    3  
ATOM   6449  O  O    . LEU A 1 135 ? -17.344 8.408   14.112  1.00 0.00 ? 290 LEU A O    3  
ATOM   6450  C  CB   . LEU A 1 135 ? -15.226 7.946   11.612  1.00 0.00 ? 290 LEU A CB   3  
ATOM   6451  C  CG   . LEU A 1 135 ? -16.439 7.312   10.930  1.00 0.00 ? 290 LEU A CG   3  
ATOM   6452  C  CD1  . LEU A 1 135 ? -16.961 8.250   9.841   1.00 0.00 ? 290 LEU A CD1  3  
ATOM   6453  C  CD2  . LEU A 1 135 ? -16.025 5.981   10.299  1.00 0.00 ? 290 LEU A CD2  3  
ATOM   6454  H  H    . LEU A 1 135 ? -13.636 9.794   12.264  1.00 0.00 ? 290 LEU A H    3  
ATOM   6455  H  HA   . LEU A 1 135 ? -16.484 9.641   12.049  1.00 0.00 ? 290 LEU A HA   3  
ATOM   6456  H  HB2  . LEU A 1 135 ? -14.551 8.330   10.861  1.00 0.00 ? 290 LEU A HB2  3  
ATOM   6457  H  HB3  . LEU A 1 135 ? -14.718 7.200   12.205  1.00 0.00 ? 290 LEU A HB3  3  
ATOM   6458  H  HG   . LEU A 1 135 ? -17.215 7.142   11.662  1.00 0.00 ? 290 LEU A HG   3  
ATOM   6459  H  HD11 . LEU A 1 135 ? -17.778 7.776   9.317   1.00 0.00 ? 290 LEU A HD11 3  
ATOM   6460  H  HD12 . LEU A 1 135 ? -16.166 8.469   9.142   1.00 0.00 ? 290 LEU A HD12 3  
ATOM   6461  H  HD13 . LEU A 1 135 ? -17.307 9.169   10.292  1.00 0.00 ? 290 LEU A HD13 3  
ATOM   6462  H  HD21 . LEU A 1 135 ? -16.074 5.199   11.043  1.00 0.00 ? 290 LEU A HD21 3  
ATOM   6463  H  HD22 . LEU A 1 135 ? -15.016 6.059   9.923   1.00 0.00 ? 290 LEU A HD22 3  
ATOM   6464  H  HD23 . LEU A 1 135 ? -16.696 5.744   9.485   1.00 0.00 ? 290 LEU A HD23 3  
ATOM   6465  N  N    . LEU A 1 136 ? -15.244 8.222   14.773  1.00 0.00 ? 291 LEU A N    3  
ATOM   6466  C  CA   . LEU A 1 136 ? -15.671 7.678   16.116  1.00 0.00 ? 291 LEU A CA   3  
ATOM   6467  C  C    . LEU A 1 136 ? -16.597 8.681   16.827  1.00 0.00 ? 291 LEU A C    3  
ATOM   6468  O  O    . LEU A 1 136 ? -17.542 8.288   17.486  1.00 0.00 ? 291 LEU A O    3  
ATOM   6469  C  CB   . LEU A 1 136 ? -14.388 7.473   16.939  1.00 0.00 ? 291 LEU A CB   3  
ATOM   6470  C  CG   . LEU A 1 136 ? -14.676 6.533   18.109  1.00 0.00 ? 291 LEU A CG   3  
ATOM   6471  C  CD1  . LEU A 1 136 ? -14.410 5.088   17.681  1.00 0.00 ? 291 LEU A CD1  3  
ATOM   6472  C  CD2  . LEU A 1 136 ? -13.765 6.890   19.285  1.00 0.00 ? 291 LEU A CD2  3  
ATOM   6473  H  H    . LEU A 1 136 ? -14.288 8.341   14.563  1.00 0.00 ? 291 LEU A H    3  
ATOM   6474  H  HA   . LEU A 1 136 ? -16.177 6.734   15.988  1.00 0.00 ? 291 LEU A HA   3  
ATOM   6475  H  HB2  . LEU A 1 136 ? -13.622 7.042   16.309  1.00 0.00 ? 291 LEU A HB2  3  
ATOM   6476  H  HB3  . LEU A 1 136 ? -14.048 8.425   17.319  1.00 0.00 ? 291 LEU A HB3  3  
ATOM   6477  H  HG   . LEU A 1 136 ? -15.710 6.635   18.407  1.00 0.00 ? 291 LEU A HG   3  
ATOM   6478  H  HD11 . LEU A 1 136 ? -13.384 4.831   17.899  1.00 0.00 ? 291 LEU A HD11 3  
ATOM   6479  H  HD12 . LEU A 1 136 ? -14.589 4.988   16.620  1.00 0.00 ? 291 LEU A HD12 3  
ATOM   6480  H  HD13 . LEU A 1 136 ? -15.071 4.425   18.221  1.00 0.00 ? 291 LEU A HD13 3  
ATOM   6481  H  HD21 . LEU A 1 136 ? -14.197 7.712   19.838  1.00 0.00 ? 291 LEU A HD21 3  
ATOM   6482  H  HD22 . LEU A 1 136 ? -12.793 7.178   18.913  1.00 0.00 ? 291 LEU A HD22 3  
ATOM   6483  H  HD23 . LEU A 1 136 ? -13.662 6.034   19.935  1.00 0.00 ? 291 LEU A HD23 3  
ATOM   6484  N  N    . GLN A 1 137 ? -16.341 9.970   16.700  1.00 0.00 ? 292 GLN A N    3  
ATOM   6485  C  CA   . GLN A 1 137 ? -17.227 10.976  17.378  1.00 0.00 ? 292 GLN A CA   3  
ATOM   6486  C  C    . GLN A 1 137 ? -18.301 11.486  16.401  1.00 0.00 ? 292 GLN A C    3  
ATOM   6487  O  O    . GLN A 1 137 ? -19.436 11.696  16.783  1.00 0.00 ? 292 GLN A O    3  
ATOM   6488  C  CB   . GLN A 1 137 ? -16.308 12.128  17.815  1.00 0.00 ? 292 GLN A CB   3  
ATOM   6489  C  CG   . GLN A 1 137 ? -15.767 11.854  19.224  1.00 0.00 ? 292 GLN A CG   3  
ATOM   6490  C  CD   . GLN A 1 137 ? -16.526 12.712  20.245  1.00 0.00 ? 292 GLN A CD   3  
ATOM   6491  O  OE1  . GLN A 1 137 ? -16.565 13.920  20.125  1.00 0.00 ? 292 GLN A OE1  3  
ATOM   6492  N  NE2  . GLN A 1 137 ? -17.137 12.140  21.255  1.00 0.00 ? 292 GLN A NE2  3  
ATOM   6493  H  H    . GLN A 1 137 ? -15.573 10.272  16.160  1.00 0.00 ? 292 GLN A H    3  
ATOM   6494  H  HA   . GLN A 1 137 ? -17.695 10.534  18.244  1.00 0.00 ? 292 GLN A HA   3  
ATOM   6495  H  HB2  . GLN A 1 137 ? -15.483 12.209  17.122  1.00 0.00 ? 292 GLN A HB2  3  
ATOM   6496  H  HB3  . GLN A 1 137 ? -16.868 13.052  17.816  1.00 0.00 ? 292 GLN A HB3  3  
ATOM   6497  H  HG2  . GLN A 1 137 ? -15.897 10.808  19.465  1.00 0.00 ? 292 GLN A HG2  3  
ATOM   6498  H  HG3  . GLN A 1 137 ? -14.717 12.103  19.259  1.00 0.00 ? 292 GLN A HG3  3  
ATOM   6499  H  HE21 . GLN A 1 137 ? -17.113 11.165  21.364  1.00 0.00 ? 292 GLN A HE21 3  
ATOM   6500  H  HE22 . GLN A 1 137 ? -17.620 12.690  21.907  1.00 0.00 ? 292 GLN A HE22 3  
ATOM   6501  N  N    . GLN A 1 138 ? -17.958 11.689  15.140  1.00 0.00 ? 293 GLN A N    3  
ATOM   6502  C  CA   . GLN A 1 138 ? -18.967 12.185  14.145  1.00 0.00 ? 293 GLN A CA   3  
ATOM   6503  C  C    . GLN A 1 138 ? -19.640 13.475  14.650  1.00 0.00 ? 293 GLN A C    3  
ATOM   6504  O  O    . GLN A 1 138 ? -20.844 13.525  14.819  1.00 0.00 ? 293 GLN A O    3  
ATOM   6505  C  CB   . GLN A 1 138 ? -19.994 11.056  14.007  1.00 0.00 ? 293 GLN A CB   3  
ATOM   6506  C  CG   . GLN A 1 138 ? -20.850 11.292  12.762  1.00 0.00 ? 293 GLN A CG   3  
ATOM   6507  C  CD   . GLN A 1 138 ? -21.210 9.946   12.123  1.00 0.00 ? 293 GLN A CD   3  
ATOM   6508  O  OE1  . GLN A 1 138 ? -20.592 9.537   11.160  1.00 0.00 ? 293 GLN A OE1  3  
ATOM   6509  N  NE2  . GLN A 1 138 ? -22.190 9.228   12.617  1.00 0.00 ? 293 GLN A NE2  3  
ATOM   6510  H  H    . GLN A 1 138 ? -17.038 11.517  14.843  1.00 0.00 ? 293 GLN A H    3  
ATOM   6511  H  HA   . GLN A 1 138 ? -18.491 12.364  13.193  1.00 0.00 ? 293 GLN A HA   3  
ATOM   6512  H  HB2  . GLN A 1 138 ? -19.478 10.111  13.915  1.00 0.00 ? 293 GLN A HB2  3  
ATOM   6513  H  HB3  . GLN A 1 138 ? -20.628 11.037  14.881  1.00 0.00 ? 293 GLN A HB3  3  
ATOM   6514  H  HG2  . GLN A 1 138 ? -21.756 11.813  13.042  1.00 0.00 ? 293 GLN A HG2  3  
ATOM   6515  H  HG3  . GLN A 1 138 ? -20.297 11.888  12.052  1.00 0.00 ? 293 GLN A HG3  3  
ATOM   6516  H  HE21 . GLN A 1 138 ? -22.697 9.547   13.395  1.00 0.00 ? 293 GLN A HE21 3  
ATOM   6517  H  HE22 . GLN A 1 138 ? -22.417 8.367   12.207  1.00 0.00 ? 293 GLN A HE22 3  
ATOM   6518  N  N    . ASN A 1 139 ? -18.874 14.521  14.891  1.00 0.00 ? 294 ASN A N    3  
ATOM   6519  C  CA   . ASN A 1 139 ? -19.478 15.796  15.382  1.00 0.00 ? 294 ASN A CA   3  
ATOM   6520  C  C    . ASN A 1 139 ? -19.129 16.950  14.429  1.00 0.00 ? 294 ASN A C    3  
ATOM   6521  O  O    . ASN A 1 139 ? -18.838 18.049  14.865  1.00 0.00 ? 294 ASN A O    3  
ATOM   6522  C  CB   . ASN A 1 139 ? -18.852 16.028  16.757  1.00 0.00 ? 294 ASN A CB   3  
ATOM   6523  C  CG   . ASN A 1 139 ? -19.882 16.685  17.684  1.00 0.00 ? 294 ASN A CG   3  
ATOM   6524  O  OD1  . ASN A 1 139 ? -20.243 16.121  18.699  1.00 0.00 ? 294 ASN A OD1  3  
ATOM   6525  N  ND2  . ASN A 1 139 ? -20.376 17.862  17.384  1.00 0.00 ? 294 ASN A ND2  3  
ATOM   6526  H  H    . ASN A 1 139 ? -17.903 14.469  14.750  1.00 0.00 ? 294 ASN A H    3  
ATOM   6527  H  HA   . ASN A 1 139 ? -20.548 15.695  15.475  1.00 0.00 ? 294 ASN A HA   3  
ATOM   6528  H  HB2  . ASN A 1 139 ? -18.542 15.081  17.174  1.00 0.00 ? 294 ASN A HB2  3  
ATOM   6529  H  HB3  . ASN A 1 139 ? -17.996 16.677  16.658  1.00 0.00 ? 294 ASN A HB3  3  
ATOM   6530  H  HD21 . ASN A 1 139 ? -20.092 18.327  16.568  1.00 0.00 ? 294 ASN A HD21 3  
ATOM   6531  H  HD22 . ASN A 1 139 ? -21.035 18.279  17.979  1.00 0.00 ? 294 ASN A HD22 3  
ATOM   6532  N  N    . LYS A 1 140 ? -19.151 16.715  13.132  1.00 0.00 ? 295 LYS A N    3  
ATOM   6533  C  CA   . LYS A 1 140 ? -18.817 17.806  12.166  1.00 0.00 ? 295 LYS A CA   3  
ATOM   6534  C  C    . LYS A 1 140 ? -19.869 17.865  11.047  1.00 0.00 ? 295 LYS A C    3  
ATOM   6535  O  O    . LYS A 1 140 ? -19.788 17.130  10.081  1.00 0.00 ? 295 LYS A O    3  
ATOM   6536  C  CB   . LYS A 1 140 ? -17.449 17.425  11.598  1.00 0.00 ? 295 LYS A CB   3  
ATOM   6537  C  CG   . LYS A 1 140 ? -16.600 18.685  11.417  1.00 0.00 ? 295 LYS A CG   3  
ATOM   6538  C  CD   . LYS A 1 140 ? -15.725 18.893  12.654  1.00 0.00 ? 295 LYS A CD   3  
ATOM   6539  C  CE   . LYS A 1 140 ? -14.579 19.848  12.314  1.00 0.00 ? 295 LYS A CE   3  
ATOM   6540  N  NZ   . LYS A 1 140 ? -13.449 19.418  13.184  1.00 0.00 ? 295 LYS A NZ   3  
ATOM   6541  H  H    . LYS A 1 140 ? -19.387 15.823  12.792  1.00 0.00 ? 295 LYS A H    3  
ATOM   6542  H  HA   . LYS A 1 140 ? -18.755 18.754  12.677  1.00 0.00 ? 295 LYS A HA   3  
ATOM   6543  H  HB2  . LYS A 1 140 ? -16.953 16.749  12.279  1.00 0.00 ? 295 LYS A HB2  3  
ATOM   6544  H  HB3  . LYS A 1 140 ? -17.580 16.941  10.641  1.00 0.00 ? 295 LYS A HB3  3  
ATOM   6545  H  HG2  . LYS A 1 140 ? -15.973 18.573  10.545  1.00 0.00 ? 295 LYS A HG2  3  
ATOM   6546  H  HG3  . LYS A 1 140 ? -17.247 19.540  11.288  1.00 0.00 ? 295 LYS A HG3  3  
ATOM   6547  H  HD2  . LYS A 1 140 ? -16.322 19.314  13.451  1.00 0.00 ? 295 LYS A HD2  3  
ATOM   6548  H  HD3  . LYS A 1 140 ? -15.318 17.945  12.971  1.00 0.00 ? 295 LYS A HD3  3  
ATOM   6549  H  HE2  . LYS A 1 140 ? -14.311 19.756  11.271  1.00 0.00 ? 295 LYS A HE2  3  
ATOM   6550  H  HE3  . LYS A 1 140 ? -14.856 20.865  12.543  1.00 0.00 ? 295 LYS A HE3  3  
ATOM   6551  H  HZ1  . LYS A 1 140 ? -13.091 18.499  12.858  1.00 0.00 ? 295 LYS A HZ1  3  
ATOM   6552  H  HZ2  . LYS A 1 140 ? -13.782 19.333  14.166  1.00 0.00 ? 295 LYS A HZ2  3  
ATOM   6553  H  HZ3  . LYS A 1 140 ? -12.686 20.122  13.135  1.00 0.00 ? 295 LYS A HZ3  3  
ATOM   6554  N  N    . LYS A 1 141 ? -20.855 18.732  11.164  1.00 0.00 ? 296 LYS A N    3  
ATOM   6555  C  CA   . LYS A 1 141 ? -21.901 18.824  10.094  1.00 0.00 ? 296 LYS A CA   3  
ATOM   6556  C  C    . LYS A 1 141 ? -22.622 20.178  10.149  1.00 0.00 ? 296 LYS A C    3  
ATOM   6557  O  O    . LYS A 1 141 ? -22.156 21.046  10.869  1.00 0.00 ? 296 LYS A O    3  
ATOM   6558  C  CB   . LYS A 1 141 ? -22.875 17.676  10.387  1.00 0.00 ? 296 LYS A CB   3  
ATOM   6559  C  CG   . LYS A 1 141 ? -23.486 17.843  11.783  1.00 0.00 ? 296 LYS A CG   3  
ATOM   6560  C  CD   . LYS A 1 141 ? -23.747 16.464  12.394  1.00 0.00 ? 296 LYS A CD   3  
ATOM   6561  C  CE   . LYS A 1 141 ? -24.572 16.621  13.673  1.00 0.00 ? 296 LYS A CE   3  
ATOM   6562  N  NZ   . LYS A 1 141 ? -23.568 16.846  14.751  1.00 0.00 ? 296 LYS A NZ   3  
ATOM   6563  O  OXT  . LYS A 1 141 ? -23.626 20.320  9.471   1.00 0.00 ? 296 LYS A OXT  3  
ATOM   6564  H  H    . LYS A 1 141 ? -20.906 19.321  11.951  1.00 0.00 ? 296 LYS A H    3  
ATOM   6565  H  HA   . LYS A 1 141 ? -21.452 18.682  9.124   1.00 0.00 ? 296 LYS A HA   3  
ATOM   6566  H  HB2  . LYS A 1 141 ? -23.664 17.680  9.648   1.00 0.00 ? 296 LYS A HB2  3  
ATOM   6567  H  HB3  . LYS A 1 141 ? -22.345 16.737  10.339  1.00 0.00 ? 296 LYS A HB3  3  
ATOM   6568  H  HG2  . LYS A 1 141 ? -22.803 18.393  12.414  1.00 0.00 ? 296 LYS A HG2  3  
ATOM   6569  H  HG3  . LYS A 1 141 ? -24.418 18.382  11.706  1.00 0.00 ? 296 LYS A HG3  3  
ATOM   6570  H  HD2  . LYS A 1 141 ? -24.291 15.855  11.686  1.00 0.00 ? 296 LYS A HD2  3  
ATOM   6571  H  HD3  . LYS A 1 141 ? -22.806 15.991  12.630  1.00 0.00 ? 296 LYS A HD3  3  
ATOM   6572  H  HE2  . LYS A 1 141 ? -25.236 17.471  13.590  1.00 0.00 ? 296 LYS A HE2  3  
ATOM   6573  H  HE3  . LYS A 1 141 ? -25.133 15.721  13.873  1.00 0.00 ? 296 LYS A HE3  3  
ATOM   6574  H  HZ1  . LYS A 1 141 ? -22.974 17.662  14.507  1.00 0.00 ? 296 LYS A HZ1  3  
ATOM   6575  H  HZ2  . LYS A 1 141 ? -22.972 15.998  14.850  1.00 0.00 ? 296 LYS A HZ2  3  
ATOM   6576  H  HZ3  . LYS A 1 141 ? -24.059 17.033  15.648  1.00 0.00 ? 296 LYS A HZ3  3  
HETATM 6577  ZN ZN   . ZN  B 2 .   ? -5.766  -3.700  -0.672  1.00 0.00 ? 1   ZN  A ZN   3  
HETATM 6578  ZN ZN   . ZN  C 2 .   ? 1.800   -6.350  -5.543  1.00 0.00 ? 2   ZN  A ZN   3  
HETATM 6579  ZN ZN   . ZN  D 2 .   ? 14.384  -4.616  -0.489  1.00 0.00 ? 3   ZN  A ZN   3  
ATOM   6580  N  N    . GLY A 1 1   ? 5.848   30.550  0.550   1.00 0.00 ? 156 GLY A N    4  
ATOM   6581  C  CA   . GLY A 1 1   ? 5.446   29.125  0.378   1.00 0.00 ? 156 GLY A CA   4  
ATOM   6582  C  C    . GLY A 1 1   ? 4.557   28.987  -0.865  1.00 0.00 ? 156 GLY A C    4  
ATOM   6583  O  O    . GLY A 1 1   ? 4.497   29.883  -1.687  1.00 0.00 ? 156 GLY A O    4  
ATOM   6584  H  H1   . GLY A 1 1   ? 5.025   31.165  0.392   1.00 0.00 ? 156 GLY A H1   4  
ATOM   6585  H  H2   . GLY A 1 1   ? 6.594   30.784  -0.138  1.00 0.00 ? 156 GLY A H2   4  
ATOM   6586  H  H3   . GLY A 1 1   ? 6.208   30.696  1.514   1.00 0.00 ? 156 GLY A H3   4  
ATOM   6587  H  HA2  . GLY A 1 1   ? 6.330   28.514  0.261   1.00 0.00 ? 156 GLY A HA2  4  
ATOM   6588  H  HA3  . GLY A 1 1   ? 4.895   28.799  1.248   1.00 0.00 ? 156 GLY A HA3  4  
ATOM   6589  N  N    . ALA A 1 2   ? 3.866   27.875  -1.016  1.00 0.00 ? 157 ALA A N    4  
ATOM   6590  C  CA   . ALA A 1 2   ? 2.987   27.695  -2.210  1.00 0.00 ? 157 ALA A CA   4  
ATOM   6591  C  C    . ALA A 1 2   ? 1.585   27.243  -1.774  1.00 0.00 ? 157 ALA A C    4  
ATOM   6592  O  O    . ALA A 1 2   ? 1.348   26.995  -0.607  1.00 0.00 ? 157 ALA A O    4  
ATOM   6593  C  CB   . ALA A 1 2   ? 3.668   26.607  -3.041  1.00 0.00 ? 157 ALA A CB   4  
ATOM   6594  H  H    . ALA A 1 2   ? 3.923   27.159  -0.345  1.00 0.00 ? 157 ALA A H    4  
ATOM   6595  H  HA   . ALA A 1 2   ? 2.929   28.611  -2.777  1.00 0.00 ? 157 ALA A HA   4  
ATOM   6596  H  HB1  . ALA A 1 2   ? 3.969   25.796  -2.395  1.00 0.00 ? 157 ALA A HB1  4  
ATOM   6597  H  HB2  . ALA A 1 2   ? 4.537   27.019  -3.531  1.00 0.00 ? 157 ALA A HB2  4  
ATOM   6598  H  HB3  . ALA A 1 2   ? 2.976   26.237  -3.784  1.00 0.00 ? 157 ALA A HB3  4  
ATOM   6599  N  N    . MET A 1 3   ? 0.651   27.132  -2.699  1.00 0.00 ? 158 MET A N    4  
ATOM   6600  C  CA   . MET A 1 3   ? -0.727  26.695  -2.322  1.00 0.00 ? 158 MET A CA   4  
ATOM   6601  C  C    . MET A 1 3   ? -1.079  25.379  -3.033  1.00 0.00 ? 158 MET A C    4  
ATOM   6602  O  O    . MET A 1 3   ? -0.254  24.804  -3.717  1.00 0.00 ? 158 MET A O    4  
ATOM   6603  C  CB   . MET A 1 3   ? -1.643  27.823  -2.798  1.00 0.00 ? 158 MET A CB   4  
ATOM   6604  C  CG   . MET A 1 3   ? -1.853  28.823  -1.659  1.00 0.00 ? 158 MET A CG   4  
ATOM   6605  S  SD   . MET A 1 3   ? -2.801  30.241  -2.268  1.00 0.00 ? 158 MET A SD   4  
ATOM   6606  C  CE   . MET A 1 3   ? -1.472  31.005  -3.229  1.00 0.00 ? 158 MET A CE   4  
ATOM   6607  H  H    . MET A 1 3   ? 0.854   27.334  -3.639  1.00 0.00 ? 158 MET A H    4  
ATOM   6608  H  HA   . MET A 1 3   ? -0.807  26.580  -1.253  1.00 0.00 ? 158 MET A HA   4  
ATOM   6609  H  HB2  . MET A 1 3   ? -1.188  28.326  -3.639  1.00 0.00 ? 158 MET A HB2  4  
ATOM   6610  H  HB3  . MET A 1 3   ? -2.596  27.413  -3.094  1.00 0.00 ? 158 MET A HB3  4  
ATOM   6611  H  HG2  . MET A 1 3   ? -2.396  28.347  -0.856  1.00 0.00 ? 158 MET A HG2  4  
ATOM   6612  H  HG3  . MET A 1 3   ? -0.894  29.161  -1.295  1.00 0.00 ? 158 MET A HG3  4  
ATOM   6613  H  HE1  . MET A 1 3   ? -0.660  31.276  -2.568  1.00 0.00 ? 158 MET A HE1  4  
ATOM   6614  H  HE2  . MET A 1 3   ? -1.843  31.889  -3.720  1.00 0.00 ? 158 MET A HE2  4  
ATOM   6615  H  HE3  . MET A 1 3   ? -1.119  30.304  -3.973  1.00 0.00 ? 158 MET A HE3  4  
ATOM   6616  N  N    . LYS A 1 4   ? -2.297  24.897  -2.880  1.00 0.00 ? 159 LYS A N    4  
ATOM   6617  C  CA   . LYS A 1 4   ? -2.686  23.621  -3.551  1.00 0.00 ? 159 LYS A CA   4  
ATOM   6618  C  C    . LYS A 1 4   ? -4.054  23.776  -4.232  1.00 0.00 ? 159 LYS A C    4  
ATOM   6619  O  O    . LYS A 1 4   ? -5.078  23.780  -3.577  1.00 0.00 ? 159 LYS A O    4  
ATOM   6620  C  CB   . LYS A 1 4   ? -2.761  22.588  -2.424  1.00 0.00 ? 159 LYS A CB   4  
ATOM   6621  C  CG   . LYS A 1 4   ? -2.176  21.259  -2.907  1.00 0.00 ? 159 LYS A CG   4  
ATOM   6622  C  CD   . LYS A 1 4   ? -2.665  20.126  -2.002  1.00 0.00 ? 159 LYS A CD   4  
ATOM   6623  C  CE   . LYS A 1 4   ? -3.928  19.504  -2.601  1.00 0.00 ? 159 LYS A CE   4  
ATOM   6624  N  NZ   . LYS A 1 4   ? -4.473  18.630  -1.524  1.00 0.00 ? 159 LYS A NZ   4  
ATOM   6625  H  H    . LYS A 1 4   ? -2.955  25.372  -2.325  1.00 0.00 ? 159 LYS A H    4  
ATOM   6626  H  HA   . LYS A 1 4   ? -1.937  23.331  -4.270  1.00 0.00 ? 159 LYS A HA   4  
ATOM   6627  H  HB2  . LYS A 1 4   ? -2.198  22.943  -1.573  1.00 0.00 ? 159 LYS A HB2  4  
ATOM   6628  H  HB3  . LYS A 1 4   ? -3.792  22.442  -2.138  1.00 0.00 ? 159 LYS A HB3  4  
ATOM   6629  H  HG2  . LYS A 1 4   ? -2.494  21.073  -3.922  1.00 0.00 ? 159 LYS A HG2  4  
ATOM   6630  H  HG3  . LYS A 1 4   ? -1.097  21.306  -2.870  1.00 0.00 ? 159 LYS A HG3  4  
ATOM   6631  H  HD2  . LYS A 1 4   ? -1.895  19.373  -1.920  1.00 0.00 ? 159 LYS A HD2  4  
ATOM   6632  H  HD3  . LYS A 1 4   ? -2.889  20.519  -1.022  1.00 0.00 ? 159 LYS A HD3  4  
ATOM   6633  H  HE2  . LYS A 1 4   ? -4.641  20.276  -2.858  1.00 0.00 ? 159 LYS A HE2  4  
ATOM   6634  H  HE3  . LYS A 1 4   ? -3.683  18.913  -3.467  1.00 0.00 ? 159 LYS A HE3  4  
ATOM   6635  H  HZ1  . LYS A 1 4   ? -3.762  17.919  -1.262  1.00 0.00 ? 159 LYS A HZ1  4  
ATOM   6636  H  HZ2  . LYS A 1 4   ? -5.332  18.153  -1.867  1.00 0.00 ? 159 LYS A HZ2  4  
ATOM   6637  H  HZ3  . LYS A 1 4   ? -4.705  19.208  -0.691  1.00 0.00 ? 159 LYS A HZ3  4  
ATOM   6638  N  N    . ARG A 1 5   ? -4.086  23.904  -5.548  1.00 0.00 ? 160 ARG A N    4  
ATOM   6639  C  CA   . ARG A 1 5   ? -5.394  24.059  -6.269  1.00 0.00 ? 160 ARG A CA   4  
ATOM   6640  C  C    . ARG A 1 5   ? -6.215  25.214  -5.665  1.00 0.00 ? 160 ARG A C    4  
ATOM   6641  O  O    . ARG A 1 5   ? -7.421  25.116  -5.533  1.00 0.00 ? 160 ARG A O    4  
ATOM   6642  C  CB   . ARG A 1 5   ? -6.125  22.722  -6.078  1.00 0.00 ? 160 ARG A CB   4  
ATOM   6643  C  CG   . ARG A 1 5   ? -6.039  21.897  -7.367  1.00 0.00 ? 160 ARG A CG   4  
ATOM   6644  C  CD   . ARG A 1 5   ? -7.316  22.093  -8.188  1.00 0.00 ? 160 ARG A CD   4  
ATOM   6645  N  NE   . ARG A 1 5   ? -7.288  23.522  -8.606  1.00 0.00 ? 160 ARG A NE   4  
ATOM   6646  C  CZ   . ARG A 1 5   ? -7.015  23.834  -9.844  1.00 0.00 ? 160 ARG A CZ   4  
ATOM   6647  N  NH1  . ARG A 1 5   ? -7.634  23.229  -10.821 1.00 0.00 ? 160 ARG A NH1  4  
ATOM   6648  N  NH2  . ARG A 1 5   ? -6.123  24.749  -10.104 1.00 0.00 ? 160 ARG A NH2  4  
ATOM   6649  H  H    . ARG A 1 5   ? -3.251  23.899  -6.066  1.00 0.00 ? 160 ARG A H    4  
ATOM   6650  H  HA   . ARG A 1 5   ? -5.221  24.236  -7.319  1.00 0.00 ? 160 ARG A HA   4  
ATOM   6651  H  HB2  . ARG A 1 5   ? -5.664  22.175  -5.269  1.00 0.00 ? 160 ARG A HB2  4  
ATOM   6652  H  HB3  . ARG A 1 5   ? -7.161  22.910  -5.840  1.00 0.00 ? 160 ARG A HB3  4  
ATOM   6653  H  HG2  . ARG A 1 5   ? -5.185  22.219  -7.944  1.00 0.00 ? 160 ARG A HG2  4  
ATOM   6654  H  HG3  . ARG A 1 5   ? -5.931  20.852  -7.117  1.00 0.00 ? 160 ARG A HG3  4  
ATOM   6655  H  HD2  . ARG A 1 5   ? -7.308  21.443  -9.052  1.00 0.00 ? 160 ARG A HD2  4  
ATOM   6656  H  HD3  . ARG A 1 5   ? -8.187  21.903  -7.581  1.00 0.00 ? 160 ARG A HD3  4  
ATOM   6657  H  HE   . ARG A 1 5   ? -7.475  24.228  -7.954  1.00 0.00 ? 160 ARG A HE   4  
ATOM   6658  H  HH11 . ARG A 1 5   ? -8.317  22.527  -10.622 1.00 0.00 ? 160 ARG A HH11 4  
ATOM   6659  H  HH12 . ARG A 1 5   ? -7.424  23.468  -11.770 1.00 0.00 ? 160 ARG A HH12 4  
ATOM   6660  H  HH21 . ARG A 1 5   ? -5.648  25.212  -9.356  1.00 0.00 ? 160 ARG A HH21 4  
ATOM   6661  H  HH22 . ARG A 1 5   ? -5.914  24.987  -11.053 1.00 0.00 ? 160 ARG A HH22 4  
ATOM   6662  N  N    . GLY A 1 6   ? -5.575  26.307  -5.300  1.00 0.00 ? 161 GLY A N    4  
ATOM   6663  C  CA   . GLY A 1 6   ? -6.328  27.453  -4.712  1.00 0.00 ? 161 GLY A CA   4  
ATOM   6664  C  C    . GLY A 1 6   ? -6.406  27.289  -3.187  1.00 0.00 ? 161 GLY A C    4  
ATOM   6665  O  O    . GLY A 1 6   ? -5.394  27.283  -2.511  1.00 0.00 ? 161 GLY A O    4  
ATOM   6666  H  H    . GLY A 1 6   ? -4.601  26.375  -5.413  1.00 0.00 ? 161 GLY A H    4  
ATOM   6667  H  HA2  . GLY A 1 6   ? -5.820  28.377  -4.951  1.00 0.00 ? 161 GLY A HA2  4  
ATOM   6668  H  HA3  . GLY A 1 6   ? -7.328  27.475  -5.119  1.00 0.00 ? 161 GLY A HA3  4  
ATOM   6669  N  N    . GLU A 1 7   ? -7.596  27.159  -2.636  1.00 0.00 ? 162 GLU A N    4  
ATOM   6670  C  CA   . GLU A 1 7   ? -7.723  26.998  -1.157  1.00 0.00 ? 162 GLU A CA   4  
ATOM   6671  C  C    . GLU A 1 7   ? -8.360  25.641  -0.821  1.00 0.00 ? 162 GLU A C    4  
ATOM   6672  O  O    . GLU A 1 7   ? -9.568  25.497  -0.852  1.00 0.00 ? 162 GLU A O    4  
ATOM   6673  C  CB   . GLU A 1 7   ? -8.633  28.142  -0.710  1.00 0.00 ? 162 GLU A CB   4  
ATOM   6674  C  CG   . GLU A 1 7   ? -8.587  28.268  0.813   1.00 0.00 ? 162 GLU A CG   4  
ATOM   6675  C  CD   . GLU A 1 7   ? -7.462  29.225  1.213   1.00 0.00 ? 162 GLU A CD   4  
ATOM   6676  O  OE1  . GLU A 1 7   ? -6.320  28.797  1.213   1.00 0.00 ? 162 GLU A OE1  4  
ATOM   6677  O  OE2  . GLU A 1 7   ? -7.762  30.368  1.512   1.00 0.00 ? 162 GLU A OE2  4  
ATOM   6678  H  H    . GLU A 1 7   ? -8.407  27.167  -3.193  1.00 0.00 ? 162 GLU A H    4  
ATOM   6679  H  HA   . GLU A 1 7   ? -6.758  27.089  -0.684  1.00 0.00 ? 162 GLU A HA   4  
ATOM   6680  H  HB2  . GLU A 1 7   ? -8.297  29.066  -1.159  1.00 0.00 ? 162 GLU A HB2  4  
ATOM   6681  H  HB3  . GLU A 1 7   ? -9.647  27.938  -1.022  1.00 0.00 ? 162 GLU A HB3  4  
ATOM   6682  H  HG2  . GLU A 1 7   ? -9.532  28.652  1.172   1.00 0.00 ? 162 GLU A HG2  4  
ATOM   6683  H  HG3  . GLU A 1 7   ? -8.404  27.298  1.250   1.00 0.00 ? 162 GLU A HG3  4  
ATOM   6684  N  N    . ASP A 1 8   ? -7.562  24.641  -0.499  1.00 0.00 ? 163 ASP A N    4  
ATOM   6685  C  CA   . ASP A 1 8   ? -8.135  23.304  -0.165  1.00 0.00 ? 163 ASP A CA   4  
ATOM   6686  C  C    . ASP A 1 8   ? -7.406  22.702  1.047   1.00 0.00 ? 163 ASP A C    4  
ATOM   6687  O  O    . ASP A 1 8   ? -6.212  22.472  1.002   1.00 0.00 ? 163 ASP A O    4  
ATOM   6688  C  CB   . ASP A 1 8   ? -7.899  22.448  -1.411  1.00 0.00 ? 163 ASP A CB   4  
ATOM   6689  C  CG   . ASP A 1 8   ? -9.106  22.560  -2.343  1.00 0.00 ? 163 ASP A CG   4  
ATOM   6690  O  OD1  . ASP A 1 8   ? -10.184 22.160  -1.936  1.00 0.00 ? 163 ASP A OD1  4  
ATOM   6691  O  OD2  . ASP A 1 8   ? -8.932  23.044  -3.450  1.00 0.00 ? 163 ASP A OD2  4  
ATOM   6692  H  H    . ASP A 1 8   ? -6.587  24.769  -0.477  1.00 0.00 ? 163 ASP A H    4  
ATOM   6693  H  HA   . ASP A 1 8   ? -9.192  23.385  0.032   1.00 0.00 ? 163 ASP A HA   4  
ATOM   6694  H  HB2  . ASP A 1 8   ? -7.013  22.796  -1.923  1.00 0.00 ? 163 ASP A HB2  4  
ATOM   6695  H  HB3  . ASP A 1 8   ? -7.766  21.417  -1.120  1.00 0.00 ? 163 ASP A HB3  4  
ATOM   6696  N  N    . GLY A 1 9   ? -8.111  22.448  2.133   1.00 0.00 ? 164 GLY A N    4  
ATOM   6697  C  CA   . GLY A 1 9   ? -7.447  21.863  3.336   1.00 0.00 ? 164 GLY A CA   4  
ATOM   6698  C  C    . GLY A 1 9   ? -6.877  20.481  2.988   1.00 0.00 ? 164 GLY A C    4  
ATOM   6699  O  O    . GLY A 1 9   ? -5.689  20.338  2.769   1.00 0.00 ? 164 GLY A O    4  
ATOM   6700  H  H    . GLY A 1 9   ? -9.075  22.639  2.157   1.00 0.00 ? 164 GLY A H    4  
ATOM   6701  H  HA2  . GLY A 1 9   ? -6.646  22.515  3.656   1.00 0.00 ? 164 GLY A HA2  4  
ATOM   6702  H  HA3  . GLY A 1 9   ? -8.169  21.761  4.131   1.00 0.00 ? 164 GLY A HA3  4  
ATOM   6703  N  N    . LEU A 1 10  ? -7.709  19.461  2.932   1.00 0.00 ? 165 LEU A N    4  
ATOM   6704  C  CA   . LEU A 1 10  ? -7.202  18.098  2.594   1.00 0.00 ? 165 LEU A CA   4  
ATOM   6705  C  C    . LEU A 1 10  ? -7.993  17.512  1.417   1.00 0.00 ? 165 LEU A C    4  
ATOM   6706  O  O    . LEU A 1 10  ? -7.453  17.303  0.347   1.00 0.00 ? 165 LEU A O    4  
ATOM   6707  C  CB   . LEU A 1 10  ? -7.423  17.267  3.860   1.00 0.00 ? 165 LEU A CB   4  
ATOM   6708  C  CG   . LEU A 1 10  ? -6.245  17.465  4.815   1.00 0.00 ? 165 LEU A CG   4  
ATOM   6709  C  CD1  . LEU A 1 10  ? -6.682  17.133  6.242   1.00 0.00 ? 165 LEU A CD1  4  
ATOM   6710  C  CD2  . LEU A 1 10  ? -5.097  16.539  4.404   1.00 0.00 ? 165 LEU A CD2  4  
ATOM   6711  H  H    . LEU A 1 10  ? -8.668  19.590  3.109   1.00 0.00 ? 165 LEU A H    4  
ATOM   6712  H  HA   . LEU A 1 10  ? -6.155  18.136  2.359   1.00 0.00 ? 165 LEU A HA   4  
ATOM   6713  H  HB2  . LEU A 1 10  ? -8.336  17.583  4.343   1.00 0.00 ? 165 LEU A HB2  4  
ATOM   6714  H  HB3  . LEU A 1 10  ? -7.498  16.222  3.596   1.00 0.00 ? 165 LEU A HB3  4  
ATOM   6715  H  HG   . LEU A 1 10  ? -5.914  18.493  4.770   1.00 0.00 ? 165 LEU A HG   4  
ATOM   6716  H  HD11 . LEU A 1 10  ? -6.579  16.070  6.411   1.00 0.00 ? 165 LEU A HD11 4  
ATOM   6717  H  HD12 . LEU A 1 10  ? -7.714  17.421  6.379   1.00 0.00 ? 165 LEU A HD12 4  
ATOM   6718  H  HD13 . LEU A 1 10  ? -6.061  17.670  6.942   1.00 0.00 ? 165 LEU A HD13 4  
ATOM   6719  H  HD21 . LEU A 1 10  ? -4.958  16.589  3.335   1.00 0.00 ? 165 LEU A HD21 4  
ATOM   6720  H  HD22 . LEU A 1 10  ? -5.334  15.525  4.689   1.00 0.00 ? 165 LEU A HD22 4  
ATOM   6721  H  HD23 . LEU A 1 10  ? -4.189  16.849  4.901   1.00 0.00 ? 165 LEU A HD23 4  
ATOM   6722  N  N    . HIS A 1 11  ? -9.271  17.245  1.599   1.00 0.00 ? 166 HIS A N    4  
ATOM   6723  C  CA   . HIS A 1 11  ? -10.100 16.672  0.487   1.00 0.00 ? 166 HIS A CA   4  
ATOM   6724  C  C    . HIS A 1 11  ? -9.423  15.428  -0.116  1.00 0.00 ? 166 HIS A C    4  
ATOM   6725  O  O    . HIS A 1 11  ? -9.446  15.227  -1.316  1.00 0.00 ? 166 HIS A O    4  
ATOM   6726  C  CB   . HIS A 1 11  ? -10.202 17.787  -0.557  1.00 0.00 ? 166 HIS A CB   4  
ATOM   6727  C  CG   . HIS A 1 11  ? -11.516 17.679  -1.280  1.00 0.00 ? 166 HIS A CG   4  
ATOM   6728  N  ND1  . HIS A 1 11  ? -11.610 17.767  -2.661  1.00 0.00 ? 166 HIS A ND1  4  
ATOM   6729  C  CD2  . HIS A 1 11  ? -12.799 17.490  -0.829  1.00 0.00 ? 166 HIS A CD2  4  
ATOM   6730  C  CE1  . HIS A 1 11  ? -12.908 17.633  -2.988  1.00 0.00 ? 166 HIS A CE1  4  
ATOM   6731  N  NE2  . HIS A 1 11  ? -13.677 17.461  -1.909  1.00 0.00 ? 166 HIS A NE2  4  
ATOM   6732  H  H    . HIS A 1 11  ? -9.689  17.422  2.469   1.00 0.00 ? 166 HIS A H    4  
ATOM   6733  H  HA   . HIS A 1 11  ? -11.085 16.420  0.849   1.00 0.00 ? 166 HIS A HA   4  
ATOM   6734  H  HB2  . HIS A 1 11  ? -10.139 18.747  -0.066  1.00 0.00 ? 166 HIS A HB2  4  
ATOM   6735  H  HB3  . HIS A 1 11  ? -9.393  17.691  -1.266  1.00 0.00 ? 166 HIS A HB3  4  
ATOM   6736  H  HD1  . HIS A 1 11  ? -10.866 17.902  -3.284  1.00 0.00 ? 166 HIS A HD1  4  
ATOM   6737  H  HD2  . HIS A 1 11  ? -13.084 17.381  0.206   1.00 0.00 ? 166 HIS A HD2  4  
ATOM   6738  H  HE1  . HIS A 1 11  ? -13.283 17.660  -4.001  1.00 0.00 ? 166 HIS A HE1  4  
ATOM   6739  N  N    . GLY A 1 12  ? -8.816  14.593  0.705   1.00 0.00 ? 167 GLY A N    4  
ATOM   6740  C  CA   . GLY A 1 12  ? -8.141  13.374  0.168   1.00 0.00 ? 167 GLY A CA   4  
ATOM   6741  C  C    . GLY A 1 12  ? -9.150  12.218  0.091   1.00 0.00 ? 167 GLY A C    4  
ATOM   6742  O  O    . GLY A 1 12  ? -10.320 12.395  0.374   1.00 0.00 ? 167 GLY A O    4  
ATOM   6743  H  H    . GLY A 1 12  ? -8.801  14.767  1.672   1.00 0.00 ? 167 GLY A H    4  
ATOM   6744  H  HA2  . GLY A 1 12  ? -7.754  13.583  -0.820  1.00 0.00 ? 167 GLY A HA2  4  
ATOM   6745  H  HA3  . GLY A 1 12  ? -7.329  13.095  0.822   1.00 0.00 ? 167 GLY A HA3  4  
ATOM   6746  N  N    . ILE A 1 13  ? -8.708  11.035  -0.289  1.00 0.00 ? 168 ILE A N    4  
ATOM   6747  C  CA   . ILE A 1 13  ? -9.649  9.878   -0.380  1.00 0.00 ? 168 ILE A CA   4  
ATOM   6748  C  C    . ILE A 1 13  ? -9.082  8.678   0.392   1.00 0.00 ? 168 ILE A C    4  
ATOM   6749  O  O    . ILE A 1 13  ? -7.882  8.549   0.553   1.00 0.00 ? 168 ILE A O    4  
ATOM   6750  C  CB   . ILE A 1 13  ? -9.747  9.561   -1.878  1.00 0.00 ? 168 ILE A CB   4  
ATOM   6751  C  CG1  . ILE A 1 13  ? -10.297 10.781  -2.623  1.00 0.00 ? 168 ILE A CG1  4  
ATOM   6752  C  CG2  . ILE A 1 13  ? -10.688 8.372   -2.097  1.00 0.00 ? 168 ILE A CG2  4  
ATOM   6753  C  CD1  . ILE A 1 13  ? -10.105 10.590  -4.129  1.00 0.00 ? 168 ILE A CD1  4  
ATOM   6754  H  H    . ILE A 1 13  ? -7.761  10.907  -0.515  1.00 0.00 ? 168 ILE A H    4  
ATOM   6755  H  HA   . ILE A 1 13  ? -10.620 10.145  0.005   1.00 0.00 ? 168 ILE A HA   4  
ATOM   6756  H  HB   . ILE A 1 13  ? -8.766  9.317   -2.258  1.00 0.00 ? 168 ILE A HB   4  
ATOM   6757  H  HG12 . ILE A 1 13  ? -11.349 10.893  -2.406  1.00 0.00 ? 168 ILE A HG12 4  
ATOM   6758  H  HG13 . ILE A 1 13  ? -9.767  11.666  -2.305  1.00 0.00 ? 168 ILE A HG13 4  
ATOM   6759  H  HG21 . ILE A 1 13  ? -11.457 8.375   -1.338  1.00 0.00 ? 168 ILE A HG21 4  
ATOM   6760  H  HG22 . ILE A 1 13  ? -10.127 7.451   -2.037  1.00 0.00 ? 168 ILE A HG22 4  
ATOM   6761  H  HG23 . ILE A 1 13  ? -11.147 8.449   -3.073  1.00 0.00 ? 168 ILE A HG23 4  
ATOM   6762  H  HD11 . ILE A 1 13  ? -10.371 9.579   -4.400  1.00 0.00 ? 168 ILE A HD11 4  
ATOM   6763  H  HD12 . ILE A 1 13  ? -9.072  10.771  -4.386  1.00 0.00 ? 168 ILE A HD12 4  
ATOM   6764  H  HD13 . ILE A 1 13  ? -10.736 11.284  -4.664  1.00 0.00 ? 168 ILE A HD13 4  
ATOM   6765  N  N    . VAL A 1 14  ? -9.933  7.790   0.862   1.00 0.00 ? 169 VAL A N    4  
ATOM   6766  C  CA   . VAL A 1 14  ? -9.430  6.594   1.612   1.00 0.00 ? 169 VAL A CA   4  
ATOM   6767  C  C    . VAL A 1 14  ? -9.402  5.381   0.674   1.00 0.00 ? 169 VAL A C    4  
ATOM   6768  O  O    . VAL A 1 14  ? -10.408 4.727   0.474   1.00 0.00 ? 169 VAL A O    4  
ATOM   6769  C  CB   . VAL A 1 14  ? -10.421 6.366   2.763   1.00 0.00 ? 169 VAL A CB   4  
ATOM   6770  C  CG1  . VAL A 1 14  ? -9.967  5.169   3.607   1.00 0.00 ? 169 VAL A CG1  4  
ATOM   6771  C  CG2  . VAL A 1 14  ? -10.483 7.620   3.643   1.00 0.00 ? 169 VAL A CG2  4  
ATOM   6772  H  H    . VAL A 1 14  ? -10.901 7.905   0.710   1.00 0.00 ? 169 VAL A H    4  
ATOM   6773  H  HA   . VAL A 1 14  ? -8.443  6.786   2.005   1.00 0.00 ? 169 VAL A HA   4  
ATOM   6774  H  HB   . VAL A 1 14  ? -11.402 6.163   2.355   1.00 0.00 ? 169 VAL A HB   4  
ATOM   6775  H  HG11 . VAL A 1 14  ? -9.305  4.546   3.025   1.00 0.00 ? 169 VAL A HG11 4  
ATOM   6776  H  HG12 . VAL A 1 14  ? -10.830 4.594   3.908   1.00 0.00 ? 169 VAL A HG12 4  
ATOM   6777  H  HG13 . VAL A 1 14  ? -9.448  5.523   4.485   1.00 0.00 ? 169 VAL A HG13 4  
ATOM   6778  H  HG21 . VAL A 1 14  ? -9.567  8.181   3.534   1.00 0.00 ? 169 VAL A HG21 4  
ATOM   6779  H  HG22 . VAL A 1 14  ? -10.607 7.330   4.675   1.00 0.00 ? 169 VAL A HG22 4  
ATOM   6780  H  HG23 . VAL A 1 14  ? -11.318 8.232   3.338   1.00 0.00 ? 169 VAL A HG23 4  
ATOM   6781  N  N    . SER A 1 15  ? -8.263  5.082   0.083   1.00 0.00 ? 170 SER A N    4  
ATOM   6782  C  CA   . SER A 1 15  ? -8.193  3.921   -0.853  1.00 0.00 ? 170 SER A CA   4  
ATOM   6783  C  C    . SER A 1 15  ? -6.956  3.062   -0.576  1.00 0.00 ? 170 SER A C    4  
ATOM   6784  O  O    . SER A 1 15  ? -6.061  3.457   0.147   1.00 0.00 ? 170 SER A O    4  
ATOM   6785  C  CB   . SER A 1 15  ? -8.114  4.542   -2.246  1.00 0.00 ? 170 SER A CB   4  
ATOM   6786  O  OG   . SER A 1 15  ? -7.030  5.462   -2.289  1.00 0.00 ? 170 SER A OG   4  
ATOM   6787  H  H    . SER A 1 15  ? -7.459  5.626   0.244   1.00 0.00 ? 170 SER A H    4  
ATOM   6788  H  HA   . SER A 1 15  ? -9.078  3.315   -0.772  1.00 0.00 ? 170 SER A HA   4  
ATOM   6789  H  HB2  . SER A 1 15  ? -7.951  3.769   -2.978  1.00 0.00 ? 170 SER A HB2  4  
ATOM   6790  H  HB3  . SER A 1 15  ? -9.042  5.053   -2.464  1.00 0.00 ? 170 SER A HB3  4  
ATOM   6791  H  HG   . SER A 1 15  ? -6.965  5.802   -3.185  1.00 0.00 ? 170 SER A HG   4  
ATOM   6792  N  N    . CYS A 1 16  ? -6.908  1.883   -1.152  1.00 0.00 ? 171 CYS A N    4  
ATOM   6793  C  CA   . CYS A 1 16  ? -5.726  0.982   -0.925  1.00 0.00 ? 171 CYS A CA   4  
ATOM   6794  C  C    . CYS A 1 16  ? -4.647  1.232   -1.988  1.00 0.00 ? 171 CYS A C    4  
ATOM   6795  O  O    . CYS A 1 16  ? -4.956  1.558   -3.122  1.00 0.00 ? 171 CYS A O    4  
ATOM   6796  C  CB   . CYS A 1 16  ? -6.257  -0.451  -1.046  1.00 0.00 ? 171 CYS A CB   4  
ATOM   6797  S  SG   . CYS A 1 16  ? -4.984  -1.617  -0.504  1.00 0.00 ? 171 CYS A SG   4  
ATOM   6798  H  H    . CYS A 1 16  ? -7.654  1.592   -1.734  1.00 0.00 ? 171 CYS A H    4  
ATOM   6799  H  HA   . CYS A 1 16  ? -5.321  1.140   0.063   1.00 0.00 ? 171 CYS A HA   4  
ATOM   6800  H  HB2  . CYS A 1 16  ? -7.135  -0.562  -0.429  1.00 0.00 ? 171 CYS A HB2  4  
ATOM   6801  H  HB3  . CYS A 1 16  ? -6.512  -0.652  -2.074  1.00 0.00 ? 171 CYS A HB3  4  
ATOM   6802  N  N    . THR A 1 17  ? -3.384  1.070   -1.639  1.00 0.00 ? 172 THR A N    4  
ATOM   6803  C  CA   . THR A 1 17  ? -2.293  1.293   -2.647  1.00 0.00 ? 172 THR A CA   4  
ATOM   6804  C  C    . THR A 1 17  ? -1.977  -0.019  -3.392  1.00 0.00 ? 172 THR A C    4  
ATOM   6805  O  O    . THR A 1 17  ? -1.727  -0.010  -4.583  1.00 0.00 ? 172 THR A O    4  
ATOM   6806  C  CB   . THR A 1 17  ? -1.063  1.810   -1.865  1.00 0.00 ? 172 THR A CB   4  
ATOM   6807  O  OG1  . THR A 1 17  ? -0.094  2.282   -2.789  1.00 0.00 ? 172 THR A OG1  4  
ATOM   6808  C  CG2  . THR A 1 17  ? -0.437  0.699   -1.001  1.00 0.00 ? 172 THR A CG2  4  
ATOM   6809  H  H    . THR A 1 17  ? -3.159  0.793   -0.720  1.00 0.00 ? 172 THR A H    4  
ATOM   6810  H  HA   . THR A 1 17  ? -2.607  2.043   -3.358  1.00 0.00 ? 172 THR A HA   4  
ATOM   6811  H  HB   . THR A 1 17  ? -1.368  2.625   -1.224  1.00 0.00 ? 172 THR A HB   4  
ATOM   6812  H  HG1  . THR A 1 17  ? -0.397  3.127   -3.131  1.00 0.00 ? 172 THR A HG1  4  
ATOM   6813  H  HG21 . THR A 1 17  ? 0.463   1.072   -0.534  1.00 0.00 ? 172 THR A HG21 4  
ATOM   6814  H  HG22 . THR A 1 17  ? -0.190  -0.147  -1.624  1.00 0.00 ? 172 THR A HG22 4  
ATOM   6815  H  HG23 . THR A 1 17  ? -1.134  0.392   -0.238  1.00 0.00 ? 172 THR A HG23 4  
ATOM   6816  N  N    . ALA A 1 18  ? -1.997  -1.147  -2.708  1.00 0.00 ? 173 ALA A N    4  
ATOM   6817  C  CA   . ALA A 1 18  ? -1.708  -2.448  -3.411  1.00 0.00 ? 173 ALA A CA   4  
ATOM   6818  C  C    . ALA A 1 18  ? -2.872  -2.814  -4.352  1.00 0.00 ? 173 ALA A C    4  
ATOM   6819  O  O    . ALA A 1 18  ? -2.666  -3.434  -5.378  1.00 0.00 ? 173 ALA A O    4  
ATOM   6820  C  CB   . ALA A 1 18  ? -1.537  -3.513  -2.314  1.00 0.00 ? 173 ALA A CB   4  
ATOM   6821  H  H    . ALA A 1 18  ? -2.213  -1.138  -1.745  1.00 0.00 ? 173 ALA A H    4  
ATOM   6822  H  HA   . ALA A 1 18  ? -0.796  -2.360  -3.977  1.00 0.00 ? 173 ALA A HA   4  
ATOM   6823  H  HB1  . ALA A 1 18  ? -2.499  -3.937  -2.071  1.00 0.00 ? 173 ALA A HB1  4  
ATOM   6824  H  HB2  . ALA A 1 18  ? -1.111  -3.056  -1.429  1.00 0.00 ? 173 ALA A HB2  4  
ATOM   6825  H  HB3  . ALA A 1 18  ? -0.878  -4.292  -2.668  1.00 0.00 ? 173 ALA A HB3  4  
ATOM   6826  N  N    . CYS A 1 19  ? -4.092  -2.429  -4.023  1.00 0.00 ? 174 CYS A N    4  
ATOM   6827  C  CA   . CYS A 1 19  ? -5.252  -2.752  -4.917  1.00 0.00 ? 174 CYS A CA   4  
ATOM   6828  C  C    . CYS A 1 19  ? -5.548  -1.578  -5.866  1.00 0.00 ? 174 CYS A C    4  
ATOM   6829  O  O    . CYS A 1 19  ? -5.959  -1.782  -6.992  1.00 0.00 ? 174 CYS A O    4  
ATOM   6830  C  CB   . CYS A 1 19  ? -6.447  -2.987  -3.982  1.00 0.00 ? 174 CYS A CB   4  
ATOM   6831  S  SG   . CYS A 1 19  ? -6.106  -4.388  -2.889  1.00 0.00 ? 174 CYS A SG   4  
ATOM   6832  H  H    . CYS A 1 19  ? -4.244  -1.923  -3.201  1.00 0.00 ? 174 CYS A H    4  
ATOM   6833  H  HA   . CYS A 1 19  ? -5.050  -3.639  -5.482  1.00 0.00 ? 174 CYS A HA   4  
ATOM   6834  H  HB2  . CYS A 1 19  ? -6.619  -2.103  -3.390  1.00 0.00 ? 174 CYS A HB2  4  
ATOM   6835  H  HB3  . CYS A 1 19  ? -7.322  -3.196  -4.572  1.00 0.00 ? 174 CYS A HB3  4  
ATOM   6836  N  N    . GLY A 1 20  ? -5.361  -0.350  -5.423  1.00 0.00 ? 175 GLY A N    4  
ATOM   6837  C  CA   . GLY A 1 20  ? -5.653  0.817   -6.304  1.00 0.00 ? 175 GLY A CA   4  
ATOM   6838  C  C    . GLY A 1 20  ? -7.165  1.069   -6.303  1.00 0.00 ? 175 GLY A C    4  
ATOM   6839  O  O    . GLY A 1 20  ? -7.750  1.345   -7.334  1.00 0.00 ? 175 GLY A O    4  
ATOM   6840  H  H    . GLY A 1 20  ? -5.042  -0.193  -4.510  1.00 0.00 ? 175 GLY A H    4  
ATOM   6841  H  HA2  . GLY A 1 20  ? -5.135  1.690   -5.931  1.00 0.00 ? 175 GLY A HA2  4  
ATOM   6842  H  HA3  . GLY A 1 20  ? -5.326  0.602   -7.310  1.00 0.00 ? 175 GLY A HA3  4  
ATOM   6843  N  N    . GLN A 1 21  ? -7.809  0.969   -5.155  1.00 0.00 ? 176 GLN A N    4  
ATOM   6844  C  CA   . GLN A 1 21  ? -9.286  1.195   -5.105  1.00 0.00 ? 176 GLN A CA   4  
ATOM   6845  C  C    . GLN A 1 21  ? -9.696  1.845   -3.776  1.00 0.00 ? 176 GLN A C    4  
ATOM   6846  O  O    . GLN A 1 21  ? -8.988  1.755   -2.792  1.00 0.00 ? 176 GLN A O    4  
ATOM   6847  C  CB   . GLN A 1 21  ? -9.901  -0.200  -5.228  1.00 0.00 ? 176 GLN A CB   4  
ATOM   6848  C  CG   . GLN A 1 21  ? -10.258 -0.479  -6.691  1.00 0.00 ? 176 GLN A CG   4  
ATOM   6849  C  CD   . GLN A 1 21  ? -11.731 -0.129  -6.935  1.00 0.00 ? 176 GLN A CD   4  
ATOM   6850  O  OE1  . GLN A 1 21  ? -12.065 1.022   -7.141  1.00 0.00 ? 176 GLN A OE1  4  
ATOM   6851  N  NE2  . GLN A 1 21  ? -12.639 -1.075  -6.921  1.00 0.00 ? 176 GLN A NE2  4  
ATOM   6852  H  H    . GLN A 1 21  ? -7.323  0.738   -4.328  1.00 0.00 ? 176 GLN A H    4  
ATOM   6853  H  HA   . GLN A 1 21  ? -9.605  1.809   -5.932  1.00 0.00 ? 176 GLN A HA   4  
ATOM   6854  H  HB2  . GLN A 1 21  ? -9.189  -0.937  -4.885  1.00 0.00 ? 176 GLN A HB2  4  
ATOM   6855  H  HB3  . GLN A 1 21  ? -10.794 -0.255  -4.625  1.00 0.00 ? 176 GLN A HB3  4  
ATOM   6856  H  HG2  . GLN A 1 21  ? -9.633  0.124   -7.335  1.00 0.00 ? 176 GLN A HG2  4  
ATOM   6857  H  HG3  . GLN A 1 21  ? -10.098 -1.523  -6.908  1.00 0.00 ? 176 GLN A HG3  4  
ATOM   6858  H  HE21 . GLN A 1 21  ? -12.382 -2.008  -6.756  1.00 0.00 ? 176 GLN A HE21 4  
ATOM   6859  H  HE22 . GLN A 1 21  ? -13.580 -0.849  -7.077  1.00 0.00 ? 176 GLN A HE22 4  
ATOM   6860  N  N    . GLN A 1 22  ? -10.841 2.497   -3.741  1.00 0.00 ? 177 GLN A N    4  
ATOM   6861  C  CA   . GLN A 1 22  ? -11.293 3.151   -2.461  1.00 0.00 ? 177 GLN A CA   4  
ATOM   6862  C  C    . GLN A 1 22  ? -11.766 2.089   -1.458  1.00 0.00 ? 177 GLN A C    4  
ATOM   6863  O  O    . GLN A 1 22  ? -12.086 0.975   -1.831  1.00 0.00 ? 177 GLN A O    4  
ATOM   6864  C  CB   . GLN A 1 22  ? -12.455 4.086   -2.831  1.00 0.00 ? 177 GLN A CB   4  
ATOM   6865  C  CG   . GLN A 1 22  ? -12.579 5.189   -1.778  1.00 0.00 ? 177 GLN A CG   4  
ATOM   6866  C  CD   . GLN A 1 22  ? -13.589 6.241   -2.255  1.00 0.00 ? 177 GLN A CD   4  
ATOM   6867  O  OE1  . GLN A 1 22  ? -13.532 6.678   -3.387  1.00 0.00 ? 177 GLN A OE1  4  
ATOM   6868  N  NE2  . GLN A 1 22  ? -14.518 6.673   -1.437  1.00 0.00 ? 177 GLN A NE2  4  
ATOM   6869  H  H    . GLN A 1 22  ? -11.398 2.552   -4.554  1.00 0.00 ? 177 GLN A H    4  
ATOM   6870  H  HA   . GLN A 1 22  ? -10.489 3.724   -2.030  1.00 0.00 ? 177 GLN A HA   4  
ATOM   6871  H  HB2  . GLN A 1 22  ? -12.266 4.530   -3.798  1.00 0.00 ? 177 GLN A HB2  4  
ATOM   6872  H  HB3  . GLN A 1 22  ? -13.375 3.522   -2.868  1.00 0.00 ? 177 GLN A HB3  4  
ATOM   6873  H  HG2  . GLN A 1 22  ? -12.918 4.760   -0.845  1.00 0.00 ? 177 GLN A HG2  4  
ATOM   6874  H  HG3  . GLN A 1 22  ? -11.618 5.658   -1.632  1.00 0.00 ? 177 GLN A HG3  4  
ATOM   6875  H  HE21 . GLN A 1 22  ? -14.575 6.327   -0.520  1.00 0.00 ? 177 GLN A HE21 4  
ATOM   6876  H  HE22 . GLN A 1 22  ? -15.162 7.345   -1.744  1.00 0.00 ? 177 GLN A HE22 4  
ATOM   6877  N  N    . VAL A 1 23  ? -11.817 2.427   -0.186  1.00 0.00 ? 178 VAL A N    4  
ATOM   6878  C  CA   . VAL A 1 23  ? -12.277 1.424   0.840   1.00 0.00 ? 178 VAL A CA   4  
ATOM   6879  C  C    . VAL A 1 23  ? -13.812 1.469   0.955   1.00 0.00 ? 178 VAL A C    4  
ATOM   6880  O  O    . VAL A 1 23  ? -14.433 2.416   0.517   1.00 0.00 ? 178 VAL A O    4  
ATOM   6881  C  CB   . VAL A 1 23  ? -11.613 1.829   2.170   1.00 0.00 ? 178 VAL A CB   4  
ATOM   6882  C  CG1  . VAL A 1 23  ? -11.989 0.826   3.263   1.00 0.00 ? 178 VAL A CG1  4  
ATOM   6883  C  CG2  . VAL A 1 23  ? -10.090 1.840   1.999   1.00 0.00 ? 178 VAL A CG2  4  
ATOM   6884  H  H    . VAL A 1 23  ? -11.556 3.339   0.091   1.00 0.00 ? 178 VAL A H    4  
ATOM   6885  H  HA   . VAL A 1 23  ? -11.958 0.433   0.557   1.00 0.00 ? 178 VAL A HA   4  
ATOM   6886  H  HB   . VAL A 1 23  ? -11.952 2.813   2.458   1.00 0.00 ? 178 VAL A HB   4  
ATOM   6887  H  HG11 . VAL A 1 23  ? -11.983 -0.173  2.853   1.00 0.00 ? 178 VAL A HG11 4  
ATOM   6888  H  HG12 . VAL A 1 23  ? -12.974 1.055   3.639   1.00 0.00 ? 178 VAL A HG12 4  
ATOM   6889  H  HG13 . VAL A 1 23  ? -11.272 0.888   4.069   1.00 0.00 ? 178 VAL A HG13 4  
ATOM   6890  H  HG21 . VAL A 1 23  ? -9.841  2.015   0.964   1.00 0.00 ? 178 VAL A HG21 4  
ATOM   6891  H  HG22 . VAL A 1 23  ? -9.685  0.887   2.308   1.00 0.00 ? 178 VAL A HG22 4  
ATOM   6892  H  HG23 . VAL A 1 23  ? -9.666  2.624   2.609   1.00 0.00 ? 178 VAL A HG23 4  
ATOM   6893  N  N    . ASN A 1 24  ? -14.430 0.445   1.519   1.00 0.00 ? 179 ASN A N    4  
ATOM   6894  C  CA   . ASN A 1 24  ? -15.938 0.439   1.632   1.00 0.00 ? 179 ASN A CA   4  
ATOM   6895  C  C    . ASN A 1 24  ? -16.452 1.690   2.372   1.00 0.00 ? 179 ASN A C    4  
ATOM   6896  O  O    . ASN A 1 24  ? -16.656 1.663   3.570   1.00 0.00 ? 179 ASN A O    4  
ATOM   6897  C  CB   . ASN A 1 24  ? -16.314 -0.823  2.425   1.00 0.00 ? 179 ASN A CB   4  
ATOM   6898  C  CG   . ASN A 1 24  ? -17.835 -1.010  2.403   1.00 0.00 ? 179 ASN A CG   4  
ATOM   6899  O  OD1  . ASN A 1 24  ? -18.349 -1.781  1.617   1.00 0.00 ? 179 ASN A OD1  4  
ATOM   6900  N  ND2  . ASN A 1 24  ? -18.590 -0.334  3.237   1.00 0.00 ? 179 ASN A ND2  4  
ATOM   6901  H  H    . ASN A 1 24  ? -13.905 -0.322  1.848   1.00 0.00 ? 179 ASN A H    4  
ATOM   6902  H  HA   . ASN A 1 24  ? -16.379 0.390   0.649   1.00 0.00 ? 179 ASN A HA   4  
ATOM   6903  H  HB2  . ASN A 1 24  ? -15.838 -1.684  1.977   1.00 0.00 ? 179 ASN A HB2  4  
ATOM   6904  H  HB3  . ASN A 1 24  ? -15.980 -0.719  3.447   1.00 0.00 ? 179 ASN A HB3  4  
ATOM   6905  H  HD21 . ASN A 1 24  ? -18.186 0.292   3.877   1.00 0.00 ? 179 ASN A HD21 4  
ATOM   6906  H  HD22 . ASN A 1 24  ? -19.562 -0.455  3.221   1.00 0.00 ? 179 ASN A HD22 4  
ATOM   6907  N  N    . HIS A 1 25  ? -16.680 2.780   1.666   1.00 0.00 ? 180 HIS A N    4  
ATOM   6908  C  CA   . HIS A 1 25  ? -17.199 4.028   2.316   1.00 0.00 ? 180 HIS A CA   4  
ATOM   6909  C  C    . HIS A 1 25  ? -16.421 4.394   3.598   1.00 0.00 ? 180 HIS A C    4  
ATOM   6910  O  O    . HIS A 1 25  ? -16.976 4.996   4.495   1.00 0.00 ? 180 HIS A O    4  
ATOM   6911  C  CB   . HIS A 1 25  ? -18.654 3.708   2.659   1.00 0.00 ? 180 HIS A CB   4  
ATOM   6912  C  CG   . HIS A 1 25  ? -19.467 4.973   2.631   1.00 0.00 ? 180 HIS A CG   4  
ATOM   6913  N  ND1  . HIS A 1 25  ? -20.244 5.329   1.541   1.00 0.00 ? 180 HIS A ND1  4  
ATOM   6914  C  CD2  . HIS A 1 25  ? -19.632 5.977   3.554   1.00 0.00 ? 180 HIS A CD2  4  
ATOM   6915  C  CE1  . HIS A 1 25  ? -20.837 6.502   1.830   1.00 0.00 ? 180 HIS A CE1  4  
ATOM   6916  N  NE2  . HIS A 1 25  ? -20.498 6.942   3.045   1.00 0.00 ? 180 HIS A NE2  4  
ATOM   6917  H  H    . HIS A 1 25  ? -16.522 2.779   0.695   1.00 0.00 ? 180 HIS A H    4  
ATOM   6918  H  HA   . HIS A 1 25  ? -17.168 4.849   1.619   1.00 0.00 ? 180 HIS A HA   4  
ATOM   6919  H  HB2  . HIS A 1 25  ? -19.049 3.011   1.935   1.00 0.00 ? 180 HIS A HB2  4  
ATOM   6920  H  HB3  . HIS A 1 25  ? -18.704 3.271   3.646   1.00 0.00 ? 180 HIS A HB3  4  
ATOM   6921  H  HD1  . HIS A 1 25  ? -20.345 4.819   0.710   1.00 0.00 ? 180 HIS A HD1  4  
ATOM   6922  H  HD2  . HIS A 1 25  ? -19.162 6.014   4.525   1.00 0.00 ? 180 HIS A HD2  4  
ATOM   6923  H  HE1  . HIS A 1 25  ? -21.505 7.024   1.162   1.00 0.00 ? 180 HIS A HE1  4  
ATOM   6924  N  N    . PHE A 1 26  ? -15.144 4.060   3.693   1.00 0.00 ? 181 PHE A N    4  
ATOM   6925  C  CA   . PHE A 1 26  ? -14.351 4.415   4.921   1.00 0.00 ? 181 PHE A CA   4  
ATOM   6926  C  C    . PHE A 1 26  ? -15.091 3.992   6.211   1.00 0.00 ? 181 PHE A C    4  
ATOM   6927  O  O    . PHE A 1 26  ? -15.938 4.712   6.707   1.00 0.00 ? 181 PHE A O    4  
ATOM   6928  C  CB   . PHE A 1 26  ? -14.196 5.940   4.856   1.00 0.00 ? 181 PHE A CB   4  
ATOM   6929  C  CG   . PHE A 1 26  ? -13.444 6.444   6.069   1.00 0.00 ? 181 PHE A CG   4  
ATOM   6930  C  CD1  . PHE A 1 26  ? -12.216 5.872   6.429   1.00 0.00 ? 181 PHE A CD1  4  
ATOM   6931  C  CD2  . PHE A 1 26  ? -13.978 7.490   6.833   1.00 0.00 ? 181 PHE A CD2  4  
ATOM   6932  C  CE1  . PHE A 1 26  ? -11.527 6.345   7.551   1.00 0.00 ? 181 PHE A CE1  4  
ATOM   6933  C  CE2  . PHE A 1 26  ? -13.288 7.961   7.953   1.00 0.00 ? 181 PHE A CE2  4  
ATOM   6934  C  CZ   . PHE A 1 26  ? -12.063 7.389   8.313   1.00 0.00 ? 181 PHE A CZ   4  
ATOM   6935  H  H    . PHE A 1 26  ? -14.699 3.588   2.956   1.00 0.00 ? 181 PHE A H    4  
ATOM   6936  H  HA   . PHE A 1 26  ? -13.380 3.949   4.882   1.00 0.00 ? 181 PHE A HA   4  
ATOM   6937  H  HB2  . PHE A 1 26  ? -13.651 6.205   3.962   1.00 0.00 ? 181 PHE A HB2  4  
ATOM   6938  H  HB3  . PHE A 1 26  ? -15.174 6.397   4.826   1.00 0.00 ? 181 PHE A HB3  4  
ATOM   6939  H  HD1  . PHE A 1 26  ? -11.801 5.064   5.843   1.00 0.00 ? 181 PHE A HD1  4  
ATOM   6940  H  HD2  . PHE A 1 26  ? -14.924 7.931   6.556   1.00 0.00 ? 181 PHE A HD2  4  
ATOM   6941  H  HE1  . PHE A 1 26  ? -10.581 5.904   7.830   1.00 0.00 ? 181 PHE A HE1  4  
ATOM   6942  H  HE2  . PHE A 1 26  ? -13.700 8.767   8.542   1.00 0.00 ? 181 PHE A HE2  4  
ATOM   6943  H  HZ   . PHE A 1 26  ? -11.532 7.753   9.177   1.00 0.00 ? 181 PHE A HZ   4  
ATOM   6944  N  N    . GLN A 1 27  ? -14.766 2.842   6.767   1.00 0.00 ? 182 GLN A N    4  
ATOM   6945  C  CA   . GLN A 1 27  ? -15.451 2.404   8.028   1.00 0.00 ? 182 GLN A CA   4  
ATOM   6946  C  C    . GLN A 1 27  ? -14.510 2.597   9.229   1.00 0.00 ? 182 GLN A C    4  
ATOM   6947  O  O    . GLN A 1 27  ? -13.305 2.647   9.070   1.00 0.00 ? 182 GLN A O    4  
ATOM   6948  C  CB   . GLN A 1 27  ? -15.780 0.922   7.826   1.00 0.00 ? 182 GLN A CB   4  
ATOM   6949  C  CG   . GLN A 1 27  ? -16.653 0.425   8.978   1.00 0.00 ? 182 GLN A CG   4  
ATOM   6950  C  CD   . GLN A 1 27  ? -17.656 -0.609  8.452   1.00 0.00 ? 182 GLN A CD   4  
ATOM   6951  O  OE1  . GLN A 1 27  ? -18.657 -0.251  7.864   1.00 0.00 ? 182 GLN A OE1  4  
ATOM   6952  N  NE2  . GLN A 1 27  ? -17.434 -1.888  8.636   1.00 0.00 ? 182 GLN A NE2  4  
ATOM   6953  H  H    . GLN A 1 27  ? -14.068 2.276   6.366   1.00 0.00 ? 182 GLN A H    4  
ATOM   6954  H  HA   . GLN A 1 27  ? -16.361 2.966   8.174   1.00 0.00 ? 182 GLN A HA   4  
ATOM   6955  H  HB2  . GLN A 1 27  ? -16.305 0.794   6.892   1.00 0.00 ? 182 GLN A HB2  4  
ATOM   6956  H  HB3  . GLN A 1 27  ? -14.865 0.355   7.806   1.00 0.00 ? 182 GLN A HB3  4  
ATOM   6957  H  HG2  . GLN A 1 27  ? -16.025 -0.031  9.729   1.00 0.00 ? 182 GLN A HG2  4  
ATOM   6958  H  HG3  . GLN A 1 27  ? -17.189 1.256   9.409   1.00 0.00 ? 182 GLN A HG3  4  
ATOM   6959  H  HE21 . GLN A 1 27  ? -16.628 -2.190  9.110   1.00 0.00 ? 182 GLN A HE21 4  
ATOM   6960  H  HE22 . GLN A 1 27  ? -18.076 -2.548  8.299   1.00 0.00 ? 182 GLN A HE22 4  
ATOM   6961  N  N    . LYS A 1 28  ? -15.045 2.720   10.428  1.00 0.00 ? 183 LYS A N    4  
ATOM   6962  C  CA   . LYS A 1 28  ? -14.154 2.927   11.630  1.00 0.00 ? 183 LYS A CA   4  
ATOM   6963  C  C    . LYS A 1 28  ? -13.126 1.786   11.794  1.00 0.00 ? 183 LYS A C    4  
ATOM   6964  O  O    . LYS A 1 28  ? -12.098 1.978   12.416  1.00 0.00 ? 183 LYS A O    4  
ATOM   6965  C  CB   . LYS A 1 28  ? -15.072 2.991   12.865  1.00 0.00 ? 183 LYS A CB   4  
ATOM   6966  C  CG   . LYS A 1 28  ? -15.868 1.689   13.000  1.00 0.00 ? 183 LYS A CG   4  
ATOM   6967  C  CD   . LYS A 1 28  ? -16.163 1.423   14.477  1.00 0.00 ? 183 LYS A CD   4  
ATOM   6968  C  CE   . LYS A 1 28  ? -17.426 2.179   14.891  1.00 0.00 ? 183 LYS A CE   4  
ATOM   6969  N  NZ   . LYS A 1 28  ? -17.444 2.111   16.379  1.00 0.00 ? 183 LYS A NZ   4  
ATOM   6970  H  H    . LYS A 1 28  ? -16.026 2.689   10.534  1.00 0.00 ? 183 LYS A H    4  
ATOM   6971  H  HA   . LYS A 1 28  ? -13.633 3.864   11.530  1.00 0.00 ? 183 LYS A HA   4  
ATOM   6972  H  HB2  . LYS A 1 28  ? -14.470 3.137   13.751  1.00 0.00 ? 183 LYS A HB2  4  
ATOM   6973  H  HB3  . LYS A 1 28  ? -15.757 3.819   12.759  1.00 0.00 ? 183 LYS A HB3  4  
ATOM   6974  H  HG2  . LYS A 1 28  ? -16.798 1.779   12.457  1.00 0.00 ? 183 LYS A HG2  4  
ATOM   6975  H  HG3  . LYS A 1 28  ? -15.295 0.870   12.597  1.00 0.00 ? 183 LYS A HG3  4  
ATOM   6976  H  HD2  . LYS A 1 28  ? -16.309 0.364   14.629  1.00 0.00 ? 183 LYS A HD2  4  
ATOM   6977  H  HD3  . LYS A 1 28  ? -15.330 1.761   15.077  1.00 0.00 ? 183 LYS A HD3  4  
ATOM   6978  H  HE2  . LYS A 1 28  ? -17.373 3.208   14.560  1.00 0.00 ? 183 LYS A HE2  4  
ATOM   6979  H  HE3  . LYS A 1 28  ? -18.303 1.697   14.488  1.00 0.00 ? 183 LYS A HE3  4  
ATOM   6980  H  HZ1  . LYS A 1 28  ? -16.672 2.692   16.762  1.00 0.00 ? 183 LYS A HZ1  4  
ATOM   6981  H  HZ2  . LYS A 1 28  ? -17.320 1.123   16.681  1.00 0.00 ? 183 LYS A HZ2  4  
ATOM   6982  H  HZ3  . LYS A 1 28  ? -18.354 2.471   16.732  1.00 0.00 ? 183 LYS A HZ3  4  
ATOM   6983  N  N    . ASP A 1 29  ? -13.381 0.605   11.266  1.00 0.00 ? 184 ASP A N    4  
ATOM   6984  C  CA   . ASP A 1 29  ? -12.396 -0.508  11.434  1.00 0.00 ? 184 ASP A CA   4  
ATOM   6985  C  C    . ASP A 1 29  ? -12.199 -1.293  10.125  1.00 0.00 ? 184 ASP A C    4  
ATOM   6986  O  O    . ASP A 1 29  ? -11.970 -2.488  10.155  1.00 0.00 ? 184 ASP A O    4  
ATOM   6987  C  CB   . ASP A 1 29  ? -13.005 -1.409  12.508  1.00 0.00 ? 184 ASP A CB   4  
ATOM   6988  C  CG   . ASP A 1 29  ? -12.606 -0.894  13.892  1.00 0.00 ? 184 ASP A CG   4  
ATOM   6989  O  OD1  . ASP A 1 29  ? -11.426 -0.929  14.198  1.00 0.00 ? 184 ASP A OD1  4  
ATOM   6990  O  OD2  . ASP A 1 29  ? -13.488 -0.473  14.623  1.00 0.00 ? 184 ASP A OD2  4  
ATOM   6991  H  H    . ASP A 1 29  ? -14.210 0.446   10.776  1.00 0.00 ? 184 ASP A H    4  
ATOM   6992  H  HA   . ASP A 1 29  ? -11.453 -0.119  11.780  1.00 0.00 ? 184 ASP A HA   4  
ATOM   6993  H  HB2  . ASP A 1 29  ? -14.081 -1.402  12.416  1.00 0.00 ? 184 ASP A HB2  4  
ATOM   6994  H  HB3  . ASP A 1 29  ? -12.639 -2.418  12.383  1.00 0.00 ? 184 ASP A HB3  4  
ATOM   6995  N  N    . SER A 1 30  ? -12.267 -0.644  8.979   1.00 0.00 ? 185 SER A N    4  
ATOM   6996  C  CA   . SER A 1 30  ? -12.058 -1.392  7.692   1.00 0.00 ? 185 SER A CA   4  
ATOM   6997  C  C    . SER A 1 30  ? -10.602 -1.244  7.228   1.00 0.00 ? 185 SER A C    4  
ATOM   6998  O  O    . SER A 1 30  ? -9.871  -2.209  7.184   1.00 0.00 ? 185 SER A O    4  
ATOM   6999  C  CB   . SER A 1 30  ? -13.006 -0.765  6.666   1.00 0.00 ? 185 SER A CB   4  
ATOM   7000  O  OG   . SER A 1 30  ? -12.506 -1.005  5.358   1.00 0.00 ? 185 SER A OG   4  
ATOM   7001  H  H    . SER A 1 30  ? -12.441 0.325   8.965   1.00 0.00 ? 185 SER A H    4  
ATOM   7002  H  HA   . SER A 1 30  ? -12.301 -2.435  7.826   1.00 0.00 ? 185 SER A HA   4  
ATOM   7003  H  HB2  . SER A 1 30  ? -13.984 -1.207  6.759   1.00 0.00 ? 185 SER A HB2  4  
ATOM   7004  H  HB3  . SER A 1 30  ? -13.076 0.300   6.847   1.00 0.00 ? 185 SER A HB3  4  
ATOM   7005  H  HG   . SER A 1 30  ? -12.704 -1.916  5.127   1.00 0.00 ? 185 SER A HG   4  
ATOM   7006  N  N    . ILE A 1 31  ? -10.176 -0.049  6.865   1.00 0.00 ? 186 ILE A N    4  
ATOM   7007  C  CA   . ILE A 1 31  ? -8.750  0.136   6.386   1.00 0.00 ? 186 ILE A CA   4  
ATOM   7008  C  C    . ILE A 1 31  ? -7.734  -0.504  7.345   1.00 0.00 ? 186 ILE A C    4  
ATOM   7009  O  O    . ILE A 1 31  ? -8.007  -0.706  8.512   1.00 0.00 ? 186 ILE A O    4  
ATOM   7010  C  CB   . ILE A 1 31  ? -8.490  1.651   6.308   1.00 0.00 ? 186 ILE A CB   4  
ATOM   7011  C  CG1  . ILE A 1 31  ? -8.797  2.305   7.662   1.00 0.00 ? 186 ILE A CG1  4  
ATOM   7012  C  CG2  . ILE A 1 31  ? -9.376  2.269   5.230   1.00 0.00 ? 186 ILE A CG2  4  
ATOM   7013  C  CD1  . ILE A 1 31  ? -8.107  3.667   7.738   1.00 0.00 ? 186 ILE A CD1  4  
ATOM   7014  H  H    . ILE A 1 31  ? -10.795 0.719   6.892   1.00 0.00 ? 186 ILE A H    4  
ATOM   7015  H  HA   . ILE A 1 31  ? -8.636  -0.297  5.405   1.00 0.00 ? 186 ILE A HA   4  
ATOM   7016  H  HB   . ILE A 1 31  ? -7.454  1.821   6.055   1.00 0.00 ? 186 ILE A HB   4  
ATOM   7017  H  HG12 . ILE A 1 31  ? -9.865  2.438   7.766   1.00 0.00 ? 186 ILE A HG12 4  
ATOM   7018  H  HG13 . ILE A 1 31  ? -8.433  1.673   8.457   1.00 0.00 ? 186 ILE A HG13 4  
ATOM   7019  H  HG21 . ILE A 1 31  ? -8.955  3.215   4.917   1.00 0.00 ? 186 ILE A HG21 4  
ATOM   7020  H  HG22 . ILE A 1 31  ? -10.368 2.429   5.625   1.00 0.00 ? 186 ILE A HG22 4  
ATOM   7021  H  HG23 . ILE A 1 31  ? -9.426  1.599   4.383   1.00 0.00 ? 186 ILE A HG23 4  
ATOM   7022  H  HD11 . ILE A 1 31  ? -8.630  4.295   8.444   1.00 0.00 ? 186 ILE A HD11 4  
ATOM   7023  H  HD12 . ILE A 1 31  ? -8.121  4.133   6.764   1.00 0.00 ? 186 ILE A HD12 4  
ATOM   7024  H  HD13 . ILE A 1 31  ? -7.085  3.535   8.061   1.00 0.00 ? 186 ILE A HD13 4  
ATOM   7025  N  N    . TYR A 1 32  ? -6.554  -0.817  6.848   1.00 0.00 ? 187 TYR A N    4  
ATOM   7026  C  CA   . TYR A 1 32  ? -5.504  -1.435  7.710   1.00 0.00 ? 187 TYR A CA   4  
ATOM   7027  C  C    . TYR A 1 32  ? -4.140  -0.823  7.382   1.00 0.00 ? 187 TYR A C    4  
ATOM   7028  O  O    . TYR A 1 32  ? -3.984  -0.144  6.385   1.00 0.00 ? 187 TYR A O    4  
ATOM   7029  C  CB   . TYR A 1 32  ? -5.515  -2.920  7.351   1.00 0.00 ? 187 TYR A CB   4  
ATOM   7030  C  CG   . TYR A 1 32  ? -6.450  -3.656  8.276   1.00 0.00 ? 187 TYR A CG   4  
ATOM   7031  C  CD1  . TYR A 1 32  ? -5.986  -4.131  9.509   1.00 0.00 ? 187 TYR A CD1  4  
ATOM   7032  C  CD2  . TYR A 1 32  ? -7.779  -3.862  7.901   1.00 0.00 ? 187 TYR A CD2  4  
ATOM   7033  C  CE1  . TYR A 1 32  ? -6.856  -4.816  10.365  1.00 0.00 ? 187 TYR A CE1  4  
ATOM   7034  C  CE2  . TYR A 1 32  ? -8.650  -4.545  8.756   1.00 0.00 ? 187 TYR A CE2  4  
ATOM   7035  C  CZ   . TYR A 1 32  ? -8.190  -5.023  9.989   1.00 0.00 ? 187 TYR A CZ   4  
ATOM   7036  O  OH   . TYR A 1 32  ? -9.048  -5.697  10.834  1.00 0.00 ? 187 TYR A OH   4  
ATOM   7037  H  H    . TYR A 1 32  ? -6.355  -0.640  5.902   1.00 0.00 ? 187 TYR A H    4  
ATOM   7038  H  HA   . TYR A 1 32  ? -5.730  -1.303  8.755   1.00 0.00 ? 187 TYR A HA   4  
ATOM   7039  H  HB2  . TYR A 1 32  ? -5.849  -3.041  6.330   1.00 0.00 ? 187 TYR A HB2  4  
ATOM   7040  H  HB3  . TYR A 1 32  ? -4.518  -3.322  7.453   1.00 0.00 ? 187 TYR A HB3  4  
ATOM   7041  H  HD1  . TYR A 1 32  ? -4.958  -3.971  9.798   1.00 0.00 ? 187 TYR A HD1  4  
ATOM   7042  H  HD2  . TYR A 1 32  ? -8.133  -3.497  6.945   1.00 0.00 ? 187 TYR A HD2  4  
ATOM   7043  H  HE1  . TYR A 1 32  ? -6.499  -5.184  11.316  1.00 0.00 ? 187 TYR A HE1  4  
ATOM   7044  H  HE2  . TYR A 1 32  ? -9.678  -4.705  8.464   1.00 0.00 ? 187 TYR A HE2  4  
ATOM   7045  H  HH   . TYR A 1 32  ? -9.242  -5.124  11.579  1.00 0.00 ? 187 TYR A HH   4  
ATOM   7046  N  N    . ARG A 1 33  ? -3.150  -1.064  8.209   1.00 0.00 ? 188 ARG A N    4  
ATOM   7047  C  CA   . ARG A 1 33  ? -1.795  -0.498  7.934   1.00 0.00 ? 188 ARG A CA   4  
ATOM   7048  C  C    . ARG A 1 33  ? -0.834  -1.625  7.537   1.00 0.00 ? 188 ARG A C    4  
ATOM   7049  O  O    . ARG A 1 33  ? -0.815  -2.668  8.165   1.00 0.00 ? 188 ARG A O    4  
ATOM   7050  C  CB   . ARG A 1 33  ? -1.344  0.150   9.248   1.00 0.00 ? 188 ARG A CB   4  
ATOM   7051  C  CG   . ARG A 1 33  ? -2.079  1.481   9.450   1.00 0.00 ? 188 ARG A CG   4  
ATOM   7052  C  CD   . ARG A 1 33  ? -1.099  2.539   9.966   1.00 0.00 ? 188 ARG A CD   4  
ATOM   7053  N  NE   . ARG A 1 33  ? -0.665  2.044   11.301  1.00 0.00 ? 188 ARG A NE   4  
ATOM   7054  C  CZ   . ARG A 1 33  ? -1.435  2.212   12.341  1.00 0.00 ? 188 ARG A CZ   4  
ATOM   7055  N  NH1  . ARG A 1 33  ? -1.443  3.355   12.970  1.00 0.00 ? 188 ARG A NH1  4  
ATOM   7056  N  NH2  . ARG A 1 33  ? -2.199  1.236   12.752  1.00 0.00 ? 188 ARG A NH2  4  
ATOM   7057  H  H    . ARG A 1 33  ? -3.297  -1.625  9.008   1.00 0.00 ? 188 ARG A H    4  
ATOM   7058  H  HA   . ARG A 1 33  ? -1.849  0.245   7.153   1.00 0.00 ? 188 ARG A HA   4  
ATOM   7059  H  HB2  . ARG A 1 33  ? -1.571  -0.514  10.070  1.00 0.00 ? 188 ARG A HB2  4  
ATOM   7060  H  HB3  . ARG A 1 33  ? -0.280  0.327   9.212   1.00 0.00 ? 188 ARG A HB3  4  
ATOM   7061  H  HG2  . ARG A 1 33  ? -2.501  1.808   8.511   1.00 0.00 ? 188 ARG A HG2  4  
ATOM   7062  H  HG3  . ARG A 1 33  ? -2.870  1.346   10.172  1.00 0.00 ? 188 ARG A HG3  4  
ATOM   7063  H  HD2  . ARG A 1 33  ? -0.252  2.622   9.298   1.00 0.00 ? 188 ARG A HD2  4  
ATOM   7064  H  HD3  . ARG A 1 33  ? -1.593  3.493   10.067  1.00 0.00 ? 188 ARG A HD3  4  
ATOM   7065  H  HE   . ARG A 1 33  ? 0.199   1.592   11.399  1.00 0.00 ? 188 ARG A HE   4  
ATOM   7066  H  HH11 . ARG A 1 33  ? -0.858  4.102   12.655  1.00 0.00 ? 188 ARG A HH11 4  
ATOM   7067  H  HH12 . ARG A 1 33  ? -2.033  3.483   13.767  1.00 0.00 ? 188 ARG A HH12 4  
ATOM   7068  H  HH21 . ARG A 1 33  ? -2.193  0.360   12.269  1.00 0.00 ? 188 ARG A HH21 4  
ATOM   7069  H  HH22 . ARG A 1 33  ? -2.788  1.365   13.549  1.00 0.00 ? 188 ARG A HH22 4  
ATOM   7070  N  N    . HIS A 1 34  ? -0.028  -1.432  6.512   1.00 0.00 ? 189 HIS A N    4  
ATOM   7071  C  CA   . HIS A 1 34  ? 0.929   -2.520  6.117   1.00 0.00 ? 189 HIS A CA   4  
ATOM   7072  C  C    . HIS A 1 34  ? 1.948   -2.701  7.255   1.00 0.00 ? 189 HIS A C    4  
ATOM   7073  O  O    . HIS A 1 34  ? 2.481   -1.726  7.749   1.00 0.00 ? 189 HIS A O    4  
ATOM   7074  C  CB   . HIS A 1 34  ? 1.617   -2.052  4.826   1.00 0.00 ? 189 HIS A CB   4  
ATOM   7075  C  CG   . HIS A 1 34  ? 1.990   -3.247  3.984   1.00 0.00 ? 189 HIS A CG   4  
ATOM   7076  N  ND1  . HIS A 1 34  ? 3.227   -3.857  4.075   1.00 0.00 ? 189 HIS A ND1  4  
ATOM   7077  C  CD2  . HIS A 1 34  ? 1.289   -3.968  3.050   1.00 0.00 ? 189 HIS A CD2  4  
ATOM   7078  C  CE1  . HIS A 1 34  ? 3.236   -4.900  3.231   1.00 0.00 ? 189 HIS A CE1  4  
ATOM   7079  N  NE2  . HIS A 1 34  ? 2.077   -5.015  2.577   1.00 0.00 ? 189 HIS A NE2  4  
ATOM   7080  H  H    . HIS A 1 34  ? -0.046  -0.575  6.020   1.00 0.00 ? 189 HIS A H    4  
ATOM   7081  H  HA   . HIS A 1 34  ? 0.389   -3.438  5.939   1.00 0.00 ? 189 HIS A HA   4  
ATOM   7082  H  HB2  . HIS A 1 34  ? 0.940   -1.419  4.270   1.00 0.00 ? 189 HIS A HB2  4  
ATOM   7083  H  HB3  . HIS A 1 34  ? 2.500   -1.494  5.082   1.00 0.00 ? 189 HIS A HB3  4  
ATOM   7084  H  HD1  . HIS A 1 34  ? 3.970   -3.566  4.626   1.00 0.00 ? 189 HIS A HD1  4  
ATOM   7085  H  HD2  . HIS A 1 34  ? 0.288   -3.747  2.720   1.00 0.00 ? 189 HIS A HD2  4  
ATOM   7086  H  HE1  . HIS A 1 34  ? 4.074   -5.571  3.112   1.00 0.00 ? 189 HIS A HE1  4  
ATOM   7087  N  N    . PRO A 1 35  ? 2.170   -3.930  7.670   1.00 0.00 ? 190 PRO A N    4  
ATOM   7088  C  CA   . PRO A 1 35  ? 3.110   -4.178  8.794   1.00 0.00 ? 190 PRO A CA   4  
ATOM   7089  C  C    . PRO A 1 35  ? 4.568   -3.932  8.373   1.00 0.00 ? 190 PRO A C    4  
ATOM   7090  O  O    . PRO A 1 35  ? 5.356   -3.426  9.152   1.00 0.00 ? 190 PRO A O    4  
ATOM   7091  C  CB   . PRO A 1 35  ? 2.879   -5.648  9.138   1.00 0.00 ? 190 PRO A CB   4  
ATOM   7092  C  CG   . PRO A 1 35  ? 2.352   -6.261  7.882   1.00 0.00 ? 190 PRO A CG   4  
ATOM   7093  C  CD   . PRO A 1 35  ? 1.595   -5.185  7.153   1.00 0.00 ? 190 PRO A CD   4  
ATOM   7094  H  HA   . PRO A 1 35  ? 2.854   -3.563  9.641   1.00 0.00 ? 190 PRO A HA   4  
ATOM   7095  H  HB2  . PRO A 1 35  ? 3.809   -6.117  9.429   1.00 0.00 ? 190 PRO A HB2  4  
ATOM   7096  H  HB3  . PRO A 1 35  ? 2.146   -5.737  9.925   1.00 0.00 ? 190 PRO A HB3  4  
ATOM   7097  H  HG2  . PRO A 1 35  ? 3.173   -6.617  7.274   1.00 0.00 ? 190 PRO A HG2  4  
ATOM   7098  H  HG3  . PRO A 1 35  ? 1.686   -7.077  8.120   1.00 0.00 ? 190 PRO A HG3  4  
ATOM   7099  H  HD2  . PRO A 1 35  ? 1.755   -5.269  6.086   1.00 0.00 ? 190 PRO A HD2  4  
ATOM   7100  H  HD3  . PRO A 1 35  ? 0.543   -5.235  7.387   1.00 0.00 ? 190 PRO A HD3  4  
ATOM   7101  N  N    . SER A 1 36  ? 4.945   -4.294  7.165   1.00 0.00 ? 191 SER A N    4  
ATOM   7102  C  CA   . SER A 1 36  ? 6.371   -4.080  6.736   1.00 0.00 ? 191 SER A CA   4  
ATOM   7103  C  C    . SER A 1 36  ? 6.545   -2.869  5.790   1.00 0.00 ? 191 SER A C    4  
ATOM   7104  O  O    . SER A 1 36  ? 7.574   -2.752  5.151   1.00 0.00 ? 191 SER A O    4  
ATOM   7105  C  CB   . SER A 1 36  ? 6.765   -5.368  6.007   1.00 0.00 ? 191 SER A CB   4  
ATOM   7106  O  OG   . SER A 1 36  ? 6.702   -6.461  6.915   1.00 0.00 ? 191 SER A OG   4  
ATOM   7107  H  H    . SER A 1 36  ? 4.301   -4.715  6.551   1.00 0.00 ? 191 SER A H    4  
ATOM   7108  H  HA   . SER A 1 36  ? 6.999   -3.958  7.604   1.00 0.00 ? 191 SER A HA   4  
ATOM   7109  H  HB2  . SER A 1 36  ? 6.083   -5.544  5.190   1.00 0.00 ? 191 SER A HB2  4  
ATOM   7110  H  HB3  . SER A 1 36  ? 7.770   -5.267  5.618   1.00 0.00 ? 191 SER A HB3  4  
ATOM   7111  H  HG   . SER A 1 36  ? 7.260   -7.162  6.573   1.00 0.00 ? 191 SER A HG   4  
ATOM   7112  N  N    . LEU A 1 37  ? 5.576   -1.974  5.669   1.00 0.00 ? 192 LEU A N    4  
ATOM   7113  C  CA   . LEU A 1 37  ? 5.766   -0.810  4.729   1.00 0.00 ? 192 LEU A CA   4  
ATOM   7114  C  C    . LEU A 1 37  ? 5.287   0.552   5.291   1.00 0.00 ? 192 LEU A C    4  
ATOM   7115  O  O    . LEU A 1 37  ? 5.330   1.535   4.574   1.00 0.00 ? 192 LEU A O    4  
ATOM   7116  C  CB   . LEU A 1 37  ? 4.919   -1.146  3.494   1.00 0.00 ? 192 LEU A CB   4  
ATOM   7117  C  CG   . LEU A 1 37  ? 5.552   -2.265  2.661   1.00 0.00 ? 192 LEU A CG   4  
ATOM   7118  C  CD1  . LEU A 1 37  ? 4.695   -2.474  1.408   1.00 0.00 ? 192 LEU A CD1  4  
ATOM   7119  C  CD2  . LEU A 1 37  ? 6.971   -1.873  2.236   1.00 0.00 ? 192 LEU A CD2  4  
ATOM   7120  H  H    . LEU A 1 37  ? 4.742   -2.072  6.170   1.00 0.00 ? 192 LEU A H    4  
ATOM   7121  H  HA   . LEU A 1 37  ? 6.800   -0.740  4.438   1.00 0.00 ? 192 LEU A HA   4  
ATOM   7122  H  HB2  . LEU A 1 37  ? 3.940   -1.459  3.811   1.00 0.00 ? 192 LEU A HB2  4  
ATOM   7123  H  HB3  . LEU A 1 37  ? 4.824   -0.262  2.882   1.00 0.00 ? 192 LEU A HB3  4  
ATOM   7124  H  HG   . LEU A 1 37  ? 5.580   -3.178  3.238   1.00 0.00 ? 192 LEU A HG   4  
ATOM   7125  H  HD11 . LEU A 1 37  ? 5.270   -2.997  0.658   1.00 0.00 ? 192 LEU A HD11 4  
ATOM   7126  H  HD12 . LEU A 1 37  ? 4.392   -1.507  1.024   1.00 0.00 ? 192 LEU A HD12 4  
ATOM   7127  H  HD13 . LEU A 1 37  ? 3.814   -3.052  1.660   1.00 0.00 ? 192 LEU A HD13 4  
ATOM   7128  H  HD21 . LEU A 1 37  ? 7.228   -2.389  1.323   1.00 0.00 ? 192 LEU A HD21 4  
ATOM   7129  H  HD22 . LEU A 1 37  ? 7.669   -2.150  3.011   1.00 0.00 ? 192 LEU A HD22 4  
ATOM   7130  H  HD23 . LEU A 1 37  ? 7.017   -0.807  2.074   1.00 0.00 ? 192 LEU A HD23 4  
ATOM   7131  N  N    . GLN A 1 38  ? 4.827   0.653   6.532   1.00 0.00 ? 193 GLN A N    4  
ATOM   7132  C  CA   . GLN A 1 38  ? 4.349   1.982   7.057   1.00 0.00 ? 193 GLN A CA   4  
ATOM   7133  C  C    . GLN A 1 38  ? 3.360   2.634   6.069   1.00 0.00 ? 193 GLN A C    4  
ATOM   7134  O  O    . GLN A 1 38  ? 3.431   3.821   5.812   1.00 0.00 ? 193 GLN A O    4  
ATOM   7135  C  CB   . GLN A 1 38  ? 5.613   2.837   7.190   1.00 0.00 ? 193 GLN A CB   4  
ATOM   7136  C  CG   . GLN A 1 38  ? 6.307   2.520   8.517   1.00 0.00 ? 193 GLN A CG   4  
ATOM   7137  C  CD   . GLN A 1 38  ? 6.872   1.096   8.473   1.00 0.00 ? 193 GLN A CD   4  
ATOM   7138  O  OE1  . GLN A 1 38  ? 6.468   0.251   9.246   1.00 0.00 ? 193 GLN A OE1  4  
ATOM   7139  N  NE2  . GLN A 1 38  ? 7.798   0.786   7.598   1.00 0.00 ? 193 GLN A NE2  4  
ATOM   7140  H  H    . GLN A 1 38  ? 4.787   -0.124  7.114   1.00 0.00 ? 193 GLN A H    4  
ATOM   7141  H  HA   . GLN A 1 38  ? 3.885   1.855   8.023   1.00 0.00 ? 193 GLN A HA   4  
ATOM   7142  H  HB2  . GLN A 1 38  ? 6.283   2.620   6.371   1.00 0.00 ? 193 GLN A HB2  4  
ATOM   7143  H  HB3  . GLN A 1 38  ? 5.345   3.883   7.167   1.00 0.00 ? 193 GLN A HB3  4  
ATOM   7144  H  HG2  . GLN A 1 38  ? 7.112   3.224   8.678   1.00 0.00 ? 193 GLN A HG2  4  
ATOM   7145  H  HG3  . GLN A 1 38  ? 5.593   2.598   9.325   1.00 0.00 ? 193 GLN A HG3  4  
ATOM   7146  H  HE21 . GLN A 1 38  ? 8.133   1.462   6.968   1.00 0.00 ? 193 GLN A HE21 4  
ATOM   7147  H  HE22 . GLN A 1 38  ? 8.158   -0.125  7.572   1.00 0.00 ? 193 GLN A HE22 4  
ATOM   7148  N  N    . VAL A 1 39  ? 2.451   1.865   5.500   1.00 0.00 ? 194 VAL A N    4  
ATOM   7149  C  CA   . VAL A 1 39  ? 1.483   2.448   4.519   1.00 0.00 ? 194 VAL A CA   4  
ATOM   7150  C  C    . VAL A 1 39  ? 0.059   1.922   4.777   1.00 0.00 ? 194 VAL A C    4  
ATOM   7151  O  O    . VAL A 1 39  ? -0.127  0.939   5.468   1.00 0.00 ? 194 VAL A O    4  
ATOM   7152  C  CB   . VAL A 1 39  ? 2.015   2.011   3.145   1.00 0.00 ? 194 VAL A CB   4  
ATOM   7153  C  CG1  . VAL A 1 39  ? 1.923   0.489   2.989   1.00 0.00 ? 194 VAL A CG1  4  
ATOM   7154  C  CG2  . VAL A 1 39  ? 1.199   2.686   2.044   1.00 0.00 ? 194 VAL A CG2  4  
ATOM   7155  H  H    . VAL A 1 39  ? 2.412   0.906   5.707   1.00 0.00 ? 194 VAL A H    4  
ATOM   7156  H  HA   . VAL A 1 39  ? 1.487   3.524   4.581   1.00 0.00 ? 194 VAL A HA   4  
ATOM   7157  H  HB   . VAL A 1 39  ? 3.049   2.312   3.056   1.00 0.00 ? 194 VAL A HB   4  
ATOM   7158  H  HG11 . VAL A 1 39  ? 2.290   0.207   2.015   1.00 0.00 ? 194 VAL A HG11 4  
ATOM   7159  H  HG12 . VAL A 1 39  ? 0.893   0.179   3.089   1.00 0.00 ? 194 VAL A HG12 4  
ATOM   7160  H  HG13 . VAL A 1 39  ? 2.520   0.011   3.751   1.00 0.00 ? 194 VAL A HG13 4  
ATOM   7161  H  HG21 . VAL A 1 39  ? 1.642   2.468   1.084   1.00 0.00 ? 194 VAL A HG21 4  
ATOM   7162  H  HG22 . VAL A 1 39  ? 1.196   3.754   2.204   1.00 0.00 ? 194 VAL A HG22 4  
ATOM   7163  H  HG23 . VAL A 1 39  ? 0.185   2.314   2.066   1.00 0.00 ? 194 VAL A HG23 4  
ATOM   7164  N  N    . LEU A 1 40  ? -0.947  2.582   4.238   1.00 0.00 ? 195 LEU A N    4  
ATOM   7165  C  CA   . LEU A 1 40  ? -2.362  2.122   4.474   1.00 0.00 ? 195 LEU A CA   4  
ATOM   7166  C  C    . LEU A 1 40  ? -2.811  1.107   3.408   1.00 0.00 ? 195 LEU A C    4  
ATOM   7167  O  O    . LEU A 1 40  ? -2.495  1.238   2.241   1.00 0.00 ? 195 LEU A O    4  
ATOM   7168  C  CB   . LEU A 1 40  ? -3.240  3.381   4.393   1.00 0.00 ? 195 LEU A CB   4  
ATOM   7169  C  CG   . LEU A 1 40  ? -4.691  3.022   4.731   1.00 0.00 ? 195 LEU A CG   4  
ATOM   7170  C  CD1  . LEU A 1 40  ? -4.962  3.316   6.206   1.00 0.00 ? 195 LEU A CD1  4  
ATOM   7171  C  CD2  . LEU A 1 40  ? -5.638  3.857   3.865   1.00 0.00 ? 195 LEU A CD2  4  
ATOM   7172  H  H    . LEU A 1 40  ? -0.768  3.384   3.691   1.00 0.00 ? 195 LEU A H    4  
ATOM   7173  H  HA   . LEU A 1 40  ? -2.448  1.686   5.456   1.00 0.00 ? 195 LEU A HA   4  
ATOM   7174  H  HB2  . LEU A 1 40  ? -2.879  4.114   5.094   1.00 0.00 ? 195 LEU A HB2  4  
ATOM   7175  H  HB3  . LEU A 1 40  ? -3.194  3.785   3.393   1.00 0.00 ? 195 LEU A HB3  4  
ATOM   7176  H  HG   . LEU A 1 40  ? -4.857  1.971   4.538   1.00 0.00 ? 195 LEU A HG   4  
ATOM   7177  H  HD11 . LEU A 1 40  ? -4.367  2.655   6.819   1.00 0.00 ? 195 LEU A HD11 4  
ATOM   7178  H  HD12 . LEU A 1 40  ? -6.009  3.159   6.418   1.00 0.00 ? 195 LEU A HD12 4  
ATOM   7179  H  HD13 . LEU A 1 40  ? -4.700  4.341   6.423   1.00 0.00 ? 195 LEU A HD13 4  
ATOM   7180  H  HD21 . LEU A 1 40  ? -6.564  4.018   4.396   1.00 0.00 ? 195 LEU A HD21 4  
ATOM   7181  H  HD22 . LEU A 1 40  ? -5.838  3.333   2.941   1.00 0.00 ? 195 LEU A HD22 4  
ATOM   7182  H  HD23 . LEU A 1 40  ? -5.179  4.810   3.646   1.00 0.00 ? 195 LEU A HD23 4  
ATOM   7183  N  N    . ILE A 1 41  ? -3.572  0.106   3.804   1.00 0.00 ? 196 ILE A N    4  
ATOM   7184  C  CA   . ILE A 1 41  ? -4.077  -0.911  2.827   1.00 0.00 ? 196 ILE A CA   4  
ATOM   7185  C  C    . ILE A 1 41  ? -5.562  -1.191  3.131   1.00 0.00 ? 196 ILE A C    4  
ATOM   7186  O  O    . ILE A 1 41  ? -6.176  -0.466  3.893   1.00 0.00 ? 196 ILE A O    4  
ATOM   7187  C  CB   . ILE A 1 41  ? -3.210  -2.170  3.028   1.00 0.00 ? 196 ILE A CB   4  
ATOM   7188  C  CG1  . ILE A 1 41  ? -3.153  -2.548  4.515   1.00 0.00 ? 196 ILE A CG1  4  
ATOM   7189  C  CG2  . ILE A 1 41  ? -1.792  -1.908  2.508   1.00 0.00 ? 196 ILE A CG2  4  
ATOM   7190  C  CD1  . ILE A 1 41  ? -2.420  -3.881  4.675   1.00 0.00 ? 196 ILE A CD1  4  
ATOM   7191  H  H    . ILE A 1 41  ? -3.831  0.028   4.750   1.00 0.00 ? 196 ILE A H    4  
ATOM   7192  H  HA   . ILE A 1 41  ? -3.968  -0.543  1.817   1.00 0.00 ? 196 ILE A HA   4  
ATOM   7193  H  HB   . ILE A 1 41  ? -3.635  -2.989  2.469   1.00 0.00 ? 196 ILE A HB   4  
ATOM   7194  H  HG12 . ILE A 1 41  ? -2.628  -1.779  5.063   1.00 0.00 ? 196 ILE A HG12 4  
ATOM   7195  H  HG13 . ILE A 1 41  ? -4.157  -2.644  4.901   1.00 0.00 ? 196 ILE A HG13 4  
ATOM   7196  H  HG21 . ILE A 1 41  ? -1.685  -2.339  1.521   1.00 0.00 ? 196 ILE A HG21 4  
ATOM   7197  H  HG22 . ILE A 1 41  ? -1.072  -2.358  3.175   1.00 0.00 ? 196 ILE A HG22 4  
ATOM   7198  H  HG23 . ILE A 1 41  ? -1.616  -0.845  2.453   1.00 0.00 ? 196 ILE A HG23 4  
ATOM   7199  H  HD11 . ILE A 1 41  ? -3.135  -4.689  4.661   1.00 0.00 ? 196 ILE A HD11 4  
ATOM   7200  H  HD12 . ILE A 1 41  ? -1.886  -3.888  5.614   1.00 0.00 ? 196 ILE A HD12 4  
ATOM   7201  H  HD13 . ILE A 1 41  ? -1.720  -4.006  3.862   1.00 0.00 ? 196 ILE A HD13 4  
ATOM   7202  N  N    . CYS A 1 42  ? -6.152  -2.220  2.555   1.00 0.00 ? 197 CYS A N    4  
ATOM   7203  C  CA   . CYS A 1 42  ? -7.592  -2.503  2.838   1.00 0.00 ? 197 CYS A CA   4  
ATOM   7204  C  C    . CYS A 1 42  ? -7.731  -3.814  3.636   1.00 0.00 ? 197 CYS A C    4  
ATOM   7205  O  O    . CYS A 1 42  ? -6.819  -4.617  3.671   1.00 0.00 ? 197 CYS A O    4  
ATOM   7206  C  CB   . CYS A 1 42  ? -8.281  -2.580  1.459   1.00 0.00 ? 197 CYS A CB   4  
ATOM   7207  S  SG   . CYS A 1 42  ? -7.739  -4.034  0.509   1.00 0.00 ? 197 CYS A SG   4  
ATOM   7208  H  H    . CYS A 1 42  ? -5.656  -2.798  1.946   1.00 0.00 ? 197 CYS A H    4  
ATOM   7209  H  HA   . CYS A 1 42  ? -8.018  -1.685  3.407   1.00 0.00 ? 197 CYS A HA   4  
ATOM   7210  H  HB2  . CYS A 1 42  ? -9.350  -2.633  1.600   1.00 0.00 ? 197 CYS A HB2  4  
ATOM   7211  H  HB3  . CYS A 1 42  ? -8.045  -1.686  0.902   1.00 0.00 ? 197 CYS A HB3  4  
ATOM   7212  N  N    . LYS A 1 43  ? -8.856  -4.029  4.295   1.00 0.00 ? 198 LYS A N    4  
ATOM   7213  C  CA   . LYS A 1 43  ? -9.029  -5.293  5.112   1.00 0.00 ? 198 LYS A CA   4  
ATOM   7214  C  C    . LYS A 1 43  ? -8.662  -6.541  4.294   1.00 0.00 ? 198 LYS A C    4  
ATOM   7215  O  O    . LYS A 1 43  ? -8.073  -7.469  4.818   1.00 0.00 ? 198 LYS A O    4  
ATOM   7216  C  CB   . LYS A 1 43  ? -10.504 -5.343  5.533   1.00 0.00 ? 198 LYS A CB   4  
ATOM   7217  C  CG   . LYS A 1 43  ? -10.733 -6.543  6.455   1.00 0.00 ? 198 LYS A CG   4  
ATOM   7218  C  CD   . LYS A 1 43  ? -11.978 -6.300  7.311   1.00 0.00 ? 198 LYS A CD   4  
ATOM   7219  C  CE   . LYS A 1 43  ? -13.229 -6.665  6.508   1.00 0.00 ? 198 LYS A CE   4  
ATOM   7220  N  NZ   . LYS A 1 43  ? -13.515 -8.082  6.864   1.00 0.00 ? 198 LYS A NZ   4  
ATOM   7221  H  H    . LYS A 1 43  ? -9.575  -3.354  4.266   1.00 0.00 ? 198 LYS A H    4  
ATOM   7222  H  HA   . LYS A 1 43  ? -8.409  -5.247  5.985   1.00 0.00 ? 198 LYS A HA   4  
ATOM   7223  H  HB2  . LYS A 1 43  ? -10.753 -4.433  6.061   1.00 0.00 ? 198 LYS A HB2  4  
ATOM   7224  H  HB3  . LYS A 1 43  ? -11.128 -5.438  4.658   1.00 0.00 ? 198 LYS A HB3  4  
ATOM   7225  H  HG2  . LYS A 1 43  ? -10.873 -7.433  5.859   1.00 0.00 ? 198 LYS A HG2  4  
ATOM   7226  H  HG3  . LYS A 1 43  ? -9.876  -6.671  7.098   1.00 0.00 ? 198 LYS A HG3  4  
ATOM   7227  H  HD2  . LYS A 1 43  ? -11.929 -6.912  8.200   1.00 0.00 ? 198 LYS A HD2  4  
ATOM   7228  H  HD3  . LYS A 1 43  ? -12.024 -5.259  7.591   1.00 0.00 ? 198 LYS A HD3  4  
ATOM   7229  H  HE2  . LYS A 1 43  ? -14.056 -6.028  6.792   1.00 0.00 ? 198 LYS A HE2  4  
ATOM   7230  H  HE3  . LYS A 1 43  ? -13.035 -6.581  5.450   1.00 0.00 ? 198 LYS A HE3  4  
ATOM   7231  H  HZ1  . LYS A 1 43  ? -13.751 -8.145  7.875   1.00 0.00 ? 198 LYS A HZ1  4  
ATOM   7232  H  HZ2  . LYS A 1 43  ? -12.675 -8.664  6.667   1.00 0.00 ? 198 LYS A HZ2  4  
ATOM   7233  H  HZ3  . LYS A 1 43  ? -14.317 -8.427  6.301   1.00 0.00 ? 198 LYS A HZ3  4  
ATOM   7234  N  N    . ASN A 1 44  ? -8.985  -6.572  3.021   1.00 0.00 ? 199 ASN A N    4  
ATOM   7235  C  CA   . ASN A 1 44  ? -8.620  -7.780  2.198   1.00 0.00 ? 199 ASN A CA   4  
ATOM   7236  C  C    . ASN A 1 44  ? -7.090  -7.924  2.104   1.00 0.00 ? 199 ASN A C    4  
ATOM   7237  O  O    . ASN A 1 44  ? -6.585  -9.023  1.979   1.00 0.00 ? 199 ASN A O    4  
ATOM   7238  C  CB   . ASN A 1 44  ? -9.226  -7.571  0.801   1.00 0.00 ? 199 ASN A CB   4  
ATOM   7239  C  CG   . ASN A 1 44  ? -10.697 -8.003  0.811   1.00 0.00 ? 199 ASN A CG   4  
ATOM   7240  O  OD1  . ASN A 1 44  ? -11.580 -7.170  0.875   1.00 0.00 ? 199 ASN A OD1  4  
ATOM   7241  N  ND2  . ASN A 1 44  ? -11.006 -9.275  0.750   1.00 0.00 ? 199 ASN A ND2  4  
ATOM   7242  H  H    . ASN A 1 44  ? -9.452  -5.805  2.614   1.00 0.00 ? 199 ASN A H    4  
ATOM   7243  H  HA   . ASN A 1 44  ? -9.034  -8.664  2.650   1.00 0.00 ? 199 ASN A HA   4  
ATOM   7244  H  HB2  . ASN A 1 44  ? -9.157  -6.527  0.531   1.00 0.00 ? 199 ASN A HB2  4  
ATOM   7245  H  HB3  . ASN A 1 44  ? -8.683  -8.166  0.081   1.00 0.00 ? 199 ASN A HB3  4  
ATOM   7246  H  HD21 . ASN A 1 44  ? -10.301 -9.957  0.697   1.00 0.00 ? 199 ASN A HD21 4  
ATOM   7247  H  HD22 . ASN A 1 44  ? -11.948 -9.549  0.757   1.00 0.00 ? 199 ASN A HD22 4  
ATOM   7248  N  N    . CYS A 1 45  ? -6.343  -6.838  2.184   1.00 0.00 ? 200 CYS A N    4  
ATOM   7249  C  CA   . CYS A 1 45  ? -4.847  -6.961  2.121   1.00 0.00 ? 200 CYS A CA   4  
ATOM   7250  C  C    . CYS A 1 45  ? -4.346  -7.448  3.480   1.00 0.00 ? 200 CYS A C    4  
ATOM   7251  O  O    . CYS A 1 45  ? -3.642  -8.433  3.570   1.00 0.00 ? 200 CYS A O    4  
ATOM   7252  C  CB   . CYS A 1 45  ? -4.292  -5.555  1.828   1.00 0.00 ? 200 CYS A CB   4  
ATOM   7253  S  SG   . CYS A 1 45  ? -4.211  -5.288  0.041   1.00 0.00 ? 200 CYS A SG   4  
ATOM   7254  H  H    . CYS A 1 45  ? -6.761  -5.960  2.307   1.00 0.00 ? 200 CYS A H    4  
ATOM   7255  H  HA   . CYS A 1 45  ? -4.557  -7.648  1.345   1.00 0.00 ? 200 CYS A HA   4  
ATOM   7256  H  HB2  . CYS A 1 45  ? -4.936  -4.812  2.274   1.00 0.00 ? 200 CYS A HB2  4  
ATOM   7257  H  HB3  . CYS A 1 45  ? -3.301  -5.467  2.249   1.00 0.00 ? 200 CYS A HB3  4  
ATOM   7258  N  N    . PHE A 1 46  ? -4.718  -6.771  4.543   1.00 0.00 ? 201 PHE A N    4  
ATOM   7259  C  CA   . PHE A 1 46  ? -4.265  -7.213  5.909   1.00 0.00 ? 201 PHE A CA   4  
ATOM   7260  C  C    . PHE A 1 46  ? -4.769  -8.635  6.198   1.00 0.00 ? 201 PHE A C    4  
ATOM   7261  O  O    . PHE A 1 46  ? -4.076  -9.416  6.825   1.00 0.00 ? 201 PHE A O    4  
ATOM   7262  C  CB   . PHE A 1 46  ? -4.865  -6.215  6.915   1.00 0.00 ? 201 PHE A CB   4  
ATOM   7263  C  CG   . PHE A 1 46  ? -3.994  -6.134  8.147   1.00 0.00 ? 201 PHE A CG   4  
ATOM   7264  C  CD1  . PHE A 1 46  ? -2.892  -5.270  8.173   1.00 0.00 ? 201 PHE A CD1  4  
ATOM   7265  C  CD2  . PHE A 1 46  ? -4.296  -6.918  9.267   1.00 0.00 ? 201 PHE A CD2  4  
ATOM   7266  C  CE1  . PHE A 1 46  ? -2.090  -5.192  9.319   1.00 0.00 ? 201 PHE A CE1  4  
ATOM   7267  C  CE2  . PHE A 1 46  ? -3.495  -6.840  10.412  1.00 0.00 ? 201 PHE A CE2  4  
ATOM   7268  C  CZ   . PHE A 1 46  ? -2.393  -5.976  10.438  1.00 0.00 ? 201 PHE A CZ   4  
ATOM   7269  H  H    . PHE A 1 46  ? -5.301  -5.981  4.439   1.00 0.00 ? 201 PHE A H    4  
ATOM   7270  H  HA   . PHE A 1 46  ? -3.189  -7.193  5.960   1.00 0.00 ? 201 PHE A HA   4  
ATOM   7271  H  HB2  . PHE A 1 46  ? -4.928  -5.239  6.457   1.00 0.00 ? 201 PHE A HB2  4  
ATOM   7272  H  HB3  . PHE A 1 46  ? -5.855  -6.543  7.198   1.00 0.00 ? 201 PHE A HB3  4  
ATOM   7273  H  HD1  . PHE A 1 46  ? -2.659  -4.665  7.310   1.00 0.00 ? 201 PHE A HD1  4  
ATOM   7274  H  HD2  . PHE A 1 46  ? -5.146  -7.583  9.247   1.00 0.00 ? 201 PHE A HD2  4  
ATOM   7275  H  HE1  . PHE A 1 46  ? -1.239  -4.526  9.340   1.00 0.00 ? 201 PHE A HE1  4  
ATOM   7276  H  HE2  . PHE A 1 46  ? -3.729  -7.443  11.276  1.00 0.00 ? 201 PHE A HE2  4  
ATOM   7277  H  HZ   . PHE A 1 46  ? -1.775  -5.917  11.323  1.00 0.00 ? 201 PHE A HZ   4  
ATOM   7278  N  N    . LYS A 1 47  ? -5.956  -8.995  5.739   1.00 0.00 ? 202 LYS A N    4  
ATOM   7279  C  CA   . LYS A 1 47  ? -6.447  -10.391 5.998   1.00 0.00 ? 202 LYS A CA   4  
ATOM   7280  C  C    . LYS A 1 47  ? -5.771  -11.354 5.017   1.00 0.00 ? 202 LYS A C    4  
ATOM   7281  O  O    . LYS A 1 47  ? -5.392  -12.445 5.389   1.00 0.00 ? 202 LYS A O    4  
ATOM   7282  C  CB   . LYS A 1 47  ? -7.969  -10.377 5.784   1.00 0.00 ? 202 LYS A CB   4  
ATOM   7283  C  CG   . LYS A 1 47  ? -8.606  -11.523 6.571   1.00 0.00 ? 202 LYS A CG   4  
ATOM   7284  C  CD   . LYS A 1 47  ? -8.986  -11.033 7.970   1.00 0.00 ? 202 LYS A CD   4  
ATOM   7285  C  CE   . LYS A 1 47  ? -10.419 -10.498 7.952   1.00 0.00 ? 202 LYS A CE   4  
ATOM   7286  N  NZ   . LYS A 1 47  ? -10.891 -10.617 9.359   1.00 0.00 ? 202 LYS A NZ   4  
ATOM   7287  H  H    . LYS A 1 47  ? -6.506  -8.360  5.216   1.00 0.00 ? 202 LYS A H    4  
ATOM   7288  H  HA   . LYS A 1 47  ? -6.217  -10.683 7.012   1.00 0.00 ? 202 LYS A HA   4  
ATOM   7289  H  HB2  . LYS A 1 47  ? -8.371  -9.434  6.127   1.00 0.00 ? 202 LYS A HB2  4  
ATOM   7290  H  HB3  . LYS A 1 47  ? -8.185  -10.500 4.734   1.00 0.00 ? 202 LYS A HB3  4  
ATOM   7291  H  HG2  . LYS A 1 47  ? -9.492  -11.864 6.055   1.00 0.00 ? 202 LYS A HG2  4  
ATOM   7292  H  HG3  . LYS A 1 47  ? -7.902  -12.337 6.657   1.00 0.00 ? 202 LYS A HG3  4  
ATOM   7293  H  HD2  . LYS A 1 47  ? -8.914  -11.852 8.670   1.00 0.00 ? 202 LYS A HD2  4  
ATOM   7294  H  HD3  . LYS A 1 47  ? -8.313  -10.242 8.270   1.00 0.00 ? 202 LYS A HD3  4  
ATOM   7295  H  HE2  . LYS A 1 47  ? -10.430 -9.465  7.634   1.00 0.00 ? 202 LYS A HE2  4  
ATOM   7296  H  HE3  . LYS A 1 47  ? -11.037 -11.100 7.303   1.00 0.00 ? 202 LYS A HE3  4  
ATOM   7297  H  HZ1  . LYS A 1 47  ? -11.896 -10.360 9.411   1.00 0.00 ? 202 LYS A HZ1  4  
ATOM   7298  H  HZ2  . LYS A 1 47  ? -10.336 -9.976  9.965   1.00 0.00 ? 202 LYS A HZ2  4  
ATOM   7299  H  HZ3  . LYS A 1 47  ? -10.768 -11.596 9.686   1.00 0.00 ? 202 LYS A HZ3  4  
ATOM   7300  N  N    . TYR A 1 48  ? -5.597  -10.958 3.774   1.00 0.00 ? 203 TYR A N    4  
ATOM   7301  C  CA   . TYR A 1 48  ? -4.916  -11.876 2.796   1.00 0.00 ? 203 TYR A CA   4  
ATOM   7302  C  C    . TYR A 1 48  ? -3.415  -11.957 3.120   1.00 0.00 ? 203 TYR A C    4  
ATOM   7303  O  O    . TYR A 1 48  ? -2.816  -13.009 2.987   1.00 0.00 ? 203 TYR A O    4  
ATOM   7304  C  CB   . TYR A 1 48  ? -5.147  -11.275 1.396   1.00 0.00 ? 203 TYR A CB   4  
ATOM   7305  C  CG   . TYR A 1 48  ? -4.467  -12.120 0.343   1.00 0.00 ? 203 TYR A CG   4  
ATOM   7306  C  CD1  . TYR A 1 48  ? -4.686  -13.502 0.299   1.00 0.00 ? 203 TYR A CD1  4  
ATOM   7307  C  CD2  . TYR A 1 48  ? -3.619  -11.514 -0.589  1.00 0.00 ? 203 TYR A CD2  4  
ATOM   7308  C  CE1  . TYR A 1 48  ? -4.055  -14.279 -0.680  1.00 0.00 ? 203 TYR A CE1  4  
ATOM   7309  C  CE2  . TYR A 1 48  ? -2.988  -12.290 -1.569  1.00 0.00 ? 203 TYR A CE2  4  
ATOM   7310  C  CZ   . TYR A 1 48  ? -3.206  -13.673 -1.614  1.00 0.00 ? 203 TYR A CZ   4  
ATOM   7311  O  OH   . TYR A 1 48  ? -2.583  -14.437 -2.580  1.00 0.00 ? 203 TYR A OH   4  
ATOM   7312  H  H    . TYR A 1 48  ? -5.897  -10.061 3.491   1.00 0.00 ? 203 TYR A H    4  
ATOM   7313  H  HA   . TYR A 1 48  ? -5.356  -12.861 2.853   1.00 0.00 ? 203 TYR A HA   4  
ATOM   7314  H  HB2  . TYR A 1 48  ? -6.207  -11.239 1.194   1.00 0.00 ? 203 TYR A HB2  4  
ATOM   7315  H  HB3  . TYR A 1 48  ? -4.743  -10.274 1.367   1.00 0.00 ? 203 TYR A HB3  4  
ATOM   7316  H  HD1  . TYR A 1 48  ? -5.341  -13.969 1.019   1.00 0.00 ? 203 TYR A HD1  4  
ATOM   7317  H  HD2  . TYR A 1 48  ? -3.451  -10.446 -0.553  1.00 0.00 ? 203 TYR A HD2  4  
ATOM   7318  H  HE1  . TYR A 1 48  ? -4.222  -15.345 -0.716  1.00 0.00 ? 203 TYR A HE1  4  
ATOM   7319  H  HE2  . TYR A 1 48  ? -2.333  -11.822 -2.289  1.00 0.00 ? 203 TYR A HE2  4  
ATOM   7320  H  HH   . TYR A 1 48  ? -3.147  -14.452 -3.357  1.00 0.00 ? 203 TYR A HH   4  
ATOM   7321  N  N    . TYR A 1 49  ? -2.798  -10.875 3.565   1.00 0.00 ? 204 TYR A N    4  
ATOM   7322  C  CA   . TYR A 1 49  ? -1.334  -10.957 3.908   1.00 0.00 ? 204 TYR A CA   4  
ATOM   7323  C  C    . TYR A 1 49  ? -1.136  -11.902 5.107   1.00 0.00 ? 204 TYR A C    4  
ATOM   7324  O  O    . TYR A 1 49  ? -0.129  -12.578 5.202   1.00 0.00 ? 204 TYR A O    4  
ATOM   7325  C  CB   . TYR A 1 49  ? -0.870  -9.532  4.264   1.00 0.00 ? 204 TYR A CB   4  
ATOM   7326  C  CG   . TYR A 1 49  ? 0.576   -9.344  3.864   1.00 0.00 ? 204 TYR A CG   4  
ATOM   7327  C  CD1  . TYR A 1 49  ? 0.993   -9.656  2.563   1.00 0.00 ? 204 TYR A CD1  4  
ATOM   7328  C  CD2  . TYR A 1 49  ? 1.498   -8.852  4.794   1.00 0.00 ? 204 TYR A CD2  4  
ATOM   7329  C  CE1  . TYR A 1 49  ? 2.330   -9.477  2.194   1.00 0.00 ? 204 TYR A CE1  4  
ATOM   7330  C  CE2  . TYR A 1 49  ? 2.837   -8.672  4.424   1.00 0.00 ? 204 TYR A CE2  4  
ATOM   7331  C  CZ   . TYR A 1 49  ? 3.253   -8.985  3.125   1.00 0.00 ? 204 TYR A CZ   4  
ATOM   7332  O  OH   . TYR A 1 49  ? 4.572   -8.809  2.761   1.00 0.00 ? 204 TYR A OH   4  
ATOM   7333  H  H    . TYR A 1 49  ? -3.296  -10.028 3.689   1.00 0.00 ? 204 TYR A H    4  
ATOM   7334  H  HA   . TYR A 1 49  ? -0.780  -11.322 3.057   1.00 0.00 ? 204 TYR A HA   4  
ATOM   7335  H  HB2  . TYR A 1 49  ? -1.479  -8.815  3.737   1.00 0.00 ? 204 TYR A HB2  4  
ATOM   7336  H  HB3  . TYR A 1 49  ? -0.971  -9.377  5.327   1.00 0.00 ? 204 TYR A HB3  4  
ATOM   7337  H  HD1  . TYR A 1 49  ? 0.281   -10.035 1.844   1.00 0.00 ? 204 TYR A HD1  4  
ATOM   7338  H  HD2  . TYR A 1 49  ? 1.178   -8.610  5.797   1.00 0.00 ? 204 TYR A HD2  4  
ATOM   7339  H  HE1  . TYR A 1 49  ? 2.649   -9.718  1.191   1.00 0.00 ? 204 TYR A HE1  4  
ATOM   7340  H  HE2  . TYR A 1 49  ? 3.548   -8.292  5.143   1.00 0.00 ? 204 TYR A HE2  4  
ATOM   7341  H  HH   . TYR A 1 49  ? 5.099   -9.458  3.231   1.00 0.00 ? 204 TYR A HH   4  
ATOM   7342  N  N    . MET A 1 50  ? -2.091  -11.966 6.021   1.00 0.00 ? 205 MET A N    4  
ATOM   7343  C  CA   . MET A 1 50  ? -1.937  -12.887 7.198   1.00 0.00 ? 205 MET A CA   4  
ATOM   7344  C  C    . MET A 1 50  ? -2.610  -14.239 6.900   1.00 0.00 ? 205 MET A C    4  
ATOM   7345  O  O    . MET A 1 50  ? -2.088  -15.281 7.249   1.00 0.00 ? 205 MET A O    4  
ATOM   7346  C  CB   . MET A 1 50  ? -2.625  -12.182 8.380   1.00 0.00 ? 205 MET A CB   4  
ATOM   7347  C  CG   . MET A 1 50  ? -2.553  -13.067 9.625   1.00 0.00 ? 205 MET A CG   4  
ATOM   7348  S  SD   . MET A 1 50  ? -3.105  -12.123 11.069  1.00 0.00 ? 205 MET A SD   4  
ATOM   7349  C  CE   . MET A 1 50  ? -4.879  -12.194 10.721  1.00 0.00 ? 205 MET A CE   4  
ATOM   7350  H  H    . MET A 1 50  ? -2.906  -11.420 5.929   1.00 0.00 ? 205 MET A H    4  
ATOM   7351  H  HA   . MET A 1 50  ? -0.895  -13.035 7.415   1.00 0.00 ? 205 MET A HA   4  
ATOM   7352  H  HB2  . MET A 1 50  ? -2.127  -11.243 8.576   1.00 0.00 ? 205 MET A HB2  4  
ATOM   7353  H  HB3  . MET A 1 50  ? -3.659  -11.994 8.133   1.00 0.00 ? 205 MET A HB3  4  
ATOM   7354  H  HG2  . MET A 1 50  ? -3.194  -13.926 9.491   1.00 0.00 ? 205 MET A HG2  4  
ATOM   7355  H  HG3  . MET A 1 50  ? -1.536  -13.396 9.776   1.00 0.00 ? 205 MET A HG3  4  
ATOM   7356  H  HE1  . MET A 1 50  ? -5.104  -11.559 9.876   1.00 0.00 ? 205 MET A HE1  4  
ATOM   7357  H  HE2  . MET A 1 50  ? -5.430  -11.850 11.582  1.00 0.00 ? 205 MET A HE2  4  
ATOM   7358  H  HE3  . MET A 1 50  ? -5.160  -13.214 10.500  1.00 0.00 ? 205 MET A HE3  4  
ATOM   7359  N  N    . SER A 1 51  ? -3.763  -14.237 6.259   1.00 0.00 ? 206 SER A N    4  
ATOM   7360  C  CA   . SER A 1 51  ? -4.454  -15.546 5.948   1.00 0.00 ? 206 SER A CA   4  
ATOM   7361  C  C    . SER A 1 51  ? -3.510  -16.481 5.175   1.00 0.00 ? 206 SER A C    4  
ATOM   7362  O  O    . SER A 1 51  ? -3.502  -17.677 5.396   1.00 0.00 ? 206 SER A O    4  
ATOM   7363  C  CB   . SER A 1 51  ? -5.681  -15.220 5.086   1.00 0.00 ? 206 SER A CB   4  
ATOM   7364  O  OG   . SER A 1 51  ? -5.251  -14.749 3.816   1.00 0.00 ? 206 SER A OG   4  
ATOM   7365  H  H    . SER A 1 51  ? -4.168  -13.383 5.987   1.00 0.00 ? 206 SER A H    4  
ATOM   7366  H  HA   . SER A 1 51  ? -4.768  -16.015 6.857   1.00 0.00 ? 206 SER A HA   4  
ATOM   7367  H  HB2  . SER A 1 51  ? -6.273  -16.111 4.951   1.00 0.00 ? 206 SER A HB2  4  
ATOM   7368  H  HB3  . SER A 1 51  ? -6.280  -14.467 5.580   1.00 0.00 ? 206 SER A HB3  4  
ATOM   7369  H  HG   . SER A 1 51  ? -5.950  -14.920 3.181   1.00 0.00 ? 206 SER A HG   4  
ATOM   7370  N  N    . ASP A 1 52  ? -2.715  -15.945 4.274   1.00 0.00 ? 207 ASP A N    4  
ATOM   7371  C  CA   . ASP A 1 52  ? -1.778  -16.808 3.496   1.00 0.00 ? 207 ASP A CA   4  
ATOM   7372  C  C    . ASP A 1 52  ? -0.323  -16.435 3.815   1.00 0.00 ? 207 ASP A C    4  
ATOM   7373  O  O    . ASP A 1 52  ? -0.025  -15.294 4.115   1.00 0.00 ? 207 ASP A O    4  
ATOM   7374  C  CB   . ASP A 1 52  ? -2.096  -16.521 2.028   1.00 0.00 ? 207 ASP A CB   4  
ATOM   7375  C  CG   . ASP A 1 52  ? -3.079  -17.570 1.503   1.00 0.00 ? 207 ASP A CG   4  
ATOM   7376  O  OD1  . ASP A 1 52  ? -4.271  -17.359 1.645   1.00 0.00 ? 207 ASP A OD1  4  
ATOM   7377  O  OD2  . ASP A 1 52  ? -2.620  -18.566 0.967   1.00 0.00 ? 207 ASP A OD2  4  
ATOM   7378  H  H    . ASP A 1 52  ? -2.733  -14.976 4.110   1.00 0.00 ? 207 ASP A H    4  
ATOM   7379  H  HA   . ASP A 1 52  ? -1.953  -17.850 3.714   1.00 0.00 ? 207 ASP A HA   4  
ATOM   7380  H  HB2  . ASP A 1 52  ? -2.537  -15.538 1.941   1.00 0.00 ? 207 ASP A HB2  4  
ATOM   7381  H  HB3  . ASP A 1 52  ? -1.187  -16.559 1.447   1.00 0.00 ? 207 ASP A HB3  4  
ATOM   7382  N  N    . ASP A 1 53  ? 0.587   -17.385 3.747   1.00 0.00 ? 208 ASP A N    4  
ATOM   7383  C  CA   . ASP A 1 53  ? 2.021   -17.072 4.043   1.00 0.00 ? 208 ASP A CA   4  
ATOM   7384  C  C    . ASP A 1 53  ? 2.824   -17.032 2.737   1.00 0.00 ? 208 ASP A C    4  
ATOM   7385  O  O    . ASP A 1 53  ? 2.486   -17.705 1.781   1.00 0.00 ? 208 ASP A O    4  
ATOM   7386  C  CB   . ASP A 1 53  ? 2.516   -18.205 4.946   1.00 0.00 ? 208 ASP A CB   4  
ATOM   7387  C  CG   . ASP A 1 53  ? 2.265   -17.839 6.411   1.00 0.00 ? 208 ASP A CG   4  
ATOM   7388  O  OD1  . ASP A 1 53  ? 2.580   -16.721 6.783   1.00 0.00 ? 208 ASP A OD1  4  
ATOM   7389  O  OD2  . ASP A 1 53  ? 1.763   -18.683 7.134   1.00 0.00 ? 208 ASP A OD2  4  
ATOM   7390  H  H    . ASP A 1 53  ? 0.328   -18.302 3.496   1.00 0.00 ? 208 ASP A H    4  
ATOM   7391  H  HA   . ASP A 1 53  ? 2.102   -16.127 4.558   1.00 0.00 ? 208 ASP A HA   4  
ATOM   7392  H  HB2  . ASP A 1 53  ? 1.985   -19.114 4.706   1.00 0.00 ? 208 ASP A HB2  4  
ATOM   7393  H  HB3  . ASP A 1 53  ? 3.574   -18.354 4.791   1.00 0.00 ? 208 ASP A HB3  4  
ATOM   7394  N  N    . ILE A 1 54  ? 3.884   -16.252 2.685   1.00 0.00 ? 209 ILE A N    4  
ATOM   7395  C  CA   . ILE A 1 54  ? 4.694   -16.184 1.429   1.00 0.00 ? 209 ILE A CA   4  
ATOM   7396  C  C    . ILE A 1 54  ? 6.006   -16.962 1.600   1.00 0.00 ? 209 ILE A C    4  
ATOM   7397  O  O    . ILE A 1 54  ? 6.930   -16.500 2.241   1.00 0.00 ? 209 ILE A O    4  
ATOM   7398  C  CB   . ILE A 1 54  ? 4.950   -14.685 1.184   1.00 0.00 ? 209 ILE A CB   4  
ATOM   7399  C  CG1  . ILE A 1 54  ? 3.615   -13.980 0.894   1.00 0.00 ? 209 ILE A CG1  4  
ATOM   7400  C  CG2  . ILE A 1 54  ? 5.892   -14.496 -0.013  1.00 0.00 ? 209 ILE A CG2  4  
ATOM   7401  C  CD1  . ILE A 1 54  ? 2.930   -14.611 -0.329  1.00 0.00 ? 209 ILE A CD1  4  
ATOM   7402  H  H    . ILE A 1 54  ? 4.144   -15.714 3.468   1.00 0.00 ? 209 ILE A H    4  
ATOM   7403  H  HA   . ILE A 1 54  ? 4.130   -16.595 0.607   1.00 0.00 ? 209 ILE A HA   4  
ATOM   7404  H  HB   . ILE A 1 54  ? 5.401   -14.253 2.065   1.00 0.00 ? 209 ILE A HB   4  
ATOM   7405  H  HG12 . ILE A 1 54  ? 2.968   -14.073 1.754   1.00 0.00 ? 209 ILE A HG12 4  
ATOM   7406  H  HG13 . ILE A 1 54  ? 3.799   -12.934 0.698   1.00 0.00 ? 209 ILE A HG13 4  
ATOM   7407  H  HG21 . ILE A 1 54  ? 5.798   -15.337 -0.682  1.00 0.00 ? 209 ILE A HG21 4  
ATOM   7408  H  HG22 . ILE A 1 54  ? 6.910   -14.426 0.339   1.00 0.00 ? 209 ILE A HG22 4  
ATOM   7409  H  HG23 . ILE A 1 54  ? 5.629   -13.588 -0.536  1.00 0.00 ? 209 ILE A HG23 4  
ATOM   7410  H  HD11 . ILE A 1 54  ? 2.674   -13.837 -1.037  1.00 0.00 ? 209 ILE A HD11 4  
ATOM   7411  H  HD12 . ILE A 1 54  ? 2.033   -15.122 -0.014  1.00 0.00 ? 209 ILE A HD12 4  
ATOM   7412  H  HD13 . ILE A 1 54  ? 3.602   -15.321 -0.796  1.00 0.00 ? 209 ILE A HD13 4  
ATOM   7413  N  N    . SER A 1 55  ? 6.094   -18.146 1.025   1.00 0.00 ? 210 SER A N    4  
ATOM   7414  C  CA   . SER A 1 55  ? 7.354   -18.959 1.152   1.00 0.00 ? 210 SER A CA   4  
ATOM   7415  C  C    . SER A 1 55  ? 7.273   -20.243 0.301   1.00 0.00 ? 210 SER A C    4  
ATOM   7416  O  O    . SER A 1 55  ? 7.604   -21.317 0.768   1.00 0.00 ? 210 SER A O    4  
ATOM   7417  C  CB   . SER A 1 55  ? 7.456   -19.322 2.637   1.00 0.00 ? 210 SER A CB   4  
ATOM   7418  O  OG   . SER A 1 55  ? 8.820   -19.543 2.974   1.00 0.00 ? 210 SER A OG   4  
ATOM   7419  H  H    . SER A 1 55  ? 5.330   -18.497 0.507   1.00 0.00 ? 210 SER A H    4  
ATOM   7420  H  HA   . SER A 1 55  ? 8.209   -18.370 0.860   1.00 0.00 ? 210 SER A HA   4  
ATOM   7421  H  HB2  . SER A 1 55  ? 7.070   -18.514 3.236   1.00 0.00 ? 210 SER A HB2  4  
ATOM   7422  H  HB3  . SER A 1 55  ? 6.878   -20.216 2.829   1.00 0.00 ? 210 SER A HB3  4  
ATOM   7423  H  HG   . SER A 1 55  ? 9.248   -18.687 3.055   1.00 0.00 ? 210 SER A HG   4  
ATOM   7424  N  N    . ARG A 1 56  ? 6.834   -20.147 -0.940  1.00 0.00 ? 211 ARG A N    4  
ATOM   7425  C  CA   . ARG A 1 56  ? 6.739   -21.379 -1.797  1.00 0.00 ? 211 ARG A CA   4  
ATOM   7426  C  C    . ARG A 1 56  ? 6.433   -21.016 -3.262  1.00 0.00 ? 211 ARG A C    4  
ATOM   7427  O  O    . ARG A 1 56  ? 5.533   -21.573 -3.864  1.00 0.00 ? 211 ARG A O    4  
ATOM   7428  C  CB   . ARG A 1 56  ? 5.586   -22.190 -1.197  1.00 0.00 ? 211 ARG A CB   4  
ATOM   7429  C  CG   . ARG A 1 56  ? 5.918   -23.681 -1.271  1.00 0.00 ? 211 ARG A CG   4  
ATOM   7430  C  CD   . ARG A 1 56  ? 4.794   -24.488 -0.619  1.00 0.00 ? 211 ARG A CD   4  
ATOM   7431  N  NE   . ARG A 1 56  ? 5.229   -24.679 0.794   1.00 0.00 ? 211 ARG A NE   4  
ATOM   7432  C  CZ   . ARG A 1 56  ? 5.903   -25.744 1.131   1.00 0.00 ? 211 ARG A CZ   4  
ATOM   7433  N  NH1  . ARG A 1 56  ? 5.401   -26.929 0.917   1.00 0.00 ? 211 ARG A NH1  4  
ATOM   7434  N  NH2  . ARG A 1 56  ? 7.080   -25.624 1.681   1.00 0.00 ? 211 ARG A NH2  4  
ATOM   7435  H  H    . ARG A 1 56  ? 6.568   -19.274 -1.307  1.00 0.00 ? 211 ARG A H    4  
ATOM   7436  H  HA   . ARG A 1 56  ? 7.655   -21.946 -1.735  1.00 0.00 ? 211 ARG A HA   4  
ATOM   7437  H  HB2  . ARG A 1 56  ? 5.442   -21.903 -0.166  1.00 0.00 ? 211 ARG A HB2  4  
ATOM   7438  H  HB3  . ARG A 1 56  ? 4.683   -21.996 -1.756  1.00 0.00 ? 211 ARG A HB3  4  
ATOM   7439  H  HG2  . ARG A 1 56  ? 6.020   -23.977 -2.306  1.00 0.00 ? 211 ARG A HG2  4  
ATOM   7440  H  HG3  . ARG A 1 56  ? 6.844   -23.872 -0.750  1.00 0.00 ? 211 ARG A HG3  4  
ATOM   7441  H  HD2  . ARG A 1 56  ? 3.865   -23.937 -0.657  1.00 0.00 ? 211 ARG A HD2  4  
ATOM   7442  H  HD3  . ARG A 1 56  ? 4.686   -25.446 -1.104  1.00 0.00 ? 211 ARG A HD3  4  
ATOM   7443  H  HE   . ARG A 1 56  ? 5.009   -24.004 1.469   1.00 0.00 ? 211 ARG A HE   4  
ATOM   7444  H  HH11 . ARG A 1 56  ? 4.499   -27.022 0.495   1.00 0.00 ? 211 ARG A HH11 4  
ATOM   7445  H  HH12 . ARG A 1 56  ? 5.918   -27.746 1.176   1.00 0.00 ? 211 ARG A HH12 4  
ATOM   7446  H  HH21 . ARG A 1 56  ? 7.465   -24.715 1.844   1.00 0.00 ? 211 ARG A HH21 4  
ATOM   7447  H  HH22 . ARG A 1 56  ? 7.597   -26.440 1.940   1.00 0.00 ? 211 ARG A HH22 4  
ATOM   7448  N  N    . ASP A 1 57  ? 7.171   -20.092 -3.843  1.00 0.00 ? 212 ASP A N    4  
ATOM   7449  C  CA   . ASP A 1 57  ? 6.910   -19.713 -5.264  1.00 0.00 ? 212 ASP A CA   4  
ATOM   7450  C  C    . ASP A 1 57  ? 8.195   -19.846 -6.097  1.00 0.00 ? 212 ASP A C    4  
ATOM   7451  O  O    . ASP A 1 57  ? 9.284   -19.721 -5.576  1.00 0.00 ? 212 ASP A O    4  
ATOM   7452  C  CB   . ASP A 1 57  ? 6.453   -18.254 -5.208  1.00 0.00 ? 212 ASP A CB   4  
ATOM   7453  C  CG   . ASP A 1 57  ? 4.986   -18.193 -4.784  1.00 0.00 ? 212 ASP A CG   4  
ATOM   7454  O  OD1  . ASP A 1 57  ? 4.675   -18.702 -3.720  1.00 0.00 ? 212 ASP A OD1  4  
ATOM   7455  O  OD2  . ASP A 1 57  ? 4.195   -17.639 -5.531  1.00 0.00 ? 212 ASP A OD2  4  
ATOM   7456  H  H    . ASP A 1 57  ? 7.897   -19.650 -3.349  1.00 0.00 ? 212 ASP A H    4  
ATOM   7457  H  HA   . ASP A 1 57  ? 6.127   -20.327 -5.680  1.00 0.00 ? 212 ASP A HA   4  
ATOM   7458  H  HB2  . ASP A 1 57  ? 7.058   -17.715 -4.493  1.00 0.00 ? 212 ASP A HB2  4  
ATOM   7459  H  HB3  . ASP A 1 57  ? 6.563   -17.804 -6.183  1.00 0.00 ? 212 ASP A HB3  4  
ATOM   7460  N  N    . SER A 1 58  ? 8.078   -20.093 -7.392  1.00 0.00 ? 213 SER A N    4  
ATOM   7461  C  CA   . SER A 1 58  ? 9.290   -20.238 -8.270  1.00 0.00 ? 213 SER A CA   4  
ATOM   7462  C  C    . SER A 1 58  ? 10.148  -21.442 -7.827  1.00 0.00 ? 213 SER A C    4  
ATOM   7463  O  O    . SER A 1 58  ? 10.143  -22.471 -8.478  1.00 0.00 ? 213 SER A O    4  
ATOM   7464  C  CB   . SER A 1 58  ? 10.068  -18.912 -8.161  1.00 0.00 ? 213 SER A CB   4  
ATOM   7465  O  OG   . SER A 1 58  ? 11.431  -19.176 -7.848  1.00 0.00 ? 213 SER A OG   4  
ATOM   7466  H  H    . SER A 1 58  ? 7.186   -20.185 -7.794  1.00 0.00 ? 213 SER A H    4  
ATOM   7467  H  HA   . SER A 1 58  ? 8.974   -20.381 -9.293  1.00 0.00 ? 213 SER A HA   4  
ATOM   7468  H  HB2  . SER A 1 58  ? 10.020  -18.389 -9.101  1.00 0.00 ? 213 SER A HB2  4  
ATOM   7469  H  HB3  . SER A 1 58  ? 9.624   -18.296 -7.391  1.00 0.00 ? 213 SER A HB3  4  
ATOM   7470  H  HG   . SER A 1 58  ? 11.919  -18.352 -7.929  1.00 0.00 ? 213 SER A HG   4  
ATOM   7471  N  N    . ASP A 1 59  ? 10.881  -21.334 -6.737  1.00 0.00 ? 214 ASP A N    4  
ATOM   7472  C  CA   . ASP A 1 59  ? 11.722  -22.484 -6.283  1.00 0.00 ? 214 ASP A CA   4  
ATOM   7473  C  C    . ASP A 1 59  ? 11.294  -22.949 -4.881  1.00 0.00 ? 214 ASP A C    4  
ATOM   7474  O  O    . ASP A 1 59  ? 12.121  -23.353 -4.085  1.00 0.00 ? 214 ASP A O    4  
ATOM   7475  C  CB   . ASP A 1 59  ? 13.148  -21.935 -6.245  1.00 0.00 ? 214 ASP A CB   4  
ATOM   7476  C  CG   . ASP A 1 59  ? 13.571  -21.512 -7.652  1.00 0.00 ? 214 ASP A CG   4  
ATOM   7477  O  OD1  . ASP A 1 59  ? 13.678  -22.379 -8.504  1.00 0.00 ? 214 ASP A OD1  4  
ATOM   7478  O  OD2  . ASP A 1 59  ? 13.782  -20.327 -7.855  1.00 0.00 ? 214 ASP A OD2  4  
ATOM   7479  H  H    . ASP A 1 59  ? 10.879  -20.503 -6.214  1.00 0.00 ? 214 ASP A H    4  
ATOM   7480  H  HA   . ASP A 1 59  ? 11.659  -23.300 -6.987  1.00 0.00 ? 214 ASP A HA   4  
ATOM   7481  H  HB2  . ASP A 1 59  ? 13.185  -21.082 -5.583  1.00 0.00 ? 214 ASP A HB2  4  
ATOM   7482  H  HB3  . ASP A 1 59  ? 13.818  -22.701 -5.884  1.00 0.00 ? 214 ASP A HB3  4  
ATOM   7483  N  N    . GLY A 1 60  ? 10.013  -22.897 -4.564  1.00 0.00 ? 215 GLY A N    4  
ATOM   7484  C  CA   . GLY A 1 60  ? 9.552   -23.338 -3.209  1.00 0.00 ? 215 GLY A CA   4  
ATOM   7485  C  C    . GLY A 1 60  ? 10.325  -22.588 -2.106  1.00 0.00 ? 215 GLY A C    4  
ATOM   7486  O  O    . GLY A 1 60  ? 10.601  -23.146 -1.060  1.00 0.00 ? 215 GLY A O    4  
ATOM   7487  H  H    . GLY A 1 60  ? 9.352   -22.570 -5.213  1.00 0.00 ? 215 GLY A H    4  
ATOM   7488  H  HA2  . GLY A 1 60  ? 8.496   -23.133 -3.108  1.00 0.00 ? 215 GLY A HA2  4  
ATOM   7489  H  HA3  . GLY A 1 60  ? 9.722   -24.398 -3.102  1.00 0.00 ? 215 GLY A HA3  4  
ATOM   7490  N  N    . MET A 1 61  ? 10.678  -21.334 -2.323  1.00 0.00 ? 216 MET A N    4  
ATOM   7491  C  CA   . MET A 1 61  ? 11.428  -20.578 -1.275  1.00 0.00 ? 216 MET A CA   4  
ATOM   7492  C  C    . MET A 1 61  ? 10.776  -19.207 -1.035  1.00 0.00 ? 216 MET A C    4  
ATOM   7493  O  O    . MET A 1 61  ? 10.221  -18.962 0.021   1.00 0.00 ? 216 MET A O    4  
ATOM   7494  C  CB   . MET A 1 61  ? 12.841  -20.416 -1.837  1.00 0.00 ? 216 MET A CB   4  
ATOM   7495  C  CG   . MET A 1 61  ? 13.712  -21.589 -1.382  1.00 0.00 ? 216 MET A CG   4  
ATOM   7496  S  SD   . MET A 1 61  ? 15.017  -21.879 -2.602  1.00 0.00 ? 216 MET A SD   4  
ATOM   7497  C  CE   . MET A 1 61  ? 14.886  -23.682 -2.648  1.00 0.00 ? 216 MET A CE   4  
ATOM   7498  H  H    . MET A 1 61  ? 10.452  -20.890 -3.170  1.00 0.00 ? 216 MET A H    4  
ATOM   7499  H  HA   . MET A 1 61  ? 11.461  -21.145 -0.357  1.00 0.00 ? 216 MET A HA   4  
ATOM   7500  H  HB2  . MET A 1 61  ? 12.799  -20.396 -2.916  1.00 0.00 ? 216 MET A HB2  4  
ATOM   7501  H  HB3  . MET A 1 61  ? 13.268  -19.491 -1.477  1.00 0.00 ? 216 MET A HB3  4  
ATOM   7502  H  HG2  . MET A 1 61  ? 14.157  -21.355 -0.426  1.00 0.00 ? 216 MET A HG2  4  
ATOM   7503  H  HG3  . MET A 1 61  ? 13.103  -22.474 -1.288  1.00 0.00 ? 216 MET A HG3  4  
ATOM   7504  H  HE1  . MET A 1 61  ? 13.843  -23.966 -2.680  1.00 0.00 ? 216 MET A HE1  4  
ATOM   7505  H  HE2  . MET A 1 61  ? 15.344  -24.102 -1.767  1.00 0.00 ? 216 MET A HE2  4  
ATOM   7506  H  HE3  . MET A 1 61  ? 15.393  -24.057 -3.528  1.00 0.00 ? 216 MET A HE3  4  
ATOM   7507  N  N    . ASP A 1 62  ? 10.835  -18.305 -1.998  1.00 0.00 ? 217 ASP A N    4  
ATOM   7508  C  CA   . ASP A 1 62  ? 10.211  -16.954 -1.797  1.00 0.00 ? 217 ASP A CA   4  
ATOM   7509  C  C    . ASP A 1 62  ? 10.174  -16.160 -3.117  1.00 0.00 ? 217 ASP A C    4  
ATOM   7510  O  O    . ASP A 1 62  ? 11.200  -15.735 -3.614  1.00 0.00 ? 217 ASP A O    4  
ATOM   7511  C  CB   . ASP A 1 62  ? 11.112  -16.249 -0.780  1.00 0.00 ? 217 ASP A CB   4  
ATOM   7512  C  CG   . ASP A 1 62  ? 10.429  -14.970 -0.292  1.00 0.00 ? 217 ASP A CG   4  
ATOM   7513  O  OD1  . ASP A 1 62  ? 10.345  -14.034 -1.069  1.00 0.00 ? 217 ASP A OD1  4  
ATOM   7514  O  OD2  . ASP A 1 62  ? 10.003  -14.951 0.851   1.00 0.00 ? 217 ASP A OD2  4  
ATOM   7515  H  H    . ASP A 1 62  ? 11.287  -18.515 -2.847  1.00 0.00 ? 217 ASP A H    4  
ATOM   7516  H  HA   . ASP A 1 62  ? 9.217   -17.058 -1.394  1.00 0.00 ? 217 ASP A HA   4  
ATOM   7517  H  HB2  . ASP A 1 62  ? 11.292  -16.907 0.058   1.00 0.00 ? 217 ASP A HB2  4  
ATOM   7518  H  HB3  . ASP A 1 62  ? 12.052  -15.997 -1.248  1.00 0.00 ? 217 ASP A HB3  4  
ATOM   7519  N  N    . GLU A 1 63  ? 9.004   -15.958 -3.689  1.00 0.00 ? 218 GLU A N    4  
ATOM   7520  C  CA   . GLU A 1 63  ? 8.921   -15.192 -4.973  1.00 0.00 ? 218 GLU A CA   4  
ATOM   7521  C  C    . GLU A 1 63  ? 7.527   -14.562 -5.142  1.00 0.00 ? 218 GLU A C    4  
ATOM   7522  O  O    . GLU A 1 63  ? 6.847   -14.805 -6.122  1.00 0.00 ? 218 GLU A O    4  
ATOM   7523  C  CB   . GLU A 1 63  ? 9.182   -16.227 -6.067  1.00 0.00 ? 218 GLU A CB   4  
ATOM   7524  C  CG   . GLU A 1 63  ? 9.337   -15.519 -7.414  1.00 0.00 ? 218 GLU A CG   4  
ATOM   7525  C  CD   . GLU A 1 63  ? 10.767  -14.993 -7.552  1.00 0.00 ? 218 GLU A CD   4  
ATOM   7526  O  OE1  . GLU A 1 63  ? 11.279  -14.462 -6.581  1.00 0.00 ? 218 GLU A OE1  4  
ATOM   7527  O  OE2  . GLU A 1 63  ? 11.327  -15.132 -8.628  1.00 0.00 ? 218 GLU A OE2  4  
ATOM   7528  H  H    . GLU A 1 63  ? 8.182   -16.310 -3.276  1.00 0.00 ? 218 GLU A H    4  
ATOM   7529  H  HA   . GLU A 1 63  ? 9.683   -14.429 -5.002  1.00 0.00 ? 218 GLU A HA   4  
ATOM   7530  H  HB2  . GLU A 1 63  ? 10.088  -16.771 -5.839  1.00 0.00 ? 218 GLU A HB2  4  
ATOM   7531  H  HB3  . GLU A 1 63  ? 8.352   -16.914 -6.118  1.00 0.00 ? 218 GLU A HB3  4  
ATOM   7532  H  HG2  . GLU A 1 63  ? 9.129   -16.216 -8.213  1.00 0.00 ? 218 GLU A HG2  4  
ATOM   7533  H  HG3  . GLU A 1 63  ? 8.646   -14.692 -7.468  1.00 0.00 ? 218 GLU A HG3  4  
ATOM   7534  N  N    . GLN A 1 64  ? 7.092   -13.753 -4.196  1.00 0.00 ? 219 GLN A N    4  
ATOM   7535  C  CA   . GLN A 1 64  ? 5.746   -13.116 -4.313  1.00 0.00 ? 219 GLN A CA   4  
ATOM   7536  C  C    . GLN A 1 64  ? 5.844   -11.615 -4.002  1.00 0.00 ? 219 GLN A C    4  
ATOM   7537  O  O    . GLN A 1 64  ? 6.874   -11.139 -3.566  1.00 0.00 ? 219 GLN A O    4  
ATOM   7538  C  CB   . GLN A 1 64  ? 4.880   -13.827 -3.273  1.00 0.00 ? 219 GLN A CB   4  
ATOM   7539  C  CG   . GLN A 1 64  ? 4.209   -15.044 -3.913  1.00 0.00 ? 219 GLN A CG   4  
ATOM   7540  C  CD   . GLN A 1 64  ? 2.839   -15.275 -3.262  1.00 0.00 ? 219 GLN A CD   4  
ATOM   7541  O  OE1  . GLN A 1 64  ? 1.979   -14.420 -3.323  1.00 0.00 ? 219 GLN A OE1  4  
ATOM   7542  N  NE2  . GLN A 1 64  ? 2.595   -16.400 -2.636  1.00 0.00 ? 219 GLN A NE2  4  
ATOM   7543  H  H    . GLN A 1 64  ? 7.650   -13.563 -3.410  1.00 0.00 ? 219 GLN A H    4  
ATOM   7544  H  HA   . GLN A 1 64  ? 5.340   -13.272 -5.301  1.00 0.00 ? 219 GLN A HA   4  
ATOM   7545  H  HB2  . GLN A 1 64  ? 5.501   -14.148 -2.450  1.00 0.00 ? 219 GLN A HB2  4  
ATOM   7546  H  HB3  . GLN A 1 64  ? 4.123   -13.148 -2.911  1.00 0.00 ? 219 GLN A HB3  4  
ATOM   7547  H  HG2  . GLN A 1 64  ? 4.081   -14.867 -4.972  1.00 0.00 ? 219 GLN A HG2  4  
ATOM   7548  H  HG3  . GLN A 1 64  ? 4.827   -15.915 -3.765  1.00 0.00 ? 219 GLN A HG3  4  
ATOM   7549  H  HE21 . GLN A 1 64  ? 3.283   -17.098 -2.579  1.00 0.00 ? 219 GLN A HE21 4  
ATOM   7550  H  HE22 . GLN A 1 64  ? 1.719   -16.545 -2.220  1.00 0.00 ? 219 GLN A HE22 4  
ATOM   7551  N  N    . CYS A 1 65  ? 4.785   -10.864 -4.225  1.00 0.00 ? 220 CYS A N    4  
ATOM   7552  C  CA   . CYS A 1 65  ? 4.844   -9.381  -3.937  1.00 0.00 ? 220 CYS A CA   4  
ATOM   7553  C  C    . CYS A 1 65  ? 4.887   -9.117  -2.426  1.00 0.00 ? 220 CYS A C    4  
ATOM   7554  O  O    . CYS A 1 65  ? 4.399   -9.909  -1.641  1.00 0.00 ? 220 CYS A O    4  
ATOM   7555  C  CB   . CYS A 1 65  ? 3.552   -8.784  -4.506  1.00 0.00 ? 220 CYS A CB   4  
ATOM   7556  S  SG   . CYS A 1 65  ? 3.616   -6.979  -4.437  1.00 0.00 ? 220 CYS A SG   4  
ATOM   7557  H  H    . CYS A 1 65  ? 3.955   -11.273 -4.583  1.00 0.00 ? 220 CYS A H    4  
ATOM   7558  H  HA   . CYS A 1 65  ? 5.696   -8.934  -4.423  1.00 0.00 ? 220 CYS A HA   4  
ATOM   7559  H  HB2  . CYS A 1 65  ? 3.426   -9.101  -5.529  1.00 0.00 ? 220 CYS A HB2  4  
ATOM   7560  H  HB3  . CYS A 1 65  ? 2.718   -9.127  -3.917  1.00 0.00 ? 220 CYS A HB3  4  
ATOM   7561  N  N    . ARG A 1 66  ? 5.431   -7.988  -2.010  1.00 0.00 ? 221 ARG A N    4  
ATOM   7562  C  CA   . ARG A 1 66  ? 5.452   -7.661  -0.549  1.00 0.00 ? 221 ARG A CA   4  
ATOM   7563  C  C    . ARG A 1 66  ? 4.376   -6.594  -0.251  1.00 0.00 ? 221 ARG A C    4  
ATOM   7564  O  O    . ARG A 1 66  ? 4.568   -5.725  0.577   1.00 0.00 ? 221 ARG A O    4  
ATOM   7565  C  CB   . ARG A 1 66  ? 6.853   -7.111  -0.265  1.00 0.00 ? 221 ARG A CB   4  
ATOM   7566  C  CG   . ARG A 1 66  ? 7.838   -8.271  -0.101  1.00 0.00 ? 221 ARG A CG   4  
ATOM   7567  C  CD   . ARG A 1 66  ? 7.774   -8.808  1.334   1.00 0.00 ? 221 ARG A CD   4  
ATOM   7568  N  NE   . ARG A 1 66  ? 7.082   -10.123 1.226   1.00 0.00 ? 221 ARG A NE   4  
ATOM   7569  C  CZ   . ARG A 1 66  ? 7.780   -11.221 1.133   1.00 0.00 ? 221 ARG A CZ   4  
ATOM   7570  N  NH1  . ARG A 1 66  ? 8.402   -11.689 2.180   1.00 0.00 ? 221 ARG A NH1  4  
ATOM   7571  N  NH2  . ARG A 1 66  ? 7.855   -11.853 -0.007  1.00 0.00 ? 221 ARG A NH2  4  
ATOM   7572  H  H    . ARG A 1 66  ? 5.793   -7.342  -2.658  1.00 0.00 ? 221 ARG A H    4  
ATOM   7573  H  HA   . ARG A 1 66  ? 5.274   -8.548  0.038   1.00 0.00 ? 221 ARG A HA   4  
ATOM   7574  H  HB2  . ARG A 1 66  ? 7.166   -6.488  -1.090  1.00 0.00 ? 221 ARG A HB2  4  
ATOM   7575  H  HB3  . ARG A 1 66  ? 6.834   -6.526  0.642   1.00 0.00 ? 221 ARG A HB3  4  
ATOM   7576  H  HG2  . ARG A 1 66  ? 7.583   -9.060  -0.794  1.00 0.00 ? 221 ARG A HG2  4  
ATOM   7577  H  HG3  . ARG A 1 66  ? 8.838   -7.922  -0.307  1.00 0.00 ? 221 ARG A HG3  4  
ATOM   7578  H  HD2  . ARG A 1 66  ? 8.772   -8.939  1.728   1.00 0.00 ? 221 ARG A HD2  4  
ATOM   7579  H  HD3  . ARG A 1 66  ? 7.205   -8.141  1.964   1.00 0.00 ? 221 ARG A HD3  4  
ATOM   7580  H  HE   . ARG A 1 66  ? 6.102   -10.163 1.227   1.00 0.00 ? 221 ARG A HE   4  
ATOM   7581  H  HH11 . ARG A 1 66  ? 8.344   -11.205 3.053   1.00 0.00 ? 221 ARG A HH11 4  
ATOM   7582  H  HH12 . ARG A 1 66  ? 8.937   -12.531 2.110   1.00 0.00 ? 221 ARG A HH12 4  
ATOM   7583  H  HH21 . ARG A 1 66  ? 7.377   -11.494 -0.810  1.00 0.00 ? 221 ARG A HH21 4  
ATOM   7584  H  HH22 . ARG A 1 66  ? 8.389   -12.695 -0.078  1.00 0.00 ? 221 ARG A HH22 4  
ATOM   7585  N  N    . TRP A 1 67  ? 3.239   -6.655  -0.927  1.00 0.00 ? 222 TRP A N    4  
ATOM   7586  C  CA   . TRP A 1 67  ? 2.151   -5.654  -0.692  1.00 0.00 ? 222 TRP A CA   4  
ATOM   7587  C  C    . TRP A 1 67  ? 0.785   -6.315  -0.954  1.00 0.00 ? 222 TRP A C    4  
ATOM   7588  O  O    . TRP A 1 67  ? -0.051  -6.403  -0.076  1.00 0.00 ? 222 TRP A O    4  
ATOM   7589  C  CB   . TRP A 1 67  ? 2.398   -4.543  -1.722  1.00 0.00 ? 222 TRP A CB   4  
ATOM   7590  C  CG   . TRP A 1 67  ? 2.247   -3.201  -1.077  1.00 0.00 ? 222 TRP A CG   4  
ATOM   7591  C  CD1  . TRP A 1 67  ? 1.313   -2.874  -0.149  1.00 0.00 ? 222 TRP A CD1  4  
ATOM   7592  C  CD2  . TRP A 1 67  ? 3.032   -2.001  -1.305  1.00 0.00 ? 222 TRP A CD2  4  
ATOM   7593  N  NE1  . TRP A 1 67  ? 1.498   -1.558  0.223   1.00 0.00 ? 222 TRP A NE1  4  
ATOM   7594  C  CE2  . TRP A 1 67  ? 2.544   -0.976  -0.465  1.00 0.00 ? 222 TRP A CE2  4  
ATOM   7595  C  CE3  . TRP A 1 67  ? 4.118   -1.708  -2.147  1.00 0.00 ? 222 TRP A CE3  4  
ATOM   7596  C  CZ2  . TRP A 1 67  ? 3.116   0.293   -0.457  1.00 0.00 ? 222 TRP A CZ2  4  
ATOM   7597  C  CZ3  . TRP A 1 67  ? 4.692   -0.428  -2.147  1.00 0.00 ? 222 TRP A CZ3  4  
ATOM   7598  C  CH2  . TRP A 1 67  ? 4.193   0.570   -1.301  1.00 0.00 ? 222 TRP A CH2  4  
ATOM   7599  H  H    . TRP A 1 67  ? 3.099   -7.365  -1.590  1.00 0.00 ? 222 TRP A H    4  
ATOM   7600  H  HA   . TRP A 1 67  ? 2.205   -5.257  0.312   1.00 0.00 ? 222 TRP A HA   4  
ATOM   7601  H  HB2  . TRP A 1 67  ? 3.399   -4.637  -2.116  1.00 0.00 ? 222 TRP A HB2  4  
ATOM   7602  H  HB3  . TRP A 1 67  ? 1.689   -4.632  -2.532  1.00 0.00 ? 222 TRP A HB3  4  
ATOM   7603  H  HD1  . TRP A 1 67  ? 0.557   -3.537  0.244   1.00 0.00 ? 222 TRP A HD1  4  
ATOM   7604  H  HE1  . TRP A 1 67  ? 0.962   -1.077  0.887   1.00 0.00 ? 222 TRP A HE1  4  
ATOM   7605  H  HE3  . TRP A 1 67  ? 4.508   -2.470  -2.804  1.00 0.00 ? 222 TRP A HE3  4  
ATOM   7606  H  HZ2  . TRP A 1 67  ? 2.736   1.050   0.203   1.00 0.00 ? 222 TRP A HZ2  4  
ATOM   7607  H  HZ3  . TRP A 1 67  ? 5.522   -0.212  -2.800  1.00 0.00 ? 222 TRP A HZ3  4  
ATOM   7608  H  HH2  . TRP A 1 67  ? 4.637   1.554   -1.305  1.00 0.00 ? 222 TRP A HH2  4  
ATOM   7609  N  N    . CYS A 1 68  ? 0.568   -6.795  -2.165  1.00 0.00 ? 223 CYS A N    4  
ATOM   7610  C  CA   . CYS A 1 68  ? -0.732  -7.470  -2.486  1.00 0.00 ? 223 CYS A CA   4  
ATOM   7611  C  C    . CYS A 1 68  ? -0.622  -9.014  -2.354  1.00 0.00 ? 223 CYS A C    4  
ATOM   7612  O  O    . CYS A 1 68  ? -1.604  -9.711  -2.521  1.00 0.00 ? 223 CYS A O    4  
ATOM   7613  C  CB   . CYS A 1 68  ? -1.093  -7.043  -3.930  1.00 0.00 ? 223 CYS A CB   4  
ATOM   7614  S  SG   . CYS A 1 68  ? 0.060   -7.752  -5.147  1.00 0.00 ? 223 CYS A SG   4  
ATOM   7615  H  H    . CYS A 1 68  ? 1.266   -6.724  -2.852  1.00 0.00 ? 223 CYS A H    4  
ATOM   7616  H  HA   . CYS A 1 68  ? -1.494  -7.111  -1.812  1.00 0.00 ? 223 CYS A HA   4  
ATOM   7617  H  HB2  . CYS A 1 68  ? -2.093  -7.380  -4.158  1.00 0.00 ? 223 CYS A HB2  4  
ATOM   7618  H  HB3  . CYS A 1 68  ? -1.063  -5.964  -3.996  1.00 0.00 ? 223 CYS A HB3  4  
ATOM   7619  N  N    . ALA A 1 69  ? 0.552   -9.561  -2.051  1.00 0.00 ? 224 ALA A N    4  
ATOM   7620  C  CA   . ALA A 1 69  ? 0.694   -11.046 -1.905  1.00 0.00 ? 224 ALA A CA   4  
ATOM   7621  C  C    . ALA A 1 69  ? 0.229   -11.766 -3.180  1.00 0.00 ? 224 ALA A C    4  
ATOM   7622  O  O    . ALA A 1 69  ? -0.473  -12.757 -3.119  1.00 0.00 ? 224 ALA A O    4  
ATOM   7623  C  CB   . ALA A 1 69  ? -0.168  -11.441 -0.700  1.00 0.00 ? 224 ALA A CB   4  
ATOM   7624  H  H    . ALA A 1 69  ? 1.342   -9.003  -1.916  1.00 0.00 ? 224 ALA A H    4  
ATOM   7625  H  HA   . ALA A 1 69  ? 1.726   -11.294 -1.705  1.00 0.00 ? 224 ALA A HA   4  
ATOM   7626  H  HB1  . ALA A 1 69  ? -0.372  -12.500 -0.738  1.00 0.00 ? 224 ALA A HB1  4  
ATOM   7627  H  HB2  . ALA A 1 69  ? -1.097  -10.894 -0.724  1.00 0.00 ? 224 ALA A HB2  4  
ATOM   7628  H  HB3  . ALA A 1 69  ? 0.362   -11.208 0.214   1.00 0.00 ? 224 ALA A HB3  4  
ATOM   7629  N  N    . GLU A 1 70  ? 0.635   -11.285 -4.337  1.00 0.00 ? 225 GLU A N    4  
ATOM   7630  C  CA   . GLU A 1 70  ? 0.244   -11.947 -5.613  1.00 0.00 ? 225 GLU A CA   4  
ATOM   7631  C  C    . GLU A 1 70  ? 1.509   -12.459 -6.316  1.00 0.00 ? 225 GLU A C    4  
ATOM   7632  O  O    . GLU A 1 70  ? 2.578   -12.457 -5.734  1.00 0.00 ? 225 GLU A O    4  
ATOM   7633  C  CB   . GLU A 1 70  ? -0.432  -10.851 -6.442  1.00 0.00 ? 225 GLU A CB   4  
ATOM   7634  C  CG   . GLU A 1 70  ? -1.680  -10.350 -5.711  1.00 0.00 ? 225 GLU A CG   4  
ATOM   7635  C  CD   . GLU A 1 70  ? -2.864  -11.261 -6.038  1.00 0.00 ? 225 GLU A CD   4  
ATOM   7636  O  OE1  . GLU A 1 70  ? -2.746  -12.456 -5.816  1.00 0.00 ? 225 GLU A OE1  4  
ATOM   7637  O  OE2  . GLU A 1 70  ? -3.869  -10.750 -6.504  1.00 0.00 ? 225 GLU A OE2  4  
ATOM   7638  H  H    . GLU A 1 70  ? 1.215   -10.495 -4.366  1.00 0.00 ? 225 GLU A H    4  
ATOM   7639  H  HA   . GLU A 1 70  ? -0.446  -12.756 -5.427  1.00 0.00 ? 225 GLU A HA   4  
ATOM   7640  H  HB2  . GLU A 1 70  ? 0.258   -10.031 -6.584  1.00 0.00 ? 225 GLU A HB2  4  
ATOM   7641  H  HB3  . GLU A 1 70  ? -0.717  -11.250 -7.404  1.00 0.00 ? 225 GLU A HB3  4  
ATOM   7642  H  HG2  . GLU A 1 70  ? -1.500  -10.360 -4.647  1.00 0.00 ? 225 GLU A HG2  4  
ATOM   7643  H  HG3  . GLU A 1 70  ? -1.904  -9.343  -6.030  1.00 0.00 ? 225 GLU A HG3  4  
ATOM   7644  N  N    . GLY A 1 71  ? 1.411   -12.899 -7.554  1.00 0.00 ? 226 GLY A N    4  
ATOM   7645  C  CA   . GLY A 1 71  ? 2.630   -13.401 -8.258  1.00 0.00 ? 226 GLY A CA   4  
ATOM   7646  C  C    . GLY A 1 71  ? 2.568   -13.021 -9.746  1.00 0.00 ? 226 GLY A C    4  
ATOM   7647  O  O    . GLY A 1 71  ? 1.614   -12.411 -10.192 1.00 0.00 ? 226 GLY A O    4  
ATOM   7648  H  H    . GLY A 1 71  ? 0.545   -12.899 -8.017  1.00 0.00 ? 226 GLY A H    4  
ATOM   7649  H  HA2  . GLY A 1 71  ? 3.508   -12.957 -7.807  1.00 0.00 ? 226 GLY A HA2  4  
ATOM   7650  H  HA3  . GLY A 1 71  ? 2.681   -14.475 -8.165  1.00 0.00 ? 226 GLY A HA3  4  
ATOM   7651  N  N    . GLY A 1 72  ? 3.573   -13.378 -10.520 1.00 0.00 ? 227 GLY A N    4  
ATOM   7652  C  CA   . GLY A 1 72  ? 3.558   -13.034 -11.975 1.00 0.00 ? 227 GLY A CA   4  
ATOM   7653  C  C    . GLY A 1 72  ? 4.416   -11.784 -12.219 1.00 0.00 ? 227 GLY A C    4  
ATOM   7654  O  O    . GLY A 1 72  ? 4.060   -10.697 -11.805 1.00 0.00 ? 227 GLY A O    4  
ATOM   7655  H  H    . GLY A 1 72  ? 4.337   -13.871 -10.149 1.00 0.00 ? 227 GLY A H    4  
ATOM   7656  H  HA2  . GLY A 1 72  ? 3.957   -13.863 -12.543 1.00 0.00 ? 227 GLY A HA2  4  
ATOM   7657  H  HA3  . GLY A 1 72  ? 2.545   -12.838 -12.287 1.00 0.00 ? 227 GLY A HA3  4  
ATOM   7658  N  N    . ASN A 1 73  ? 5.548   -11.922 -12.889 1.00 0.00 ? 228 ASN A N    4  
ATOM   7659  C  CA   . ASN A 1 73  ? 6.425   -10.734 -13.158 1.00 0.00 ? 228 ASN A CA   4  
ATOM   7660  C  C    . ASN A 1 73  ? 6.725   -9.971  -11.856 1.00 0.00 ? 228 ASN A C    4  
ATOM   7661  O  O    . ASN A 1 73  ? 5.992   -9.075  -11.481 1.00 0.00 ? 228 ASN A O    4  
ATOM   7662  C  CB   . ASN A 1 73  ? 5.629   -9.852  -14.124 1.00 0.00 ? 228 ASN A CB   4  
ATOM   7663  C  CG   . ASN A 1 73  ? 5.774   -10.395 -15.551 1.00 0.00 ? 228 ASN A CG   4  
ATOM   7664  O  OD1  . ASN A 1 73  ? 5.479   -11.547 -15.802 1.00 0.00 ? 228 ASN A OD1  4  
ATOM   7665  N  ND2  . ASN A 1 73  ? 6.216   -9.614  -16.506 1.00 0.00 ? 228 ASN A ND2  4  
ATOM   7666  H  H    . ASN A 1 73  ? 5.823   -12.806 -13.218 1.00 0.00 ? 228 ASN A H    4  
ATOM   7667  H  HA   . ASN A 1 73  ? 7.345   -11.046 -13.626 1.00 0.00 ? 228 ASN A HA   4  
ATOM   7668  H  HB2  . ASN A 1 73  ? 4.587   -9.857  -13.839 1.00 0.00 ? 228 ASN A HB2  4  
ATOM   7669  H  HB3  . ASN A 1 73  ? 6.008   -8.842  -14.085 1.00 0.00 ? 228 ASN A HB3  4  
ATOM   7670  H  HD21 . ASN A 1 73  ? 6.458   -8.682  -16.316 1.00 0.00 ? 228 ASN A HD21 4  
ATOM   7671  H  HD22 . ASN A 1 73  ? 6.307   -9.964  -17.418 1.00 0.00 ? 228 ASN A HD22 4  
ATOM   7672  N  N    . LEU A 1 74  ? 7.792   -10.317 -11.162 1.00 0.00 ? 229 LEU A N    4  
ATOM   7673  C  CA   . LEU A 1 74  ? 8.114   -9.600  -9.891  1.00 0.00 ? 229 LEU A CA   4  
ATOM   7674  C  C    . LEU A 1 74  ? 9.511   -8.963  -9.968  1.00 0.00 ? 229 LEU A C    4  
ATOM   7675  O  O    . LEU A 1 74  ? 10.301  -9.300  -10.830 1.00 0.00 ? 229 LEU A O    4  
ATOM   7676  C  CB   . LEU A 1 74  ? 8.091   -10.673 -8.796  1.00 0.00 ? 229 LEU A CB   4  
ATOM   7677  C  CG   . LEU A 1 74  ? 6.722   -11.356 -8.749  1.00 0.00 ? 229 LEU A CG   4  
ATOM   7678  C  CD1  . LEU A 1 74  ? 6.839   -12.667 -7.967  1.00 0.00 ? 229 LEU A CD1  4  
ATOM   7679  C  CD2  . LEU A 1 74  ? 5.715   -10.441 -8.049  1.00 0.00 ? 229 LEU A CD2  4  
ATOM   7680  H  H    . LEU A 1 74  ? 8.377   -11.042 -11.472 1.00 0.00 ? 229 LEU A H    4  
ATOM   7681  H  HA   . LEU A 1 74  ? 7.368   -8.851  -9.690  1.00 0.00 ? 229 LEU A HA   4  
ATOM   7682  H  HB2  . LEU A 1 74  ? 8.852   -11.411 -9.004  1.00 0.00 ? 229 LEU A HB2  4  
ATOM   7683  H  HB3  . LEU A 1 74  ? 8.291   -10.212 -7.841  1.00 0.00 ? 229 LEU A HB3  4  
ATOM   7684  H  HG   . LEU A 1 74  ? 6.387   -11.565 -9.754  1.00 0.00 ? 229 LEU A HG   4  
ATOM   7685  H  HD11 . LEU A 1 74  ? 5.873   -12.933 -7.562  1.00 0.00 ? 229 LEU A HD11 4  
ATOM   7686  H  HD12 . LEU A 1 74  ? 7.547   -12.543 -7.159  1.00 0.00 ? 229 LEU A HD12 4  
ATOM   7687  H  HD13 . LEU A 1 74  ? 7.181   -13.451 -8.627  1.00 0.00 ? 229 LEU A HD13 4  
ATOM   7688  H  HD21 . LEU A 1 74  ? 4.999   -11.041 -7.505  1.00 0.00 ? 229 LEU A HD21 4  
ATOM   7689  H  HD22 . LEU A 1 74  ? 5.199   -9.846  -8.787  1.00 0.00 ? 229 LEU A HD22 4  
ATOM   7690  H  HD23 . LEU A 1 74  ? 6.236   -9.793  -7.360  1.00 0.00 ? 229 LEU A HD23 4  
ATOM   7691  N  N    . ILE A 1 75  ? 9.830   -8.055  -9.065  1.00 0.00 ? 230 ILE A N    4  
ATOM   7692  C  CA   . ILE A 1 75  ? 11.183  -7.417  -9.084  1.00 0.00 ? 230 ILE A CA   4  
ATOM   7693  C  C    . ILE A 1 75  ? 11.962  -7.834  -7.830  1.00 0.00 ? 230 ILE A C    4  
ATOM   7694  O  O    . ILE A 1 75  ? 11.784  -7.260  -6.772  1.00 0.00 ? 230 ILE A O    4  
ATOM   7695  C  CB   . ILE A 1 75  ? 10.922  -5.905  -9.082  1.00 0.00 ? 230 ILE A CB   4  
ATOM   7696  C  CG1  . ILE A 1 75  ? 10.217  -5.516  -10.386 1.00 0.00 ? 230 ILE A CG1  4  
ATOM   7697  C  CG2  . ILE A 1 75  ? 12.250  -5.136  -8.970  1.00 0.00 ? 230 ILE A CG2  4  
ATOM   7698  C  CD1  . ILE A 1 75  ? 9.869   -4.026  -10.362 1.00 0.00 ? 230 ILE A CD1  4  
ATOM   7699  H  H    . ILE A 1 75  ? 9.186   -7.801  -8.367  1.00 0.00 ? 230 ILE A H    4  
ATOM   7700  H  HA   . ILE A 1 75  ? 11.720  -7.701  -9.974  1.00 0.00 ? 230 ILE A HA   4  
ATOM   7701  H  HB   . ILE A 1 75  ? 10.289  -5.652  -8.243  1.00 0.00 ? 230 ILE A HB   4  
ATOM   7702  H  HG12 . ILE A 1 75  ? 10.871  -5.720  -11.222 1.00 0.00 ? 230 ILE A HG12 4  
ATOM   7703  H  HG13 . ILE A 1 75  ? 9.310   -6.093  -10.490 1.00 0.00 ? 230 ILE A HG13 4  
ATOM   7704  H  HG21 . ILE A 1 75  ? 12.716  -5.353  -8.017  1.00 0.00 ? 230 ILE A HG21 4  
ATOM   7705  H  HG22 . ILE A 1 75  ? 12.059  -4.075  -9.039  1.00 0.00 ? 230 ILE A HG22 4  
ATOM   7706  H  HG23 . ILE A 1 75  ? 12.910  -5.435  -9.770  1.00 0.00 ? 230 ILE A HG23 4  
ATOM   7707  H  HD11 . ILE A 1 75  ? 9.902   -3.663  -9.343  1.00 0.00 ? 230 ILE A HD11 4  
ATOM   7708  H  HD12 . ILE A 1 75  ? 8.878   -3.881  -10.763 1.00 0.00 ? 230 ILE A HD12 4  
ATOM   7709  H  HD13 . ILE A 1 75  ? 10.584  -3.482  -10.961 1.00 0.00 ? 230 ILE A HD13 4  
ATOM   7710  N  N    . CYS A 1 76  ? 12.831  -8.819  -7.936  1.00 0.00 ? 231 CYS A N    4  
ATOM   7711  C  CA   . CYS A 1 76  ? 13.618  -9.245  -6.722  1.00 0.00 ? 231 CYS A CA   4  
ATOM   7712  C  C    . CYS A 1 76  ? 14.422  -8.053  -6.183  1.00 0.00 ? 231 CYS A C    4  
ATOM   7713  O  O    . CYS A 1 76  ? 14.804  -7.172  -6.931  1.00 0.00 ? 231 CYS A O    4  
ATOM   7714  C  CB   . CYS A 1 76  ? 14.566  -10.365 -7.178  1.00 0.00 ? 231 CYS A CB   4  
ATOM   7715  S  SG   . CYS A 1 76  ? 13.637  -11.908 -7.355  1.00 0.00 ? 231 CYS A SG   4  
ATOM   7716  H  H    . CYS A 1 76  ? 12.966  -9.267  -8.806  1.00 0.00 ? 231 CYS A H    4  
ATOM   7717  H  HA   . CYS A 1 76  ? 12.949  -9.613  -5.957  1.00 0.00 ? 231 CYS A HA   4  
ATOM   7718  H  HB2  . CYS A 1 76  ? 15.008  -10.098 -8.127  1.00 0.00 ? 231 CYS A HB2  4  
ATOM   7719  H  HB3  . CYS A 1 76  ? 15.346  -10.495 -6.442  1.00 0.00 ? 231 CYS A HB3  4  
ATOM   7720  H  HG   . CYS A 1 76  ? 12.742  -11.752 -7.046  1.00 0.00 ? 231 CYS A HG   4  
ATOM   7721  N  N    . CYS A 1 77  ? 14.671  -8.011  -4.894  1.00 0.00 ? 232 CYS A N    4  
ATOM   7722  C  CA   . CYS A 1 77  ? 15.441  -6.862  -4.321  1.00 0.00 ? 232 CYS A CA   4  
ATOM   7723  C  C    . CYS A 1 77  ? 16.861  -7.301  -3.938  1.00 0.00 ? 232 CYS A C    4  
ATOM   7724  O  O    . CYS A 1 77  ? 17.095  -8.455  -3.630  1.00 0.00 ? 232 CYS A O    4  
ATOM   7725  C  CB   . CYS A 1 77  ? 14.654  -6.432  -3.077  1.00 0.00 ? 232 CYS A CB   4  
ATOM   7726  S  SG   . CYS A 1 77  ? 15.449  -4.999  -2.307  1.00 0.00 ? 232 CYS A SG   4  
ATOM   7727  H  H    . CYS A 1 77  ? 14.350  -8.729  -4.302  1.00 0.00 ? 232 CYS A H    4  
ATOM   7728  H  HA   . CYS A 1 77  ? 15.480  -6.049  -5.028  1.00 0.00 ? 232 CYS A HA   4  
ATOM   7729  H  HB2  . CYS A 1 77  ? 13.646  -6.171  -3.365  1.00 0.00 ? 232 CYS A HB2  4  
ATOM   7730  H  HB3  . CYS A 1 77  ? 14.625  -7.248  -2.373  1.00 0.00 ? 232 CYS A HB3  4  
ATOM   7731  N  N    . ASP A 1 78  ? 17.807  -6.384  -3.939  1.00 0.00 ? 233 ASP A N    4  
ATOM   7732  C  CA   . ASP A 1 78  ? 19.205  -6.756  -3.556  1.00 0.00 ? 233 ASP A CA   4  
ATOM   7733  C  C    . ASP A 1 78  ? 19.520  -6.209  -2.155  1.00 0.00 ? 233 ASP A C    4  
ATOM   7734  O  O    . ASP A 1 78  ? 20.610  -5.729  -1.904  1.00 0.00 ? 233 ASP A O    4  
ATOM   7735  C  CB   . ASP A 1 78  ? 20.109  -6.101  -4.606  1.00 0.00 ? 233 ASP A CB   4  
ATOM   7736  C  CG   . ASP A 1 78  ? 21.286  -7.027  -4.916  1.00 0.00 ? 233 ASP A CG   4  
ATOM   7737  O  OD1  . ASP A 1 78  ? 22.129  -7.192  -4.050  1.00 0.00 ? 233 ASP A OD1  4  
ATOM   7738  O  OD2  . ASP A 1 78  ? 21.325  -7.555  -6.015  1.00 0.00 ? 233 ASP A OD2  4  
ATOM   7739  H  H    . ASP A 1 78  ? 17.595  -5.450  -4.180  1.00 0.00 ? 233 ASP A H    4  
ATOM   7740  H  HA   . ASP A 1 78  ? 19.329  -7.827  -3.578  1.00 0.00 ? 233 ASP A HA   4  
ATOM   7741  H  HB2  . ASP A 1 78  ? 19.542  -5.924  -5.508  1.00 0.00 ? 233 ASP A HB2  4  
ATOM   7742  H  HB3  . ASP A 1 78  ? 20.482  -5.162  -4.225  1.00 0.00 ? 233 ASP A HB3  4  
ATOM   7743  N  N    . PHE A 1 79  ? 18.574  -6.272  -1.237  1.00 0.00 ? 234 PHE A N    4  
ATOM   7744  C  CA   . PHE A 1 79  ? 18.828  -5.749  0.140   1.00 0.00 ? 234 PHE A CA   4  
ATOM   7745  C  C    . PHE A 1 79  ? 17.983  -6.515  1.175   1.00 0.00 ? 234 PHE A C    4  
ATOM   7746  O  O    . PHE A 1 79  ? 18.519  -7.142  2.070   1.00 0.00 ? 234 PHE A O    4  
ATOM   7747  C  CB   . PHE A 1 79  ? 18.398  -4.281  0.086   1.00 0.00 ? 234 PHE A CB   4  
ATOM   7748  C  CG   . PHE A 1 79  ? 19.496  -3.437  -0.525  1.00 0.00 ? 234 PHE A CG   4  
ATOM   7749  C  CD1  . PHE A 1 79  ? 20.815  -3.545  -0.063  1.00 0.00 ? 234 PHE A CD1  4  
ATOM   7750  C  CD2  . PHE A 1 79  ? 19.189  -2.539  -1.553  1.00 0.00 ? 234 PHE A CD2  4  
ATOM   7751  C  CE1  . PHE A 1 79  ? 21.822  -2.755  -0.629  1.00 0.00 ? 234 PHE A CE1  4  
ATOM   7752  C  CE2  . PHE A 1 79  ? 20.196  -1.750  -2.120  1.00 0.00 ? 234 PHE A CE2  4  
ATOM   7753  C  CZ   . PHE A 1 79  ? 21.513  -1.857  -1.658  1.00 0.00 ? 234 PHE A CZ   4  
ATOM   7754  H  H    . PHE A 1 79  ? 17.695  -6.659  -1.454  1.00 0.00 ? 234 PHE A H    4  
ATOM   7755  H  HA   . PHE A 1 79  ? 19.876  -5.816  0.383   1.00 0.00 ? 234 PHE A HA   4  
ATOM   7756  H  HB2  . PHE A 1 79  ? 17.507  -4.194  -0.516  1.00 0.00 ? 234 PHE A HB2  4  
ATOM   7757  H  HB3  . PHE A 1 79  ? 18.192  -3.930  1.086   1.00 0.00 ? 234 PHE A HB3  4  
ATOM   7758  H  HD1  . PHE A 1 79  ? 21.054  -4.237  0.731   1.00 0.00 ? 234 PHE A HD1  4  
ATOM   7759  H  HD2  . PHE A 1 79  ? 18.174  -2.455  -1.913  1.00 0.00 ? 234 PHE A HD2  4  
ATOM   7760  H  HE1  . PHE A 1 79  ? 22.839  -2.837  -0.274  1.00 0.00 ? 234 PHE A HE1  4  
ATOM   7761  H  HE2  . PHE A 1 79  ? 19.954  -1.055  -2.910  1.00 0.00 ? 234 PHE A HE2  4  
ATOM   7762  H  HZ   . PHE A 1 79  ? 22.290  -1.249  -2.096  1.00 0.00 ? 234 PHE A HZ   4  
ATOM   7763  N  N    . CYS A 1 80  ? 16.667  -6.472  1.062   1.00 0.00 ? 235 CYS A N    4  
ATOM   7764  C  CA   . CYS A 1 80  ? 15.811  -7.213  2.058   1.00 0.00 ? 235 CYS A CA   4  
ATOM   7765  C  C    . CYS A 1 80  ? 15.443  -8.638  1.573   1.00 0.00 ? 235 CYS A C    4  
ATOM   7766  O  O    . CYS A 1 80  ? 14.557  -9.259  2.127   1.00 0.00 ? 235 CYS A O    4  
ATOM   7767  C  CB   . CYS A 1 80  ? 14.541  -6.356  2.262   1.00 0.00 ? 235 CYS A CB   4  
ATOM   7768  S  SG   . CYS A 1 80  ? 13.544  -6.286  0.743   1.00 0.00 ? 235 CYS A SG   4  
ATOM   7769  H  H    . CYS A 1 80  ? 16.252  -5.960  0.330   1.00 0.00 ? 235 CYS A H    4  
ATOM   7770  H  HA   . CYS A 1 80  ? 16.339  -7.283  2.996   1.00 0.00 ? 235 CYS A HA   4  
ATOM   7771  H  HB2  . CYS A 1 80  ? 13.946  -6.787  3.054   1.00 0.00 ? 235 CYS A HB2  4  
ATOM   7772  H  HB3  . CYS A 1 80  ? 14.832  -5.354  2.545   1.00 0.00 ? 235 CYS A HB3  4  
ATOM   7773  N  N    . HIS A 1 81  ? 16.114  -9.177  0.567   1.00 0.00 ? 236 HIS A N    4  
ATOM   7774  C  CA   . HIS A 1 81  ? 15.787  -10.565 0.090   1.00 0.00 ? 236 HIS A CA   4  
ATOM   7775  C  C    . HIS A 1 81  ? 14.279  -10.725 -0.192  1.00 0.00 ? 236 HIS A C    4  
ATOM   7776  O  O    . HIS A 1 81  ? 13.646  -11.634 0.314   1.00 0.00 ? 236 HIS A O    4  
ATOM   7777  C  CB   . HIS A 1 81  ? 16.221  -11.491 1.229   1.00 0.00 ? 236 HIS A CB   4  
ATOM   7778  C  CG   . HIS A 1 81  ? 16.576  -12.841 0.667   1.00 0.00 ? 236 HIS A CG   4  
ATOM   7779  N  ND1  . HIS A 1 81  ? 17.742  -13.061 -0.047  1.00 0.00 ? 236 HIS A ND1  4  
ATOM   7780  C  CD2  . HIS A 1 81  ? 15.926  -14.049 0.706   1.00 0.00 ? 236 HIS A CD2  4  
ATOM   7781  C  CE1  . HIS A 1 81  ? 17.759  -14.358 -0.406  1.00 0.00 ? 236 HIS A CE1  4  
ATOM   7782  N  NE2  . HIS A 1 81  ? 16.674  -15.006 0.027   1.00 0.00 ? 236 HIS A NE2  4  
ATOM   7783  H  H    . HIS A 1 81  ? 16.838  -8.685  0.130   1.00 0.00 ? 236 HIS A H    4  
ATOM   7784  H  HA   . HIS A 1 81  ? 16.355  -10.792 -0.798  1.00 0.00 ? 236 HIS A HA   4  
ATOM   7785  H  HB2  . HIS A 1 81  ? 17.083  -11.071 1.726   1.00 0.00 ? 236 HIS A HB2  4  
ATOM   7786  H  HB3  . HIS A 1 81  ? 15.412  -11.597 1.936   1.00 0.00 ? 236 HIS A HB3  4  
ATOM   7787  H  HD1  . HIS A 1 81  ? 18.430  -12.394 -0.253  1.00 0.00 ? 236 HIS A HD1  4  
ATOM   7788  H  HD2  . HIS A 1 81  ? 14.976  -14.231 1.188   1.00 0.00 ? 236 HIS A HD2  4  
ATOM   7789  H  HE1  . HIS A 1 81  ? 18.553  -14.819 -0.976  1.00 0.00 ? 236 HIS A HE1  4  
ATOM   7790  N  N    . ASN A 1 82  ? 13.700  -9.865  -1.006  1.00 0.00 ? 237 ASN A N    4  
ATOM   7791  C  CA   . ASN A 1 82  ? 12.241  -9.994  -1.322  1.00 0.00 ? 237 ASN A CA   4  
ATOM   7792  C  C    . ASN A 1 82  ? 11.977  -9.573  -2.778  1.00 0.00 ? 237 ASN A C    4  
ATOM   7793  O  O    . ASN A 1 82  ? 12.900  -9.294  -3.517  1.00 0.00 ? 237 ASN A O    4  
ATOM   7794  C  CB   . ASN A 1 82  ? 11.523  -9.045  -0.359  1.00 0.00 ? 237 ASN A CB   4  
ATOM   7795  C  CG   . ASN A 1 82  ? 11.690  -9.537  1.086   1.00 0.00 ? 237 ASN A CG   4  
ATOM   7796  O  OD1  . ASN A 1 82  ? 12.136  -8.794  1.936   1.00 0.00 ? 237 ASN A OD1  4  
ATOM   7797  N  ND2  . ASN A 1 82  ? 11.338  -10.757 1.410   1.00 0.00 ? 237 ASN A ND2  4  
ATOM   7798  H  H    . ASN A 1 82  ? 14.223  -9.143  -1.418  1.00 0.00 ? 237 ASN A H    4  
ATOM   7799  H  HA   . ASN A 1 82  ? 11.911  -11.007 -1.160  1.00 0.00 ? 237 ASN A HA   4  
ATOM   7800  H  HB2  . ASN A 1 82  ? 11.942  -8.056  -0.453  1.00 0.00 ? 237 ASN A HB2  4  
ATOM   7801  H  HB3  . ASN A 1 82  ? 10.474  -9.014  -0.605  1.00 0.00 ? 237 ASN A HB3  4  
ATOM   7802  H  HD21 . ASN A 1 82  ? 10.965  -11.365 0.735   1.00 0.00 ? 237 ASN A HD21 4  
ATOM   7803  H  HD22 . ASN A 1 82  ? 11.448  -11.066 2.335   1.00 0.00 ? 237 ASN A HD22 4  
ATOM   7804  N  N    . ALA A 1 83  ? 10.728  -9.523  -3.196  1.00 0.00 ? 238 ALA A N    4  
ATOM   7805  C  CA   . ALA A 1 83  ? 10.428  -9.117  -4.606  1.00 0.00 ? 238 ALA A CA   4  
ATOM   7806  C  C    . ALA A 1 83  ? 9.010   -8.521  -4.710  1.00 0.00 ? 238 ALA A C    4  
ATOM   7807  O  O    . ALA A 1 83  ? 8.074   -9.054  -4.145  1.00 0.00 ? 238 ALA A O    4  
ATOM   7808  C  CB   . ALA A 1 83  ? 10.521  -10.412 -5.415  1.00 0.00 ? 238 ALA A CB   4  
ATOM   7809  H  H    . ALA A 1 83  ? 9.990   -9.753  -2.586  1.00 0.00 ? 238 ALA A H    4  
ATOM   7810  H  HA   . ALA A 1 83  ? 11.165  -8.412  -4.958  1.00 0.00 ? 238 ALA A HA   4  
ATOM   7811  H  HB1  . ALA A 1 83  ? 10.341  -10.197 -6.459  1.00 0.00 ? 238 ALA A HB1  4  
ATOM   7812  H  HB2  . ALA A 1 83  ? 9.780   -11.114 -5.060  1.00 0.00 ? 238 ALA A HB2  4  
ATOM   7813  H  HB3  . ALA A 1 83  ? 11.506  -10.839 -5.301  1.00 0.00 ? 238 ALA A HB3  4  
ATOM   7814  N  N    . PHE A 1 84  ? 8.837   -7.435  -5.436  1.00 0.00 ? 239 PHE A N    4  
ATOM   7815  C  CA   . PHE A 1 84  ? 7.465   -6.840  -5.576  1.00 0.00 ? 239 PHE A CA   4  
ATOM   7816  C  C    . PHE A 1 84  ? 6.874   -7.258  -6.930  1.00 0.00 ? 239 PHE A C    4  
ATOM   7817  O  O    . PHE A 1 84  ? 7.508   -7.983  -7.671  1.00 0.00 ? 239 PHE A O    4  
ATOM   7818  C  CB   . PHE A 1 84  ? 7.650   -5.319  -5.506  1.00 0.00 ? 239 PHE A CB   4  
ATOM   7819  C  CG   . PHE A 1 84  ? 7.641   -4.876  -4.060  1.00 0.00 ? 239 PHE A CG   4  
ATOM   7820  C  CD1  . PHE A 1 84  ? 6.429   -4.562  -3.429  1.00 0.00 ? 239 PHE A CD1  4  
ATOM   7821  C  CD2  . PHE A 1 84  ? 8.843   -4.783  -3.351  1.00 0.00 ? 239 PHE A CD2  4  
ATOM   7822  C  CE1  . PHE A 1 84  ? 6.422   -4.156  -2.088  1.00 0.00 ? 239 PHE A CE1  4  
ATOM   7823  C  CE2  . PHE A 1 84  ? 8.835   -4.376  -2.010  1.00 0.00 ? 239 PHE A CE2  4  
ATOM   7824  C  CZ   . PHE A 1 84  ? 7.625   -4.063  -1.379  1.00 0.00 ? 239 PHE A CZ   4  
ATOM   7825  H  H    . PHE A 1 84  ? 9.602   -7.021  -5.901  1.00 0.00 ? 239 PHE A H    4  
ATOM   7826  H  HA   . PHE A 1 84  ? 6.829   -7.174  -4.770  1.00 0.00 ? 239 PHE A HA   4  
ATOM   7827  H  HB2  . PHE A 1 84  ? 8.594   -5.050  -5.958  1.00 0.00 ? 239 PHE A HB2  4  
ATOM   7828  H  HB3  . PHE A 1 84  ? 6.845   -4.832  -6.036  1.00 0.00 ? 239 PHE A HB3  4  
ATOM   7829  H  HD1  . PHE A 1 84  ? 5.501   -4.634  -3.977  1.00 0.00 ? 239 PHE A HD1  4  
ATOM   7830  H  HD2  . PHE A 1 84  ? 9.776   -5.024  -3.839  1.00 0.00 ? 239 PHE A HD2  4  
ATOM   7831  H  HE1  . PHE A 1 84  ? 5.488   -3.913  -1.600  1.00 0.00 ? 239 PHE A HE1  4  
ATOM   7832  H  HE2  . PHE A 1 84  ? 9.763   -4.305  -1.463  1.00 0.00 ? 239 PHE A HE2  4  
ATOM   7833  H  HZ   . PHE A 1 84  ? 7.621   -3.751  -0.343  1.00 0.00 ? 239 PHE A HZ   4  
ATOM   7834  N  N    . CYS A 1 85  ? 5.677   -6.819  -7.266  1.00 0.00 ? 240 CYS A N    4  
ATOM   7835  C  CA   . CYS A 1 85  ? 5.085   -7.221  -8.580  1.00 0.00 ? 240 CYS A CA   4  
ATOM   7836  C  C    . CYS A 1 85  ? 4.930   -5.995  -9.507  1.00 0.00 ? 240 CYS A C    4  
ATOM   7837  O  O    . CYS A 1 85  ? 5.022   -4.865  -9.066  1.00 0.00 ? 240 CYS A O    4  
ATOM   7838  C  CB   . CYS A 1 85  ? 3.735   -7.904  -8.241  1.00 0.00 ? 240 CYS A CB   4  
ATOM   7839  S  SG   . CYS A 1 85  ? 2.405   -6.704  -7.917  1.00 0.00 ? 240 CYS A SG   4  
ATOM   7840  H  H    . CYS A 1 85  ? 5.173   -6.235  -6.664  1.00 0.00 ? 240 CYS A H    4  
ATOM   7841  H  HA   . CYS A 1 85  ? 5.734   -7.941  -9.053  1.00 0.00 ? 240 CYS A HA   4  
ATOM   7842  H  HB2  . CYS A 1 85  ? 3.442   -8.529  -9.070  1.00 0.00 ? 240 CYS A HB2  4  
ATOM   7843  H  HB3  . CYS A 1 85  ? 3.870   -8.527  -7.369  1.00 0.00 ? 240 CYS A HB3  4  
ATOM   7844  N  N    . LYS A 1 86  ? 4.707   -6.214  -10.787 1.00 0.00 ? 241 LYS A N    4  
ATOM   7845  C  CA   . LYS A 1 86  ? 4.564   -5.045  -11.736 1.00 0.00 ? 241 LYS A CA   4  
ATOM   7846  C  C    . LYS A 1 86  ? 3.226   -4.293  -11.534 1.00 0.00 ? 241 LYS A C    4  
ATOM   7847  O  O    . LYS A 1 86  ? 3.121   -3.132  -11.884 1.00 0.00 ? 241 LYS A O    4  
ATOM   7848  C  CB   . LYS A 1 86  ? 4.649   -5.627  -13.163 1.00 0.00 ? 241 LYS A CB   4  
ATOM   7849  C  CG   . LYS A 1 86  ? 3.457   -6.556  -13.435 1.00 0.00 ? 241 LYS A CG   4  
ATOM   7850  C  CD   . LYS A 1 86  ? 2.416   -5.827  -14.286 1.00 0.00 ? 241 LYS A CD   4  
ATOM   7851  C  CE   . LYS A 1 86  ? 1.431   -6.842  -14.871 1.00 0.00 ? 241 LYS A CE   4  
ATOM   7852  N  NZ   . LYS A 1 86  ? 0.105   -6.167  -14.817 1.00 0.00 ? 241 LYS A NZ   4  
ATOM   7853  H  H    . LYS A 1 86  ? 4.647   -7.140  -11.123 1.00 0.00 ? 241 LYS A H    4  
ATOM   7854  H  HA   . LYS A 1 86  ? 5.383   -4.361  -11.586 1.00 0.00 ? 241 LYS A HA   4  
ATOM   7855  H  HB2  . LYS A 1 86  ? 4.646   -4.818  -13.880 1.00 0.00 ? 241 LYS A HB2  4  
ATOM   7856  H  HB3  . LYS A 1 86  ? 5.567   -6.188  -13.266 1.00 0.00 ? 241 LYS A HB3  4  
ATOM   7857  H  HG2  . LYS A 1 86  ? 3.799   -7.435  -13.960 1.00 0.00 ? 241 LYS A HG2  4  
ATOM   7858  H  HG3  . LYS A 1 86  ? 3.009   -6.851  -12.498 1.00 0.00 ? 241 LYS A HG3  4  
ATOM   7859  H  HD2  . LYS A 1 86  ? 1.880   -5.117  -13.671 1.00 0.00 ? 241 LYS A HD2  4  
ATOM   7860  H  HD3  . LYS A 1 86  ? 2.910   -5.304  -15.091 1.00 0.00 ? 241 LYS A HD3  4  
ATOM   7861  H  HE2  . LYS A 1 86  ? 1.697   -7.075  -15.893 1.00 0.00 ? 241 LYS A HE2  4  
ATOM   7862  H  HE3  . LYS A 1 86  ? 1.415   -7.738  -14.271 1.00 0.00 ? 241 LYS A HE3  4  
ATOM   7863  H  HZ1  . LYS A 1 86  ? -0.592  -6.727  -15.345 1.00 0.00 ? 241 LYS A HZ1  4  
ATOM   7864  H  HZ2  . LYS A 1 86  ? 0.181   -5.219  -15.239 1.00 0.00 ? 241 LYS A HZ2  4  
ATOM   7865  H  HZ3  . LYS A 1 86  ? -0.201  -6.082  -13.827 1.00 0.00 ? 241 LYS A HZ3  4  
ATOM   7866  N  N    . LYS A 1 87  ? 2.203   -4.927  -10.987 1.00 0.00 ? 242 LYS A N    4  
ATOM   7867  C  CA   . LYS A 1 87  ? 0.892   -4.200  -10.794 1.00 0.00 ? 242 LYS A CA   4  
ATOM   7868  C  C    . LYS A 1 87  ? 0.943   -3.213  -9.605  1.00 0.00 ? 242 LYS A C    4  
ATOM   7869  O  O    . LYS A 1 87  ? 0.109   -2.328  -9.512  1.00 0.00 ? 242 LYS A O    4  
ATOM   7870  C  CB   . LYS A 1 87  ? -0.170  -5.280  -10.534 1.00 0.00 ? 242 LYS A CB   4  
ATOM   7871  C  CG   . LYS A 1 87  ? -1.560  -4.711  -10.826 1.00 0.00 ? 242 LYS A CG   4  
ATOM   7872  C  CD   . LYS A 1 87  ? -2.454  -5.815  -11.395 1.00 0.00 ? 242 LYS A CD   4  
ATOM   7873  C  CE   . LYS A 1 87  ? -3.740  -5.196  -11.949 1.00 0.00 ? 242 LYS A CE   4  
ATOM   7874  N  NZ   . LYS A 1 87  ? -4.598  -4.961  -10.755 1.00 0.00 ? 242 LYS A NZ   4  
ATOM   7875  H  H    . LYS A 1 87  ? 2.294   -5.867  -10.709 1.00 0.00 ? 242 LYS A H    4  
ATOM   7876  H  HA   . LYS A 1 87  ? 0.641   -3.665  -11.696 1.00 0.00 ? 242 LYS A HA   4  
ATOM   7877  H  HB2  . LYS A 1 87  ? 0.016   -6.128  -11.176 1.00 0.00 ? 242 LYS A HB2  4  
ATOM   7878  H  HB3  . LYS A 1 87  ? -0.120  -5.592  -9.501  1.00 0.00 ? 242 LYS A HB3  4  
ATOM   7879  H  HG2  . LYS A 1 87  ? -1.993  -4.332  -9.911  1.00 0.00 ? 242 LYS A HG2  4  
ATOM   7880  H  HG3  . LYS A 1 87  ? -1.478  -3.910  -11.544 1.00 0.00 ? 242 LYS A HG3  4  
ATOM   7881  H  HD2  . LYS A 1 87  ? -1.929  -6.328  -12.189 1.00 0.00 ? 242 LYS A HD2  4  
ATOM   7882  H  HD3  . LYS A 1 87  ? -2.702  -6.517  -10.614 1.00 0.00 ? 242 LYS A HD3  4  
ATOM   7883  H  HE2  . LYS A 1 87  ? -3.521  -4.263  -12.449 1.00 0.00 ? 242 LYS A HE2  4  
ATOM   7884  H  HE3  . LYS A 1 87  ? -4.227  -5.881  -12.625 1.00 0.00 ? 242 LYS A HE3  4  
ATOM   7885  H  HZ1  . LYS A 1 87  ? -4.128  -4.290  -10.116 1.00 0.00 ? 242 LYS A HZ1  4  
ATOM   7886  H  HZ2  . LYS A 1 87  ? -4.754  -5.863  -10.258 1.00 0.00 ? 242 LYS A HZ2  4  
ATOM   7887  H  HZ3  . LYS A 1 87  ? -5.512  -4.567  -11.056 1.00 0.00 ? 242 LYS A HZ3  4  
ATOM   7888  N  N    . CYS A 1 88  ? 1.899   -3.333  -8.701  1.00 0.00 ? 243 CYS A N    4  
ATOM   7889  C  CA   . CYS A 1 88  ? 1.953   -2.373  -7.544  1.00 0.00 ? 243 CYS A CA   4  
ATOM   7890  C  C    . CYS A 1 88  ? 2.786   -1.144  -7.931  1.00 0.00 ? 243 CYS A C    4  
ATOM   7891  O  O    . CYS A 1 88  ? 2.430   -0.028  -7.602  1.00 0.00 ? 243 CYS A O    4  
ATOM   7892  C  CB   . CYS A 1 88  ? 2.605   -3.132  -6.376  1.00 0.00 ? 243 CYS A CB   4  
ATOM   7893  S  SG   . CYS A 1 88  ? 1.352   -4.116  -5.508  1.00 0.00 ? 243 CYS A SG   4  
ATOM   7894  H  H    . CYS A 1 88  ? 2.576   -4.035  -8.783  1.00 0.00 ? 243 CYS A H    4  
ATOM   7895  H  HA   . CYS A 1 88  ? 0.954   -2.067  -7.274  1.00 0.00 ? 243 CYS A HA   4  
ATOM   7896  H  HB2  . CYS A 1 88  ? 3.374   -3.786  -6.757  1.00 0.00 ? 243 CYS A HB2  4  
ATOM   7897  H  HB3  . CYS A 1 88  ? 3.045   -2.424  -5.689  1.00 0.00 ? 243 CYS A HB3  4  
ATOM   7898  N  N    . ILE A 1 89  ? 3.879   -1.329  -8.648  1.00 0.00 ? 244 ILE A N    4  
ATOM   7899  C  CA   . ILE A 1 89  ? 4.695   -0.134  -9.063  1.00 0.00 ? 244 ILE A CA   4  
ATOM   7900  C  C    . ILE A 1 89  ? 3.926   0.639   -10.145 1.00 0.00 ? 244 ILE A C    4  
ATOM   7901  O  O    . ILE A 1 89  ? 3.915   1.856   -10.142 1.00 0.00 ? 244 ILE A O    4  
ATOM   7902  C  CB   . ILE A 1 89  ? 6.031   -0.668  -9.604  1.00 0.00 ? 244 ILE A CB   4  
ATOM   7903  C  CG1  . ILE A 1 89  ? 6.765   -1.397  -8.478  1.00 0.00 ? 244 ILE A CG1  4  
ATOM   7904  C  CG2  . ILE A 1 89  ? 6.894   0.498   -10.097 1.00 0.00 ? 244 ILE A CG2  4  
ATOM   7905  C  CD1  . ILE A 1 89  ? 8.024   -2.065  -9.033  1.00 0.00 ? 244 ILE A CD1  4  
ATOM   7906  H  H    . ILE A 1 89  ? 4.144   -2.238  -8.925  1.00 0.00 ? 244 ILE A H    4  
ATOM   7907  H  HA   . ILE A 1 89  ? 4.873   0.504   -8.211  1.00 0.00 ? 244 ILE A HA   4  
ATOM   7908  H  HB   . ILE A 1 89  ? 5.845   -1.351  -10.420 1.00 0.00 ? 244 ILE A HB   4  
ATOM   7909  H  HG12 . ILE A 1 89  ? 7.039   -0.687  -7.713  1.00 0.00 ? 244 ILE A HG12 4  
ATOM   7910  H  HG13 . ILE A 1 89  ? 6.118   -2.149  -8.055  1.00 0.00 ? 244 ILE A HG13 4  
ATOM   7911  H  HG21 . ILE A 1 89  ? 6.885   1.288   -9.358  1.00 0.00 ? 244 ILE A HG21 4  
ATOM   7912  H  HG22 . ILE A 1 89  ? 6.496   0.872   -11.028 1.00 0.00 ? 244 ILE A HG22 4  
ATOM   7913  H  HG23 . ILE A 1 89  ? 7.907   0.159   -10.248 1.00 0.00 ? 244 ILE A HG23 4  
ATOM   7914  H  HD11 . ILE A 1 89  ? 7.810   -3.095  -9.273  1.00 0.00 ? 244 ILE A HD11 4  
ATOM   7915  H  HD12 . ILE A 1 89  ? 8.809   -2.024  -8.292  1.00 0.00 ? 244 ILE A HD12 4  
ATOM   7916  H  HD13 . ILE A 1 89  ? 8.344   -1.545  -9.924  1.00 0.00 ? 244 ILE A HD13 4  
ATOM   7917  N  N    . LEU A 1 90  ? 3.257   -0.048  -11.055 1.00 0.00 ? 245 LEU A N    4  
ATOM   7918  C  CA   . LEU A 1 90  ? 2.469   0.685   -12.108 1.00 0.00 ? 245 LEU A CA   4  
ATOM   7919  C  C    . LEU A 1 90  ? 1.419   1.583   -11.430 1.00 0.00 ? 245 LEU A C    4  
ATOM   7920  O  O    . LEU A 1 90  ? 1.181   2.694   -11.865 1.00 0.00 ? 245 LEU A O    4  
ATOM   7921  C  CB   . LEU A 1 90  ? 1.778   -0.381  -12.975 1.00 0.00 ? 245 LEU A CB   4  
ATOM   7922  C  CG   . LEU A 1 90  ? 1.552   0.174   -14.383 1.00 0.00 ? 245 LEU A CG   4  
ATOM   7923  C  CD1  . LEU A 1 90  ? 1.005   -0.932  -15.287 1.00 0.00 ? 245 LEU A CD1  4  
ATOM   7924  C  CD2  . LEU A 1 90  ? 0.546   1.325   -14.320 1.00 0.00 ? 245 LEU A CD2  4  
ATOM   7925  H  H    . LEU A 1 90  ? 3.263   -1.032  -11.035 1.00 0.00 ? 245 LEU A H    4  
ATOM   7926  H  HA   . LEU A 1 90  ? 3.129   1.282   -12.712 1.00 0.00 ? 245 LEU A HA   4  
ATOM   7927  H  HB2  . LEU A 1 90  ? 2.404   -1.260  -13.030 1.00 0.00 ? 245 LEU A HB2  4  
ATOM   7928  H  HB3  . LEU A 1 90  ? 0.827   -0.642  -12.536 1.00 0.00 ? 245 LEU A HB3  4  
ATOM   7929  H  HG   . LEU A 1 90  ? 2.491   0.534   -14.782 1.00 0.00 ? 245 LEU A HG   4  
ATOM   7930  H  HD11 . LEU A 1 90  ? 0.673   -0.502  -16.220 1.00 0.00 ? 245 LEU A HD11 4  
ATOM   7931  H  HD12 . LEU A 1 90  ? 0.173   -1.417  -14.798 1.00 0.00 ? 245 LEU A HD12 4  
ATOM   7932  H  HD13 . LEU A 1 90  ? 1.782   -1.657  -15.480 1.00 0.00 ? 245 LEU A HD13 4  
ATOM   7933  H  HD21 . LEU A 1 90  ? 0.026   1.400   -15.263 1.00 0.00 ? 245 LEU A HD21 4  
ATOM   7934  H  HD22 . LEU A 1 90  ? 1.068   2.250   -14.123 1.00 0.00 ? 245 LEU A HD22 4  
ATOM   7935  H  HD23 . LEU A 1 90  ? -0.165  1.138   -13.530 1.00 0.00 ? 245 LEU A HD23 4  
ATOM   7936  N  N    . ARG A 1 91  ? 0.801   1.122   -10.357 1.00 0.00 ? 246 ARG A N    4  
ATOM   7937  C  CA   . ARG A 1 91  ? -0.215  1.985   -9.657  1.00 0.00 ? 246 ARG A CA   4  
ATOM   7938  C  C    . ARG A 1 91  ? 0.470   3.001   -8.712  1.00 0.00 ? 246 ARG A C    4  
ATOM   7939  O  O    . ARG A 1 91  ? -0.145  3.970   -8.308  1.00 0.00 ? 246 ARG A O    4  
ATOM   7940  C  CB   . ARG A 1 91  ? -1.113  1.035   -8.852  1.00 0.00 ? 246 ARG A CB   4  
ATOM   7941  C  CG   . ARG A 1 91  ? -2.134  0.385   -9.786  1.00 0.00 ? 246 ARG A CG   4  
ATOM   7942  C  CD   . ARG A 1 91  ? -3.415  0.078   -9.008  1.00 0.00 ? 246 ARG A CD   4  
ATOM   7943  N  NE   . ARG A 1 91  ? -4.519  0.295   -9.985  1.00 0.00 ? 246 ARG A NE   4  
ATOM   7944  C  CZ   . ARG A 1 91  ? -5.222  1.393   -9.941  1.00 0.00 ? 246 ARG A CZ   4  
ATOM   7945  N  NH1  . ARG A 1 91  ? -4.658  2.540   -10.203 1.00 0.00 ? 246 ARG A NH1  4  
ATOM   7946  N  NH2  . ARG A 1 91  ? -6.490  1.344   -9.636  1.00 0.00 ? 246 ARG A NH2  4  
ATOM   7947  H  H    . ARG A 1 91  ? 1.016   0.221   -10.003 1.00 0.00 ? 246 ARG A H    4  
ATOM   7948  H  HA   . ARG A 1 91  ? -0.810  2.512   -10.386 1.00 0.00 ? 246 ARG A HA   4  
ATOM   7949  H  HB2  . ARG A 1 91  ? -0.505  0.269   -8.393  1.00 0.00 ? 246 ARG A HB2  4  
ATOM   7950  H  HB3  . ARG A 1 91  ? -1.632  1.591   -8.086  1.00 0.00 ? 246 ARG A HB3  4  
ATOM   7951  H  HG2  . ARG A 1 91  ? -2.359  1.060   -10.600 1.00 0.00 ? 246 ARG A HG2  4  
ATOM   7952  H  HG3  . ARG A 1 91  ? -1.728  -0.533  -10.183 1.00 0.00 ? 246 ARG A HG3  4  
ATOM   7953  H  HD2  . ARG A 1 91  ? -3.408  -0.948  -8.666  1.00 0.00 ? 246 ARG A HD2  4  
ATOM   7954  H  HD3  . ARG A 1 91  ? -3.520  0.754   -8.174  1.00 0.00 ? 246 ARG A HD3  4  
ATOM   7955  H  HE   . ARG A 1 91  ? -4.717  -0.387  -10.661 1.00 0.00 ? 246 ARG A HE   4  
ATOM   7956  H  HH11 . ARG A 1 91  ? -3.686  2.578   -10.437 1.00 0.00 ? 246 ARG A HH11 4  
ATOM   7957  H  HH12 . ARG A 1 91  ? -5.198  3.382   -10.170 1.00 0.00 ? 246 ARG A HH12 4  
ATOM   7958  H  HH21 . ARG A 1 91  ? -6.922  0.464   -9.435  1.00 0.00 ? 246 ARG A HH21 4  
ATOM   7959  H  HH22 . ARG A 1 91  ? -7.030  2.185   -9.604  1.00 0.00 ? 246 ARG A HH22 4  
ATOM   7960  N  N    . ASN A 1 92  ? 1.729   2.801   -8.351  1.00 0.00 ? 247 ASN A N    4  
ATOM   7961  C  CA   . ASN A 1 92  ? 2.407   3.778   -7.435  1.00 0.00 ? 247 ASN A CA   4  
ATOM   7962  C  C    . ASN A 1 92  ? 3.256   4.775   -8.236  1.00 0.00 ? 247 ASN A C    4  
ATOM   7963  O  O    . ASN A 1 92  ? 3.267   5.955   -7.938  1.00 0.00 ? 247 ASN A O    4  
ATOM   7964  C  CB   . ASN A 1 92  ? 3.301   2.940   -6.510  1.00 0.00 ? 247 ASN A CB   4  
ATOM   7965  C  CG   . ASN A 1 92  ? 3.823   3.819   -5.367  1.00 0.00 ? 247 ASN A CG   4  
ATOM   7966  O  OD1  . ASN A 1 92  ? 4.101   4.985   -5.568  1.00 0.00 ? 247 ASN A OD1  4  
ATOM   7967  N  ND2  . ASN A 1 92  ? 3.972   3.314   -4.167  1.00 0.00 ? 247 ASN A ND2  4  
ATOM   7968  H  H    . ASN A 1 92  ? 2.224   2.021   -8.676  1.00 0.00 ? 247 ASN A H    4  
ATOM   7969  H  HA   . ASN A 1 92  ? 1.674   4.305   -6.851  1.00 0.00 ? 247 ASN A HA   4  
ATOM   7970  H  HB2  . ASN A 1 92  ? 2.729   2.120   -6.102  1.00 0.00 ? 247 ASN A HB2  4  
ATOM   7971  H  HB3  . ASN A 1 92  ? 4.137   2.550   -7.073  1.00 0.00 ? 247 ASN A HB3  4  
ATOM   7972  H  HD21 . ASN A 1 92  ? 3.751   2.373   -3.993  1.00 0.00 ? 247 ASN A HD21 4  
ATOM   7973  H  HD22 . ASN A 1 92  ? 4.306   3.878   -3.439  1.00 0.00 ? 247 ASN A HD22 4  
ATOM   7974  N  N    . LEU A 1 93  ? 3.970   4.321   -9.246  1.00 0.00 ? 248 LEU A N    4  
ATOM   7975  C  CA   . LEU A 1 93  ? 4.813   5.274   -10.043 1.00 0.00 ? 248 LEU A CA   4  
ATOM   7976  C  C    . LEU A 1 93  ? 4.907   4.890   -11.538 1.00 0.00 ? 248 LEU A C    4  
ATOM   7977  O  O    . LEU A 1 93  ? 5.850   5.273   -12.206 1.00 0.00 ? 248 LEU A O    4  
ATOM   7978  C  CB   . LEU A 1 93  ? 6.199   5.233   -9.384  1.00 0.00 ? 248 LEU A CB   4  
ATOM   7979  C  CG   . LEU A 1 93  ? 6.810   3.829   -9.488  1.00 0.00 ? 248 LEU A CG   4  
ATOM   7980  C  CD1  . LEU A 1 93  ? 7.581   3.699   -10.801 1.00 0.00 ? 248 LEU A CD1  4  
ATOM   7981  C  CD2  . LEU A 1 93  ? 7.768   3.609   -8.316  1.00 0.00 ? 248 LEU A CD2  4  
ATOM   7982  H  H    . LEU A 1 93  ? 3.954   3.368   -9.472  1.00 0.00 ? 248 LEU A H    4  
ATOM   7983  H  HA   . LEU A 1 93  ? 4.411   6.271   -9.952  1.00 0.00 ? 248 LEU A HA   4  
ATOM   7984  H  HB2  . LEU A 1 93  ? 6.849   5.941   -9.878  1.00 0.00 ? 248 LEU A HB2  4  
ATOM   7985  H  HB3  . LEU A 1 93  ? 6.106   5.504   -8.342  1.00 0.00 ? 248 LEU A HB3  4  
ATOM   7986  H  HG   . LEU A 1 93  ? 6.029   3.089   -9.458  1.00 0.00 ? 248 LEU A HG   4  
ATOM   7987  H  HD11 . LEU A 1 93  ? 6.904   3.392   -11.585 1.00 0.00 ? 248 LEU A HD11 4  
ATOM   7988  H  HD12 . LEU A 1 93  ? 8.361   2.962   -10.689 1.00 0.00 ? 248 LEU A HD12 4  
ATOM   7989  H  HD13 . LEU A 1 93  ? 8.020   4.652   -11.057 1.00 0.00 ? 248 LEU A HD13 4  
ATOM   7990  H  HD21 . LEU A 1 93  ? 7.248   3.788   -7.386  1.00 0.00 ? 248 LEU A HD21 4  
ATOM   7991  H  HD22 . LEU A 1 93  ? 8.602   4.290   -8.398  1.00 0.00 ? 248 LEU A HD22 4  
ATOM   7992  H  HD23 . LEU A 1 93  ? 8.130   2.592   -8.334  1.00 0.00 ? 248 LEU A HD23 4  
ATOM   7993  N  N    . GLY A 1 94  ? 3.943   4.171   -12.086 1.00 0.00 ? 249 GLY A N    4  
ATOM   7994  C  CA   . GLY A 1 94  ? 4.011   3.820   -13.540 1.00 0.00 ? 249 GLY A CA   4  
ATOM   7995  C  C    . GLY A 1 94  ? 4.934   2.612   -13.759 1.00 0.00 ? 249 GLY A C    4  
ATOM   7996  O  O    . GLY A 1 94  ? 5.546   2.115   -12.833 1.00 0.00 ? 249 GLY A O    4  
ATOM   7997  H  H    . GLY A 1 94  ? 3.170   3.880   -11.556 1.00 0.00 ? 249 GLY A H    4  
ATOM   7998  H  HA2  . GLY A 1 94  ? 3.020   3.582   -13.896 1.00 0.00 ? 249 GLY A HA2  4  
ATOM   7999  H  HA3  . GLY A 1 94  ? 4.397   4.663   -14.094 1.00 0.00 ? 249 GLY A HA3  4  
ATOM   8000  N  N    . ARG A 1 95  ? 5.033   2.133   -14.984 1.00 0.00 ? 250 ARG A N    4  
ATOM   8001  C  CA   . ARG A 1 95  ? 5.914   0.948   -15.261 1.00 0.00 ? 250 ARG A CA   4  
ATOM   8002  C  C    . ARG A 1 95  ? 7.274   1.369   -15.859 1.00 0.00 ? 250 ARG A C    4  
ATOM   8003  O  O    . ARG A 1 95  ? 8.250   0.658   -15.712 1.00 0.00 ? 250 ARG A O    4  
ATOM   8004  C  CB   . ARG A 1 95  ? 5.145   0.088   -16.269 1.00 0.00 ? 250 ARG A CB   4  
ATOM   8005  C  CG   . ARG A 1 95  ? 5.818   -1.280  -16.395 1.00 0.00 ? 250 ARG A CG   4  
ATOM   8006  C  CD   . ARG A 1 95  ? 5.616   -1.821  -17.812 1.00 0.00 ? 250 ARG A CD   4  
ATOM   8007  N  NE   . ARG A 1 95  ? 6.132   -3.217  -17.768 1.00 0.00 ? 250 ARG A NE   4  
ATOM   8008  C  CZ   . ARG A 1 95  ? 7.258   -3.516  -18.356 1.00 0.00 ? 250 ARG A CZ   4  
ATOM   8009  N  NH1  . ARG A 1 95  ? 8.387   -3.098  -17.853 1.00 0.00 ? 250 ARG A NH1  4  
ATOM   8010  N  NH2  . ARG A 1 95  ? 7.255   -4.233  -19.446 1.00 0.00 ? 250 ARG A NH2  4  
ATOM   8011  H  H    . ARG A 1 95  ? 4.523   2.548   -15.719 1.00 0.00 ? 250 ARG A H    4  
ATOM   8012  H  HA   . ARG A 1 95  ? 6.072   0.388   -14.357 1.00 0.00 ? 250 ARG A HA   4  
ATOM   8013  H  HB2  . ARG A 1 95  ? 4.127   -0.040  -15.929 1.00 0.00 ? 250 ARG A HB2  4  
ATOM   8014  H  HB3  . ARG A 1 95  ? 5.145   0.577   -17.231 1.00 0.00 ? 250 ARG A HB3  4  
ATOM   8015  H  HG2  . ARG A 1 95  ? 6.876   -1.180  -16.194 1.00 0.00 ? 250 ARG A HG2  4  
ATOM   8016  H  HG3  . ARG A 1 95  ? 5.379   -1.965  -15.685 1.00 0.00 ? 250 ARG A HG3  4  
ATOM   8017  H  HD2  . ARG A 1 95  ? 4.567   -1.812  -18.071 1.00 0.00 ? 250 ARG A HD2  4  
ATOM   8018  H  HD3  . ARG A 1 95  ? 6.185   -1.239  -18.522 1.00 0.00 ? 250 ARG A HD3  4  
ATOM   8019  H  HE   . ARG A 1 95  ? 5.625   -3.911  -17.298 1.00 0.00 ? 250 ARG A HE   4  
ATOM   8020  H  HH11 . ARG A 1 95  ? 8.390   -2.548  -17.017 1.00 0.00 ? 250 ARG A HH11 4  
ATOM   8021  H  HH12 . ARG A 1 95  ? 9.251   -3.326  -18.304 1.00 0.00 ? 250 ARG A HH12 4  
ATOM   8022  H  HH21 . ARG A 1 95  ? 6.391   -4.554  -19.831 1.00 0.00 ? 250 ARG A HH21 4  
ATOM   8023  H  HH22 . ARG A 1 95  ? 8.119   -4.462  -19.896 1.00 0.00 ? 250 ARG A HH22 4  
ATOM   8024  N  N    . LYS A 1 96  ? 7.357   2.501   -16.542 1.00 0.00 ? 251 LYS A N    4  
ATOM   8025  C  CA   . LYS A 1 96  ? 8.681   2.926   -17.150 1.00 0.00 ? 251 LYS A CA   4  
ATOM   8026  C  C    . LYS A 1 96  ? 9.809   2.851   -16.108 1.00 0.00 ? 251 LYS A C    4  
ATOM   8027  O  O    . LYS A 1 96  ? 10.777  2.139   -16.298 1.00 0.00 ? 251 LYS A O    4  
ATOM   8028  C  CB   . LYS A 1 96  ? 8.503   4.375   -17.630 1.00 0.00 ? 251 LYS A CB   4  
ATOM   8029  C  CG   . LYS A 1 96  ? 9.493   4.666   -18.760 1.00 0.00 ? 251 LYS A CG   4  
ATOM   8030  C  CD   . LYS A 1 96  ? 9.406   6.142   -19.150 1.00 0.00 ? 251 LYS A CD   4  
ATOM   8031  C  CE   . LYS A 1 96  ? 10.001  6.338   -20.545 1.00 0.00 ? 251 LYS A CE   4  
ATOM   8032  N  NZ   . LYS A 1 96  ? 9.330   7.557   -21.081 1.00 0.00 ? 251 LYS A NZ   4  
ATOM   8033  H  H    . LYS A 1 96  ? 6.557   3.058   -16.666 1.00 0.00 ? 251 LYS A H    4  
ATOM   8034  H  HA   . LYS A 1 96  ? 8.921   2.290   -17.988 1.00 0.00 ? 251 LYS A HA   4  
ATOM   8035  H  HB2  . LYS A 1 96  ? 7.494   4.513   -17.989 1.00 0.00 ? 251 LYS A HB2  4  
ATOM   8036  H  HB3  . LYS A 1 96  ? 8.689   5.052   -16.809 1.00 0.00 ? 251 LYS A HB3  4  
ATOM   8037  H  HG2  . LYS A 1 96  ? 10.496  4.437   -18.428 1.00 0.00 ? 251 LYS A HG2  4  
ATOM   8038  H  HG3  . LYS A 1 96  ? 9.250   4.054   -19.616 1.00 0.00 ? 251 LYS A HG3  4  
ATOM   8039  H  HD2  . LYS A 1 96  ? 8.372   6.454   -19.150 1.00 0.00 ? 251 LYS A HD2  4  
ATOM   8040  H  HD3  . LYS A 1 96  ? 9.961   6.735   -18.437 1.00 0.00 ? 251 LYS A HD3  4  
ATOM   8041  H  HE2  . LYS A 1 96  ? 11.069  6.492   -20.480 1.00 0.00 ? 251 LYS A HE2  4  
ATOM   8042  H  HE3  . LYS A 1 96  ? 9.778   5.489   -21.172 1.00 0.00 ? 251 LYS A HE3  4  
ATOM   8043  H  HZ1  . LYS A 1 96  ? 8.304   7.397   -21.126 1.00 0.00 ? 251 LYS A HZ1  4  
ATOM   8044  H  HZ2  . LYS A 1 96  ? 9.693   7.761   -22.034 1.00 0.00 ? 251 LYS A HZ2  4  
ATOM   8045  H  HZ3  . LYS A 1 96  ? 9.527   8.363   -20.455 1.00 0.00 ? 251 LYS A HZ3  4  
ATOM   8046  N  N    . GLU A 1 97  ? 9.691   3.558   -14.999 1.00 0.00 ? 252 GLU A N    4  
ATOM   8047  C  CA   . GLU A 1 97  ? 10.775  3.481   -13.950 1.00 0.00 ? 252 GLU A CA   4  
ATOM   8048  C  C    . GLU A 1 97  ? 11.039  2.008   -13.572 1.00 0.00 ? 252 GLU A C    4  
ATOM   8049  O  O    . GLU A 1 97  ? 12.150  1.642   -13.236 1.00 0.00 ? 252 GLU A O    4  
ATOM   8050  C  CB   . GLU A 1 97  ? 10.268  4.257   -12.724 1.00 0.00 ? 252 GLU A CB   4  
ATOM   8051  C  CG   . GLU A 1 97  ? 11.459  4.840   -11.961 1.00 0.00 ? 252 GLU A CG   4  
ATOM   8052  C  CD   . GLU A 1 97  ? 11.031  5.185   -10.533 1.00 0.00 ? 252 GLU A CD   4  
ATOM   8053  O  OE1  . GLU A 1 97  ? 11.141  4.322   -9.678  1.00 0.00 ? 252 GLU A OE1  4  
ATOM   8054  O  OE2  . GLU A 1 97  ? 10.602  6.307   -10.319 1.00 0.00 ? 252 GLU A OE2  4  
ATOM   8055  H  H    . GLU A 1 97  ? 8.894   4.118   -14.856 1.00 0.00 ? 252 GLU A H    4  
ATOM   8056  H  HA   . GLU A 1 97  ? 11.677  3.932   -14.322 1.00 0.00 ? 252 GLU A HA   4  
ATOM   8057  H  HB2  . GLU A 1 97  ? 9.619   5.059   -13.047 1.00 0.00 ? 252 GLU A HB2  4  
ATOM   8058  H  HB3  . GLU A 1 97  ? 9.721   3.590   -12.076 1.00 0.00 ? 252 GLU A HB3  4  
ATOM   8059  H  HG2  . GLU A 1 97  ? 12.259  4.115   -11.933 1.00 0.00 ? 252 GLU A HG2  4  
ATOM   8060  H  HG3  . GLU A 1 97  ? 11.802  5.736   -12.458 1.00 0.00 ? 252 GLU A HG3  4  
ATOM   8061  N  N    . LEU A 1 98  ? 10.029  1.158   -13.633 1.00 0.00 ? 253 LEU A N    4  
ATOM   8062  C  CA   . LEU A 1 98  ? 10.241  -0.291  -13.286 1.00 0.00 ? 253 LEU A CA   4  
ATOM   8063  C  C    . LEU A 1 98  ? 11.334  -0.904  -14.183 1.00 0.00 ? 253 LEU A C    4  
ATOM   8064  O  O    . LEU A 1 98  ? 12.079  -1.760  -13.746 1.00 0.00 ? 253 LEU A O    4  
ATOM   8065  C  CB   . LEU A 1 98  ? 8.898   -0.999  -13.534 1.00 0.00 ? 253 LEU A CB   4  
ATOM   8066  C  CG   . LEU A 1 98  ? 8.803   -2.246  -12.655 1.00 0.00 ? 253 LEU A CG   4  
ATOM   8067  C  CD1  . LEU A 1 98  ? 7.342   -2.684  -12.547 1.00 0.00 ? 253 LEU A CD1  4  
ATOM   8068  C  CD2  . LEU A 1 98  ? 9.629   -3.373  -13.278 1.00 0.00 ? 253 LEU A CD2  4  
ATOM   8069  H  H    . LEU A 1 98  ? 9.138   1.472   -13.912 1.00 0.00 ? 253 LEU A H    4  
ATOM   8070  H  HA   . LEU A 1 98  ? 10.519  -0.387  -12.248 1.00 0.00 ? 253 LEU A HA   4  
ATOM   8071  H  HB2  . LEU A 1 98  ? 8.089   -0.325  -13.290 1.00 0.00 ? 253 LEU A HB2  4  
ATOM   8072  H  HB3  . LEU A 1 98  ? 8.829   -1.283  -14.572 1.00 0.00 ? 253 LEU A HB3  4  
ATOM   8073  H  HG   . LEU A 1 98  ? 9.184   -2.020  -11.670 1.00 0.00 ? 253 LEU A HG   4  
ATOM   8074  H  HD11 . LEU A 1 98  ? 6.754   -1.881  -12.128 1.00 0.00 ? 253 LEU A HD11 4  
ATOM   8075  H  HD12 . LEU A 1 98  ? 7.273   -3.553  -11.909 1.00 0.00 ? 253 LEU A HD12 4  
ATOM   8076  H  HD13 . LEU A 1 98  ? 6.967   -2.930  -13.530 1.00 0.00 ? 253 LEU A HD13 4  
ATOM   8077  H  HD21 . LEU A 1 98  ? 10.654  -3.295  -12.947 1.00 0.00 ? 253 LEU A HD21 4  
ATOM   8078  H  HD22 . LEU A 1 98  ? 9.591   -3.294  -14.355 1.00 0.00 ? 253 LEU A HD22 4  
ATOM   8079  H  HD23 . LEU A 1 98  ? 9.224   -4.327  -12.974 1.00 0.00 ? 253 LEU A HD23 4  
ATOM   8080  N  N    . SER A 1 99  ? 11.445  -0.482  -15.432 1.00 0.00 ? 254 SER A N    4  
ATOM   8081  C  CA   . SER A 1 99  ? 12.515  -1.076  -16.315 1.00 0.00 ? 254 SER A CA   4  
ATOM   8082  C  C    . SER A 1 99  ? 13.898  -0.742  -15.743 1.00 0.00 ? 254 SER A C    4  
ATOM   8083  O  O    . SER A 1 99  ? 14.725  -1.619  -15.573 1.00 0.00 ? 254 SER A O    4  
ATOM   8084  C  CB   . SER A 1 99  ? 12.345  -0.450  -17.707 1.00 0.00 ? 254 SER A CB   4  
ATOM   8085  O  OG   . SER A 1 99  ? 11.433  -1.232  -18.466 1.00 0.00 ? 254 SER A OG   4  
ATOM   8086  H  H    . SER A 1 99  ? 10.834  0.214   -15.780 1.00 0.00 ? 254 SER A H    4  
ATOM   8087  H  HA   . SER A 1 99  ? 12.394  -2.147  -16.373 1.00 0.00 ? 254 SER A HA   4  
ATOM   8088  H  HB2  . SER A 1 99  ? 11.960  0.551   -17.609 1.00 0.00 ? 254 SER A HB2  4  
ATOM   8089  H  HB3  . SER A 1 99  ? 13.307  -0.415  -18.204 1.00 0.00 ? 254 SER A HB3  4  
ATOM   8090  H  HG   . SER A 1 99  ? 11.913  -1.979  -18.830 1.00 0.00 ? 254 SER A HG   4  
ATOM   8091  N  N    . THR A 1 100 ? 14.158  0.512   -15.430 1.00 0.00 ? 255 THR A N    4  
ATOM   8092  C  CA   . THR A 1 100 ? 15.506  0.869   -14.848 1.00 0.00 ? 255 THR A CA   4  
ATOM   8093  C  C    . THR A 1 100 ? 15.769  0.050   -13.572 1.00 0.00 ? 255 THR A C    4  
ATOM   8094  O  O    . THR A 1 100 ? 16.898  -0.295  -13.281 1.00 0.00 ? 255 THR A O    4  
ATOM   8095  C  CB   . THR A 1 100 ? 15.466  2.370   -14.517 1.00 0.00 ? 255 THR A CB   4  
ATOM   8096  O  OG1  . THR A 1 100 ? 15.135  3.103   -15.688 1.00 0.00 ? 255 THR A OG1  4  
ATOM   8097  C  CG2  . THR A 1 100 ? 16.834  2.819   -14.001 1.00 0.00 ? 255 THR A CG2  4  
ATOM   8098  H  H    . THR A 1 100 ? 13.470  1.207   -15.566 1.00 0.00 ? 255 THR A H    4  
ATOM   8099  H  HA   . THR A 1 100 ? 16.281  0.673   -15.568 1.00 0.00 ? 255 THR A HA   4  
ATOM   8100  H  HB   . THR A 1 100 ? 14.722  2.551   -13.756 1.00 0.00 ? 255 THR A HB   4  
ATOM   8101  H  HG1  . THR A 1 100 ? 14.829  3.972   -15.418 1.00 0.00 ? 255 THR A HG1  4  
ATOM   8102  H  HG21 . THR A 1 100 ? 17.542  2.824   -14.816 1.00 0.00 ? 255 THR A HG21 4  
ATOM   8103  H  HG22 . THR A 1 100 ? 17.172  2.137   -13.235 1.00 0.00 ? 255 THR A HG22 4  
ATOM   8104  H  HG23 . THR A 1 100 ? 16.754  3.813   -13.587 1.00 0.00 ? 255 THR A HG23 4  
ATOM   8105  N  N    . ILE A 1 101 ? 14.740  -0.278  -12.812 1.00 0.00 ? 256 ILE A N    4  
ATOM   8106  C  CA   . ILE A 1 101 ? 14.964  -1.093  -11.564 1.00 0.00 ? 256 ILE A CA   4  
ATOM   8107  C  C    . ILE A 1 101 ? 15.668  -2.418  -11.915 1.00 0.00 ? 256 ILE A C    4  
ATOM   8108  O  O    . ILE A 1 101 ? 16.456  -2.921  -11.135 1.00 0.00 ? 256 ILE A O    4  
ATOM   8109  C  CB   . ILE A 1 101 ? 13.572  -1.359  -10.945 1.00 0.00 ? 256 ILE A CB   4  
ATOM   8110  C  CG1  . ILE A 1 101 ? 12.984  -0.042  -10.427 1.00 0.00 ? 256 ILE A CG1  4  
ATOM   8111  C  CG2  . ILE A 1 101 ? 13.694  -2.342  -9.778  1.00 0.00 ? 256 ILE A CG2  4  
ATOM   8112  C  CD1  . ILE A 1 101 ? 11.541  -0.269  -9.972  1.00 0.00 ? 256 ILE A CD1  4  
ATOM   8113  H  H    . ILE A 1 101 ? 13.831  0.001   -13.067 1.00 0.00 ? 256 ILE A H    4  
ATOM   8114  H  HA   . ILE A 1 101 ? 15.568  -0.535  -10.870 1.00 0.00 ? 256 ILE A HA   4  
ATOM   8115  H  HB   . ILE A 1 101 ? 12.920  -1.775  -11.696 1.00 0.00 ? 256 ILE A HB   4  
ATOM   8116  H  HG12 . ILE A 1 101 ? 13.573  0.312   -9.593  1.00 0.00 ? 256 ILE A HG12 4  
ATOM   8117  H  HG13 . ILE A 1 101 ? 12.998  0.696   -11.214 1.00 0.00 ? 256 ILE A HG13 4  
ATOM   8118  H  HG21 . ILE A 1 101 ? 12.938  -2.123  -9.042  1.00 0.00 ? 256 ILE A HG21 4  
ATOM   8119  H  HG22 . ILE A 1 101 ? 14.673  -2.245  -9.333  1.00 0.00 ? 256 ILE A HG22 4  
ATOM   8120  H  HG23 . ILE A 1 101 ? 13.564  -3.351  -10.141 1.00 0.00 ? 256 ILE A HG23 4  
ATOM   8121  H  HD11 . ILE A 1 101 ? 10.951  0.608   -10.195 1.00 0.00 ? 256 ILE A HD11 4  
ATOM   8122  H  HD12 . ILE A 1 101 ? 11.524  -0.454  -8.908  1.00 0.00 ? 256 ILE A HD12 4  
ATOM   8123  H  HD13 . ILE A 1 101 ? 11.129  -1.122  -10.491 1.00 0.00 ? 256 ILE A HD13 4  
ATOM   8124  N  N    . MET A 1 102 ? 15.402  -2.989  -13.075 1.00 0.00 ? 257 MET A N    4  
ATOM   8125  C  CA   . MET A 1 102 ? 16.084  -4.278  -13.433 1.00 0.00 ? 257 MET A CA   4  
ATOM   8126  C  C    . MET A 1 102 ? 17.309  -4.036  -14.343 1.00 0.00 ? 257 MET A C    4  
ATOM   8127  O  O    . MET A 1 102 ? 17.734  -4.933  -15.047 1.00 0.00 ? 257 MET A O    4  
ATOM   8128  C  CB   . MET A 1 102 ? 15.029  -5.119  -14.162 1.00 0.00 ? 257 MET A CB   4  
ATOM   8129  C  CG   . MET A 1 102 ? 14.123  -5.804  -13.135 1.00 0.00 ? 257 MET A CG   4  
ATOM   8130  S  SD   . MET A 1 102 ? 14.845  -7.395  -12.660 1.00 0.00 ? 257 MET A SD   4  
ATOM   8131  C  CE   . MET A 1 102 ? 14.519  -7.278  -10.883 1.00 0.00 ? 257 MET A CE   4  
ATOM   8132  H  H    . MET A 1 102 ? 14.766  -2.572  -13.704 1.00 0.00 ? 257 MET A H    4  
ATOM   8133  H  HA   . MET A 1 102 ? 16.392  -4.790  -12.535 1.00 0.00 ? 257 MET A HA   4  
ATOM   8134  H  HB2  . MET A 1 102 ? 14.434  -4.478  -14.798 1.00 0.00 ? 257 MET A HB2  4  
ATOM   8135  H  HB3  . MET A 1 102 ? 15.518  -5.869  -14.765 1.00 0.00 ? 257 MET A HB3  4  
ATOM   8136  H  HG2  . MET A 1 102 ? 14.029  -5.175  -12.260 1.00 0.00 ? 257 MET A HG2  4  
ATOM   8137  H  HG3  . MET A 1 102 ? 13.146  -5.966  -13.567 1.00 0.00 ? 257 MET A HG3  4  
ATOM   8138  H  HE1  . MET A 1 102 ? 13.466  -7.097  -10.724 1.00 0.00 ? 257 MET A HE1  4  
ATOM   8139  H  HE2  . MET A 1 102 ? 15.089  -6.464  -10.464 1.00 0.00 ? 257 MET A HE2  4  
ATOM   8140  H  HE3  . MET A 1 102 ? 14.809  -8.202  -10.402 1.00 0.00 ? 257 MET A HE3  4  
ATOM   8141  N  N    . ASP A 1 103 ? 17.891  -2.846  -14.336 1.00 0.00 ? 258 ASP A N    4  
ATOM   8142  C  CA   . ASP A 1 103 ? 19.090  -2.595  -15.202 1.00 0.00 ? 258 ASP A CA   4  
ATOM   8143  C  C    . ASP A 1 103 ? 19.765  -1.263  -14.821 1.00 0.00 ? 258 ASP A C    4  
ATOM   8144  O  O    . ASP A 1 103 ? 19.810  -0.338  -15.612 1.00 0.00 ? 258 ASP A O    4  
ATOM   8145  C  CB   . ASP A 1 103 ? 18.539  -2.534  -16.631 1.00 0.00 ? 258 ASP A CB   4  
ATOM   8146  C  CG   . ASP A 1 103 ? 18.796  -3.867  -17.340 1.00 0.00 ? 258 ASP A CG   4  
ATOM   8147  O  OD1  . ASP A 1 103 ? 19.939  -4.291  -17.365 1.00 0.00 ? 258 ASP A OD1  4  
ATOM   8148  O  OD2  . ASP A 1 103 ? 17.845  -4.440  -17.845 1.00 0.00 ? 258 ASP A OD2  4  
ATOM   8149  H  H    . ASP A 1 103 ? 17.549  -2.126  -13.762 1.00 0.00 ? 258 ASP A H    4  
ATOM   8150  H  HA   . ASP A 1 103 ? 19.793  -3.408  -15.111 1.00 0.00 ? 258 ASP A HA   4  
ATOM   8151  H  HB2  . ASP A 1 103 ? 17.476  -2.343  -16.599 1.00 0.00 ? 258 ASP A HB2  4  
ATOM   8152  H  HB3  . ASP A 1 103 ? 19.031  -1.742  -17.173 1.00 0.00 ? 258 ASP A HB3  4  
ATOM   8153  N  N    . GLU A 1 104 ? 20.286  -1.154  -13.614 1.00 0.00 ? 259 GLU A N    4  
ATOM   8154  C  CA   . GLU A 1 104 ? 20.944  0.120   -13.200 1.00 0.00 ? 259 GLU A CA   4  
ATOM   8155  C  C    . GLU A 1 104 ? 22.332  -0.157  -12.594 1.00 0.00 ? 259 GLU A C    4  
ATOM   8156  O  O    . GLU A 1 104 ? 23.339  0.218   -13.165 1.00 0.00 ? 259 GLU A O    4  
ATOM   8157  C  CB   . GLU A 1 104 ? 19.989  0.740   -12.168 1.00 0.00 ? 259 GLU A CB   4  
ATOM   8158  C  CG   . GLU A 1 104 ? 20.582  2.046   -11.628 1.00 0.00 ? 259 GLU A CG   4  
ATOM   8159  C  CD   . GLU A 1 104 ? 19.497  2.831   -10.888 1.00 0.00 ? 259 GLU A CD   4  
ATOM   8160  O  OE1  . GLU A 1 104 ? 18.424  2.990   -11.445 1.00 0.00 ? 259 GLU A OE1  4  
ATOM   8161  O  OE2  . GLU A 1 104 ? 19.759  3.259   -9.776  1.00 0.00 ? 259 GLU A OE2  4  
ATOM   8162  H  H    . GLU A 1 104 ? 20.240  -1.905  -12.981 1.00 0.00 ? 259 GLU A H    4  
ATOM   8163  H  HA   . GLU A 1 104 ? 21.040  0.773   -14.045 1.00 0.00 ? 259 GLU A HA   4  
ATOM   8164  H  HB2  . GLU A 1 104 ? 19.040  0.948   -12.641 1.00 0.00 ? 259 GLU A HB2  4  
ATOM   8165  H  HB3  . GLU A 1 104 ? 19.836  0.051   -11.352 1.00 0.00 ? 259 GLU A HB3  4  
ATOM   8166  H  HG2  . GLU A 1 104 ? 21.392  1.820   -10.950 1.00 0.00 ? 259 GLU A HG2  4  
ATOM   8167  H  HG3  . GLU A 1 104 ? 20.954  2.639   -12.450 1.00 0.00 ? 259 GLU A HG3  4  
ATOM   8168  N  N    . ASN A 1 105 ? 22.400  -0.807  -11.453 1.00 0.00 ? 260 ASN A N    4  
ATOM   8169  C  CA   . ASN A 1 105 ? 23.734  -1.096  -10.836 1.00 0.00 ? 260 ASN A CA   4  
ATOM   8170  C  C    . ASN A 1 105 ? 23.664  -2.359  -9.963  1.00 0.00 ? 260 ASN A C    4  
ATOM   8171  O  O    . ASN A 1 105 ? 24.293  -2.433  -8.924  1.00 0.00 ? 260 ASN A O    4  
ATOM   8172  C  CB   . ASN A 1 105 ? 24.045  0.131   -9.977  1.00 0.00 ? 260 ASN A CB   4  
ATOM   8173  C  CG   . ASN A 1 105 ? 25.563  0.259   -9.795  1.00 0.00 ? 260 ASN A CG   4  
ATOM   8174  O  OD1  . ASN A 1 105 ? 26.153  -0.471  -9.024  1.00 0.00 ? 260 ASN A OD1  4  
ATOM   8175  N  ND2  . ASN A 1 105 ? 26.228  1.161   -10.475 1.00 0.00 ? 260 ASN A ND2  4  
ATOM   8176  H  H    . ASN A 1 105 ? 21.581  -1.107  -11.001 1.00 0.00 ? 260 ASN A H    4  
ATOM   8177  H  HA   . ASN A 1 105 ? 24.487  -1.208  -11.601 1.00 0.00 ? 260 ASN A HA   4  
ATOM   8178  H  HB2  . ASN A 1 105 ? 23.662  1.017   -10.463 1.00 0.00 ? 260 ASN A HB2  4  
ATOM   8179  H  HB3  . ASN A 1 105 ? 23.578  0.020   -9.009  1.00 0.00 ? 260 ASN A HB3  4  
ATOM   8180  H  HD21 . ASN A 1 105 ? 25.762  1.757   -11.102 1.00 0.00 ? 260 ASN A HD21 4  
ATOM   8181  H  HD22 . ASN A 1 105 ? 27.198  1.241   -10.359 1.00 0.00 ? 260 ASN A HD22 4  
ATOM   8182  N  N    . ASN A 1 106 ? 22.901  -3.358  -10.371 1.00 0.00 ? 261 ASN A N    4  
ATOM   8183  C  CA   . ASN A 1 106 ? 22.790  -4.614  -9.555  1.00 0.00 ? 261 ASN A CA   4  
ATOM   8184  C  C    . ASN A 1 106 ? 22.462  -4.305  -8.076  1.00 0.00 ? 261 ASN A C    4  
ATOM   8185  O  O    . ASN A 1 106 ? 22.846  -5.045  -7.192  1.00 0.00 ? 261 ASN A O    4  
ATOM   8186  C  CB   . ASN A 1 106 ? 24.163  -5.284  -9.666  1.00 0.00 ? 261 ASN A CB   4  
ATOM   8187  C  CG   . ASN A 1 106 ? 24.204  -6.165  -10.921 1.00 0.00 ? 261 ASN A CG   4  
ATOM   8188  O  OD1  . ASN A 1 106 ? 24.692  -5.745  -11.951 1.00 0.00 ? 261 ASN A OD1  4  
ATOM   8189  N  ND2  . ASN A 1 106 ? 23.708  -7.378  -10.885 1.00 0.00 ? 261 ASN A ND2  4  
ATOM   8190  H  H    . ASN A 1 106 ? 22.395  -3.284  -11.214 1.00 0.00 ? 261 ASN A H    4  
ATOM   8191  H  HA   . ASN A 1 106 ? 22.038  -5.263  -9.973  1.00 0.00 ? 261 ASN A HA   4  
ATOM   8192  H  HB2  . ASN A 1 106 ? 24.928  -4.523  -9.734  1.00 0.00 ? 261 ASN A HB2  4  
ATOM   8193  H  HB3  . ASN A 1 106 ? 24.338  -5.894  -8.794  1.00 0.00 ? 261 ASN A HB3  4  
ATOM   8194  H  HD21 . ASN A 1 106 ? 23.311  -7.728  -10.057 1.00 0.00 ? 261 ASN A HD21 4  
ATOM   8195  H  HD22 . ASN A 1 106 ? 23.736  -7.939  -11.687 1.00 0.00 ? 261 ASN A HD22 4  
ATOM   8196  N  N    . GLN A 1 107 ? 21.751  -3.226  -7.799  1.00 0.00 ? 262 GLN A N    4  
ATOM   8197  C  CA   . GLN A 1 107 ? 21.405  -2.894  -6.375  1.00 0.00 ? 262 GLN A CA   4  
ATOM   8198  C  C    . GLN A 1 107 ? 20.151  -2.002  -6.338  1.00 0.00 ? 262 GLN A C    4  
ATOM   8199  O  O    . GLN A 1 107 ? 20.243  -0.798  -6.490  1.00 0.00 ? 262 GLN A O    4  
ATOM   8200  C  CB   . GLN A 1 107 ? 22.618  -2.134  -5.830  1.00 0.00 ? 262 GLN A CB   4  
ATOM   8201  C  CG   . GLN A 1 107 ? 23.428  -3.043  -4.902  1.00 0.00 ? 262 GLN A CG   4  
ATOM   8202  C  CD   . GLN A 1 107 ? 24.748  -2.354  -4.534  1.00 0.00 ? 262 GLN A CD   4  
ATOM   8203  O  OE1  . GLN A 1 107 ? 24.760  -1.184  -4.208  1.00 0.00 ? 262 GLN A OE1  4  
ATOM   8204  N  NE2  . GLN A 1 107 ? 25.870  -3.030  -4.570  1.00 0.00 ? 262 GLN A NE2  4  
ATOM   8205  H  H    . GLN A 1 107 ? 21.440  -2.639  -8.522  1.00 0.00 ? 262 GLN A H    4  
ATOM   8206  H  HA   . GLN A 1 107 ? 21.243  -3.796  -5.806  1.00 0.00 ? 262 GLN A HA   4  
ATOM   8207  H  HB2  . GLN A 1 107 ? 23.240  -1.812  -6.652  1.00 0.00 ? 262 GLN A HB2  4  
ATOM   8208  H  HB3  . GLN A 1 107 ? 22.280  -1.269  -5.276  1.00 0.00 ? 262 GLN A HB3  4  
ATOM   8209  H  HG2  . GLN A 1 107 ? 22.860  -3.238  -4.004  1.00 0.00 ? 262 GLN A HG2  4  
ATOM   8210  H  HG3  . GLN A 1 107 ? 23.639  -3.974  -5.403  1.00 0.00 ? 262 GLN A HG3  4  
ATOM   8211  H  HE21 . GLN A 1 107 ? 25.873  -3.977  -4.831  1.00 0.00 ? 262 GLN A HE21 4  
ATOM   8212  H  HE22 . GLN A 1 107 ? 26.713  -2.589  -4.334  1.00 0.00 ? 262 GLN A HE22 4  
ATOM   8213  N  N    . TRP A 1 108 ? 18.982  -2.580  -6.163  1.00 0.00 ? 263 TRP A N    4  
ATOM   8214  C  CA   . TRP A 1 108 ? 17.737  -1.753  -6.149  1.00 0.00 ? 263 TRP A CA   4  
ATOM   8215  C  C    . TRP A 1 108 ? 17.143  -1.646  -4.732  1.00 0.00 ? 263 TRP A C    4  
ATOM   8216  O  O    . TRP A 1 108 ? 16.950  -2.640  -4.057  1.00 0.00 ? 263 TRP A O    4  
ATOM   8217  C  CB   . TRP A 1 108 ? 16.767  -2.500  -7.086  1.00 0.00 ? 263 TRP A CB   4  
ATOM   8218  C  CG   . TRP A 1 108 ? 15.395  -1.888  -7.023  1.00 0.00 ? 263 TRP A CG   4  
ATOM   8219  C  CD1  . TRP A 1 108 ? 15.080  -0.637  -7.424  1.00 0.00 ? 263 TRP A CD1  4  
ATOM   8220  C  CD2  . TRP A 1 108 ? 14.159  -2.484  -6.536  1.00 0.00 ? 263 TRP A CD2  4  
ATOM   8221  N  NE1  . TRP A 1 108 ? 13.730  -0.421  -7.203  1.00 0.00 ? 263 TRP A NE1  4  
ATOM   8222  C  CE2  . TRP A 1 108 ? 13.118  -1.532  -6.657  1.00 0.00 ? 263 TRP A CE2  4  
ATOM   8223  C  CE3  . TRP A 1 108 ? 13.845  -3.746  -6.003  1.00 0.00 ? 263 TRP A CE3  4  
ATOM   8224  C  CZ2  . TRP A 1 108 ? 11.811  -1.823  -6.261  1.00 0.00 ? 263 TRP A CZ2  4  
ATOM   8225  C  CZ3  . TRP A 1 108 ? 12.530  -4.043  -5.604  1.00 0.00 ? 263 TRP A CZ3  4  
ATOM   8226  C  CH2  . TRP A 1 108 ? 11.517  -3.083  -5.733  1.00 0.00 ? 263 TRP A CH2  4  
ATOM   8227  H  H    . TRP A 1 108 ? 18.921  -3.556  -6.061  1.00 0.00 ? 263 TRP A H    4  
ATOM   8228  H  HA   . TRP A 1 108 ? 17.938  -0.771  -6.544  1.00 0.00 ? 263 TRP A HA   4  
ATOM   8229  H  HB2  . TRP A 1 108 ? 17.142  -2.448  -8.093  1.00 0.00 ? 263 TRP A HB2  4  
ATOM   8230  H  HB3  . TRP A 1 108 ? 16.710  -3.535  -6.782  1.00 0.00 ? 263 TRP A HB3  4  
ATOM   8231  H  HD1  . TRP A 1 108 ? 15.767  0.078   -7.846  1.00 0.00 ? 263 TRP A HD1  4  
ATOM   8232  H  HE1  . TRP A 1 108 ? 13.249  0.408   -7.404  1.00 0.00 ? 263 TRP A HE1  4  
ATOM   8233  H  HE3  . TRP A 1 108 ? 14.618  -4.492  -5.904  1.00 0.00 ? 263 TRP A HE3  4  
ATOM   8234  H  HZ2  . TRP A 1 108 ? 11.033  -1.080  -6.361  1.00 0.00 ? 263 TRP A HZ2  4  
ATOM   8235  H  HZ3  . TRP A 1 108 ? 12.300  -5.015  -5.195  1.00 0.00 ? 263 TRP A HZ3  4  
ATOM   8236  H  HH2  . TRP A 1 108 ? 10.508  -3.317  -5.425  1.00 0.00 ? 263 TRP A HH2  4  
ATOM   8237  N  N    . TYR A 1 109 ? 16.784  -0.448  -4.311  1.00 0.00 ? 264 TYR A N    4  
ATOM   8238  C  CA   . TYR A 1 109 ? 16.124  -0.295  -2.977  1.00 0.00 ? 264 TYR A CA   4  
ATOM   8239  C  C    . TYR A 1 109 ? 14.621  -0.404  -3.226  1.00 0.00 ? 264 TYR A C    4  
ATOM   8240  O  O    . TYR A 1 109 ? 14.160  -0.069  -4.302  1.00 0.00 ? 264 TYR A O    4  
ATOM   8241  C  CB   . TYR A 1 109 ? 16.504  1.092   -2.443  1.00 0.00 ? 264 TYR A CB   4  
ATOM   8242  C  CG   . TYR A 1 109 ? 17.670  0.947   -1.496  1.00 0.00 ? 264 TYR A CG   4  
ATOM   8243  C  CD1  . TYR A 1 109 ? 17.447  0.568   -0.166  1.00 0.00 ? 264 TYR A CD1  4  
ATOM   8244  C  CD2  . TYR A 1 109 ? 18.971  1.182   -1.949  1.00 0.00 ? 264 TYR A CD2  4  
ATOM   8245  C  CE1  . TYR A 1 109 ? 18.529  0.426   0.711   1.00 0.00 ? 264 TYR A CE1  4  
ATOM   8246  C  CE2  . TYR A 1 109 ? 20.053  1.040   -1.073  1.00 0.00 ? 264 TYR A CE2  4  
ATOM   8247  C  CZ   . TYR A 1 109 ? 19.832  0.663   0.258   1.00 0.00 ? 264 TYR A CZ   4  
ATOM   8248  O  OH   . TYR A 1 109 ? 20.900  0.523   1.121   1.00 0.00 ? 264 TYR A OH   4  
ATOM   8249  H  H    . TYR A 1 109 ? 16.897  0.336   -4.898  1.00 0.00 ? 264 TYR A H    4  
ATOM   8250  H  HA   . TYR A 1 109 ? 16.452  -1.068  -2.296  1.00 0.00 ? 264 TYR A HA   4  
ATOM   8251  H  HB2  . TYR A 1 109 ? 16.781  1.736   -3.264  1.00 0.00 ? 264 TYR A HB2  4  
ATOM   8252  H  HB3  . TYR A 1 109 ? 15.664  1.518   -1.916  1.00 0.00 ? 264 TYR A HB3  4  
ATOM   8253  H  HD1  . TYR A 1 109 ? 16.442  0.384   0.183   1.00 0.00 ? 264 TYR A HD1  4  
ATOM   8254  H  HD2  . TYR A 1 109 ? 19.141  1.475   -2.975  1.00 0.00 ? 264 TYR A HD2  4  
ATOM   8255  H  HE1  . TYR A 1 109 ? 18.358  0.136   1.736   1.00 0.00 ? 264 TYR A HE1  4  
ATOM   8256  H  HE2  . TYR A 1 109 ? 21.057  1.217   -1.426  1.00 0.00 ? 264 TYR A HE2  4  
ATOM   8257  H  HH   . TYR A 1 109 ? 21.281  -0.347  0.982   1.00 0.00 ? 264 TYR A HH   4  
ATOM   8258  N  N    . CYS A 1 110 ? 13.850  -0.898  -2.286  1.00 0.00 ? 265 CYS A N    4  
ATOM   8259  C  CA   . CYS A 1 110 ? 12.392  -1.044  -2.553  1.00 0.00 ? 265 CYS A CA   4  
ATOM   8260  C  C    . CYS A 1 110 ? 11.547  -0.461  -1.394  1.00 0.00 ? 265 CYS A C    4  
ATOM   8261  O  O    . CYS A 1 110 ? 11.951  0.496   -0.760  1.00 0.00 ? 265 CYS A O    4  
ATOM   8262  C  CB   . CYS A 1 110 ? 12.207  -2.564  -2.764  1.00 0.00 ? 265 CYS A CB   4  
ATOM   8263  S  SG   . CYS A 1 110 ? 12.283  -3.465  -1.193  1.00 0.00 ? 265 CYS A SG   4  
ATOM   8264  H  H    . CYS A 1 110 ? 14.227  -1.193  -1.428  1.00 0.00 ? 265 CYS A H    4  
ATOM   8265  H  HA   . CYS A 1 110 ? 12.141  -0.529  -3.467  1.00 0.00 ? 265 CYS A HA   4  
ATOM   8266  H  HB2  . CYS A 1 110 ? 11.249  -2.743  -3.226  1.00 0.00 ? 265 CYS A HB2  4  
ATOM   8267  H  HB3  . CYS A 1 110 ? 12.988  -2.925  -3.420  1.00 0.00 ? 265 CYS A HB3  4  
ATOM   8268  N  N    . TYR A 1 111 ? 10.372  -1.004  -1.126  1.00 0.00 ? 266 TYR A N    4  
ATOM   8269  C  CA   . TYR A 1 111 ? 9.518   -0.437  -0.025  1.00 0.00 ? 266 TYR A CA   4  
ATOM   8270  C  C    . TYR A 1 111 ? 9.826   -1.139  1.314   1.00 0.00 ? 266 TYR A C    4  
ATOM   8271  O  O    . TYR A 1 111 ? 9.844   -0.506  2.353   1.00 0.00 ? 266 TYR A O    4  
ATOM   8272  C  CB   . TYR A 1 111 ? 8.054   -0.680  -0.450  1.00 0.00 ? 266 TYR A CB   4  
ATOM   8273  C  CG   . TYR A 1 111 ? 7.822   -0.147  -1.853  1.00 0.00 ? 266 TYR A CG   4  
ATOM   8274  C  CD1  . TYR A 1 111 ? 7.553   1.211   -2.053  1.00 0.00 ? 266 TYR A CD1  4  
ATOM   8275  C  CD2  . TYR A 1 111 ? 7.881   -1.015  -2.952  1.00 0.00 ? 266 TYR A CD2  4  
ATOM   8276  C  CE1  . TYR A 1 111 ? 7.343   1.702   -3.347  1.00 0.00 ? 266 TYR A CE1  4  
ATOM   8277  C  CE2  . TYR A 1 111 ? 7.671   -0.525  -4.246  1.00 0.00 ? 266 TYR A CE2  4  
ATOM   8278  C  CZ   . TYR A 1 111 ? 7.403   0.834   -4.444  1.00 0.00 ? 266 TYR A CZ   4  
ATOM   8279  O  OH   . TYR A 1 111 ? 7.195   1.318   -5.719  1.00 0.00 ? 266 TYR A OH   4  
ATOM   8280  H  H    . TYR A 1 111 ? 10.045  -1.766  -1.651  1.00 0.00 ? 266 TYR A H    4  
ATOM   8281  H  HA   . TYR A 1 111 ? 9.696   0.624   0.069   1.00 0.00 ? 266 TYR A HA   4  
ATOM   8282  H  HB2  . TYR A 1 111 ? 7.848   -1.740  -0.434  1.00 0.00 ? 266 TYR A HB2  4  
ATOM   8283  H  HB3  . TYR A 1 111 ? 7.392   -0.175  0.238   1.00 0.00 ? 266 TYR A HB3  4  
ATOM   8284  H  HD1  . TYR A 1 111 ? 7.508   1.879   -1.210  1.00 0.00 ? 266 TYR A HD1  4  
ATOM   8285  H  HD2  . TYR A 1 111 ? 8.088   -2.063  -2.800  1.00 0.00 ? 266 TYR A HD2  4  
ATOM   8286  H  HE1  . TYR A 1 111 ? 7.136   2.751   -3.500  1.00 0.00 ? 266 TYR A HE1  4  
ATOM   8287  H  HE2  . TYR A 1 111 ? 7.720   -1.195  -5.093  1.00 0.00 ? 266 TYR A HE2  4  
ATOM   8288  H  HH   . TYR A 1 111 ? 8.053   1.436   -6.135  1.00 0.00 ? 266 TYR A HH   4  
ATOM   8289  N  N    . ILE A 1 112 ? 10.080  -2.434  1.302   1.00 0.00 ? 267 ILE A N    4  
ATOM   8290  C  CA   . ILE A 1 112 ? 10.396  -3.148  2.596   1.00 0.00 ? 267 ILE A CA   4  
ATOM   8291  C  C    . ILE A 1 112 ? 11.701  -2.587  3.189   1.00 0.00 ? 267 ILE A C    4  
ATOM   8292  O  O    . ILE A 1 112 ? 11.782  -2.296  4.367   1.00 0.00 ? 267 ILE A O    4  
ATOM   8293  C  CB   . ILE A 1 112 ? 10.581  -4.650  2.266   1.00 0.00 ? 267 ILE A CB   4  
ATOM   8294  C  CG1  . ILE A 1 112 ? 9.320   -5.233  1.593   1.00 0.00 ? 267 ILE A CG1  4  
ATOM   8295  C  CG2  . ILE A 1 112 ? 10.843  -5.420  3.562   1.00 0.00 ? 267 ILE A CG2  4  
ATOM   8296  C  CD1  . ILE A 1 112 ? 8.083   -5.000  2.468   1.00 0.00 ? 267 ILE A CD1  4  
ATOM   8297  H  H    . ILE A 1 112 ? 10.067  -2.924  0.452   1.00 0.00 ? 267 ILE A H    4  
ATOM   8298  H  HA   . ILE A 1 112 ? 9.589   -3.021  3.295   1.00 0.00 ? 267 ILE A HA   4  
ATOM   8299  H  HB   . ILE A 1 112 ? 11.435  -4.769  1.605   1.00 0.00 ? 267 ILE A HB   4  
ATOM   8300  H  HG12 . ILE A 1 112 ? 9.168   -4.769  0.633   1.00 0.00 ? 267 ILE A HG12 4  
ATOM   8301  H  HG13 . ILE A 1 112 ? 9.455   -6.295  1.453   1.00 0.00 ? 267 ILE A HG13 4  
ATOM   8302  H  HG21 . ILE A 1 112 ? 10.118  -5.127  4.307   1.00 0.00 ? 267 ILE A HG21 4  
ATOM   8303  H  HG22 . ILE A 1 112 ? 11.837  -5.196  3.920   1.00 0.00 ? 267 ILE A HG22 4  
ATOM   8304  H  HG23 . ILE A 1 112 ? 10.757  -6.481  3.375   1.00 0.00 ? 267 ILE A HG23 4  
ATOM   8305  H  HD11 . ILE A 1 112 ? 7.574   -5.939  2.627   1.00 0.00 ? 267 ILE A HD11 4  
ATOM   8306  H  HD12 . ILE A 1 112 ? 7.418   -4.311  1.969   1.00 0.00 ? 267 ILE A HD12 4  
ATOM   8307  H  HD13 . ILE A 1 112 ? 8.382   -4.587  3.421   1.00 0.00 ? 267 ILE A HD13 4  
ATOM   8308  N  N    . CYS A 1 113 ? 12.724  -2.436  2.375   1.00 0.00 ? 268 CYS A N    4  
ATOM   8309  C  CA   . CYS A 1 113 ? 14.040  -1.897  2.876   1.00 0.00 ? 268 CYS A CA   4  
ATOM   8310  C  C    . CYS A 1 113 ? 13.827  -0.583  3.642   1.00 0.00 ? 268 CYS A C    4  
ATOM   8311  O  O    . CYS A 1 113 ? 14.328  -0.411  4.736   1.00 0.00 ? 268 CYS A O    4  
ATOM   8312  C  CB   . CYS A 1 113 ? 14.890  -1.633  1.622   1.00 0.00 ? 268 CYS A CB   4  
ATOM   8313  S  SG   . CYS A 1 113 ? 15.545  -3.197  0.989   1.00 0.00 ? 268 CYS A SG   4  
ATOM   8314  H  H    . CYS A 1 113 ? 12.626  -2.682  1.437   1.00 0.00 ? 268 CYS A H    4  
ATOM   8315  H  HA   . CYS A 1 113 ? 14.530  -2.623  3.504   1.00 0.00 ? 268 CYS A HA   4  
ATOM   8316  H  HB2  . CYS A 1 113 ? 14.278  -1.168  0.863   1.00 0.00 ? 268 CYS A HB2  4  
ATOM   8317  H  HB3  . CYS A 1 113 ? 15.707  -0.977  1.875   1.00 0.00 ? 268 CYS A HB3  4  
ATOM   8318  N  N    . HIS A 1 114 ? 13.079  0.344   3.078   1.00 0.00 ? 269 HIS A N    4  
ATOM   8319  C  CA   . HIS A 1 114 ? 12.830  1.646   3.785   1.00 0.00 ? 269 HIS A CA   4  
ATOM   8320  C  C    . HIS A 1 114 ? 11.836  2.520   3.000   1.00 0.00 ? 269 HIS A C    4  
ATOM   8321  O  O    . HIS A 1 114 ? 11.648  2.324   1.816   1.00 0.00 ? 269 HIS A O    4  
ATOM   8322  C  CB   . HIS A 1 114 ? 14.195  2.345   3.906   1.00 0.00 ? 269 HIS A CB   4  
ATOM   8323  C  CG   . HIS A 1 114 ? 14.875  2.486   2.563   1.00 0.00 ? 269 HIS A CG   4  
ATOM   8324  N  ND1  . HIS A 1 114 ? 16.119  3.090   2.447   1.00 0.00 ? 269 HIS A ND1  4  
ATOM   8325  C  CD2  . HIS A 1 114 ? 14.524  2.119   1.281   1.00 0.00 ? 269 HIS A CD2  4  
ATOM   8326  C  CE1  . HIS A 1 114 ? 16.465  3.072   1.150   1.00 0.00 ? 269 HIS A CE1  4  
ATOM   8327  N  NE2  . HIS A 1 114 ? 15.529  2.492   0.395   1.00 0.00 ? 269 HIS A NE2  4  
ATOM   8328  H  H    . HIS A 1 114 ? 12.672  0.179   2.198   1.00 0.00 ? 269 HIS A H    4  
ATOM   8329  H  HA   . HIS A 1 114 ? 12.439  1.452   4.772   1.00 0.00 ? 269 HIS A HA   4  
ATOM   8330  H  HB2  . HIS A 1 114 ? 14.050  3.327   4.330   1.00 0.00 ? 269 HIS A HB2  4  
ATOM   8331  H  HB3  . HIS A 1 114 ? 14.828  1.768   4.565   1.00 0.00 ? 269 HIS A HB3  4  
ATOM   8332  H  HD1  . HIS A 1 114 ? 16.649  3.464   3.182   1.00 0.00 ? 269 HIS A HD1  4  
ATOM   8333  H  HD2  . HIS A 1 114 ? 13.615  1.615   0.998   1.00 0.00 ? 269 HIS A HD2  4  
ATOM   8334  H  HE1  . HIS A 1 114 ? 17.390  3.472   0.764   1.00 0.00 ? 269 HIS A HE1  4  
ATOM   8335  N  N    . PRO A 1 115 ? 11.219  3.459   3.688   1.00 0.00 ? 270 PRO A N    4  
ATOM   8336  C  CA   . PRO A 1 115 ? 10.233  4.349   3.025   1.00 0.00 ? 270 PRO A CA   4  
ATOM   8337  C  C    . PRO A 1 115 ? 10.942  5.306   2.054   1.00 0.00 ? 270 PRO A C    4  
ATOM   8338  O  O    . PRO A 1 115 ? 11.060  6.488   2.321   1.00 0.00 ? 270 PRO A O    4  
ATOM   8339  C  CB   . PRO A 1 115 ? 9.597   5.113   4.185   1.00 0.00 ? 270 PRO A CB   4  
ATOM   8340  C  CG   . PRO A 1 115 ? 10.619  5.078   5.275   1.00 0.00 ? 270 PRO A CG   4  
ATOM   8341  C  CD   . PRO A 1 115 ? 11.373  3.786   5.117   1.00 0.00 ? 270 PRO A CD   4  
ATOM   8342  H  HA   . PRO A 1 115 ? 9.485   3.770   2.512   1.00 0.00 ? 270 PRO A HA   4  
ATOM   8343  H  HB2  . PRO A 1 115 ? 9.389   6.134   3.893   1.00 0.00 ? 270 PRO A HB2  4  
ATOM   8344  H  HB3  . PRO A 1 115 ? 8.693   4.621   4.511   1.00 0.00 ? 270 PRO A HB3  4  
ATOM   8345  H  HG2  . PRO A 1 115 ? 11.293  5.919   5.175   1.00 0.00 ? 270 PRO A HG2  4  
ATOM   8346  H  HG3  . PRO A 1 115 ? 10.135  5.102   6.238   1.00 0.00 ? 270 PRO A HG3  4  
ATOM   8347  H  HD2  . PRO A 1 115 ? 12.417  3.924   5.367   1.00 0.00 ? 270 PRO A HD2  4  
ATOM   8348  H  HD3  . PRO A 1 115 ? 10.934  3.011   5.725   1.00 0.00 ? 270 PRO A HD3  4  
ATOM   8349  N  N    . GLU A 1 116 ? 11.418  4.808   0.929   1.00 0.00 ? 271 GLU A N    4  
ATOM   8350  C  CA   . GLU A 1 116 ? 12.117  5.707   -0.042  1.00 0.00 ? 271 GLU A CA   4  
ATOM   8351  C  C    . GLU A 1 116 ? 11.217  6.030   -1.251  1.00 0.00 ? 271 GLU A C    4  
ATOM   8352  O  O    . GLU A 1 116 ? 10.944  7.189   -1.492  1.00 0.00 ? 271 GLU A O    4  
ATOM   8353  C  CB   . GLU A 1 116 ? 13.393  4.965   -0.470  1.00 0.00 ? 271 GLU A CB   4  
ATOM   8354  C  CG   . GLU A 1 116 ? 14.615  5.602   0.201   1.00 0.00 ? 271 GLU A CG   4  
ATOM   8355  C  CD   . GLU A 1 116 ? 14.785  7.038   -0.299  1.00 0.00 ? 271 GLU A CD   4  
ATOM   8356  O  OE1  . GLU A 1 116 ? 14.866  7.220   -1.502  1.00 0.00 ? 271 GLU A OE1  4  
ATOM   8357  O  OE2  . GLU A 1 116 ? 14.831  7.932   0.531   1.00 0.00 ? 271 GLU A OE2  4  
ATOM   8358  H  H    . GLU A 1 116 ? 11.318  3.853   0.729   1.00 0.00 ? 271 GLU A H    4  
ATOM   8359  H  HA   . GLU A 1 116 ? 12.386  6.626   0.455   1.00 0.00 ? 271 GLU A HA   4  
ATOM   8360  H  HB2  . GLU A 1 116 ? 13.322  3.927   -0.176  1.00 0.00 ? 271 GLU A HB2  4  
ATOM   8361  H  HB3  . GLU A 1 116 ? 13.501  5.028   -1.541  1.00 0.00 ? 271 GLU A HB3  4  
ATOM   8362  H  HG2  . GLU A 1 116 ? 14.476  5.606   1.273   1.00 0.00 ? 271 GLU A HG2  4  
ATOM   8363  H  HG3  . GLU A 1 116 ? 15.498  5.032   -0.045  1.00 0.00 ? 271 GLU A HG3  4  
ATOM   8364  N  N    . PRO A 1 117 ? 10.770  5.022   -1.990  1.00 0.00 ? 272 PRO A N    4  
ATOM   8365  C  CA   . PRO A 1 117 ? 9.905   5.294   -3.163  1.00 0.00 ? 272 PRO A CA   4  
ATOM   8366  C  C    . PRO A 1 117 ? 8.397   5.308   -2.819  1.00 0.00 ? 272 PRO A C    4  
ATOM   8367  O  O    . PRO A 1 117 ? 7.583   4.993   -3.668  1.00 0.00 ? 272 PRO A O    4  
ATOM   8368  C  CB   . PRO A 1 117 ? 10.206  4.123   -4.089  1.00 0.00 ? 272 PRO A CB   4  
ATOM   8369  C  CG   . PRO A 1 117 ? 10.662  3.002   -3.199  1.00 0.00 ? 272 PRO A CG   4  
ATOM   8370  C  CD   . PRO A 1 117 ? 11.023  3.581   -1.850  1.00 0.00 ? 272 PRO A CD   4  
ATOM   8371  H  HA   . PRO A 1 117 ? 10.195  6.213   -3.635  1.00 0.00 ? 272 PRO A HA   4  
ATOM   8372  H  HB2  . PRO A 1 117 ? 9.312   3.836   -4.627  1.00 0.00 ? 272 PRO A HB2  4  
ATOM   8373  H  HB3  . PRO A 1 117 ? 10.990  4.385   -4.782  1.00 0.00 ? 272 PRO A HB3  4  
ATOM   8374  H  HG2  . PRO A 1 117 ? 9.866   2.280   -3.086  1.00 0.00 ? 272 PRO A HG2  4  
ATOM   8375  H  HG3  . PRO A 1 117 ? 11.529  2.526   -3.630  1.00 0.00 ? 272 PRO A HG3  4  
ATOM   8376  H  HD2  . PRO A 1 117 ? 10.396  3.155   -1.081  1.00 0.00 ? 272 PRO A HD2  4  
ATOM   8377  H  HD3  . PRO A 1 117 ? 12.057  3.396   -1.639  1.00 0.00 ? 272 PRO A HD3  4  
ATOM   8378  N  N    . LEU A 1 118 ? 7.999   5.670   -1.613  1.00 0.00 ? 273 LEU A N    4  
ATOM   8379  C  CA   . LEU A 1 118 ? 6.532   5.693   -1.293  1.00 0.00 ? 273 LEU A CA   4  
ATOM   8380  C  C    . LEU A 1 118 ? 6.220   6.670   -0.140  1.00 0.00 ? 273 LEU A C    4  
ATOM   8381  O  O    . LEU A 1 118 ? 5.338   6.415   0.660   1.00 0.00 ? 273 LEU A O    4  
ATOM   8382  C  CB   . LEU A 1 118 ? 6.161   4.242   -0.919  1.00 0.00 ? 273 LEU A CB   4  
ATOM   8383  C  CG   . LEU A 1 118 ? 6.725   3.845   0.459   1.00 0.00 ? 273 LEU A CG   4  
ATOM   8384  C  CD1  . LEU A 1 118 ? 6.073   2.537   0.916   1.00 0.00 ? 273 LEU A CD1  4  
ATOM   8385  C  CD2  . LEU A 1 118 ? 8.241   3.657   0.362   1.00 0.00 ? 273 LEU A CD2  4  
ATOM   8386  H  H    . LEU A 1 118 ? 8.649   5.931   -0.932  1.00 0.00 ? 273 LEU A H    4  
ATOM   8387  H  HA   . LEU A 1 118 ? 5.977   5.986   -2.171  1.00 0.00 ? 273 LEU A HA   4  
ATOM   8388  H  HB2  . LEU A 1 118 ? 5.086   4.146   -0.899  1.00 0.00 ? 273 LEU A HB2  4  
ATOM   8389  H  HB3  . LEU A 1 118 ? 6.558   3.573   -1.668  1.00 0.00 ? 273 LEU A HB3  4  
ATOM   8390  H  HG   . LEU A 1 118 ? 6.504   4.616   1.180   1.00 0.00 ? 273 LEU A HG   4  
ATOM   8391  H  HD11 . LEU A 1 118 ? 6.023   1.849   0.087   1.00 0.00 ? 273 LEU A HD11 4  
ATOM   8392  H  HD12 . LEU A 1 118 ? 5.075   2.739   1.275   1.00 0.00 ? 273 LEU A HD12 4  
ATOM   8393  H  HD13 . LEU A 1 118 ? 6.659   2.101   1.711   1.00 0.00 ? 273 LEU A HD13 4  
ATOM   8394  H  HD21 . LEU A 1 118 ? 8.734   4.544   0.733   1.00 0.00 ? 273 LEU A HD21 4  
ATOM   8395  H  HD22 . LEU A 1 118 ? 8.517   3.498   -0.669  1.00 0.00 ? 273 LEU A HD22 4  
ATOM   8396  H  HD23 . LEU A 1 118 ? 8.541   2.804   0.952   1.00 0.00 ? 273 LEU A HD23 4  
ATOM   8397  N  N    . LEU A 1 119 ? 6.918   7.786   -0.046  1.00 0.00 ? 274 LEU A N    4  
ATOM   8398  C  CA   . LEU A 1 119 ? 6.618   8.750   1.077   1.00 0.00 ? 274 LEU A CA   4  
ATOM   8399  C  C    . LEU A 1 119 ? 5.154   9.196   0.990   1.00 0.00 ? 274 LEU A C    4  
ATOM   8400  O  O    . LEU A 1 119 ? 4.436   9.162   1.970   1.00 0.00 ? 274 LEU A O    4  
ATOM   8401  C  CB   . LEU A 1 119 ? 7.563   9.966   0.928   1.00 0.00 ? 274 LEU A CB   4  
ATOM   8402  C  CG   . LEU A 1 119 ? 8.470   10.084  2.163   1.00 0.00 ? 274 LEU A CG   4  
ATOM   8403  C  CD1  . LEU A 1 119 ? 7.615   10.265  3.423   1.00 0.00 ? 274 LEU A CD1  4  
ATOM   8404  C  CD2  . LEU A 1 119 ? 9.321   8.816   2.301   1.00 0.00 ? 274 LEU A CD2  4  
ATOM   8405  H  H    . LEU A 1 119 ? 7.621   7.984   -0.705  1.00 0.00 ? 274 LEU A H    4  
ATOM   8406  H  HA   . LEU A 1 119 ? 6.789   8.267   2.023   1.00 0.00 ? 274 LEU A HA   4  
ATOM   8407  H  HB2  . LEU A 1 119 ? 8.175   9.849   0.048   1.00 0.00 ? 274 LEU A HB2  4  
ATOM   8408  H  HB3  . LEU A 1 119 ? 6.976   10.867  0.833   1.00 0.00 ? 274 LEU A HB3  4  
ATOM   8409  H  HG   . LEU A 1 119 ? 9.118   10.941  2.047   1.00 0.00 ? 274 LEU A HG   4  
ATOM   8410  H  HD11 . LEU A 1 119 ? 6.753   10.875  3.191   1.00 0.00 ? 274 LEU A HD11 4  
ATOM   8411  H  HD12 . LEU A 1 119 ? 8.201   10.750  4.190   1.00 0.00 ? 274 LEU A HD12 4  
ATOM   8412  H  HD13 . LEU A 1 119 ? 7.287   9.299   3.779   1.00 0.00 ? 274 LEU A HD13 4  
ATOM   8413  H  HD21 . LEU A 1 119 ? 10.276  9.070   2.737   1.00 0.00 ? 274 LEU A HD21 4  
ATOM   8414  H  HD22 . LEU A 1 119 ? 9.475   8.378   1.325   1.00 0.00 ? 274 LEU A HD22 4  
ATOM   8415  H  HD23 . LEU A 1 119 ? 8.811   8.107   2.938   1.00 0.00 ? 274 LEU A HD23 4  
ATOM   8416  N  N    . ASP A 1 120 ? 4.696   9.594   -0.179  1.00 0.00 ? 275 ASP A N    4  
ATOM   8417  C  CA   . ASP A 1 120 ? 3.254   10.023  -0.309  1.00 0.00 ? 275 ASP A CA   4  
ATOM   8418  C  C    . ASP A 1 120 ? 2.320   8.904   0.191   1.00 0.00 ? 275 ASP A C    4  
ATOM   8419  O  O    . ASP A 1 120 ? 1.294   9.173   0.787   1.00 0.00 ? 275 ASP A O    4  
ATOM   8420  C  CB   . ASP A 1 120 ? 3.000   10.308  -1.800  1.00 0.00 ? 275 ASP A CB   4  
ATOM   8421  C  CG   . ASP A 1 120 ? 3.292   9.054   -2.629  1.00 0.00 ? 275 ASP A CG   4  
ATOM   8422  O  OD1  . ASP A 1 120 ? 4.451   8.684   -2.719  1.00 0.00 ? 275 ASP A OD1  4  
ATOM   8423  O  OD2  . ASP A 1 120 ? 2.352   8.487   -3.159  1.00 0.00 ? 275 ASP A OD2  4  
ATOM   8424  H  H    . ASP A 1 120 ? 5.296   9.596   -0.962  1.00 0.00 ? 275 ASP A H    4  
ATOM   8425  H  HA   . ASP A 1 120 ? 3.088   10.918  0.267   1.00 0.00 ? 275 ASP A HA   4  
ATOM   8426  H  HB2  . ASP A 1 120 ? 1.969   10.598  -1.938  1.00 0.00 ? 275 ASP A HB2  4  
ATOM   8427  H  HB3  . ASP A 1 120 ? 3.645   11.111  -2.126  1.00 0.00 ? 275 ASP A HB3  4  
ATOM   8428  N  N    . LEU A 1 121 ? 2.674   7.653   -0.031  1.00 0.00 ? 276 LEU A N    4  
ATOM   8429  C  CA   . LEU A 1 121 ? 1.795   6.533   0.461   1.00 0.00 ? 276 LEU A CA   4  
ATOM   8430  C  C    . LEU A 1 121 ? 1.809   6.514   1.992   1.00 0.00 ? 276 LEU A C    4  
ATOM   8431  O  O    . LEU A 1 121 ? 0.770   6.480   2.625   1.00 0.00 ? 276 LEU A O    4  
ATOM   8432  C  CB   . LEU A 1 121 ? 2.382   5.215   -0.084  1.00 0.00 ? 276 LEU A CB   4  
ATOM   8433  C  CG   . LEU A 1 121 ? 1.641   4.792   -1.352  1.00 0.00 ? 276 LEU A CG   4  
ATOM   8434  C  CD1  . LEU A 1 121 ? 1.992   5.745   -2.496  1.00 0.00 ? 276 LEU A CD1  4  
ATOM   8435  C  CD2  . LEU A 1 121 ? 2.062   3.368   -1.729  1.00 0.00 ? 276 LEU A CD2  4  
ATOM   8436  H  H    . LEU A 1 121 ? 3.516   7.458   -0.505  1.00 0.00 ? 276 LEU A H    4  
ATOM   8437  H  HA   . LEU A 1 121 ? 0.790   6.671   0.108   1.00 0.00 ? 276 LEU A HA   4  
ATOM   8438  H  HB2  . LEU A 1 121 ? 3.429   5.350   -0.310  1.00 0.00 ? 276 LEU A HB2  4  
ATOM   8439  H  HB3  . LEU A 1 121 ? 2.277   4.445   0.663   1.00 0.00 ? 276 LEU A HB3  4  
ATOM   8440  H  HG   . LEU A 1 121 ? 0.575   4.820   -1.174  1.00 0.00 ? 276 LEU A HG   4  
ATOM   8441  H  HD11 . LEU A 1 121 ? 1.990   5.202   -3.430  1.00 0.00 ? 276 LEU A HD11 4  
ATOM   8442  H  HD12 . LEU A 1 121 ? 2.971   6.167   -2.325  1.00 0.00 ? 276 LEU A HD12 4  
ATOM   8443  H  HD13 . LEU A 1 121 ? 1.261   6.539   -2.540  1.00 0.00 ? 276 LEU A HD13 4  
ATOM   8444  H  HD21 . LEU A 1 121 ? 1.378   2.660   -1.285  1.00 0.00 ? 276 LEU A HD21 4  
ATOM   8445  H  HD22 . LEU A 1 121 ? 3.060   3.178   -1.364  1.00 0.00 ? 276 LEU A HD22 4  
ATOM   8446  H  HD23 . LEU A 1 121 ? 2.045   3.259   -2.804  1.00 0.00 ? 276 LEU A HD23 4  
ATOM   8447  N  N    . VAL A 1 122 ? 2.977   6.550   2.594   1.00 0.00 ? 277 VAL A N    4  
ATOM   8448  C  CA   . VAL A 1 122 ? 3.038   6.548   4.097   1.00 0.00 ? 277 VAL A CA   4  
ATOM   8449  C  C    . VAL A 1 122 ? 2.503   7.884   4.631   1.00 0.00 ? 277 VAL A C    4  
ATOM   8450  O  O    . VAL A 1 122 ? 1.797   7.916   5.621   1.00 0.00 ? 277 VAL A O    4  
ATOM   8451  C  CB   . VAL A 1 122 ? 4.512   6.352   4.481   1.00 0.00 ? 277 VAL A CB   4  
ATOM   8452  C  CG1  . VAL A 1 122 ? 4.648   6.319   6.006   1.00 0.00 ? 277 VAL A CG1  4  
ATOM   8453  C  CG2  . VAL A 1 122 ? 5.013   5.026   3.892   1.00 0.00 ? 277 VAL A CG2  4  
ATOM   8454  H  H    . VAL A 1 122 ? 3.804   6.590   2.059   1.00 0.00 ? 277 VAL A H    4  
ATOM   8455  H  HA   . VAL A 1 122 ? 2.447   5.738   4.486   1.00 0.00 ? 277 VAL A HA   4  
ATOM   8456  H  HB   . VAL A 1 122 ? 5.099   7.168   4.086   1.00 0.00 ? 277 VAL A HB   4  
ATOM   8457  H  HG11 . VAL A 1 122 ? 4.847   7.316   6.371   1.00 0.00 ? 277 VAL A HG11 4  
ATOM   8458  H  HG12 . VAL A 1 122 ? 5.463   5.666   6.281   1.00 0.00 ? 277 VAL A HG12 4  
ATOM   8459  H  HG13 . VAL A 1 122 ? 3.730   5.952   6.441   1.00 0.00 ? 277 VAL A HG13 4  
ATOM   8460  H  HG21 . VAL A 1 122 ? 5.547   5.220   2.974   1.00 0.00 ? 277 VAL A HG21 4  
ATOM   8461  H  HG22 . VAL A 1 122 ? 4.170   4.379   3.688   1.00 0.00 ? 277 VAL A HG22 4  
ATOM   8462  H  HG23 . VAL A 1 122 ? 5.674   4.543   4.598   1.00 0.00 ? 277 VAL A HG23 4  
ATOM   8463  N  N    . THR A 1 123 ? 2.813   8.986   3.976   1.00 0.00 ? 278 THR A N    4  
ATOM   8464  C  CA   . THR A 1 123 ? 2.282   10.308  4.461   1.00 0.00 ? 278 THR A CA   4  
ATOM   8465  C  C    . THR A 1 123 ? 0.744   10.300  4.396   1.00 0.00 ? 278 THR A C    4  
ATOM   8466  O  O    . THR A 1 123 ? 0.088   10.870  5.247   1.00 0.00 ? 278 THR A O    4  
ATOM   8467  C  CB   . THR A 1 123 ? 2.854   11.399  3.531   1.00 0.00 ? 278 THR A CB   4  
ATOM   8468  O  OG1  . THR A 1 123 ? 4.234   11.134  3.253   1.00 0.00 ? 278 THR A OG1  4  
ATOM   8469  C  CG2  . THR A 1 123 ? 2.711   12.772  4.198   1.00 0.00 ? 278 THR A CG2  4  
ATOM   8470  H  H    . THR A 1 123 ? 3.373   8.939   3.166   1.00 0.00 ? 278 THR A H    4  
ATOM   8471  H  HA   . THR A 1 123 ? 2.606   10.485  5.476   1.00 0.00 ? 278 THR A HA   4  
ATOM   8472  H  HB   . THR A 1 123 ? 2.300   11.400  2.604   1.00 0.00 ? 278 THR A HB   4  
ATOM   8473  H  HG1  . THR A 1 123 ? 4.730   11.122  4.080   1.00 0.00 ? 278 THR A HG1  4  
ATOM   8474  H  HG21 . THR A 1 123 ? 3.659   13.062  4.628   1.00 0.00 ? 278 THR A HG21 4  
ATOM   8475  H  HG22 . THR A 1 123 ? 1.964   12.721  4.977   1.00 0.00 ? 278 THR A HG22 4  
ATOM   8476  H  HG23 . THR A 1 123 ? 2.413   13.501  3.460   1.00 0.00 ? 278 THR A HG23 4  
ATOM   8477  N  N    . ALA A 1 124 ? 0.157   9.643   3.406   1.00 0.00 ? 279 ALA A N    4  
ATOM   8478  C  CA   . ALA A 1 124 ? -1.348  9.603   3.335   1.00 0.00 ? 279 ALA A CA   4  
ATOM   8479  C  C    . ALA A 1 124 ? -1.910  8.590   4.353   1.00 0.00 ? 279 ALA A C    4  
ATOM   8480  O  O    . ALA A 1 124 ? -3.019  8.746   4.828   1.00 0.00 ? 279 ALA A O    4  
ATOM   8481  C  CB   . ALA A 1 124 ? -1.710  9.176   1.904   1.00 0.00 ? 279 ALA A CB   4  
ATOM   8482  H  H    . ALA A 1 124 ? 0.699   9.169   2.728   1.00 0.00 ? 279 ALA A H    4  
ATOM   8483  H  HA   . ALA A 1 124 ? -1.749  10.581  3.535   1.00 0.00 ? 279 ALA A HA   4  
ATOM   8484  H  HB1  . ALA A 1 124 ? -1.175  9.794   1.198   1.00 0.00 ? 279 ALA A HB1  4  
ATOM   8485  H  HB2  . ALA A 1 124 ? -2.772  9.293   1.751   1.00 0.00 ? 279 ALA A HB2  4  
ATOM   8486  H  HB3  . ALA A 1 124 ? -1.436  8.142   1.757   1.00 0.00 ? 279 ALA A HB3  4  
ATOM   8487  N  N    . CYS A 1 125 ? -1.163  7.552   4.697   1.00 0.00 ? 280 CYS A N    4  
ATOM   8488  C  CA   . CYS A 1 125 ? -1.690  6.546   5.690   1.00 0.00 ? 280 CYS A CA   4  
ATOM   8489  C  C    . CYS A 1 125 ? -2.046  7.246   7.010   1.00 0.00 ? 280 CYS A C    4  
ATOM   8490  O  O    . CYS A 1 125 ? -3.085  6.989   7.586   1.00 0.00 ? 280 CYS A O    4  
ATOM   8491  C  CB   . CYS A 1 125 ? -0.559  5.522   5.919   1.00 0.00 ? 280 CYS A CB   4  
ATOM   8492  S  SG   . CYS A 1 125 ? -1.105  4.235   7.073   1.00 0.00 ? 280 CYS A SG   4  
ATOM   8493  H  H    . CYS A 1 125 ? -0.270  7.438   4.304   1.00 0.00 ? 280 CYS A H    4  
ATOM   8494  H  HA   . CYS A 1 125 ? -2.560  6.051   5.290   1.00 0.00 ? 280 CYS A HA   4  
ATOM   8495  H  HB2  . CYS A 1 125 ? -0.292  5.067   4.977   1.00 0.00 ? 280 CYS A HB2  4  
ATOM   8496  H  HB3  . CYS A 1 125 ? 0.303   6.028   6.329   1.00 0.00 ? 280 CYS A HB3  4  
ATOM   8497  H  HG   . CYS A 1 125 ? -1.773  4.616   7.649   1.00 0.00 ? 280 CYS A HG   4  
ATOM   8498  N  N    . ASN A 1 126 ? -1.197  8.131   7.492   1.00 0.00 ? 281 ASN A N    4  
ATOM   8499  C  CA   . ASN A 1 126 ? -1.522  8.834   8.783   1.00 0.00 ? 281 ASN A CA   4  
ATOM   8500  C  C    . ASN A 1 126 ? -2.727  9.759   8.579   1.00 0.00 ? 281 ASN A C    4  
ATOM   8501  O  O    . ASN A 1 126 ? -3.601  9.834   9.423   1.00 0.00 ? 281 ASN A O    4  
ATOM   8502  C  CB   . ASN A 1 126 ? -0.280  9.650   9.176   1.00 0.00 ? 281 ASN A CB   4  
ATOM   8503  C  CG   . ASN A 1 126 ? 0.841   8.698   9.613   1.00 0.00 ? 281 ASN A CG   4  
ATOM   8504  O  OD1  . ASN A 1 126 ? 0.731   8.046   10.633  1.00 0.00 ? 281 ASN A OD1  4  
ATOM   8505  N  ND2  . ASN A 1 126 ? 1.924   8.585   8.884   1.00 0.00 ? 281 ASN A ND2  4  
ATOM   8506  H  H    . ASN A 1 126 ? -0.359  8.330   7.006   1.00 0.00 ? 281 ASN A H    4  
ATOM   8507  H  HA   . ASN A 1 126 ? -1.746  8.111   9.546   1.00 0.00 ? 281 ASN A HA   4  
ATOM   8508  H  HB2  . ASN A 1 126 ? 0.051   10.233  8.328   1.00 0.00 ? 281 ASN A HB2  4  
ATOM   8509  H  HB3  . ASN A 1 126 ? -0.527  10.311  9.993   1.00 0.00 ? 281 ASN A HB3  4  
ATOM   8510  H  HD21 . ASN A 1 126 ? 2.025   9.107   8.058   1.00 0.00 ? 281 ASN A HD21 4  
ATOM   8511  H  HD22 . ASN A 1 126 ? 2.639   7.977   9.165   1.00 0.00 ? 281 ASN A HD22 4  
ATOM   8512  N  N    . SER A 1 127 ? -2.794  10.452  7.463   1.00 0.00 ? 282 SER A N    4  
ATOM   8513  C  CA   . SER A 1 127 ? -3.971  11.360  7.224   1.00 0.00 ? 282 SER A CA   4  
ATOM   8514  C  C    . SER A 1 127 ? -5.240  10.528  6.987   1.00 0.00 ? 282 SER A C    4  
ATOM   8515  O  O    . SER A 1 127 ? -6.321  10.927  7.382   1.00 0.00 ? 282 SER A O    4  
ATOM   8516  C  CB   . SER A 1 127 ? -3.643  12.201  5.982   1.00 0.00 ? 282 SER A CB   4  
ATOM   8517  O  OG   . SER A 1 127 ? -4.615  13.230  5.842   1.00 0.00 ? 282 SER A OG   4  
ATOM   8518  H  H    . SER A 1 127 ? -2.081  10.368  6.787   1.00 0.00 ? 282 SER A H    4  
ATOM   8519  H  HA   . SER A 1 127 ? -4.113  12.001  8.075   1.00 0.00 ? 282 SER A HA   4  
ATOM   8520  H  HB2  . SER A 1 127 ? -2.669  12.647  6.093   1.00 0.00 ? 282 SER A HB2  4  
ATOM   8521  H  HB3  . SER A 1 127 ? -3.649  11.564  5.106   1.00 0.00 ? 282 SER A HB3  4  
ATOM   8522  H  HG   . SER A 1 127 ? -4.398  13.928  6.463   1.00 0.00 ? 282 SER A HG   4  
ATOM   8523  N  N    . VAL A 1 128 ? -5.130  9.372   6.358   1.00 0.00 ? 283 VAL A N    4  
ATOM   8524  C  CA   . VAL A 1 128 ? -6.360  8.539   6.128   1.00 0.00 ? 283 VAL A CA   4  
ATOM   8525  C  C    . VAL A 1 128 ? -6.750  7.826   7.423   1.00 0.00 ? 283 VAL A C    4  
ATOM   8526  O  O    . VAL A 1 128 ? -7.922  7.737   7.745   1.00 0.00 ? 283 VAL A O    4  
ATOM   8527  C  CB   . VAL A 1 128 ? -6.013  7.522   5.026   1.00 0.00 ? 283 VAL A CB   4  
ATOM   8528  C  CG1  . VAL A 1 128 ? -7.227  6.632   4.740   1.00 0.00 ? 283 VAL A CG1  4  
ATOM   8529  C  CG2  . VAL A 1 128 ? -5.622  8.270   3.749   1.00 0.00 ? 283 VAL A CG2  4  
ATOM   8530  H  H    . VAL A 1 128 ? -4.248  9.056   6.052   1.00 0.00 ? 283 VAL A H    4  
ATOM   8531  H  HA   . VAL A 1 128 ? -7.170  9.169   5.810   1.00 0.00 ? 283 VAL A HA   4  
ATOM   8532  H  HB   . VAL A 1 128 ? -5.187  6.907   5.352   1.00 0.00 ? 283 VAL A HB   4  
ATOM   8533  H  HG11 . VAL A 1 128 ? -7.472  6.062   5.625   1.00 0.00 ? 283 VAL A HG11 4  
ATOM   8534  H  HG12 . VAL A 1 128 ? -6.996  5.957   3.930   1.00 0.00 ? 283 VAL A HG12 4  
ATOM   8535  H  HG13 . VAL A 1 128 ? -8.069  7.249   4.465   1.00 0.00 ? 283 VAL A HG13 4  
ATOM   8536  H  HG21 . VAL A 1 128 ? -5.226  9.242   4.008   1.00 0.00 ? 283 VAL A HG21 4  
ATOM   8537  H  HG22 . VAL A 1 128 ? -6.493  8.392   3.123   1.00 0.00 ? 283 VAL A HG22 4  
ATOM   8538  H  HG23 . VAL A 1 128 ? -4.870  7.706   3.217   1.00 0.00 ? 283 VAL A HG23 4  
ATOM   8539  N  N    . PHE A 1 129 ? -5.794  7.339   8.185   1.00 0.00 ? 284 PHE A N    4  
ATOM   8540  C  CA   . PHE A 1 129 ? -6.172  6.668   9.472   1.00 0.00 ? 284 PHE A CA   4  
ATOM   8541  C  C    . PHE A 1 129 ? -6.519  7.739   10.516  1.00 0.00 ? 284 PHE A C    4  
ATOM   8542  O  O    . PHE A 1 129 ? -7.384  7.528   11.347  1.00 0.00 ? 284 PHE A O    4  
ATOM   8543  C  CB   . PHE A 1 129 ? -4.979  5.803   9.929   1.00 0.00 ? 284 PHE A CB   4  
ATOM   8544  C  CG   . PHE A 1 129 ? -5.388  4.345   9.909   1.00 0.00 ? 284 PHE A CG   4  
ATOM   8545  C  CD1  . PHE A 1 129 ? -6.530  3.930   10.607  1.00 0.00 ? 284 PHE A CD1  4  
ATOM   8546  C  CD2  . PHE A 1 129 ? -4.636  3.414   9.183   1.00 0.00 ? 284 PHE A CD2  4  
ATOM   8547  C  CE1  . PHE A 1 129 ? -6.920  2.587   10.578  1.00 0.00 ? 284 PHE A CE1  4  
ATOM   8548  C  CE2  . PHE A 1 129 ? -5.025  2.069   9.157   1.00 0.00 ? 284 PHE A CE2  4  
ATOM   8549  C  CZ   . PHE A 1 129 ? -6.168  1.656   9.853   1.00 0.00 ? 284 PHE A CZ   4  
ATOM   8550  H  H    . PHE A 1 129 ? -4.848  7.440   7.926   1.00 0.00 ? 284 PHE A H    4  
ATOM   8551  H  HA   . PHE A 1 129 ? -7.035  6.044   9.302   1.00 0.00 ? 284 PHE A HA   4  
ATOM   8552  H  HB2  . PHE A 1 129 ? -4.142  5.951   9.264   1.00 0.00 ? 284 PHE A HB2  4  
ATOM   8553  H  HB3  . PHE A 1 129 ? -4.696  6.082   10.933  1.00 0.00 ? 284 PHE A HB3  4  
ATOM   8554  H  HD1  . PHE A 1 129 ? -7.111  4.648   11.167  1.00 0.00 ? 284 PHE A HD1  4  
ATOM   8555  H  HD2  . PHE A 1 129 ? -3.755  3.732   8.645   1.00 0.00 ? 284 PHE A HD2  4  
ATOM   8556  H  HE1  . PHE A 1 129 ? -7.801  2.269   11.116  1.00 0.00 ? 284 PHE A HE1  4  
ATOM   8557  H  HE2  . PHE A 1 129 ? -4.446  1.350   8.597   1.00 0.00 ? 284 PHE A HE2  4  
ATOM   8558  H  HZ   . PHE A 1 129 ? -6.472  0.618   9.829   1.00 0.00 ? 284 PHE A HZ   4  
ATOM   8559  N  N    . GLU A 1 130 ? -5.888  8.904   10.468  1.00 0.00 ? 285 GLU A N    4  
ATOM   8560  C  CA   . GLU A 1 130 ? -6.252  9.980   11.459  1.00 0.00 ? 285 GLU A CA   4  
ATOM   8561  C  C    . GLU A 1 130 ? -7.739  10.323  11.292  1.00 0.00 ? 285 GLU A C    4  
ATOM   8562  O  O    . GLU A 1 130 ? -8.440  10.532  12.265  1.00 0.00 ? 285 GLU A O    4  
ATOM   8563  C  CB   . GLU A 1 130 ? -5.376  11.205  11.142  1.00 0.00 ? 285 GLU A CB   4  
ATOM   8564  C  CG   . GLU A 1 130 ? -5.688  12.330  12.132  1.00 0.00 ? 285 GLU A CG   4  
ATOM   8565  C  CD   . GLU A 1 130 ? -6.745  13.260  11.533  1.00 0.00 ? 285 GLU A CD   4  
ATOM   8566  O  OE1  . GLU A 1 130 ? -6.457  13.879  10.523  1.00 0.00 ? 285 GLU A OE1  4  
ATOM   8567  O  OE2  . GLU A 1 130 ? -7.825  13.337  12.096  1.00 0.00 ? 285 GLU A OE2  4  
ATOM   8568  H  H    . GLU A 1 130 ? -5.208  9.075   9.776   1.00 0.00 ? 285 GLU A H    4  
ATOM   8569  H  HA   . GLU A 1 130 ? -6.065  9.638   12.462  1.00 0.00 ? 285 GLU A HA   4  
ATOM   8570  H  HB2  . GLU A 1 130 ? -4.335  10.933  11.225  1.00 0.00 ? 285 GLU A HB2  4  
ATOM   8571  H  HB3  . GLU A 1 130 ? -5.582  11.545  10.138  1.00 0.00 ? 285 GLU A HB3  4  
ATOM   8572  H  HG2  . GLU A 1 130 ? -6.061  11.905  13.054  1.00 0.00 ? 285 GLU A HG2  4  
ATOM   8573  H  HG3  . GLU A 1 130 ? -4.789  12.893  12.333  1.00 0.00 ? 285 GLU A HG3  4  
ATOM   8574  N  N    . ASN A 1 131 ? -8.241  10.350  10.068  1.00 0.00 ? 286 ASN A N    4  
ATOM   8575  C  CA   . ASN A 1 131 ? -9.706  10.645  9.878   1.00 0.00 ? 286 ASN A CA   4  
ATOM   8576  C  C    . ASN A 1 131 ? -10.556 9.610   10.648  1.00 0.00 ? 286 ASN A C    4  
ATOM   8577  O  O    . ASN A 1 131 ? -11.660 9.904   11.064  1.00 0.00 ? 286 ASN A O    4  
ATOM   8578  C  CB   . ASN A 1 131 ? -9.991  10.544  8.370   1.00 0.00 ? 286 ASN A CB   4  
ATOM   8579  C  CG   . ASN A 1 131 ? -9.667  11.884  7.698   1.00 0.00 ? 286 ASN A CG   4  
ATOM   8580  O  OD1  . ASN A 1 131 ? -8.566  12.384  7.821   1.00 0.00 ? 286 ASN A OD1  4  
ATOM   8581  N  ND2  . ASN A 1 131 ? -10.581 12.496  6.985   1.00 0.00 ? 286 ASN A ND2  4  
ATOM   8582  H  H    . ASN A 1 131 ? -7.662  10.154  9.287   1.00 0.00 ? 286 ASN A H    4  
ATOM   8583  H  HA   . ASN A 1 131 ? -9.932  11.638  10.229  1.00 0.00 ? 286 ASN A HA   4  
ATOM   8584  H  HB2  . ASN A 1 131 ? -9.376  9.767   7.939   1.00 0.00 ? 286 ASN A HB2  4  
ATOM   8585  H  HB3  . ASN A 1 131 ? -11.032 10.309  8.215   1.00 0.00 ? 286 ASN A HB3  4  
ATOM   8586  H  HD21 . ASN A 1 131 ? -11.475 12.103  6.879   1.00 0.00 ? 286 ASN A HD21 4  
ATOM   8587  H  HD22 . ASN A 1 131 ? -10.372 13.352  6.556   1.00 0.00 ? 286 ASN A HD22 4  
ATOM   8588  N  N    . LEU A 1 132 ? -10.050 8.401   10.849  1.00 0.00 ? 287 LEU A N    4  
ATOM   8589  C  CA   . LEU A 1 132 ? -10.847 7.368   11.604  1.00 0.00 ? 287 LEU A CA   4  
ATOM   8590  C  C    . LEU A 1 132 ? -11.209 7.910   12.996  1.00 0.00 ? 287 LEU A C    4  
ATOM   8591  O  O    . LEU A 1 132 ? -12.320 7.734   13.461  1.00 0.00 ? 287 LEU A O    4  
ATOM   8592  C  CB   . LEU A 1 132 ? -9.936  6.130   11.746  1.00 0.00 ? 287 LEU A CB   4  
ATOM   8593  C  CG   . LEU A 1 132 ? -10.768 4.841   11.866  1.00 0.00 ? 287 LEU A CG   4  
ATOM   8594  C  CD1  . LEU A 1 132 ? -11.814 4.974   12.982  1.00 0.00 ? 287 LEU A CD1  4  
ATOM   8595  C  CD2  . LEU A 1 132 ? -11.469 4.564   10.534  1.00 0.00 ? 287 LEU A CD2  4  
ATOM   8596  H  H    . LEU A 1 132 ? -9.155  8.178   10.510  1.00 0.00 ? 287 LEU A H    4  
ATOM   8597  H  HA   . LEU A 1 132 ? -11.741 7.109   11.057  1.00 0.00 ? 287 LEU A HA   4  
ATOM   8598  H  HB2  . LEU A 1 132 ? -9.299  6.057   10.877  1.00 0.00 ? 287 LEU A HB2  4  
ATOM   8599  H  HB3  . LEU A 1 132 ? -9.322  6.244   12.625  1.00 0.00 ? 287 LEU A HB3  4  
ATOM   8600  H  HG   . LEU A 1 132 ? -10.109 4.017   12.099  1.00 0.00 ? 287 LEU A HG   4  
ATOM   8601  H  HD11 . LEU A 1 132 ? -12.693 5.469   12.595  1.00 0.00 ? 287 LEU A HD11 4  
ATOM   8602  H  HD12 . LEU A 1 132 ? -11.402 5.554   13.795  1.00 0.00 ? 287 LEU A HD12 4  
ATOM   8603  H  HD13 . LEU A 1 132 ? -12.084 3.993   13.343  1.00 0.00 ? 287 LEU A HD13 4  
ATOM   8604  H  HD21 . LEU A 1 132 ? -12.242 5.300   10.372  1.00 0.00 ? 287 LEU A HD21 4  
ATOM   8605  H  HD22 . LEU A 1 132 ? -11.909 3.577   10.557  1.00 0.00 ? 287 LEU A HD22 4  
ATOM   8606  H  HD23 . LEU A 1 132 ? -10.748 4.617   9.730   1.00 0.00 ? 287 LEU A HD23 4  
ATOM   8607  N  N    . GLU A 1 133 ? -10.281 8.569   13.665  1.00 0.00 ? 288 GLU A N    4  
ATOM   8608  C  CA   . GLU A 1 133 ? -10.602 9.117   15.033  1.00 0.00 ? 288 GLU A CA   4  
ATOM   8609  C  C    . GLU A 1 133 ? -11.730 10.150  14.925  1.00 0.00 ? 288 GLU A C    4  
ATOM   8610  O  O    . GLU A 1 133 ? -12.635 10.170  15.740  1.00 0.00 ? 288 GLU A O    4  
ATOM   8611  C  CB   . GLU A 1 133 ? -9.320  9.781   15.562  1.00 0.00 ? 288 GLU A CB   4  
ATOM   8612  C  CG   . GLU A 1 133 ? -8.483  8.746   16.316  1.00 0.00 ? 288 GLU A CG   4  
ATOM   8613  C  CD   . GLU A 1 133 ? -6.997  9.067   16.144  1.00 0.00 ? 288 GLU A CD   4  
ATOM   8614  O  OE1  . GLU A 1 133 ? -6.481  8.828   15.066  1.00 0.00 ? 288 GLU A OE1  4  
ATOM   8615  O  OE2  . GLU A 1 133 ? -6.401  9.547   17.095  1.00 0.00 ? 288 GLU A OE2  4  
ATOM   8616  H  H    . GLU A 1 133 ? -9.385  8.702   13.267  1.00 0.00 ? 288 GLU A H    4  
ATOM   8617  H  HA   . GLU A 1 133 ? -10.899 8.318   15.688  1.00 0.00 ? 288 GLU A HA   4  
ATOM   8618  H  HB2  . GLU A 1 133 ? -8.749  10.172  14.732  1.00 0.00 ? 288 GLU A HB2  4  
ATOM   8619  H  HB3  . GLU A 1 133 ? -9.583  10.586  16.231  1.00 0.00 ? 288 GLU A HB3  4  
ATOM   8620  H  HG2  . GLU A 1 133 ? -8.740  8.773   17.365  1.00 0.00 ? 288 GLU A HG2  4  
ATOM   8621  H  HG3  . GLU A 1 133 ? -8.684  7.761   15.920  1.00 0.00 ? 288 GLU A HG3  4  
ATOM   8622  N  N    . GLN A 1 134 ? -11.696 11.001  13.921  1.00 0.00 ? 289 GLN A N    4  
ATOM   8623  C  CA   . GLN A 1 134 ? -12.795 12.023  13.774  1.00 0.00 ? 289 GLN A CA   4  
ATOM   8624  C  C    . GLN A 1 134 ? -14.115 11.318  13.426  1.00 0.00 ? 289 GLN A C    4  
ATOM   8625  O  O    . GLN A 1 134 ? -15.165 11.705  13.902  1.00 0.00 ? 289 GLN A O    4  
ATOM   8626  C  CB   . GLN A 1 134 ? -12.377 12.966  12.635  1.00 0.00 ? 289 GLN A CB   4  
ATOM   8627  C  CG   . GLN A 1 134 ? -11.461 14.060  13.188  1.00 0.00 ? 289 GLN A CG   4  
ATOM   8628  C  CD   . GLN A 1 134 ? -12.308 15.248  13.661  1.00 0.00 ? 289 GLN A CD   4  
ATOM   8629  O  OE1  . GLN A 1 134 ? -12.621 16.128  12.883  1.00 0.00 ? 289 GLN A OE1  4  
ATOM   8630  N  NE2  . GLN A 1 134 ? -12.700 15.316  14.911  1.00 0.00 ? 289 GLN A NE2  4  
ATOM   8631  H  H    . GLN A 1 134 ? -10.959 10.959  13.267  1.00 0.00 ? 289 GLN A H    4  
ATOM   8632  H  HA   . GLN A 1 134 ? -12.905 12.579  14.692  1.00 0.00 ? 289 GLN A HA   4  
ATOM   8633  H  HB2  . GLN A 1 134 ? -11.851 12.405  11.877  1.00 0.00 ? 289 GLN A HB2  4  
ATOM   8634  H  HB3  . GLN A 1 134 ? -13.256 13.420  12.203  1.00 0.00 ? 289 GLN A HB3  4  
ATOM   8635  H  HG2  . GLN A 1 134 ? -10.894 13.668  14.020  1.00 0.00 ? 289 GLN A HG2  4  
ATOM   8636  H  HG3  . GLN A 1 134 ? -10.785 14.390  12.414  1.00 0.00 ? 289 GLN A HG3  4  
ATOM   8637  H  HE21 . GLN A 1 134 ? -12.455 14.611  15.548  1.00 0.00 ? 289 GLN A HE21 4  
ATOM   8638  H  HE22 . GLN A 1 134 ? -13.242 16.076  15.210  1.00 0.00 ? 289 GLN A HE22 4  
ATOM   8639  N  N    . LEU A 1 135 ? -14.076 10.281  12.610  1.00 0.00 ? 290 LEU A N    4  
ATOM   8640  C  CA   . LEU A 1 135 ? -15.354 9.563   12.260  1.00 0.00 ? 290 LEU A CA   4  
ATOM   8641  C  C    . LEU A 1 135 ? -15.874 8.790   13.483  1.00 0.00 ? 290 LEU A C    4  
ATOM   8642  O  O    . LEU A 1 135 ? -17.066 8.730   13.715  1.00 0.00 ? 290 LEU A O    4  
ATOM   8643  C  CB   . LEU A 1 135 ? -15.017 8.588   11.120  1.00 0.00 ? 290 LEU A CB   4  
ATOM   8644  C  CG   . LEU A 1 135 ? -16.295 7.892   10.640  1.00 0.00 ? 290 LEU A CG   4  
ATOM   8645  C  CD1  . LEU A 1 135 ? -16.829 8.602   9.394   1.00 0.00 ? 290 LEU A CD1  4  
ATOM   8646  C  CD2  . LEU A 1 135 ? -15.983 6.433   10.297  1.00 0.00 ? 290 LEU A CD2  4  
ATOM   8647  H  H    . LEU A 1 135 ? -13.215 9.975   12.239  1.00 0.00 ? 290 LEU A H    4  
ATOM   8648  H  HA   . LEU A 1 135 ? -16.095 10.269  11.933  1.00 0.00 ? 290 LEU A HA   4  
ATOM   8649  H  HB2  . LEU A 1 135 ? -14.574 9.137   10.300  1.00 0.00 ? 290 LEU A HB2  4  
ATOM   8650  H  HB3  . LEU A 1 135 ? -14.316 7.848   11.477  1.00 0.00 ? 290 LEU A HB3  4  
ATOM   8651  H  HG   . LEU A 1 135 ? -17.039 7.929   11.422  1.00 0.00 ? 290 LEU A HG   4  
ATOM   8652  H  HD11 . LEU A 1 135 ? -16.832 9.669   9.561   1.00 0.00 ? 290 LEU A HD11 4  
ATOM   8653  H  HD12 . LEU A 1 135 ? -17.836 8.266   9.192   1.00 0.00 ? 290 LEU A HD12 4  
ATOM   8654  H  HD13 . LEU A 1 135 ? -16.197 8.371   8.549   1.00 0.00 ? 290 LEU A HD13 4  
ATOM   8655  H  HD21 . LEU A 1 135 ? -16.622 6.109   9.489   1.00 0.00 ? 290 LEU A HD21 4  
ATOM   8656  H  HD22 . LEU A 1 135 ? -16.159 5.814   11.165  1.00 0.00 ? 290 LEU A HD22 4  
ATOM   8657  H  HD23 . LEU A 1 135 ? -14.949 6.346   9.997   1.00 0.00 ? 290 LEU A HD23 4  
ATOM   8658  N  N    . LEU A 1 136 ? -14.995 8.204   14.271  1.00 0.00 ? 291 LEU A N    4  
ATOM   8659  C  CA   . LEU A 1 136 ? -15.473 7.446   15.484  1.00 0.00 ? 291 LEU A CA   4  
ATOM   8660  C  C    . LEU A 1 136 ? -15.999 8.419   16.556  1.00 0.00 ? 291 LEU A C    4  
ATOM   8661  O  O    . LEU A 1 136 ? -16.910 8.088   17.293  1.00 0.00 ? 291 LEU A O    4  
ATOM   8662  C  CB   . LEU A 1 136 ? -14.262 6.668   16.025  1.00 0.00 ? 291 LEU A CB   4  
ATOM   8663  C  CG   . LEU A 1 136 ? -14.749 5.511   16.898  1.00 0.00 ? 291 LEU A CG   4  
ATOM   8664  C  CD1  . LEU A 1 136 ? -13.706 4.392   16.893  1.00 0.00 ? 291 LEU A CD1  4  
ATOM   8665  C  CD2  . LEU A 1 136 ? -14.955 6.007   18.332  1.00 0.00 ? 291 LEU A CD2  4  
ATOM   8666  H  H    . LEU A 1 136 ? -14.033 8.269   14.070  1.00 0.00 ? 291 LEU A H    4  
ATOM   8667  H  HA   . LEU A 1 136 ? -16.251 6.754   15.202  1.00 0.00 ? 291 LEU A HA   4  
ATOM   8668  H  HB2  . LEU A 1 136 ? -13.686 6.280   15.199  1.00 0.00 ? 291 LEU A HB2  4  
ATOM   8669  H  HB3  . LEU A 1 136 ? -13.645 7.328   16.617  1.00 0.00 ? 291 LEU A HB3  4  
ATOM   8670  H  HG   . LEU A 1 136 ? -15.683 5.133   16.508  1.00 0.00 ? 291 LEU A HG   4  
ATOM   8671  H  HD11 . LEU A 1 136 ? -12.774 4.766   17.288  1.00 0.00 ? 291 LEU A HD11 4  
ATOM   8672  H  HD12 . LEU A 1 136 ? -13.555 4.046   15.881  1.00 0.00 ? 291 LEU A HD12 4  
ATOM   8673  H  HD13 . LEU A 1 136 ? -14.054 3.573   17.505  1.00 0.00 ? 291 LEU A HD13 4  
ATOM   8674  H  HD21 . LEU A 1 136 ? -14.754 5.202   19.023  1.00 0.00 ? 291 LEU A HD21 4  
ATOM   8675  H  HD22 . LEU A 1 136 ? -15.975 6.340   18.454  1.00 0.00 ? 291 LEU A HD22 4  
ATOM   8676  H  HD23 . LEU A 1 136 ? -14.281 6.827   18.528  1.00 0.00 ? 291 LEU A HD23 4  
ATOM   8677  N  N    . GLN A 1 137 ? -15.443 9.613   16.657  1.00 0.00 ? 292 GLN A N    4  
ATOM   8678  C  CA   . GLN A 1 137 ? -15.937 10.583  17.694  1.00 0.00 ? 292 GLN A CA   4  
ATOM   8679  C  C    . GLN A 1 137 ? -16.972 11.558  17.097  1.00 0.00 ? 292 GLN A C    4  
ATOM   8680  O  O    . GLN A 1 137 ? -17.841 12.034  17.804  1.00 0.00 ? 292 GLN A O    4  
ATOM   8681  C  CB   . GLN A 1 137 ? -14.701 11.349  18.181  1.00 0.00 ? 292 GLN A CB   4  
ATOM   8682  C  CG   . GLN A 1 137 ? -13.862 10.443  19.085  1.00 0.00 ? 292 GLN A CG   4  
ATOM   8683  C  CD   . GLN A 1 137 ? -12.541 11.142  19.428  1.00 0.00 ? 292 GLN A CD   4  
ATOM   8684  O  OE1  . GLN A 1 137 ? -11.965 11.809  18.591  1.00 0.00 ? 292 GLN A OE1  4  
ATOM   8685  N  NE2  . GLN A 1 137 ? -12.028 11.020  20.628  1.00 0.00 ? 292 GLN A NE2  4  
ATOM   8686  H  H    . GLN A 1 137 ? -14.707 9.873   16.055  1.00 0.00 ? 292 GLN A H    4  
ATOM   8687  H  HA   . GLN A 1 137 ? -16.376 10.044  18.519  1.00 0.00 ? 292 GLN A HA   4  
ATOM   8688  H  HB2  . GLN A 1 137 ? -14.110 11.656  17.330  1.00 0.00 ? 292 GLN A HB2  4  
ATOM   8689  H  HB3  . GLN A 1 137 ? -15.012 12.220  18.737  1.00 0.00 ? 292 GLN A HB3  4  
ATOM   8690  H  HG2  . GLN A 1 137 ? -14.409 10.237  19.995  1.00 0.00 ? 292 GLN A HG2  4  
ATOM   8691  H  HG3  . GLN A 1 137 ? -13.654 9.515   18.573  1.00 0.00 ? 292 GLN A HG3  4  
ATOM   8692  H  HE21 . GLN A 1 137 ? -12.484 10.482  21.312  1.00 0.00 ? 292 GLN A HE21 4  
ATOM   8693  H  HE22 . GLN A 1 137 ? -11.183 11.467  20.843  1.00 0.00 ? 292 GLN A HE22 4  
ATOM   8694  N  N    . GLN A 1 138 ? -16.898 11.866  15.814  1.00 0.00 ? 293 GLN A N    4  
ATOM   8695  C  CA   . GLN A 1 138 ? -17.897 12.814  15.220  1.00 0.00 ? 293 GLN A CA   4  
ATOM   8696  C  C    . GLN A 1 138 ? -18.945 12.039  14.403  1.00 0.00 ? 293 GLN A C    4  
ATOM   8697  O  O    . GLN A 1 138 ? -19.071 12.231  13.208  1.00 0.00 ? 293 GLN A O    4  
ATOM   8698  C  CB   . GLN A 1 138 ? -17.090 13.755  14.316  1.00 0.00 ? 293 GLN A CB   4  
ATOM   8699  C  CG   . GLN A 1 138 ? -17.852 15.071  14.141  1.00 0.00 ? 293 GLN A CG   4  
ATOM   8700  C  CD   . GLN A 1 138 ? -18.789 14.964  12.932  1.00 0.00 ? 293 GLN A CD   4  
ATOM   8701  O  OE1  . GLN A 1 138 ? -18.334 14.870  11.809  1.00 0.00 ? 293 GLN A OE1  4  
ATOM   8702  N  NE2  . GLN A 1 138 ? -20.088 14.974  13.108  1.00 0.00 ? 293 GLN A NE2  4  
ATOM   8703  H  H    . GLN A 1 138 ? -16.196 11.479  15.245  1.00 0.00 ? 293 GLN A H    4  
ATOM   8704  H  HA   . GLN A 1 138 ? -18.379 13.382  16.000  1.00 0.00 ? 293 GLN A HA   4  
ATOM   8705  H  HB2  . GLN A 1 138 ? -16.129 13.951  14.768  1.00 0.00 ? 293 GLN A HB2  4  
ATOM   8706  H  HB3  . GLN A 1 138 ? -16.948 13.293  13.351  1.00 0.00 ? 293 GLN A HB3  4  
ATOM   8707  H  HG2  . GLN A 1 138 ? -18.431 15.271  15.031  1.00 0.00 ? 293 GLN A HG2  4  
ATOM   8708  H  HG3  . GLN A 1 138 ? -17.150 15.874  13.980  1.00 0.00 ? 293 GLN A HG3  4  
ATOM   8709  H  HE21 . GLN A 1 138 ? -20.468 15.051  14.011  1.00 0.00 ? 293 GLN A HE21 4  
ATOM   8710  H  HE22 . GLN A 1 138 ? -20.685 14.905  12.334  1.00 0.00 ? 293 GLN A HE22 4  
ATOM   8711  N  N    . ASN A 1 139 ? -19.703 11.167  15.039  1.00 0.00 ? 294 ASN A N    4  
ATOM   8712  C  CA   . ASN A 1 139 ? -20.741 10.393  14.292  1.00 0.00 ? 294 ASN A CA   4  
ATOM   8713  C  C    . ASN A 1 139 ? -22.098 10.494  15.011  1.00 0.00 ? 294 ASN A C    4  
ATOM   8714  O  O    . ASN A 1 139 ? -22.734 9.493   15.281  1.00 0.00 ? 294 ASN A O    4  
ATOM   8715  C  CB   . ASN A 1 139 ? -20.240 8.943   14.280  1.00 0.00 ? 294 ASN A CB   4  
ATOM   8716  C  CG   . ASN A 1 139 ? -20.062 8.426   15.717  1.00 0.00 ? 294 ASN A CG   4  
ATOM   8717  O  OD1  . ASN A 1 139 ? -20.405 9.105   16.666  1.00 0.00 ? 294 ASN A OD1  4  
ATOM   8718  N  ND2  . ASN A 1 139 ? -19.536 7.243   15.924  1.00 0.00 ? 294 ASN A ND2  4  
ATOM   8719  H  H    . ASN A 1 139 ? -19.594 11.025  16.006  1.00 0.00 ? 294 ASN A H    4  
ATOM   8720  H  HA   . ASN A 1 139 ? -20.826 10.760  13.281  1.00 0.00 ? 294 ASN A HA   4  
ATOM   8721  H  HB2  . ASN A 1 139 ? -20.959 8.322   13.763  1.00 0.00 ? 294 ASN A HB2  4  
ATOM   8722  H  HB3  . ASN A 1 139 ? -19.293 8.898   13.765  1.00 0.00 ? 294 ASN A HB3  4  
ATOM   8723  H  HD21 . ASN A 1 139 ? -19.256 6.684   15.167  1.00 0.00 ? 294 ASN A HD21 4  
ATOM   8724  H  HD22 . ASN A 1 139 ? -19.423 6.914   16.840  1.00 0.00 ? 294 ASN A HD22 4  
ATOM   8725  N  N    . LYS A 1 140 ? -22.547 11.694  15.322  1.00 0.00 ? 295 LYS A N    4  
ATOM   8726  C  CA   . LYS A 1 140 ? -23.859 11.844  16.021  1.00 0.00 ? 295 LYS A CA   4  
ATOM   8727  C  C    . LYS A 1 140 ? -24.845 12.623  15.136  1.00 0.00 ? 295 LYS A C    4  
ATOM   8728  O  O    . LYS A 1 140 ? -24.547 13.714  14.688  1.00 0.00 ? 295 LYS A O    4  
ATOM   8729  C  CB   . LYS A 1 140 ? -23.543 12.630  17.294  1.00 0.00 ? 295 LYS A CB   4  
ATOM   8730  C  CG   . LYS A 1 140 ? -24.398 12.101  18.447  1.00 0.00 ? 295 LYS A CG   4  
ATOM   8731  C  CD   . LYS A 1 140 ? -25.837 12.593  18.284  1.00 0.00 ? 295 LYS A CD   4  
ATOM   8732  C  CE   . LYS A 1 140 ? -26.755 11.811  19.225  1.00 0.00 ? 295 LYS A CE   4  
ATOM   8733  N  NZ   . LYS A 1 140 ? -26.989 10.509  18.541  1.00 0.00 ? 295 LYS A NZ   4  
ATOM   8734  H  H    . LYS A 1 140 ? -22.025 12.495  15.098  1.00 0.00 ? 295 LYS A H    4  
ATOM   8735  H  HA   . LYS A 1 140 ? -24.264 10.876  16.275  1.00 0.00 ? 295 LYS A HA   4  
ATOM   8736  H  HB2  . LYS A 1 140 ? -22.497 12.514  17.537  1.00 0.00 ? 295 LYS A HB2  4  
ATOM   8737  H  HB3  . LYS A 1 140 ? -23.763 13.675  17.135  1.00 0.00 ? 295 LYS A HB3  4  
ATOM   8738  H  HG2  . LYS A 1 140 ? -24.382 11.021  18.440  1.00 0.00 ? 295 LYS A HG2  4  
ATOM   8739  H  HG3  . LYS A 1 140 ? -24.001 12.462  19.384  1.00 0.00 ? 295 LYS A HG3  4  
ATOM   8740  H  HD2  . LYS A 1 140 ? -25.886 13.646  18.524  1.00 0.00 ? 295 LYS A HD2  4  
ATOM   8741  H  HD3  . LYS A 1 140 ? -26.156 12.441  17.264  1.00 0.00 ? 295 LYS A HD3  4  
ATOM   8742  H  HE2  . LYS A 1 140 ? -26.268 11.655  20.179  1.00 0.00 ? 295 LYS A HE2  4  
ATOM   8743  H  HE3  . LYS A 1 140 ? -27.690 12.332  19.359  1.00 0.00 ? 295 LYS A HE3  4  
ATOM   8744  H  HZ1  . LYS A 1 140 ? -26.093 9.987   18.471  1.00 0.00 ? 295 LYS A HZ1  4  
ATOM   8745  H  HZ2  . LYS A 1 140 ? -27.363 10.684  17.585  1.00 0.00 ? 295 LYS A HZ2  4  
ATOM   8746  H  HZ3  . LYS A 1 140 ? -27.674 9.948   19.085  1.00 0.00 ? 295 LYS A HZ3  4  
ATOM   8747  N  N    . LYS A 1 141 ? -26.016 12.075  14.878  1.00 0.00 ? 296 LYS A N    4  
ATOM   8748  C  CA   . LYS A 1 141 ? -27.007 12.794  14.023  1.00 0.00 ? 296 LYS A CA   4  
ATOM   8749  C  C    . LYS A 1 141 ? -28.321 12.990  14.784  1.00 0.00 ? 296 LYS A C    4  
ATOM   8750  O  O    . LYS A 1 141 ? -28.306 12.852  15.996  1.00 0.00 ? 296 LYS A O    4  
ATOM   8751  C  CB   . LYS A 1 141 ? -27.218 11.885  12.813  1.00 0.00 ? 296 LYS A CB   4  
ATOM   8752  C  CG   . LYS A 1 141 ? -27.855 12.686  11.675  1.00 0.00 ? 296 LYS A CG   4  
ATOM   8753  C  CD   . LYS A 1 141 ? -27.738 11.901  10.367  1.00 0.00 ? 296 LYS A CD   4  
ATOM   8754  C  CE   . LYS A 1 141 ? -28.971 12.164  9.500   1.00 0.00 ? 296 LYS A CE   4  
ATOM   8755  N  NZ   . LYS A 1 141 ? -28.494 12.016  8.098   1.00 0.00 ? 296 LYS A NZ   4  
ATOM   8756  O  OXT  . LYS A 1 141 ? -29.319 13.273  14.142  1.00 0.00 ? 296 LYS A OXT  4  
ATOM   8757  H  H    . LYS A 1 141 ? -26.245 11.193  15.246  1.00 0.00 ? 296 LYS A H    4  
ATOM   8758  H  HA   . LYS A 1 141 ? -26.610 13.745  13.704  1.00 0.00 ? 296 LYS A HA   4  
ATOM   8759  H  HB2  . LYS A 1 141 ? -26.266 11.490  12.487  1.00 0.00 ? 296 LYS A HB2  4  
ATOM   8760  H  HB3  . LYS A 1 141 ? -27.872 11.069  13.085  1.00 0.00 ? 296 LYS A HB3  4  
ATOM   8761  H  HG2  . LYS A 1 141 ? -28.898 12.862  11.899  1.00 0.00 ? 296 LYS A HG2  4  
ATOM   8762  H  HG3  . LYS A 1 141 ? -27.345 13.632  11.572  1.00 0.00 ? 296 LYS A HG3  4  
ATOM   8763  H  HD2  . LYS A 1 141 ? -26.850 12.216  9.837   1.00 0.00 ? 296 LYS A HD2  4  
ATOM   8764  H  HD3  . LYS A 1 141 ? -27.672 10.846  10.586  1.00 0.00 ? 296 LYS A HD3  4  
ATOM   8765  H  HE2  . LYS A 1 141 ? -29.744 11.438  9.717   1.00 0.00 ? 296 LYS A HE2  4  
ATOM   8766  H  HE3  . LYS A 1 141 ? -29.338 13.166  9.662   1.00 0.00 ? 296 LYS A HE3  4  
ATOM   8767  H  HZ1  . LYS A 1 141 ? -29.308 12.021  7.451   1.00 0.00 ? 296 LYS A HZ1  4  
ATOM   8768  H  HZ2  . LYS A 1 141 ? -27.978 11.117  8.001   1.00 0.00 ? 296 LYS A HZ2  4  
ATOM   8769  H  HZ3  . LYS A 1 141 ? -27.862 12.807  7.861   1.00 0.00 ? 296 LYS A HZ3  4  
HETATM 8770  ZN ZN   . ZN  B 2 .   ? -5.784  -3.772  -0.690  1.00 0.00 ? 1   ZN  A ZN   4  
HETATM 8771  ZN ZN   . ZN  C 2 .   ? 1.818   -6.364  -5.720  1.00 0.00 ? 2   ZN  A ZN   4  
HETATM 8772  ZN ZN   . ZN  D 2 .   ? 14.227  -4.434  -0.447  1.00 0.00 ? 3   ZN  A ZN   4  
ATOM   8773  N  N    . GLY A 1 1   ? -10.407 33.888  10.936  1.00 0.00 ? 156 GLY A N    5  
ATOM   8774  C  CA   . GLY A 1 1   ? -10.126 32.651  11.719  1.00 0.00 ? 156 GLY A CA   5  
ATOM   8775  C  C    . GLY A 1 1   ? -9.790  31.499  10.760  1.00 0.00 ? 156 GLY A C    5  
ATOM   8776  O  O    . GLY A 1 1   ? -10.577 30.589  10.582  1.00 0.00 ? 156 GLY A O    5  
ATOM   8777  H  H1   . GLY A 1 1   ? -10.194 34.723  11.517  1.00 0.00 ? 156 GLY A H1   5  
ATOM   8778  H  H2   . GLY A 1 1   ? -11.410 33.903  10.662  1.00 0.00 ? 156 GLY A H2   5  
ATOM   8779  H  H3   . GLY A 1 1   ? -9.813  33.902  10.083  1.00 0.00 ? 156 GLY A H3   5  
ATOM   8780  H  HA2  . GLY A 1 1   ? -9.288  32.827  12.380  1.00 0.00 ? 156 GLY A HA2  5  
ATOM   8781  H  HA3  . GLY A 1 1   ? -10.996 32.387  12.301  1.00 0.00 ? 156 GLY A HA3  5  
ATOM   8782  N  N    . ALA A 1 2   ? -8.625  31.525  10.136  1.00 0.00 ? 157 ALA A N    5  
ATOM   8783  C  CA   . ALA A 1 2   ? -8.242  30.427  9.187   1.00 0.00 ? 157 ALA A CA   5  
ATOM   8784  C  C    . ALA A 1 2   ? -9.340  30.210  8.130   1.00 0.00 ? 157 ALA A C    5  
ATOM   8785  O  O    . ALA A 1 2   ? -10.184 29.346  8.280   1.00 0.00 ? 157 ALA A O    5  
ATOM   8786  C  CB   . ALA A 1 2   ? -8.079  29.177  10.056  1.00 0.00 ? 157 ALA A CB   5  
ATOM   8787  H  H    . ALA A 1 2   ? -7.998  32.267  10.290  1.00 0.00 ? 157 ALA A H    5  
ATOM   8788  H  HA   . ALA A 1 2   ? -7.305  30.662  8.707   1.00 0.00 ? 157 ALA A HA   5  
ATOM   8789  H  HB1  . ALA A 1 2   ? -9.045  28.720  10.213  1.00 0.00 ? 157 ALA A HB1  5  
ATOM   8790  H  HB2  . ALA A 1 2   ? -7.653  29.454  11.009  1.00 0.00 ? 157 ALA A HB2  5  
ATOM   8791  H  HB3  . ALA A 1 2   ? -7.425  28.475  9.559   1.00 0.00 ? 157 ALA A HB3  5  
ATOM   8792  N  N    . MET A 1 3   ? -9.336  30.984  7.062   1.00 0.00 ? 158 MET A N    5  
ATOM   8793  C  CA   . MET A 1 3   ? -10.380 30.811  6.008   1.00 0.00 ? 158 MET A CA   5  
ATOM   8794  C  C    . MET A 1 3   ? -9.720  30.640  4.631   1.00 0.00 ? 158 MET A C    5  
ATOM   8795  O  O    . MET A 1 3   ? -10.194 31.176  3.646   1.00 0.00 ? 158 MET A O    5  
ATOM   8796  C  CB   . MET A 1 3   ? -11.205 32.098  6.052   1.00 0.00 ? 158 MET A CB   5  
ATOM   8797  C  CG   . MET A 1 3   ? -12.454 31.878  6.911   1.00 0.00 ? 158 MET A CG   5  
ATOM   8798  S  SD   . MET A 1 3   ? -12.078 32.278  8.635   1.00 0.00 ? 158 MET A SD   5  
ATOM   8799  C  CE   . MET A 1 3   ? -12.957 33.858  8.697   1.00 0.00 ? 158 MET A CE   5  
ATOM   8800  H  H    . MET A 1 3   ? -8.648  31.677  6.952   1.00 0.00 ? 158 MET A H    5  
ATOM   8801  H  HA   . MET A 1 3   ? -11.006 29.962  6.233   1.00 0.00 ? 158 MET A HA   5  
ATOM   8802  H  HB2  . MET A 1 3   ? -10.610 32.892  6.478   1.00 0.00 ? 158 MET A HB2  5  
ATOM   8803  H  HB3  . MET A 1 3   ? -11.504 32.368  5.050   1.00 0.00 ? 158 MET A HB3  5  
ATOM   8804  H  HG2  . MET A 1 3   ? -13.250 32.516  6.558   1.00 0.00 ? 158 MET A HG2  5  
ATOM   8805  H  HG3  . MET A 1 3   ? -12.761 30.845  6.840   1.00 0.00 ? 158 MET A HG3  5  
ATOM   8806  H  HE1  . MET A 1 3   ? -13.317 34.030  9.703   1.00 0.00 ? 158 MET A HE1  5  
ATOM   8807  H  HE2  . MET A 1 3   ? -13.795 33.833  8.019   1.00 0.00 ? 158 MET A HE2  5  
ATOM   8808  H  HE3  . MET A 1 3   ? -12.286 34.655  8.408   1.00 0.00 ? 158 MET A HE3  5  
ATOM   8809  N  N    . LYS A 1 4   ? -8.632  29.902  4.550   1.00 0.00 ? 159 LYS A N    5  
ATOM   8810  C  CA   . LYS A 1 4   ? -7.955  29.708  3.231   1.00 0.00 ? 159 LYS A CA   5  
ATOM   8811  C  C    . LYS A 1 4   ? -7.399  28.280  3.124   1.00 0.00 ? 159 LYS A C    5  
ATOM   8812  O  O    . LYS A 1 4   ? -6.417  27.946  3.760   1.00 0.00 ? 159 LYS A O    5  
ATOM   8813  C  CB   . LYS A 1 4   ? -6.816  30.729  3.219   1.00 0.00 ? 159 LYS A CB   5  
ATOM   8814  C  CG   . LYS A 1 4   ? -6.690  31.340  1.821   1.00 0.00 ? 159 LYS A CG   5  
ATOM   8815  C  CD   . LYS A 1 4   ? -6.252  32.801  1.940   1.00 0.00 ? 159 LYS A CD   5  
ATOM   8816  C  CE   . LYS A 1 4   ? -6.885  33.618  0.811   1.00 0.00 ? 159 LYS A CE   5  
ATOM   8817  N  NZ   . LYS A 1 4   ? -5.854  33.652  -0.263  1.00 0.00 ? 159 LYS A NZ   5  
ATOM   8818  H  H    . LYS A 1 4   ? -8.259  29.475  5.353   1.00 0.00 ? 159 LYS A H    5  
ATOM   8819  H  HA   . LYS A 1 4   ? -8.640  29.909  2.424   1.00 0.00 ? 159 LYS A HA   5  
ATOM   8820  H  HB2  . LYS A 1 4   ? -7.026  31.510  3.936   1.00 0.00 ? 159 LYS A HB2  5  
ATOM   8821  H  HB3  . LYS A 1 4   ? -5.890  30.240  3.480   1.00 0.00 ? 159 LYS A HB3  5  
ATOM   8822  H  HG2  . LYS A 1 4   ? -5.955  30.788  1.253   1.00 0.00 ? 159 LYS A HG2  5  
ATOM   8823  H  HG3  . LYS A 1 4   ? -7.645  31.291  1.320   1.00 0.00 ? 159 LYS A HG3  5  
ATOM   8824  H  HD2  . LYS A 1 4   ? -6.572  33.196  2.894   1.00 0.00 ? 159 LYS A HD2  5  
ATOM   8825  H  HD3  . LYS A 1 4   ? -5.177  32.862  1.867   1.00 0.00 ? 159 LYS A HD3  5  
ATOM   8826  H  HE2  . LYS A 1 4   ? -7.785  33.133  0.458   1.00 0.00 ? 159 LYS A HE2  5  
ATOM   8827  H  HE3  . LYS A 1 4   ? -7.103  34.620  1.147   1.00 0.00 ? 159 LYS A HE3  5  
ATOM   8828  H  HZ1  . LYS A 1 4   ? -6.222  34.175  -1.081  1.00 0.00 ? 159 LYS A HZ1  5  
ATOM   8829  H  HZ2  . LYS A 1 4   ? -5.620  32.678  -0.550  1.00 0.00 ? 159 LYS A HZ2  5  
ATOM   8830  H  HZ3  . LYS A 1 4   ? -4.998  34.124  0.092   1.00 0.00 ? 159 LYS A HZ3  5  
ATOM   8831  N  N    . ARG A 1 5   ? -8.017  27.431  2.325   1.00 0.00 ? 160 ARG A N    5  
ATOM   8832  C  CA   . ARG A 1 5   ? -7.514  26.031  2.188   1.00 0.00 ? 160 ARG A CA   5  
ATOM   8833  C  C    . ARG A 1 5   ? -7.074  25.765  0.740   1.00 0.00 ? 160 ARG A C    5  
ATOM   8834  O  O    . ARG A 1 5   ? -7.428  24.756  0.159   1.00 0.00 ? 160 ARG A O    5  
ATOM   8835  C  CB   . ARG A 1 5   ? -8.704  25.145  2.559   1.00 0.00 ? 160 ARG A CB   5  
ATOM   8836  C  CG   . ARG A 1 5   ? -8.726  24.927  4.073   1.00 0.00 ? 160 ARG A CG   5  
ATOM   8837  C  CD   . ARG A 1 5   ? -9.301  23.543  4.382   1.00 0.00 ? 160 ARG A CD   5  
ATOM   8838  N  NE   . ARG A 1 5   ? -8.524  23.058  5.555   1.00 0.00 ? 160 ARG A NE   5  
ATOM   8839  C  CZ   . ARG A 1 5   ? -9.139  22.768  6.670   1.00 0.00 ? 160 ARG A CZ   5  
ATOM   8840  N  NH1  . ARG A 1 5   ? -9.791  23.695  7.315   1.00 0.00 ? 160 ARG A NH1  5  
ATOM   8841  N  NH2  . ARG A 1 5   ? -9.101  21.551  7.139   1.00 0.00 ? 160 ARG A NH2  5  
ATOM   8842  H  H    . ARG A 1 5   ? -8.810  27.712  1.817   1.00 0.00 ? 160 ARG A H    5  
ATOM   8843  H  HA   . ARG A 1 5   ? -6.696  25.856  2.870   1.00 0.00 ? 160 ARG A HA   5  
ATOM   8844  H  HB2  . ARG A 1 5   ? -9.620  25.625  2.250   1.00 0.00 ? 160 ARG A HB2  5  
ATOM   8845  H  HB3  . ARG A 1 5   ? -8.611  24.191  2.061   1.00 0.00 ? 160 ARG A HB3  5  
ATOM   8846  H  HG2  . ARG A 1 5   ? -7.721  24.996  4.461   1.00 0.00 ? 160 ARG A HG2  5  
ATOM   8847  H  HG3  . ARG A 1 5   ? -9.343  25.683  4.536   1.00 0.00 ? 160 ARG A HG3  5  
ATOM   8848  H  HD2  . ARG A 1 5   ? -10.352 23.620  4.628   1.00 0.00 ? 160 ARG A HD2  5  
ATOM   8849  H  HD3  . ARG A 1 5   ? -9.157  22.880  3.543   1.00 0.00 ? 160 ARG A HD3  5  
ATOM   8850  H  HE   . ARG A 1 5   ? -7.552  22.955  5.492   1.00 0.00 ? 160 ARG A HE   5  
ATOM   8851  H  HH11 . ARG A 1 5   ? -9.820  24.629  6.956   1.00 0.00 ? 160 ARG A HH11 5  
ATOM   8852  H  HH12 . ARG A 1 5   ? -10.262 23.473  8.170   1.00 0.00 ? 160 ARG A HH12 5  
ATOM   8853  H  HH21 . ARG A 1 5   ? -8.600  20.839  6.644   1.00 0.00 ? 160 ARG A HH21 5  
ATOM   8854  H  HH22 . ARG A 1 5   ? -9.571  21.329  7.993   1.00 0.00 ? 160 ARG A HH22 5  
ATOM   8855  N  N    . GLY A 1 6   ? -6.303  26.658  0.150   1.00 0.00 ? 161 GLY A N    5  
ATOM   8856  C  CA   . GLY A 1 6   ? -5.850  26.443  -1.256  1.00 0.00 ? 161 GLY A CA   5  
ATOM   8857  C  C    . GLY A 1 6   ? -7.064  26.461  -2.195  1.00 0.00 ? 161 GLY A C    5  
ATOM   8858  O  O    . GLY A 1 6   ? -7.512  25.426  -2.651  1.00 0.00 ? 161 GLY A O    5  
ATOM   8859  H  H    . GLY A 1 6   ? -6.024  27.469  0.630   1.00 0.00 ? 161 GLY A H    5  
ATOM   8860  H  HA2  . GLY A 1 6   ? -5.164  27.231  -1.536  1.00 0.00 ? 161 GLY A HA2  5  
ATOM   8861  H  HA3  . GLY A 1 6   ? -5.354  25.488  -1.332  1.00 0.00 ? 161 GLY A HA3  5  
ATOM   8862  N  N    . GLU A 1 7   ? -7.607  27.628  -2.493  1.00 0.00 ? 162 GLU A N    5  
ATOM   8863  C  CA   . GLU A 1 7   ? -8.796  27.709  -3.407  1.00 0.00 ? 162 GLU A CA   5  
ATOM   8864  C  C    . GLU A 1 7   ? -9.919  26.774  -2.922  1.00 0.00 ? 162 GLU A C    5  
ATOM   8865  O  O    . GLU A 1 7   ? -10.550 26.099  -3.712  1.00 0.00 ? 162 GLU A O    5  
ATOM   8866  C  CB   . GLU A 1 7   ? -8.284  27.264  -4.780  1.00 0.00 ? 162 GLU A CB   5  
ATOM   8867  C  CG   . GLU A 1 7   ? -8.988  28.072  -5.872  1.00 0.00 ? 162 GLU A CG   5  
ATOM   8868  C  CD   . GLU A 1 7   ? -8.048  28.245  -7.067  1.00 0.00 ? 162 GLU A CD   5  
ATOM   8869  O  OE1  . GLU A 1 7   ? -6.965  28.771  -6.871  1.00 0.00 ? 162 GLU A OE1  5  
ATOM   8870  O  OE2  . GLU A 1 7   ? -8.427  27.848  -8.156  1.00 0.00 ? 162 GLU A OE2  5  
ATOM   8871  H  H    . GLU A 1 7   ? -7.235  28.457  -2.117  1.00 0.00 ? 162 GLU A H    5  
ATOM   8872  H  HA   . GLU A 1 7   ? -9.154  28.724  -3.462  1.00 0.00 ? 162 GLU A HA   5  
ATOM   8873  H  HB2  . GLU A 1 7   ? -7.218  27.432  -4.838  1.00 0.00 ? 162 GLU A HB2  5  
ATOM   8874  H  HB3  . GLU A 1 7   ? -8.492  26.214  -4.920  1.00 0.00 ? 162 GLU A HB3  5  
ATOM   8875  H  HG2  . GLU A 1 7   ? -9.880  27.549  -6.187  1.00 0.00 ? 162 GLU A HG2  5  
ATOM   8876  H  HG3  . GLU A 1 7   ? -9.258  29.043  -5.486  1.00 0.00 ? 162 GLU A HG3  5  
ATOM   8877  N  N    . ASP A 1 8   ? -10.179 26.729  -1.627  1.00 0.00 ? 163 ASP A N    5  
ATOM   8878  C  CA   . ASP A 1 8   ? -11.262 25.837  -1.095  1.00 0.00 ? 163 ASP A CA   5  
ATOM   8879  C  C    . ASP A 1 8   ? -11.074 24.392  -1.592  1.00 0.00 ? 163 ASP A C    5  
ATOM   8880  O  O    . ASP A 1 8   ? -10.091 24.080  -2.238  1.00 0.00 ? 163 ASP A O    5  
ATOM   8881  C  CB   . ASP A 1 8   ? -12.572 26.424  -1.632  1.00 0.00 ? 163 ASP A CB   5  
ATOM   8882  C  CG   . ASP A 1 8   ? -12.797 27.809  -1.024  1.00 0.00 ? 163 ASP A CG   5  
ATOM   8883  O  OD1  . ASP A 1 8   ? -12.185 28.750  -1.501  1.00 0.00 ? 163 ASP A OD1  5  
ATOM   8884  O  OD2  . ASP A 1 8   ? -13.577 27.906  -0.091  1.00 0.00 ? 163 ASP A OD2  5  
ATOM   8885  H  H    . ASP A 1 8   ? -9.660  27.280  -1.000  1.00 0.00 ? 163 ASP A H    5  
ATOM   8886  H  HA   . ASP A 1 8   ? -11.267 25.861  -0.016  1.00 0.00 ? 163 ASP A HA   5  
ATOM   8887  H  HB2  . ASP A 1 8   ? -12.515 26.506  -2.707  1.00 0.00 ? 163 ASP A HB2  5  
ATOM   8888  H  HB3  . ASP A 1 8   ? -13.393 25.777  -1.362  1.00 0.00 ? 163 ASP A HB3  5  
ATOM   8889  N  N    . GLY A 1 9   ? -12.006 23.507  -1.299  1.00 0.00 ? 164 GLY A N    5  
ATOM   8890  C  CA   . GLY A 1 9   ? -11.868 22.094  -1.758  1.00 0.00 ? 164 GLY A CA   5  
ATOM   8891  C  C    . GLY A 1 9   ? -11.978 21.151  -0.551  1.00 0.00 ? 164 GLY A C    5  
ATOM   8892  O  O    . GLY A 1 9   ? -11.103 21.123  0.295   1.00 0.00 ? 164 GLY A O    5  
ATOM   8893  H  H    . GLY A 1 9   ? -12.796 23.771  -0.776  1.00 0.00 ? 164 GLY A H    5  
ATOM   8894  H  HA2  . GLY A 1 9   ? -12.653 21.868  -2.466  1.00 0.00 ? 164 GLY A HA2  5  
ATOM   8895  H  HA3  . GLY A 1 9   ? -10.908 21.960  -2.230  1.00 0.00 ? 164 GLY A HA3  5  
ATOM   8896  N  N    . LEU A 1 10  ? -13.040 20.376  -0.461  1.00 0.00 ? 165 LEU A N    5  
ATOM   8897  C  CA   . LEU A 1 10  ? -13.189 19.442  0.694   1.00 0.00 ? 165 LEU A CA   5  
ATOM   8898  C  C    . LEU A 1 10  ? -13.590 18.044  0.196   1.00 0.00 ? 165 LEU A C    5  
ATOM   8899  O  O    . LEU A 1 10  ? -14.735 17.648  0.308   1.00 0.00 ? 165 LEU A O    5  
ATOM   8900  C  CB   . LEU A 1 10  ? -14.302 20.049  1.551   1.00 0.00 ? 165 LEU A CB   5  
ATOM   8901  C  CG   . LEU A 1 10  ? -14.287 19.405  2.938   1.00 0.00 ? 165 LEU A CG   5  
ATOM   8902  C  CD1  . LEU A 1 10  ? -14.717 20.436  3.983   1.00 0.00 ? 165 LEU A CD1  5  
ATOM   8903  C  CD2  . LEU A 1 10  ? -15.259 18.222  2.960   1.00 0.00 ? 165 LEU A CD2  5  
ATOM   8904  H  H    . LEU A 1 10  ? -13.739 20.408  -1.152  1.00 0.00 ? 165 LEU A H    5  
ATOM   8905  H  HA   . LEU A 1 10  ? -12.273 19.393  1.260   1.00 0.00 ? 165 LEU A HA   5  
ATOM   8906  H  HB2  . LEU A 1 10  ? -14.142 21.113  1.645   1.00 0.00 ? 165 LEU A HB2  5  
ATOM   8907  H  HB3  . LEU A 1 10  ? -15.257 19.869  1.082   1.00 0.00 ? 165 LEU A HB3  5  
ATOM   8908  H  HG   . LEU A 1 10  ? -13.289 19.058  3.164   1.00 0.00 ? 165 LEU A HG   5  
ATOM   8909  H  HD11 . LEU A 1 10  ? -14.121 21.330  3.875   1.00 0.00 ? 165 LEU A HD11 5  
ATOM   8910  H  HD12 . LEU A 1 10  ? -14.575 20.026  4.973   1.00 0.00 ? 165 LEU A HD12 5  
ATOM   8911  H  HD13 . LEU A 1 10  ? -15.761 20.679  3.842   1.00 0.00 ? 165 LEU A HD13 5  
ATOM   8912  H  HD21 . LEU A 1 10  ? -14.750 17.333  2.619   1.00 0.00 ? 165 LEU A HD21 5  
ATOM   8913  H  HD22 . LEU A 1 10  ? -16.096 18.431  2.310   1.00 0.00 ? 165 LEU A HD22 5  
ATOM   8914  H  HD23 . LEU A 1 10  ? -15.615 18.068  3.968   1.00 0.00 ? 165 LEU A HD23 5  
ATOM   8915  N  N    . HIS A 1 11  ? -12.659 17.291  -0.355  1.00 0.00 ? 166 HIS A N    5  
ATOM   8916  C  CA   . HIS A 1 11  ? -13.000 15.926  -0.855  1.00 0.00 ? 166 HIS A CA   5  
ATOM   8917  C  C    . HIS A 1 11  ? -11.948 14.908  -0.387  1.00 0.00 ? 166 HIS A C    5  
ATOM   8918  O  O    . HIS A 1 11  ? -10.938 14.715  -1.038  1.00 0.00 ? 166 HIS A O    5  
ATOM   8919  C  CB   . HIS A 1 11  ? -12.986 16.049  -2.380  1.00 0.00 ? 166 HIS A CB   5  
ATOM   8920  C  CG   . HIS A 1 11  ? -13.999 15.107  -2.968  1.00 0.00 ? 166 HIS A CG   5  
ATOM   8921  N  ND1  . HIS A 1 11  ? -13.705 14.284  -4.045  1.00 0.00 ? 166 HIS A ND1  5  
ATOM   8922  C  CD2  . HIS A 1 11  ? -15.306 14.844  -2.642  1.00 0.00 ? 166 HIS A CD2  5  
ATOM   8923  C  CE1  . HIS A 1 11  ? -14.812 13.573  -4.325  1.00 0.00 ? 166 HIS A CE1  5  
ATOM   8924  N  NE2  . HIS A 1 11  ? -15.818 13.876  -3.499  1.00 0.00 ? 166 HIS A NE2  5  
ATOM   8925  H  H    . HIS A 1 11  ? -11.738 17.623  -0.442  1.00 0.00 ? 166 HIS A H    5  
ATOM   8926  H  HA   . HIS A 1 11  ? -13.982 15.635  -0.518  1.00 0.00 ? 166 HIS A HA   5  
ATOM   8927  H  HB2  . HIS A 1 11  ? -13.230 17.063  -2.661  1.00 0.00 ? 166 HIS A HB2  5  
ATOM   8928  H  HB3  . HIS A 1 11  ? -12.003 15.800  -2.752  1.00 0.00 ? 166 HIS A HB3  5  
ATOM   8929  H  HD1  . HIS A 1 11  ? -12.848 14.231  -4.516  1.00 0.00 ? 166 HIS A HD1  5  
ATOM   8930  H  HD2  . HIS A 1 11  ? -15.854 15.318  -1.839  1.00 0.00 ? 166 HIS A HD2  5  
ATOM   8931  H  HE1  . HIS A 1 11  ? -14.880 12.847  -5.120  1.00 0.00 ? 166 HIS A HE1  5  
ATOM   8932  N  N    . GLY A 1 12  ? -12.174 14.253  0.734   1.00 0.00 ? 167 GLY A N    5  
ATOM   8933  C  CA   . GLY A 1 12  ? -11.182 13.252  1.228   1.00 0.00 ? 167 GLY A CA   5  
ATOM   8934  C  C    . GLY A 1 12  ? -11.647 11.841  0.842   1.00 0.00 ? 167 GLY A C    5  
ATOM   8935  O  O    . GLY A 1 12  ? -12.796 11.491  1.037   1.00 0.00 ? 167 GLY A O    5  
ATOM   8936  H  H    . GLY A 1 12  ? -12.994 14.417  1.251   1.00 0.00 ? 167 GLY A H    5  
ATOM   8937  H  HA2  . GLY A 1 12  ? -10.218 13.451  0.784   1.00 0.00 ? 167 GLY A HA2  5  
ATOM   8938  H  HA3  . GLY A 1 12  ? -11.106 13.320  2.303   1.00 0.00 ? 167 GLY A HA3  5  
ATOM   8939  N  N    . ILE A 1 13  ? -10.769 11.024  0.295   1.00 0.00 ? 168 ILE A N    5  
ATOM   8940  C  CA   . ILE A 1 13  ? -11.178 9.641   -0.100  1.00 0.00 ? 168 ILE A CA   5  
ATOM   8941  C  C    . ILE A 1 13  ? -10.169 8.614   0.438   1.00 0.00 ? 168 ILE A C    5  
ATOM   8942  O  O    . ILE A 1 13  ? -9.003  8.914   0.607   1.00 0.00 ? 168 ILE A O    5  
ATOM   8943  C  CB   . ILE A 1 13  ? -11.181 9.644   -1.634  1.00 0.00 ? 168 ILE A CB   5  
ATOM   8944  C  CG1  . ILE A 1 13  ? -12.172 10.695  -2.145  1.00 0.00 ? 168 ILE A CG1  5  
ATOM   8945  C  CG2  . ILE A 1 13  ? -11.597 8.262   -2.153  1.00 0.00 ? 168 ILE A CG2  5  
ATOM   8946  C  CD1  . ILE A 1 13  ? -11.427 11.998  -2.443  1.00 0.00 ? 168 ILE A CD1  5  
ATOM   8947  H  H    . ILE A 1 13  ? -9.844  11.317  0.140   1.00 0.00 ? 168 ILE A H    5  
ATOM   8948  H  HA   . ILE A 1 13  ? -12.167 9.421   0.268   1.00 0.00 ? 168 ILE A HA   5  
ATOM   8949  H  HB   . ILE A 1 13  ? -10.188 9.877   -1.993  1.00 0.00 ? 168 ILE A HB   5  
ATOM   8950  H  HG12 . ILE A 1 13  ? -12.646 10.337  -3.047  1.00 0.00 ? 168 ILE A HG12 5  
ATOM   8951  H  HG13 . ILE A 1 13  ? -12.923 10.879  -1.391  1.00 0.00 ? 168 ILE A HG13 5  
ATOM   8952  H  HG21 . ILE A 1 13  ? -12.239 7.784   -1.429  1.00 0.00 ? 168 ILE A HG21 5  
ATOM   8953  H  HG22 . ILE A 1 13  ? -10.716 7.655   -2.309  1.00 0.00 ? 168 ILE A HG22 5  
ATOM   8954  H  HG23 . ILE A 1 13  ? -12.127 8.374   -3.088  1.00 0.00 ? 168 ILE A HG23 5  
ATOM   8955  H  HD11 . ILE A 1 13  ? -10.463 11.770  -2.874  1.00 0.00 ? 168 ILE A HD11 5  
ATOM   8956  H  HD12 . ILE A 1 13  ? -11.289 12.552  -1.527  1.00 0.00 ? 168 ILE A HD12 5  
ATOM   8957  H  HD13 . ILE A 1 13  ? -12.001 12.591  -3.139  1.00 0.00 ? 168 ILE A HD13 5  
ATOM   8958  N  N    . VAL A 1 14  ? -10.609 7.401   0.698   1.00 0.00 ? 169 VAL A N    5  
ATOM   8959  C  CA   . VAL A 1 14  ? -9.669  6.354   1.213   1.00 0.00 ? 169 VAL A CA   5  
ATOM   8960  C  C    . VAL A 1 14  ? -9.341  5.367   0.085   1.00 0.00 ? 169 VAL A C    5  
ATOM   8961  O  O    . VAL A 1 14  ? -10.233 4.790   -0.509  1.00 0.00 ? 169 VAL A O    5  
ATOM   8962  C  CB   . VAL A 1 14  ? -10.420 5.650   2.352   1.00 0.00 ? 169 VAL A CB   5  
ATOM   8963  C  CG1  . VAL A 1 14  ? -9.545  4.543   2.946   1.00 0.00 ? 169 VAL A CG1  5  
ATOM   8964  C  CG2  . VAL A 1 14  ? -10.761 6.670   3.445   1.00 0.00 ? 169 VAL A CG2  5  
ATOM   8965  H  H    . VAL A 1 14  ? -11.557 7.174   0.545   1.00 0.00 ? 169 VAL A H    5  
ATOM   8966  H  HA   . VAL A 1 14  ? -8.766  6.811   1.589   1.00 0.00 ? 169 VAL A HA   5  
ATOM   8967  H  HB   . VAL A 1 14  ? -11.332 5.218   1.966   1.00 0.00 ? 169 VAL A HB   5  
ATOM   8968  H  HG11 . VAL A 1 14  ? -8.815  4.979   3.612   1.00 0.00 ? 169 VAL A HG11 5  
ATOM   8969  H  HG12 . VAL A 1 14  ? -9.038  4.017   2.151   1.00 0.00 ? 169 VAL A HG12 5  
ATOM   8970  H  HG13 . VAL A 1 14  ? -10.166 3.851   3.497   1.00 0.00 ? 169 VAL A HG13 5  
ATOM   8971  H  HG21 . VAL A 1 14  ? -11.731 6.437   3.862   1.00 0.00 ? 169 VAL A HG21 5  
ATOM   8972  H  HG22 . VAL A 1 14  ? -10.781 7.662   3.021   1.00 0.00 ? 169 VAL A HG22 5  
ATOM   8973  H  HG23 . VAL A 1 14  ? -10.016 6.626   4.225   1.00 0.00 ? 169 VAL A HG23 5  
ATOM   8974  N  N    . SER A 1 15  ? -8.076  5.169   -0.229  1.00 0.00 ? 170 SER A N    5  
ATOM   8975  C  CA   . SER A 1 15  ? -7.724  4.224   -1.332  1.00 0.00 ? 170 SER A CA   5  
ATOM   8976  C  C    . SER A 1 15  ? -6.592  3.278   -0.913  1.00 0.00 ? 170 SER A C    5  
ATOM   8977  O  O    . SER A 1 15  ? -5.766  3.617   -0.086  1.00 0.00 ? 170 SER A O    5  
ATOM   8978  C  CB   . SER A 1 15  ? -7.274  5.118   -2.487  1.00 0.00 ? 170 SER A CB   5  
ATOM   8979  O  OG   . SER A 1 15  ? -7.974  6.353   -2.426  1.00 0.00 ? 170 SER A OG   5  
ATOM   8980  H  H    . SER A 1 15  ? -7.362  5.644   0.250   1.00 0.00 ? 170 SER A H    5  
ATOM   8981  H  HA   . SER A 1 15  ? -8.588  3.656   -1.627  1.00 0.00 ? 170 SER A HA   5  
ATOM   8982  H  HB2  . SER A 1 15  ? -6.217  5.306   -2.407  1.00 0.00 ? 170 SER A HB2  5  
ATOM   8983  H  HB3  . SER A 1 15  ? -7.479  4.621   -3.425  1.00 0.00 ? 170 SER A HB3  5  
ATOM   8984  H  HG   . SER A 1 15  ? -7.997  6.726   -3.310  1.00 0.00 ? 170 SER A HG   5  
ATOM   8985  N  N    . CYS A 1 16  ? -6.542  2.094   -1.490  1.00 0.00 ? 171 CYS A N    5  
ATOM   8986  C  CA   . CYS A 1 16  ? -5.448  1.131   -1.132  1.00 0.00 ? 171 CYS A CA   5  
ATOM   8987  C  C    . CYS A 1 16  ? -4.319  1.221   -2.168  1.00 0.00 ? 171 CYS A C    5  
ATOM   8988  O  O    . CYS A 1 16  ? -4.574  1.325   -3.355  1.00 0.00 ? 171 CYS A O    5  
ATOM   8989  C  CB   . CYS A 1 16  ? -6.082  -0.266  -1.161  1.00 0.00 ? 171 CYS A CB   5  
ATOM   8990  S  SG   . CYS A 1 16  ? -4.899  -1.476  -0.520  1.00 0.00 ? 171 CYS A SG   5  
ATOM   8991  H  H    . CYS A 1 16  ? -7.218  1.846   -2.167  1.00 0.00 ? 171 CYS A H    5  
ATOM   8992  H  HA   . CYS A 1 16  ? -5.069  1.343   -0.143  1.00 0.00 ? 171 CYS A HA   5  
ATOM   8993  H  HB2  . CYS A 1 16  ? -6.973  -0.272  -0.550  1.00 0.00 ? 171 CYS A HB2  5  
ATOM   8994  H  HB3  . CYS A 1 16  ? -6.339  -0.519  -2.177  1.00 0.00 ? 171 CYS A HB3  5  
ATOM   8995  N  N    . THR A 1 17  ? -3.073  1.183   -1.733  1.00 0.00 ? 172 THR A N    5  
ATOM   8996  C  CA   . THR A 1 17  ? -1.934  1.272   -2.716  1.00 0.00 ? 172 THR A CA   5  
ATOM   8997  C  C    . THR A 1 17  ? -1.659  -0.101  -3.355  1.00 0.00 ? 172 THR A C    5  
ATOM   8998  O  O    . THR A 1 17  ? -1.350  -0.186  -4.530  1.00 0.00 ? 172 THR A O    5  
ATOM   8999  C  CB   . THR A 1 17  ? -0.699  1.773   -1.930  1.00 0.00 ? 172 THR A CB   5  
ATOM   9000  O  OG1  . THR A 1 17  ? 0.332   2.090   -2.853  1.00 0.00 ? 172 THR A OG1  5  
ATOM   9001  C  CG2  . THR A 1 17  ? -0.188  0.701   -0.949  1.00 0.00 ? 172 THR A CG2  5  
ATOM   9002  H  H    . THR A 1 17  ? -2.892  1.097   -0.769  1.00 0.00 ? 172 THR A H    5  
ATOM   9003  H  HA   . THR A 1 17  ? -2.180  1.986   -3.488  1.00 0.00 ? 172 THR A HA   5  
ATOM   9004  H  HB   . THR A 1 17  ? -0.966  2.661   -1.376  1.00 0.00 ? 172 THR A HB   5  
ATOM   9005  H  HG1  . THR A 1 17  ? 0.138   2.951   -3.230  1.00 0.00 ? 172 THR A HG1  5  
ATOM   9006  H  HG21 . THR A 1 17  ? 0.044   -0.204  -1.492  1.00 0.00 ? 172 THR A HG21 5  
ATOM   9007  H  HG22 . THR A 1 17  ? -0.944  0.492   -0.209  1.00 0.00 ? 172 THR A HG22 5  
ATOM   9008  H  HG23 . THR A 1 17  ? 0.703   1.058   -0.455  1.00 0.00 ? 172 THR A HG23 5  
ATOM   9009  N  N    . ALA A 1 18  ? -1.769  -1.175  -2.600  1.00 0.00 ? 173 ALA A N    5  
ATOM   9010  C  CA   . ALA A 1 18  ? -1.506  -2.532  -3.197  1.00 0.00 ? 173 ALA A CA   5  
ATOM   9011  C  C    . ALA A 1 18  ? -2.645  -2.933  -4.157  1.00 0.00 ? 173 ALA A C    5  
ATOM   9012  O  O    . ALA A 1 18  ? -2.422  -3.656  -5.110  1.00 0.00 ? 173 ALA A O    5  
ATOM   9013  C  CB   . ALA A 1 18  ? -1.406  -3.517  -2.019  1.00 0.00 ? 173 ALA A CB   5  
ATOM   9014  H  H    . ALA A 1 18  ? -2.025  -1.087  -1.651  1.00 0.00 ? 173 ALA A H    5  
ATOM   9015  H  HA   . ALA A 1 18  ? -0.573  -2.516  -3.734  1.00 0.00 ? 173 ALA A HA   5  
ATOM   9016  H  HB1  . ALA A 1 18  ? -1.674  -4.507  -2.352  1.00 0.00 ? 173 ALA A HB1  5  
ATOM   9017  H  HB2  . ALA A 1 18  ? -2.075  -3.205  -1.230  1.00 0.00 ? 173 ALA A HB2  5  
ATOM   9018  H  HB3  . ALA A 1 18  ? -0.391  -3.522  -1.645  1.00 0.00 ? 173 ALA A HB3  5  
ATOM   9019  N  N    . CYS A 1 19  ? -3.859  -2.464  -3.931  1.00 0.00 ? 174 CYS A N    5  
ATOM   9020  C  CA   . CYS A 1 19  ? -4.986  -2.821  -4.853  1.00 0.00 ? 174 CYS A CA   5  
ATOM   9021  C  C    . CYS A 1 19  ? -5.195  -1.720  -5.905  1.00 0.00 ? 174 CYS A C    5  
ATOM   9022  O  O    . CYS A 1 19  ? -5.538  -2.002  -7.037  1.00 0.00 ? 174 CYS A O    5  
ATOM   9023  C  CB   . CYS A 1 19  ? -6.232  -2.942  -3.967  1.00 0.00 ? 174 CYS A CB   5  
ATOM   9024  S  SG   . CYS A 1 19  ? -6.038  -4.325  -2.819  1.00 0.00 ? 174 CYS A SG   5  
ATOM   9025  H  H    . CYS A 1 19  ? -4.028  -1.876  -3.167  1.00 0.00 ? 174 CYS A H    5  
ATOM   9026  H  HA   . CYS A 1 19  ? -4.789  -3.759  -5.335  1.00 0.00 ? 174 CYS A HA   5  
ATOM   9027  H  HB2  . CYS A 1 19  ? -6.365  -2.030  -3.410  1.00 0.00 ? 174 CYS A HB2  5  
ATOM   9028  H  HB3  . CYS A 1 19  ? -7.094  -3.108  -4.588  1.00 0.00 ? 174 CYS A HB3  5  
ATOM   9029  N  N    . GLY A 1 20  ? -5.009  -0.466  -5.542  1.00 0.00 ? 175 GLY A N    5  
ATOM   9030  C  CA   . GLY A 1 20  ? -5.217  0.637   -6.523  1.00 0.00 ? 175 GLY A CA   5  
ATOM   9031  C  C    . GLY A 1 20  ? -6.719  0.940   -6.613  1.00 0.00 ? 175 GLY A C    5  
ATOM   9032  O  O    . GLY A 1 20  ? -7.242  1.172   -7.686  1.00 0.00 ? 175 GLY A O    5  
ATOM   9033  H  H    . GLY A 1 20  ? -4.747  -0.247  -4.625  1.00 0.00 ? 175 GLY A H    5  
ATOM   9034  H  HA2  . GLY A 1 20  ? -4.686  1.519   -6.195  1.00 0.00 ? 175 GLY A HA2  5  
ATOM   9035  H  HA3  . GLY A 1 20  ? -4.856  0.333   -7.494  1.00 0.00 ? 175 GLY A HA3  5  
ATOM   9036  N  N    . GLN A 1 21  ? -7.423  0.931   -5.495  1.00 0.00 ? 176 GLN A N    5  
ATOM   9037  C  CA   . GLN A 1 21  ? -8.897  1.210   -5.540  1.00 0.00 ? 176 GLN A CA   5  
ATOM   9038  C  C    . GLN A 1 21  ? -9.425  1.610   -4.149  1.00 0.00 ? 176 GLN A C    5  
ATOM   9039  O  O    . GLN A 1 21  ? -8.843  1.270   -3.137  1.00 0.00 ? 176 GLN A O    5  
ATOM   9040  C  CB   . GLN A 1 21  ? -9.537  -0.108  -5.996  1.00 0.00 ? 176 GLN A CB   5  
ATOM   9041  C  CG   . GLN A 1 21  ? -10.093 0.047   -7.416  1.00 0.00 ? 176 GLN A CG   5  
ATOM   9042  C  CD   . GLN A 1 21  ? -11.327 0.958   -7.387  1.00 0.00 ? 176 GLN A CD   5  
ATOM   9043  O  OE1  . GLN A 1 21  ? -11.421 1.839   -6.555  1.00 0.00 ? 176 GLN A OE1  5  
ATOM   9044  N  NE2  . GLN A 1 21  ? -12.287 0.787   -8.263  1.00 0.00 ? 176 GLN A NE2  5  
ATOM   9045  H  H    . GLN A 1 21  ? -6.986  0.735   -4.632  1.00 0.00 ? 176 GLN A H    5  
ATOM   9046  H  HA   . GLN A 1 21  ? -9.110  1.991   -6.252  1.00 0.00 ? 176 GLN A HA   5  
ATOM   9047  H  HB2  . GLN A 1 21  ? -8.795  -0.892  -5.985  1.00 0.00 ? 176 GLN A HB2  5  
ATOM   9048  H  HB3  . GLN A 1 21  ? -10.342 -0.368  -5.326  1.00 0.00 ? 176 GLN A HB3  5  
ATOM   9049  H  HG2  . GLN A 1 21  ? -9.338  0.483   -8.053  1.00 0.00 ? 176 GLN A HG2  5  
ATOM   9050  H  HG3  . GLN A 1 21  ? -10.373 -0.922  -7.800  1.00 0.00 ? 176 GLN A HG3  5  
ATOM   9051  H  HE21 . GLN A 1 21  ? -12.223 0.080   -8.940  1.00 0.00 ? 176 GLN A HE21 5  
ATOM   9052  H  HE22 . GLN A 1 21  ? -13.075 1.371   -8.242  1.00 0.00 ? 176 GLN A HE22 5  
ATOM   9053  N  N    . GLN A 1 22  ? -10.526 2.333   -4.097  1.00 0.00 ? 177 GLN A N    5  
ATOM   9054  C  CA   . GLN A 1 22  ? -11.089 2.753   -2.760  1.00 0.00 ? 177 GLN A CA   5  
ATOM   9055  C  C    . GLN A 1 22  ? -11.360 1.525   -1.877  1.00 0.00 ? 177 GLN A C    5  
ATOM   9056  O  O    . GLN A 1 22  ? -11.610 0.442   -2.374  1.00 0.00 ? 177 GLN A O    5  
ATOM   9057  C  CB   . GLN A 1 22  ? -12.407 3.492   -3.051  1.00 0.00 ? 177 GLN A CB   5  
ATOM   9058  C  CG   . GLN A 1 22  ? -12.836 4.284   -1.814  1.00 0.00 ? 177 GLN A CG   5  
ATOM   9059  C  CD   . GLN A 1 22  ? -14.236 4.867   -2.040  1.00 0.00 ? 177 GLN A CD   5  
ATOM   9060  O  OE1  . GLN A 1 22  ? -14.628 5.106   -3.165  1.00 0.00 ? 177 GLN A OE1  5  
ATOM   9061  N  NE2  . GLN A 1 22  ? -15.017 5.109   -1.015  1.00 0.00 ? 177 GLN A NE2  5  
ATOM   9062  H  H    . GLN A 1 22  ? -10.977 2.599   -4.935  1.00 0.00 ? 177 GLN A H    5  
ATOM   9063  H  HA   . GLN A 1 22  ? -10.403 3.416   -2.262  1.00 0.00 ? 177 GLN A HA   5  
ATOM   9064  H  HB2  . GLN A 1 22  ? -12.264 4.168   -3.881  1.00 0.00 ? 177 GLN A HB2  5  
ATOM   9065  H  HB3  . GLN A 1 22  ? -13.174 2.774   -3.299  1.00 0.00 ? 177 GLN A HB3  5  
ATOM   9066  H  HG2  . GLN A 1 22  ? -12.851 3.630   -0.955  1.00 0.00 ? 177 GLN A HG2  5  
ATOM   9067  H  HG3  . GLN A 1 22  ? -12.138 5.089   -1.642  1.00 0.00 ? 177 GLN A HG3  5  
ATOM   9068  H  HE21 . GLN A 1 22  ? -14.711 4.921   -0.101  1.00 0.00 ? 177 GLN A HE21 5  
ATOM   9069  H  HE22 . GLN A 1 22  ? -15.912 5.482   -1.162  1.00 0.00 ? 177 GLN A HE22 5  
ATOM   9070  N  N    . VAL A 1 23  ? -11.320 1.685   -0.568  1.00 0.00 ? 178 VAL A N    5  
ATOM   9071  C  CA   . VAL A 1 23  ? -11.589 0.512   0.337   1.00 0.00 ? 178 VAL A CA   5  
ATOM   9072  C  C    . VAL A 1 23  ? -13.101 0.390   0.583   1.00 0.00 ? 178 VAL A C    5  
ATOM   9073  O  O    . VAL A 1 23  ? -13.840 1.331   0.364   1.00 0.00 ? 178 VAL A O    5  
ATOM   9074  C  CB   . VAL A 1 23  ? -10.845 0.794   1.656   1.00 0.00 ? 178 VAL A CB   5  
ATOM   9075  C  CG1  . VAL A 1 23  ? -10.994 -0.404  2.594   1.00 0.00 ? 178 VAL A CG1  5  
ATOM   9076  C  CG2  . VAL A 1 23  ? -9.359  1.026   1.367   1.00 0.00 ? 178 VAL A CG2  5  
ATOM   9077  H  H    . VAL A 1 23  ? -11.123 2.573   -0.186  1.00 0.00 ? 178 VAL A H    5  
ATOM   9078  H  HA   . VAL A 1 23  ? -11.212 -0.394  -0.110  1.00 0.00 ? 178 VAL A HA   5  
ATOM   9079  H  HB   . VAL A 1 23  ? -11.263 1.672   2.128   1.00 0.00 ? 178 VAL A HB   5  
ATOM   9080  H  HG11 . VAL A 1 23  ? -10.924 -1.319  2.024   1.00 0.00 ? 178 VAL A HG11 5  
ATOM   9081  H  HG12 . VAL A 1 23  ? -11.955 -0.359  3.086   1.00 0.00 ? 178 VAL A HG12 5  
ATOM   9082  H  HG13 . VAL A 1 23  ? -10.209 -0.381  3.336   1.00 0.00 ? 178 VAL A HG13 5  
ATOM   9083  H  HG21 . VAL A 1 23  ? -8.809  1.035   2.297   1.00 0.00 ? 178 VAL A HG21 5  
ATOM   9084  H  HG22 . VAL A 1 23  ? -9.233  1.973   0.864   1.00 0.00 ? 178 VAL A HG22 5  
ATOM   9085  H  HG23 . VAL A 1 23  ? -8.986  0.231   0.738   1.00 0.00 ? 178 VAL A HG23 5  
ATOM   9086  N  N    . ASN A 1 24  ? -13.576 -0.761  1.023   1.00 0.00 ? 179 ASN A N    5  
ATOM   9087  C  CA   . ASN A 1 24  ? -15.060 -0.924  1.264   1.00 0.00 ? 179 ASN A CA   5  
ATOM   9088  C  C    . ASN A 1 24  ? -15.596 0.195   2.178   1.00 0.00 ? 179 ASN A C    5  
ATOM   9089  O  O    . ASN A 1 24  ? -15.563 0.079   3.388   1.00 0.00 ? 179 ASN A O    5  
ATOM   9090  C  CB   . ASN A 1 24  ? -15.248 -2.289  1.948   1.00 0.00 ? 179 ASN A CB   5  
ATOM   9091  C  CG   . ASN A 1 24  ? -16.740 -2.644  1.983   1.00 0.00 ? 179 ASN A CG   5  
ATOM   9092  O  OD1  . ASN A 1 24  ? -17.529 -1.924  2.560   1.00 0.00 ? 179 ASN A OD1  5  
ATOM   9093  N  ND2  . ASN A 1 24  ? -17.168 -3.731  1.387   1.00 0.00 ? 179 ASN A ND2  5  
ATOM   9094  H  H    . ASN A 1 24  ? -12.959 -1.517  1.182   1.00 0.00 ? 179 ASN A H    5  
ATOM   9095  H  HA   . ASN A 1 24  ? -15.588 -0.916  0.324   1.00 0.00 ? 179 ASN A HA   5  
ATOM   9096  H  HB2  . ASN A 1 24  ? -14.710 -3.045  1.393   1.00 0.00 ? 179 ASN A HB2  5  
ATOM   9097  H  HB3  . ASN A 1 24  ? -14.868 -2.242  2.956   1.00 0.00 ? 179 ASN A HB3  5  
ATOM   9098  H  HD21 . ASN A 1 24  ? -16.540 -4.321  0.918   1.00 0.00 ? 179 ASN A HD21 5  
ATOM   9099  H  HD22 . ASN A 1 24  ? -18.121 -3.955  1.411   1.00 0.00 ? 179 ASN A HD22 5  
ATOM   9100  N  N    . HIS A 1 25  ? -16.098 1.276   1.609   1.00 0.00 ? 180 HIS A N    5  
ATOM   9101  C  CA   . HIS A 1 25  ? -16.643 2.398   2.443   1.00 0.00 ? 180 HIS A CA   5  
ATOM   9102  C  C    . HIS A 1 25  ? -15.634 2.824   3.528   1.00 0.00 ? 180 HIS A C    5  
ATOM   9103  O  O    . HIS A 1 25  ? -14.521 2.334   3.569   1.00 0.00 ? 180 HIS A O    5  
ATOM   9104  C  CB   . HIS A 1 25  ? -17.915 1.837   3.087   1.00 0.00 ? 180 HIS A CB   5  
ATOM   9105  C  CG   . HIS A 1 25  ? -18.968 2.911   3.145   1.00 0.00 ? 180 HIS A CG   5  
ATOM   9106  N  ND1  . HIS A 1 25  ? -19.705 3.163   4.291   1.00 0.00 ? 180 HIS A ND1  5  
ATOM   9107  C  CD2  . HIS A 1 25  ? -19.416 3.807   2.206   1.00 0.00 ? 180 HIS A CD2  5  
ATOM   9108  C  CE1  . HIS A 1 25  ? -20.550 4.174   4.016   1.00 0.00 ? 180 HIS A CE1  5  
ATOM   9109  N  NE2  . HIS A 1 25  ? -20.416 4.603   2.759   1.00 0.00 ? 180 HIS A NE2  5  
ATOM   9110  H  H    . HIS A 1 25  ? -16.123 1.353   0.629   1.00 0.00 ? 180 HIS A H    5  
ATOM   9111  H  HA   . HIS A 1 25  ? -16.892 3.240   1.817   1.00 0.00 ? 180 HIS A HA   5  
ATOM   9112  H  HB2  . HIS A 1 25  ? -18.279 1.007   2.498   1.00 0.00 ? 180 HIS A HB2  5  
ATOM   9113  H  HB3  . HIS A 1 25  ? -17.693 1.498   4.087   1.00 0.00 ? 180 HIS A HB3  5  
ATOM   9114  H  HD1  . HIS A 1 25  ? -19.625 2.691   5.146   1.00 0.00 ? 180 HIS A HD1  5  
ATOM   9115  H  HD2  . HIS A 1 25  ? -19.049 3.883   1.193   1.00 0.00 ? 180 HIS A HD2  5  
ATOM   9116  H  HE1  . HIS A 1 25  ? -21.251 4.587   4.725   1.00 0.00 ? 180 HIS A HE1  5  
ATOM   9117  N  N    . PHE A 1 26  ? -16.016 3.728   4.408   1.00 0.00 ? 181 PHE A N    5  
ATOM   9118  C  CA   . PHE A 1 26  ? -15.079 4.172   5.485   1.00 0.00 ? 181 PHE A CA   5  
ATOM   9119  C  C    . PHE A 1 26  ? -15.614 3.722   6.856   1.00 0.00 ? 181 PHE A C    5  
ATOM   9120  O  O    . PHE A 1 26  ? -16.510 4.334   7.405   1.00 0.00 ? 181 PHE A O    5  
ATOM   9121  C  CB   . PHE A 1 26  ? -15.047 5.704   5.378   1.00 0.00 ? 181 PHE A CB   5  
ATOM   9122  C  CG   . PHE A 1 26  ? -14.192 6.291   6.482   1.00 0.00 ? 181 PHE A CG   5  
ATOM   9123  C  CD1  . PHE A 1 26  ? -12.896 5.806   6.710   1.00 0.00 ? 181 PHE A CD1  5  
ATOM   9124  C  CD2  . PHE A 1 26  ? -14.699 7.327   7.277   1.00 0.00 ? 181 PHE A CD2  5  
ATOM   9125  C  CE1  . PHE A 1 26  ? -12.113 6.355   7.731   1.00 0.00 ? 181 PHE A CE1  5  
ATOM   9126  C  CE2  . PHE A 1 26  ? -13.915 7.875   8.296   1.00 0.00 ? 181 PHE A CE2  5  
ATOM   9127  C  CZ   . PHE A 1 26  ? -12.623 7.390   8.524   1.00 0.00 ? 181 PHE A CZ   5  
ATOM   9128  H  H    . PHE A 1 26  ? -16.920 4.112   4.365   1.00 0.00 ? 181 PHE A H    5  
ATOM   9129  H  HA   . PHE A 1 26  ? -14.093 3.769   5.314   1.00 0.00 ? 181 PHE A HA   5  
ATOM   9130  H  HB2  . PHE A 1 26  ? -14.637 5.986   4.420   1.00 0.00 ? 181 PHE A HB2  5  
ATOM   9131  H  HB3  . PHE A 1 26  ? -16.053 6.088   5.462   1.00 0.00 ? 181 PHE A HB3  5  
ATOM   9132  H  HD1  . PHE A 1 26  ? -12.502 5.007   6.099   1.00 0.00 ? 181 PHE A HD1  5  
ATOM   9133  H  HD2  . PHE A 1 26  ? -15.697 7.701   7.102   1.00 0.00 ? 181 PHE A HD2  5  
ATOM   9134  H  HE1  . PHE A 1 26  ? -11.115 5.981   7.907   1.00 0.00 ? 181 PHE A HE1  5  
ATOM   9135  H  HE2  . PHE A 1 26  ? -14.307 8.674   8.909   1.00 0.00 ? 181 PHE A HE2  5  
ATOM   9136  H  HZ   . PHE A 1 26  ? -12.019 7.814   9.312   1.00 0.00 ? 181 PHE A HZ   5  
ATOM   9137  N  N    . GLN A 1 27  ? -15.071 2.658   7.412   1.00 0.00 ? 182 GLN A N    5  
ATOM   9138  C  CA   . GLN A 1 27  ? -15.554 2.180   8.743   1.00 0.00 ? 182 GLN A CA   5  
ATOM   9139  C  C    . GLN A 1 27  ? -14.460 2.386   9.804   1.00 0.00 ? 182 GLN A C    5  
ATOM   9140  O  O    . GLN A 1 27  ? -13.284 2.387   9.492   1.00 0.00 ? 182 GLN A O    5  
ATOM   9141  C  CB   . GLN A 1 27  ? -15.849 0.690   8.549   1.00 0.00 ? 182 GLN A CB   5  
ATOM   9142  C  CG   . GLN A 1 27  ? -16.480 0.112   9.820   1.00 0.00 ? 182 GLN A CG   5  
ATOM   9143  C  CD   . GLN A 1 27  ? -17.616 -0.848  9.442   1.00 0.00 ? 182 GLN A CD   5  
ATOM   9144  O  OE1  . GLN A 1 27  ? -18.751 -0.434  9.310   1.00 0.00 ? 182 GLN A OE1  5  
ATOM   9145  N  NE2  . GLN A 1 27  ? -17.363 -2.121  9.263   1.00 0.00 ? 182 GLN A NE2  5  
ATOM   9146  H  H    . GLN A 1 27  ? -14.346 2.175   6.956   1.00 0.00 ? 182 GLN A H    5  
ATOM   9147  H  HA   . GLN A 1 27  ? -16.455 2.700   9.025   1.00 0.00 ? 182 GLN A HA   5  
ATOM   9148  H  HB2  . GLN A 1 27  ? -16.527 0.565   7.717   1.00 0.00 ? 182 GLN A HB2  5  
ATOM   9149  H  HB3  . GLN A 1 27  ? -14.929 0.168   8.342   1.00 0.00 ? 182 GLN A HB3  5  
ATOM   9150  H  HG2  . GLN A 1 27  ? -15.727 -0.423  10.379  1.00 0.00 ? 182 GLN A HG2  5  
ATOM   9151  H  HG3  . GLN A 1 27  ? -16.876 0.914   10.424  1.00 0.00 ? 182 GLN A HG3  5  
ATOM   9152  H  HE21 . GLN A 1 27  ? -16.450 -2.467  9.368   1.00 0.00 ? 182 GLN A HE21 5  
ATOM   9153  H  HE22 . GLN A 1 27  ? -18.089 -2.732  9.022   1.00 0.00 ? 182 GLN A HE22 5  
ATOM   9154  N  N    . LYS A 1 28  ? -14.835 2.575   11.054  1.00 0.00 ? 183 LYS A N    5  
ATOM   9155  C  CA   . LYS A 1 28  ? -13.793 2.796   12.125  1.00 0.00 ? 183 LYS A CA   5  
ATOM   9156  C  C    . LYS A 1 28  ? -12.731 1.675   12.134  1.00 0.00 ? 183 LYS A C    5  
ATOM   9157  O  O    . LYS A 1 28  ? -11.608 1.899   12.545  1.00 0.00 ? 183 LYS A O    5  
ATOM   9158  C  CB   . LYS A 1 28  ? -14.538 2.828   13.474  1.00 0.00 ? 183 LYS A CB   5  
ATOM   9159  C  CG   . LYS A 1 28  ? -15.269 1.502   13.703  1.00 0.00 ? 183 LYS A CG   5  
ATOM   9160  C  CD   . LYS A 1 28  ? -15.646 1.378   15.181  1.00 0.00 ? 183 LYS A CD   5  
ATOM   9161  C  CE   . LYS A 1 28  ? -14.410 0.985   15.993  1.00 0.00 ? 183 LYS A CE   5  
ATOM   9162  N  NZ   . LYS A 1 28  ? -14.827 1.121   17.416  1.00 0.00 ? 183 LYS A NZ   5  
ATOM   9163  H  H    . LYS A 1 28  ? -15.795 2.582   11.284  1.00 0.00 ? 183 LYS A H    5  
ATOM   9164  H  HA   . LYS A 1 28  ? -13.312 3.743   11.964  1.00 0.00 ? 183 LYS A HA   5  
ATOM   9165  H  HB2  . LYS A 1 28  ? -13.826 2.989   14.271  1.00 0.00 ? 183 LYS A HB2  5  
ATOM   9166  H  HB3  . LYS A 1 28  ? -15.255 3.635   13.466  1.00 0.00 ? 183 LYS A HB3  5  
ATOM   9167  H  HG2  . LYS A 1 28  ? -16.164 1.473   13.099  1.00 0.00 ? 183 LYS A HG2  5  
ATOM   9168  H  HG3  . LYS A 1 28  ? -14.624 0.682   13.430  1.00 0.00 ? 183 LYS A HG3  5  
ATOM   9169  H  HD2  . LYS A 1 28  ? -16.026 2.326   15.535  1.00 0.00 ? 183 LYS A HD2  5  
ATOM   9170  H  HD3  . LYS A 1 28  ? -16.406 0.620   15.296  1.00 0.00 ? 183 LYS A HD3  5  
ATOM   9171  H  HE2  . LYS A 1 28  ? -14.128 -0.036  15.775  1.00 0.00 ? 183 LYS A HE2  5  
ATOM   9172  H  HE3  . LYS A 1 28  ? -13.592 1.656   15.782  1.00 0.00 ? 183 LYS A HE3  5  
ATOM   9173  H  HZ1  . LYS A 1 28  ? -15.599 0.453   17.617  1.00 0.00 ? 183 LYS A HZ1  5  
ATOM   9174  H  HZ2  . LYS A 1 28  ? -15.154 2.093   17.591  1.00 0.00 ? 183 LYS A HZ2  5  
ATOM   9175  H  HZ3  . LYS A 1 28  ? -14.020 0.908   18.036  1.00 0.00 ? 183 LYS A HZ3  5  
ATOM   9176  N  N    . ASP A 1 29  ? -13.063 0.475   11.703  1.00 0.00 ? 184 ASP A N    5  
ATOM   9177  C  CA   . ASP A 1 29  ? -12.048 -0.624  11.720  1.00 0.00 ? 184 ASP A CA   5  
ATOM   9178  C  C    . ASP A 1 29  ? -11.955 -1.331  10.358  1.00 0.00 ? 184 ASP A C    5  
ATOM   9179  O  O    . ASP A 1 29  ? -11.715 -2.523  10.301  1.00 0.00 ? 184 ASP A O    5  
ATOM   9180  C  CB   . ASP A 1 29  ? -12.540 -1.595  12.792  1.00 0.00 ? 184 ASP A CB   5  
ATOM   9181  C  CG   . ASP A 1 29  ? -11.387 -2.500  13.230  1.00 0.00 ? 184 ASP A CG   5  
ATOM   9182  O  OD1  . ASP A 1 29  ? -10.268 -2.016  13.286  1.00 0.00 ? 184 ASP A OD1  5  
ATOM   9183  O  OD2  . ASP A 1 29  ? -11.642 -3.662  13.502  1.00 0.00 ? 184 ASP A OD2  5  
ATOM   9184  H  H    . ASP A 1 29  ? -13.967 0.294   11.383  1.00 0.00 ? 184 ASP A H    5  
ATOM   9185  H  HA   . ASP A 1 29  ? -11.084 -0.231  12.000  1.00 0.00 ? 184 ASP A HA   5  
ATOM   9186  H  HB2  . ASP A 1 29  ? -12.904 -1.038  13.644  1.00 0.00 ? 184 ASP A HB2  5  
ATOM   9187  H  HB3  . ASP A 1 29  ? -13.337 -2.201  12.390  1.00 0.00 ? 184 ASP A HB3  5  
ATOM   9188  N  N    . SER A 1 30  ? -12.117 -0.619  9.260   1.00 0.00 ? 185 SER A N    5  
ATOM   9189  C  CA   . SER A 1 30  ? -12.003 -1.291  7.921   1.00 0.00 ? 185 SER A CA   5  
ATOM   9190  C  C    . SER A 1 30  ? -10.568 -1.142  7.390   1.00 0.00 ? 185 SER A C    5  
ATOM   9191  O  O    . SER A 1 30  ? -9.843  -2.108  7.309   1.00 0.00 ? 185 SER A O    5  
ATOM   9192  C  CB   . SER A 1 30  ? -12.998 -0.584  6.994   1.00 0.00 ? 185 SER A CB   5  
ATOM   9193  O  OG   . SER A 1 30  ? -12.547 -0.695  5.650   1.00 0.00 ? 185 SER A OG   5  
ATOM   9194  H  H    . SER A 1 30  ? -12.293 0.349   9.317   1.00 0.00 ? 185 SER A H    5  
ATOM   9195  H  HA   . SER A 1 30  ? -12.258 -2.335  8.008   1.00 0.00 ? 185 SER A HA   5  
ATOM   9196  H  HB2  . SER A 1 30  ? -13.967 -1.048  7.082   1.00 0.00 ? 185 SER A HB2  5  
ATOM   9197  H  HB3  . SER A 1 30  ? -13.073 0.457   7.275   1.00 0.00 ? 185 SER A HB3  5  
ATOM   9198  H  HG   . SER A 1 30  ? -12.948 0.015   5.143   1.00 0.00 ? 185 SER A HG   5  
ATOM   9199  N  N    . ILE A 1 31  ? -10.149 0.057   7.025   1.00 0.00 ? 186 ILE A N    5  
ATOM   9200  C  CA   . ILE A 1 31  ? -8.740  0.240   6.495   1.00 0.00 ? 186 ILE A CA   5  
ATOM   9201  C  C    . ILE A 1 31  ? -7.700  -0.400  7.431   1.00 0.00 ? 186 ILE A C    5  
ATOM   9202  O  O    . ILE A 1 31  ? -7.957  -0.618  8.600   1.00 0.00 ? 186 ILE A O    5  
ATOM   9203  C  CB   . ILE A 1 31  ? -8.480  1.755   6.401   1.00 0.00 ? 186 ILE A CB   5  
ATOM   9204  C  CG1  . ILE A 1 31  ? -8.695  2.416   7.770   1.00 0.00 ? 186 ILE A CG1  5  
ATOM   9205  C  CG2  . ILE A 1 31  ? -9.424  2.379   5.374   1.00 0.00 ? 186 ILE A CG2  5  
ATOM   9206  C  CD1  . ILE A 1 31  ? -8.273  3.883   7.698   1.00 0.00 ? 186 ILE A CD1  5  
ATOM   9207  H  H    . ILE A 1 31  ? -10.759 0.825   7.090   1.00 0.00 ? 186 ILE A H    5  
ATOM   9208  H  HA   . ILE A 1 31  ? -8.656  -0.201  5.514   1.00 0.00 ? 186 ILE A HA   5  
ATOM   9209  H  HB   . ILE A 1 31  ? -7.461  1.917   6.083   1.00 0.00 ? 186 ILE A HB   5  
ATOM   9210  H  HG12 . ILE A 1 31  ? -9.735  2.359   8.046   1.00 0.00 ? 186 ILE A HG12 5  
ATOM   9211  H  HG13 . ILE A 1 31  ? -8.097  1.909   8.511   1.00 0.00 ? 186 ILE A HG13 5  
ATOM   9212  H  HG21 . ILE A 1 31  ? -9.514  1.719   4.523   1.00 0.00 ? 186 ILE A HG21 5  
ATOM   9213  H  HG22 . ILE A 1 31  ? -9.024  3.330   5.054   1.00 0.00 ? 186 ILE A HG22 5  
ATOM   9214  H  HG23 . ILE A 1 31  ? -10.396 2.529   5.820   1.00 0.00 ? 186 ILE A HG23 5  
ATOM   9215  H  HD11 . ILE A 1 31  ? -9.090  4.474   7.307   1.00 0.00 ? 186 ILE A HD11 5  
ATOM   9216  H  HD12 . ILE A 1 31  ? -7.417  3.980   7.048   1.00 0.00 ? 186 ILE A HD12 5  
ATOM   9217  H  HD13 . ILE A 1 31  ? -8.018  4.233   8.687   1.00 0.00 ? 186 ILE A HD13 5  
ATOM   9218  N  N    . TYR A 1 32  ? -6.523  -0.698  6.918   1.00 0.00 ? 187 TYR A N    5  
ATOM   9219  C  CA   . TYR A 1 32  ? -5.461  -1.320  7.767   1.00 0.00 ? 187 TYR A CA   5  
ATOM   9220  C  C    . TYR A 1 32  ? -4.095  -0.706  7.454   1.00 0.00 ? 187 TYR A C    5  
ATOM   9221  O  O    . TYR A 1 32  ? -3.950  0.071   6.528   1.00 0.00 ? 187 TYR A O    5  
ATOM   9222  C  CB   . TYR A 1 32  ? -5.462  -2.800  7.390   1.00 0.00 ? 187 TYR A CB   5  
ATOM   9223  C  CG   . TYR A 1 32  ? -6.375  -3.559  8.318   1.00 0.00 ? 187 TYR A CG   5  
ATOM   9224  C  CD1  . TYR A 1 32  ? -5.885  -4.074  9.524   1.00 0.00 ? 187 TYR A CD1  5  
ATOM   9225  C  CD2  . TYR A 1 32  ? -7.713  -3.747  7.970   1.00 0.00 ? 187 TYR A CD2  5  
ATOM   9226  C  CE1  . TYR A 1 32  ? -6.738  -4.780  10.380  1.00 0.00 ? 187 TYR A CE1  5  
ATOM   9227  C  CE2  . TYR A 1 32  ? -8.568  -4.453  8.823   1.00 0.00 ? 187 TYR A CE2  5  
ATOM   9228  C  CZ   . TYR A 1 32  ? -8.081  -4.970  10.029  1.00 0.00 ? 187 TYR A CZ   5  
ATOM   9229  O  OH   . TYR A 1 32  ? -8.923  -5.666  10.872  1.00 0.00 ? 187 TYR A OH   5  
ATOM   9230  H  H    . TYR A 1 32  ? -6.337  -0.512  5.971   1.00 0.00 ? 187 TYR A H    5  
ATOM   9231  H  HA   . TYR A 1 32  ? -5.682  -1.206  8.815   1.00 0.00 ? 187 TYR A HA   5  
ATOM   9232  H  HB2  . TYR A 1 32  ? -5.809  -2.912  6.373   1.00 0.00 ? 187 TYR A HB2  5  
ATOM   9233  H  HB3  . TYR A 1 32  ? -4.460  -3.193  7.473   1.00 0.00 ? 187 TYR A HB3  5  
ATOM   9234  H  HD1  . TYR A 1 32  ? -4.849  -3.927  9.793   1.00 0.00 ? 187 TYR A HD1  5  
ATOM   9235  H  HD2  . TYR A 1 32  ? -8.086  -3.352  7.036   1.00 0.00 ? 187 TYR A HD2  5  
ATOM   9236  H  HE1  . TYR A 1 32  ? -6.360  -5.180  11.311  1.00 0.00 ? 187 TYR A HE1  5  
ATOM   9237  H  HE2  . TYR A 1 32  ? -9.603  -4.597  8.549   1.00 0.00 ? 187 TYR A HE2  5  
ATOM   9238  H  HH   . TYR A 1 32  ? -9.377  -5.030  11.429  1.00 0.00 ? 187 TYR A HH   5  
ATOM   9239  N  N    . ARG A 1 33  ? -3.089  -1.056  8.220   1.00 0.00 ? 188 ARG A N    5  
ATOM   9240  C  CA   . ARG A 1 33  ? -1.724  -0.503  7.972   1.00 0.00 ? 188 ARG A CA   5  
ATOM   9241  C  C    . ARG A 1 33  ? -0.773  -1.632  7.559   1.00 0.00 ? 188 ARG A C    5  
ATOM   9242  O  O    . ARG A 1 33  ? -0.841  -2.722  8.096   1.00 0.00 ? 188 ARG A O    5  
ATOM   9243  C  CB   . ARG A 1 33  ? -1.285  0.090   9.314   1.00 0.00 ? 188 ARG A CB   5  
ATOM   9244  C  CG   . ARG A 1 33  ? -1.513  1.603   9.311   1.00 0.00 ? 188 ARG A CG   5  
ATOM   9245  C  CD   . ARG A 1 33  ? -0.708  2.247   10.449  1.00 0.00 ? 188 ARG A CD   5  
ATOM   9246  N  NE   . ARG A 1 33  ? 0.067   3.346   9.807   1.00 0.00 ? 188 ARG A NE   5  
ATOM   9247  C  CZ   . ARG A 1 33  ? -0.012  4.561   10.277  1.00 0.00 ? 188 ARG A CZ   5  
ATOM   9248  N  NH1  . ARG A 1 33  ? -1.179  5.097   10.505  1.00 0.00 ? 188 ARG A NH1  5  
ATOM   9249  N  NH2  . ARG A 1 33  ? 1.076   5.239   10.516  1.00 0.00 ? 188 ARG A NH2  5  
ATOM   9250  H  H    . ARG A 1 33  ? -3.232  -1.692  8.961   1.00 0.00 ? 188 ARG A H    5  
ATOM   9251  H  HA   . ARG A 1 33  ? -1.756  0.265   7.217   1.00 0.00 ? 188 ARG A HA   5  
ATOM   9252  H  HB2  . ARG A 1 33  ? -1.863  -0.359  10.110  1.00 0.00 ? 188 ARG A HB2  5  
ATOM   9253  H  HB3  . ARG A 1 33  ? -0.238  -0.113  9.471   1.00 0.00 ? 188 ARG A HB3  5  
ATOM   9254  H  HG2  . ARG A 1 33  ? -1.193  2.013   8.364   1.00 0.00 ? 188 ARG A HG2  5  
ATOM   9255  H  HG3  . ARG A 1 33  ? -2.561  1.807   9.457   1.00 0.00 ? 188 ARG A HG3  5  
ATOM   9256  H  HD2  . ARG A 1 33  ? -1.378  2.647   11.198  1.00 0.00 ? 188 ARG A HD2  5  
ATOM   9257  H  HD3  . ARG A 1 33  ? -0.034  1.530   10.891  1.00 0.00 ? 188 ARG A HD3  5  
ATOM   9258  H  HE   . ARG A 1 33  ? 0.639   3.156   9.033   1.00 0.00 ? 188 ARG A HE   5  
ATOM   9259  H  HH11 . ARG A 1 33  ? -2.013  4.577   10.321  1.00 0.00 ? 188 ARG A HH11 5  
ATOM   9260  H  HH12 . ARG A 1 33  ? -1.240  6.028   10.865  1.00 0.00 ? 188 ARG A HH12 5  
ATOM   9261  H  HH21 . ARG A 1 33  ? 1.971   4.828   10.341  1.00 0.00 ? 188 ARG A HH21 5  
ATOM   9262  H  HH22 . ARG A 1 33  ? 1.016   6.170   10.876  1.00 0.00 ? 188 ARG A HH22 5  
ATOM   9263  N  N    . HIS A 1 34  ? 0.128   -1.386  6.627   1.00 0.00 ? 189 HIS A N    5  
ATOM   9264  C  CA   . HIS A 1 34  ? 1.083   -2.475  6.228   1.00 0.00 ? 189 HIS A CA   5  
ATOM   9265  C  C    . HIS A 1 34  ? 2.079   -2.680  7.382   1.00 0.00 ? 189 HIS A C    5  
ATOM   9266  O  O    . HIS A 1 34  ? 2.610   -1.715  7.898   1.00 0.00 ? 189 HIS A O    5  
ATOM   9267  C  CB   . HIS A 1 34  ? 1.799   -1.996  4.956   1.00 0.00 ? 189 HIS A CB   5  
ATOM   9268  C  CG   . HIS A 1 34  ? 2.188   -3.187  4.116   1.00 0.00 ? 189 HIS A CG   5  
ATOM   9269  N  ND1  . HIS A 1 34  ? 3.431   -3.785  4.212   1.00 0.00 ? 189 HIS A ND1  5  
ATOM   9270  C  CD2  . HIS A 1 34  ? 1.499   -3.918  3.179   1.00 0.00 ? 189 HIS A CD2  5  
ATOM   9271  C  CE1  . HIS A 1 34  ? 3.452   -4.830  3.370   1.00 0.00 ? 189 HIS A CE1  5  
ATOM   9272  N  NE2  . HIS A 1 34  ? 2.299   -4.957  2.711   1.00 0.00 ? 189 HIS A NE2  5  
ATOM   9273  H  H    . HIS A 1 34  ? 0.185   -0.491  6.214   1.00 0.00 ? 189 HIS A H    5  
ATOM   9274  H  HA   . HIS A 1 34  ? 0.539   -3.386  6.030   1.00 0.00 ? 189 HIS A HA   5  
ATOM   9275  H  HB2  . HIS A 1 34  ? 1.135   -1.358  4.390   1.00 0.00 ? 189 HIS A HB2  5  
ATOM   9276  H  HB3  . HIS A 1 34  ? 2.680   -1.442  5.232   1.00 0.00 ? 189 HIS A HB3  5  
ATOM   9277  H  HD1  . HIS A 1 34  ? 4.167   -3.487  4.765   1.00 0.00 ? 189 HIS A HD1  5  
ATOM   9278  H  HD2  . HIS A 1 34  ? 0.498   -3.708  2.844   1.00 0.00 ? 189 HIS A HD2  5  
ATOM   9279  H  HE1  . HIS A 1 34  ? 4.298   -5.492  3.253   1.00 0.00 ? 189 HIS A HE1  5  
ATOM   9280  N  N    . PRO A 1 35  ? 2.283   -3.916  7.787   1.00 0.00 ? 190 PRO A N    5  
ATOM   9281  C  CA   . PRO A 1 35  ? 3.197   -4.183  8.927   1.00 0.00 ? 190 PRO A CA   5  
ATOM   9282  C  C    . PRO A 1 35  ? 4.668   -3.946  8.542   1.00 0.00 ? 190 PRO A C    5  
ATOM   9283  O  O    . PRO A 1 35  ? 5.450   -3.485  9.353   1.00 0.00 ? 190 PRO A O    5  
ATOM   9284  C  CB   . PRO A 1 35  ? 2.943   -5.654  9.251   1.00 0.00 ? 190 PRO A CB   5  
ATOM   9285  C  CG   . PRO A 1 35  ? 2.436   -6.250  7.980   1.00 0.00 ? 190 PRO A CG   5  
ATOM   9286  C  CD   . PRO A 1 35  ? 1.707   -5.159  7.243   1.00 0.00 ? 190 PRO A CD   5  
ATOM   9287  H  HA   . PRO A 1 35  ? 2.930   -3.574  9.775   1.00 0.00 ? 190 PRO A HA   5  
ATOM   9288  H  HB2  . PRO A 1 35  ? 3.861   -6.136  9.558   1.00 0.00 ? 190 PRO A HB2  5  
ATOM   9289  H  HB3  . PRO A 1 35  ? 2.191   -5.742  10.022  1.00 0.00 ? 190 PRO A HB3  5  
ATOM   9290  H  HG2  . PRO A 1 35  ? 3.266   -6.611  7.386   1.00 0.00 ? 190 PRO A HG2  5  
ATOM   9291  H  HG3  . PRO A 1 35  ? 1.756   -7.060  8.196   1.00 0.00 ? 190 PRO A HG3  5  
ATOM   9292  H  HD2  . PRO A 1 35  ? 1.893   -5.234  6.180   1.00 0.00 ? 190 PRO A HD2  5  
ATOM   9293  H  HD3  . PRO A 1 35  ? 0.650   -5.201  7.451   1.00 0.00 ? 190 PRO A HD3  5  
ATOM   9294  N  N    . SER A 1 36  ? 5.063   -4.269  7.328   1.00 0.00 ? 191 SER A N    5  
ATOM   9295  C  CA   . SER A 1 36  ? 6.500   -4.066  6.933   1.00 0.00 ? 191 SER A CA   5  
ATOM   9296  C  C    . SER A 1 36  ? 6.705   -2.866  5.978   1.00 0.00 ? 191 SER A C    5  
ATOM   9297  O  O    . SER A 1 36  ? 7.732   -2.784  5.332   1.00 0.00 ? 191 SER A O    5  
ATOM   9298  C  CB   . SER A 1 36  ? 6.903   -5.363  6.226   1.00 0.00 ? 191 SER A CB   5  
ATOM   9299  O  OG   . SER A 1 36  ? 6.778   -6.451  7.132   1.00 0.00 ? 191 SER A OG   5  
ATOM   9300  H  H    . SER A 1 36  ? 4.425   -4.658  6.686   1.00 0.00 ? 191 SER A H    5  
ATOM   9301  H  HA   . SER A 1 36  ? 7.107   -3.939  7.815   1.00 0.00 ? 191 SER A HA   5  
ATOM   9302  H  HB2  . SER A 1 36  ? 6.255   -5.530  5.379   1.00 0.00 ? 191 SER A HB2  5  
ATOM   9303  H  HB3  . SER A 1 36  ? 7.926   -5.281  5.883   1.00 0.00 ? 191 SER A HB3  5  
ATOM   9304  H  HG   . SER A 1 36  ? 5.854   -6.710  7.158   1.00 0.00 ? 191 SER A HG   5  
ATOM   9305  N  N    . LEU A 1 37  ? 5.762   -1.944  5.859   1.00 0.00 ? 192 LEU A N    5  
ATOM   9306  C  CA   . LEU A 1 37  ? 5.979   -0.793  4.908   1.00 0.00 ? 192 LEU A CA   5  
ATOM   9307  C  C    . LEU A 1 37  ? 5.513   0.583   5.451   1.00 0.00 ? 192 LEU A C    5  
ATOM   9308  O  O    . LEU A 1 37  ? 5.559   1.551   4.716   1.00 0.00 ? 192 LEU A O    5  
ATOM   9309  C  CB   . LEU A 1 37  ? 5.140   -1.129  3.669   1.00 0.00 ? 192 LEU A CB   5  
ATOM   9310  C  CG   . LEU A 1 37  ? 5.783   -2.239  2.830   1.00 0.00 ? 192 LEU A CG   5  
ATOM   9311  C  CD1  . LEU A 1 37  ? 4.936   -2.441  1.570   1.00 0.00 ? 192 LEU A CD1  5  
ATOM   9312  C  CD2  . LEU A 1 37  ? 7.207   -1.844  2.419   1.00 0.00 ? 192 LEU A CD2  5  
ATOM   9313  H  H    . LEU A 1 37  ? 4.927   -2.016  6.364   1.00 0.00 ? 192 LEU A H    5  
ATOM   9314  H  HA   . LEU A 1 37  ? 7.017   -0.740  4.628   1.00 0.00 ? 192 LEU A HA   5  
ATOM   9315  H  HB2  . LEU A 1 37  ? 4.162   -1.451  3.982   1.00 0.00 ? 192 LEU A HB2  5  
ATOM   9316  H  HB3  . LEU A 1 37  ? 5.040   -0.241  3.061   1.00 0.00 ? 192 LEU A HB3  5  
ATOM   9317  H  HG   . LEU A 1 37  ? 5.807   -3.157  3.401   1.00 0.00 ? 192 LEU A HG   5  
ATOM   9318  H  HD11 . LEU A 1 37  ? 4.023   -2.966  1.823   1.00 0.00 ? 192 LEU A HD11 5  
ATOM   9319  H  HD12 . LEU A 1 37  ? 5.494   -3.016  0.845   1.00 0.00 ? 192 LEU A HD12 5  
ATOM   9320  H  HD13 . LEU A 1 37  ? 4.689   -1.472  1.151   1.00 0.00 ? 192 LEU A HD13 5  
ATOM   9321  H  HD21 . LEU A 1 37  ? 7.896   -2.106  3.209   1.00 0.00 ? 192 LEU A HD21 5  
ATOM   9322  H  HD22 . LEU A 1 37  ? 7.248   -0.779  2.244   1.00 0.00 ? 192 LEU A HD22 5  
ATOM   9323  H  HD23 . LEU A 1 37  ? 7.480   -2.370  1.517   1.00 0.00 ? 192 LEU A HD23 5  
ATOM   9324  N  N    . GLN A 1 38  ? 5.061   0.709   6.693   1.00 0.00 ? 193 GLN A N    5  
ATOM   9325  C  CA   . GLN A 1 38  ? 4.596   2.050   7.197   1.00 0.00 ? 193 GLN A CA   5  
ATOM   9326  C  C    . GLN A 1 38  ? 3.607   2.693   6.200   1.00 0.00 ? 193 GLN A C    5  
ATOM   9327  O  O    . GLN A 1 38  ? 3.651   3.886   5.964   1.00 0.00 ? 193 GLN A O    5  
ATOM   9328  C  CB   . GLN A 1 38  ? 5.867   2.898   7.310   1.00 0.00 ? 193 GLN A CB   5  
ATOM   9329  C  CG   . GLN A 1 38  ? 6.648   2.483   8.558   1.00 0.00 ? 193 GLN A CG   5  
ATOM   9330  C  CD   . GLN A 1 38  ? 7.794   3.474   8.797   1.00 0.00 ? 193 GLN A CD   5  
ATOM   9331  O  OE1  . GLN A 1 38  ? 8.288   4.079   7.867   1.00 0.00 ? 193 GLN A OE1  5  
ATOM   9332  N  NE2  . GLN A 1 38  ? 8.245   3.671   10.013  1.00 0.00 ? 193 GLN A NE2  5  
ATOM   9333  H  H    . GLN A 1 38  ? 5.021   -0.058  7.288   1.00 0.00 ? 193 GLN A H    5  
ATOM   9334  H  HA   . GLN A 1 38  ? 4.135   1.945   8.166   1.00 0.00 ? 193 GLN A HA   5  
ATOM   9335  H  HB2  . GLN A 1 38  ? 6.480   2.746   6.433   1.00 0.00 ? 193 GLN A HB2  5  
ATOM   9336  H  HB3  . GLN A 1 38  ? 5.599   3.942   7.385   1.00 0.00 ? 193 GLN A HB3  5  
ATOM   9337  H  HG2  . GLN A 1 38  ? 5.987   2.483   9.413   1.00 0.00 ? 193 GLN A HG2  5  
ATOM   9338  H  HG3  . GLN A 1 38  ? 7.055   1.493   8.416   1.00 0.00 ? 193 GLN A HG3  5  
ATOM   9339  H  HE21 . GLN A 1 38  ? 7.854   3.188   10.773  1.00 0.00 ? 193 GLN A HE21 5  
ATOM   9340  H  HE22 . GLN A 1 38  ? 8.978   4.305   10.163  1.00 0.00 ? 193 GLN A HE22 5  
ATOM   9341  N  N    . VAL A 1 39  ? 2.731   1.909   5.602   1.00 0.00 ? 194 VAL A N    5  
ATOM   9342  C  CA   . VAL A 1 39  ? 1.767   2.479   4.610   1.00 0.00 ? 194 VAL A CA   5  
ATOM   9343  C  C    . VAL A 1 39  ? 0.344   1.949   4.867   1.00 0.00 ? 194 VAL A C    5  
ATOM   9344  O  O    . VAL A 1 39  ? 0.156   0.985   5.584   1.00 0.00 ? 194 VAL A O    5  
ATOM   9345  C  CB   . VAL A 1 39  ? 2.310   2.032   3.244   1.00 0.00 ? 194 VAL A CB   5  
ATOM   9346  C  CG1  . VAL A 1 39  ? 2.197   0.511   3.082   1.00 0.00 ? 194 VAL A CG1  5  
ATOM   9347  C  CG2  . VAL A 1 39  ? 1.521   2.723   2.133   1.00 0.00 ? 194 VAL A CG2  5  
ATOM   9348  H  H    . VAL A 1 39  ? 2.716   0.945   5.793   1.00 0.00 ? 194 VAL A H    5  
ATOM   9349  H  HA   . VAL A 1 39  ? 1.764   3.555   4.663   1.00 0.00 ? 194 VAL A HA   5  
ATOM   9350  H  HB   . VAL A 1 39  ? 3.351   2.316   3.169   1.00 0.00 ? 194 VAL A HB   5  
ATOM   9351  H  HG11 . VAL A 1 39  ? 1.161   0.216   3.164   1.00 0.00 ? 194 VAL A HG11 5  
ATOM   9352  H  HG12 . VAL A 1 39  ? 2.773   0.022   3.852   1.00 0.00 ? 194 VAL A HG12 5  
ATOM   9353  H  HG13 . VAL A 1 39  ? 2.578   0.224   2.114   1.00 0.00 ? 194 VAL A HG13 5  
ATOM   9354  H  HG21 . VAL A 1 39  ? 0.527   2.305   2.082   1.00 0.00 ? 194 VAL A HG21 5  
ATOM   9355  H  HG22 . VAL A 1 39  ? 2.024   2.576   1.188   1.00 0.00 ? 194 VAL A HG22 5  
ATOM   9356  H  HG23 . VAL A 1 39  ? 1.458   3.781   2.344   1.00 0.00 ? 194 VAL A HG23 5  
ATOM   9357  N  N    . LEU A 1 40  ? -0.660  2.587   4.299   1.00 0.00 ? 195 LEU A N    5  
ATOM   9358  C  CA   . LEU A 1 40  ? -2.074  2.123   4.536   1.00 0.00 ? 195 LEU A CA   5  
ATOM   9359  C  C    . LEU A 1 40  ? -2.551  1.150   3.443   1.00 0.00 ? 195 LEU A C    5  
ATOM   9360  O  O    . LEU A 1 40  ? -2.132  1.223   2.305   1.00 0.00 ? 195 LEU A O    5  
ATOM   9361  C  CB   . LEU A 1 40  ? -2.943  3.386   4.513   1.00 0.00 ? 195 LEU A CB   5  
ATOM   9362  C  CG   . LEU A 1 40  ? -4.236  3.127   5.288   1.00 0.00 ? 195 LEU A CG   5  
ATOM   9363  C  CD1  . LEU A 1 40  ? -4.695  4.421   5.960   1.00 0.00 ? 195 LEU A CD1  5  
ATOM   9364  C  CD2  . LEU A 1 40  ? -5.320  2.638   4.322   1.00 0.00 ? 195 LEU A CD2  5  
ATOM   9365  H  H    . LEU A 1 40  ? -0.484  3.375   3.734   1.00 0.00 ? 195 LEU A H    5  
ATOM   9366  H  HA   . LEU A 1 40  ? -2.149  1.654   5.504   1.00 0.00 ? 195 LEU A HA   5  
ATOM   9367  H  HB2  . LEU A 1 40  ? -2.406  4.202   4.966   1.00 0.00 ? 195 LEU A HB2  5  
ATOM   9368  H  HB3  . LEU A 1 40  ? -3.184  3.637   3.491   1.00 0.00 ? 195 LEU A HB3  5  
ATOM   9369  H  HG   . LEU A 1 40  ? -4.057  2.374   6.041   1.00 0.00 ? 195 LEU A HG   5  
ATOM   9370  H  HD11 . LEU A 1 40  ? -3.860  4.877   6.471   1.00 0.00 ? 195 LEU A HD11 5  
ATOM   9371  H  HD12 . LEU A 1 40  ? -5.475  4.198   6.673   1.00 0.00 ? 195 LEU A HD12 5  
ATOM   9372  H  HD13 . LEU A 1 40  ? -5.075  5.100   5.212   1.00 0.00 ? 195 LEU A HD13 5  
ATOM   9373  H  HD21 . LEU A 1 40  ? -4.856  2.202   3.448   1.00 0.00 ? 195 LEU A HD21 5  
ATOM   9374  H  HD22 . LEU A 1 40  ? -5.939  3.471   4.021   1.00 0.00 ? 195 LEU A HD22 5  
ATOM   9375  H  HD23 . LEU A 1 40  ? -5.930  1.895   4.812   1.00 0.00 ? 195 LEU A HD23 5  
ATOM   9376  N  N    . ILE A 1 41  ? -3.450  0.250   3.789   1.00 0.00 ? 196 ILE A N    5  
ATOM   9377  C  CA   . ILE A 1 41  ? -3.994  -0.725  2.787   1.00 0.00 ? 196 ILE A CA   5  
ATOM   9378  C  C    . ILE A 1 41  ? -5.485  -0.979  3.092   1.00 0.00 ? 196 ILE A C    5  
ATOM   9379  O  O    . ILE A 1 41  ? -6.093  -0.225  3.830   1.00 0.00 ? 196 ILE A O    5  
ATOM   9380  C  CB   . ILE A 1 41  ? -3.150  -2.004  2.944   1.00 0.00 ? 196 ILE A CB   5  
ATOM   9381  C  CG1  . ILE A 1 41  ? -3.138  -2.456  4.412   1.00 0.00 ? 196 ILE A CG1  5  
ATOM   9382  C  CG2  . ILE A 1 41  ? -1.718  -1.729  2.479   1.00 0.00 ? 196 ILE A CG2  5  
ATOM   9383  C  CD1  . ILE A 1 41  ? -2.398  -3.791  4.533   1.00 0.00 ? 196 ILE A CD1  5  
ATOM   9384  H  H    . ILE A 1 41  ? -3.785  0.221   4.716   1.00 0.00 ? 196 ILE A H    5  
ATOM   9385  H  HA   . ILE A 1 41  ? -3.885  -0.333  1.788   1.00 0.00 ? 196 ILE A HA   5  
ATOM   9386  H  HB   . ILE A 1 41  ? -3.566  -2.787  2.332   1.00 0.00 ? 196 ILE A HB   5  
ATOM   9387  H  HG12 . ILE A 1 41  ? -2.637  -1.711  5.013   1.00 0.00 ? 196 ILE A HG12 5  
ATOM   9388  H  HG13 . ILE A 1 41  ? -4.152  -2.576  4.761   1.00 0.00 ? 196 ILE A HG13 5  
ATOM   9389  H  HG21 . ILE A 1 41  ? -1.278  -0.962  3.097   1.00 0.00 ? 196 ILE A HG21 5  
ATOM   9390  H  HG22 . ILE A 1 41  ? -1.732  -1.400  1.449   1.00 0.00 ? 196 ILE A HG22 5  
ATOM   9391  H  HG23 . ILE A 1 41  ? -1.136  -2.633  2.558   1.00 0.00 ? 196 ILE A HG23 5  
ATOM   9392  H  HD11 . ILE A 1 41  ? -1.524  -3.777  3.897   1.00 0.00 ? 196 ILE A HD11 5  
ATOM   9393  H  HD12 . ILE A 1 41  ? -3.052  -4.594  4.228   1.00 0.00 ? 196 ILE A HD12 5  
ATOM   9394  H  HD13 . ILE A 1 41  ? -2.094  -3.942  5.558   1.00 0.00 ? 196 ILE A HD13 5  
ATOM   9395  N  N    . CYS A 1 42  ? -6.086  -2.013  2.541   1.00 0.00 ? 197 CYS A N    5  
ATOM   9396  C  CA   . CYS A 1 42  ? -7.533  -2.268  2.821   1.00 0.00 ? 197 CYS A CA   5  
ATOM   9397  C  C    . CYS A 1 42  ? -7.705  -3.569  3.632   1.00 0.00 ? 197 CYS A C    5  
ATOM   9398  O  O    . CYS A 1 42  ? -6.810  -4.392  3.682   1.00 0.00 ? 197 CYS A O    5  
ATOM   9399  C  CB   . CYS A 1 42  ? -8.211  -2.344  1.436   1.00 0.00 ? 197 CYS A CB   5  
ATOM   9400  S  SG   . CYS A 1 42  ? -7.704  -3.830  0.517   1.00 0.00 ? 197 CYS A SG   5  
ATOM   9401  H  H    . CYS A 1 42  ? -5.597  -2.613  1.949   1.00 0.00 ? 197 CYS A H    5  
ATOM   9402  H  HA   . CYS A 1 42  ? -7.947  -1.436  3.377   1.00 0.00 ? 197 CYS A HA   5  
ATOM   9403  H  HB2  . CYS A 1 42  ? -9.282  -2.362  1.567   1.00 0.00 ? 197 CYS A HB2  5  
ATOM   9404  H  HB3  . CYS A 1 42  ? -7.942  -1.467  0.867   1.00 0.00 ? 197 CYS A HB3  5  
ATOM   9405  N  N    . LYS A 1 43  ? -8.841  -3.757  4.282   1.00 0.00 ? 198 LYS A N    5  
ATOM   9406  C  CA   . LYS A 1 43  ? -9.048  -5.012  5.106   1.00 0.00 ? 198 LYS A CA   5  
ATOM   9407  C  C    . LYS A 1 43  ? -8.712  -6.270  4.292   1.00 0.00 ? 198 LYS A C    5  
ATOM   9408  O  O    . LYS A 1 43  ? -8.103  -7.192  4.805   1.00 0.00 ? 198 LYS A O    5  
ATOM   9409  C  CB   . LYS A 1 43  ? -10.526 -5.018  5.527   1.00 0.00 ? 198 LYS A CB   5  
ATOM   9410  C  CG   . LYS A 1 43  ? -10.806 -6.232  6.419   1.00 0.00 ? 198 LYS A CG   5  
ATOM   9411  C  CD   . LYS A 1 43  ? -12.309 -6.336  6.682   1.00 0.00 ? 198 LYS A CD   5  
ATOM   9412  C  CE   . LYS A 1 43  ? -12.943 -7.280  5.656   1.00 0.00 ? 198 LYS A CE   5  
ATOM   9413  N  NZ   . LYS A 1 43  ? -13.996 -8.015  6.411   1.00 0.00 ? 198 LYS A NZ   5  
ATOM   9414  H  H    . LYS A 1 43  ? -9.548  -3.069  4.238   1.00 0.00 ? 198 LYS A H    5  
ATOM   9415  H  HA   . LYS A 1 43  ? -8.428  -4.979  5.980   1.00 0.00 ? 198 LYS A HA   5  
ATOM   9416  H  HB2  . LYS A 1 43  ? -10.742 -4.112  6.075   1.00 0.00 ? 198 LYS A HB2  5  
ATOM   9417  H  HB3  . LYS A 1 43  ? -11.152 -5.067  4.648   1.00 0.00 ? 198 LYS A HB3  5  
ATOM   9418  H  HG2  . LYS A 1 43  ? -10.462 -7.129  5.925   1.00 0.00 ? 198 LYS A HG2  5  
ATOM   9419  H  HG3  . LYS A 1 43  ? -10.285 -6.115  7.357   1.00 0.00 ? 198 LYS A HG3  5  
ATOM   9420  H  HD2  . LYS A 1 43  ? -12.474 -6.722  7.678   1.00 0.00 ? 198 LYS A HD2  5  
ATOM   9421  H  HD3  . LYS A 1 43  ? -12.759 -5.359  6.595   1.00 0.00 ? 198 LYS A HD3  5  
ATOM   9422  H  HE2  . LYS A 1 43  ? -13.383 -6.713  4.848   1.00 0.00 ? 198 LYS A HE2  5  
ATOM   9423  H  HE3  . LYS A 1 43  ? -12.208 -7.972  5.278   1.00 0.00 ? 198 LYS A HE3  5  
ATOM   9424  H  HZ1  . LYS A 1 43  ? -14.587 -8.554  5.747   1.00 0.00 ? 198 LYS A HZ1  5  
ATOM   9425  H  HZ2  . LYS A 1 43  ? -14.588 -7.335  6.931   1.00 0.00 ? 198 LYS A HZ2  5  
ATOM   9426  H  HZ3  . LYS A 1 43  ? -13.548 -8.669  7.083   1.00 0.00 ? 198 LYS A HZ3  5  
ATOM   9427  N  N    . ASN A 1 44  ? -9.084  -6.315  3.034   1.00 0.00 ? 199 ASN A N    5  
ATOM   9428  C  CA   . ASN A 1 44  ? -8.749  -7.533  2.212   1.00 0.00 ? 199 ASN A CA   5  
ATOM   9429  C  C    . ASN A 1 44  ? -7.224  -7.722  2.128   1.00 0.00 ? 199 ASN A C    5  
ATOM   9430  O  O    . ASN A 1 44  ? -6.754  -8.834  1.987   1.00 0.00 ? 199 ASN A O    5  
ATOM   9431  C  CB   . ASN A 1 44  ? -9.339  -7.305  0.812   1.00 0.00 ? 199 ASN A CB   5  
ATOM   9432  C  CG   . ASN A 1 44  ? -10.868 -7.418  0.875   1.00 0.00 ? 199 ASN A CG   5  
ATOM   9433  O  OD1  . ASN A 1 44  ? -11.532 -6.507  1.326   1.00 0.00 ? 199 ASN A OD1  5  
ATOM   9434  N  ND2  . ASN A 1 44  ? -11.463 -8.504  0.443   1.00 0.00 ? 199 ASN A ND2  5  
ATOM   9435  H  H    . ASN A 1 44  ? -9.565  -5.553  2.635   1.00 0.00 ? 199 ASN A H    5  
ATOM   9436  H  HA   . ASN A 1 44  ? -9.195  -8.405  2.662   1.00 0.00 ? 199 ASN A HA   5  
ATOM   9437  H  HB2  . ASN A 1 44  ? -9.065  -6.321  0.462   1.00 0.00 ? 199 ASN A HB2  5  
ATOM   9438  H  HB3  . ASN A 1 44  ? -8.954  -8.051  0.133   1.00 0.00 ? 199 ASN A HB3  5  
ATOM   9439  H  HD21 . ASN A 1 44  ? -10.935 -9.247  0.077   1.00 0.00 ? 199 ASN A HD21 5  
ATOM   9440  H  HD22 . ASN A 1 44  ? -12.439 -8.573  0.485   1.00 0.00 ? 199 ASN A HD22 5  
ATOM   9441  N  N    . CYS A 1 45  ? -6.443  -6.663  2.229   1.00 0.00 ? 200 CYS A N    5  
ATOM   9442  C  CA   . CYS A 1 45  ? -4.949  -6.832  2.170   1.00 0.00 ? 200 CYS A CA   5  
ATOM   9443  C  C    . CYS A 1 45  ? -4.463  -7.386  3.511   1.00 0.00 ? 200 CYS A C    5  
ATOM   9444  O  O    . CYS A 1 45  ? -3.767  -8.381  3.560   1.00 0.00 ? 200 CYS A O    5  
ATOM   9445  C  CB   . CYS A 1 45  ? -4.346  -5.436  1.927   1.00 0.00 ? 200 CYS A CB   5  
ATOM   9446  S  SG   . CYS A 1 45  ? -4.178  -5.141  0.150   1.00 0.00 ? 200 CYS A SG   5  
ATOM   9447  H  H    . CYS A 1 45  ? -6.833  -5.774  2.361   1.00 0.00 ? 200 CYS A H    5  
ATOM   9448  H  HA   . CYS A 1 45  ? -4.678  -7.500  1.369   1.00 0.00 ? 200 CYS A HA   5  
ATOM   9449  H  HB2  . CYS A 1 45  ? -4.990  -4.683  2.356   1.00 0.00 ? 200 CYS A HB2  5  
ATOM   9450  H  HB3  . CYS A 1 45  ? -3.373  -5.381  2.392   1.00 0.00 ? 200 CYS A HB3  5  
ATOM   9451  N  N    . PHE A 1 46  ? -4.834  -6.752  4.601   1.00 0.00 ? 201 PHE A N    5  
ATOM   9452  C  CA   . PHE A 1 46  ? -4.390  -7.258  5.949   1.00 0.00 ? 201 PHE A CA   5  
ATOM   9453  C  C    . PHE A 1 46  ? -4.927  -8.677  6.183   1.00 0.00 ? 201 PHE A C    5  
ATOM   9454  O  O    . PHE A 1 46  ? -4.247  -9.501  6.767   1.00 0.00 ? 201 PHE A O    5  
ATOM   9455  C  CB   . PHE A 1 46  ? -4.960  -6.287  6.999   1.00 0.00 ? 201 PHE A CB   5  
ATOM   9456  C  CG   . PHE A 1 46  ? -4.031  -6.204  8.187   1.00 0.00 ? 201 PHE A CG   5  
ATOM   9457  C  CD1  . PHE A 1 46  ? -2.917  -5.354  8.151   1.00 0.00 ? 201 PHE A CD1  5  
ATOM   9458  C  CD2  . PHE A 1 46  ? -4.285  -6.973  9.328   1.00 0.00 ? 201 PHE A CD2  5  
ATOM   9459  C  CE1  . PHE A 1 46  ? -2.060  -5.274  9.257   1.00 0.00 ? 201 PHE A CE1  5  
ATOM   9460  C  CE2  . PHE A 1 46  ? -3.429  -6.893  10.433  1.00 0.00 ? 201 PHE A CE2  5  
ATOM   9461  C  CZ   . PHE A 1 46  ? -2.316  -6.045  10.397  1.00 0.00 ? 201 PHE A CZ   5  
ATOM   9462  H  H    . PHE A 1 46  ? -5.405  -5.952  4.529   1.00 0.00 ? 201 PHE A H    5  
ATOM   9463  H  HA   . PHE A 1 46  ? -3.313  -7.265  5.999   1.00 0.00 ? 201 PHE A HA   5  
ATOM   9464  H  HB2  . PHE A 1 46  ? -5.068  -5.306  6.561   1.00 0.00 ? 201 PHE A HB2  5  
ATOM   9465  H  HB3  . PHE A 1 46  ? -5.928  -6.640  7.325   1.00 0.00 ? 201 PHE A HB3  5  
ATOM   9466  H  HD1  . PHE A 1 46  ? -2.719  -4.758  7.271   1.00 0.00 ? 201 PHE A HD1  5  
ATOM   9467  H  HD2  . PHE A 1 46  ? -5.144  -7.628  9.357   1.00 0.00 ? 201 PHE A HD2  5  
ATOM   9468  H  HE1  . PHE A 1 46  ? -1.199  -4.619  9.229   1.00 0.00 ? 201 PHE A HE1  5  
ATOM   9469  H  HE2  . PHE A 1 46  ? -3.629  -7.485  11.314  1.00 0.00 ? 201 PHE A HE2  5  
ATOM   9470  H  HZ   . PHE A 1 46  ? -1.656  -5.983  11.249  1.00 0.00 ? 201 PHE A HZ   5  
ATOM   9471  N  N    . LYS A 1 47  ? -6.126  -8.987  5.723   1.00 0.00 ? 202 LYS A N    5  
ATOM   9472  C  CA   . LYS A 1 47  ? -6.650  -10.381 5.930   1.00 0.00 ? 202 LYS A CA   5  
ATOM   9473  C  C    . LYS A 1 47  ? -6.017  -11.317 4.896   1.00 0.00 ? 202 LYS A C    5  
ATOM   9474  O  O    . LYS A 1 47  ? -5.674  -12.436 5.213   1.00 0.00 ? 202 LYS A O    5  
ATOM   9475  C  CB   . LYS A 1 47  ? -8.175  -10.318 5.749   1.00 0.00 ? 202 LYS A CB   5  
ATOM   9476  C  CG   . LYS A 1 47  ? -8.826  -9.867  7.061   1.00 0.00 ? 202 LYS A CG   5  
ATOM   9477  C  CD   . LYS A 1 47  ? -9.135  -11.089 7.938   1.00 0.00 ? 202 LYS A CD   5  
ATOM   9478  C  CE   . LYS A 1 47  ? -10.649 -11.323 7.989   1.00 0.00 ? 202 LYS A CE   5  
ATOM   9479  N  NZ   . LYS A 1 47  ? -10.811 -12.803 7.934   1.00 0.00 ? 202 LYS A NZ   5  
ATOM   9480  H  H    . LYS A 1 47  ? -6.666  -8.318  5.233   1.00 0.00 ? 202 LYS A H    5  
ATOM   9481  H  HA   . LYS A 1 47  ? -6.406  -10.725 6.924   1.00 0.00 ? 202 LYS A HA   5  
ATOM   9482  H  HB2  . LYS A 1 47  ? -8.416  -9.614  4.965   1.00 0.00 ? 202 LYS A HB2  5  
ATOM   9483  H  HB3  . LYS A 1 47  ? -8.547  -11.296 5.483   1.00 0.00 ? 202 LYS A HB3  5  
ATOM   9484  H  HG2  . LYS A 1 47  ? -8.148  -9.210  7.587   1.00 0.00 ? 202 LYS A HG2  5  
ATOM   9485  H  HG3  . LYS A 1 47  ? -9.741  -9.337  6.842   1.00 0.00 ? 202 LYS A HG3  5  
ATOM   9486  H  HD2  . LYS A 1 47  ? -8.651  -11.963 7.528   1.00 0.00 ? 202 LYS A HD2  5  
ATOM   9487  H  HD3  . LYS A 1 47  ? -8.769  -10.913 8.938   1.00 0.00 ? 202 LYS A HD3  5  
ATOM   9488  H  HE2  . LYS A 1 47  ? -11.058 -10.931 8.910   1.00 0.00 ? 202 LYS A HE2  5  
ATOM   9489  H  HE3  . LYS A 1 47  ? -11.129 -10.867 7.138   1.00 0.00 ? 202 LYS A HE3  5  
ATOM   9490  H  HZ1  . LYS A 1 47  ? -10.188 -13.247 8.638   1.00 0.00 ? 202 LYS A HZ1  5  
ATOM   9491  H  HZ2  . LYS A 1 47  ? -10.560 -13.143 6.983   1.00 0.00 ? 202 LYS A HZ2  5  
ATOM   9492  H  HZ3  . LYS A 1 47  ? -11.798 -13.052 8.143   1.00 0.00 ? 202 LYS A HZ3  5  
ATOM   9493  N  N    . TYR A 1 48  ? -5.835  -10.868 3.671   1.00 0.00 ? 203 TYR A N    5  
ATOM   9494  C  CA   . TYR A 1 48  ? -5.188  -11.761 2.649   1.00 0.00 ? 203 TYR A CA   5  
ATOM   9495  C  C    . TYR A 1 48  ? -3.697  -11.938 2.989   1.00 0.00 ? 203 TYR A C    5  
ATOM   9496  O  O    . TYR A 1 48  ? -3.138  -12.995 2.763   1.00 0.00 ? 203 TYR A O    5  
ATOM   9497  C  CB   . TYR A 1 48  ? -5.358  -11.065 1.288   1.00 0.00 ? 203 TYR A CB   5  
ATOM   9498  C  CG   . TYR A 1 48  ? -4.741  -11.901 0.191   1.00 0.00 ? 203 TYR A CG   5  
ATOM   9499  C  CD1  . TYR A 1 48  ? -5.082  -13.253 0.058   1.00 0.00 ? 203 TYR A CD1  5  
ATOM   9500  C  CD2  . TYR A 1 48  ? -3.830  -11.319 -0.696  1.00 0.00 ? 203 TYR A CD2  5  
ATOM   9501  C  CE1  . TYR A 1 48  ? -4.511  -14.022 -0.962  1.00 0.00 ? 203 TYR A CE1  5  
ATOM   9502  C  CE2  . TYR A 1 48  ? -3.258  -12.087 -1.717  1.00 0.00 ? 203 TYR A CE2  5  
ATOM   9503  C  CZ   . TYR A 1 48  ? -3.599  -13.439 -1.850  1.00 0.00 ? 203 TYR A CZ   5  
ATOM   9504  O  OH   . TYR A 1 48  ? -3.035  -14.196 -2.856  1.00 0.00 ? 203 TYR A OH   5  
ATOM   9505  H  H    . TYR A 1 48  ? -6.103  -9.949  3.434   1.00 0.00 ? 203 TYR A H    5  
ATOM   9506  H  HA   . TYR A 1 48  ? -5.679  -12.724 2.636   1.00 0.00 ? 203 TYR A HA   5  
ATOM   9507  H  HB2  . TYR A 1 48  ? -6.410  -10.930 1.085   1.00 0.00 ? 203 TYR A HB2  5  
ATOM   9508  H  HB3  . TYR A 1 48  ? -4.873  -10.101 1.317   1.00 0.00 ? 203 TYR A HB3  5  
ATOM   9509  H  HD1  . TYR A 1 48  ? -5.786  -13.702 0.744   1.00 0.00 ? 203 TYR A HD1  5  
ATOM   9510  H  HD2  . TYR A 1 48  ? -3.569  -10.273 -0.591  1.00 0.00 ? 203 TYR A HD2  5  
ATOM   9511  H  HE1  . TYR A 1 48  ? -4.773  -15.064 -1.064  1.00 0.00 ? 203 TYR A HE1  5  
ATOM   9512  H  HE2  . TYR A 1 48  ? -2.556  -11.637 -2.402  1.00 0.00 ? 203 TYR A HE2  5  
ATOM   9513  H  HH   . TYR A 1 48  ? -3.524  -14.026 -3.665  1.00 0.00 ? 203 TYR A HH   5  
ATOM   9514  N  N    . TYR A 1 49  ? -3.043  -10.926 3.543   1.00 0.00 ? 204 TYR A N    5  
ATOM   9515  C  CA   . TYR A 1 49  ? -1.587  -11.096 3.895   1.00 0.00 ? 204 TYR A CA   5  
ATOM   9516  C  C    . TYR A 1 49  ? -1.432  -12.234 4.918   1.00 0.00 ? 204 TYR A C    5  
ATOM   9517  O  O    . TYR A 1 49  ? -0.481  -12.992 4.864   1.00 0.00 ? 204 TYR A O    5  
ATOM   9518  C  CB   . TYR A 1 49  ? -1.105  -9.761  4.499   1.00 0.00 ? 204 TYR A CB   5  
ATOM   9519  C  CG   . TYR A 1 49  ? 0.351   -9.520  4.159   1.00 0.00 ? 204 TYR A CG   5  
ATOM   9520  C  CD1  . TYR A 1 49  ? 0.806   -9.674  2.841   1.00 0.00 ? 204 TYR A CD1  5  
ATOM   9521  C  CD2  . TYR A 1 49  ? 1.244   -9.130  5.165   1.00 0.00 ? 204 TYR A CD2  5  
ATOM   9522  C  CE1  . TYR A 1 49  ? 2.152   -9.442  2.533   1.00 0.00 ? 204 TYR A CE1  5  
ATOM   9523  C  CE2  . TYR A 1 49  ? 2.590   -8.896  4.856   1.00 0.00 ? 204 TYR A CE2  5  
ATOM   9524  C  CZ   . TYR A 1 49  ? 3.043   -9.053  3.541   1.00 0.00 ? 204 TYR A CZ   5  
ATOM   9525  O  OH   . TYR A 1 49  ? 4.369   -8.822  3.236   1.00 0.00 ? 204 TYR A OH   5  
ATOM   9526  H  H    . TYR A 1 49  ? -3.508  -10.073 3.732   1.00 0.00 ? 204 TYR A H    5  
ATOM   9527  H  HA   . TYR A 1 49  ? -1.022  -11.326 3.009   1.00 0.00 ? 204 TYR A HA   5  
ATOM   9528  H  HB2  . TYR A 1 49  ? -1.699  -8.953  4.101   1.00 0.00 ? 204 TYR A HB2  5  
ATOM   9529  H  HB3  . TYR A 1 49  ? -1.221  -9.792  5.572   1.00 0.00 ? 204 TYR A HB3  5  
ATOM   9530  H  HD1  . TYR A 1 49  ? 0.119   -9.974  2.064   1.00 0.00 ? 204 TYR A HD1  5  
ATOM   9531  H  HD2  . TYR A 1 49  ? 0.895   -9.010  6.179   1.00 0.00 ? 204 TYR A HD2  5  
ATOM   9532  H  HE1  . TYR A 1 49  ? 2.501   -9.564  1.519   1.00 0.00 ? 204 TYR A HE1  5  
ATOM   9533  H  HE2  . TYR A 1 49  ? 3.276   -8.594  5.632   1.00 0.00 ? 204 TYR A HE2  5  
ATOM   9534  H  HH   . TYR A 1 49  ? 4.784   -9.669  3.052   1.00 0.00 ? 204 TYR A HH   5  
ATOM   9535  N  N    . MET A 1 50  ? -2.364  -12.372 5.843   1.00 0.00 ? 205 MET A N    5  
ATOM   9536  C  CA   . MET A 1 50  ? -2.255  -13.480 6.850   1.00 0.00 ? 205 MET A CA   5  
ATOM   9537  C  C    . MET A 1 50  ? -3.085  -14.695 6.394   1.00 0.00 ? 205 MET A C    5  
ATOM   9538  O  O    . MET A 1 50  ? -2.658  -15.826 6.529   1.00 0.00 ? 205 MET A O    5  
ATOM   9539  C  CB   . MET A 1 50  ? -2.805  -12.909 8.167   1.00 0.00 ? 205 MET A CB   5  
ATOM   9540  C  CG   . MET A 1 50  ? -2.745  -13.978 9.260   1.00 0.00 ? 205 MET A CG   5  
ATOM   9541  S  SD   . MET A 1 50  ? -3.041  -13.211 10.873  1.00 0.00 ? 205 MET A SD   5  
ATOM   9542  C  CE   . MET A 1 50  ? -4.839  -13.420 10.897  1.00 0.00 ? 205 MET A CE   5  
ATOM   9543  H  H    . MET A 1 50  ? -3.134  -11.754 5.869   1.00 0.00 ? 205 MET A H    5  
ATOM   9544  H  HA   . MET A 1 50  ? -1.226  -13.765 6.977   1.00 0.00 ? 205 MET A HA   5  
ATOM   9545  H  HB2  . MET A 1 50  ? -2.211  -12.057 8.464   1.00 0.00 ? 205 MET A HB2  5  
ATOM   9546  H  HB3  . MET A 1 50  ? -3.830  -12.600 8.024   1.00 0.00 ? 205 MET A HB3  5  
ATOM   9547  H  HG2  . MET A 1 50  ? -3.502  -14.725 9.072   1.00 0.00 ? 205 MET A HG2  5  
ATOM   9548  H  HG3  . MET A 1 50  ? -1.771  -14.444 9.255   1.00 0.00 ? 205 MET A HG3  5  
ATOM   9549  H  HE1  . MET A 1 50  ? -5.306  -12.559 10.441  1.00 0.00 ? 205 MET A HE1  5  
ATOM   9550  H  HE2  . MET A 1 50  ? -5.178  -13.512 11.916  1.00 0.00 ? 205 MET A HE2  5  
ATOM   9551  H  HE3  . MET A 1 50  ? -5.103  -14.313 10.348  1.00 0.00 ? 205 MET A HE3  5  
ATOM   9552  N  N    . SER A 1 51  ? -4.267  -14.471 5.860   1.00 0.00 ? 206 SER A N    5  
ATOM   9553  C  CA   . SER A 1 51  ? -5.117  -15.632 5.401   1.00 0.00 ? 206 SER A CA   5  
ATOM   9554  C  C    . SER A 1 51  ? -4.396  -16.451 4.317   1.00 0.00 ? 206 SER A C    5  
ATOM   9555  O  O    . SER A 1 51  ? -4.563  -17.654 4.241   1.00 0.00 ? 206 SER A O    5  
ATOM   9556  C  CB   . SER A 1 51  ? -6.412  -15.038 4.829   1.00 0.00 ? 206 SER A CB   5  
ATOM   9557  O  OG   . SER A 1 51  ? -7.227  -16.087 4.325   1.00 0.00 ? 206 SER A OG   5  
ATOM   9558  H  H    . SER A 1 51  ? -4.593  -13.545 5.765   1.00 0.00 ? 206 SER A H    5  
ATOM   9559  H  HA   . SER A 1 51  ? -5.350  -16.264 6.237   1.00 0.00 ? 206 SER A HA   5  
ATOM   9560  H  HB2  . SER A 1 51  ? -6.946  -14.516 5.607   1.00 0.00 ? 206 SER A HB2  5  
ATOM   9561  H  HB3  . SER A 1 51  ? -6.168  -14.343 4.035   1.00 0.00 ? 206 SER A HB3  5  
ATOM   9562  H  HG   . SER A 1 51  ? -7.858  -15.704 3.711   1.00 0.00 ? 206 SER A HG   5  
ATOM   9563  N  N    . ASP A 1 52  ? -3.603  -15.820 3.474   1.00 0.00 ? 207 ASP A N    5  
ATOM   9564  C  CA   . ASP A 1 52  ? -2.895  -16.590 2.401   1.00 0.00 ? 207 ASP A CA   5  
ATOM   9565  C  C    . ASP A 1 52  ? -1.408  -16.764 2.750   1.00 0.00 ? 207 ASP A C    5  
ATOM   9566  O  O    . ASP A 1 52  ? -0.810  -15.908 3.373   1.00 0.00 ? 207 ASP A O    5  
ATOM   9567  C  CB   . ASP A 1 52  ? -3.051  -15.758 1.125   1.00 0.00 ? 207 ASP A CB   5  
ATOM   9568  C  CG   . ASP A 1 52  ? -3.057  -16.686 -0.093  1.00 0.00 ? 207 ASP A CG   5  
ATOM   9569  O  OD1  . ASP A 1 52  ? -4.079  -17.304 -0.337  1.00 0.00 ? 207 ASP A OD1  5  
ATOM   9570  O  OD2  . ASP A 1 52  ? -2.037  -16.760 -0.759  1.00 0.00 ? 207 ASP A OD2  5  
ATOM   9571  H  H    . ASP A 1 52  ? -3.478  -14.848 3.543   1.00 0.00 ? 207 ASP A H    5  
ATOM   9572  H  HA   . ASP A 1 52  ? -3.358  -17.555 2.267   1.00 0.00 ? 207 ASP A HA   5  
ATOM   9573  H  HB2  . ASP A 1 52  ? -3.982  -15.212 1.166   1.00 0.00 ? 207 ASP A HB2  5  
ATOM   9574  H  HB3  . ASP A 1 52  ? -2.228  -15.065 1.043   1.00 0.00 ? 207 ASP A HB3  5  
ATOM   9575  N  N    . ASP A 1 53  ? -0.807  -17.867 2.349   1.00 0.00 ? 208 ASP A N    5  
ATOM   9576  C  CA   . ASP A 1 53  ? 0.638   -18.091 2.655   1.00 0.00 ? 208 ASP A CA   5  
ATOM   9577  C  C    . ASP A 1 53  ? 1.453   -18.115 1.356   1.00 0.00 ? 208 ASP A C    5  
ATOM   9578  O  O    . ASP A 1 53  ? 0.924   -18.387 0.294   1.00 0.00 ? 208 ASP A O    5  
ATOM   9579  C  CB   . ASP A 1 53  ? 0.694   -19.453 3.350   1.00 0.00 ? 208 ASP A CB   5  
ATOM   9580  C  CG   . ASP A 1 53  ? 0.523   -19.265 4.858   1.00 0.00 ? 208 ASP A CG   5  
ATOM   9581  O  OD1  . ASP A 1 53  ? 1.502   -18.935 5.509   1.00 0.00 ? 208 ASP A OD1  5  
ATOM   9582  O  OD2  . ASP A 1 53  ? -0.583  -19.452 5.337   1.00 0.00 ? 208 ASP A OD2  5  
ATOM   9583  H  H    . ASP A 1 53  ? -1.307  -18.548 1.843   1.00 0.00 ? 208 ASP A H    5  
ATOM   9584  H  HA   . ASP A 1 53  ? 1.012   -17.324 3.315   1.00 0.00 ? 208 ASP A HA   5  
ATOM   9585  H  HB2  . ASP A 1 53  ? -0.099  -20.082 2.973   1.00 0.00 ? 208 ASP A HB2  5  
ATOM   9586  H  HB3  . ASP A 1 53  ? 1.648   -19.919 3.153   1.00 0.00 ? 208 ASP A HB3  5  
ATOM   9587  N  N    . ILE A 1 54  ? 2.736   -17.833 1.429   1.00 0.00 ? 209 ILE A N    5  
ATOM   9588  C  CA   . ILE A 1 54  ? 3.575   -17.842 0.189   1.00 0.00 ? 209 ILE A CA   5  
ATOM   9589  C  C    . ILE A 1 54  ? 4.503   -19.068 0.182   1.00 0.00 ? 209 ILE A C    5  
ATOM   9590  O  O    . ILE A 1 54  ? 4.982   -19.494 1.217   1.00 0.00 ? 209 ILE A O    5  
ATOM   9591  C  CB   . ILE A 1 54  ? 4.394   -16.542 0.240   1.00 0.00 ? 209 ILE A CB   5  
ATOM   9592  C  CG1  . ILE A 1 54  ? 3.444   -15.331 0.278   1.00 0.00 ? 209 ILE A CG1  5  
ATOM   9593  C  CG2  . ILE A 1 54  ? 5.312   -16.449 -0.989  1.00 0.00 ? 209 ILE A CG2  5  
ATOM   9594  C  CD1  . ILE A 1 54  ? 2.550   -15.308 -0.971  1.00 0.00 ? 209 ILE A CD1  5  
ATOM   9595  H  H    . ILE A 1 54  ? 3.146   -17.615 2.298   1.00 0.00 ? 209 ILE A H    5  
ATOM   9596  H  HA   . ILE A 1 54  ? 2.947   -17.844 -0.687  1.00 0.00 ? 209 ILE A HA   5  
ATOM   9597  H  HB   . ILE A 1 54  ? 5.002   -16.545 1.133   1.00 0.00 ? 209 ILE A HB   5  
ATOM   9598  H  HG12 . ILE A 1 54  ? 2.822   -15.394 1.159   1.00 0.00 ? 209 ILE A HG12 5  
ATOM   9599  H  HG13 . ILE A 1 54  ? 4.025   -14.423 0.316   1.00 0.00 ? 209 ILE A HG13 5  
ATOM   9600  H  HG21 . ILE A 1 54  ? 5.422   -17.424 -1.437  1.00 0.00 ? 209 ILE A HG21 5  
ATOM   9601  H  HG22 . ILE A 1 54  ? 6.284   -16.083 -0.688  1.00 0.00 ? 209 ILE A HG22 5  
ATOM   9602  H  HG23 . ILE A 1 54  ? 4.883   -15.770 -1.708  1.00 0.00 ? 209 ILE A HG23 5  
ATOM   9603  H  HD11 . ILE A 1 54  ? 2.286   -14.285 -1.207  1.00 0.00 ? 209 ILE A HD11 5  
ATOM   9604  H  HD12 . ILE A 1 54  ? 1.652   -15.876 -0.781  1.00 0.00 ? 209 ILE A HD12 5  
ATOM   9605  H  HD13 . ILE A 1 54  ? 3.081   -15.743 -1.805  1.00 0.00 ? 209 ILE A HD13 5  
ATOM   9606  N  N    . SER A 1 55  ? 4.762   -19.639 -0.978  1.00 0.00 ? 210 SER A N    5  
ATOM   9607  C  CA   . SER A 1 55  ? 5.659   -20.830 -1.044  1.00 0.00 ? 210 SER A CA   5  
ATOM   9608  C  C    . SER A 1 55  ? 6.846   -20.543 -1.978  1.00 0.00 ? 210 SER A C    5  
ATOM   9609  O  O    . SER A 1 55  ? 6.716   -19.802 -2.934  1.00 0.00 ? 210 SER A O    5  
ATOM   9610  C  CB   . SER A 1 55  ? 4.789   -21.951 -1.611  1.00 0.00 ? 210 SER A CB   5  
ATOM   9611  O  OG   . SER A 1 55  ? 5.248   -23.199 -1.112  1.00 0.00 ? 210 SER A OG   5  
ATOM   9612  H  H    . SER A 1 55  ? 4.369   -19.281 -1.806  1.00 0.00 ? 210 SER A H    5  
ATOM   9613  H  HA   . SER A 1 55  ? 6.009   -21.095 -0.058  1.00 0.00 ? 210 SER A HA   5  
ATOM   9614  H  HB2  . SER A 1 55  ? 3.766   -21.802 -1.308  1.00 0.00 ? 210 SER A HB2  5  
ATOM   9615  H  HB3  . SER A 1 55  ? 4.848   -21.939 -2.692  1.00 0.00 ? 210 SER A HB3  5  
ATOM   9616  H  HG   . SER A 1 55  ? 6.061   -23.422 -1.571  1.00 0.00 ? 210 SER A HG   5  
ATOM   9617  N  N    . ARG A 1 56  ? 8.005   -21.118 -1.711  1.00 0.00 ? 211 ARG A N    5  
ATOM   9618  C  CA   . ARG A 1 56  ? 9.192   -20.854 -2.607  1.00 0.00 ? 211 ARG A CA   5  
ATOM   9619  C  C    . ARG A 1 56  ? 8.861   -21.234 -4.062  1.00 0.00 ? 211 ARG A C    5  
ATOM   9620  O  O    . ARG A 1 56  ? 8.462   -22.351 -4.335  1.00 0.00 ? 211 ARG A O    5  
ATOM   9621  C  CB   . ARG A 1 56  ? 10.354  -21.718 -2.075  1.00 0.00 ? 211 ARG A CB   5  
ATOM   9622  C  CG   . ARG A 1 56  ? 9.981   -23.204 -2.145  1.00 0.00 ? 211 ARG A CG   5  
ATOM   9623  C  CD   . ARG A 1 56  ? 10.580  -23.944 -0.945  1.00 0.00 ? 211 ARG A CD   5  
ATOM   9624  N  NE   . ARG A 1 56  ? 11.147  -25.202 -1.509  1.00 0.00 ? 211 ARG A NE   5  
ATOM   9625  C  CZ   . ARG A 1 56  ? 10.781  -26.358 -1.024  1.00 0.00 ? 211 ARG A CZ   5  
ATOM   9626  N  NH1  . ARG A 1 56  ? 9.525   -26.583 -0.754  1.00 0.00 ? 211 ARG A NH1  5  
ATOM   9627  N  NH2  . ARG A 1 56  ? 11.672  -27.288 -0.812  1.00 0.00 ? 211 ARG A NH2  5  
ATOM   9628  H  H    . ARG A 1 56  ? 8.090   -21.712 -0.928  1.00 0.00 ? 211 ARG A H    5  
ATOM   9629  H  HA   . ARG A 1 56  ? 9.465   -19.810 -2.555  1.00 0.00 ? 211 ARG A HA   5  
ATOM   9630  H  HB2  . ARG A 1 56  ? 11.235  -21.539 -2.674  1.00 0.00 ? 211 ARG A HB2  5  
ATOM   9631  H  HB3  . ARG A 1 56  ? 10.558  -21.449 -1.050  1.00 0.00 ? 211 ARG A HB3  5  
ATOM   9632  H  HG2  . ARG A 1 56  ? 8.906   -23.308 -2.133  1.00 0.00 ? 211 ARG A HG2  5  
ATOM   9633  H  HG3  . ARG A 1 56  ? 10.372  -23.628 -3.059  1.00 0.00 ? 211 ARG A HG3  5  
ATOM   9634  H  HD2  . ARG A 1 56  ? 11.360  -23.349 -0.488  1.00 0.00 ? 211 ARG A HD2  5  
ATOM   9635  H  HD3  . ARG A 1 56  ? 9.812   -24.176 -0.225  1.00 0.00 ? 211 ARG A HD3  5  
ATOM   9636  H  HE   . ARG A 1 56  ? 11.796  -25.161 -2.242  1.00 0.00 ? 211 ARG A HE   5  
ATOM   9637  H  HH11 . ARG A 1 56  ? 8.843   -25.871 -0.917  1.00 0.00 ? 211 ARG A HH11 5  
ATOM   9638  H  HH12 . ARG A 1 56  ? 9.245   -27.468 -0.383  1.00 0.00 ? 211 ARG A HH12 5  
ATOM   9639  H  HH21 . ARG A 1 56  ? 12.634  -27.114 -1.020  1.00 0.00 ? 211 ARG A HH21 5  
ATOM   9640  H  HH22 . ARG A 1 56  ? 11.391  -28.173 -0.442  1.00 0.00 ? 211 ARG A HH22 5  
ATOM   9641  N  N    . ASP A 1 57  ? 9.020   -20.318 -4.997  1.00 0.00 ? 212 ASP A N    5  
ATOM   9642  C  CA   . ASP A 1 57  ? 8.710   -20.642 -6.421  1.00 0.00 ? 212 ASP A CA   5  
ATOM   9643  C  C    . ASP A 1 57  ? 9.773   -20.033 -7.351  1.00 0.00 ? 212 ASP A C    5  
ATOM   9644  O  O    . ASP A 1 57  ? 10.686  -19.373 -6.899  1.00 0.00 ? 212 ASP A O    5  
ATOM   9645  C  CB   . ASP A 1 57  ? 7.344   -20.008 -6.683  1.00 0.00 ? 212 ASP A CB   5  
ATOM   9646  C  CG   . ASP A 1 57  ? 6.556   -20.879 -7.664  1.00 0.00 ? 212 ASP A CG   5  
ATOM   9647  O  OD1  . ASP A 1 57  ? 6.139   -21.955 -7.267  1.00 0.00 ? 212 ASP A OD1  5  
ATOM   9648  O  OD2  . ASP A 1 57  ? 6.384   -20.456 -8.795  1.00 0.00 ? 212 ASP A OD2  5  
ATOM   9649  H  H    . ASP A 1 57  ? 9.342   -19.420 -4.763  1.00 0.00 ? 212 ASP A H    5  
ATOM   9650  H  HA   . ASP A 1 57  ? 8.654   -21.710 -6.562  1.00 0.00 ? 212 ASP A HA   5  
ATOM   9651  H  HB2  . ASP A 1 57  ? 6.799   -19.930 -5.752  1.00 0.00 ? 212 ASP A HB2  5  
ATOM   9652  H  HB3  . ASP A 1 57  ? 7.477   -19.024 -7.106  1.00 0.00 ? 212 ASP A HB3  5  
ATOM   9653  N  N    . SER A 1 58  ? 9.660   -20.245 -8.653  1.00 0.00 ? 213 SER A N    5  
ATOM   9654  C  CA   . SER A 1 58  ? 10.661  -19.682 -9.625  1.00 0.00 ? 213 SER A CA   5  
ATOM   9655  C  C    . SER A 1 58  ? 12.056  -20.293 -9.387  1.00 0.00 ? 213 SER A C    5  
ATOM   9656  O  O    . SER A 1 58  ? 12.519  -21.092 -10.180 1.00 0.00 ? 213 SER A O    5  
ATOM   9657  C  CB   . SER A 1 58  ? 10.678  -18.161 -9.406  1.00 0.00 ? 213 SER A CB   5  
ATOM   9658  O  OG   . SER A 1 58  ? 10.270  -17.513 -10.604 1.00 0.00 ? 213 SER A OG   5  
ATOM   9659  H  H    . SER A 1 58  ? 8.911   -20.780 -8.998  1.00 0.00 ? 213 SER A H    5  
ATOM   9660  H  HA   . SER A 1 58  ? 10.342  -19.894 -10.634 1.00 0.00 ? 213 SER A HA   5  
ATOM   9661  H  HB2  . SER A 1 58  ? 9.997   -17.900 -8.614  1.00 0.00 ? 213 SER A HB2  5  
ATOM   9662  H  HB3  . SER A 1 58  ? 11.678  -17.846 -9.136  1.00 0.00 ? 213 SER A HB3  5  
ATOM   9663  H  HG   . SER A 1 58  ? 10.651  -16.631 -10.610 1.00 0.00 ? 213 SER A HG   5  
ATOM   9664  N  N    . ASP A 1 59  ? 12.730  -19.934 -8.313  1.00 0.00 ? 214 ASP A N    5  
ATOM   9665  C  CA   . ASP A 1 59  ? 14.084  -20.510 -8.052  1.00 0.00 ? 214 ASP A CA   5  
ATOM   9666  C  C    . ASP A 1 59  ? 14.199  -20.988 -6.594  1.00 0.00 ? 214 ASP A C    5  
ATOM   9667  O  O    . ASP A 1 59  ? 15.255  -20.900 -5.996  1.00 0.00 ? 214 ASP A O    5  
ATOM   9668  C  CB   . ASP A 1 59  ? 15.055  -19.358 -8.308  1.00 0.00 ? 214 ASP A CB   5  
ATOM   9669  C  CG   . ASP A 1 59  ? 14.956  -18.918 -9.769  1.00 0.00 ? 214 ASP A CG   5  
ATOM   9670  O  OD1  . ASP A 1 59  ? 14.139  -18.057 -10.055 1.00 0.00 ? 214 ASP A OD1  5  
ATOM   9671  O  OD2  . ASP A 1 59  ? 15.698  -19.448 -10.580 1.00 0.00 ? 214 ASP A OD2  5  
ATOM   9672  H  H    . ASP A 1 59  ? 12.348  -19.291 -7.677  1.00 0.00 ? 214 ASP A H    5  
ATOM   9673  H  HA   . ASP A 1 59  ? 14.289  -21.321 -8.732  1.00 0.00 ? 214 ASP A HA   5  
ATOM   9674  H  HB2  . ASP A 1 59  ? 14.805  -18.528 -7.662  1.00 0.00 ? 214 ASP A HB2  5  
ATOM   9675  H  HB3  . ASP A 1 59  ? 16.064  -19.683 -8.099  1.00 0.00 ? 214 ASP A HB3  5  
ATOM   9676  N  N    . GLY A 1 60  ? 13.127  -21.492 -6.009  1.00 0.00 ? 215 GLY A N    5  
ATOM   9677  C  CA   . GLY A 1 60  ? 13.193  -21.969 -4.592  1.00 0.00 ? 215 GLY A CA   5  
ATOM   9678  C  C    . GLY A 1 60  ? 13.738  -20.858 -3.674  1.00 0.00 ? 215 GLY A C    5  
ATOM   9679  O  O    . GLY A 1 60  ? 14.452  -21.136 -2.728  1.00 0.00 ? 215 GLY A O    5  
ATOM   9680  H  H    . GLY A 1 60  ? 12.279  -21.562 -6.499  1.00 0.00 ? 215 GLY A H    5  
ATOM   9681  H  HA2  . GLY A 1 60  ? 12.202  -22.250 -4.265  1.00 0.00 ? 215 GLY A HA2  5  
ATOM   9682  H  HA3  . GLY A 1 60  ? 13.844  -22.828 -4.534  1.00 0.00 ? 215 GLY A HA3  5  
ATOM   9683  N  N    . MET A 1 61  ? 13.416  -19.606 -3.939  1.00 0.00 ? 216 MET A N    5  
ATOM   9684  C  CA   . MET A 1 61  ? 13.932  -18.503 -3.070  1.00 0.00 ? 216 MET A CA   5  
ATOM   9685  C  C    . MET A 1 61  ? 12.859  -17.419 -2.874  1.00 0.00 ? 216 MET A C    5  
ATOM   9686  O  O    . MET A 1 61  ? 13.170  -16.245 -2.838  1.00 0.00 ? 216 MET A O    5  
ATOM   9687  C  CB   . MET A 1 61  ? 15.134  -17.936 -3.825  1.00 0.00 ? 216 MET A CB   5  
ATOM   9688  C  CG   . MET A 1 61  ? 16.205  -17.497 -2.826  1.00 0.00 ? 216 MET A CG   5  
ATOM   9689  S  SD   . MET A 1 61  ? 17.820  -17.473 -3.643  1.00 0.00 ? 216 MET A SD   5  
ATOM   9690  C  CE   . MET A 1 61  ? 17.662  -15.844 -4.413  1.00 0.00 ? 216 MET A CE   5  
ATOM   9691  H  H    . MET A 1 61  ? 12.842  -19.388 -4.706  1.00 0.00 ? 216 MET A H    5  
ATOM   9692  H  HA   . MET A 1 61  ? 14.249  -18.895 -2.117  1.00 0.00 ? 216 MET A HA   5  
ATOM   9693  H  HB2  . MET A 1 61  ? 15.540  -18.695 -4.479  1.00 0.00 ? 216 MET A HB2  5  
ATOM   9694  H  HB3  . MET A 1 61  ? 14.821  -17.086 -4.412  1.00 0.00 ? 216 MET A HB3  5  
ATOM   9695  H  HG2  . MET A 1 61  ? 15.973  -16.507 -2.461  1.00 0.00 ? 216 MET A HG2  5  
ATOM   9696  H  HG3  . MET A 1 61  ? 16.231  -18.189 -1.998  1.00 0.00 ? 216 MET A HG3  5  
ATOM   9697  H  HE1  . MET A 1 61  ? 17.170  -15.946 -5.371  1.00 0.00 ? 216 MET A HE1  5  
ATOM   9698  H  HE2  . MET A 1 61  ? 18.640  -15.416 -4.558  1.00 0.00 ? 216 MET A HE2  5  
ATOM   9699  H  HE3  . MET A 1 61  ? 17.079  -15.198 -3.770  1.00 0.00 ? 216 MET A HE3  5  
ATOM   9700  N  N    . ASP A 1 62  ? 11.599  -17.797 -2.734  1.00 0.00 ? 217 ASP A N    5  
ATOM   9701  C  CA   . ASP A 1 62  ? 10.504  -16.785 -2.534  1.00 0.00 ? 217 ASP A CA   5  
ATOM   9702  C  C    . ASP A 1 62  ? 10.414  -15.825 -3.735  1.00 0.00 ? 217 ASP A C    5  
ATOM   9703  O  O    . ASP A 1 62  ? 11.362  -15.134 -4.057  1.00 0.00 ? 217 ASP A O    5  
ATOM   9704  C  CB   . ASP A 1 62  ? 10.867  -16.015 -1.255  1.00 0.00 ? 217 ASP A CB   5  
ATOM   9705  C  CG   . ASP A 1 62  ? 9.587   -15.621 -0.517  1.00 0.00 ? 217 ASP A CG   5  
ATOM   9706  O  OD1  . ASP A 1 62  ? 8.851   -16.513 -0.127  1.00 0.00 ? 217 ASP A OD1  5  
ATOM   9707  O  OD2  . ASP A 1 62  ? 9.363   -14.433 -0.353  1.00 0.00 ? 217 ASP A OD2  5  
ATOM   9708  H  H    . ASP A 1 62  ? 11.367  -18.752 -2.757  1.00 0.00 ? 217 ASP A H    5  
ATOM   9709  H  HA   . ASP A 1 62  ? 9.559   -17.287 -2.395  1.00 0.00 ? 217 ASP A HA   5  
ATOM   9710  H  HB2  . ASP A 1 62  ? 11.473  -16.642 -0.618  1.00 0.00 ? 217 ASP A HB2  5  
ATOM   9711  H  HB3  . ASP A 1 62  ? 11.419  -15.125 -1.515  1.00 0.00 ? 217 ASP A HB3  5  
ATOM   9712  N  N    . GLU A 1 63  ? 9.276   -15.769 -4.396  1.00 0.00 ? 218 GLU A N    5  
ATOM   9713  C  CA   . GLU A 1 63  ? 9.132   -14.850 -5.567  1.00 0.00 ? 218 GLU A CA   5  
ATOM   9714  C  C    . GLU A 1 63  ? 7.743   -14.196 -5.554  1.00 0.00 ? 218 GLU A C    5  
ATOM   9715  O  O    . GLU A 1 63  ? 7.049   -14.190 -6.555  1.00 0.00 ? 218 GLU A O    5  
ATOM   9716  C  CB   . GLU A 1 63  ? 9.296   -15.742 -6.798  1.00 0.00 ? 218 GLU A CB   5  
ATOM   9717  C  CG   . GLU A 1 63  ? 9.344   -14.874 -8.058  1.00 0.00 ? 218 GLU A CG   5  
ATOM   9718  C  CD   . GLU A 1 63  ? 8.627   -15.590 -9.206  1.00 0.00 ? 218 GLU A CD   5  
ATOM   9719  O  OE1  . GLU A 1 63  ? 7.640   -16.255 -8.939  1.00 0.00 ? 218 GLU A OE1  5  
ATOM   9720  O  OE2  . GLU A 1 63  ? 9.078   -15.460 -10.332 1.00 0.00 ? 218 GLU A OE2  5  
ATOM   9721  H  H    . GLU A 1 63  ? 8.512   -16.327 -4.124  1.00 0.00 ? 218 GLU A H    5  
ATOM   9722  H  HA   . GLU A 1 63  ? 9.902   -14.095 -5.551  1.00 0.00 ? 218 GLU A HA   5  
ATOM   9723  H  HB2  . GLU A 1 63  ? 10.215  -16.305 -6.714  1.00 0.00 ? 218 GLU A HB2  5  
ATOM   9724  H  HB3  . GLU A 1 63  ? 8.462   -16.424 -6.862  1.00 0.00 ? 218 GLU A HB3  5  
ATOM   9725  H  HG2  . GLU A 1 63  ? 8.855   -13.929 -7.864  1.00 0.00 ? 218 GLU A HG2  5  
ATOM   9726  H  HG3  . GLU A 1 63  ? 10.372  -14.696 -8.335  1.00 0.00 ? 218 GLU A HG3  5  
ATOM   9727  N  N    . GLN A 1 64  ? 7.325   -13.651 -4.430  1.00 0.00 ? 219 GLN A N    5  
ATOM   9728  C  CA   . GLN A 1 64  ? 5.976   -13.010 -4.368  1.00 0.00 ? 219 GLN A CA   5  
ATOM   9729  C  C    . GLN A 1 64  ? 6.095   -11.493 -4.132  1.00 0.00 ? 219 GLN A C    5  
ATOM   9730  O  O    . GLN A 1 64  ? 7.171   -10.979 -3.894  1.00 0.00 ? 219 GLN A O    5  
ATOM   9731  C  CB   . GLN A 1 64  ? 5.267   -13.687 -3.185  1.00 0.00 ? 219 GLN A CB   5  
ATOM   9732  C  CG   . GLN A 1 64  ? 5.946   -13.304 -1.854  1.00 0.00 ? 219 GLN A CG   5  
ATOM   9733  C  CD   . GLN A 1 64  ? 4.970   -12.515 -0.969  1.00 0.00 ? 219 GLN A CD   5  
ATOM   9734  O  OE1  . GLN A 1 64  ? 3.771   -12.617 -1.131  1.00 0.00 ? 219 GLN A OE1  5  
ATOM   9735  N  NE2  . GLN A 1 64  ? 5.432   -11.725 -0.031  1.00 0.00 ? 219 GLN A NE2  5  
ATOM   9736  H  H    . GLN A 1 64  ? 7.893   -13.670 -3.628  1.00 0.00 ? 219 GLN A H    5  
ATOM   9737  H  HA   . GLN A 1 64  ? 5.430   -13.203 -5.278  1.00 0.00 ? 219 GLN A HA   5  
ATOM   9738  H  HB2  . GLN A 1 64  ? 4.232   -13.379 -3.169  1.00 0.00 ? 219 GLN A HB2  5  
ATOM   9739  H  HB3  . GLN A 1 64  ? 5.316   -14.757 -3.315  1.00 0.00 ? 219 GLN A HB3  5  
ATOM   9740  H  HG2  . GLN A 1 64  ? 6.257   -14.197 -1.337  1.00 0.00 ? 219 GLN A HG2  5  
ATOM   9741  H  HG3  . GLN A 1 64  ? 6.812   -12.691 -2.055  1.00 0.00 ? 219 GLN A HG3  5  
ATOM   9742  H  HE21 . GLN A 1 64  ? 6.399   -11.633 0.111   1.00 0.00 ? 219 GLN A HE21 5  
ATOM   9743  H  HE22 . GLN A 1 64  ? 4.808   -11.221 0.533   1.00 0.00 ? 219 GLN A HE22 5  
ATOM   9744  N  N    . CYS A 1 65  ? 4.989   -10.780 -4.180  1.00 0.00 ? 220 CYS A N    5  
ATOM   9745  C  CA   . CYS A 1 65  ? 5.044   -9.293  -3.936  1.00 0.00 ? 220 CYS A CA   5  
ATOM   9746  C  C    . CYS A 1 65  ? 5.170   -9.000  -2.434  1.00 0.00 ? 220 CYS A C    5  
ATOM   9747  O  O    . CYS A 1 65  ? 4.739   -9.786  -1.611  1.00 0.00 ? 220 CYS A O    5  
ATOM   9748  C  CB   . CYS A 1 65  ? 3.712   -8.728  -4.441  1.00 0.00 ? 220 CYS A CB   5  
ATOM   9749  S  SG   . CYS A 1 65  ? 3.748   -6.922  -4.388  1.00 0.00 ? 220 CYS A SG   5  
ATOM   9750  H  H    . CYS A 1 65  ? 4.122   -11.225 -4.366  1.00 0.00 ? 220 CYS A H    5  
ATOM   9751  H  HA   . CYS A 1 65  ? 5.861   -8.849  -4.478  1.00 0.00 ? 220 CYS A HA   5  
ATOM   9752  H  HB2  . CYS A 1 65  ? 3.540   -9.058  -5.453  1.00 0.00 ? 220 CYS A HB2  5  
ATOM   9753  H  HB3  . CYS A 1 65  ? 2.917   -9.084  -3.808  1.00 0.00 ? 220 CYS A HB3  5  
ATOM   9754  N  N    . ARG A 1 66  ? 5.719   -7.858  -2.067  1.00 0.00 ? 221 ARG A N    5  
ATOM   9755  C  CA   . ARG A 1 66  ? 5.819   -7.509  -0.615  1.00 0.00 ? 221 ARG A CA   5  
ATOM   9756  C  C    . ARG A 1 66  ? 4.738   -6.463  -0.280  1.00 0.00 ? 221 ARG A C    5  
ATOM   9757  O  O    . ARG A 1 66  ? 4.985   -5.514  0.440   1.00 0.00 ? 221 ARG A O    5  
ATOM   9758  C  CB   . ARG A 1 66  ? 7.223   -6.923  -0.423  1.00 0.00 ? 221 ARG A CB   5  
ATOM   9759  C  CG   . ARG A 1 66  ? 8.148   -7.990  0.169   1.00 0.00 ? 221 ARG A CG   5  
ATOM   9760  C  CD   . ARG A 1 66  ? 7.684   -8.343  1.583   1.00 0.00 ? 221 ARG A CD   5  
ATOM   9761  N  NE   . ARG A 1 66  ? 8.911   -8.819  2.282   1.00 0.00 ? 221 ARG A NE   5  
ATOM   9762  C  CZ   . ARG A 1 66  ? 8.935   -10.007 2.820   1.00 0.00 ? 221 ARG A CZ   5  
ATOM   9763  N  NH1  . ARG A 1 66  ? 8.904   -11.068 2.062   1.00 0.00 ? 221 ARG A NH1  5  
ATOM   9764  N  NH2  . ARG A 1 66  ? 8.990   -10.135 4.118   1.00 0.00 ? 221 ARG A NH2  5  
ATOM   9765  H  H    . ARG A 1 66  ? 6.036   -7.219  -2.745  1.00 0.00 ? 221 ARG A H    5  
ATOM   9766  H  HA   . ARG A 1 66  ? 5.694   -8.390  -0.005  1.00 0.00 ? 221 ARG A HA   5  
ATOM   9767  H  HB2  . ARG A 1 66  ? 7.611   -6.599  -1.377  1.00 0.00 ? 221 ARG A HB2  5  
ATOM   9768  H  HB3  . ARG A 1 66  ? 7.173   -6.081  0.251   1.00 0.00 ? 221 ARG A HB3  5  
ATOM   9769  H  HG2  . ARG A 1 66  ? 8.119   -8.875  -0.452  1.00 0.00 ? 221 ARG A HG2  5  
ATOM   9770  H  HG3  . ARG A 1 66  ? 9.158   -7.610  0.207   1.00 0.00 ? 221 ARG A HG3  5  
ATOM   9771  H  HD2  . ARG A 1 66  ? 7.282   -7.468  2.075   1.00 0.00 ? 221 ARG A HD2  5  
ATOM   9772  H  HD3  . ARG A 1 66  ? 6.948   -9.130  1.552   1.00 0.00 ? 221 ARG A HD3  5  
ATOM   9773  H  HE   . ARG A 1 66  ? 9.699   -8.239  2.337   1.00 0.00 ? 221 ARG A HE   5  
ATOM   9774  H  HH11 . ARG A 1 66  ? 8.861   -10.970 1.068   1.00 0.00 ? 221 ARG A HH11 5  
ATOM   9775  H  HH12 . ARG A 1 66  ? 8.923   -11.979 2.474   1.00 0.00 ? 221 ARG A HH12 5  
ATOM   9776  H  HH21 . ARG A 1 66  ? 9.013   -9.321  4.700   1.00 0.00 ? 221 ARG A HH21 5  
ATOM   9777  H  HH22 . ARG A 1 66  ? 9.009   -11.045 4.531   1.00 0.00 ? 221 ARG A HH22 5  
ATOM   9778  N  N    . TRP A 1 67  ? 3.539   -6.629  -0.809  1.00 0.00 ? 222 TRP A N    5  
ATOM   9779  C  CA   . TRP A 1 67  ? 2.440   -5.647  -0.537  1.00 0.00 ? 222 TRP A CA   5  
ATOM   9780  C  C    . TRP A 1 67  ? 1.070   -6.319  -0.752  1.00 0.00 ? 222 TRP A C    5  
ATOM   9781  O  O    . TRP A 1 67  ? 0.249   -6.374  0.144   1.00 0.00 ? 222 TRP A O    5  
ATOM   9782  C  CB   . TRP A 1 67  ? 2.639   -4.534  -1.576  1.00 0.00 ? 222 TRP A CB   5  
ATOM   9783  C  CG   . TRP A 1 67  ? 2.492   -3.193  -0.926  1.00 0.00 ? 222 TRP A CG   5  
ATOM   9784  C  CD1  . TRP A 1 67  ? 1.566   -2.867  0.009   1.00 0.00 ? 222 TRP A CD1  5  
ATOM   9785  C  CD2  . TRP A 1 67  ? 3.278   -1.993  -1.157  1.00 0.00 ? 222 TRP A CD2  5  
ATOM   9786  N  NE1  . TRP A 1 67  ? 1.752   -1.550  0.380   1.00 0.00 ? 222 TRP A NE1  5  
ATOM   9787  C  CE2  . TRP A 1 67  ? 2.794   -0.969  -0.313  1.00 0.00 ? 222 TRP A CE2  5  
ATOM   9788  C  CE3  . TRP A 1 67  ? 4.360   -1.700  -2.006  1.00 0.00 ? 222 TRP A CE3  5  
ATOM   9789  C  CZ2  . TRP A 1 67  ? 3.367   0.300   -0.310  1.00 0.00 ? 222 TRP A CZ2  5  
ATOM   9790  C  CZ3  . TRP A 1 67  ? 4.934   -0.420  -2.006  1.00 0.00 ? 222 TRP A CZ3  5  
ATOM   9791  C  CH2  . TRP A 1 67  ? 4.440   0.577   -1.158  1.00 0.00 ? 222 TRP A CH2  5  
ATOM   9792  H  H    . TRP A 1 67  ? 3.361   -7.399  -1.392  1.00 0.00 ? 222 TRP A H    5  
ATOM   9793  H  HA   . TRP A 1 67  ? 2.523   -5.247  0.462   1.00 0.00 ? 222 TRP A HA   5  
ATOM   9794  H  HB2  . TRP A 1 67  ? 3.627   -4.615  -2.002  1.00 0.00 ? 222 TRP A HB2  5  
ATOM   9795  H  HB3  . TRP A 1 67  ? 1.902   -4.633  -2.360  1.00 0.00 ? 222 TRP A HB3  5  
ATOM   9796  H  HD1  . TRP A 1 67  ? 0.813   -3.530  0.408   1.00 0.00 ? 222 TRP A HD1  5  
ATOM   9797  H  HE1  . TRP A 1 67  ? 1.219   -1.070  1.047   1.00 0.00 ? 222 TRP A HE1  5  
ATOM   9798  H  HE3  . TRP A 1 67  ? 4.746   -2.463  -2.664  1.00 0.00 ? 222 TRP A HE3  5  
ATOM   9799  H  HZ2  . TRP A 1 67  ? 2.990   1.058   0.352   1.00 0.00 ? 222 TRP A HZ2  5  
ATOM   9800  H  HZ3  . TRP A 1 67  ? 5.762   -0.203  -2.663  1.00 0.00 ? 222 TRP A HZ3  5  
ATOM   9801  H  HH2  . TRP A 1 67  ? 4.886   1.561   -1.163  1.00 0.00 ? 222 TRP A HH2  5  
ATOM   9802  N  N    . CYS A 1 68  ? 0.827   -6.836  -1.942  1.00 0.00 ? 223 CYS A N    5  
ATOM   9803  C  CA   . CYS A 1 68  ? -0.484  -7.510  -2.218  1.00 0.00 ? 223 CYS A CA   5  
ATOM   9804  C  C    . CYS A 1 68  ? -0.383  -9.056  -2.113  1.00 0.00 ? 223 CYS A C    5  
ATOM   9805  O  O    . CYS A 1 68  ? -1.378  -9.740  -2.249  1.00 0.00 ? 223 CYS A O    5  
ATOM   9806  C  CB   . CYS A 1 68  ? -0.903  -7.059  -3.638  1.00 0.00 ? 223 CYS A CB   5  
ATOM   9807  S  SG   . CYS A 1 68  ? 0.192   -7.759  -4.912  1.00 0.00 ? 223 CYS A SG   5  
ATOM   9808  H  H    . CYS A 1 68  ? 1.508   -6.784  -2.647  1.00 0.00 ? 223 CYS A H    5  
ATOM   9809  H  HA   . CYS A 1 68  ? -1.217  -7.157  -1.510  1.00 0.00 ? 223 CYS A HA   5  
ATOM   9810  H  HB2  . CYS A 1 68  ? -1.914  -7.386  -3.828  1.00 0.00 ? 223 CYS A HB2  5  
ATOM   9811  H  HB3  . CYS A 1 68  ? -0.867  -5.981  -3.691  1.00 0.00 ? 223 CYS A HB3  5  
ATOM   9812  N  N    . ALA A 1 69  ? 0.794   -9.624  -1.864  1.00 0.00 ? 224 ALA A N    5  
ATOM   9813  C  CA   . ALA A 1 69  ? 0.912   -11.119 -1.747  1.00 0.00 ? 224 ALA A CA   5  
ATOM   9814  C  C    . ALA A 1 69  ? 0.439   -11.803 -3.040  1.00 0.00 ? 224 ALA A C    5  
ATOM   9815  O  O    . ALA A 1 69  ? -0.253  -12.802 -3.001  1.00 0.00 ? 224 ALA A O    5  
ATOM   9816  C  CB   . ALA A 1 69  ? 0.027   -11.523 -0.561  1.00 0.00 ? 224 ALA A CB   5  
ATOM   9817  H  H    . ALA A 1 69  ? 1.599   -9.078  -1.752  1.00 0.00 ? 224 ALA A H    5  
ATOM   9818  H  HA   . ALA A 1 69  ? 1.936   -11.395 -1.544  1.00 0.00 ? 224 ALA A HA   5  
ATOM   9819  H  HB1  . ALA A 1 69  ? 0.247   -12.543 -0.278  1.00 0.00 ? 224 ALA A HB1  5  
ATOM   9820  H  HB2  . ALA A 1 69  ? -1.012  -11.443 -0.842  1.00 0.00 ? 224 ALA A HB2  5  
ATOM   9821  H  HB3  . ALA A 1 69  ? 0.225   -10.869 0.276   1.00 0.00 ? 224 ALA A HB3  5  
ATOM   9822  N  N    . GLU A 1 70  ? 0.825   -11.283 -4.186  1.00 0.00 ? 225 GLU A N    5  
ATOM   9823  C  CA   . GLU A 1 70  ? 0.419   -11.911 -5.478  1.00 0.00 ? 225 GLU A CA   5  
ATOM   9824  C  C    . GLU A 1 70  ? 1.684   -12.340 -6.236  1.00 0.00 ? 225 GLU A C    5  
ATOM   9825  O  O    . GLU A 1 70  ? 2.764   -12.340 -5.673  1.00 0.00 ? 225 GLU A O    5  
ATOM   9826  C  CB   . GLU A 1 70  ? -0.328  -10.815 -6.245  1.00 0.00 ? 225 GLU A CB   5  
ATOM   9827  C  CG   . GLU A 1 70  ? -1.552  -10.364 -5.444  1.00 0.00 ? 225 GLU A CG   5  
ATOM   9828  C  CD   . GLU A 1 70  ? -2.729  -11.296 -5.741  1.00 0.00 ? 225 GLU A CD   5  
ATOM   9829  O  OE1  . GLU A 1 70  ? -2.979  -11.548 -6.908  1.00 0.00 ? 225 GLU A OE1  5  
ATOM   9830  O  OE2  . GLU A 1 70  ? -3.360  -11.740 -4.796  1.00 0.00 ? 225 GLU A OE2  5  
ATOM   9831  H  H    . GLU A 1 70  ? 1.394   -10.486 -4.200  1.00 0.00 ? 225 GLU A H    5  
ATOM   9832  H  HA   . GLU A 1 70  ? -0.228  -12.757 -5.305  1.00 0.00 ? 225 GLU A HA   5  
ATOM   9833  H  HB2  . GLU A 1 70  ? 0.332   -9.975  -6.402  1.00 0.00 ? 225 GLU A HB2  5  
ATOM   9834  H  HB3  . GLU A 1 70  ? -0.650  -11.201 -7.199  1.00 0.00 ? 225 GLU A HB3  5  
ATOM   9835  H  HG2  . GLU A 1 70  ? -1.326  -10.395 -4.389  1.00 0.00 ? 225 GLU A HG2  5  
ATOM   9836  H  HG3  . GLU A 1 70  ? -1.815  -9.355  -5.726  1.00 0.00 ? 225 GLU A HG3  5  
ATOM   9837  N  N    . GLY A 1 71  ? 1.577   -12.702 -7.497  1.00 0.00 ? 226 GLY A N    5  
ATOM   9838  C  CA   . GLY A 1 71  ? 2.796   -13.118 -8.250  1.00 0.00 ? 226 GLY A CA   5  
ATOM   9839  C  C    . GLY A 1 71  ? 2.716   -12.612 -9.702  1.00 0.00 ? 226 GLY A C    5  
ATOM   9840  O  O    . GLY A 1 71  ? 2.014   -11.661 -9.990  1.00 0.00 ? 226 GLY A O    5  
ATOM   9841  H  H    . GLY A 1 71  ? 0.703   -12.698 -7.947  1.00 0.00 ? 226 GLY A H    5  
ATOM   9842  H  HA2  . GLY A 1 71  ? 3.671   -12.698 -7.765  1.00 0.00 ? 226 GLY A HA2  5  
ATOM   9843  H  HA3  . GLY A 1 71  ? 2.869   -14.195 -8.250  1.00 0.00 ? 226 GLY A HA3  5  
ATOM   9844  N  N    . GLY A 1 72  ? 3.433   -13.236 -10.619 1.00 0.00 ? 227 GLY A N    5  
ATOM   9845  C  CA   . GLY A 1 72  ? 3.394   -12.781 -12.043 1.00 0.00 ? 227 GLY A CA   5  
ATOM   9846  C  C    . GLY A 1 72  ? 4.708   -12.059 -12.379 1.00 0.00 ? 227 GLY A C    5  
ATOM   9847  O  O    . GLY A 1 72  ? 5.779   -12.616 -12.223 1.00 0.00 ? 227 GLY A O    5  
ATOM   9848  H  H    . GLY A 1 72  ? 3.998   -14.001 -10.372 1.00 0.00 ? 227 GLY A H    5  
ATOM   9849  H  HA2  . GLY A 1 72  ? 3.275   -13.638 -12.691 1.00 0.00 ? 227 GLY A HA2  5  
ATOM   9850  H  HA3  . GLY A 1 72  ? 2.568   -12.102 -12.184 1.00 0.00 ? 227 GLY A HA3  5  
ATOM   9851  N  N    . ASN A 1 73  ? 4.644   -10.818 -12.823 1.00 0.00 ? 228 ASN A N    5  
ATOM   9852  C  CA   . ASN A 1 73  ? 5.913   -10.073 -13.140 1.00 0.00 ? 228 ASN A CA   5  
ATOM   9853  C  C    . ASN A 1 73  ? 6.418   -9.390  -11.864 1.00 0.00 ? 228 ASN A C    5  
ATOM   9854  O  O    . ASN A 1 73  ? 5.781   -8.487  -11.355 1.00 0.00 ? 228 ASN A O    5  
ATOM   9855  C  CB   . ASN A 1 73  ? 5.549   -9.026  -14.204 1.00 0.00 ? 228 ASN A CB   5  
ATOM   9856  C  CG   . ASN A 1 73  ? 5.179   -9.734  -15.513 1.00 0.00 ? 228 ASN A CG   5  
ATOM   9857  O  OD1  . ASN A 1 73  ? 4.030   -9.734  -15.908 1.00 0.00 ? 228 ASN A OD1  5  
ATOM   9858  N  ND2  . ASN A 1 73  ? 6.107   -10.344 -16.212 1.00 0.00 ? 228 ASN A ND2  5  
ATOM   9859  H  H    . ASN A 1 73  ? 3.769   -10.375 -12.927 1.00 0.00 ? 228 ASN A H    5  
ATOM   9860  H  HA   . ASN A 1 73  ? 6.659   -10.749 -13.524 1.00 0.00 ? 228 ASN A HA   5  
ATOM   9861  H  HB2  . ASN A 1 73  ? 4.709   -8.440  -13.860 1.00 0.00 ? 228 ASN A HB2  5  
ATOM   9862  H  HB3  . ASN A 1 73  ? 6.395   -8.378  -14.375 1.00 0.00 ? 228 ASN A HB3  5  
ATOM   9863  H  HD21 . ASN A 1 73  ? 7.039   -10.351 -15.903 1.00 0.00 ? 228 ASN A HD21 5  
ATOM   9864  H  HD22 . ASN A 1 73  ? 5.867   -10.795 -17.049 1.00 0.00 ? 228 ASN A HD22 5  
ATOM   9865  N  N    . LEU A 1 74  ? 7.539   -9.826  -11.320 1.00 0.00 ? 229 LEU A N    5  
ATOM   9866  C  CA   . LEU A 1 74  ? 8.034   -9.201  -10.058 1.00 0.00 ? 229 LEU A CA   5  
ATOM   9867  C  C    . LEU A 1 74  ? 9.491   -8.733  -10.174 1.00 0.00 ? 229 LEU A C    5  
ATOM   9868  O  O    . LEU A 1 74  ? 10.254  -9.230  -10.980 1.00 0.00 ? 229 LEU A O    5  
ATOM   9869  C  CB   . LEU A 1 74  ? 7.942   -10.308 -9.005  1.00 0.00 ? 229 LEU A CB   5  
ATOM   9870  C  CG   . LEU A 1 74  ? 6.507   -10.443 -8.492  1.00 0.00 ? 229 LEU A CG   5  
ATOM   9871  C  CD1  . LEU A 1 74  ? 5.637   -11.128 -9.552  1.00 0.00 ? 229 LEU A CD1  5  
ATOM   9872  C  CD2  . LEU A 1 74  ? 6.516   -11.281 -7.209  1.00 0.00 ? 229 LEU A CD2  5  
ATOM   9873  H  H    . LEU A 1 74  ? 8.036   -10.571 -11.726 1.00 0.00 ? 229 LEU A H    5  
ATOM   9874  H  HA   . LEU A 1 74  ? 7.402   -8.381  -9.779  1.00 0.00 ? 229 LEU A HA   5  
ATOM   9875  H  HB2  . LEU A 1 74  ? 8.254   -11.244 -9.444  1.00 0.00 ? 229 LEU A HB2  5  
ATOM   9876  H  HB3  . LEU A 1 74  ? 8.592   -10.066 -8.180  1.00 0.00 ? 229 LEU A HB3  5  
ATOM   9877  H  HG   . LEU A 1 74  ? 6.106   -9.466  -8.280  1.00 0.00 ? 229 LEU A HG   5  
ATOM   9878  H  HD11 . LEU A 1 74  ? 5.001   -11.860 -9.078  1.00 0.00 ? 229 LEU A HD11 5  
ATOM   9879  H  HD12 . LEU A 1 74  ? 6.268   -11.619 -10.278 1.00 0.00 ? 229 LEU A HD12 5  
ATOM   9880  H  HD13 . LEU A 1 74  ? 5.026   -10.388 -10.047 1.00 0.00 ? 229 LEU A HD13 5  
ATOM   9881  H  HD21 . LEU A 1 74  ? 5.532   -11.690 -7.038  1.00 0.00 ? 229 LEU A HD21 5  
ATOM   9882  H  HD22 . LEU A 1 74  ? 6.798   -10.655 -6.375  1.00 0.00 ? 229 LEU A HD22 5  
ATOM   9883  H  HD23 . LEU A 1 74  ? 7.229   -12.087 -7.311  1.00 0.00 ? 229 LEU A HD23 5  
ATOM   9884  N  N    . ILE A 1 75  ? 9.890   -7.801  -9.331  1.00 0.00 ? 230 ILE A N    5  
ATOM   9885  C  CA   . ILE A 1 75  ? 11.303  -7.321  -9.337  1.00 0.00 ? 230 ILE A CA   5  
ATOM   9886  C  C    . ILE A 1 75  ? 11.988  -7.886  -8.095  1.00 0.00 ? 230 ILE A C    5  
ATOM   9887  O  O    . ILE A 1 75  ? 11.336  -8.144  -7.103  1.00 0.00 ? 230 ILE A O    5  
ATOM   9888  C  CB   . ILE A 1 75  ? 11.221  -5.784  -9.268  1.00 0.00 ? 230 ILE A CB   5  
ATOM   9889  C  CG1  . ILE A 1 75  ? 10.668  -5.257  -10.592 1.00 0.00 ? 230 ILE A CG1  5  
ATOM   9890  C  CG2  . ILE A 1 75  ? 12.610  -5.162  -9.021  1.00 0.00 ? 230 ILE A CG2  5  
ATOM   9891  C  CD1  . ILE A 1 75  ? 10.148  -3.831  -10.402 1.00 0.00 ? 230 ILE A CD1  5  
ATOM   9892  H  H    . ILE A 1 75  ? 9.262   -7.438  -8.663  1.00 0.00 ? 230 ILE A H    5  
ATOM   9893  H  HA   . ILE A 1 75  ? 11.817  -7.636  -10.232 1.00 0.00 ? 230 ILE A HA   5  
ATOM   9894  H  HB   . ILE A 1 75  ? 10.556  -5.499  -8.465  1.00 0.00 ? 230 ILE A HB   5  
ATOM   9895  H  HG12 . ILE A 1 75  ? 11.452  -5.258  -11.335 1.00 0.00 ? 230 ILE A HG12 5  
ATOM   9896  H  HG13 . ILE A 1 75  ? 9.858   -5.890  -10.922 1.00 0.00 ? 230 ILE A HG13 5  
ATOM   9897  H  HG21 . ILE A 1 75  ? 13.205  -5.237  -9.918  1.00 0.00 ? 230 ILE A HG21 5  
ATOM   9898  H  HG22 . ILE A 1 75  ? 13.106  -5.683  -8.214  1.00 0.00 ? 230 ILE A HG22 5  
ATOM   9899  H  HG23 . ILE A 1 75  ? 12.495  -4.121  -8.752  1.00 0.00 ? 230 ILE A HG23 5  
ATOM   9900  H  HD11 . ILE A 1 75  ? 9.109   -3.791  -10.688 1.00 0.00 ? 230 ILE A HD11 5  
ATOM   9901  H  HD12 . ILE A 1 75  ? 10.719  -3.156  -11.023 1.00 0.00 ? 230 ILE A HD12 5  
ATOM   9902  H  HD13 . ILE A 1 75  ? 10.247  -3.537  -9.365  1.00 0.00 ? 230 ILE A HD13 5  
ATOM   9903  N  N    . CYS A 1 76  ? 13.282  -8.077  -8.129  1.00 0.00 ? 231 CYS A N    5  
ATOM   9904  C  CA   . CYS A 1 76  ? 13.975  -8.618  -6.925  1.00 0.00 ? 231 CYS A CA   5  
ATOM   9905  C  C    . CYS A 1 76  ? 14.801  -7.506  -6.273  1.00 0.00 ? 231 CYS A C    5  
ATOM   9906  O  O    . CYS A 1 76  ? 15.293  -6.622  -6.949  1.00 0.00 ? 231 CYS A O    5  
ATOM   9907  C  CB   . CYS A 1 76  ? 14.870  -9.746  -7.439  1.00 0.00 ? 231 CYS A CB   5  
ATOM   9908  S  SG   . CYS A 1 76  ? 13.917  -11.283 -7.517  1.00 0.00 ? 231 CYS A SG   5  
ATOM   9909  H  H    . CYS A 1 76  ? 13.797  -7.857  -8.940  1.00 0.00 ? 231 CYS A H    5  
ATOM   9910  H  HA   . CYS A 1 76  ? 13.253  -9.004  -6.218  1.00 0.00 ? 231 CYS A HA   5  
ATOM   9911  H  HB2  . CYS A 1 76  ? 15.231  -9.496  -8.425  1.00 0.00 ? 231 CYS A HB2  5  
ATOM   9912  H  HB3  . CYS A 1 76  ? 15.706  -9.874  -6.769  1.00 0.00 ? 231 CYS A HB3  5  
ATOM   9913  H  HG   . CYS A 1 76  ? 14.393  -11.952 -7.019  1.00 0.00 ? 231 CYS A HG   5  
ATOM   9914  N  N    . CYS A 1 77  ? 14.944  -7.528  -4.965  1.00 0.00 ? 232 CYS A N    5  
ATOM   9915  C  CA   . CYS A 1 77  ? 15.728  -6.447  -4.293  1.00 0.00 ? 232 CYS A CA   5  
ATOM   9916  C  C    . CYS A 1 77  ? 17.142  -6.925  -3.947  1.00 0.00 ? 232 CYS A C    5  
ATOM   9917  O  O    . CYS A 1 77  ? 17.351  -8.074  -3.604  1.00 0.00 ? 232 CYS A O    5  
ATOM   9918  C  CB   . CYS A 1 77  ? 14.954  -6.097  -3.016  1.00 0.00 ? 232 CYS A CB   5  
ATOM   9919  S  SG   . CYS A 1 77  ? 15.774  -4.720  -2.172  1.00 0.00 ? 232 CYS A SG   5  
ATOM   9920  H  H    . CYS A 1 77  ? 14.531  -8.246  -4.431  1.00 0.00 ? 232 CYS A H    5  
ATOM   9921  H  HA   . CYS A 1 77  ? 15.782  -5.581  -4.929  1.00 0.00 ? 232 CYS A HA   5  
ATOM   9922  H  HB2  . CYS A 1 77  ? 13.945  -5.813  -3.274  1.00 0.00 ? 232 CYS A HB2  5  
ATOM   9923  H  HB3  . CYS A 1 77  ? 14.930  -6.957  -2.363  1.00 0.00 ? 232 CYS A HB3  5  
ATOM   9924  N  N    . ASP A 1 78  ? 18.113  -6.039  -4.015  1.00 0.00 ? 233 ASP A N    5  
ATOM   9925  C  CA   . ASP A 1 78  ? 19.512  -6.435  -3.665  1.00 0.00 ? 233 ASP A CA   5  
ATOM   9926  C  C    . ASP A 1 78  ? 19.875  -5.876  -2.279  1.00 0.00 ? 233 ASP A C    5  
ATOM   9927  O  O    . ASP A 1 78  ? 20.980  -5.414  -2.065  1.00 0.00 ? 233 ASP A O    5  
ATOM   9928  C  CB   . ASP A 1 78  ? 20.402  -5.815  -4.747  1.00 0.00 ? 233 ASP A CB   5  
ATOM   9929  C  CG   . ASP A 1 78  ? 20.082  -6.455  -6.100  1.00 0.00 ? 233 ASP A CG   5  
ATOM   9930  O  OD1  . ASP A 1 78  ? 19.111  -6.043  -6.713  1.00 0.00 ? 233 ASP A OD1  5  
ATOM   9931  O  OD2  . ASP A 1 78  ? 20.812  -7.347  -6.499  1.00 0.00 ? 233 ASP A OD2  5  
ATOM   9932  H  H    . ASP A 1 78  ? 17.915  -5.106  -4.279  1.00 0.00 ? 233 ASP A H    5  
ATOM   9933  H  HA   . ASP A 1 78  ? 19.611  -7.510  -3.675  1.00 0.00 ? 233 ASP A HA   5  
ATOM   9934  H  HB2  . ASP A 1 78  ? 20.219  -4.752  -4.798  1.00 0.00 ? 233 ASP A HB2  5  
ATOM   9935  H  HB3  . ASP A 1 78  ? 21.440  -5.991  -4.505  1.00 0.00 ? 233 ASP A HB3  5  
ATOM   9936  N  N    . PHE A 1 79  ? 18.953  -5.913  -1.334  1.00 0.00 ? 234 PHE A N    5  
ATOM   9937  C  CA   . PHE A 1 79  ? 19.254  -5.380  0.031   1.00 0.00 ? 234 PHE A CA   5  
ATOM   9938  C  C    . PHE A 1 79  ? 18.481  -6.174  1.101   1.00 0.00 ? 234 PHE A C    5  
ATOM   9939  O  O    . PHE A 1 79  ? 19.079  -6.798  1.957   1.00 0.00 ? 234 PHE A O    5  
ATOM   9940  C  CB   . PHE A 1 79  ? 18.784  -3.923  0.002   1.00 0.00 ? 234 PHE A CB   5  
ATOM   9941  C  CG   . PHE A 1 79  ? 19.834  -3.050  -0.652  1.00 0.00 ? 234 PHE A CG   5  
ATOM   9942  C  CD1  . PHE A 1 79  ? 21.175  -3.127  -0.246  1.00 0.00 ? 234 PHE A CD1  5  
ATOM   9943  C  CD2  . PHE A 1 79  ? 19.465  -2.152  -1.663  1.00 0.00 ? 234 PHE A CD2  5  
ATOM   9944  C  CE1  . PHE A 1 79  ? 22.139  -2.314  -0.851  1.00 0.00 ? 234 PHE A CE1  5  
ATOM   9945  C  CE2  . PHE A 1 79  ? 20.428  -1.338  -2.266  1.00 0.00 ? 234 PHE A CE2  5  
ATOM   9946  C  CZ   . PHE A 1 79  ? 21.766  -1.419  -1.861  1.00 0.00 ? 234 PHE A CZ   5  
ATOM   9947  H  H    . PHE A 1 79  ? 18.064  -6.289  -1.521  1.00 0.00 ? 234 PHE A H    5  
ATOM   9948  H  HA   . PHE A 1 79  ? 20.314  -5.422  0.224   1.00 0.00 ? 234 PHE A HA   5  
ATOM   9949  H  HB2  . PHE A 1 79  ? 17.863  -3.855  -0.557  1.00 0.00 ? 234 PHE A HB2  5  
ATOM   9950  H  HB3  . PHE A 1 79  ? 18.616  -3.581  1.013   1.00 0.00 ? 234 PHE A HB3  5  
ATOM   9951  H  HD1  . PHE A 1 79  ? 21.464  -3.817  0.533   1.00 0.00 ? 234 PHE A HD1  5  
ATOM   9952  H  HD2  . PHE A 1 79  ? 18.434  -2.090  -1.979  1.00 0.00 ? 234 PHE A HD2  5  
ATOM   9953  H  HE1  . PHE A 1 79  ? 23.171  -2.375  -0.539  1.00 0.00 ? 234 PHE A HE1  5  
ATOM   9954  H  HE2  . PHE A 1 79  ? 20.140  -0.645  -3.042  1.00 0.00 ? 234 PHE A HE2  5  
ATOM   9955  H  HZ   . PHE A 1 79  ? 22.511  -0.790  -2.328  1.00 0.00 ? 234 PHE A HZ   5  
ATOM   9956  N  N    . CYS A 1 80  ? 17.161  -6.158  1.063   1.00 0.00 ? 235 CYS A N    5  
ATOM   9957  C  CA   . CYS A 1 80  ? 16.380  -6.926  2.097   1.00 0.00 ? 235 CYS A CA   5  
ATOM   9958  C  C    . CYS A 1 80  ? 15.969  -8.332  1.592   1.00 0.00 ? 235 CYS A C    5  
ATOM   9959  O  O    . CYS A 1 80  ? 15.080  -8.945  2.151   1.00 0.00 ? 235 CYS A O    5  
ATOM   9960  C  CB   . CYS A 1 80  ? 15.135  -6.070  2.422   1.00 0.00 ? 235 CYS A CB   5  
ATOM   9961  S  SG   . CYS A 1 80  ? 14.013  -5.973  0.993   1.00 0.00 ? 235 CYS A SG   5  
ATOM   9962  H  H    . CYS A 1 80  ? 16.692  -5.650  0.363   1.00 0.00 ? 235 CYS A H    5  
ATOM   9963  H  HA   . CYS A 1 80  ? 16.976  -7.030  2.990   1.00 0.00 ? 235 CYS A HA   5  
ATOM   9964  H  HB2  . CYS A 1 80  ? 14.608  -6.512  3.254   1.00 0.00 ? 235 CYS A HB2  5  
ATOM   9965  H  HB3  . CYS A 1 80  ? 15.453  -5.074  2.694   1.00 0.00 ? 235 CYS A HB3  5  
ATOM   9966  N  N    . HIS A 1 81  ? 16.605  -8.862  0.557   1.00 0.00 ? 236 HIS A N    5  
ATOM   9967  C  CA   . HIS A 1 81  ? 16.237  -10.228 0.051   1.00 0.00 ? 236 HIS A CA   5  
ATOM   9968  C  C    . HIS A 1 81  ? 14.714  -10.357 -0.165  1.00 0.00 ? 236 HIS A C    5  
ATOM   9969  O  O    . HIS A 1 81  ? 14.055  -11.137 0.499   1.00 0.00 ? 236 HIS A O    5  
ATOM   9970  C  CB   . HIS A 1 81  ? 16.709  -11.193 1.142   1.00 0.00 ? 236 HIS A CB   5  
ATOM   9971  C  CG   . HIS A 1 81  ? 17.082  -12.509 0.519   1.00 0.00 ? 236 HIS A CG   5  
ATOM   9972  N  ND1  . HIS A 1 81  ? 16.227  -13.601 0.528   1.00 0.00 ? 236 HIS A ND1  5  
ATOM   9973  C  CD2  . HIS A 1 81  ? 18.214  -12.926 -0.138  1.00 0.00 ? 236 HIS A CD2  5  
ATOM   9974  C  CE1  . HIS A 1 81  ? 16.852  -14.611 -0.104  1.00 0.00 ? 236 HIS A CE1  5  
ATOM   9975  N  NE2  . HIS A 1 81  ? 18.066  -14.253 -0.531  1.00 0.00 ? 236 HIS A NE2  5  
ATOM   9976  H  H    . HIS A 1 81  ? 17.329  -8.373  0.114   1.00 0.00 ? 236 HIS A H    5  
ATOM   9977  H  HA   . HIS A 1 81  ? 16.760  -10.436 -0.868  1.00 0.00 ? 236 HIS A HA   5  
ATOM   9978  H  HB2  . HIS A 1 81  ? 17.569  -10.775 1.644   1.00 0.00 ? 236 HIS A HB2  5  
ATOM   9979  H  HB3  . HIS A 1 81  ? 15.914  -11.346 1.856   1.00 0.00 ? 236 HIS A HB3  5  
ATOM   9980  H  HD1  . HIS A 1 81  ? 15.331  -13.630 0.924   1.00 0.00 ? 236 HIS A HD1  5  
ATOM   9981  H  HD2  . HIS A 1 81  ? 19.086  -12.316 -0.323  1.00 0.00 ? 236 HIS A HD2  5  
ATOM   9982  H  HE1  . HIS A 1 81  ? 16.424  -15.592 -0.249  1.00 0.00 ? 236 HIS A HE1  5  
ATOM   9983  N  N    . ASN A 1 82  ? 14.149  -9.604  -1.088  1.00 0.00 ? 237 ASN A N    5  
ATOM   9984  C  CA   . ASN A 1 82  ? 12.674  -9.702  -1.334  1.00 0.00 ? 237 ASN A CA   5  
ATOM   9985  C  C    . ASN A 1 82  ? 12.337  -9.286  -2.776  1.00 0.00 ? 237 ASN A C    5  
ATOM   9986  O  O    . ASN A 1 82  ? 13.219  -8.964  -3.550  1.00 0.00 ? 237 ASN A O    5  
ATOM   9987  C  CB   . ASN A 1 82  ? 12.038  -8.732  -0.339  1.00 0.00 ? 237 ASN A CB   5  
ATOM   9988  C  CG   . ASN A 1 82  ? 12.044  -9.354  1.063   1.00 0.00 ? 237 ASN A CG   5  
ATOM   9989  O  OD1  . ASN A 1 82  ? 12.604  -8.789  1.982   1.00 0.00 ? 237 ASN A OD1  5  
ATOM   9990  N  ND2  . ASN A 1 82  ? 11.442  -10.498 1.275   1.00 0.00 ? 237 ASN A ND2  5  
ATOM   9991  H  H    . ASN A 1 82  ? 14.692  -8.979  -1.619  1.00 0.00 ? 237 ASN A H    5  
ATOM   9992  H  HA   . ASN A 1 82  ? 12.327  -10.705 -1.142  1.00 0.00 ? 237 ASN A HA   5  
ATOM   9993  H  HB2  . ASN A 1 82  ? 12.599  -7.810  -0.328  1.00 0.00 ? 237 ASN A HB2  5  
ATOM   9994  H  HB3  . ASN A 1 82  ? 11.019  -8.530  -0.635  1.00 0.00 ? 237 ASN A HB3  5  
ATOM   9995  H  HD21 . ASN A 1 82  ? 10.983  -10.963 0.541   1.00 0.00 ? 237 ASN A HD21 5  
ATOM   9996  H  HD22 . ASN A 1 82  ? 11.448  -10.895 2.172   1.00 0.00 ? 237 ASN A HD22 5  
ATOM   9997  N  N    . ALA A 1 83  ? 11.071  -9.291  -3.146  1.00 0.00 ? 238 ALA A N    5  
ATOM   9998  C  CA   . ALA A 1 83  ? 10.701  -8.894  -4.540  1.00 0.00 ? 238 ALA A CA   5  
ATOM   9999  C  C    . ALA A 1 83  ? 9.262   -8.337  -4.585  1.00 0.00 ? 238 ALA A C    5  
ATOM   10000 O  O    . ALA A 1 83  ? 8.393   -8.808  -3.875  1.00 0.00 ? 238 ALA A O    5  
ATOM   10001 C  CB   . ALA A 1 83  ? 10.800  -10.186 -5.354  1.00 0.00 ? 238 ALA A CB   5  
ATOM   10002 H  H    . ALA A 1 83  ? 10.368  -9.554  -2.510  1.00 0.00 ? 238 ALA A H    5  
ATOM   10003 H  HA   . ALA A 1 83  ? 11.403  -8.167  -4.919  1.00 0.00 ? 238 ALA A HA   5  
ATOM   10004 H  HB1  . ALA A 1 83  ? 10.013  -10.207 -6.094  1.00 0.00 ? 238 ALA A HB1  5  
ATOM   10005 H  HB2  . ALA A 1 83  ? 10.696  -11.035 -4.695  1.00 0.00 ? 238 ALA A HB2  5  
ATOM   10006 H  HB3  . ALA A 1 83  ? 11.761  -10.230 -5.847  1.00 0.00 ? 238 ALA A HB3  5  
ATOM   10007 N  N    . PHE A 1 84  ? 8.999   -7.348  -5.418  1.00 0.00 ? 239 PHE A N    5  
ATOM   10008 C  CA   . PHE A 1 84  ? 7.611   -6.782  -5.503  1.00 0.00 ? 239 PHE A CA   5  
ATOM   10009 C  C    . PHE A 1 84  ? 6.975   -7.166  -6.849  1.00 0.00 ? 239 PHE A C    5  
ATOM   10010 O  O    . PHE A 1 84  ? 7.555   -7.921  -7.604  1.00 0.00 ? 239 PHE A O    5  
ATOM   10011 C  CB   . PHE A 1 84  ? 7.781   -5.264  -5.395  1.00 0.00 ? 239 PHE A CB   5  
ATOM   10012 C  CG   . PHE A 1 84  ? 7.859   -4.868  -3.940  1.00 0.00 ? 239 PHE A CG   5  
ATOM   10013 C  CD1  . PHE A 1 84  ? 6.685   -4.661  -3.203  1.00 0.00 ? 239 PHE A CD1  5  
ATOM   10014 C  CD2  . PHE A 1 84  ? 9.107   -4.710  -3.326  1.00 0.00 ? 239 PHE A CD2  5  
ATOM   10015 C  CE1  . PHE A 1 84  ? 6.760   -4.297  -1.852  1.00 0.00 ? 239 PHE A CE1  5  
ATOM   10016 C  CE2  . PHE A 1 84  ? 9.182   -4.348  -1.975  1.00 0.00 ? 239 PHE A CE2  5  
ATOM   10017 C  CZ   . PHE A 1 84  ? 8.009   -4.140  -1.237  1.00 0.00 ? 239 PHE A CZ   5  
ATOM   10018 H  H    . PHE A 1 84  ? 9.711   -6.982  -5.992  1.00 0.00 ? 239 PHE A H    5  
ATOM   10019 H  HA   . PHE A 1 84  ? 7.008   -7.145  -4.686  1.00 0.00 ? 239 PHE A HA   5  
ATOM   10020 H  HB2  . PHE A 1 84  ? 8.690   -4.967  -5.899  1.00 0.00 ? 239 PHE A HB2  5  
ATOM   10021 H  HB3  . PHE A 1 84  ? 6.938   -4.772  -5.856  1.00 0.00 ? 239 PHE A HB3  5  
ATOM   10022 H  HD1  . PHE A 1 84  ? 5.723   -4.782  -3.678  1.00 0.00 ? 239 PHE A HD1  5  
ATOM   10023 H  HD2  . PHE A 1 84  ? 10.012  -4.869  -3.897  1.00 0.00 ? 239 PHE A HD2  5  
ATOM   10024 H  HE1  . PHE A 1 84  ? 5.855   -4.136  -1.283  1.00 0.00 ? 239 PHE A HE1  5  
ATOM   10025 H  HE2  . PHE A 1 84  ? 10.144  -4.227  -1.501  1.00 0.00 ? 239 PHE A HE2  5  
ATOM   10026 H  HZ   . PHE A 1 84  ? 8.067   -3.861  -0.193  1.00 0.00 ? 239 PHE A HZ   5  
ATOM   10027 N  N    . CYS A 1 85  ? 5.793   -6.661  -7.163  1.00 0.00 ? 240 CYS A N    5  
ATOM   10028 C  CA   . CYS A 1 85  ? 5.155   -7.024  -8.469  1.00 0.00 ? 240 CYS A CA   5  
ATOM   10029 C  C    . CYS A 1 85  ? 4.886   -5.762  -9.319  1.00 0.00 ? 240 CYS A C    5  
ATOM   10030 O  O    . CYS A 1 85  ? 4.999   -4.651  -8.838  1.00 0.00 ? 240 CYS A O    5  
ATOM   10031 C  CB   . CYS A 1 85  ? 3.869   -7.813  -8.102  1.00 0.00 ? 240 CYS A CB   5  
ATOM   10032 S  SG   . CYS A 1 85  ? 2.433   -6.735  -7.791  1.00 0.00 ? 240 CYS A SG   5  
ATOM   10033 H  H    . CYS A 1 85  ? 5.333   -6.050  -6.551  1.00 0.00 ? 240 CYS A H    5  
ATOM   10034 H  HA   . CYS A 1 85  ? 5.818   -7.672  -9.012  1.00 0.00 ? 240 CYS A HA   5  
ATOM   10035 H  HB2  . CYS A 1 85  ? 3.627   -8.479  -8.915  1.00 0.00 ? 240 CYS A HB2  5  
ATOM   10036 H  HB3  . CYS A 1 85  ? 4.066   -8.404  -7.221  1.00 0.00 ? 240 CYS A HB3  5  
ATOM   10037 N  N    . LYS A 1 86  ? 4.546   -5.931  -10.581 1.00 0.00 ? 241 LYS A N    5  
ATOM   10038 C  CA   . LYS A 1 86  ? 4.289   -4.726  -11.455 1.00 0.00 ? 241 LYS A CA   5  
ATOM   10039 C  C    . LYS A 1 86  ? 2.941   -4.057  -11.105 1.00 0.00 ? 241 LYS A C    5  
ATOM   10040 O  O    . LYS A 1 86  ? 2.811   -2.851  -11.198 1.00 0.00 ? 241 LYS A O    5  
ATOM   10041 C  CB   . LYS A 1 86  ? 4.299   -5.230  -12.918 1.00 0.00 ? 241 LYS A CB   5  
ATOM   10042 C  CG   . LYS A 1 86  ? 3.088   -6.132  -13.197 1.00 0.00 ? 241 LYS A CG   5  
ATOM   10043 C  CD   . LYS A 1 86  ? 3.013   -6.434  -14.695 1.00 0.00 ? 241 LYS A CD   5  
ATOM   10044 C  CE   . LYS A 1 86  ? 1.744   -7.237  -14.990 1.00 0.00 ? 241 LYS A CE   5  
ATOM   10045 N  NZ   . LYS A 1 86  ? 2.057   -8.009  -16.225 1.00 0.00 ? 241 LYS A NZ   5  
ATOM   10046 H  H    . LYS A 1 86  ? 4.471   -6.842  -10.951 1.00 0.00 ? 241 LYS A H    5  
ATOM   10047 H  HA   . LYS A 1 86  ? 5.087   -4.012  -11.321 1.00 0.00 ? 241 LYS A HA   5  
ATOM   10048 H  HB2  . LYS A 1 86  ? 4.271   -4.382  -13.586 1.00 0.00 ? 241 LYS A HB2  5  
ATOM   10049 H  HB3  . LYS A 1 86  ? 5.207   -5.790  -13.094 1.00 0.00 ? 241 LYS A HB3  5  
ATOM   10050 H  HG2  . LYS A 1 86  ? 3.190   -7.058  -12.649 1.00 0.00 ? 241 LYS A HG2  5  
ATOM   10051 H  HG3  . LYS A 1 86  ? 2.185   -5.630  -12.889 1.00 0.00 ? 241 LYS A HG3  5  
ATOM   10052 H  HD2  . LYS A 1 86  ? 2.990   -5.506  -15.247 1.00 0.00 ? 241 LYS A HD2  5  
ATOM   10053 H  HD3  . LYS A 1 86  ? 3.877   -7.009  -14.990 1.00 0.00 ? 241 LYS A HD3  5  
ATOM   10054 H  HE2  . LYS A 1 86  ? 1.524   -7.907  -14.170 1.00 0.00 ? 241 LYS A HE2  5  
ATOM   10055 H  HE3  . LYS A 1 86  ? 0.911   -6.574  -15.170 1.00 0.00 ? 241 LYS A HE3  5  
ATOM   10056 H  HZ1  . LYS A 1 86  ? 2.444   -7.368  -16.946 1.00 0.00 ? 241 LYS A HZ1  5  
ATOM   10057 H  HZ2  . LYS A 1 86  ? 1.187   -8.452  -16.586 1.00 0.00 ? 241 LYS A HZ2  5  
ATOM   10058 H  HZ3  . LYS A 1 86  ? 2.757   -8.745  -16.006 1.00 0.00 ? 241 LYS A HZ3  5  
ATOM   10059 N  N    . LYS A 1 87  ? 1.938   -4.819  -10.713 1.00 0.00 ? 242 LYS A N    5  
ATOM   10060 C  CA   . LYS A 1 87  ? 0.608   -4.187  -10.372 1.00 0.00 ? 242 LYS A CA   5  
ATOM   10061 C  C    . LYS A 1 87  ? 0.755   -3.142  -9.247  1.00 0.00 ? 242 LYS A C    5  
ATOM   10062 O  O    . LYS A 1 87  ? -0.029  -2.213  -9.165  1.00 0.00 ? 242 LYS A O    5  
ATOM   10063 C  CB   . LYS A 1 87  ? -0.315  -5.326  -9.909  1.00 0.00 ? 242 LYS A CB   5  
ATOM   10064 C  CG   . LYS A 1 87  ? -1.773  -4.944  -10.176 1.00 0.00 ? 242 LYS A CG   5  
ATOM   10065 C  CD   . LYS A 1 87  ? -2.696  -6.017  -9.595  1.00 0.00 ? 242 LYS A CD   5  
ATOM   10066 C  CE   . LYS A 1 87  ? -3.985  -6.082  -10.419 1.00 0.00 ? 242 LYS A CE   5  
ATOM   10067 N  NZ   . LYS A 1 87  ? -4.921  -6.904  -9.602  1.00 0.00 ? 242 LYS A NZ   5  
ATOM   10068 H  H    . LYS A 1 87  ? 2.059   -5.795  -10.647 1.00 0.00 ? 242 LYS A H    5  
ATOM   10069 H  HA   . LYS A 1 87  ? 0.192   -3.721  -11.249 1.00 0.00 ? 242 LYS A HA   5  
ATOM   10070 H  HB2  . LYS A 1 87  ? -0.074  -6.228  -10.454 1.00 0.00 ? 242 LYS A HB2  5  
ATOM   10071 H  HB3  . LYS A 1 87  ? -0.176  -5.496  -8.853  1.00 0.00 ? 242 LYS A HB3  5  
ATOM   10072 H  HG2  . LYS A 1 87  ? -1.986  -3.994  -9.709  1.00 0.00 ? 242 LYS A HG2  5  
ATOM   10073 H  HG3  . LYS A 1 87  ? -1.936  -4.868  -11.240 1.00 0.00 ? 242 LYS A HG3  5  
ATOM   10074 H  HD2  . LYS A 1 87  ? -2.198  -6.976  -9.627  1.00 0.00 ? 242 LYS A HD2  5  
ATOM   10075 H  HD3  . LYS A 1 87  ? -2.937  -5.770  -8.572  1.00 0.00 ? 242 LYS A HD3  5  
ATOM   10076 H  HE2  . LYS A 1 87  ? -4.384  -5.088  -10.567 1.00 0.00 ? 242 LYS A HE2  5  
ATOM   10077 H  HE3  . LYS A 1 87  ? -3.801  -6.561  -11.367 1.00 0.00 ? 242 LYS A HE3  5  
ATOM   10078 H  HZ1  . LYS A 1 87  ? -4.458  -7.795  -9.336  1.00 0.00 ? 242 LYS A HZ1  5  
ATOM   10079 H  HZ2  . LYS A 1 87  ? -5.776  -7.109  -10.159 1.00 0.00 ? 242 LYS A HZ2  5  
ATOM   10080 H  HZ3  . LYS A 1 87  ? -5.182  -6.381  -8.743  1.00 0.00 ? 242 LYS A HZ3  5  
ATOM   10081 N  N    . CYS A 1 88  ? 1.742   -3.271  -8.382  1.00 0.00 ? 243 CYS A N    5  
ATOM   10082 C  CA   . CYS A 1 88  ? 1.904   -2.266  -7.279  1.00 0.00 ? 243 CYS A CA   5  
ATOM   10083 C  C    . CYS A 1 88  ? 2.793   -1.108  -7.753  1.00 0.00 ? 243 CYS A C    5  
ATOM   10084 O  O    . CYS A 1 88  ? 2.517   0.042   -7.461  1.00 0.00 ? 243 CYS A O    5  
ATOM   10085 C  CB   . CYS A 1 88  ? 2.558   -3.014  -6.103  1.00 0.00 ? 243 CYS A CB   5  
ATOM   10086 S  SG   . CYS A 1 88  ? 1.343   -4.115  -5.328  1.00 0.00 ? 243 CYS A SG   5  
ATOM   10087 H  H    . CYS A 1 88  ? 2.374   -4.014  -8.463  1.00 0.00 ? 243 CYS A H    5  
ATOM   10088 H  HA   . CYS A 1 88  ? 0.939   -1.887  -6.981  1.00 0.00 ? 243 CYS A HA   5  
ATOM   10089 H  HB2  . CYS A 1 88  ? 3.391   -3.598  -6.468  1.00 0.00 ? 243 CYS A HB2  5  
ATOM   10090 H  HB3  . CYS A 1 88  ? 2.914   -2.299  -5.376  1.00 0.00 ? 243 CYS A HB3  5  
ATOM   10091 N  N    . ILE A 1 89  ? 3.842   -1.390  -8.501  1.00 0.00 ? 244 ILE A N    5  
ATOM   10092 C  CA   . ILE A 1 89  ? 4.711   -0.268  -9.001  1.00 0.00 ? 244 ILE A CA   5  
ATOM   10093 C  C    . ILE A 1 89  ? 3.947   0.517   -10.079 1.00 0.00 ? 244 ILE A C    5  
ATOM   10094 O  O    . ILE A 1 89  ? 4.041   1.729   -10.143 1.00 0.00 ? 244 ILE A O    5  
ATOM   10095 C  CB   . ILE A 1 89  ? 5.987   -0.909  -9.572  1.00 0.00 ? 244 ILE A CB   5  
ATOM   10096 C  CG1  . ILE A 1 89  ? 6.722   -1.631  -8.440  1.00 0.00 ? 244 ILE A CG1  5  
ATOM   10097 C  CG2  . ILE A 1 89  ? 6.898   0.176   -10.156 1.00 0.00 ? 244 ILE A CG2  5  
ATOM   10098 C  CD1  . ILE A 1 89  ? 7.922   -2.390  -9.005  1.00 0.00 ? 244 ILE A CD1  5  
ATOM   10099 H  H    . ILE A 1 89  ? 4.039   -2.325  -8.745  1.00 0.00 ? 244 ILE A H    5  
ATOM   10100 H  HA   . ILE A 1 89  ? 4.967   0.388   -8.183  1.00 0.00 ? 244 ILE A HA   5  
ATOM   10101 H  HB   . ILE A 1 89  ? 5.723   -1.617  -10.344 1.00 0.00 ? 244 ILE A HB   5  
ATOM   10102 H  HG12 . ILE A 1 89  ? 7.062   -0.905  -7.716  1.00 0.00 ? 244 ILE A HG12 5  
ATOM   10103 H  HG13 . ILE A 1 89  ? 6.051   -2.327  -7.961  1.00 0.00 ? 244 ILE A HG13 5  
ATOM   10104 H  HG21 . ILE A 1 89  ? 6.496   0.512   -11.100 1.00 0.00 ? 244 ILE A HG21 5  
ATOM   10105 H  HG22 . ILE A 1 89  ? 7.887   -0.228  -10.308 1.00 0.00 ? 244 ILE A HG22 5  
ATOM   10106 H  HG23 . ILE A 1 89  ? 6.950   1.008   -9.469  1.00 0.00 ? 244 ILE A HG23 5  
ATOM   10107 H  HD11 . ILE A 1 89  ? 8.591   -2.657  -8.200  1.00 0.00 ? 244 ILE A HD11 5  
ATOM   10108 H  HD12 . ILE A 1 89  ? 8.443   -1.764  -9.714  1.00 0.00 ? 244 ILE A HD12 5  
ATOM   10109 H  HD13 . ILE A 1 89  ? 7.579   -3.287  -9.501  1.00 0.00 ? 244 ILE A HD13 5  
ATOM   10110 N  N    . LEU A 1 90  ? 3.166   -0.151  -10.914 1.00 0.00 ? 245 LEU A N    5  
ATOM   10111 C  CA   . LEU A 1 90  ? 2.384   0.600   -11.957 1.00 0.00 ? 245 LEU A CA   5  
ATOM   10112 C  C    . LEU A 1 90  ? 1.430   1.586   -11.262 1.00 0.00 ? 245 LEU A C    5  
ATOM   10113 O  O    . LEU A 1 90  ? 1.272   2.711   -11.702 1.00 0.00 ? 245 LEU A O    5  
ATOM   10114 C  CB   . LEU A 1 90  ? 1.587   -0.446  -12.763 1.00 0.00 ? 245 LEU A CB   5  
ATOM   10115 C  CG   . LEU A 1 90  ? 0.728   0.250   -13.827 1.00 0.00 ? 245 LEU A CG   5  
ATOM   10116 C  CD1  . LEU A 1 90  ? 1.625   1.020   -14.802 1.00 0.00 ? 245 LEU A CD1  5  
ATOM   10117 C  CD2  . LEU A 1 90  ? -0.076  -0.804  -14.593 1.00 0.00 ? 245 LEU A CD2  5  
ATOM   10118 H  H    . LEU A 1 90  ? 3.086   -1.129  -10.842 1.00 0.00 ? 245 LEU A H    5  
ATOM   10119 H  HA   . LEU A 1 90  ? 3.056   1.132   -12.607 1.00 0.00 ? 245 LEU A HA   5  
ATOM   10120 H  HB2  . LEU A 1 90  ? 2.275   -1.124  -13.246 1.00 0.00 ? 245 LEU A HB2  5  
ATOM   10121 H  HB3  . LEU A 1 90  ? 0.947   -1.002  -12.094 1.00 0.00 ? 245 LEU A HB3  5  
ATOM   10122 H  HG   . LEU A 1 90  ? 0.050   0.939   -13.344 1.00 0.00 ? 245 LEU A HG   5  
ATOM   10123 H  HD11 . LEU A 1 90  ? 2.633   0.637   -14.744 1.00 0.00 ? 245 LEU A HD11 5  
ATOM   10124 H  HD12 . LEU A 1 90  ? 1.624   2.068   -14.540 1.00 0.00 ? 245 LEU A HD12 5  
ATOM   10125 H  HD13 . LEU A 1 90  ? 1.253   0.901   -15.810 1.00 0.00 ? 245 LEU A HD13 5  
ATOM   10126 H  HD21 . LEU A 1 90  ? -0.269  -1.649  -13.949 1.00 0.00 ? 245 LEU A HD21 5  
ATOM   10127 H  HD22 . LEU A 1 90  ? 0.487   -1.129  -15.456 1.00 0.00 ? 245 LEU A HD22 5  
ATOM   10128 H  HD23 . LEU A 1 90  ? -1.014  -0.376  -14.917 1.00 0.00 ? 245 LEU A HD23 5  
ATOM   10129 N  N    . ARG A 1 91  ? 0.807   1.187   -10.168 1.00 0.00 ? 246 ARG A N    5  
ATOM   10130 C  CA   . ARG A 1 91  ? -0.114  2.140   -9.452  1.00 0.00 ? 246 ARG A CA   5  
ATOM   10131 C  C    . ARG A 1 91  ? 0.685   3.133   -8.575  1.00 0.00 ? 246 ARG A C    5  
ATOM   10132 O  O    . ARG A 1 91  ? 0.154   4.150   -8.169  1.00 0.00 ? 246 ARG A O    5  
ATOM   10133 C  CB   . ARG A 1 91  ? -1.044  1.286   -8.574  1.00 0.00 ? 246 ARG A CB   5  
ATOM   10134 C  CG   . ARG A 1 91  ? -2.310  0.938   -9.359  1.00 0.00 ? 246 ARG A CG   5  
ATOM   10135 C  CD   . ARG A 1 91  ? -1.949  0.034   -10.540 1.00 0.00 ? 246 ARG A CD   5  
ATOM   10136 N  NE   . ARG A 1 91  ? -3.240  -0.224  -11.236 1.00 0.00 ? 246 ARG A NE   5  
ATOM   10137 C  CZ   . ARG A 1 91  ? -3.445  0.257   -12.431 1.00 0.00 ? 246 ARG A CZ   5  
ATOM   10138 N  NH1  . ARG A 1 91  ? -2.859  -0.284  -13.462 1.00 0.00 ? 246 ARG A NH1  5  
ATOM   10139 N  NH2  . ARG A 1 91  ? -4.238  1.282   -12.595 1.00 0.00 ? 246 ARG A NH2  5  
ATOM   10140 H  H    . ARG A 1 91  ? 0.959   0.275   -9.812  1.00 0.00 ? 246 ARG A H    5  
ATOM   10141 H  HA   . ARG A 1 91  ? -0.702  2.687   -10.172 1.00 0.00 ? 246 ARG A HA   5  
ATOM   10142 H  HB2  . ARG A 1 91  ? -0.537  0.378   -8.282  1.00 0.00 ? 246 ARG A HB2  5  
ATOM   10143 H  HB3  . ARG A 1 91  ? -1.315  1.844   -7.690  1.00 0.00 ? 246 ARG A HB3  5  
ATOM   10144 H  HG2  . ARG A 1 91  ? -3.005  0.423   -8.710  1.00 0.00 ? 246 ARG A HG2  5  
ATOM   10145 H  HG3  . ARG A 1 91  ? -2.767  1.844   -9.728  1.00 0.00 ? 246 ARG A HG3  5  
ATOM   10146 H  HD2  . ARG A 1 91  ? -1.258  0.540   -11.200 1.00 0.00 ? 246 ARG A HD2  5  
ATOM   10147 H  HD3  . ARG A 1 91  ? -1.527  -0.894  -10.189 1.00 0.00 ? 246 ARG A HD3  5  
ATOM   10148 H  HE   . ARG A 1 91  ? -3.937  -0.755  -10.795 1.00 0.00 ? 246 ARG A HE   5  
ATOM   10149 H  HH11 . ARG A 1 91  ? -2.251  -1.069  -13.337 1.00 0.00 ? 246 ARG A HH11 5  
ATOM   10150 H  HH12 . ARG A 1 91  ? -3.015  0.084   -14.378 1.00 0.00 ? 246 ARG A HH12 5  
ATOM   10151 H  HH21 . ARG A 1 91  ? -4.688  1.697   -11.804 1.00 0.00 ? 246 ARG A HH21 5  
ATOM   10152 H  HH22 . ARG A 1 91  ? -4.395  1.650   -13.511 1.00 0.00 ? 246 ARG A HH22 5  
ATOM   10153 N  N    . ASN A 1 92  ? 1.948   2.863   -8.276  1.00 0.00 ? 247 ASN A N    5  
ATOM   10154 C  CA   . ASN A 1 92  ? 2.733   3.819   -7.427  1.00 0.00 ? 247 ASN A CA   5  
ATOM   10155 C  C    . ASN A 1 92  ? 3.596   4.738   -8.305  1.00 0.00 ? 247 ASN A C    5  
ATOM   10156 O  O    . ASN A 1 92  ? 3.699   5.923   -8.044  1.00 0.00 ? 247 ASN A O    5  
ATOM   10157 C  CB   . ASN A 1 92  ? 3.624   2.953   -6.526  1.00 0.00 ? 247 ASN A CB   5  
ATOM   10158 C  CG   . ASN A 1 92  ? 4.277   3.833   -5.453  1.00 0.00 ? 247 ASN A CG   5  
ATOM   10159 O  OD1  . ASN A 1 92  ? 4.741   4.917   -5.747  1.00 0.00 ? 247 ASN A OD1  5  
ATOM   10160 N  ND2  . ASN A 1 92  ? 4.336   3.415   -4.211  1.00 0.00 ? 247 ASN A ND2  5  
ATOM   10161 H  H    . ASN A 1 92  ? 2.374   2.045   -8.604  1.00 0.00 ? 247 ASN A H    5  
ATOM   10162 H  HA   . ASN A 1 92  ? 2.068   4.408   -6.824  1.00 0.00 ? 247 ASN A HA   5  
ATOM   10163 H  HB2  . ASN A 1 92  ? 3.021   2.191   -6.051  1.00 0.00 ? 247 ASN A HB2  5  
ATOM   10164 H  HB3  . ASN A 1 92  ? 4.392   2.484   -7.122  1.00 0.00 ? 247 ASN A HB3  5  
ATOM   10165 H  HD21 . ASN A 1 92  ? 3.965   2.541   -3.963  1.00 0.00 ? 247 ASN A HD21 5  
ATOM   10166 H  HD22 . ASN A 1 92  ? 4.755   3.979   -3.528  1.00 0.00 ? 247 ASN A HD22 5  
ATOM   10167 N  N    . LEU A 1 93  ? 4.223   4.212   -9.339  1.00 0.00 ? 248 LEU A N    5  
ATOM   10168 C  CA   . LEU A 1 93  ? 5.077   5.087   -10.208 1.00 0.00 ? 248 LEU A CA   5  
ATOM   10169 C  C    . LEU A 1 93  ? 5.050   4.669   -11.699 1.00 0.00 ? 248 LEU A C    5  
ATOM   10170 O  O    . LEU A 1 93  ? 5.968   4.980   -12.434 1.00 0.00 ? 248 LEU A O    5  
ATOM   10171 C  CB   . LEU A 1 93  ? 6.496   4.964   -9.633  1.00 0.00 ? 248 LEU A CB   5  
ATOM   10172 C  CG   . LEU A 1 93  ? 7.008   3.524   -9.754  1.00 0.00 ? 248 LEU A CG   5  
ATOM   10173 C  CD1  . LEU A 1 93  ? 7.700   3.338   -11.103 1.00 0.00 ? 248 LEU A CD1  5  
ATOM   10174 C  CD2  . LEU A 1 93  ? 8.009   3.247   -8.630  1.00 0.00 ? 248 LEU A CD2  5  
ATOM   10175 H  H    . LEU A 1 93  ? 4.135   3.256   -9.534  1.00 0.00 ? 248 LEU A H    5  
ATOM   10176 H  HA   . LEU A 1 93  ? 4.751   6.111   -10.118 1.00 0.00 ? 248 LEU A HA   5  
ATOM   10177 H  HB2  . LEU A 1 93  ? 7.158   5.624   -10.174 1.00 0.00 ? 248 LEU A HB2  5  
ATOM   10178 H  HB3  . LEU A 1 93  ? 6.483   5.250   -8.591  1.00 0.00 ? 248 LEU A HB3  5  
ATOM   10179 H  HG   . LEU A 1 93  ? 6.183   2.836   -9.678  1.00 0.00 ? 248 LEU A HG   5  
ATOM   10180 H  HD11 . LEU A 1 93  ? 8.176   4.262   -11.392 1.00 0.00 ? 248 LEU A HD11 5  
ATOM   10181 H  HD12 . LEU A 1 93  ? 6.967   3.062   -11.847 1.00 0.00 ? 248 LEU A HD12 5  
ATOM   10182 H  HD13 . LEU A 1 93  ? 8.443   2.559   -11.023 1.00 0.00 ? 248 LEU A HD13 5  
ATOM   10183 H  HD21 . LEU A 1 93  ? 8.583   2.364   -8.869  1.00 0.00 ? 248 LEU A HD21 5  
ATOM   10184 H  HD22 . LEU A 1 93  ? 7.476   3.091   -7.704  1.00 0.00 ? 248 LEU A HD22 5  
ATOM   10185 H  HD23 . LEU A 1 93  ? 8.674   4.091   -8.525  1.00 0.00 ? 248 LEU A HD23 5  
ATOM   10186 N  N    . GLY A 1 94  ? 4.010   4.001   -12.167 1.00 0.00 ? 249 GLY A N    5  
ATOM   10187 C  CA   . GLY A 1 94  ? 3.959   3.619   -13.613 1.00 0.00 ? 249 GLY A CA   5  
ATOM   10188 C  C    . GLY A 1 94  ? 4.805   2.364   -13.872 1.00 0.00 ? 249 GLY A C    5  
ATOM   10189 O  O    . GLY A 1 94  ? 5.456   1.852   -12.981 1.00 0.00 ? 249 GLY A O    5  
ATOM   10190 H  H    . GLY A 1 94  ? 3.258   3.770   -11.583 1.00 0.00 ? 249 GLY A H    5  
ATOM   10191 H  HA2  . GLY A 1 94  ? 2.936   3.424   -13.896 1.00 0.00 ? 249 GLY A HA2  5  
ATOM   10192 H  HA3  . GLY A 1 94  ? 4.345   4.431   -14.213 1.00 0.00 ? 249 GLY A HA3  5  
ATOM   10193 N  N    . ARG A 1 95  ? 4.798   1.863   -15.092 1.00 0.00 ? 250 ARG A N    5  
ATOM   10194 C  CA   . ARG A 1 95  ? 5.605   0.634   -15.408 1.00 0.00 ? 250 ARG A CA   5  
ATOM   10195 C  C    . ARG A 1 95  ? 6.951   0.998   -16.067 1.00 0.00 ? 250 ARG A C    5  
ATOM   10196 O  O    . ARG A 1 95  ? 7.919   0.279   -15.917 1.00 0.00 ? 250 ARG A O    5  
ATOM   10197 C  CB   . ARG A 1 95  ? 4.748   -0.189  -16.379 1.00 0.00 ? 250 ARG A CB   5  
ATOM   10198 C  CG   . ARG A 1 95  ? 4.825   -1.671  -16.005 1.00 0.00 ? 250 ARG A CG   5  
ATOM   10199 C  CD   . ARG A 1 95  ? 5.922   -2.352  -16.827 1.00 0.00 ? 250 ARG A CD   5  
ATOM   10200 N  NE   . ARG A 1 95  ? 5.986   -3.745  -16.303 1.00 0.00 ? 250 ARG A NE   5  
ATOM   10201 C  CZ   . ARG A 1 95  ? 5.455   -4.724  -16.983 1.00 0.00 ? 250 ARG A CZ   5  
ATOM   10202 N  NH1  . ARG A 1 95  ? 4.291   -4.567  -17.552 1.00 0.00 ? 250 ARG A NH1  5  
ATOM   10203 N  NH2  . ARG A 1 95  ? 6.087   -5.860  -17.092 1.00 0.00 ? 250 ARG A NH2  5  
ATOM   10204 H  H    . ARG A 1 95  ? 4.261   2.293   -15.799 1.00 0.00 ? 250 ARG A H    5  
ATOM   10205 H  HA   . ARG A 1 95  ? 5.780   0.071   -14.509 1.00 0.00 ? 250 ARG A HA   5  
ATOM   10206 H  HB2  . ARG A 1 95  ? 3.723   0.144   -16.326 1.00 0.00 ? 250 ARG A HB2  5  
ATOM   10207 H  HB3  . ARG A 1 95  ? 5.117   -0.054  -17.385 1.00 0.00 ? 250 ARG A HB3  5  
ATOM   10208 H  HG2  . ARG A 1 95  ? 5.052   -1.765  -14.953 1.00 0.00 ? 250 ARG A HG2  5  
ATOM   10209 H  HG3  . ARG A 1 95  ? 3.877   -2.145  -16.211 1.00 0.00 ? 250 ARG A HG3  5  
ATOM   10210 H  HD2  . ARG A 1 95  ? 5.658   -2.352  -17.875 1.00 0.00 ? 250 ARG A HD2  5  
ATOM   10211 H  HD3  . ARG A 1 95  ? 6.868   -1.857  -16.676 1.00 0.00 ? 250 ARG A HD3  5  
ATOM   10212 H  HE   . ARG A 1 95  ? 6.428   -3.926  -15.447 1.00 0.00 ? 250 ARG A HE   5  
ATOM   10213 H  HH11 . ARG A 1 95  ? 3.806   -3.697  -17.468 1.00 0.00 ? 250 ARG A HH11 5  
ATOM   10214 H  HH12 . ARG A 1 95  ? 3.884   -5.318  -18.074 1.00 0.00 ? 250 ARG A HH12 5  
ATOM   10215 H  HH21 . ARG A 1 95  ? 6.978   -5.981  -16.655 1.00 0.00 ? 250 ARG A HH21 5  
ATOM   10216 H  HH22 . ARG A 1 95  ? 5.679   -6.611  -17.613 1.00 0.00 ? 250 ARG A HH22 5  
ATOM   10217 N  N    . LYS A 1 96  ? 7.029   2.095   -16.806 1.00 0.00 ? 251 LYS A N    5  
ATOM   10218 C  CA   . LYS A 1 96  ? 8.339   2.464   -17.473 1.00 0.00 ? 251 LYS A CA   5  
ATOM   10219 C  C    . LYS A 1 96  ? 9.485   2.455   -16.450 1.00 0.00 ? 251 LYS A C    5  
ATOM   10220 O  O    . LYS A 1 96  ? 10.427  1.698   -16.587 1.00 0.00 ? 251 LYS A O    5  
ATOM   10221 C  CB   . LYS A 1 96  ? 8.157   3.876   -18.056 1.00 0.00 ? 251 LYS A CB   5  
ATOM   10222 C  CG   . LYS A 1 96  ? 9.414   4.275   -18.832 1.00 0.00 ? 251 LYS A CG   5  
ATOM   10223 C  CD   . LYS A 1 96  ? 9.429   5.791   -19.036 1.00 0.00 ? 251 LYS A CD   5  
ATOM   10224 C  CE   . LYS A 1 96  ? 10.875  6.278   -19.143 1.00 0.00 ? 251 LYS A CE   5  
ATOM   10225 N  NZ   . LYS A 1 96  ? 11.209  6.175   -20.591 1.00 0.00 ? 251 LYS A NZ   5  
ATOM   10226 H  H    . LYS A 1 96  ? 6.233   2.661   -16.926 1.00 0.00 ? 251 LYS A H    5  
ATOM   10227 H  HA   . LYS A 1 96  ? 8.556   1.765   -18.266 1.00 0.00 ? 251 LYS A HA   5  
ATOM   10228 H  HB2  . LYS A 1 96  ? 7.306   3.882   -18.722 1.00 0.00 ? 251 LYS A HB2  5  
ATOM   10229 H  HB3  . LYS A 1 96  ? 7.992   4.579   -17.255 1.00 0.00 ? 251 LYS A HB3  5  
ATOM   10230 H  HG2  . LYS A 1 96  ? 10.291  3.977   -18.274 1.00 0.00 ? 251 LYS A HG2  5  
ATOM   10231 H  HG3  . LYS A 1 96  ? 9.416   3.784   -19.793 1.00 0.00 ? 251 LYS A HG3  5  
ATOM   10232 H  HD2  . LYS A 1 96  ? 8.896   6.037   -19.944 1.00 0.00 ? 251 LYS A HD2  5  
ATOM   10233 H  HD3  . LYS A 1 96  ? 8.951   6.272   -18.196 1.00 0.00 ? 251 LYS A HD3  5  
ATOM   10234 H  HE2  . LYS A 1 96  ? 10.951  7.305   -18.810 1.00 0.00 ? 251 LYS A HE2  5  
ATOM   10235 H  HE3  . LYS A 1 96  ? 11.530  5.645   -18.566 1.00 0.00 ? 251 LYS A HE3  5  
ATOM   10236 H  HZ1  . LYS A 1 96  ? 12.205  6.434   -20.738 1.00 0.00 ? 251 LYS A HZ1  5  
ATOM   10237 H  HZ2  . LYS A 1 96  ? 10.599  6.820   -21.134 1.00 0.00 ? 251 LYS A HZ2  5  
ATOM   10238 H  HZ3  . LYS A 1 96  ? 11.056  5.199   -20.913 1.00 0.00 ? 251 LYS A HZ3  5  
ATOM   10239 N  N    . GLU A 1 97  ? 9.411   3.270   -15.412 1.00 0.00 ? 252 GLU A N    5  
ATOM   10240 C  CA   . GLU A 1 97  ? 10.512  3.260   -14.379 1.00 0.00 ? 252 GLU A CA   5  
ATOM   10241 C  C    . GLU A 1 97  ? 10.743  1.822   -13.868 1.00 0.00 ? 252 GLU A C    5  
ATOM   10242 O  O    . GLU A 1 97  ? 11.850  1.454   -13.524 1.00 0.00 ? 252 GLU A O    5  
ATOM   10243 C  CB   . GLU A 1 97  ? 10.050  4.163   -13.223 1.00 0.00 ? 252 GLU A CB   5  
ATOM   10244 C  CG   . GLU A 1 97  ? 10.616  5.571   -13.419 1.00 0.00 ? 252 GLU A CG   5  
ATOM   10245 C  CD   . GLU A 1 97  ? 10.688  6.283   -12.067 1.00 0.00 ? 252 GLU A CD   5  
ATOM   10246 O  OE1  . GLU A 1 97  ? 11.368  5.779   -11.189 1.00 0.00 ? 252 GLU A OE1  5  
ATOM   10247 O  OE2  . GLU A 1 97  ? 10.062  7.323   -11.934 1.00 0.00 ? 252 GLU A OE2  5  
ATOM   10248 H  H    . GLU A 1 97  ? 8.632   3.865   -15.310 1.00 0.00 ? 252 GLU A H    5  
ATOM   10249 H  HA   . GLU A 1 97  ? 11.419  3.648   -14.808 1.00 0.00 ? 252 GLU A HA   5  
ATOM   10250 H  HB2  . GLU A 1 97  ? 8.971   4.207   -13.210 1.00 0.00 ? 252 GLU A HB2  5  
ATOM   10251 H  HB3  . GLU A 1 97  ? 10.406  3.761   -12.287 1.00 0.00 ? 252 GLU A HB3  5  
ATOM   10252 H  HG2  . GLU A 1 97  ? 11.607  5.504   -13.845 1.00 0.00 ? 252 GLU A HG2  5  
ATOM   10253 H  HG3  . GLU A 1 97  ? 9.974   6.129   -14.084 1.00 0.00 ? 252 GLU A HG3  5  
ATOM   10254 N  N    . LEU A 1 98  ? 9.705   1.004   -13.827 1.00 0.00 ? 253 LEU A N    5  
ATOM   10255 C  CA   . LEU A 1 98  ? 9.882   -0.414  -13.348 1.00 0.00 ? 253 LEU A CA   5  
ATOM   10256 C  C    . LEU A 1 98  ? 10.939  -1.138  -14.199 1.00 0.00 ? 253 LEU A C    5  
ATOM   10257 O  O    . LEU A 1 98  ? 11.700  -1.938  -13.687 1.00 0.00 ? 253 LEU A O    5  
ATOM   10258 C  CB   . LEU A 1 98  ? 8.518   -1.103  -13.512 1.00 0.00 ? 253 LEU A CB   5  
ATOM   10259 C  CG   . LEU A 1 98  ? 8.439   -2.309  -12.578 1.00 0.00 ? 253 LEU A CG   5  
ATOM   10260 C  CD1  . LEU A 1 98  ? 6.974   -2.679  -12.344 1.00 0.00 ? 253 LEU A CD1  5  
ATOM   10261 C  CD2  . LEU A 1 98  ? 9.169   -3.493  -13.215 1.00 0.00 ? 253 LEU A CD2  5  
ATOM   10262 H  H    . LEU A 1 98  ? 8.818   1.319   -14.114 1.00 0.00 ? 253 LEU A H    5  
ATOM   10263 H  HA   . LEU A 1 98  ? 10.174  -0.422  -12.310 1.00 0.00 ? 253 LEU A HA   5  
ATOM   10264 H  HB2  . LEU A 1 98  ? 7.731   -0.404  -13.265 1.00 0.00 ? 253 LEU A HB2  5  
ATOM   10265 H  HB3  . LEU A 1 98  ? 8.400   -1.431  -14.534 1.00 0.00 ? 253 LEU A HB3  5  
ATOM   10266 H  HG   . LEU A 1 98  ? 8.903   -2.060  -11.635 1.00 0.00 ? 253 LEU A HG   5  
ATOM   10267 H  HD11 . LEU A 1 98  ? 6.361   -1.795  -12.430 1.00 0.00 ? 253 LEU A HD11 5  
ATOM   10268 H  HD12 . LEU A 1 98  ? 6.863   -3.100  -11.356 1.00 0.00 ? 253 LEU A HD12 5  
ATOM   10269 H  HD13 . LEU A 1 98  ? 6.664   -3.405  -13.081 1.00 0.00 ? 253 LEU A HD13 5  
ATOM   10270 H  HD21 . LEU A 1 98  ? 8.724   -4.416  -12.874 1.00 0.00 ? 253 LEU A HD21 5  
ATOM   10271 H  HD22 . LEU A 1 98  ? 10.210  -3.470  -12.930 1.00 0.00 ? 253 LEU A HD22 5  
ATOM   10272 H  HD23 . LEU A 1 98  ? 9.088   -3.430  -14.290 1.00 0.00 ? 253 LEU A HD23 5  
ATOM   10273 N  N    . SER A 1 99  ? 11.000  -0.873  -15.492 1.00 0.00 ? 254 SER A N    5  
ATOM   10274 C  CA   . SER A 1 99  ? 12.034  -1.575  -16.339 1.00 0.00 ? 254 SER A CA   5  
ATOM   10275 C  C    . SER A 1 99  ? 13.439  -1.163  -15.884 1.00 0.00 ? 254 SER A C    5  
ATOM   10276 O  O    . SER A 1 99  ? 14.286  -2.004  -15.645 1.00 0.00 ? 254 SER A O    5  
ATOM   10277 C  CB   . SER A 1 99  ? 11.798  -1.141  -17.791 1.00 0.00 ? 254 SER A CB   5  
ATOM   10278 O  OG   . SER A 1 99  ? 12.120  -2.217  -18.662 1.00 0.00 ? 254 SER A OG   5  
ATOM   10279 H  H    . SER A 1 99  ? 10.375  -0.220  -15.898 1.00 0.00 ? 254 SER A H    5  
ATOM   10280 H  HA   . SER A 1 99  ? 11.920  -2.645  -16.249 1.00 0.00 ? 254 SER A HA   5  
ATOM   10281 H  HB2  . SER A 1 99  ? 10.764  -0.874  -17.927 1.00 0.00 ? 254 SER A HB2  5  
ATOM   10282 H  HB3  . SER A 1 99  ? 12.420  -0.284  -18.014 1.00 0.00 ? 254 SER A HB3  5  
ATOM   10283 H  HG   . SER A 1 99  ? 12.161  -1.872  -19.557 1.00 0.00 ? 254 SER A HG   5  
ATOM   10284 N  N    . THR A 1 100 ? 13.698  0.125   -15.747 1.00 0.00 ? 255 THR A N    5  
ATOM   10285 C  CA   . THR A 1 100 ? 15.068  0.564   -15.287 1.00 0.00 ? 255 THR A CA   5  
ATOM   10286 C  C    . THR A 1 100 ? 15.418  -0.101  -13.942 1.00 0.00 ? 255 THR A C    5  
ATOM   10287 O  O    . THR A 1 100 ? 16.567  -0.402  -13.680 1.00 0.00 ? 255 THR A O    5  
ATOM   10288 C  CB   . THR A 1 100 ? 15.011  2.093   -15.121 1.00 0.00 ? 255 THR A CB   5  
ATOM   10289 O  OG1  . THR A 1 100 ? 14.396  2.668   -16.265 1.00 0.00 ? 255 THR A OG1  5  
ATOM   10290 C  CG2  . THR A 1 100 ? 16.430  2.644   -14.970 1.00 0.00 ? 255 THR A CG2  5  
ATOM   10291 H  H    . THR A 1 100 ? 12.995  0.791   -15.938 1.00 0.00 ? 255 THR A H    5  
ATOM   10292 H  HA   . THR A 1 100 ? 15.805  0.305   -16.027 1.00 0.00 ? 255 THR A HA   5  
ATOM   10293 H  HB   . THR A 1 100 ? 14.438  2.338   -14.241 1.00 0.00 ? 255 THR A HB   5  
ATOM   10294 H  HG1  . THR A 1 100 ? 14.092  3.547   -16.027 1.00 0.00 ? 255 THR A HG1  5  
ATOM   10295 H  HG21 . THR A 1 100 ? 16.903  2.190   -14.111 1.00 0.00 ? 255 THR A HG21 5  
ATOM   10296 H  HG22 . THR A 1 100 ? 16.387  3.715   -14.834 1.00 0.00 ? 255 THR A HG22 5  
ATOM   10297 H  HG23 . THR A 1 100 ? 17.001  2.417   -15.858 1.00 0.00 ? 255 THR A HG23 5  
ATOM   10298 N  N    . ILE A 1 101 ? 14.439  -0.336  -13.088 1.00 0.00 ? 256 ILE A N    5  
ATOM   10299 C  CA   . ILE A 1 101 ? 14.740  -0.990  -11.762 1.00 0.00 ? 256 ILE A CA   5  
ATOM   10300 C  C    . ILE A 1 101 ? 15.411  -2.357  -11.989 1.00 0.00 ? 256 ILE A C    5  
ATOM   10301 O  O    . ILE A 1 101 ? 16.334  -2.718  -11.283 1.00 0.00 ? 256 ILE A O    5  
ATOM   10302 C  CB   . ILE A 1 101 ? 13.383  -1.158  -11.041 1.00 0.00 ? 256 ILE A CB   5  
ATOM   10303 C  CG1  . ILE A 1 101 ? 12.856  0.219   -10.631 1.00 0.00 ? 256 ILE A CG1  5  
ATOM   10304 C  CG2  . ILE A 1 101 ? 13.542  -2.029  -9.789  1.00 0.00 ? 256 ILE A CG2  5  
ATOM   10305 C  CD1  . ILE A 1 101 ? 11.432  0.081   -10.088 1.00 0.00 ? 256 ILE A CD1  5  
ATOM   10306 H  H    . ILE A 1 101 ? 13.516  -0.085  -13.319 1.00 0.00 ? 256 ILE A H    5  
ATOM   10307 H  HA   . ILE A 1 101 ? 15.387  -0.358  -11.181 1.00 0.00 ? 256 ILE A HA   5  
ATOM   10308 H  HB   . ILE A 1 101 ? 12.679  -1.626  -11.712 1.00 0.00 ? 256 ILE A HB   5  
ATOM   10309 H  HG12 . ILE A 1 101 ? 13.495  0.635   -9.866  1.00 0.00 ? 256 ILE A HG12 5  
ATOM   10310 H  HG13 . ILE A 1 101 ? 12.849  0.874   -11.490 1.00 0.00 ? 256 ILE A HG13 5  
ATOM   10311 H  HG21 . ILE A 1 101 ? 13.508  -3.070  -10.072 1.00 0.00 ? 256 ILE A HG21 5  
ATOM   10312 H  HG22 . ILE A 1 101 ? 12.740  -1.818  -9.099  1.00 0.00 ? 256 ILE A HG22 5  
ATOM   10313 H  HG23 . ILE A 1 101 ? 14.488  -1.816  -9.323  1.00 0.00 ? 256 ILE A HG23 5  
ATOM   10314 H  HD11 . ILE A 1 101 ? 10.967  -0.796  -10.514 1.00 0.00 ? 256 ILE A HD11 5  
ATOM   10315 H  HD12 . ILE A 1 101 ? 10.859  0.957   -10.353 1.00 0.00 ? 256 ILE A HD12 5  
ATOM   10316 H  HD13 . ILE A 1 101 ? 11.465  -0.016  -9.013  1.00 0.00 ? 256 ILE A HD13 5  
ATOM   10317 N  N    . MET A 1 102 ? 14.952  -3.121  -12.956 1.00 0.00 ? 257 MET A N    5  
ATOM   10318 C  CA   . MET A 1 102 ? 15.585  -4.470  -13.191 1.00 0.00 ? 257 MET A CA   5  
ATOM   10319 C  C    . MET A 1 102 ? 17.084  -4.324  -13.512 1.00 0.00 ? 257 MET A C    5  
ATOM   10320 O  O    . MET A 1 102 ? 17.868  -5.200  -13.196 1.00 0.00 ? 257 MET A O    5  
ATOM   10321 C  CB   . MET A 1 102 ? 14.837  -5.116  -14.367 1.00 0.00 ? 257 MET A CB   5  
ATOM   10322 C  CG   . MET A 1 102 ? 13.670  -5.948  -13.824 1.00 0.00 ? 257 MET A CG   5  
ATOM   10323 S  SD   . MET A 1 102 ? 14.274  -7.581  -13.322 1.00 0.00 ? 257 MET A SD   5  
ATOM   10324 C  CE   . MET A 1 102 ? 14.228  -7.312  -11.531 1.00 0.00 ? 257 MET A CE   5  
ATOM   10325 H  H    . MET A 1 102 ? 14.198  -2.810  -13.516 1.00 0.00 ? 257 MET A H    5  
ATOM   10326 H  HA   . MET A 1 102 ? 15.465  -5.079  -12.312 1.00 0.00 ? 257 MET A HA   5  
ATOM   10327 H  HB2  . MET A 1 102 ? 14.459  -4.346  -15.023 1.00 0.00 ? 257 MET A HB2  5  
ATOM   10328 H  HB3  . MET A 1 102 ? 15.510  -5.759  -14.913 1.00 0.00 ? 257 MET A HB3  5  
ATOM   10329 H  HG2  . MET A 1 102 ? 13.236  -5.445  -12.970 1.00 0.00 ? 257 MET A HG2  5  
ATOM   10330 H  HG3  . MET A 1 102 ? 12.921  -6.063  -14.593 1.00 0.00 ? 257 MET A HG3  5  
ATOM   10331 H  HE1  . MET A 1 102 ? 14.269  -8.266  -11.021 1.00 0.00 ? 257 MET A HE1  5  
ATOM   10332 H  HE2  . MET A 1 102 ? 13.315  -6.806  -11.265 1.00 0.00 ? 257 MET A HE2  5  
ATOM   10333 H  HE3  . MET A 1 102 ? 15.073  -6.705  -11.236 1.00 0.00 ? 257 MET A HE3  5  
ATOM   10334 N  N    . ASP A 1 103 ? 17.497  -3.233  -14.126 1.00 0.00 ? 258 ASP A N    5  
ATOM   10335 C  CA   . ASP A 1 103 ? 18.947  -3.056  -14.444 1.00 0.00 ? 258 ASP A CA   5  
ATOM   10336 C  C    . ASP A 1 103 ? 19.512  -1.856  -13.664 1.00 0.00 ? 258 ASP A C    5  
ATOM   10337 O  O    . ASP A 1 103 ? 19.837  -0.833  -14.241 1.00 0.00 ? 258 ASP A O    5  
ATOM   10338 C  CB   . ASP A 1 103 ? 18.995  -2.793  -15.951 1.00 0.00 ? 258 ASP A CB   5  
ATOM   10339 C  CG   . ASP A 1 103 ? 18.782  -4.107  -16.705 1.00 0.00 ? 258 ASP A CG   5  
ATOM   10340 O  OD1  . ASP A 1 103 ? 17.836  -4.806  -16.382 1.00 0.00 ? 258 ASP A OD1  5  
ATOM   10341 O  OD2  . ASP A 1 103 ? 19.569  -4.393  -17.592 1.00 0.00 ? 258 ASP A OD2  5  
ATOM   10342 H  H    . ASP A 1 103 ? 16.861  -2.529  -14.373 1.00 0.00 ? 258 ASP A H    5  
ATOM   10343 H  HA   . ASP A 1 103 ? 19.497  -3.952  -14.207 1.00 0.00 ? 258 ASP A HA   5  
ATOM   10344 H  HB2  . ASP A 1 103 ? 18.217  -2.093  -16.219 1.00 0.00 ? 258 ASP A HB2  5  
ATOM   10345 H  HB3  . ASP A 1 103 ? 19.957  -2.381  -16.214 1.00 0.00 ? 258 ASP A HB3  5  
ATOM   10346 N  N    . GLU A 1 104 ? 19.627  -1.964  -12.354 1.00 0.00 ? 259 GLU A N    5  
ATOM   10347 C  CA   . GLU A 1 104 ? 20.164  -0.822  -11.552 1.00 0.00 ? 259 GLU A CA   5  
ATOM   10348 C  C    . GLU A 1 104 ? 21.488  -1.211  -10.868 1.00 0.00 ? 259 GLU A C    5  
ATOM   10349 O  O    . GLU A 1 104 ? 21.633  -1.070  -9.668  1.00 0.00 ? 259 GLU A O    5  
ATOM   10350 C  CB   . GLU A 1 104 ? 19.084  -0.530  -10.508 1.00 0.00 ? 259 GLU A CB   5  
ATOM   10351 C  CG   . GLU A 1 104 ? 18.942  0.982   -10.321 1.00 0.00 ? 259 GLU A CG   5  
ATOM   10352 C  CD   . GLU A 1 104 ? 18.468  1.280   -8.898  1.00 0.00 ? 259 GLU A CD   5  
ATOM   10353 O  OE1  . GLU A 1 104 ? 19.183  0.935   -7.972  1.00 0.00 ? 259 GLU A OE1  5  
ATOM   10354 O  OE2  . GLU A 1 104 ? 17.398  1.848   -8.759  1.00 0.00 ? 259 GLU A OE2  5  
ATOM   10355 H  H    . GLU A 1 104 ? 19.356  -2.792  -11.899 1.00 0.00 ? 259 GLU A H    5  
ATOM   10356 H  HA   . GLU A 1 104 ? 20.308  0.042   -12.182 1.00 0.00 ? 259 GLU A HA   5  
ATOM   10357 H  HB2  . GLU A 1 104 ? 18.141  -0.942  -10.841 1.00 0.00 ? 259 GLU A HB2  5  
ATOM   10358 H  HB3  . GLU A 1 104 ? 19.361  -0.982  -9.567  1.00 0.00 ? 259 GLU A HB3  5  
ATOM   10359 H  HG2  . GLU A 1 104 ? 19.900  1.455   -10.489 1.00 0.00 ? 259 GLU A HG2  5  
ATOM   10360 H  HG3  . GLU A 1 104 ? 18.221  1.366   -11.028 1.00 0.00 ? 259 GLU A HG3  5  
ATOM   10361 N  N    . ASN A 1 105 ? 22.461  -1.696  -11.618 1.00 0.00 ? 260 ASN A N    5  
ATOM   10362 C  CA   . ASN A 1 105 ? 23.776  -2.088  -11.009 1.00 0.00 ? 260 ASN A CA   5  
ATOM   10363 C  C    . ASN A 1 105 ? 23.568  -3.086  -9.857  1.00 0.00 ? 260 ASN A C    5  
ATOM   10364 O  O    . ASN A 1 105 ? 24.256  -3.033  -8.855  1.00 0.00 ? 260 ASN A O    5  
ATOM   10365 C  CB   . ASN A 1 105 ? 24.396  -0.787  -10.488 1.00 0.00 ? 260 ASN A CB   5  
ATOM   10366 C  CG   . ASN A 1 105 ? 25.198  -0.116  -11.611 1.00 0.00 ? 260 ASN A CG   5  
ATOM   10367 O  OD1  . ASN A 1 105 ? 24.856  -0.242  -12.769 1.00 0.00 ? 260 ASN A OD1  5  
ATOM   10368 N  ND2  . ASN A 1 105 ? 26.260  0.595   -11.320 1.00 0.00 ? 260 ASN A ND2  5  
ATOM   10369 H  H    . ASN A 1 105 ? 22.331  -1.804  -12.585 1.00 0.00 ? 260 ASN A H    5  
ATOM   10370 H  HA   . ASN A 1 105 ? 24.418  -2.521  -11.760 1.00 0.00 ? 260 ASN A HA   5  
ATOM   10371 H  HB2  . ASN A 1 105 ? 23.613  -0.120  -10.158 1.00 0.00 ? 260 ASN A HB2  5  
ATOM   10372 H  HB3  . ASN A 1 105 ? 25.054  -1.006  -9.661  1.00 0.00 ? 260 ASN A HB3  5  
ATOM   10373 H  HD21 . ASN A 1 105 ? 26.547  0.704   -10.387 1.00 0.00 ? 260 ASN A HD21 5  
ATOM   10374 H  HD22 . ASN A 1 105 ? 26.771  1.022   -12.039 1.00 0.00 ? 260 ASN A HD22 5  
ATOM   10375 N  N    . ASN A 1 106 ? 22.629  -4.003  -9.989  1.00 0.00 ? 261 ASN A N    5  
ATOM   10376 C  CA   . ASN A 1 106 ? 22.383  -5.009  -8.902  1.00 0.00 ? 261 ASN A CA   5  
ATOM   10377 C  C    . ASN A 1 106 ? 22.232  -4.333  -7.523  1.00 0.00 ? 261 ASN A C    5  
ATOM   10378 O  O    . ASN A 1 106 ? 22.583  -4.912  -6.511  1.00 0.00 ? 261 ASN A O    5  
ATOM   10379 C  CB   . ASN A 1 106 ? 23.614  -5.917  -8.917  1.00 0.00 ? 261 ASN A CB   5  
ATOM   10380 C  CG   . ASN A 1 106 ? 23.270  -7.259  -8.259  1.00 0.00 ? 261 ASN A CG   5  
ATOM   10381 O  OD1  . ASN A 1 106 ? 23.824  -7.601  -7.233  1.00 0.00 ? 261 ASN A OD1  5  
ATOM   10382 N  ND2  . ASN A 1 106 ? 22.371  -8.044  -8.804  1.00 0.00 ? 261 ASN A ND2  5  
ATOM   10383 H  H    . ASN A 1 106 ? 22.083  -4.036  -10.808 1.00 0.00 ? 261 ASN A H    5  
ATOM   10384 H  HA   . ASN A 1 106 ? 21.503  -5.590  -9.128  1.00 0.00 ? 261 ASN A HA   5  
ATOM   10385 H  HB2  . ASN A 1 106 ? 23.925  -6.085  -9.938  1.00 0.00 ? 261 ASN A HB2  5  
ATOM   10386 H  HB3  . ASN A 1 106 ? 24.416  -5.446  -8.370  1.00 0.00 ? 261 ASN A HB3  5  
ATOM   10387 H  HD21 . ASN A 1 106 ? 21.917  -7.778  -9.632  1.00 0.00 ? 261 ASN A HD21 5  
ATOM   10388 H  HD22 . ASN A 1 106 ? 22.153  -8.901  -8.381  1.00 0.00 ? 261 ASN A HD22 5  
ATOM   10389 N  N    . GLN A 1 107 ? 21.707  -3.124  -7.464  1.00 0.00 ? 262 GLN A N    5  
ATOM   10390 C  CA   . GLN A 1 107 ? 21.535  -2.444  -6.142  1.00 0.00 ? 262 GLN A CA   5  
ATOM   10391 C  C    . GLN A 1 107 ? 20.264  -1.578  -6.159  1.00 0.00 ? 262 GLN A C    5  
ATOM   10392 O  O    . GLN A 1 107 ? 20.337  -0.362  -6.184  1.00 0.00 ? 262 GLN A O    5  
ATOM   10393 C  CB   . GLN A 1 107 ? 22.778  -1.571  -5.969  1.00 0.00 ? 262 GLN A CB   5  
ATOM   10394 C  CG   . GLN A 1 107 ? 23.883  -2.381  -5.287  1.00 0.00 ? 262 GLN A CG   5  
ATOM   10395 C  CD   . GLN A 1 107 ? 25.204  -1.605  -5.355  1.00 0.00 ? 262 GLN A CD   5  
ATOM   10396 O  OE1  . GLN A 1 107 ? 25.594  -1.146  -6.411  1.00 0.00 ? 262 GLN A OE1  5  
ATOM   10397 N  NE2  . GLN A 1 107 ? 25.919  -1.434  -4.270  1.00 0.00 ? 262 GLN A NE2  5  
ATOM   10398 H  H    . GLN A 1 107 ? 21.417  -2.667  -8.284  1.00 0.00 ? 262 GLN A H    5  
ATOM   10399 H  HA   . GLN A 1 107 ? 21.482  -3.173  -5.348  1.00 0.00 ? 262 GLN A HA   5  
ATOM   10400 H  HB2  . GLN A 1 107 ? 23.120  -1.235  -6.937  1.00 0.00 ? 262 GLN A HB2  5  
ATOM   10401 H  HB3  . GLN A 1 107 ? 22.533  -0.716  -5.357  1.00 0.00 ? 262 GLN A HB3  5  
ATOM   10402 H  HG2  . GLN A 1 107 ? 23.617  -2.551  -4.254  1.00 0.00 ? 262 GLN A HG2  5  
ATOM   10403 H  HG3  . GLN A 1 107 ? 23.999  -3.328  -5.792  1.00 0.00 ? 262 GLN A HG3  5  
ATOM   10404 H  HE21 . GLN A 1 107 ? 25.615  -1.801  -3.411  1.00 0.00 ? 262 GLN A HE21 5  
ATOM   10405 H  HE22 . GLN A 1 107 ? 26.763  -0.938  -4.316  1.00 0.00 ? 262 GLN A HE22 5  
ATOM   10406 N  N    . TRP A 1 108 ? 19.099  -2.192  -6.157  1.00 0.00 ? 263 TRP A N    5  
ATOM   10407 C  CA   . TRP A 1 108 ? 17.833  -1.395  -6.187  1.00 0.00 ? 263 TRP A CA   5  
ATOM   10408 C  C    . TRP A 1 108 ? 17.212  -1.301  -4.780  1.00 0.00 ? 263 TRP A C    5  
ATOM   10409 O  O    . TRP A 1 108 ? 16.896  -2.307  -4.171  1.00 0.00 ? 263 TRP A O    5  
ATOM   10410 C  CB   . TRP A 1 108 ? 16.900  -2.162  -7.151  1.00 0.00 ? 263 TRP A CB   5  
ATOM   10411 C  CG   . TRP A 1 108 ? 15.498  -1.622  -7.077  1.00 0.00 ? 263 TRP A CG   5  
ATOM   10412 C  CD1  . TRP A 1 108 ? 15.122  -0.374  -7.431  1.00 0.00 ? 263 TRP A CD1  5  
ATOM   10413 C  CD2  . TRP A 1 108 ? 14.293  -2.296  -6.617  1.00 0.00 ? 263 TRP A CD2  5  
ATOM   10414 N  NE1  . TRP A 1 108 ? 13.763  -0.236  -7.210  1.00 0.00 ? 263 TRP A NE1  5  
ATOM   10415 C  CE2  . TRP A 1 108 ? 13.207  -1.395  -6.707  1.00 0.00 ? 263 TRP A CE2  5  
ATOM   10416 C  CE3  . TRP A 1 108 ? 14.043  -3.590  -6.133  1.00 0.00 ? 263 TRP A CE3  5  
ATOM   10417 C  CZ2  . TRP A 1 108 ? 11.916  -1.764  -6.328  1.00 0.00 ? 263 TRP A CZ2  5  
ATOM   10418 C  CZ3  . TRP A 1 108 ? 12.744  -3.968  -5.751  1.00 0.00 ? 263 TRP A CZ3  5  
ATOM   10419 C  CH2  . TRP A 1 108 ? 11.683  -3.056  -5.847  1.00 0.00 ? 263 TRP A CH2  5  
ATOM   10420 H  H    . TRP A 1 108 ? 19.057  -3.176  -6.146  1.00 0.00 ? 263 TRP A H    5  
ATOM   10421 H  HA   . TRP A 1 108 ? 18.024  -0.407  -6.576  1.00 0.00 ? 263 TRP A HA   5  
ATOM   10422 H  HB2  . TRP A 1 108 ? 17.273  -2.064  -8.155  1.00 0.00 ? 263 TRP A HB2  5  
ATOM   10423 H  HB3  . TRP A 1 108 ? 16.893  -3.208  -6.877  1.00 0.00 ? 263 TRP A HB3  5  
ATOM   10424 H  HD1  . TRP A 1 108 ? 15.771  0.386   -7.824  1.00 0.00 ? 263 TRP A HD1  5  
ATOM   10425 H  HE1  . TRP A 1 108 ? 13.241  0.576   -7.381  1.00 0.00 ? 263 TRP A HE1  5  
ATOM   10426 H  HE3  . TRP A 1 108 ? 14.854  -4.298  -6.062  1.00 0.00 ? 263 TRP A HE3  5  
ATOM   10427 H  HZ2  . TRP A 1 108 ? 11.101  -1.058  -6.403  1.00 0.00 ? 263 TRP A HZ2  5  
ATOM   10428 H  HZ3  . TRP A 1 108 ? 12.563  -4.966  -5.379  1.00 0.00 ? 263 TRP A HZ3  5  
ATOM   10429 H  HH2  . TRP A 1 108 ? 10.686  -3.351  -5.551  1.00 0.00 ? 263 TRP A HH2  5  
ATOM   10430 N  N    . TYR A 1 109 ? 16.984  -0.099  -4.284  1.00 0.00 ? 264 TYR A N    5  
ATOM   10431 C  CA   . TYR A 1 109 ? 16.320  0.031   -2.944  1.00 0.00 ? 264 TYR A CA   5  
ATOM   10432 C  C    . TYR A 1 109 ? 14.817  -0.127  -3.172  1.00 0.00 ? 264 TYR A C    5  
ATOM   10433 O  O    . TYR A 1 109 ? 14.315  0.250   -4.217  1.00 0.00 ? 264 TYR A O    5  
ATOM   10434 C  CB   . TYR A 1 109 ? 16.658  1.427   -2.400  1.00 0.00 ? 264 TYR A CB   5  
ATOM   10435 C  CG   . TYR A 1 109 ? 17.858  1.319   -1.492  1.00 0.00 ? 264 TYR A CG   5  
ATOM   10436 C  CD1  . TYR A 1 109 ? 17.686  0.987   -0.143  1.00 0.00 ? 264 TYR A CD1  5  
ATOM   10437 C  CD2  . TYR A 1 109 ? 19.141  1.542   -2.001  1.00 0.00 ? 264 TYR A CD2  5  
ATOM   10438 C  CE1  . TYR A 1 109 ? 18.799  0.879   0.698   1.00 0.00 ? 264 TYR A CE1  5  
ATOM   10439 C  CE2  . TYR A 1 109 ? 20.255  1.434   -1.161  1.00 0.00 ? 264 TYR A CE2  5  
ATOM   10440 C  CZ   . TYR A 1 109 ? 20.085  1.101   0.189   1.00 0.00 ? 264 TYR A CZ   5  
ATOM   10441 O  OH   . TYR A 1 109 ? 21.182  0.994   1.018   1.00 0.00 ? 264 TYR A OH   5  
ATOM   10442 H  H    . TYR A 1 109 ? 17.205  0.704   -4.812  1.00 0.00 ? 264 TYR A H    5  
ATOM   10443 H  HA   . TYR A 1 109 ? 16.679  -0.732  -2.268  1.00 0.00 ? 264 TYR A HA   5  
ATOM   10444 H  HB2  . TYR A 1 109 ? 16.881  2.096   -3.219  1.00 0.00 ? 264 TYR A HB2  5  
ATOM   10445 H  HB3  . TYR A 1 109 ? 15.817  1.809   -1.840  1.00 0.00 ? 264 TYR A HB3  5  
ATOM   10446 H  HD1  . TYR A 1 109 ? 16.694  0.814   0.248   1.00 0.00 ? 264 TYR A HD1  5  
ATOM   10447 H  HD2  . TYR A 1 109 ? 19.274  1.798   -3.042  1.00 0.00 ? 264 TYR A HD2  5  
ATOM   10448 H  HE1  . TYR A 1 109 ? 18.665  0.623   1.739   1.00 0.00 ? 264 TYR A HE1  5  
ATOM   10449 H  HE2  . TYR A 1 109 ? 21.245  1.602   -1.555  1.00 0.00 ? 264 TYR A HE2  5  
ATOM   10450 H  HH   . TYR A 1 109 ? 21.603  0.149   0.843   1.00 0.00 ? 264 TYR A HH   5  
ATOM   10451 N  N    . CYS A 1 110 ? 14.091  -0.706  -2.242  1.00 0.00 ? 265 CYS A N    5  
ATOM   10452 C  CA   . CYS A 1 110 ? 12.633  -0.904  -2.476  1.00 0.00 ? 265 CYS A CA   5  
ATOM   10453 C  C    . CYS A 1 110 ? 11.795  -0.321  -1.310  1.00 0.00 ? 265 CYS A C    5  
ATOM   10454 O  O    . CYS A 1 110 ? 12.186  0.657   -0.703  1.00 0.00 ? 265 CYS A O    5  
ATOM   10455 C  CB   . CYS A 1 110 ? 12.492  -2.434  -2.652  1.00 0.00 ? 265 CYS A CB   5  
ATOM   10456 S  SG   . CYS A 1 110 ? 12.611  -3.299  -1.062  1.00 0.00 ? 265 CYS A SG   5  
ATOM   10457 H  H    . CYS A 1 110 ? 14.504  -1.031  -1.412  1.00 0.00 ? 265 CYS A H    5  
ATOM   10458 H  HA   . CYS A 1 110 ? 12.348  -0.417  -3.395  1.00 0.00 ? 265 CYS A HA   5  
ATOM   10459 H  HB2  . CYS A 1 110 ? 11.534  -2.651  -3.097  1.00 0.00 ? 265 CYS A HB2  5  
ATOM   10460 H  HB3  . CYS A 1 110 ? 13.274  -2.787  -3.309  1.00 0.00 ? 265 CYS A HB3  5  
ATOM   10461 N  N    . TYR A 1 111 ? 10.642  -0.892  -1.006  1.00 0.00 ? 266 TYR A N    5  
ATOM   10462 C  CA   . TYR A 1 111 ? 9.796   -0.329  0.106   1.00 0.00 ? 266 TYR A CA   5  
ATOM   10463 C  C    . TYR A 1 111 ? 10.159  -0.994  1.449   1.00 0.00 ? 266 TYR A C    5  
ATOM   10464 O  O    . TYR A 1 111 ? 10.186  -0.340  2.475   1.00 0.00 ? 266 TYR A O    5  
ATOM   10465 C  CB   . TYR A 1 111 ? 8.330   -0.630  -0.274  1.00 0.00 ? 266 TYR A CB   5  
ATOM   10466 C  CG   . TYR A 1 111 ? 8.043   -0.144  -1.683  1.00 0.00 ? 266 TYR A CG   5  
ATOM   10467 C  CD1  . TYR A 1 111 ? 7.715   1.197   -1.910  1.00 0.00 ? 266 TYR A CD1  5  
ATOM   10468 C  CD2  . TYR A 1 111 ? 8.109   -1.037  -2.762  1.00 0.00 ? 266 TYR A CD2  5  
ATOM   10469 C  CE1  . TYR A 1 111 ? 7.454   1.646   -3.211  1.00 0.00 ? 266 TYR A CE1  5  
ATOM   10470 C  CE2  . TYR A 1 111 ? 7.850   -0.589  -4.062  1.00 0.00 ? 266 TYR A CE2  5  
ATOM   10471 C  CZ   . TYR A 1 111 ? 7.522   0.753   -4.287  1.00 0.00 ? 266 TYR A CZ   5  
ATOM   10472 O  OH   . TYR A 1 111 ? 7.264   1.196   -5.568  1.00 0.00 ? 266 TYR A OH   5  
ATOM   10473 H  H    . TYR A 1 111 ? 10.328  -1.674  -1.508  1.00 0.00 ? 266 TYR A H    5  
ATOM   10474 H  HA   . TYR A 1 111 ? 9.942   0.738   0.174   1.00 0.00 ? 266 TYR A HA   5  
ATOM   10475 H  HB2  . TYR A 1 111 ? 8.160   -1.695  -0.223  1.00 0.00 ? 266 TYR A HB2  5  
ATOM   10476 H  HB3  . TYR A 1 111 ? 7.672   -0.128  0.418   1.00 0.00 ? 266 TYR A HB3  5  
ATOM   10477 H  HD1  . TYR A 1 111 ? 7.663   1.884   -1.083  1.00 0.00 ? 266 TYR A HD1  5  
ATOM   10478 H  HD2  . TYR A 1 111 ? 8.362   -2.072  -2.590  1.00 0.00 ? 266 TYR A HD2  5  
ATOM   10479 H  HE1  . TYR A 1 111 ? 7.200   2.681   -3.384  1.00 0.00 ? 266 TYR A HE1  5  
ATOM   10480 H  HE2  . TYR A 1 111 ? 7.905   -1.278  -4.892  1.00 0.00 ? 266 TYR A HE2  5  
ATOM   10481 H  HH   . TYR A 1 111 ? 6.315   1.157   -5.710  1.00 0.00 ? 266 TYR A HH   5  
ATOM   10482 N  N    . ILE A 1 112 ? 10.441  -2.283  1.456   1.00 0.00 ? 267 ILE A N    5  
ATOM   10483 C  CA   . ILE A 1 112 ? 10.807  -2.964  2.755   1.00 0.00 ? 267 ILE A CA   5  
ATOM   10484 C  C    . ILE A 1 112 ? 12.118  -2.369  3.305   1.00 0.00 ? 267 ILE A C    5  
ATOM   10485 O  O    . ILE A 1 112 ? 12.252  -2.138  4.491   1.00 0.00 ? 267 ILE A O    5  
ATOM   10486 C  CB   . ILE A 1 112 ? 11.011  -4.470  2.454   1.00 0.00 ? 267 ILE A CB   5  
ATOM   10487 C  CG1  . ILE A 1 112 ? 9.756   -5.088  1.802   1.00 0.00 ? 267 ILE A CG1  5  
ATOM   10488 C  CG2  . ILE A 1 112 ? 11.294  -5.205  3.765   1.00 0.00 ? 267 ILE A CG2  5  
ATOM   10489 C  CD1  . ILE A 1 112 ? 8.522   -4.868  2.685   1.00 0.00 ? 267 ILE A CD1  5  
ATOM   10490 H  H    . ILE A 1 112 ? 10.418  -2.788  0.618   1.00 0.00 ? 267 ILE A H    5  
ATOM   10491 H  HA   . ILE A 1 112 ? 10.018  -2.837  3.473   1.00 0.00 ? 267 ILE A HA   5  
ATOM   10492 H  HB   . ILE A 1 112 ? 11.864  -4.589  1.789   1.00 0.00 ? 267 ILE A HB   5  
ATOM   10493 H  HG12 . ILE A 1 112 ? 9.585   -4.644  0.837   1.00 0.00 ? 267 ILE A HG12 5  
ATOM   10494 H  HG13 . ILE A 1 112 ? 9.911   -6.150  1.678   1.00 0.00 ? 267 ILE A HG13 5  
ATOM   10495 H  HG21 . ILE A 1 112 ? 12.193  -4.809  4.213   1.00 0.00 ? 267 ILE A HG21 5  
ATOM   10496 H  HG22 . ILE A 1 112 ? 11.424  -6.259  3.566   1.00 0.00 ? 267 ILE A HG22 5  
ATOM   10497 H  HG23 . ILE A 1 112 ? 10.463  -5.065  4.440   1.00 0.00 ? 267 ILE A HG23 5  
ATOM   10498 H  HD11 . ILE A 1 112 ? 8.063   -5.820  2.904   1.00 0.00 ? 267 ILE A HD11 5  
ATOM   10499 H  HD12 . ILE A 1 112 ? 7.816   -4.241  2.159   1.00 0.00 ? 267 ILE A HD12 5  
ATOM   10500 H  HD13 . ILE A 1 112 ? 8.813   -4.388  3.607   1.00 0.00 ? 267 ILE A HD13 5  
ATOM   10501 N  N    . CYS A 1 113 ? 13.086  -2.126  2.448   1.00 0.00 ? 268 CYS A N    5  
ATOM   10502 C  CA   . CYS A 1 113 ? 14.399  -1.549  2.911   1.00 0.00 ? 268 CYS A CA   5  
ATOM   10503 C  C    . CYS A 1 113 ? 14.161  -0.243  3.681   1.00 0.00 ? 268 CYS A C    5  
ATOM   10504 O  O    . CYS A 1 113 ? 14.668  -0.058  4.771   1.00 0.00 ? 268 CYS A O    5  
ATOM   10505 C  CB   . CYS A 1 113 ? 15.209  -1.258  1.637   1.00 0.00 ? 268 CYS A CB   5  
ATOM   10506 S  SG   . CYS A 1 113 ? 15.933  -2.794  1.007   1.00 0.00 ? 268 CYS A SG   5  
ATOM   10507 H  H    . CYS A 1 113 ? 12.950  -2.324  1.503   1.00 0.00 ? 268 CYS A H    5  
ATOM   10508 H  HA   . CYS A 1 113 ? 14.927  -2.259  3.529   1.00 0.00 ? 268 CYS A HA   5  
ATOM   10509 H  HB2  . CYS A 1 113 ? 14.559  -0.834  0.886   1.00 0.00 ? 268 CYS A HB2  5  
ATOM   10510 H  HB3  . CYS A 1 113 ? 15.997  -0.558  1.866   1.00 0.00 ? 268 CYS A HB3  5  
ATOM   10511 N  N    . HIS A 1 114 ? 13.384  0.663   3.123   1.00 0.00 ? 269 HIS A N    5  
ATOM   10512 C  CA   . HIS A 1 114 ? 13.106  1.961   3.827   1.00 0.00 ? 269 HIS A CA   5  
ATOM   10513 C  C    . HIS A 1 114 ? 12.095  2.809   3.036   1.00 0.00 ? 269 HIS A C    5  
ATOM   10514 O  O    . HIS A 1 114 ? 11.894  2.582   1.858   1.00 0.00 ? 269 HIS A O    5  
ATOM   10515 C  CB   . HIS A 1 114 ? 14.456  2.690   3.941   1.00 0.00 ? 269 HIS A CB   5  
ATOM   10516 C  CG   . HIS A 1 114 ? 15.119  2.853   2.591   1.00 0.00 ? 269 HIS A CG   5  
ATOM   10517 N  ND1  . HIS A 1 114 ? 16.341  3.497   2.463   1.00 0.00 ? 269 HIS A ND1  5  
ATOM   10518 C  CD2  . HIS A 1 114 ? 14.765  2.476   1.313   1.00 0.00 ? 269 HIS A CD2  5  
ATOM   10519 C  CE1  . HIS A 1 114 ? 16.673  3.490   1.160   1.00 0.00 ? 269 HIS A CE1  5  
ATOM   10520 N  NE2  . HIS A 1 114 ? 15.748  2.883   0.417   1.00 0.00 ? 269 HIS A NE2  5  
ATOM   10521 H  H    . HIS A 1 114 ? 12.974  0.485   2.245   1.00 0.00 ? 269 HIS A H    5  
ATOM   10522 H  HA   . HIS A 1 114 ? 12.720  1.764   4.815   1.00 0.00 ? 269 HIS A HA   5  
ATOM   10523 H  HB2  . HIS A 1 114 ? 14.294  3.667   4.370   1.00 0.00 ? 269 HIS A HB2  5  
ATOM   10524 H  HB3  . HIS A 1 114 ? 15.108  2.126   4.590   1.00 0.00 ? 269 HIS A HB3  5  
ATOM   10525 H  HD1  . HIS A 1 114 ? 16.868  3.887   3.192   1.00 0.00 ? 269 HIS A HD1  5  
ATOM   10526 H  HD2  . HIS A 1 114 ? 13.870  1.943   1.041   1.00 0.00 ? 269 HIS A HD2  5  
ATOM   10527 H  HE1  . HIS A 1 114 ? 17.582  3.918   0.766   1.00 0.00 ? 269 HIS A HE1  5  
ATOM   10528 N  N    . PRO A 1 115 ? 11.478  3.761   3.704   1.00 0.00 ? 270 PRO A N    5  
ATOM   10529 C  CA   . PRO A 1 115 ? 10.482  4.624   3.026   1.00 0.00 ? 270 PRO A CA   5  
ATOM   10530 C  C    . PRO A 1 115 ? 11.177  5.543   2.010   1.00 0.00 ? 270 PRO A C    5  
ATOM   10531 O  O    . PRO A 1 115 ? 11.313  6.730   2.238   1.00 0.00 ? 270 PRO A O    5  
ATOM   10532 C  CB   . PRO A 1 115 ? 9.862   5.429   4.166   1.00 0.00 ? 270 PRO A CB   5  
ATOM   10533 C  CG   . PRO A 1 115 ? 10.900  5.430   5.241   1.00 0.00 ? 270 PRO A CG   5  
ATOM   10534 C  CD   . PRO A 1 115 ? 11.641  4.126   5.123   1.00 0.00 ? 270 PRO A CD   5  
ATOM   10535 H  HA   . PRO A 1 115 ? 9.728   4.025   2.543   1.00 0.00 ? 270 PRO A HA   5  
ATOM   10536 H  HB2  . PRO A 1 115 ? 9.651   6.438   3.841   1.00 0.00 ? 270 PRO A HB2  5  
ATOM   10537 H  HB3  . PRO A 1 115 ? 8.964   4.950   4.522   1.00 0.00 ? 270 PRO A HB3  5  
ATOM   10538 H  HG2  . PRO A 1 115 ? 11.578  6.260   5.098   1.00 0.00 ? 270 PRO A HG2  5  
ATOM   10539 H  HG3  . PRO A 1 115 ? 10.431  5.496   6.210   1.00 0.00 ? 270 PRO A HG3  5  
ATOM   10540 H  HD2  . PRO A 1 115 ? 12.685  4.261   5.369   1.00 0.00 ? 270 PRO A HD2  5  
ATOM   10541 H  HD3  . PRO A 1 115 ? 11.193  3.374   5.754   1.00 0.00 ? 270 PRO A HD3  5  
ATOM   10542 N  N    . GLU A 1 116 ? 11.621  5.006   0.889   1.00 0.00 ? 271 GLU A N    5  
ATOM   10543 C  CA   . GLU A 1 116 ? 12.304  5.867   -0.126  1.00 0.00 ? 271 GLU A CA   5  
ATOM   10544 C  C    . GLU A 1 116 ? 11.374  6.145   -1.323  1.00 0.00 ? 271 GLU A C    5  
ATOM   10545 O  O    . GLU A 1 116 ? 11.074  7.294   -1.584  1.00 0.00 ? 271 GLU A O    5  
ATOM   10546 C  CB   . GLU A 1 116 ? 13.570  5.106   -0.553  1.00 0.00 ? 271 GLU A CB   5  
ATOM   10547 C  CG   . GLU A 1 116 ? 14.816  5.845   -0.055  1.00 0.00 ? 271 GLU A CG   5  
ATOM   10548 C  CD   . GLU A 1 116 ? 15.951  5.682   -1.069  1.00 0.00 ? 271 GLU A CD   5  
ATOM   10549 O  OE1  . GLU A 1 116 ? 15.661  5.649   -2.253  1.00 0.00 ? 271 GLU A OE1  5  
ATOM   10550 O  OE2  . GLU A 1 116 ? 17.091  5.592   -0.644  1.00 0.00 ? 271 GLU A OE2  5  
ATOM   10551 H  H    . GLU A 1 116 ? 11.507  4.047   0.721   1.00 0.00 ? 271 GLU A H    5  
ATOM   10552 H  HA   . GLU A 1 116 ? 12.584  6.804   0.331   1.00 0.00 ? 271 GLU A HA   5  
ATOM   10553 H  HB2  . GLU A 1 116 ? 13.548  4.110   -0.133  1.00 0.00 ? 271 GLU A HB2  5  
ATOM   10554 H  HB3  . GLU A 1 116 ? 13.601  5.039   -1.630  1.00 0.00 ? 271 GLU A HB3  5  
ATOM   10555 H  HG2  . GLU A 1 116 ? 14.589  6.894   0.066   1.00 0.00 ? 271 GLU A HG2  5  
ATOM   10556 H  HG3  . GLU A 1 116 ? 15.124  5.432   0.895   1.00 0.00 ? 271 GLU A HG3  5  
ATOM   10557 N  N    . PRO A 1 117 ? 10.927  5.112   -2.026  1.00 0.00 ? 272 PRO A N    5  
ATOM   10558 C  CA   . PRO A 1 117 ? 10.026  5.340   -3.181  1.00 0.00 ? 272 PRO A CA   5  
ATOM   10559 C  C    . PRO A 1 117 ? 8.528   5.334   -2.791  1.00 0.00 ? 272 PRO A C    5  
ATOM   10560 O  O    . PRO A 1 117 ? 7.692   5.006   -3.616  1.00 0.00 ? 272 PRO A O    5  
ATOM   10561 C  CB   . PRO A 1 117 ? 10.318  4.151   -4.087  1.00 0.00 ? 272 PRO A CB   5  
ATOM   10562 C  CG   . PRO A 1 117 ? 10.816  3.061   -3.181  1.00 0.00 ? 272 PRO A CG   5  
ATOM   10563 C  CD   . PRO A 1 117 ? 11.210  3.678   -1.859  1.00 0.00 ? 272 PRO A CD   5  
ATOM   10564 H  HA   . PRO A 1 117 ? 10.285  6.252   -3.684  1.00 0.00 ? 272 PRO A HA   5  
ATOM   10565 H  HB2  . PRO A 1 117 ? 9.415   3.837   -4.592  1.00 0.00 ? 272 PRO A HB2  5  
ATOM   10566 H  HB3  . PRO A 1 117 ? 11.080  4.407   -4.806  1.00 0.00 ? 272 PRO A HB3  5  
ATOM   10567 H  HG2  . PRO A 1 117 ? 10.032  2.332   -3.026  1.00 0.00 ? 272 PRO A HG2  5  
ATOM   10568 H  HG3  . PRO A 1 117 ? 11.675  2.581   -3.626  1.00 0.00 ? 272 PRO A HG3  5  
ATOM   10569 H  HD2  . PRO A 1 117 ? 10.617  3.258   -1.060  1.00 0.00 ? 272 PRO A HD2  5  
ATOM   10570 H  HD3  . PRO A 1 117 ? 12.254  3.514   -1.680  1.00 0.00 ? 272 PRO A HD3  5  
ATOM   10571 N  N    . LEU A 1 118 ? 8.162   5.692   -1.574  1.00 0.00 ? 273 LEU A N    5  
ATOM   10572 C  CA   . LEU A 1 118 ? 6.704   5.695   -1.210  1.00 0.00 ? 273 LEU A CA   5  
ATOM   10573 C  C    . LEU A 1 118 ? 6.411   6.675   -0.054  1.00 0.00 ? 273 LEU A C    5  
ATOM   10574 O  O    . LEU A 1 118 ? 5.557   6.413   0.772   1.00 0.00 ? 273 LEU A O    5  
ATOM   10575 C  CB   . LEU A 1 118 ? 6.368   4.240   -0.816  1.00 0.00 ? 273 LEU A CB   5  
ATOM   10576 C  CG   . LEU A 1 118 ? 6.981   3.859   0.547   1.00 0.00 ? 273 LEU A CG   5  
ATOM   10577 C  CD1  . LEU A 1 118 ? 6.360   2.545   1.034   1.00 0.00 ? 273 LEU A CD1  5  
ATOM   10578 C  CD2  . LEU A 1 118 ? 8.495   3.687   0.402   1.00 0.00 ? 273 LEU A CD2  5  
ATOM   10579 H  H    . LEU A 1 118 ? 8.828   5.962   -0.915  1.00 0.00 ? 273 LEU A H    5  
ATOM   10580 H  HA   . LEU A 1 118 ? 6.118   5.972   -2.072  1.00 0.00 ? 273 LEU A HA   5  
ATOM   10581 H  HB2  . LEU A 1 118 ? 5.295   4.130   -0.761  1.00 0.00 ? 273 LEU A HB2  5  
ATOM   10582 H  HB3  . LEU A 1 118 ? 6.751   3.574   -1.574  1.00 0.00 ? 273 LEU A HB3  5  
ATOM   10583 H  HG   . LEU A 1 118 ? 6.774   4.632   1.269   1.00 0.00 ? 273 LEU A HG   5  
ATOM   10584 H  HD11 . LEU A 1 118 ? 5.397   2.406   0.566   1.00 0.00 ? 273 LEU A HD11 5  
ATOM   10585 H  HD12 . LEU A 1 118 ? 6.236   2.582   2.106   1.00 0.00 ? 273 LEU A HD12 5  
ATOM   10586 H  HD13 . LEU A 1 118 ? 7.007   1.720   0.777   1.00 0.00 ? 273 LEU A HD13 5  
ATOM   10587 H  HD21 . LEU A 1 118 ? 8.825   2.849   1.000   1.00 0.00 ? 273 LEU A HD21 5  
ATOM   10588 H  HD22 . LEU A 1 118 ? 8.991   4.586   0.736   1.00 0.00 ? 273 LEU A HD22 5  
ATOM   10589 H  HD23 . LEU A 1 118 ? 8.735   3.508   -0.633  1.00 0.00 ? 273 LEU A HD23 5  
ATOM   10590 N  N    . LEU A 1 119 ? 7.095   7.801   0.012   1.00 0.00 ? 274 LEU A N    5  
ATOM   10591 C  CA   . LEU A 1 119 ? 6.811   8.769   1.135   1.00 0.00 ? 274 LEU A CA   5  
ATOM   10592 C  C    . LEU A 1 119 ? 5.349   9.221   1.062   1.00 0.00 ? 274 LEU A C    5  
ATOM   10593 O  O    . LEU A 1 119 ? 4.637   9.176   2.046   1.00 0.00 ? 274 LEU A O    5  
ATOM   10594 C  CB   . LEU A 1 119 ? 7.758   9.982   0.968   1.00 0.00 ? 274 LEU A CB   5  
ATOM   10595 C  CG   . LEU A 1 119 ? 8.697   10.090  2.180   1.00 0.00 ? 274 LEU A CG   5  
ATOM   10596 C  CD1  . LEU A 1 119 ? 7.876   10.262  3.464   1.00 0.00 ? 274 LEU A CD1  5  
ATOM   10597 C  CD2  . LEU A 1 119 ? 9.548   8.820   2.285   1.00 0.00 ? 274 LEU A CD2  5  
ATOM   10598 H  H    . LEU A 1 119 ? 7.775   8.003   -0.669  1.00 0.00 ? 274 LEU A H    5  
ATOM   10599 H  HA   . LEU A 1 119 ? 6.994   8.290   2.080   1.00 0.00 ? 274 LEU A HA   5  
ATOM   10600 H  HB2  . LEU A 1 119 ? 8.348   9.867   0.072   1.00 0.00 ? 274 LEU A HB2  5  
ATOM   10601 H  HB3  . LEU A 1 119 ? 7.173   10.887  0.893   1.00 0.00 ? 274 LEU A HB3  5  
ATOM   10602 H  HG   . LEU A 1 119 ? 9.344   10.946  2.054   1.00 0.00 ? 274 LEU A HG   5  
ATOM   10603 H  HD11 . LEU A 1 119 ? 7.567   9.292   3.827   1.00 0.00 ? 274 LEU A HD11 5  
ATOM   10604 H  HD12 . LEU A 1 119 ? 7.002   10.864  3.256   1.00 0.00 ? 274 LEU A HD12 5  
ATOM   10605 H  HD13 . LEU A 1 119 ? 8.480   10.751  4.214   1.00 0.00 ? 274 LEU A HD13 5  
ATOM   10606 H  HD21 . LEU A 1 119 ? 10.512  9.066   2.705   1.00 0.00 ? 274 LEU A HD21 5  
ATOM   10607 H  HD22 . LEU A 1 119 ? 9.681   8.393   1.302   1.00 0.00 ? 274 LEU A HD22 5  
ATOM   10608 H  HD23 . LEU A 1 119 ? 9.048   8.105   2.924   1.00 0.00 ? 274 LEU A HD23 5  
ATOM   10609 N  N    . ASP A 1 120 ? 4.888   9.639   -0.098  1.00 0.00 ? 275 ASP A N    5  
ATOM   10610 C  CA   . ASP A 1 120 ? 3.448   10.082  -0.221  1.00 0.00 ? 275 ASP A CA   5  
ATOM   10611 C  C    . ASP A 1 120 ? 2.509   8.967   0.273   1.00 0.00 ? 275 ASP A C    5  
ATOM   10612 O  O    . ASP A 1 120 ? 1.511   9.233   0.917   1.00 0.00 ? 275 ASP A O    5  
ATOM   10613 C  CB   . ASP A 1 120 ? 3.194   10.363  -1.710  1.00 0.00 ? 275 ASP A CB   5  
ATOM   10614 C  CG   . ASP A 1 120 ? 3.661   11.780  -2.048  1.00 0.00 ? 275 ASP A CG   5  
ATOM   10615 O  OD1  . ASP A 1 120 ? 3.138   12.712  -1.461  1.00 0.00 ? 275 ASP A OD1  5  
ATOM   10616 O  OD2  . ASP A 1 120 ? 4.535   11.909  -2.890  1.00 0.00 ? 275 ASP A OD2  5  
ATOM   10617 H  H    . ASP A 1 120 ? 5.484   9.652   -0.883  1.00 0.00 ? 275 ASP A H    5  
ATOM   10618 H  HA   . ASP A 1 120 ? 3.288   10.977  0.353   1.00 0.00 ? 275 ASP A HA   5  
ATOM   10619 H  HB2  . ASP A 1 120 ? 3.741   9.649   -2.309  1.00 0.00 ? 275 ASP A HB2  5  
ATOM   10620 H  HB3  . ASP A 1 120 ? 2.138   10.274  -1.919  1.00 0.00 ? 275 ASP A HB3  5  
ATOM   10621 N  N    . LEU A 1 121 ? 2.827   7.721   -0.014  1.00 0.00 ? 276 LEU A N    5  
ATOM   10622 C  CA   . LEU A 1 121 ? 1.939   6.597   0.459   1.00 0.00 ? 276 LEU A CA   5  
ATOM   10623 C  C    . LEU A 1 121 ? 1.882   6.592   1.991   1.00 0.00 ? 276 LEU A C    5  
ATOM   10624 O  O    . LEU A 1 121 ? 0.818   6.501   2.573   1.00 0.00 ? 276 LEU A O    5  
ATOM   10625 C  CB   . LEU A 1 121 ? 2.563   5.279   -0.045  1.00 0.00 ? 276 LEU A CB   5  
ATOM   10626 C  CG   . LEU A 1 121 ? 1.828   4.795   -1.295  1.00 0.00 ? 276 LEU A CG   5  
ATOM   10627 C  CD1  . LEU A 1 121 ? 2.165   5.709   -2.475  1.00 0.00 ? 276 LEU A CD1  5  
ATOM   10628 C  CD2  . LEU A 1 121 ? 2.267   3.362   -1.617  1.00 0.00 ? 276 LEU A CD2  5  
ATOM   10629 H  H    . LEU A 1 121 ? 3.643   7.533   -0.533  1.00 0.00 ? 276 LEU A H    5  
ATOM   10630 H  HA   . LEU A 1 121 ? 0.949   6.717   0.059   1.00 0.00 ? 276 LEU A HA   5  
ATOM   10631 H  HB2  . LEU A 1 121 ? 3.605   5.435   -0.279  1.00 0.00 ? 276 LEU A HB2  5  
ATOM   10632 H  HB3  . LEU A 1 121 ? 2.482   4.530   0.727   1.00 0.00 ? 276 LEU A HB3  5  
ATOM   10633 H  HG   . LEU A 1 121 ? 0.763   4.815   -1.117  1.00 0.00 ? 276 LEU A HG   5  
ATOM   10634 H  HD11 . LEU A 1 121 ? 1.417   6.482   -2.556  1.00 0.00 ? 276 LEU A HD11 5  
ATOM   10635 H  HD12 . LEU A 1 121 ? 2.183   5.128   -3.386  1.00 0.00 ? 276 LEU A HD12 5  
ATOM   10636 H  HD13 . LEU A 1 121 ? 3.134   6.160   -2.316  1.00 0.00 ? 276 LEU A HD13 5  
ATOM   10637 H  HD21 . LEU A 1 121 ? 2.303   3.227   -2.688  1.00 0.00 ? 276 LEU A HD21 5  
ATOM   10638 H  HD22 . LEU A 1 121 ? 1.560   2.665   -1.192  1.00 0.00 ? 276 LEU A HD22 5  
ATOM   10639 H  HD23 . LEU A 1 121 ? 3.246   3.179   -1.198  1.00 0.00 ? 276 LEU A HD23 5  
ATOM   10640 N  N    . VAL A 1 122 ? 3.016   6.692   2.649   1.00 0.00 ? 277 VAL A N    5  
ATOM   10641 C  CA   . VAL A 1 122 ? 3.003   6.693   4.153   1.00 0.00 ? 277 VAL A CA   5  
ATOM   10642 C  C    . VAL A 1 122 ? 2.335   7.976   4.664   1.00 0.00 ? 277 VAL A C    5  
ATOM   10643 O  O    . VAL A 1 122 ? 1.565   7.940   5.607   1.00 0.00 ? 277 VAL A O    5  
ATOM   10644 C  CB   . VAL A 1 122 ? 4.468   6.616   4.613   1.00 0.00 ? 277 VAL A CB   5  
ATOM   10645 C  CG1  . VAL A 1 122 ? 4.527   6.573   6.141   1.00 0.00 ? 277 VAL A CG1  5  
ATOM   10646 C  CG2  . VAL A 1 122 ? 5.107   5.345   4.040   1.00 0.00 ? 277 VAL A CG2  5  
ATOM   10647 H  H    . VAL A 1 122 ? 3.865   6.769   2.154   1.00 0.00 ? 277 VAL A H    5  
ATOM   10648 H  HA   . VAL A 1 122 ? 2.463   5.835   4.514   1.00 0.00 ? 277 VAL A HA   5  
ATOM   10649 H  HB   . VAL A 1 122 ? 5.003   7.484   4.255   1.00 0.00 ? 277 VAL A HB   5  
ATOM   10650 H  HG11 . VAL A 1 122 ? 4.624   7.577   6.526   1.00 0.00 ? 277 VAL A HG11 5  
ATOM   10651 H  HG12 . VAL A 1 122 ? 5.377   5.985   6.452   1.00 0.00 ? 277 VAL A HG12 5  
ATOM   10652 H  HG13 . VAL A 1 122 ? 3.620   6.127   6.524   1.00 0.00 ? 277 VAL A HG13 5  
ATOM   10653 H  HG21 . VAL A 1 122 ? 4.334   4.624   3.805   1.00 0.00 ? 277 VAL A HG21 5  
ATOM   10654 H  HG22 . VAL A 1 122 ? 5.784   4.922   4.768   1.00 0.00 ? 277 VAL A HG22 5  
ATOM   10655 H  HG23 . VAL A 1 122 ? 5.654   5.591   3.142   1.00 0.00 ? 277 VAL A HG23 5  
ATOM   10656 N  N    . THR A 1 123 ? 2.601   9.109   4.043   1.00 0.00 ? 278 THR A N    5  
ATOM   10657 C  CA   . THR A 1 123 ? 1.939   10.378  4.510   1.00 0.00 ? 278 THR A CA   5  
ATOM   10658 C  C    . THR A 1 123 ? 0.416   10.251  4.341   1.00 0.00 ? 278 THR A C    5  
ATOM   10659 O  O    . THR A 1 123 ? -0.339  10.718  5.176   1.00 0.00 ? 278 THR A O    5  
ATOM   10660 C  CB   . THR A 1 123 ? 2.481   11.525  3.635   1.00 0.00 ? 278 THR A CB   5  
ATOM   10661 O  OG1  . THR A 1 123 ? 3.672   11.105  2.988   1.00 0.00 ? 278 THR A OG1  5  
ATOM   10662 C  CG2  . THR A 1 123 ? 2.783   12.743  4.512   1.00 0.00 ? 278 THR A CG2  5  
ATOM   10663 H  H    . THR A 1 123 ? 3.214   9.114   3.272   1.00 0.00 ? 278 THR A H    5  
ATOM   10664 H  HA   . THR A 1 123 ? 2.182   10.560  5.546   1.00 0.00 ? 278 THR A HA   5  
ATOM   10665 H  HB   . THR A 1 123 ? 1.743   11.793  2.894   1.00 0.00 ? 278 THR A HB   5  
ATOM   10666 H  HG1  . THR A 1 123 ? 3.875   11.739  2.296   1.00 0.00 ? 278 THR A HG1  5  
ATOM   10667 H  HG21 . THR A 1 123 ? 3.834   12.751  4.762   1.00 0.00 ? 278 THR A HG21 5  
ATOM   10668 H  HG22 . THR A 1 123 ? 2.195   12.690  5.417   1.00 0.00 ? 278 THR A HG22 5  
ATOM   10669 H  HG23 . THR A 1 123 ? 2.534   13.644  3.973   1.00 0.00 ? 278 THR A HG23 5  
ATOM   10670 N  N    . ALA A 1 124 ? -0.050  9.611   3.281   1.00 0.00 ? 279 ALA A N    5  
ATOM   10671 C  CA   . ALA A 1 124 ? -1.539  9.457   3.105   1.00 0.00 ? 279 ALA A CA   5  
ATOM   10672 C  C    . ALA A 1 124 ? -2.116  8.529   4.192   1.00 0.00 ? 279 ALA A C    5  
ATOM   10673 O  O    . ALA A 1 124 ? -3.259  8.677   4.585   1.00 0.00 ? 279 ALA A O    5  
ATOM   10674 C  CB   . ALA A 1 124 ? -1.762  8.843   1.713   1.00 0.00 ? 279 ALA A CB   5  
ATOM   10675 H  H    . ALA A 1 124 ? 0.575   9.225   2.616   1.00 0.00 ? 279 ALA A H    5  
ATOM   10676 H  HA   . ALA A 1 124 ? -2.015  10.421  3.157   1.00 0.00 ? 279 ALA A HA   5  
ATOM   10677 H  HB1  . ALA A 1 124 ? -2.724  8.355   1.685   1.00 0.00 ? 279 ALA A HB1  5  
ATOM   10678 H  HB2  . ALA A 1 124 ? -0.986  8.120   1.510   1.00 0.00 ? 279 ALA A HB2  5  
ATOM   10679 H  HB3  . ALA A 1 124 ? -1.730  9.624   0.967   1.00 0.00 ? 279 ALA A HB3  5  
ATOM   10680 N  N    . CYS A 1 125 ? -1.345  7.577   4.688   1.00 0.00 ? 280 CYS A N    5  
ATOM   10681 C  CA   . CYS A 1 125 ? -1.885  6.658   5.754   1.00 0.00 ? 280 CYS A CA   5  
ATOM   10682 C  C    . CYS A 1 125 ? -2.275  7.478   6.991   1.00 0.00 ? 280 CYS A C    5  
ATOM   10683 O  O    . CYS A 1 125 ? -3.386  7.378   7.475   1.00 0.00 ? 280 CYS A O    5  
ATOM   10684 C  CB   . CYS A 1 125 ? -0.749  5.673   6.104   1.00 0.00 ? 280 CYS A CB   5  
ATOM   10685 S  SG   . CYS A 1 125 ? -1.307  4.500   7.369   1.00 0.00 ? 280 CYS A SG   5  
ATOM   10686 H  H    . CYS A 1 125 ? -0.423  7.470   4.364   1.00 0.00 ? 280 CYS A H    5  
ATOM   10687 H  HA   . CYS A 1 125 ? -2.741  6.119   5.382   1.00 0.00 ? 280 CYS A HA   5  
ATOM   10688 H  HB2  . CYS A 1 125 ? -0.461  5.130   5.216   1.00 0.00 ? 280 CYS A HB2  5  
ATOM   10689 H  HB3  . CYS A 1 125 ? 0.101   6.226   6.476   1.00 0.00 ? 280 CYS A HB3  5  
ATOM   10690 H  HG   . CYS A 1 125 ? -1.544  3.680   6.930   1.00 0.00 ? 280 CYS A HG   5  
ATOM   10691 N  N    . ASN A 1 126 ? -1.374  8.287   7.507   1.00 0.00 ? 281 ASN A N    5  
ATOM   10692 C  CA   . ASN A 1 126 ? -1.723  9.104   8.723   1.00 0.00 ? 281 ASN A CA   5  
ATOM   10693 C  C    . ASN A 1 126 ? -2.888  10.048  8.401   1.00 0.00 ? 281 ASN A C    5  
ATOM   10694 O  O    . ASN A 1 126 ? -3.783  10.225  9.207   1.00 0.00 ? 281 ASN A O    5  
ATOM   10695 C  CB   . ASN A 1 126 ? -0.470  9.910   9.099   1.00 0.00 ? 281 ASN A CB   5  
ATOM   10696 C  CG   . ASN A 1 126 ? 0.589   8.967   9.684   1.00 0.00 ? 281 ASN A CG   5  
ATOM   10697 O  OD1  . ASN A 1 126 ? 0.297   8.195   10.575  1.00 0.00 ? 281 ASN A OD1  5  
ATOM   10698 N  ND2  . ASN A 1 126 ? 1.815   8.994   9.224   1.00 0.00 ? 281 ASN A ND2  5  
ATOM   10699 H  H    . ASN A 1 126 ? -0.477  8.352   7.095   1.00 0.00 ? 281 ASN A H    5  
ATOM   10700 H  HA   . ASN A 1 126 ? -1.999  8.453   9.533   1.00 0.00 ? 281 ASN A HA   5  
ATOM   10701 H  HB2  . ASN A 1 126 ? -0.075  10.393  8.216   1.00 0.00 ? 281 ASN A HB2  5  
ATOM   10702 H  HB3  . ASN A 1 126 ? -0.729  10.658  9.833   1.00 0.00 ? 281 ASN A HB3  5  
ATOM   10703 H  HD21 . ASN A 1 126 ? 2.062   9.616   8.503   1.00 0.00 ? 281 ASN A HD21 5  
ATOM   10704 H  HD22 . ASN A 1 126 ? 2.490   8.390   9.599   1.00 0.00 ? 281 ASN A HD22 5  
ATOM   10705 N  N    . SER A 1 127 ? -2.895  10.648  7.231   1.00 0.00 ? 282 SER A N    5  
ATOM   10706 C  CA   . SER A 1 127 ? -4.031  11.572  6.879   1.00 0.00 ? 282 SER A CA   5  
ATOM   10707 C  C    . SER A 1 127 ? -5.326  10.770  6.699   1.00 0.00 ? 282 SER A C    5  
ATOM   10708 O  O    . SER A 1 127 ? -6.392  11.228  7.069   1.00 0.00 ? 282 SER A O    5  
ATOM   10709 C  CB   . SER A 1 127 ? -3.648  12.276  5.569   1.00 0.00 ? 282 SER A CB   5  
ATOM   10710 O  OG   . SER A 1 127 ? -4.434  13.452  5.422   1.00 0.00 ? 282 SER A OG   5  
ATOM   10711 H  H    . SER A 1 127 ? -2.166  10.483  6.589   1.00 0.00 ? 282 SER A H    5  
ATOM   10712 H  HA   . SER A 1 127 ? -4.163  12.299  7.661   1.00 0.00 ? 282 SER A HA   5  
ATOM   10713 H  HB2  . SER A 1 127 ? -2.607  12.547  5.594   1.00 0.00 ? 282 SER A HB2  5  
ATOM   10714 H  HB3  . SER A 1 127 ? -3.824  11.606  4.737   1.00 0.00 ? 282 SER A HB3  5  
ATOM   10715 H  HG   . SER A 1 127 ? -4.414  13.708  4.496   1.00 0.00 ? 282 SER A HG   5  
ATOM   10716 N  N    . VAL A 1 128 ? -5.251  9.574   6.150   1.00 0.00 ? 283 VAL A N    5  
ATOM   10717 C  CA   . VAL A 1 128 ? -6.506  8.763   5.978   1.00 0.00 ? 283 VAL A CA   5  
ATOM   10718 C  C    . VAL A 1 128 ? -6.892  8.138   7.319   1.00 0.00 ? 283 VAL A C    5  
ATOM   10719 O  O    . VAL A 1 128 ? -8.055  8.128   7.681   1.00 0.00 ? 283 VAL A O    5  
ATOM   10720 C  CB   . VAL A 1 128 ? -6.196  7.677   4.933   1.00 0.00 ? 283 VAL A CB   5  
ATOM   10721 C  CG1  . VAL A 1 128 ? -7.432  6.800   4.713   1.00 0.00 ? 283 VAL A CG1  5  
ATOM   10722 C  CG2  . VAL A 1 128 ? -5.803  8.341   3.611   1.00 0.00 ? 283 VAL A CG2  5  
ATOM   10723 H  H    . VAL A 1 128 ? -4.380  9.210   5.867   1.00 0.00 ? 283 VAL A H    5  
ATOM   10724 H  HA   . VAL A 1 128 ? -7.305  9.394   5.634   1.00 0.00 ? 283 VAL A HA   5  
ATOM   10725 H  HB   . VAL A 1 128 ? -5.379  7.064   5.286   1.00 0.00 ? 283 VAL A HB   5  
ATOM   10726 H  HG11 . VAL A 1 128 ? -7.866  6.541   5.668   1.00 0.00 ? 283 VAL A HG11 5  
ATOM   10727 H  HG12 . VAL A 1 128 ? -7.145  5.897   4.193   1.00 0.00 ? 283 VAL A HG12 5  
ATOM   10728 H  HG13 . VAL A 1 128 ? -8.156  7.340   4.122   1.00 0.00 ? 283 VAL A HG13 5  
ATOM   10729 H  HG21 . VAL A 1 128 ? -5.405  9.326   3.808   1.00 0.00 ? 283 VAL A HG21 5  
ATOM   10730 H  HG22 . VAL A 1 128 ? -6.673  8.425   2.977   1.00 0.00 ? 283 VAL A HG22 5  
ATOM   10731 H  HG23 . VAL A 1 128 ? -5.053  7.742   3.117   1.00 0.00 ? 283 VAL A HG23 5  
ATOM   10732 N  N    . PHE A 1 129 ? -5.936  7.643   8.077   1.00 0.00 ? 284 PHE A N    5  
ATOM   10733 C  CA   . PHE A 1 129 ? -6.303  7.060   9.411   1.00 0.00 ? 284 PHE A CA   5  
ATOM   10734 C  C    . PHE A 1 129 ? -6.706  8.194   10.365  1.00 0.00 ? 284 PHE A C    5  
ATOM   10735 O  O    . PHE A 1 129 ? -7.543  8.003   11.227  1.00 0.00 ? 284 PHE A O    5  
ATOM   10736 C  CB   . PHE A 1 129 ? -5.081  6.288   9.950   1.00 0.00 ? 284 PHE A CB   5  
ATOM   10737 C  CG   . PHE A 1 129 ? -5.348  4.804   9.839   1.00 0.00 ? 284 PHE A CG   5  
ATOM   10738 C  CD1  . PHE A 1 129 ? -6.390  4.225   10.577  1.00 0.00 ? 284 PHE A CD1  5  
ATOM   10739 C  CD2  . PHE A 1 129 ? -4.567  4.010   8.993   1.00 0.00 ? 284 PHE A CD2  5  
ATOM   10740 C  CE1  . PHE A 1 129 ? -6.648  2.854   10.469  1.00 0.00 ? 284 PHE A CE1  5  
ATOM   10741 C  CE2  . PHE A 1 129 ? -4.826  2.638   8.883   1.00 0.00 ? 284 PHE A CE2  5  
ATOM   10742 C  CZ   . PHE A 1 129 ? -5.865  2.059   9.621   1.00 0.00 ? 284 PHE A CZ   5  
ATOM   10743 H  H    . PHE A 1 129 ? -4.996  7.683   7.783   1.00 0.00 ? 284 PHE A H    5  
ATOM   10744 H  HA   . PHE A 1 129 ? -7.137  6.387   9.286   1.00 0.00 ? 284 PHE A HA   5  
ATOM   10745 H  HB2  . PHE A 1 129 ? -4.204  6.541   9.378   1.00 0.00 ? 284 PHE A HB2  5  
ATOM   10746 H  HB3  . PHE A 1 129 ? -4.922  6.546   10.986  1.00 0.00 ? 284 PHE A HB3  5  
ATOM   10747 H  HD1  . PHE A 1 129 ? -6.994  4.838   11.230  1.00 0.00 ? 284 PHE A HD1  5  
ATOM   10748 H  HD2  . PHE A 1 129 ? -3.765  4.455   8.424   1.00 0.00 ? 284 PHE A HD2  5  
ATOM   10749 H  HE1  . PHE A 1 129 ? -7.451  2.409   11.038  1.00 0.00 ? 284 PHE A HE1  5  
ATOM   10750 H  HE2  . PHE A 1 129 ? -4.222  2.025   8.230   1.00 0.00 ? 284 PHE A HE2  5  
ATOM   10751 H  HZ   . PHE A 1 129 ? -6.064  1.000   9.536   1.00 0.00 ? 284 PHE A HZ   5  
ATOM   10752 N  N    . GLU A 1 130 ? -6.151  9.391   10.208  1.00 0.00 ? 285 GLU A N    5  
ATOM   10753 C  CA   . GLU A 1 130 ? -6.569  10.525  11.112  1.00 0.00 ? 285 GLU A CA   5  
ATOM   10754 C  C    . GLU A 1 130 ? -8.094  10.699  11.027  1.00 0.00 ? 285 GLU A C    5  
ATOM   10755 O  O    . GLU A 1 130 ? -8.752  10.922  12.027  1.00 0.00 ? 285 GLU A O    5  
ATOM   10756 C  CB   . GLU A 1 130 ? -5.857  11.793  10.608  1.00 0.00 ? 285 GLU A CB   5  
ATOM   10757 C  CG   . GLU A 1 130 ? -6.211  12.975  11.514  1.00 0.00 ? 285 GLU A CG   5  
ATOM   10758 C  CD   . GLU A 1 130 ? -5.618  12.748  12.906  1.00 0.00 ? 285 GLU A CD   5  
ATOM   10759 O  OE1  . GLU A 1 130 ? -4.403  12.707  13.011  1.00 0.00 ? 285 GLU A OE1  5  
ATOM   10760 O  OE2  . GLU A 1 130 ? -6.388  12.620  13.842  1.00 0.00 ? 285 GLU A OE2  5  
ATOM   10761 H  H    . GLU A 1 130 ? -5.491  9.544   9.493   1.00 0.00 ? 285 GLU A H    5  
ATOM   10762 H  HA   . GLU A 1 130 ? -6.280  10.315  12.126  1.00 0.00 ? 285 GLU A HA   5  
ATOM   10763 H  HB2  . GLU A 1 130 ? -4.788  11.635  10.624  1.00 0.00 ? 285 GLU A HB2  5  
ATOM   10764 H  HB3  . GLU A 1 130 ? -6.174  12.007  9.599   1.00 0.00 ? 285 GLU A HB3  5  
ATOM   10765 H  HG2  . GLU A 1 130 ? -5.808  13.883  11.093  1.00 0.00 ? 285 GLU A HG2  5  
ATOM   10766 H  HG3  . GLU A 1 130 ? -7.284  13.060  11.592  1.00 0.00 ? 285 GLU A HG3  5  
ATOM   10767 N  N    . ASN A 1 131 ? -8.668  10.566  9.842   1.00 0.00 ? 286 ASN A N    5  
ATOM   10768 C  CA   . ASN A 1 131 ? -10.165 10.691  9.729   1.00 0.00 ? 286 ASN A CA   5  
ATOM   10769 C  C    . ASN A 1 131 ? -10.840 9.603   10.587  1.00 0.00 ? 286 ASN A C    5  
ATOM   10770 O  O    . ASN A 1 131 ? -11.898 9.820   11.146  1.00 0.00 ? 286 ASN A O    5  
ATOM   10771 C  CB   . ASN A 1 131 ? -10.519 10.497  8.246   1.00 0.00 ? 286 ASN A CB   5  
ATOM   10772 C  CG   . ASN A 1 131 ? -10.276 11.807  7.487   1.00 0.00 ? 286 ASN A CG   5  
ATOM   10773 O  OD1  . ASN A 1 131 ? -9.200  12.367  7.558   1.00 0.00 ? 286 ASN A OD1  5  
ATOM   10774 N  ND2  . ASN A 1 131 ? -11.232 12.326  6.755   1.00 0.00 ? 286 ASN A ND2  5  
ATOM   10775 H  H    . ASN A 1 131 ? -8.118  10.361  9.044   1.00 0.00 ? 286 ASN A H    5  
ATOM   10776 H  HA   . ASN A 1 131 ? -10.479 11.666  10.059  1.00 0.00 ? 286 ASN A HA   5  
ATOM   10777 H  HB2  . ASN A 1 131 ? -9.901  9.716   7.828   1.00 0.00 ? 286 ASN A HB2  5  
ATOM   10778 H  HB3  . ASN A 1 131 ? -11.559 10.219  8.158   1.00 0.00 ? 286 ASN A HB3  5  
ATOM   10779 H  HD21 . ASN A 1 131 ? -12.106 11.882  6.691   1.00 0.00 ? 286 ASN A HD21 5  
ATOM   10780 H  HD22 . ASN A 1 131 ? -11.074 13.163  6.271   1.00 0.00 ? 286 ASN A HD22 5  
ATOM   10781 N  N    . LEU A 1 132 ? -10.231 8.433   10.708  1.00 0.00 ? 287 LEU A N    5  
ATOM   10782 C  CA   . LEU A 1 132 ? -10.848 7.342   11.550  1.00 0.00 ? 287 LEU A CA   5  
ATOM   10783 C  C    . LEU A 1 132 ? -11.092 7.866   12.975  1.00 0.00 ? 287 LEU A C    5  
ATOM   10784 O  O    . LEU A 1 132 ? -12.132 7.623   13.558  1.00 0.00 ? 287 LEU A O    5  
ATOM   10785 C  CB   . LEU A 1 132 ? -9.820  6.188   11.585  1.00 0.00 ? 287 LEU A CB   5  
ATOM   10786 C  CG   . LEU A 1 132 ? -10.507 4.833   11.832  1.00 0.00 ? 287 LEU A CG   5  
ATOM   10787 C  CD1  . LEU A 1 132 ? -11.399 4.896   13.078  1.00 0.00 ? 287 LEU A CD1  5  
ATOM   10788 C  CD2  . LEU A 1 132 ? -11.352 4.461   10.610  1.00 0.00 ? 287 LEU A CD2  5  
ATOM   10789 H  H    . LEU A 1 132 ? -9.373  8.278   10.256  1.00 0.00 ? 287 LEU A H    5  
ATOM   10790 H  HA   . LEU A 1 132 ? -11.773 7.004   11.111  1.00 0.00 ? 287 LEU A HA   5  
ATOM   10791 H  HB2  . LEU A 1 132 ? -9.299  6.151   10.641  1.00 0.00 ? 287 LEU A HB2  5  
ATOM   10792 H  HB3  . LEU A 1 132 ? -9.108  6.375   12.374  1.00 0.00 ? 287 LEU A HB3  5  
ATOM   10793 H  HG   . LEU A 1 132 ? -9.748  4.078   11.980  1.00 0.00 ? 287 LEU A HG   5  
ATOM   10794 H  HD11 . LEU A 1 132 ? -11.528 3.903   13.481  1.00 0.00 ? 287 LEU A HD11 5  
ATOM   10795 H  HD12 . LEU A 1 132 ? -12.362 5.302   12.812  1.00 0.00 ? 287 LEU A HD12 5  
ATOM   10796 H  HD13 . LEU A 1 132 ? -10.934 5.526   13.821  1.00 0.00 ? 287 LEU A HD13 5  
ATOM   10797 H  HD21 . LEU A 1 132 ? -11.712 3.448   10.716  1.00 0.00 ? 287 LEU A HD21 5  
ATOM   10798 H  HD22 . LEU A 1 132 ? -10.745 4.534   9.719   1.00 0.00 ? 287 LEU A HD22 5  
ATOM   10799 H  HD23 . LEU A 1 132 ? -12.191 5.136   10.531  1.00 0.00 ? 287 LEU A HD23 5  
ATOM   10800 N  N    . GLU A 1 133 ? -10.143 8.590   13.537  1.00 0.00 ? 288 GLU A N    5  
ATOM   10801 C  CA   . GLU A 1 133 ? -10.351 9.130   14.928  1.00 0.00 ? 288 GLU A CA   5  
ATOM   10802 C  C    . GLU A 1 133 ? -11.504 10.139  14.919  1.00 0.00 ? 288 GLU A C    5  
ATOM   10803 O  O    . GLU A 1 133 ? -12.342 10.135  15.802  1.00 0.00 ? 288 GLU A O    5  
ATOM   10804 C  CB   . GLU A 1 133 ? -9.042  9.820   15.340  1.00 0.00 ? 288 GLU A CB   5  
ATOM   10805 C  CG   . GLU A 1 133 ? -8.903  9.788   16.863  1.00 0.00 ? 288 GLU A CG   5  
ATOM   10806 C  CD   . GLU A 1 133 ? -7.706  10.641  17.286  1.00 0.00 ? 288 GLU A CD   5  
ATOM   10807 O  OE1  . GLU A 1 133 ? -7.760  11.843  17.087  1.00 0.00 ? 288 GLU A OE1  5  
ATOM   10808 O  OE2  . GLU A 1 133 ? -6.754  10.078  17.802  1.00 0.00 ? 288 GLU A OE2  5  
ATOM   10809 H  H    . GLU A 1 133 ? -9.310  8.782   13.042  1.00 0.00 ? 288 GLU A H    5  
ATOM   10810 H  HA   . GLU A 1 133 ? -10.572 8.325   15.607  1.00 0.00 ? 288 GLU A HA   5  
ATOM   10811 H  HB2  . GLU A 1 133 ? -8.206  9.305   14.890  1.00 0.00 ? 288 GLU A HB2  5  
ATOM   10812 H  HB3  . GLU A 1 133 ? -9.055  10.846  15.004  1.00 0.00 ? 288 GLU A HB3  5  
ATOM   10813 H  HG2  . GLU A 1 133 ? -9.803  10.179  17.315  1.00 0.00 ? 288 GLU A HG2  5  
ATOM   10814 H  HG3  . GLU A 1 133 ? -8.750  8.770   17.188  1.00 0.00 ? 288 GLU A HG3  5  
ATOM   10815 N  N    . GLN A 1 134 ? -11.564 10.996  13.921  1.00 0.00 ? 289 GLN A N    5  
ATOM   10816 C  CA   . GLN A 1 134 ? -12.690 11.995  13.867  1.00 0.00 ? 289 GLN A CA   5  
ATOM   10817 C  C    . GLN A 1 134 ? -14.031 11.253  13.752  1.00 0.00 ? 289 GLN A C    5  
ATOM   10818 O  O    . GLN A 1 134 ? -15.006 11.641  14.365  1.00 0.00 ? 289 GLN A O    5  
ATOM   10819 C  CB   . GLN A 1 134 ? -12.457 12.866  12.621  1.00 0.00 ? 289 GLN A CB   5  
ATOM   10820 C  CG   . GLN A 1 134 ? -11.118 13.596  12.751  1.00 0.00 ? 289 GLN A CG   5  
ATOM   10821 C  CD   . GLN A 1 134 ? -11.139 14.861  11.883  1.00 0.00 ? 289 GLN A CD   5  
ATOM   10822 O  OE1  . GLN A 1 134 ? -12.191 15.412  11.627  1.00 0.00 ? 289 GLN A OE1  5  
ATOM   10823 N  NE2  . GLN A 1 134 ? -10.017 15.352  11.416  1.00 0.00 ? 289 GLN A NE2  5  
ATOM   10824 H  H    . GLN A 1 134 ? -10.879 10.974  13.213  1.00 0.00 ? 289 GLN A H    5  
ATOM   10825 H  HA   . GLN A 1 134 ? -12.682 12.612  14.752  1.00 0.00 ? 289 GLN A HA   5  
ATOM   10826 H  HB2  . GLN A 1 134 ? -12.441 12.237  11.741  1.00 0.00 ? 289 GLN A HB2  5  
ATOM   10827 H  HB3  . GLN A 1 134 ? -13.253 13.590  12.532  1.00 0.00 ? 289 GLN A HB3  5  
ATOM   10828 H  HG2  . GLN A 1 134 ? -10.957 13.868  13.783  1.00 0.00 ? 289 GLN A HG2  5  
ATOM   10829 H  HG3  . GLN A 1 134 ? -10.321 12.948  12.420  1.00 0.00 ? 289 GLN A HG3  5  
ATOM   10830 H  HE21 . GLN A 1 134 ? -9.161  14.914  11.617  1.00 0.00 ? 289 GLN A HE21 5  
ATOM   10831 H  HE22 . GLN A 1 134 ? -10.033 16.160  10.862  1.00 0.00 ? 289 GLN A HE22 5  
ATOM   10832 N  N    . LEU A 1 135 ? -14.090 10.185  12.977  1.00 0.00 ? 290 LEU A N    5  
ATOM   10833 C  CA   . LEU A 1 135 ? -15.389 9.429   12.848  1.00 0.00 ? 290 LEU A CA   5  
ATOM   10834 C  C    . LEU A 1 135 ? -15.854 8.930   14.227  1.00 0.00 ? 290 LEU A C    5  
ATOM   10835 O  O    . LEU A 1 135 ? -17.035 8.931   14.521  1.00 0.00 ? 290 LEU A O    5  
ATOM   10836 C  CB   . LEU A 1 135 ? -15.115 8.235   11.921  1.00 0.00 ? 290 LEU A CB   5  
ATOM   10837 C  CG   . LEU A 1 135 ? -16.440 7.585   11.516  1.00 0.00 ? 290 LEU A CG   5  
ATOM   10838 C  CD1  . LEU A 1 135 ? -16.902 8.164   10.177  1.00 0.00 ? 290 LEU A CD1  5  
ATOM   10839 C  CD2  . LEU A 1 135 ? -16.245 6.074   11.375  1.00 0.00 ? 290 LEU A CD2  5  
ATOM   10840 H  H    . LEU A 1 135 ? -13.286 9.882   12.489  1.00 0.00 ? 290 LEU A H    5  
ATOM   10841 H  HA   . LEU A 1 135 ? -16.142 10.063  12.416  1.00 0.00 ? 290 LEU A HA   5  
ATOM   10842 H  HB2  . LEU A 1 135 ? -14.595 8.577   11.039  1.00 0.00 ? 290 LEU A HB2  5  
ATOM   10843 H  HB3  . LEU A 1 135 ? -14.505 7.510   12.440  1.00 0.00 ? 290 LEU A HB3  5  
ATOM   10844 H  HG   . LEU A 1 135 ? -17.186 7.787   12.271  1.00 0.00 ? 290 LEU A HG   5  
ATOM   10845 H  HD11 . LEU A 1 135 ? -16.138 8.001   9.431   1.00 0.00 ? 290 LEU A HD11 5  
ATOM   10846 H  HD12 . LEU A 1 135 ? -17.081 9.223   10.284  1.00 0.00 ? 290 LEU A HD12 5  
ATOM   10847 H  HD13 . LEU A 1 135 ? -17.815 7.674   9.869   1.00 0.00 ? 290 LEU A HD13 5  
ATOM   10848 H  HD21 . LEU A 1 135 ? -16.480 5.593   12.314  1.00 0.00 ? 290 LEU A HD21 5  
ATOM   10849 H  HD22 . LEU A 1 135 ? -15.217 5.867   11.113  1.00 0.00 ? 290 LEU A HD22 5  
ATOM   10850 H  HD23 . LEU A 1 135 ? -16.897 5.696   10.602  1.00 0.00 ? 290 LEU A HD23 5  
ATOM   10851 N  N    . LEU A 1 136 ? -14.940 8.502   15.076  1.00 0.00 ? 291 LEU A N    5  
ATOM   10852 C  CA   . LEU A 1 136 ? -15.360 8.006   16.439  1.00 0.00 ? 291 LEU A CA   5  
ATOM   10853 C  C    . LEU A 1 136 ? -16.115 9.108   17.201  1.00 0.00 ? 291 LEU A C    5  
ATOM   10854 O  O    . LEU A 1 136 ? -17.064 8.830   17.911  1.00 0.00 ? 291 LEU A O    5  
ATOM   10855 C  CB   . LEU A 1 136 ? -14.072 7.633   17.191  1.00 0.00 ? 291 LEU A CB   5  
ATOM   10856 C  CG   . LEU A 1 136 ? -13.697 6.185   16.874  1.00 0.00 ? 291 LEU A CG   5  
ATOM   10857 C  CD1  . LEU A 1 136 ? -12.213 5.964   17.174  1.00 0.00 ? 291 LEU A CD1  5  
ATOM   10858 C  CD2  . LEU A 1 136 ? -14.537 5.241   17.738  1.00 0.00 ? 291 LEU A CD2  5  
ATOM   10859 H  H    . LEU A 1 136 ? -13.989 8.510   14.817  1.00 0.00 ? 291 LEU A H    5  
ATOM   10860 H  HA   . LEU A 1 136 ? -15.987 7.133   16.335  1.00 0.00 ? 291 LEU A HA   5  
ATOM   10861 H  HB2  . LEU A 1 136 ? -13.272 8.290   16.882  1.00 0.00 ? 291 LEU A HB2  5  
ATOM   10862 H  HB3  . LEU A 1 136 ? -14.233 7.737   18.254  1.00 0.00 ? 291 LEU A HB3  5  
ATOM   10863 H  HG   . LEU A 1 136 ? -13.887 5.985   15.829  1.00 0.00 ? 291 LEU A HG   5  
ATOM   10864 H  HD11 . LEU A 1 136 ? -11.683 6.901   17.078  1.00 0.00 ? 291 LEU A HD11 5  
ATOM   10865 H  HD12 . LEU A 1 136 ? -11.807 5.248   16.474  1.00 0.00 ? 291 LEU A HD12 5  
ATOM   10866 H  HD13 . LEU A 1 136 ? -12.101 5.587   18.179  1.00 0.00 ? 291 LEU A HD13 5  
ATOM   10867 H  HD21 . LEU A 1 136 ? -14.012 4.306   17.863  1.00 0.00 ? 291 LEU A HD21 5  
ATOM   10868 H  HD22 . LEU A 1 136 ? -15.486 5.059   17.255  1.00 0.00 ? 291 LEU A HD22 5  
ATOM   10869 H  HD23 . LEU A 1 136 ? -14.704 5.692   18.705  1.00 0.00 ? 291 LEU A HD23 5  
ATOM   10870 N  N    . GLN A 1 137 ? -15.710 10.357  17.063  1.00 0.00 ? 292 GLN A N    5  
ATOM   10871 C  CA   . GLN A 1 137 ? -16.427 11.458  17.793  1.00 0.00 ? 292 GLN A CA   5  
ATOM   10872 C  C    . GLN A 1 137 ? -17.472 12.120  16.880  1.00 0.00 ? 292 GLN A C    5  
ATOM   10873 O  O    . GLN A 1 137 ? -18.543 12.484  17.327  1.00 0.00 ? 292 GLN A O    5  
ATOM   10874 C  CB   . GLN A 1 137 ? -15.347 12.472  18.193  1.00 0.00 ? 292 GLN A CB   5  
ATOM   10875 C  CG   . GLN A 1 137 ? -14.423 11.848  19.240  1.00 0.00 ? 292 GLN A CG   5  
ATOM   10876 C  CD   . GLN A 1 137 ? -14.940 12.180  20.645  1.00 0.00 ? 292 GLN A CD   5  
ATOM   10877 O  OE1  . GLN A 1 137 ? -15.229 13.324  20.939  1.00 0.00 ? 292 GLN A OE1  5  
ATOM   10878 N  NE2  . GLN A 1 137 ? -15.074 11.227  21.535  1.00 0.00 ? 292 GLN A NE2  5  
ATOM   10879 H  H    . GLN A 1 137 ? -14.941 10.567  16.483  1.00 0.00 ? 292 GLN A H    5  
ATOM   10880 H  HA   . GLN A 1 137 ? -16.903 11.065  18.677  1.00 0.00 ? 292 GLN A HA   5  
ATOM   10881 H  HB2  . GLN A 1 137 ? -14.771 12.748  17.321  1.00 0.00 ? 292 GLN A HB2  5  
ATOM   10882 H  HB3  . GLN A 1 137 ? -15.816 13.352  18.608  1.00 0.00 ? 292 GLN A HB3  5  
ATOM   10883 H  HG2  . GLN A 1 137 ? -14.400 10.777  19.107  1.00 0.00 ? 292 GLN A HG2  5  
ATOM   10884 H  HG3  . GLN A 1 137 ? -13.425 12.246  19.123  1.00 0.00 ? 292 GLN A HG3  5  
ATOM   10885 H  HE21 . GLN A 1 137 ? -14.845 10.299  21.309  1.00 0.00 ? 292 GLN A HE21 5  
ATOM   10886 H  HE22 . GLN A 1 137 ? -15.406 11.441  22.432  1.00 0.00 ? 292 GLN A HE22 5  
ATOM   10887 N  N    . GLN A 1 138 ? -17.181 12.284  15.600  1.00 0.00 ? 293 GLN A N    5  
ATOM   10888 C  CA   . GLN A 1 138 ? -18.166 12.926  14.668  1.00 0.00 ? 293 GLN A CA   5  
ATOM   10889 C  C    . GLN A 1 138 ? -18.621 14.292  15.215  1.00 0.00 ? 293 GLN A C    5  
ATOM   10890 O  O    . GLN A 1 138 ? -19.792 14.501  15.475  1.00 0.00 ? 293 GLN A O    5  
ATOM   10891 C  CB   . GLN A 1 138 ? -19.346 11.952  14.586  1.00 0.00 ? 293 GLN A CB   5  
ATOM   10892 C  CG   . GLN A 1 138 ? -20.296 12.391  13.471  1.00 0.00 ? 293 GLN A CG   5  
ATOM   10893 C  CD   . GLN A 1 138 ? -21.065 11.173  12.943  1.00 0.00 ? 293 GLN A CD   5  
ATOM   10894 O  OE1  . GLN A 1 138 ? -20.565 10.448  12.106  1.00 0.00 ? 293 GLN A OE1  5  
ATOM   10895 N  NE2  . GLN A 1 138 ? -22.266 10.910  13.397  1.00 0.00 ? 293 GLN A NE2  5  
ATOM   10896 H  H    . GLN A 1 138 ? -16.312 11.988  15.248  1.00 0.00 ? 293 GLN A H    5  
ATOM   10897 H  HA   . GLN A 1 138 ? -17.726 13.046  13.690  1.00 0.00 ? 293 GLN A HA   5  
ATOM   10898 H  HB2  . GLN A 1 138 ? -18.979 10.957  14.378  1.00 0.00 ? 293 GLN A HB2  5  
ATOM   10899 H  HB3  . GLN A 1 138 ? -19.876 11.950  15.528  1.00 0.00 ? 293 GLN A HB3  5  
ATOM   10900 H  HG2  . GLN A 1 138 ? -20.995 13.119  13.859  1.00 0.00 ? 293 GLN A HG2  5  
ATOM   10901 H  HG3  . GLN A 1 138 ? -19.727 12.831  12.666  1.00 0.00 ? 293 GLN A HG3  5  
ATOM   10902 H  HE21 . GLN A 1 138 ? -22.680 11.489  14.074  1.00 0.00 ? 293 GLN A HE21 5  
ATOM   10903 H  HE22 . GLN A 1 138 ? -22.755 10.131  13.058  1.00 0.00 ? 293 GLN A HE22 5  
ATOM   10904 N  N    . ASN A 1 139 ? -17.706 15.224  15.392  1.00 0.00 ? 294 ASN A N    5  
ATOM   10905 C  CA   . ASN A 1 139 ? -18.096 16.567  15.919  1.00 0.00 ? 294 ASN A CA   5  
ATOM   10906 C  C    . ASN A 1 139 ? -17.849 17.648  14.854  1.00 0.00 ? 294 ASN A C    5  
ATOM   10907 O  O    . ASN A 1 139 ? -16.890 18.393  14.934  1.00 0.00 ? 294 ASN A O    5  
ATOM   10908 C  CB   . ASN A 1 139 ? -17.196 16.794  17.136  1.00 0.00 ? 294 ASN A CB   5  
ATOM   10909 C  CG   . ASN A 1 139 ? -17.939 16.372  18.410  1.00 0.00 ? 294 ASN A CG   5  
ATOM   10910 O  OD1  . ASN A 1 139 ? -18.673 15.404  18.400  1.00 0.00 ? 294 ASN A OD1  5  
ATOM   10911 N  ND2  . ASN A 1 139 ? -17.783 17.057  19.516  1.00 0.00 ? 294 ASN A ND2  5  
ATOM   10912 H  H    . ASN A 1 139 ? -16.762 15.043  15.177  1.00 0.00 ? 294 ASN A H    5  
ATOM   10913 H  HA   . ASN A 1 139 ? -19.131 16.566  16.222  1.00 0.00 ? 294 ASN A HA   5  
ATOM   10914 H  HB2  . ASN A 1 139 ? -16.296 16.207  17.032  1.00 0.00 ? 294 ASN A HB2  5  
ATOM   10915 H  HB3  . ASN A 1 139 ? -16.939 17.841  17.204  1.00 0.00 ? 294 ASN A HB3  5  
ATOM   10916 H  HD21 . ASN A 1 139 ? -17.192 17.842  19.537  1.00 0.00 ? 294 ASN A HD21 5  
ATOM   10917 H  HD22 . ASN A 1 139 ? -18.258 16.786  20.329  1.00 0.00 ? 294 ASN A HD22 5  
ATOM   10918 N  N    . LYS A 1 140 ? -18.703 17.741  13.854  1.00 0.00 ? 295 LYS A N    5  
ATOM   10919 C  CA   . LYS A 1 140 ? -18.506 18.775  12.794  1.00 0.00 ? 295 LYS A CA   5  
ATOM   10920 C  C    . LYS A 1 140 ? -19.863 19.349  12.351  1.00 0.00 ? 295 LYS A C    5  
ATOM   10921 O  O    . LYS A 1 140 ? -20.319 19.092  11.252  1.00 0.00 ? 295 LYS A O    5  
ATOM   10922 C  CB   . LYS A 1 140 ? -17.829 18.032  11.640  1.00 0.00 ? 295 LYS A CB   5  
ATOM   10923 C  CG   . LYS A 1 140 ? -17.477 19.025  10.530  1.00 0.00 ? 295 LYS A CG   5  
ATOM   10924 C  CD   . LYS A 1 140 ? -16.835 18.277  9.361   1.00 0.00 ? 295 LYS A CD   5  
ATOM   10925 C  CE   . LYS A 1 140 ? -17.919 17.849  8.370   1.00 0.00 ? 295 LYS A CE   5  
ATOM   10926 N  NZ   . LYS A 1 140 ? -17.184 17.500  7.122   1.00 0.00 ? 295 LYS A NZ   5  
ATOM   10927 H  H    . LYS A 1 140 ? -19.475 17.134  13.800  1.00 0.00 ? 295 LYS A H    5  
ATOM   10928 H  HA   . LYS A 1 140 ? -17.863 19.563  13.153  1.00 0.00 ? 295 LYS A HA   5  
ATOM   10929 H  HB2  . LYS A 1 140 ? -16.927 17.557  11.998  1.00 0.00 ? 295 LYS A HB2  5  
ATOM   10930 H  HB3  . LYS A 1 140 ? -18.502 17.283  11.251  1.00 0.00 ? 295 LYS A HB3  5  
ATOM   10931 H  HG2  . LYS A 1 140 ? -18.376 19.520  10.192  1.00 0.00 ? 295 LYS A HG2  5  
ATOM   10932 H  HG3  . LYS A 1 140 ? -16.783 19.759  10.910  1.00 0.00 ? 295 LYS A HG3  5  
ATOM   10933 H  HD2  . LYS A 1 140 ? -16.127 18.926  8.864   1.00 0.00 ? 295 LYS A HD2  5  
ATOM   10934 H  HD3  . LYS A 1 140 ? -16.322 17.402  9.731   1.00 0.00 ? 295 LYS A HD3  5  
ATOM   10935 H  HE2  . LYS A 1 140 ? -18.454 16.988  8.748   1.00 0.00 ? 295 LYS A HE2  5  
ATOM   10936 H  HE3  . LYS A 1 140 ? -18.601 18.664  8.182   1.00 0.00 ? 295 LYS A HE3  5  
ATOM   10937 H  HZ1  . LYS A 1 140 ? -16.483 16.761  7.327   1.00 0.00 ? 295 LYS A HZ1  5  
ATOM   10938 H  HZ2  . LYS A 1 140 ? -16.701 18.346  6.757   1.00 0.00 ? 295 LYS A HZ2  5  
ATOM   10939 H  HZ3  . LYS A 1 140 ? -17.856 17.149  6.411   1.00 0.00 ? 295 LYS A HZ3  5  
ATOM   10940 N  N    . LYS A 1 141 ? -20.516 20.122  13.196  1.00 0.00 ? 296 LYS A N    5  
ATOM   10941 C  CA   . LYS A 1 141 ? -21.838 20.703  12.812  1.00 0.00 ? 296 LYS A CA   5  
ATOM   10942 C  C    . LYS A 1 141 ? -21.888 22.188  13.179  1.00 0.00 ? 296 LYS A C    5  
ATOM   10943 O  O    . LYS A 1 141 ? -21.746 23.006  12.283  1.00 0.00 ? 296 LYS A O    5  
ATOM   10944 C  CB   . LYS A 1 141 ? -22.867 19.916  13.622  1.00 0.00 ? 296 LYS A CB   5  
ATOM   10945 C  CG   . LYS A 1 141 ? -23.114 18.561  12.956  1.00 0.00 ? 296 LYS A CG   5  
ATOM   10946 C  CD   . LYS A 1 141 ? -24.167 18.717  11.855  1.00 0.00 ? 296 LYS A CD   5  
ATOM   10947 C  CE   . LYS A 1 141 ? -25.554 18.432  12.431  1.00 0.00 ? 296 LYS A CE   5  
ATOM   10948 N  NZ   . LYS A 1 141 ? -26.420 18.186  11.244  1.00 0.00 ? 296 LYS A NZ   5  
ATOM   10949 O  OXT  . LYS A 1 141 ? -22.068 22.484  14.349  1.00 0.00 ? 296 LYS A OXT  5  
ATOM   10950 H  H    . LYS A 1 141 ? -20.138 20.323  14.081  1.00 0.00 ? 296 LYS A H    5  
ATOM   10951 H  HA   . LYS A 1 141 ? -22.016 20.569  11.757  1.00 0.00 ? 296 LYS A HA   5  
ATOM   10952 H  HB2  . LYS A 1 141 ? -22.495 19.762  14.625  1.00 0.00 ? 296 LYS A HB2  5  
ATOM   10953 H  HB3  . LYS A 1 141 ? -23.793 20.469  13.662  1.00 0.00 ? 296 LYS A HB3  5  
ATOM   10954 H  HG2  . LYS A 1 141 ? -22.192 18.198  12.525  1.00 0.00 ? 296 LYS A HG2  5  
ATOM   10955 H  HG3  . LYS A 1 141 ? -23.470 17.856  13.693  1.00 0.00 ? 296 LYS A HG3  5  
ATOM   10956 H  HD2  . LYS A 1 141 ? -24.135 19.725  11.469  1.00 0.00 ? 296 LYS A HD2  5  
ATOM   10957 H  HD3  . LYS A 1 141 ? -23.959 18.019  11.058  1.00 0.00 ? 296 LYS A HD3  5  
ATOM   10958 H  HE2  . LYS A 1 141 ? -25.525 17.557  13.066  1.00 0.00 ? 296 LYS A HE2  5  
ATOM   10959 H  HE3  . LYS A 1 141 ? -25.917 19.286  12.982  1.00 0.00 ? 296 LYS A HE3  5  
ATOM   10960 H  HZ1  . LYS A 1 141 ? -25.989 17.452  10.647  1.00 0.00 ? 296 LYS A HZ1  5  
ATOM   10961 H  HZ2  . LYS A 1 141 ? -26.517 19.066  10.698  1.00 0.00 ? 296 LYS A HZ2  5  
ATOM   10962 H  HZ3  . LYS A 1 141 ? -27.358 17.866  11.558  1.00 0.00 ? 296 LYS A HZ3  5  
HETATM 10963 ZN ZN   . ZN  B 2 .   ? -5.723  -3.628  -0.647  1.00 0.00 ? 1   ZN  A ZN   5  
HETATM 10964 ZN ZN   . ZN  C 2 .   ? 1.887   -6.342  -5.590  1.00 0.00 ? 2   ZN  A ZN   5  
HETATM 10965 ZN ZN   . ZN  D 2 .   ? 14.595  -4.152  -0.291  1.00 0.00 ? 3   ZN  A ZN   5  
ATOM   10966 N  N    . GLY A 1 1   ? 13.592  25.251  -19.312 1.00 0.00 ? 156 GLY A N    6  
ATOM   10967 C  CA   . GLY A 1 1   ? 12.514  25.662  -18.368 1.00 0.00 ? 156 GLY A CA   6  
ATOM   10968 C  C    . GLY A 1 1   ? 12.353  24.595  -17.276 1.00 0.00 ? 156 GLY A C    6  
ATOM   10969 O  O    . GLY A 1 1   ? 13.033  23.587  -17.288 1.00 0.00 ? 156 GLY A O    6  
ATOM   10970 H  H1   . GLY A 1 1   ? 14.395  24.867  -18.776 1.00 0.00 ? 156 GLY A H1   6  
ATOM   10971 H  H2   . GLY A 1 1   ? 13.904  26.077  -19.862 1.00 0.00 ? 156 GLY A H2   6  
ATOM   10972 H  H3   . GLY A 1 1   ? 13.229  24.521  -19.957 1.00 0.00 ? 156 GLY A H3   6  
ATOM   10973 H  HA2  . GLY A 1 1   ? 12.776  26.608  -17.914 1.00 0.00 ? 156 GLY A HA2  6  
ATOM   10974 H  HA3  . GLY A 1 1   ? 11.584  25.765  -18.905 1.00 0.00 ? 156 GLY A HA3  6  
ATOM   10975 N  N    . ALA A 1 2   ? 11.459  24.803  -16.330 1.00 0.00 ? 157 ALA A N    6  
ATOM   10976 C  CA   . ALA A 1 2   ? 11.265  23.794  -15.246 1.00 0.00 ? 157 ALA A CA   6  
ATOM   10977 C  C    . ALA A 1 2   ? 9.771   23.646  -14.919 1.00 0.00 ? 157 ALA A C    6  
ATOM   10978 O  O    . ALA A 1 2   ? 9.026   24.607  -14.971 1.00 0.00 ? 157 ALA A O    6  
ATOM   10979 C  CB   . ALA A 1 2   ? 12.025  24.355  -14.043 1.00 0.00 ? 157 ALA A CB   6  
ATOM   10980 H  H    . ALA A 1 2   ? 10.915  25.623  -16.331 1.00 0.00 ? 157 ALA A H    6  
ATOM   10981 H  HA   . ALA A 1 2   ? 11.685  22.844  -15.537 1.00 0.00 ? 157 ALA A HA   6  
ATOM   10982 H  HB1  . ALA A 1 2   ? 11.814  25.409  -13.944 1.00 0.00 ? 157 ALA A HB1  6  
ATOM   10983 H  HB2  . ALA A 1 2   ? 13.085  24.211  -14.188 1.00 0.00 ? 157 ALA A HB2  6  
ATOM   10984 H  HB3  . ALA A 1 2   ? 11.710  23.840  -13.148 1.00 0.00 ? 157 ALA A HB3  6  
ATOM   10985 N  N    . MET A 1 3   ? 9.324   22.452  -14.582 1.00 0.00 ? 158 MET A N    6  
ATOM   10986 C  CA   . MET A 1 3   ? 7.879   22.260  -14.255 1.00 0.00 ? 158 MET A CA   6  
ATOM   10987 C  C    . MET A 1 3   ? 7.726   21.715  -12.826 1.00 0.00 ? 158 MET A C    6  
ATOM   10988 O  O    . MET A 1 3   ? 7.994   20.556  -12.571 1.00 0.00 ? 158 MET A O    6  
ATOM   10989 C  CB   . MET A 1 3   ? 7.375   21.238  -15.275 1.00 0.00 ? 158 MET A CB   6  
ATOM   10990 C  CG   . MET A 1 3   ? 6.854   21.967  -16.514 1.00 0.00 ? 158 MET A CG   6  
ATOM   10991 S  SD   . MET A 1 3   ? 5.314   22.824  -16.106 1.00 0.00 ? 158 MET A SD   6  
ATOM   10992 C  CE   . MET A 1 3   ? 4.245   21.938  -17.265 1.00 0.00 ? 158 MET A CE   6  
ATOM   10993 H  H    . MET A 1 3   ? 9.935   21.684  -14.543 1.00 0.00 ? 158 MET A H    6  
ATOM   10994 H  HA   . MET A 1 3   ? 7.340   23.187  -14.366 1.00 0.00 ? 158 MET A HA   6  
ATOM   10995 H  HB2  . MET A 1 3   ? 8.187   20.581  -15.557 1.00 0.00 ? 158 MET A HB2  6  
ATOM   10996 H  HB3  . MET A 1 3   ? 6.577   20.657  -14.838 1.00 0.00 ? 158 MET A HB3  6  
ATOM   10997 H  HG2  . MET A 1 3   ? 7.589   22.685  -16.845 1.00 0.00 ? 158 MET A HG2  6  
ATOM   10998 H  HG3  . MET A 1 3   ? 6.669   21.251  -17.302 1.00 0.00 ? 158 MET A HG3  6  
ATOM   10999 H  HE1  . MET A 1 3   ? 3.862   21.045  -16.790 1.00 0.00 ? 158 MET A HE1  6  
ATOM   11000 H  HE2  . MET A 1 3   ? 4.811   21.662  -18.140 1.00 0.00 ? 158 MET A HE2  6  
ATOM   11001 H  HE3  . MET A 1 3   ? 3.423   22.577  -17.558 1.00 0.00 ? 158 MET A HE3  6  
ATOM   11002 N  N    . LYS A 1 4   ? 7.297   22.539  -11.890 1.00 0.00 ? 159 LYS A N    6  
ATOM   11003 C  CA   . LYS A 1 4   ? 7.131   22.056  -10.486 1.00 0.00 ? 159 LYS A CA   6  
ATOM   11004 C  C    . LYS A 1 4   ? 5.784   22.530  -9.917  1.00 0.00 ? 159 LYS A C    6  
ATOM   11005 O  O    . LYS A 1 4   ? 5.214   23.494  -10.395 1.00 0.00 ? 159 LYS A O    6  
ATOM   11006 C  CB   . LYS A 1 4   ? 8.292   22.684  -9.712  1.00 0.00 ? 159 LYS A CB   6  
ATOM   11007 C  CG   . LYS A 1 4   ? 9.421   21.662  -9.559  1.00 0.00 ? 159 LYS A CG   6  
ATOM   11008 C  CD   . LYS A 1 4   ? 9.006   20.590  -8.550  1.00 0.00 ? 159 LYS A CD   6  
ATOM   11009 C  CE   . LYS A 1 4   ? 9.733   19.280  -8.867  1.00 0.00 ? 159 LYS A CE   6  
ATOM   11010 N  NZ   . LYS A 1 4   ? 8.973   18.232  -8.131  1.00 0.00 ? 159 LYS A NZ   6  
ATOM   11011 H  H    . LYS A 1 4   ? 7.084   23.474  -12.108 1.00 0.00 ? 159 LYS A H    6  
ATOM   11012 H  HA   . LYS A 1 4   ? 7.199   20.980  -10.447 1.00 0.00 ? 159 LYS A HA   6  
ATOM   11013 H  HB2  . LYS A 1 4   ? 8.657   23.547  -10.250 1.00 0.00 ? 159 LYS A HB2  6  
ATOM   11014 H  HB3  . LYS A 1 4   ? 7.949   22.988  -8.734  1.00 0.00 ? 159 LYS A HB3  6  
ATOM   11015 H  HG2  . LYS A 1 4   ? 9.620   21.201  -10.515 1.00 0.00 ? 159 LYS A HG2  6  
ATOM   11016 H  HG3  . LYS A 1 4   ? 10.312  22.159  -9.206  1.00 0.00 ? 159 LYS A HG3  6  
ATOM   11017 H  HD2  . LYS A 1 4   ? 9.266   20.913  -7.553  1.00 0.00 ? 159 LYS A HD2  6  
ATOM   11018 H  HD3  . LYS A 1 4   ? 7.941   20.431  -8.611  1.00 0.00 ? 159 LYS A HD3  6  
ATOM   11019 H  HE2  . LYS A 1 4   ? 9.711   19.088  -9.932  1.00 0.00 ? 159 LYS A HE2  6  
ATOM   11020 H  HE3  . LYS A 1 4   ? 10.751  19.319  -8.512  1.00 0.00 ? 159 LYS A HE3  6  
ATOM   11021 H  HZ1  . LYS A 1 4   ? 9.006   18.431  -7.111  1.00 0.00 ? 159 LYS A HZ1  6  
ATOM   11022 H  HZ2  . LYS A 1 4   ? 9.401   17.300  -8.317  1.00 0.00 ? 159 LYS A HZ2  6  
ATOM   11023 H  HZ3  . LYS A 1 4   ? 7.984   18.230  -8.451  1.00 0.00 ? 159 LYS A HZ3  6  
ATOM   11024 N  N    . ARG A 1 5   ? 5.270   21.867  -8.901  1.00 0.00 ? 160 ARG A N    6  
ATOM   11025 C  CA   . ARG A 1 5   ? 3.964   22.290  -8.315  1.00 0.00 ? 160 ARG A CA   6  
ATOM   11026 C  C    . ARG A 1 5   ? 4.109   22.525  -6.805  1.00 0.00 ? 160 ARG A C    6  
ATOM   11027 O  O    . ARG A 1 5   ? 3.960   23.637  -6.330  1.00 0.00 ? 160 ARG A O    6  
ATOM   11028 C  CB   . ARG A 1 5   ? 3.010   21.127  -8.588  1.00 0.00 ? 160 ARG A CB   6  
ATOM   11029 C  CG   . ARG A 1 5   ? 2.431   21.260  -9.998  1.00 0.00 ? 160 ARG A CG   6  
ATOM   11030 C  CD   . ARG A 1 5   ? 1.399   20.157  -10.233 1.00 0.00 ? 160 ARG A CD   6  
ATOM   11031 N  NE   . ARG A 1 5   ? 2.169   19.031  -10.832 1.00 0.00 ? 160 ARG A NE   6  
ATOM   11032 C  CZ   . ARG A 1 5   ? 2.031   18.747  -12.098 1.00 0.00 ? 160 ARG A CZ   6  
ATOM   11033 N  NH1  . ARG A 1 5   ? 1.033   18.008  -12.496 1.00 0.00 ? 160 ARG A NH1  6  
ATOM   11034 N  NH2  . ARG A 1 5   ? 2.893   19.202  -12.966 1.00 0.00 ? 160 ARG A NH2  6  
ATOM   11035 H  H    . ARG A 1 5   ? 5.741   21.091  -8.524  1.00 0.00 ? 160 ARG A H    6  
ATOM   11036 H  HA   . ARG A 1 5   ? 3.605   23.180  -8.798  1.00 0.00 ? 160 ARG A HA   6  
ATOM   11037 H  HB2  . ARG A 1 5   ? 3.549   20.194  -8.506  1.00 0.00 ? 160 ARG A HB2  6  
ATOM   11038 H  HB3  . ARG A 1 5   ? 2.206   21.143  -7.868  1.00 0.00 ? 160 ARG A HB3  6  
ATOM   11039 H  HG2  . ARG A 1 5   ? 1.958   22.227  -10.102 1.00 0.00 ? 160 ARG A HG2  6  
ATOM   11040 H  HG3  . ARG A 1 5   ? 3.225   21.168  -10.724 1.00 0.00 ? 160 ARG A HG3  6  
ATOM   11041 H  HD2  . ARG A 1 5   ? 0.952   19.855  -9.295  1.00 0.00 ? 160 ARG A HD2  6  
ATOM   11042 H  HD3  . ARG A 1 5   ? 0.639   20.492  -10.922 1.00 0.00 ? 160 ARG A HD3  6  
ATOM   11043 H  HE   . ARG A 1 5   ? 2.778   18.504  -10.275 1.00 0.00 ? 160 ARG A HE   6  
ATOM   11044 H  HH11 . ARG A 1 5   ? 0.373   17.658  -11.831 1.00 0.00 ? 160 ARG A HH11 6  
ATOM   11045 H  HH12 . ARG A 1 5   ? 0.928   17.790  -13.466 1.00 0.00 ? 160 ARG A HH12 6  
ATOM   11046 H  HH21 . ARG A 1 5   ? 3.658   19.770  -12.661 1.00 0.00 ? 160 ARG A HH21 6  
ATOM   11047 H  HH22 . ARG A 1 5   ? 2.787   18.984  -13.936 1.00 0.00 ? 160 ARG A HH22 6  
ATOM   11048 N  N    . GLY A 1 6   ? 4.399   21.491  -6.046  1.00 0.00 ? 161 GLY A N    6  
ATOM   11049 C  CA   . GLY A 1 6   ? 4.552   21.663  -4.571  1.00 0.00 ? 161 GLY A CA   6  
ATOM   11050 C  C    . GLY A 1 6   ? 3.182   21.522  -3.893  1.00 0.00 ? 161 GLY A C    6  
ATOM   11051 O  O    . GLY A 1 6   ? 2.661   20.429  -3.768  1.00 0.00 ? 161 GLY A O    6  
ATOM   11052 H  H    . GLY A 1 6   ? 4.516   20.604  -6.445  1.00 0.00 ? 161 GLY A H    6  
ATOM   11053 H  HA2  . GLY A 1 6   ? 5.225   20.906  -4.190  1.00 0.00 ? 161 GLY A HA2  6  
ATOM   11054 H  HA3  . GLY A 1 6   ? 4.954   22.641  -4.361  1.00 0.00 ? 161 GLY A HA3  6  
ATOM   11055 N  N    . GLU A 1 7   ? 2.591   22.615  -3.452  1.00 0.00 ? 162 GLU A N    6  
ATOM   11056 C  CA   . GLU A 1 7   ? 1.257   22.528  -2.785  1.00 0.00 ? 162 GLU A CA   6  
ATOM   11057 C  C    . GLU A 1 7   ? 0.233   23.397  -3.531  1.00 0.00 ? 162 GLU A C    6  
ATOM   11058 O  O    . GLU A 1 7   ? 0.388   24.601  -3.618  1.00 0.00 ? 162 GLU A O    6  
ATOM   11059 C  CB   . GLU A 1 7   ? 1.486   23.063  -1.371  1.00 0.00 ? 162 GLU A CB   6  
ATOM   11060 C  CG   . GLU A 1 7   ? 0.247   22.794  -0.516  1.00 0.00 ? 162 GLU A CG   6  
ATOM   11061 C  CD   . GLU A 1 7   ? 0.603   22.950  0.964   1.00 0.00 ? 162 GLU A CD   6  
ATOM   11062 O  OE1  . GLU A 1 7   ? 1.116   23.997  1.321   1.00 0.00 ? 162 GLU A OE1  6  
ATOM   11063 O  OE2  . GLU A 1 7   ? 0.357   22.020  1.714   1.00 0.00 ? 162 GLU A OE2  6  
ATOM   11064 H  H    . GLU A 1 7   ? 3.022   23.491  -3.558  1.00 0.00 ? 162 GLU A H    6  
ATOM   11065 H  HA   . GLU A 1 7   ? 0.923   21.503  -2.742  1.00 0.00 ? 162 GLU A HA   6  
ATOM   11066 H  HB2  . GLU A 1 7   ? 2.341   22.569  -0.933  1.00 0.00 ? 162 GLU A HB2  6  
ATOM   11067 H  HB3  . GLU A 1 7   ? 1.667   24.126  -1.413  1.00 0.00 ? 162 GLU A HB3  6  
ATOM   11068 H  HG2  . GLU A 1 7   ? -0.531  23.498  -0.777  1.00 0.00 ? 162 GLU A HG2  6  
ATOM   11069 H  HG3  . GLU A 1 7   ? -0.103  21.787  -0.696  1.00 0.00 ? 162 GLU A HG3  6  
ATOM   11070 N  N    . ASP A 1 8   ? -0.810  22.802  -4.073  1.00 0.00 ? 163 ASP A N    6  
ATOM   11071 C  CA   . ASP A 1 8   ? -1.832  23.606  -4.809  1.00 0.00 ? 163 ASP A CA   6  
ATOM   11072 C  C    . ASP A 1 8   ? -3.238  23.043  -4.556  1.00 0.00 ? 163 ASP A C    6  
ATOM   11073 O  O    . ASP A 1 8   ? -4.074  23.699  -3.964  1.00 0.00 ? 163 ASP A O    6  
ATOM   11074 C  CB   . ASP A 1 8   ? -1.455  23.469  -6.286  1.00 0.00 ? 163 ASP A CB   6  
ATOM   11075 C  CG   . ASP A 1 8   ? -0.209  24.307  -6.574  1.00 0.00 ? 163 ASP A CG   6  
ATOM   11076 O  OD1  . ASP A 1 8   ? 0.864   23.897  -6.163  1.00 0.00 ? 163 ASP A OD1  6  
ATOM   11077 O  OD2  . ASP A 1 8   ? -0.347  25.343  -7.202  1.00 0.00 ? 163 ASP A OD2  6  
ATOM   11078 H  H    . ASP A 1 8   ? -0.923  21.828  -3.998  1.00 0.00 ? 163 ASP A H    6  
ATOM   11079 H  HA   . ASP A 1 8   ? -1.784  24.637  -4.512  1.00 0.00 ? 163 ASP A HA   6  
ATOM   11080 H  HB2  . ASP A 1 8   ? -1.253  22.431  -6.510  1.00 0.00 ? 163 ASP A HB2  6  
ATOM   11081 H  HB3  . ASP A 1 8   ? -2.272  23.819  -6.899  1.00 0.00 ? 163 ASP A HB3  6  
ATOM   11082 N  N    . GLY A 1 9   ? -3.505  21.835  -5.000  1.00 0.00 ? 164 GLY A N    6  
ATOM   11083 C  CA   . GLY A 1 9   ? -4.857  21.237  -4.783  1.00 0.00 ? 164 GLY A CA   6  
ATOM   11084 C  C    . GLY A 1 9   ? -4.902  20.554  -3.409  1.00 0.00 ? 164 GLY A C    6  
ATOM   11085 O  O    . GLY A 1 9   ? -3.877  20.343  -2.786  1.00 0.00 ? 164 GLY A O    6  
ATOM   11086 H  H    . GLY A 1 9   ? -2.819  21.320  -5.476  1.00 0.00 ? 164 GLY A H    6  
ATOM   11087 H  HA2  . GLY A 1 9   ? -5.604  22.017  -4.825  1.00 0.00 ? 164 GLY A HA2  6  
ATOM   11088 H  HA3  . GLY A 1 9   ? -5.054  20.506  -5.551  1.00 0.00 ? 164 GLY A HA3  6  
ATOM   11089 N  N    . LEU A 1 10  ? -6.078  20.205  -2.926  1.00 0.00 ? 165 LEU A N    6  
ATOM   11090 C  CA   . LEU A 1 10  ? -6.173  19.537  -1.594  1.00 0.00 ? 165 LEU A CA   6  
ATOM   11091 C  C    . LEU A 1 10  ? -7.306  18.498  -1.596  1.00 0.00 ? 165 LEU A C    6  
ATOM   11092 O  O    . LEU A 1 10  ? -8.404  18.776  -1.150  1.00 0.00 ? 165 LEU A O    6  
ATOM   11093 C  CB   . LEU A 1 10  ? -6.482  20.664  -0.606  1.00 0.00 ? 165 LEU A CB   6  
ATOM   11094 C  CG   . LEU A 1 10  ? -6.240  20.172  0.821   1.00 0.00 ? 165 LEU A CG   6  
ATOM   11095 C  CD1  . LEU A 1 10  ? -4.745  20.233  1.137   1.00 0.00 ? 165 LEU A CD1  6  
ATOM   11096 C  CD2  . LEU A 1 10  ? -7.004  21.064  1.803   1.00 0.00 ? 165 LEU A CD2  6  
ATOM   11097 H  H    . LEU A 1 10  ? -6.899  20.381  -3.439  1.00 0.00 ? 165 LEU A H    6  
ATOM   11098 H  HA   . LEU A 1 10  ? -5.235  19.070  -1.339  1.00 0.00 ? 165 LEU A HA   6  
ATOM   11099 H  HB2  . LEU A 1 10  ? -5.838  21.507  -0.812  1.00 0.00 ? 165 LEU A HB2  6  
ATOM   11100 H  HB3  . LEU A 1 10  ? -7.513  20.963  -0.712  1.00 0.00 ? 165 LEU A HB3  6  
ATOM   11101 H  HG   . LEU A 1 10  ? -6.585  19.152  0.914   1.00 0.00 ? 165 LEU A HG   6  
ATOM   11102 H  HD11 . LEU A 1 10  ? -4.507  21.194  1.569   1.00 0.00 ? 165 LEU A HD11 6  
ATOM   11103 H  HD12 . LEU A 1 10  ? -4.179  20.097  0.227   1.00 0.00 ? 165 LEU A HD12 6  
ATOM   11104 H  HD13 . LEU A 1 10  ? -4.493  19.451  1.839   1.00 0.00 ? 165 LEU A HD13 6  
ATOM   11105 H  HD21 . LEU A 1 10  ? -6.667  22.084  1.700   1.00 0.00 ? 165 LEU A HD21 6  
ATOM   11106 H  HD22 . LEU A 1 10  ? -6.824  20.725  2.812   1.00 0.00 ? 165 LEU A HD22 6  
ATOM   11107 H  HD23 . LEU A 1 10  ? -8.061  21.011  1.589   1.00 0.00 ? 165 LEU A HD23 6  
ATOM   11108 N  N    . HIS A 1 11  ? -7.053  17.305  -2.096  1.00 0.00 ? 166 HIS A N    6  
ATOM   11109 C  CA   . HIS A 1 11  ? -8.124  16.261  -2.119  1.00 0.00 ? 166 HIS A CA   6  
ATOM   11110 C  C    . HIS A 1 11  ? -7.760  15.108  -1.171  1.00 0.00 ? 166 HIS A C    6  
ATOM   11111 O  O    . HIS A 1 11  ? -6.699  14.522  -1.285  1.00 0.00 ? 166 HIS A O    6  
ATOM   11112 C  CB   . HIS A 1 11  ? -8.175  15.770  -3.568  1.00 0.00 ? 166 HIS A CB   6  
ATOM   11113 C  CG   . HIS A 1 11  ? -9.558  15.267  -3.878  1.00 0.00 ? 166 HIS A CG   6  
ATOM   11114 N  ND1  . HIS A 1 11  ? -10.066 15.252  -5.167  1.00 0.00 ? 166 HIS A ND1  6  
ATOM   11115 C  CD2  . HIS A 1 11  ? -10.551 14.758  -3.078  1.00 0.00 ? 166 HIS A CD2  6  
ATOM   11116 C  CE1  . HIS A 1 11  ? -11.313 14.749  -5.106  1.00 0.00 ? 166 HIS A CE1  6  
ATOM   11117 N  NE2  . HIS A 1 11  ? -11.658 14.431  -3.855  1.00 0.00 ? 166 HIS A NE2  6  
ATOM   11118 H  H    . HIS A 1 11  ? -6.161  17.094  -2.452  1.00 0.00 ? 166 HIS A H    6  
ATOM   11119 H  HA   . HIS A 1 11  ? -9.074  16.691  -1.842  1.00 0.00 ? 166 HIS A HA   6  
ATOM   11120 H  HB2  . HIS A 1 11  ? -7.931  16.585  -4.232  1.00 0.00 ? 166 HIS A HB